BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c28978_g1_i1 len=2576 path=[1:0-2575]

Length=2576
                                                                      Score     E

ref|XP_009760940.1|  PREDICTED: tetratricopeptide repeat protein 7A     985   0.0      
ref|XP_009623724.1|  PREDICTED: tetratricopeptide repeat protein 7A     981   0.0      
ref|XP_010320297.1|  PREDICTED: tetratricopeptide repeat protein 7B     967   0.0      
ref|XP_006356859.1|  PREDICTED: tetratricopeptide repeat protein ...    959   0.0      
emb|CDP01197.1|  unnamed protein product                                935   0.0      
ref|XP_010664509.1|  PREDICTED: tetratricopeptide repeat protein 7B     904   0.0      
ref|XP_011069800.1|  PREDICTED: tetratricopeptide repeat protein 7A     903   0.0      
ref|XP_009360728.1|  PREDICTED: tetratricopeptide repeat protein 7A     895   0.0      
ref|XP_008393726.1|  PREDICTED: tetratricopeptide repeat protein ...    890   0.0      
ref|XP_007225193.1|  hypothetical protein PRUPE_ppa002112mg             882   0.0      
ref|XP_004290971.1|  PREDICTED: tetratricopeptide repeat protein ...    881   0.0      
ref|XP_008220334.1|  PREDICTED: tetratricopeptide repeat protein 7A     876   0.0      
ref|XP_010272759.1|  PREDICTED: uncharacterized protein LOC104608456    876   0.0      
ref|XP_003523621.1|  PREDICTED: tetratricopeptide repeat protein ...    874   0.0      
gb|KHN04439.1|  Tetratricopeptide repeat protein 7B                     874   0.0      
ref|XP_007018491.1|  No pollen germination related 1                    869   0.0      
gb|KHG05379.1|  Tetratricopeptide repeat 7B                             869   0.0      
gb|KDP41618.1|  hypothetical protein JCGZ_16025                         866   0.0      
ref|XP_002320688.1|  NO POLLEN GERMINATION RELATED 1 family protein     866   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007136761.1|  hypothetical protein PHAVU_009G071800g             866   0.0      
emb|CAN72853.1|  hypothetical protein VITISV_013944                     866   0.0      Vitis vinifera
ref|XP_010090573.1|  Tetratricopeptide repeat protein 7B                863   0.0      
ref|XP_011014445.1|  PREDICTED: tetratricopeptide repeat protein ...    862   0.0      
ref|XP_010999876.1|  PREDICTED: tetratricopeptide repeat protein ...    862   0.0      
ref|XP_002302407.2|  NO POLLEN GERMINATION RELATED 1 family protein     861   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006472300.1|  PREDICTED: tetratricopeptide repeat protein ...    857   0.0      
gb|KHN36969.1|  Tetratricopeptide repeat protein 7A                     850   0.0      
ref|XP_003545340.1|  PREDICTED: tetratricopeptide repeat protein ...    849   0.0      
ref|XP_003550305.1|  PREDICTED: tetratricopeptide repeat protein ...    848   0.0      
gb|KHN07664.1|  Tetratricopeptide repeat protein 7A                     847   0.0      
ref|XP_004498994.1|  PREDICTED: tetratricopeptide repeat protein ...    846   0.0      
ref|XP_006433636.1|  hypothetical protein CICLE_v10000426mg             843   0.0      
ref|XP_003527736.1|  PREDICTED: tetratricopeptide repeat protein ...    842   0.0      
ref|XP_011017113.1|  PREDICTED: tetratricopeptide repeat protein ...    841   0.0      
ref|XP_007160913.1|  hypothetical protein PHAVU_001G027700g             838   0.0      
gb|KHG17915.1|  Tetratricopeptide repeat 7A                             830   0.0      
ref|XP_008444544.1|  PREDICTED: tetratricopeptide repeat protein 7B     828   0.0      
gb|EYU25515.1|  hypothetical protein MIMGU_mgv1a002318mg                827   0.0      
gb|AES59318.2|  TPR 7B-like protein                                     816   0.0      
ref|XP_004142894.1|  PREDICTED: tetratricopeptide repeat protein ...    815   0.0      
gb|KDO81501.1|  hypothetical protein CISIN_1g005603mg                   803   0.0      
ref|XP_010061675.1|  PREDICTED: tetratricopeptide repeat protein 7B     803   0.0      
ref|XP_008352491.1|  PREDICTED: LOW QUALITY PROTEIN: tetratricope...    796   0.0      
emb|CBI19400.3|  unnamed protein product                                790   0.0      
ref|XP_010687990.1|  PREDICTED: tetratricopeptide repeat protein 7B     785   0.0      
ref|XP_010938984.1|  PREDICTED: tetratricopeptide repeat protein 7A     769   0.0      
ref|XP_008808849.1|  PREDICTED: tetratricopeptide repeat protein 7B     761   0.0      
ref|XP_010556453.1|  PREDICTED: tetratricopeptide repeat protein ...    751   0.0      
ref|XP_002510094.1|  calmodulin binding protein, putative               739   0.0      Ricinus communis
ref|XP_006415757.1|  hypothetical protein EUTSA_v10006966mg             736   0.0      
ref|XP_006841113.1|  hypothetical protein AMTR_s00086p00090660          734   0.0      
ref|XP_006601261.1|  PREDICTED: tetratricopeptide repeat protein ...    726   0.0      
ref|NP_564285.1|  calmodulin-binding protein                            728   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006303919.1|  hypothetical protein CARUB_v10008472mg             727   0.0      
ref|XP_009414774.1|  PREDICTED: tetratricopeptide repeat protein 7A     727   0.0      
ref|XP_010499226.1|  PREDICTED: LOW QUALITY PROTEIN: tetratricope...    723   0.0      
ref|XP_010460505.1|  PREDICTED: LOW QUALITY PROTEIN: tetratricope...    722   0.0      
ref|XP_002890729.1|  hypothetical protein ARALYDRAFT_890270             720   0.0      
ref|XP_009109801.1|  PREDICTED: tetratricopeptide repeat protein 7B     716   0.0      
gb|KFK28981.1|  hypothetical protein AALP_AA7G073100                    716   0.0      
emb|CDX90089.1|  BnaA08g18950D                                          711   0.0      
emb|CDY11807.1|  BnaC03g57710D                                          707   0.0      
ref|XP_006601262.1|  PREDICTED: tetratricopeptide repeat protein ...    667   0.0      
gb|EMT30224.1|  Tetratricopeptide repeat protein 7A                     669   0.0      
gb|EMS66738.1|  Tetratricopeptide repeat protein 7A                     652   0.0      
gb|AGT16353.1|  tetratricopeptide repeat protein                        651   0.0      
ref|XP_003558571.1|  PREDICTED: tetratricopeptide repeat protein 7A     650   0.0      
gb|EEE58520.1|  hypothetical protein OsJ_09805                          647   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_002465691.1|  hypothetical protein SORBIDRAFT_01g043840          643   0.0      Sorghum bicolor [broomcorn]
ref|XP_008664767.1|  PREDICTED: uncharacterized protein LOC100216...    640   0.0      
ref|XP_004985317.1|  PREDICTED: tetratricopeptide repeat protein ...    640   0.0      
ref|XP_006649575.1|  PREDICTED: tetratricopeptide repeat protein ...    618   0.0      
ref|XP_010480675.1|  PREDICTED: tetratricopeptide repeat protein ...    617   0.0      
gb|ABF94492.1|  TPR Domain containing protein, expressed                613   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_008664794.1|  PREDICTED: uncharacterized protein LOC100216...    590   0.0      
ref|XP_010941503.1|  PREDICTED: uncharacterized protein LOC105059...    546   3e-179   
ref|XP_010262408.1|  PREDICTED: tetratricopeptide repeat protein ...    543   8e-178   
ref|XP_010941502.1|  PREDICTED: uncharacterized protein LOC105059...    538   3e-176   
ref|XP_008802400.1|  PREDICTED: tetratricopeptide repeat protein 7A     524   2e-170   
gb|KDP37741.1|  hypothetical protein JCGZ_05231                         521   7e-170   
ref|XP_002986849.1|  hypothetical protein SELMODRAFT_124742             520   2e-169   
ref|XP_002969261.1|  hypothetical protein SELMODRAFT_91665              519   3e-169   
ref|XP_009406365.1|  PREDICTED: tetratricopeptide repeat protein ...    519   7e-169   
ref|XP_010054175.1|  PREDICTED: tetratricopeptide repeat protein 7B     518   1e-168   
ref|XP_010244719.1|  PREDICTED: tetratricopeptide repeat protein ...    516   5e-168   
ref|XP_010688836.1|  PREDICTED: uncharacterized protein LOC104902676    514   6e-167   
gb|KHG27385.1|  Tetratricopeptide repeat 7A                             514   7e-167   
gb|KDP26494.1|  hypothetical protein JCGZ_17652                         514   9e-167   
ref|XP_009589150.1|  PREDICTED: tetratricopeptide repeat protein 7A     512   3e-166   
gb|EYU32843.1|  hypothetical protein MIMGU_mgv1a002198mg                512   3e-166   
ref|XP_002283407.1|  PREDICTED: tetratricopeptide repeat protein 7B     512   4e-166   Vitis vinifera
ref|XP_003534319.1|  PREDICTED: tetratricopeptide repeat protein ...    511   6e-166   
ref|XP_009762835.1|  PREDICTED: tetratricopeptide repeat protein 7A     511   9e-166   
ref|XP_011081247.1|  PREDICTED: tetratricopeptide repeat protein ...    511   1e-165   
ref|XP_007158148.1|  hypothetical protein PHAVU_002G128400g             510   1e-165   
ref|XP_002526575.1|  calmodulin binding protein, putative               512   1e-165   Ricinus communis
emb|CDP03773.1|  unnamed protein product                                511   1e-165   
ref|XP_004493802.1|  PREDICTED: uncharacterized protein LOC101495...    511   1e-165   
ref|XP_010934257.1|  PREDICTED: tetratricopeptide repeat protein ...    511   2e-165   
ref|XP_007048892.1|  Tetratricopeptide repeat (TPR)-containing pr...    509   2e-165   
ref|XP_003579080.1|  PREDICTED: uncharacterized protein LOC100821058    508   1e-164   
ref|XP_008235621.1|  PREDICTED: tetratricopeptide repeat protein 7B     507   7e-164   
ref|XP_004151995.1|  PREDICTED: tetratricopeptide repeat protein ...    507   7e-164   
ref|XP_010920330.1|  PREDICTED: tetratricopeptide repeat protein ...    507   8e-164   
ref|XP_006443778.1|  hypothetical protein CICLE_v10019014mg             507   8e-164   
ref|XP_007201775.1|  hypothetical protein PRUPE_ppa001953mg             506   1e-163   
ref|XP_010265002.1|  PREDICTED: tetratricopeptide repeat protein ...    506   2e-163   
ref|XP_006588689.1|  PREDICTED: tetratricopeptide repeat protein ...    505   2e-163   
ref|XP_003548710.1|  PREDICTED: uncharacterized protein LOC100811897    504   3e-163   
ref|XP_010265000.1|  PREDICTED: tetratricopeptide repeat protein ...    506   3e-163   
ref|XP_011070117.1|  PREDICTED: tetratricopeptide repeat protein ...    504   3e-163   
ref|XP_006841599.1|  hypothetical protein AMTR_s00003p00208040          504   4e-163   
ref|XP_007050216.1|  No pollen germination related 2                    504   6e-163   
gb|KHN05875.1|  Tetratricopeptide repeat protein 7A                     503   8e-163   
ref|XP_006446844.1|  hypothetical protein CICLE_v10014459mg             503   9e-163   
ref|XP_008777058.1|  PREDICTED: uncharacterized protein LOC103697066    503   1e-162   
ref|XP_002514581.1|  o-linked n-acetylglucosamine transferase, og...    503   1e-162   Ricinus communis
ref|XP_007048890.1|  Tetratricopeptide repeat (TPR)-containing pr...    503   1e-162   
ref|XP_003516493.1|  PREDICTED: tetratricopeptide repeat protein ...    502   2e-162   
ref|XP_006664108.1|  PREDICTED: tetratricopeptide repeat protein ...    503   2e-162   
ref|XP_004296388.1|  PREDICTED: tetratricopeptide repeat protein ...    503   3e-162   
ref|XP_004512392.1|  PREDICTED: tetratricopeptide repeat protein ...    501   4e-162   
gb|KHN47639.1|  Tetratricopeptide repeat protein 7B                     501   7e-162   
gb|KHN11830.1|  Tetratricopeptide repeat protein 7A                     501   7e-162   
ref|XP_008447403.1|  PREDICTED: tetratricopeptide repeat protein ...    501   9e-162   
emb|CDO98411.1|  unnamed protein product                                501   9e-162   
ref|XP_008383718.1|  PREDICTED: tetratricopeptide repeat protein ...    501   1e-161   
ref|XP_004305854.1|  PREDICTED: tetratricopeptide repeat protein ...    501   1e-161   
ref|XP_004170906.1|  PREDICTED: LOW QUALITY PROTEIN: tetratricope...    501   1e-161   
ref|XP_006589285.1|  PREDICTED: tetratricopeptide repeat protein ...    501   2e-161   
ref|XP_004962744.1|  PREDICTED: uncharacterized protein LOC101760798    500   2e-161   
ref|XP_006468967.1|  PREDICTED: tetratricopeptide repeat protein ...    499   2e-161   
ref|XP_008777130.1|  PREDICTED: uncharacterized protein LOC103697114    498   2e-161   
ref|XP_006589284.1|  PREDICTED: tetratricopeptide repeat protein ...    500   3e-161   
ref|XP_008438486.1|  PREDICTED: tetratricopeptide repeat protein ...    500   3e-161   
gb|KHG28092.1|  Tetratricopeptide repeat protein 7A                     500   3e-161   
ref|XP_010265001.1|  PREDICTED: tetratricopeptide repeat protein ...    500   4e-161   
gb|KHG28093.1|  Tetratricopeptide repeat protein 7A                     500   7e-161   
ref|XP_004289975.1|  PREDICTED: tetratricopeptide repeat protein ...    499   9e-161   
ref|XP_004134050.1|  PREDICTED: tetratricopeptide repeat protein ...    499   1e-160   
ref|XP_002443375.1|  hypothetical protein SORBIDRAFT_08g018430          498   1e-160   Sorghum bicolor [broomcorn]
emb|CAN65476.1|  hypothetical protein VITISV_018246                     499   1e-160   Vitis vinifera
ref|XP_006857444.1|  hypothetical protein AMTR_s00067p00173740          498   1e-160   
gb|KHN01088.1|  Tetratricopeptide repeat protein 7A                     497   3e-160   
gb|AES95557.2|  calmodulin-binding protein                              496   3e-160   
ref|XP_004241633.1|  PREDICTED: tetratricopeptide repeat protein 7A     496   5e-160   
ref|XP_007144057.1|  hypothetical protein PHAVU_007G125100g             496   6e-160   
ref|XP_007144060.1|  hypothetical protein PHAVU_007G125100g             497   7e-160   
emb|CBI23683.3|  unnamed protein product                                496   1e-159   
ref|XP_002285371.2|  PREDICTED: tetratricopeptide repeat protein ...    495   2e-159   Vitis vinifera
ref|XP_003542433.1|  PREDICTED: tetratricopeptide repeat protein ...    494   4e-159   
ref|XP_008464649.1|  PREDICTED: tetratricopeptide repeat protein 7B     493   5e-159   
ref|XP_009781614.1|  PREDICTED: tetratricopeptide repeat protein ...    494   6e-159   
ref|XP_002275620.1|  PREDICTED: tetratricopeptide repeat protein 7A     494   8e-159   Vitis vinifera
ref|NP_001064828.1|  Os10g0471400                                       492   3e-158   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011026195.1|  PREDICTED: tetratricopeptide repeat protein 7A     491   3e-158   
ref|XP_010275890.1|  PREDICTED: uncharacterized protein LOC104610799    489   4e-158   
ref|NP_001067047.1|  Os12g0565300                                       492   5e-158   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008785177.1|  PREDICTED: tetratricopeptide repeat protein ...    491   6e-158   
ref|XP_010093076.1|  Tetratricopeptide repeat protein 7A                491   7e-158   
ref|XP_009587004.1|  PREDICTED: tetratricopeptide repeat protein ...    492   7e-158   
tpg|DAA47027.1|  TPA: calmodulin-binding protein MPCBP                  490   1e-157   
ref|XP_002314490.2|  NO POLLEN GERMINATION RELATED 2 family protein     490   1e-157   Populus trichocarpa [western balsam poplar]
ref|XP_006365398.1|  PREDICTED: tetratricopeptide repeat protein ...    489   1e-157   
ref|XP_006364568.1|  PREDICTED: tetratricopeptide repeat protein ...    490   2e-157   
ref|XP_011024445.1|  PREDICTED: tetratricopeptide repeat protein ...    490   3e-157   
ref|XP_009356570.1|  PREDICTED: uncharacterized protein LOC103947392    488   4e-157   
ref|XP_004495349.1|  PREDICTED: tetratricopeptide repeat protein ...    490   4e-157   
ref|XP_004240483.1|  PREDICTED: tetratricopeptide repeat protein ...    489   4e-157   
ref|XP_010524113.1|  PREDICTED: uncharacterized protein LOC104802285    488   4e-157   
ref|XP_009413033.1|  PREDICTED: uncharacterized protein LOC103994427    488   5e-157   
ref|XP_002303124.2|  hypothetical protein POPTR_0002s26100g             489   5e-157   Populus trichocarpa [western balsam poplar]
ref|XP_004149521.1|  PREDICTED: tetratricopeptide repeat protein ...    488   5e-157   
ref|XP_002303125.2|  hypothetical protein POPTR_0002s26100g             489   7e-157   Populus trichocarpa [western balsam poplar]
ref|XP_011024442.1|  PREDICTED: tetratricopeptide repeat protein ...    489   8e-157   
ref|XP_011030454.1|  PREDICTED: tetratricopeptide repeat protein ...    488   1e-156   
ref|XP_008382827.1|  PREDICTED: tetratricopeptide repeat protein 7A     488   2e-156   
gb|KEH42485.1|  TPR 7B-like protein                                     487   2e-156   
ref|NP_001151614.1|  LOC100285248                                       487   2e-156   Zea mays [maize]
dbj|BAK01306.1|  predicted protein                                      487   3e-156   
gb|KDO63443.1|  hypothetical protein CISIN_1g005499mg                   486   3e-156   
gb|KEH20324.1|  calmodulin-binding protein MPCBP protein                486   3e-156   
ref|XP_007214841.1|  hypothetical protein PRUPE_ppa002261mg             486   4e-156   
ref|XP_008229599.1|  PREDICTED: tetratricopeptide repeat protein 7B     486   4e-156   
emb|CBI37151.3|  unnamed protein product                                485   5e-156   
ref|XP_009369434.1|  PREDICTED: tetratricopeptide repeat protein ...    487   5e-156   
ref|XP_007225212.1|  hypothetical protein PRUPE_ppa001985mg             486   6e-156   
gb|KDP40367.1|  hypothetical protein JCGZ_02365                         486   7e-156   
ref|XP_010023877.1|  PREDICTED: tetratricopeptide repeat protein ...    486   1e-155   
gb|EPS66209.1|  hypothetical protein M569_08567                         484   1e-155   
gb|EMT24866.1|  Tetratricopeptide repeat protein 7A                     485   2e-155   
ref|XP_010106172.1|  hypothetical protein L484_012717                   483   2e-155   
ref|XP_004509538.1|  PREDICTED: tetratricopeptide repeat protein ...    484   2e-155   
ref|XP_010091891.1|  Tetratricopeptide repeat protein 7B                484   4e-155   
ref|XP_004495072.1|  PREDICTED: tetratricopeptide repeat protein ...    483   5e-155   
ref|XP_006661855.1|  PREDICTED: tetratricopeptide repeat protein ...    483   8e-155   
ref|XP_002311687.2|  NO POLLEN GERMINATION RELATED 2 family protein     483   1e-154   Populus trichocarpa [western balsam poplar]
ref|XP_011029780.1|  PREDICTED: tetratricopeptide repeat protein ...    483   2e-154   
ref|XP_008224139.1|  PREDICTED: tetratricopeptide repeat protein ...    483   2e-154   
ref|XP_009133568.1|  PREDICTED: uncharacterized protein LOC103858044    481   2e-154   
ref|XP_009334224.1|  PREDICTED: uncharacterized protein LOC103927049    482   2e-154   
ref|XP_011080086.1|  PREDICTED: tetratricopeptide repeat protein 7A     482   3e-154   
ref|XP_006350695.1|  PREDICTED: tetratricopeptide repeat protein ...    482   4e-154   
ref|XP_008342319.1|  PREDICTED: tetratricopeptide repeat protein ...    480   5e-154   
ref|XP_002528816.1|  o-linked n-acetylglucosamine transferase, og...    481   6e-154   Ricinus communis
dbj|BAK03445.1|  predicted protein                                      481   8e-154   
ref|XP_002453569.1|  hypothetical protein SORBIDRAFT_04g008250          479   2e-153   Sorghum bicolor [broomcorn]
ref|XP_009358011.1|  PREDICTED: uncharacterized protein LOC103948685    480   2e-153   
ref|XP_009348291.1|  PREDICTED: uncharacterized protein LOC103939918    479   2e-153   
gb|EMT02991.1|  Tetratricopeptide repeat protein 7A                     479   4e-153   
ref|XP_008645918.1|  PREDICTED: uncharacterized protein LOC100384...    479   5e-153   
ref|XP_009597512.1|  PREDICTED: tetratricopeptide repeat protein ...    479   5e-153   
ref|XP_009376912.1|  PREDICTED: uncharacterized protein LOC103965566    477   8e-153   
gb|KHG30674.1|  Tetratricopeptide repeat 7A                             477   8e-153   
ref|XP_009763162.1|  PREDICTED: tetratricopeptide repeat protein ...    478   1e-152   
ref|XP_008375903.1|  PREDICTED: tetratricopeptide repeat protein ...    478   2e-152   
ref|XP_009412836.1|  PREDICTED: ATP-dependent RNA helicase DHX36        501   2e-152   
gb|EMS56256.1|  Tetratricopeptide repeat protein 7A                     481   4e-152   
ref|XP_009142902.1|  PREDICTED: uncharacterized protein LOC103866688    476   4e-152   
ref|XP_008380157.1|  PREDICTED: tetratricopeptide repeat protein ...    475   6e-152   
ref|XP_004982896.1|  PREDICTED: tetratricopeptide repeat protein ...    476   8e-152   
ref|XP_011070119.1|  PREDICTED: tetratricopeptide repeat protein ...    474   8e-152   
ref|XP_010684660.1|  PREDICTED: tetratricopeptide repeat protein ...    475   8e-152   
ref|XP_006663113.1|  PREDICTED: tetratricopeptide repeat protein ...    474   2e-151   
ref|XP_010684659.1|  PREDICTED: tetratricopeptide repeat protein ...    474   2e-151   
gb|EAY78895.1|  hypothetical protein OsI_33999                          475   3e-151   Oryza sativa Indica Group [Indian rice]
gb|KEH23953.1|  TPR 7B-like protein                                     473   9e-151   
ref|XP_004241005.1|  PREDICTED: uncharacterized protein LOC101248015    473   1e-150   
ref|XP_002881885.1|  hypothetical protein ARALYDRAFT_483406             471   2e-150   
ref|XP_009382212.1|  PREDICTED: tetratricopeptide repeat protein 7A     470   4e-150   
ref|XP_006411579.1|  hypothetical protein EUTSA_v10016328mg             470   6e-150   
ref|XP_009129527.1|  PREDICTED: tetratricopeptide repeat protein 7A     471   7e-150   
ref|XP_007035196.1|  No pollen germination related 2 isoform 1          470   9e-150   
ref|XP_006489675.1|  PREDICTED: tetratricopeptide repeat protein ...    470   1e-149   
emb|CDY35200.1|  BnaA01g08310D                                          470   1e-149   
ref|XP_004979219.1|  PREDICTED: tetratricopeptide repeat protein ...    469   3e-149   
ref|NP_001068489.1|  Os11g0689300                                       468   3e-149   Oryza sativa Japonica Group [Japonica rice]
gb|EAY84980.1|  hypothetical protein OsI_06345                          468   3e-149   Oryza sativa Indica Group [Indian rice]
ref|NP_850382.1|  calmodulin-binding protein NPG1                       468   3e-149   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008645613.1|  PREDICTED: tetratricopeptide repeat protein ...    468   4e-149   
gb|KHN02486.1|  Tetratricopeptide repeat protein 7A                     468   4e-149   
gb|EEC69512.1|  hypothetical protein OsI_38750                          466   4e-149   Oryza sativa Indica Group [Indian rice]
ref|XP_006293776.1|  hypothetical protein CARUB_v10022752mg             467   8e-149   
ref|XP_010508476.1|  PREDICTED: uncharacterized protein LOC104785053    466   1e-148   
ref|XP_010506159.1|  PREDICTED: uncharacterized protein LOC104782817    466   1e-148   
ref|XP_010517856.1|  PREDICTED: uncharacterized protein LOC104793234    466   2e-148   
ref|XP_004247514.1|  PREDICTED: tetratricopeptide repeat protein ...    466   2e-148   
ref|XP_002300857.1|  NO POLLEN GERMINATION 1 family protein             465   2e-148   Populus trichocarpa [western balsam poplar]
ref|XP_006367232.1|  PREDICTED: tetratricopeptide repeat protein ...    466   3e-148   
ref|XP_003590809.1|  Tetratricopeptide repeat protein 7B                466   5e-148   
ref|XP_006604502.1|  PREDICTED: tetratricopeptide repeat protein ...    466   5e-148   
ref|XP_010326649.1|  PREDICTED: tetratricopeptide repeat protein ...    465   5e-148   
gb|KEH42753.1|  TPR 7B-like protein                                     466   6e-148   
ref|XP_003520607.1|  PREDICTED: tetratricopeptide repeat protein ...    464   2e-147   
gb|KHN10763.1|  Tetratricopeptide repeat protein 7A                     463   4e-147   
ref|XP_006367231.1|  PREDICTED: tetratricopeptide repeat protein ...    462   4e-147   
gb|KHG19891.1|  Tetratricopeptide repeat protein 7B                     463   4e-147   
ref|XP_003612599.1|  Calmodulin-binding protein                         464   6e-147   
gb|KDO54078.1|  hypothetical protein CISIN_1g035707mg                   462   6e-147   
ref|XP_010433197.1|  PREDICTED: tetratricopeptide repeat protein ...    462   1e-146   
emb|CDY53656.1|  BnaC04g52900D                                          462   1e-146   
gb|KHG19890.1|  Tetratricopeptide repeat protein 7B                     462   1e-146   
ref|XP_007156368.1|  hypothetical protein PHAVU_003G280300g             460   1e-146   
emb|CDY42806.1|  BnaC03g24000D                                          460   1e-146   
emb|CDY55501.1|  BnaA05g34390D                                          461   2e-146   
emb|CDY38377.1|  BnaC01g09860D                                          462   2e-146   
emb|CAN67088.1|  hypothetical protein VITISV_011972                     460   2e-146   Vitis vinifera
ref|XP_010447950.1|  PREDICTED: tetratricopeptide repeat protein ...    461   4e-146   
gb|EYU46418.1|  hypothetical protein MIMGU_mgv1a002185mg                459   5e-146   
emb|CDO99268.1|  unnamed protein product                                460   6e-146   
ref|XP_003590810.1|  Tetratricopeptide repeat protein 7B                461   7e-146   
ref|XP_008356209.1|  PREDICTED: LOW QUALITY PROTEIN: tetratricope...    461   8e-146   
ref|XP_002869490.1|  hypothetical protein ARALYDRAFT_328837             460   1e-145   
ref|XP_006282450.1|  hypothetical protein CARUB_v10004223mg             460   1e-145   
emb|CDX83506.1|  BnaA03g20000D                                          456   2e-145   
ref|XP_010236608.1|  PREDICTED: ATP-dependent RNA helicase DHX36        481   7e-145   
gb|KHN41739.1|  Tetratricopeptide repeat protein 7A                     452   5e-144   
gb|AAG12459.1|  calmodulin-binding protein MPCBP                        452   7e-144   Zea mays [maize]
gb|AFW71226.1|  calmodulin-binding protein MPCBP                        452   1e-143   
ref|XP_007162569.1|  hypothetical protein PHAVU_001G163000g             453   3e-143   
gb|KCW89805.1|  hypothetical protein EUGRSUZ_A02045                     449   8e-143   
ref|XP_002468546.1|  hypothetical protein SORBIDRAFT_01g047740          449   7e-142   
ref|NP_194589.2|  no pollen germination related 2 protein               449   1e-141   
ref|XP_010670978.1|  PREDICTED: uncharacterized protein LOC104887...    448   2e-141   
ref|XP_010670977.1|  PREDICTED: uncharacterized protein LOC104887...    448   3e-141   
ref|XP_009593323.1|  PREDICTED: tetratricopeptide repeat protein ...    447   9e-141   
ref|XP_010532675.1|  PREDICTED: tetratricopeptide repeat protein ...    446   2e-140   
ref|XP_007048891.1|  Tetratricopeptide repeat (TPR)-containing pr...    441   3e-140   
gb|EMT27969.1|  Tetratricopeptide repeat protein 7A                     443   5e-140   
dbj|BAK05498.1|  predicted protein                                      443   5e-140   
ref|XP_010238993.1|  PREDICTED: tetratricopeptide repeat protein ...    443   5e-140   
ref|XP_010648431.1|  PREDICTED: uncharacterized protein LOC100257836    441   8e-139   
emb|CDX97448.1|  BnaC08g13130D                                          440   9e-139   
ref|XP_006412930.1|  hypothetical protein EUTSA_v10024513mg             441   1e-138   
gb|AAP85535.1|  calmodulin-binding protein                              438   8e-138   
gb|KDO60402.1|  hypothetical protein CISIN_1g007775mg                   434   2e-137   
ref|XP_004493805.1|  PREDICTED: uncharacterized protein LOC101495...    434   3e-137   
ref|XP_011091272.1|  PREDICTED: tetratricopeptide repeat protein ...    436   2e-136   
ref|XP_009797077.1|  PREDICTED: tetratricopeptide repeat protein ...    434   2e-136   
gb|EMS63968.1|  Tetratricopeptide repeat protein 7A                     428   5e-135   
emb|CDY14233.1|  BnaA08g13640D                                          431   6e-135   
emb|CBI20784.3|  unnamed protein product                                430   8e-135   
ref|XP_009109080.1|  PREDICTED: LOW QUALITY PROTEIN: tetratricope...    427   2e-133   
ref|XP_004985777.1|  PREDICTED: tetratricopeptide repeat protein ...    427   4e-133   
ref|XP_010540907.1|  PREDICTED: tetratricopeptide repeat protein 7A     427   4e-133   
gb|AAD22127.1|  hypothetical protein                                    424   6e-133   
ref|XP_011091275.1|  PREDICTED: tetratricopeptide repeat protein ...    423   8e-132   
ref|XP_004493807.1|  PREDICTED: uncharacterized protein LOC101495...    419   2e-131   
gb|EMS58599.1|  Putative ATP-dependent RNA helicase DHX57               436   4e-131   
ref|XP_001764888.1|  predicted protein                                  420   1e-130   
ref|XP_006587637.1|  PREDICTED: tetratricopeptide repeat protein ...    411   2e-129   
gb|KEH42754.1|  TPR 7B-like protein                                     411   4e-128   
ref|XP_007035201.1|  No pollen germination related 2 isoform 6          410   7e-128   
ref|XP_002992780.1|  hypothetical protein SELMODRAFT_430952             412   8e-128   
ref|XP_007035199.1|  No pollen germination related 2 isoform 4          406   2e-126   
ref|XP_002962568.1|  hypothetical protein SELMODRAFT_404439             408   2e-126   
ref|XP_010321818.1|  PREDICTED: tetratricopeptide repeat protein ...    404   2e-126   
ref|XP_011070120.1|  PREDICTED: uncharacterized protein LOC105155...    402   3e-125   
ref|XP_006364572.1|  PREDICTED: tetratricopeptide repeat protein ...    399   2e-124   
ref|XP_003589067.1|  Tetratricopeptide repeat protein 7A                389   1e-123   
gb|KCW60286.1|  hypothetical protein EUGRSUZ_H02997                     399   3e-123   
dbj|BAK07825.1|  predicted protein                                      395   5e-123   
dbj|BAK05030.1|  predicted protein                                      399   1e-122   
gb|EMT11529.1|  Tetratricopeptide repeat protein 7A                     398   2e-122   
ref|XP_008447404.1|  PREDICTED: tetratricopeptide repeat protein ...    392   2e-121   
emb|CAB81448.1|  putative protein                                       395   2e-121   
ref|XP_006420292.1|  hypothetical protein CICLE_v10004566mg             390   1e-120   
ref|XP_007035200.1|  No pollen germination related 2 isoform 5          390   1e-120   
gb|EEC74477.1|  hypothetical protein OsI_09929                          392   2e-120   
gb|EPS61061.1|  hypothetical protein M569_13738                         392   5e-120   
gb|EEE58293.1|  hypothetical protein OsJ_09333                          390   8e-120   
ref|XP_010023882.1|  PREDICTED: uncharacterized protein LOC104414...    387   1e-119   
ref|XP_003558855.1|  PREDICTED: tetratricopeptide repeat protein 7A     389   6e-119   
ref|XP_006649366.1|  PREDICTED: uncharacterized protein LOC102716940    385   7e-118   
ref|XP_006576951.1|  PREDICTED: tetratricopeptide repeat protein ...    383   1e-117   
ref|NP_001048906.1|  Os03g0138000                                       384   2e-117   
gb|EMS59861.1|  Tetratricopeptide repeat protein 7B                     381   1e-115   
ref|XP_001752974.1|  predicted protein                                  379   3e-115   
emb|CAN79843.1|  hypothetical protein VITISV_014520                     378   1e-113   
gb|EEC74700.1|  hypothetical protein OsI_10410                          372   1e-113   
ref|XP_010326650.1|  PREDICTED: tetratricopeptide repeat protein ...    371   6e-113   
emb|CAN72360.1|  hypothetical protein VITISV_000132                     368   7e-113   
ref|XP_007144866.1|  hypothetical protein PHAVU_007G1906000g            365   1e-112   
gb|KEH23954.1|  TPR 7B-like protein                                     362   2e-110   
ref|XP_010445081.1|  PREDICTED: tetratricopeptide repeat protein ...    352   6e-106   
ref|XP_009797204.1|  PREDICTED: tetratricopeptide repeat protein ...    343   5e-103   
gb|KDO60403.1|  hypothetical protein CISIN_1g007775mg                   329   2e-99    
gb|KDO60404.1|  hypothetical protein CISIN_1g007775mg                   328   2e-99    
gb|EYU18301.1|  hypothetical protein MIMGU_mgv1a003624mg                315   8e-93    
gb|EPS61294.1|  hypothetical protein M569_13503                         261   4e-74    
ref|XP_008352492.1|  PREDICTED: uncharacterized protein LOC103415994    237   2e-67    
emb|CDY11797.1|  BnaC03g57810D                                          187   1e-50    
gb|KHG08877.1|  Helicase/primase complex protein                        186   4e-50    
emb|CDP17884.1|  unnamed protein product                                183   2e-49    
gb|KHN13141.1|  Tetratricopeptide repeat protein 7B                     184   1e-48    
ref|NP_001049290.2|  Os03g0200600                                       160   2e-41    
ref|NP_001136478.1|  uncharacterized protein LOC100216592               151   2e-38    
gb|KHG08878.1|  hypothetical protein F383_15454                         152   6e-38    
emb|CAN68857.1|  hypothetical protein VITISV_011243                     144   4e-35    
gb|ADG38273.1|  AT2G43040-like protein                                  134   4e-32    
gb|ADG38272.1|  AT2G43040-like protein                                  134   5e-32    
gb|ADG38278.1|  AT2G43040-like protein                                  134   7e-32    
gb|AEN81608.1|  AT2G43040-like protein                                  132   2e-31    
gb|AEN81611.1|  AT2G43040-like protein                                  131   6e-31    
ref|XP_008343728.1|  PREDICTED: uncharacterized protein LOC103406516    129   3e-29    
ref|XP_010436360.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    125   1e-28    
ref|XP_008354193.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    110   6e-24    
emb|CDY11798.1|  BnaC03g57800D                                          106   7e-23    
ref|XP_007144865.1|  hypothetical protein PHAVU_007G1906001g            104   8e-22    
gb|EPS62151.1|  hypothetical protein M569_12641                       95.5    7e-19    
ref|XP_005686277.1|  PREDICTED: tetratricopeptide repeat protein 7B   90.5    3e-15    
ref|XP_005285447.1|  PREDICTED: tetratricopeptide repeat protein ...  90.1    4e-15    
ref|NP_001170147.1|  uncharacterized protein LOC100384077             84.0    1e-14    
ref|XP_008819966.1|  PREDICTED: tetratricopeptide repeat protein ...  88.6    1e-14    
ref|XP_005311521.1|  PREDICTED: tetratricopeptide repeat protein ...  88.6    1e-14    
ref|XP_008931145.1|  PREDICTED: tetratricopeptide repeat protein 7A   87.4    3e-14    
ref|XP_004376829.1|  PREDICTED: tetratricopeptide repeat protein 7B   87.0    4e-14    
emb|CDP22236.1|  unnamed protein product                              81.6    5e-14    
emb|CBI26545.3|  unnamed protein product                              83.2    5e-14    
gb|KGL72528.1|  Tetratricopeptide repeat protein 7A                   86.7    5e-14    
ref|XP_005436367.1|  PREDICTED: tetratricopeptide repeat protein 7A   86.3    6e-14    
ref|XP_010210488.1|  PREDICTED: tetratricopeptide repeat protein 7A   86.3    6e-14    
gb|KFR14336.1|  Tetratricopeptide repeat protein 7A                   85.9    9e-14    
ref|XP_006125553.1|  PREDICTED: tetratricopeptide repeat protein 7A   85.5    1e-13    
ref|XP_009674558.1|  PREDICTED: tetratricopeptide repeat protein ...  85.1    2e-13    
ref|XP_009674563.1|  PREDICTED: tetratricopeptide repeat protein ...  84.7    2e-13    
ref|XP_010658105.1|  PREDICTED: uncharacterized protein LOC100242030  82.0    2e-13    
ref|XP_009674561.1|  PREDICTED: tetratricopeptide repeat protein ...  84.7    2e-13    
ref|XP_006986550.1|  PREDICTED: tetratricopeptide repeat protein 7A   84.3    3e-13    
gb|ELW47267.1|  Tetratricopeptide repeat protein 7A                   83.6    4e-13    
ref|XP_006159944.1|  PREDICTED: LOW QUALITY PROTEIN: tetratricope...  83.2    7e-13    
ref|XP_005311523.1|  PREDICTED: tetratricopeptide repeat protein ...  82.8    8e-13    
ref|XP_005311520.1|  PREDICTED: tetratricopeptide repeat protein ...  82.8    8e-13    
gb|KFV70277.1|  Tetratricopeptide repeat protein 7A                   82.0    1e-12    
ref|XP_007659474.1|  PREDICTED: tetratricopeptide repeat protein ...  80.1    2e-12    
gb|KFO78651.1|  Tetratricopeptide repeat protein 7A                   80.5    4e-12    
ref|XP_010646395.1|  PREDICTED: COP9 signalosome complex subunit ...  77.4    4e-12    
gb|KFV81993.1|  Tetratricopeptide repeat protein 7A                   80.1    6e-12    
ref|XP_001660892.1|  tetratricopeptide repeat protein, tpr            80.1    6e-12    
ref|XP_007534334.1|  PREDICTED: tetratricopeptide repeat protein ...  79.3    6e-12    
ref|XP_007968912.1|  PREDICTED: tetratricopeptide repeat protein ...  79.7    7e-12    
ref|XP_005864857.1|  PREDICTED: tetratricopeptide repeat protein ...  79.7    7e-12    
ref|XP_004686282.1|  PREDICTED: tetratricopeptide repeat protein 7A   79.7    8e-12    
gb|ERE74286.1|  tetratricopeptide repeat protein 7A                   79.3    1e-11    
ref|XP_005864856.1|  PREDICTED: tetratricopeptide repeat protein ...  79.3    1e-11    
ref|XP_007534333.1|  PREDICTED: tetratricopeptide repeat protein ...  79.0    1e-11    
ref|XP_006083443.1|  PREDICTED: tetratricopeptide repeat protein ...  78.6    2e-11    
gb|ERE74284.1|  tetratricopeptide repeat protein 7A                   78.6    2e-11    
ref|XP_008821277.1|  PREDICTED: tetratricopeptide repeat protein 7A   78.6    2e-11    
ref|XP_006083442.1|  PREDICTED: tetratricopeptide repeat protein ...  78.2    2e-11    
ref|XP_007968916.1|  PREDICTED: tetratricopeptide repeat protein ...  77.8    3e-11    
ref|XP_007968915.1|  PREDICTED: tetratricopeptide repeat protein ...  77.8    3e-11    
ref|XP_005600051.1|  PREDICTED: tetratricopeptide repeat protein ...  77.4    4e-11    
ref|XP_007968909.1|  PREDICTED: tetratricopeptide repeat protein ...  77.4    4e-11    
ref|XP_010362600.1|  PREDICTED: tetratricopeptide repeat protein ...  77.4    4e-11    
ref|XP_006778691.1|  PREDICTED: tetratricopeptide repeat protein ...  77.0    5e-11    
ref|XP_004006018.1|  PREDICTED: tetratricopeptide repeat protein 7A   77.0    5e-11    
ref|XP_005576009.1|  PREDICTED: tetratricopeptide repeat protein ...  76.6    6e-11    
ref|XP_006778690.1|  PREDICTED: tetratricopeptide repeat protein ...  77.0    6e-11    
ref|XP_003908653.1|  PREDICTED: tetratricopeptide repeat protein ...  76.6    7e-11    
ref|XP_005576007.1|  PREDICTED: tetratricopeptide repeat protein ...  76.6    7e-11    
ref|XP_005324551.1|  PREDICTED: tetratricopeptide repeat protein ...  76.3    8e-11    
ref|XP_005686630.1|  PREDICTED: tetratricopeptide repeat protein 7A   76.3    8e-11    
ref|XP_007942590.1|  PREDICTED: tetratricopeptide repeat protein ...  76.3    9e-11    
ref|XP_005324552.1|  PREDICTED: tetratricopeptide repeat protein ...  76.3    9e-11    
ref|XP_005980698.1|  PREDICTED: tetratricopeptide repeat protein 7A   75.9    1e-10    
ref|XP_009235615.1|  PREDICTED: LOW QUALITY PROTEIN: tetratricope...  75.9    1e-10    
ref|XP_009473330.1|  PREDICTED: tetratricopeptide repeat protein ...  75.5    1e-10    
ref|XP_006268558.1|  PREDICTED: tetratricopeptide repeat protein 7A   75.5    1e-10    
ref|XP_004699812.1|  PREDICTED: tetratricopeptide repeat protein 7A   75.5    1e-10    
ref|XP_004265029.1|  PREDICTED: tetratricopeptide repeat protein 7A   75.5    2e-10    
ref|XP_006014814.1|  PREDICTED: tetratricopeptide repeat protein 7A   75.5    2e-10    
ref|XP_004029230.1|  PREDICTED: tetratricopeptide repeat protein ...  75.5    2e-10    
ref|XP_007106912.1|  PREDICTED: tetratricopeptide repeat protein ...  74.7    2e-10    
ref|XP_006930157.1|  PREDICTED: tetratricopeptide repeat protein ...  74.3    2e-10    
ref|XP_007106913.1|  PREDICTED: tetratricopeptide repeat protein ...  74.7    2e-10    
ref|XP_004436734.1|  PREDICTED: tetratricopeptide repeat protein 7A   74.7    3e-10    
ref|XP_004618664.1|  PREDICTED: tetratricopeptide repeat protein 7A   74.7    3e-10    
ref|XP_004660199.1|  PREDICTED: tetratricopeptide repeat protein 7A   74.7    3e-10    
ref|XP_005600055.1|  PREDICTED: tetratricopeptide repeat protein ...  73.9    3e-10    
ref|XP_004582965.1|  PREDICTED: tetratricopeptide repeat protein 7A   74.3    4e-10    
ref|XP_005600052.1|  PREDICTED: tetratricopeptide repeat protein ...  74.3    4e-10    
ref|XP_010362601.1|  PREDICTED: tetratricopeptide repeat protein ...  73.9    4e-10    
ref|XP_006185834.1|  PREDICTED: tetratricopeptide repeat protein 7A   73.9    4e-10    
ref|XP_005626143.1|  PREDICTED: tetratricopeptide repeat protein ...  73.9    4e-10    
ref|XP_005600053.1|  PREDICTED: tetratricopeptide repeat protein ...  73.6    5e-10    
ref|XP_010982337.1|  PREDICTED: tetratricopeptide repeat protein 7A   73.6    5e-10    
ref|XP_007190119.1|  PREDICTED: tetratricopeptide repeat protein ...  73.6    6e-10    
ref|XP_003984012.1|  PREDICTED: tetratricopeptide repeat protein ...  73.6    6e-10    
ref|XP_007942591.1|  PREDICTED: tetratricopeptide repeat protein ...  72.8    6e-10    
emb|CAD39046.2|  hypothetical protein                                 73.2    7e-10    
emb|CBI25784.3|  unnamed protein product                              71.6    8e-10    
ref|XP_006216503.1|  PREDICTED: tetratricopeptide repeat protein ...  72.8    9e-10    
ref|XP_007190118.1|  PREDICTED: tetratricopeptide repeat protein ...  72.8    9e-10    
ref|XP_004369544.1|  PREDICTED: tetratricopeptide repeat protein 7A   72.8    9e-10    
ref|XP_003473120.1|  PREDICTED: tetratricopeptide repeat protein ...  72.8    9e-10    
ref|XP_008974495.1|  PREDICTED: tetratricopeptide repeat protein ...  72.8    1e-09    
ref|XP_007460035.1|  PREDICTED: tetratricopeptide repeat protein 7A   72.8    1e-09    
ref|XP_010392408.1|  PREDICTED: tetratricopeptide repeat protein ...  72.8    1e-09    
ref|XP_006216502.1|  PREDICTED: tetratricopeptide repeat protein ...  72.4    1e-09    
ref|XP_009440704.1|  PREDICTED: tetratricopeptide repeat protein 7A   72.4    1e-09    
ref|XP_007084770.1|  PREDICTED: tetratricopeptide repeat protein ...  72.0    1e-09    
emb|CDY30949.1|  BnaA06g19640D                                        69.7    1e-09    
ref|XP_003822714.1|  PREDICTED: tetratricopeptide repeat protein ...  72.4    1e-09    
dbj|BAG51719.1|  unnamed protein product                              72.4    1e-09    
ref|XP_003473121.1|  PREDICTED: tetratricopeptide repeat protein ...  72.4    1e-09    
ref|XP_010335754.1|  PREDICTED: tetratricopeptide repeat protein ...  72.0    2e-09    
ref|XP_008974494.1|  PREDICTED: tetratricopeptide repeat protein ...  72.0    2e-09    
ref|XP_003926789.1|  PREDICTED: tetratricopeptide repeat protein ...  72.0    2e-09    
ref|XP_006054863.1|  PREDICTED: tetratricopeptide repeat protein 7A   72.0    2e-09    
ref|XP_002757829.1|  PREDICTED: tetratricopeptide repeat protein 7A   72.0    2e-09    
ref|NP_001275882.1|  tetratricopeptide repeat protein 7A isoform 3    72.0    2e-09    
ref|XP_006839489.1|  PREDICTED: tetratricopeptide repeat protein ...  71.2    2e-09    
gb|EAX00227.1|  tetratricopeptide repeat domain 7A, isoform CRA_b     72.0    2e-09    
ref|NP_065191.2|  tetratricopeptide repeat protein 7A isoform 2       72.0    2e-09    
gb|AAH65554.1|  TTC7A protein                                         71.6    2e-09    
ref|XP_002912462.1|  PREDICTED: tetratricopeptide repeat protein ...  71.6    2e-09    
ref|XP_004403436.1|  PREDICTED: tetratricopeptide repeat protein 7A   71.6    2e-09    
gb|AAI14366.1|  TTC7A protein                                         71.2    2e-09    
ref|XP_006909683.1|  PREDICTED: tetratricopeptide repeat protein 7A   71.6    2e-09    
ref|XP_005391045.1|  PREDICTED: tetratricopeptide repeat protein ...  71.6    2e-09    
dbj|BAG10426.1|  tetratricopeptide repeat protein 7A                  71.2    3e-09    
ref|XP_005264496.1|  PREDICTED: tetratricopeptide repeat protein ...  71.2    3e-09    
ref|XP_007084769.1|  PREDICTED: tetratricopeptide repeat protein ...  71.2    3e-09    
dbj|BAA86454.2|  KIAA1140 protein                                     71.2    3e-09    
ref|NP_001275884.1|  tetratricopeptide repeat protein 7A isoform 4    70.9    3e-09    
ref|XP_010705091.1|  PREDICTED: tetratricopeptide repeat protein ...  71.2    3e-09    
ref|XP_010705093.1|  PREDICTED: tetratricopeptide repeat protein ...  70.9    3e-09    
ref|NP_001026226.1|  tetratricopeptide repeat protein 7A              71.2    3e-09    
ref|XP_007435734.1|  PREDICTED: tetratricopeptide repeat protein ...  70.9    3e-09    
ref|XP_008160682.1|  PREDICTED: tetratricopeptide repeat protein 7A   71.2    3e-09    
ref|XP_010705090.1|  PREDICTED: tetratricopeptide repeat protein ...  71.2    3e-09    
ref|XP_002613242.1|  hypothetical protein BRAFLDRAFT_68206            67.8    4e-09    
ref|XP_009150286.1|  PREDICTED: uncharacterized protein LOC103873632  67.4    4e-09    
ref|XP_005077359.1|  PREDICTED: tetratricopeptide repeat protein 7A   70.9    4e-09    
ref|XP_001949304.1|  PREDICTED: tetratricopeptide repeat protein 7B   70.9    4e-09    
ref|XP_006839488.1|  PREDICTED: tetratricopeptide repeat protein ...  70.9    4e-09    
ref|XP_008698061.1|  PREDICTED: tetratricopeptide repeat protein 7A   69.7    7e-09    
ref|XP_003741986.1|  PREDICTED: tetratricopeptide repeat protein ...  70.1    8e-09    
ref|XP_001632235.1|  predicted protein                                69.7    8e-09    



>ref|XP_009760940.1| PREDICTED: tetratricopeptide repeat protein 7A [Nicotiana sylvestris]
Length=707

 Score =   985 bits (2547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/711 (72%), Positives = 596/711 (84%), Gaps = 4/711 (1%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFKF+EP P       LATRDFSASGLSS RTGT DW+S+ E+AQVDEVEST
Sbjct  1     MLCACSGEQFKFDEPPPQSPES--LATRDFSASGLSS-RTGTVDWDSKLEDAQVDEVEST  57

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLEYQRGNFDAAL VFQGIDI+TLS RMSKAI ERTRP KPR 
Sbjct  58    LKEALSLNYEEARALLGRLEYQRGNFDAALHVFQGIDIRTLSSRMSKAIAERTRPLKPRS  117

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                 IV +GVMSLHSVSLLLEAILLK+KSL  L RI+DAA+ECK ILD+VDSA PNG+ E
Sbjct  118   KCD-IVPAGVMSLHSVSLLLEAILLKAKSLEELSRIKDAAKECKMILDVVDSALPNGIPE  176

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G+ EDCKL EMFHKALE LPKLW+Q G +DEAV +YRRALVKPWNLD++RLA +QKDLA 
Sbjct  177   GISEDCKLLEMFHKALELLPKLWIQAGYVDEAVLAYRRALVKPWNLDSQRLACIQKDLAA  236

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LLF GVEV++  +F++  ST PKNN+EEAILLLFVLM K+  G++EWDSE+M HLTFAL
Sbjct  237   TLLFGGVEVEVPAQFQVSGSTSPKNNLEEAILLLFVLMSKMLNGQIEWDSEIMHHLTFAL  296

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             T+ G  ES+AD++EQ+LPG+ TR+ERWY LALCYS+AGQN+TALNL++K+SG SEA  EP
Sbjct  297   TISGHSESVADHIEQVLPGIYTRSERWYLLALCYSAAGQNDTALNLVKKISGCSEANQEP  356

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             HIPSLLLGAKLCSQD  ++ EG++FAR A++S  NQN+H L QA K LG+CYGNAA++S 
Sbjct  357   HIPSLLLGAKLCSQDLQQAHEGVNFARAALNSAKNQNEHFLVQAHKLLGICYGNAARVSI  416

Query  1508  SDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGS  1687
             SD ERN  Q ++  +L  A   CKED E +FSLGLE A QRNLTPAF+N ++YSEM AGS
Sbjct  417   SDFERNFCQREAFAALNSAFATCKEDPEILFSLGLENAIQRNLTPAFNNGMRYSEMVAGS  476

Query  1688  TAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMET  1867
             T + WKLLAL+VSAEQRF DAEAIVDLA DETG+IDQ+++L+LKA LQIA+Q P QA+ET
Sbjct  477   TTRAWKLLALVVSAEQRFKDAEAIVDLAFDETGKIDQMEYLRLKAVLQIAQQQPKQAIET  536

Query  1868  YRILLAMIQAQRQSGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIY  2047
             YRILLA+IQAQ++S  D EV   R+LEVEAWLDL+R+Y D +SW DA++CI+KAK I  Y
Sbjct  537   YRILLALIQAQQESMTDDEVTFQRRLEVEAWLDLSRLYTDLESWRDAEICINKAKAIQFY  596

Query  2048  SPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSL  2227
              P+SWH TGALF+A+ R KEALVAFS SLSI+PDY+PSIVSTA+VLMKMG   VPIARS 
Sbjct  597   CPRSWHATGALFQAKARDKEALVAFSISLSIEPDYIPSIVSTAQVLMKMGDDTVPIARSF  656

Query  2228  LMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSFV  2380
             LMNALR+EPT HDAWFSLG L+K EGS QQAADFFQAAHELKLS PVQSFV
Sbjct  657   LMNALRLEPTNHDAWFSLGMLAKTEGSLQQAADFFQAAHELKLSAPVQSFV  707



>ref|XP_009623724.1| PREDICTED: tetratricopeptide repeat protein 7A [Nicotiana tomentosiformis]
 ref|XP_009623725.1| PREDICTED: tetratricopeptide repeat protein 7A [Nicotiana tomentosiformis]
Length=707

 Score =   981 bits (2536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/711 (72%), Positives = 596/711 (84%), Gaps = 4/711 (1%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFKF+EP P       LATRDFSASGLSS RTGT DW+S+ E+AQVDEVEST
Sbjct  1     MLCACSGEQFKFDEPPPQSPES--LATRDFSASGLSS-RTGTVDWDSKLEDAQVDEVEST  57

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLEYQRGNFDAAL VFQGIDI+TLS RMSKAI ERTRP KPR 
Sbjct  58    LKEALSLNYEEARALLGRLEYQRGNFDAALHVFQGIDIRTLSSRMSKAIAERTRPLKPRS  117

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                 IV +GVMSLHSVSLLLEAILLK+KSL  L RI+DAA+ECK ILD+VDSA PNG+ E
Sbjct  118   KCD-IVPAGVMSLHSVSLLLEAILLKAKSLEELSRIKDAAKECKMILDVVDSALPNGIPE  176

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G+ EDCKL EMFHKALE LPKLW+Q G +DEAV +YRRALVKPWNLD++RLA +QKDLA 
Sbjct  177   GISEDCKLLEMFHKALELLPKLWIQAGYLDEAVLAYRRALVKPWNLDSQRLACIQKDLAA  236

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LLF GVEV++  +F++  ST PKNN+EEAILLLFVLM K+  G++EWDSE+M+HLTFAL
Sbjct  237   TLLFGGVEVEVPAQFQVCGSTAPKNNLEEAILLLFVLMSKMLNGQIEWDSEIMNHLTFAL  296

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             T+ G  ESLAD++EQ+LPG+ TRAERWY LALCYS+AGQN+TALNL++K+SG SEA  EP
Sbjct  297   TISGHSESLADHIEQVLPGIYTRAERWYLLALCYSAAGQNDTALNLVKKISGCSEANQEP  356

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             HIPSLLLGAKLCSQD  ++ EGI+FAR  ++   NQN+H L QA K LGVCYGNAA++S 
Sbjct  357   HIPSLLLGAKLCSQDLQQAHEGINFARAVINLAKNQNEHFLVQAHKLLGVCYGNAARVSI  416

Query  1508  SDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGS  1687
             SD ERN  Q ++L +L      CKED E +FSLGLE A QRNLTPAF+N ++YSEM AGS
Sbjct  417   SDFERNFCQREALAALNSTFATCKEDPEILFSLGLENAIQRNLTPAFNNVMRYSEMVAGS  476

Query  1688  TAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMET  1867
             T + WKLLAL+VSAEQRF DAEAIVDLA DETG++DQ+++L+LKA LQIA+Q P QA+ET
Sbjct  477   TTRAWKLLALVVSAEQRFKDAEAIVDLAFDETGKVDQMEYLRLKAVLQIAQQQPKQAIET  536

Query  1868  YRILLAMIQAQRQSGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIY  2047
             YRILLA+IQAQ++S  D EV + R+LEVEAWLDL+ +Y D +SW DA++CI+KAK I  Y
Sbjct  537   YRILLALIQAQKESTTDDEVTAQRRLEVEAWLDLSSLYTDLESWRDAEICINKAKAIQFY  596

Query  2048  SPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSL  2227
              P++WH TGALF+A+ R KEALVA S SLSI+PDY+PSIVSTA+VLMKMG+  VPIARS 
Sbjct  597   CPRNWHATGALFQAKARDKEALVALSVSLSIEPDYIPSIVSTAQVLMKMGNDTVPIARSF  656

Query  2228  LMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSFV  2380
             LMNALR+EPT HDAWF+LG L+KMEGS QQAADFFQAAHELK+S PVQSFV
Sbjct  657   LMNALRLEPTNHDAWFNLGMLAKMEGSLQQAADFFQAAHELKISAPVQSFV  707



>ref|XP_010320297.1| PREDICTED: tetratricopeptide repeat protein 7B [Solanum lycopersicum]
Length=706

 Score =   967 bits (2499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 502/711 (71%), Positives = 599/711 (84%), Gaps = 5/711 (1%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFKF+EP+P       LATRDFSASG+SS R GT DW+S+ ++AQVDEVEST
Sbjct  1     MLCACSGEQFKFDEPQPESPES--LATRDFSASGISS-RNGTVDWDSKLDDAQVDEVEST  57

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDI+TLS RMSKAI+ERTRP KPR 
Sbjct  58    LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIRTLSSRMSKAISERTRPLKPRS  117

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                 I+ +GVMSLHSVSLLLEAILLK+KSL  L RI+DAA ECK ILD+VDSA PNG+ +
Sbjct  118   KGD-ILPAGVMSLHSVSLLLEAILLKAKSLEELSRIKDAANECKMILDVVDSALPNGIPD  176

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G+ EDCKL EMFHKALE LPKLW+Q G +DEAV +YRRAL+KPWNLD++RLA +QKDLA 
Sbjct  177   GISEDCKLLEMFHKALELLPKLWIQAGYLDEAVLAYRRALIKPWNLDSQRLACIQKDLAT  236

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LLF GVEV++  +F++W ST PK+N+EEAILLLFVLM K+  G++ WDSEVM HLTFAL
Sbjct  237   NLLFGGVEVEVPAQFQVWGSTAPKSNLEEAILLLFVLMSKMLNGQIIWDSEVMSHLTFAL  296

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             T+   FES+AD++EQ++PG+ TRAERWY LALCYS+AGQN+TALNL++K+SG SEA  EP
Sbjct  297   TISNNFESVADHIEQVIPGVYTRAERWYLLALCYSAAGQNDTALNLVKKISGRSEANQEP  356

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             ++PSLLLGAKLCSQD  ++ EGI+FAR  ++   NQ+ H L QA   LGVCYGNAA+IS 
Sbjct  357   YVPSLLLGAKLCSQDLQQAHEGINFAREVINLAKNQDDHFLVQAHNLLGVCYGNAARISI  416

Query  1508  SDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGS  1687
             SD ERN  Q ++L +L  A++ CKED E +FSLGLE A QRNLTPAF+N ++YSEM+AGS
Sbjct  417   SDFERNFCQREALAALNSASV-CKEDPEFMFSLGLENAIQRNLTPAFNNVMRYSEMSAGS  475

Query  1688  TAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMET  1867
             TAK WKLLAL+VSAEQRF DAEAIVDLALDETGQIDQ++ L+LKA LQI++Q P QA+ET
Sbjct  476   TAKAWKLLALVVSAEQRFKDAEAIVDLALDETGQIDQMEHLRLKAVLQISQQQPKQAIET  535

Query  1868  YRILLAMIQAQRQSGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIY  2047
             YRILLA+IQAQ+ S  + EV S R+LEVEAWLDLA +Y D +SW DA++CI++AKTI  +
Sbjct  536   YRILLALIQAQKVSATNDEVTSQRRLEVEAWLDLAGLYTDLESWRDAEICINRAKTIQFF  595

Query  2048  SPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSL  2227
              P++WH TGALF+A+ER KEALVAFS SLSI+PDY+PSIVSTA+VLMKM +  VPIARS 
Sbjct  596   CPRNWHATGALFQAKERYKEALVAFSVSLSIEPDYIPSIVSTAKVLMKMSNDVVPIARSF  655

Query  2228  LMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSFV  2380
             LMNALR++PT H+AWF+LG L+KMEGS  QAADFFQAAHELKLS PVQSF+
Sbjct  656   LMNALRLDPTNHEAWFNLGMLAKMEGSVHQAADFFQAAHELKLSAPVQSFI  706



>ref|XP_006356859.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Solanum 
tuberosum]
Length=706

 Score =   959 bits (2479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/711 (70%), Positives = 596/711 (84%), Gaps = 5/711 (1%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFKF+EP P       LATRDFSASG+SS R GT DW+S+ ++AQVDEVEST
Sbjct  1     MLCACSGEQFKFDEPPPESPES--LATRDFSASGISS-RNGTVDWDSKLDDAQVDEVEST  57

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDI+TLS RMSKAI+ERTRP KPR 
Sbjct  58    LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIRTLSSRMSKAISERTRPLKPRS  117

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                 IV +GVMSLHSVSLLLEAILLK+KSL  L RI+DAA+ECK +LD+VDSA PNG+ +
Sbjct  118   KGD-IVPAGVMSLHSVSLLLEAILLKAKSLEELSRIKDAAKECKMMLDVVDSALPNGIPD  176

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G+ EDCKL EMFHKALE LPKLW+Q G +DEAV +YRRAL+KPWNLD++RLA +QKDLA 
Sbjct  177   GISEDCKLLEMFHKALELLPKLWIQAGYLDEAVLAYRRALIKPWNLDSQRLACIQKDLAT  236

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LLF GVEV++  +F++W ST PK+N+EEAILLLFVLM ++  G++ WDSEVM HLTFAL
Sbjct  237   TLLFGGVEVEVPAQFQVWGSTAPKSNLEEAILLLFVLMSRMLNGQIIWDSEVMSHLTFAL  296

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             T+   FES+AD++EQ++PG+ TRAERWY LALCYS+AGQN+TALNL++K+SG SEA  EP
Sbjct  297   TISNNFESVADHIEQVIPGVYTRAERWYLLALCYSAAGQNDTALNLVKKISGCSEANQEP  356

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             +IPSLLLGAKLCSQD  ++ EGI+FAR  ++S  NQ++H L QA K LGVCYGNAA++S 
Sbjct  357   YIPSLLLGAKLCSQDLQQAHEGINFARQVINSAKNQDEHFLVQAHKLLGVCYGNAARVSL  416

Query  1508  SDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGS  1687
             SD ERN  Q ++L +L  A++ CKED E +F LGLE A QRNLTPAF+N + YSEM+AGS
Sbjct  417   SDFERNFCQREALAALNSASV-CKEDPEIMFILGLENAIQRNLTPAFNNVMCYSEMSAGS  475

Query  1688  TAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMET  1867
             TAK WKLLAL+VSAEQRF DAEAIVDLALDETGQIDQ++ L+LKA LQI++Q P QA+ET
Sbjct  476   TAKAWKLLALVVSAEQRFKDAEAIVDLALDETGQIDQMEHLRLKAVLQISQQQPKQAIET  535

Query  1868  YRILLAMIQAQRQSGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIY  2047
             YRILLA+IQAQ++S  +  V S R+LEVEAWLDLA +Y D +SW DA++CI++AK I  +
Sbjct  536   YRILLALIQAQKESATNDVVTSQRRLEVEAWLDLAGLYTDLESWRDAEICINRAKAIQFF  595

Query  2048  SPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSL  2227
              P++WH TG LF+A+ R KEALVAF+ SLSI+PDY+PSIVSTA+VLMKM +   PIARS 
Sbjct  596   CPRNWHATGVLFQAKARYKEALVAFTVSLSIEPDYIPSIVSTAKVLMKMSNDVAPIARSF  655

Query  2228  LMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSFV  2380
             LMNALR+EPT H+AWF+LG L+KMEGS  QAADFFQAAHELKLS PVQ+F+
Sbjct  656   LMNALRLEPTNHEAWFNLGMLAKMEGSVHQAADFFQAAHELKLSAPVQNFI  706



>emb|CDP01197.1| unnamed protein product [Coffea canephora]
Length=710

 Score =   935 bits (2416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/713 (70%), Positives = 579/713 (81%), Gaps = 7/713 (1%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFKFEEP P       LATRDFSASGLSS R GT  WES+ E+AQVDEVEST
Sbjct  1     MLCACSGEQFKFEEPAPQSPES--LATRDFSASGLSS-RNGTGGWESKLEDAQVDEVEST  57

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAI ERTRPRKPR 
Sbjct  58    LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAIAERTRPRKPRQ  117

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                  +V GVMSLHSVSLLLEA+LLK+KSL  LGRI+DAARECK ILD+V+SA PNGM E
Sbjct  118   KGESSLV-GVMSLHSVSLLLEAVLLKAKSLWELGRIKDAARECKVILDVVESALPNGMPE  176

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G+GEDCKLQEMFHKALE LPKLW+Q G +DEA+  YRRAL K WNLD +RLA +QKDLA 
Sbjct  177   GIGEDCKLQEMFHKALELLPKLWMQVGCLDEAITGYRRALSKQWNLDPQRLAIVQKDLAA  236

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LL+ G E  LSP  ++   T PKNN EEA+LLLF+LM K+  G++ WD E MDHLTFAL
Sbjct  237   TLLYGGFEASLSPCPQLQGQTAPKNNTEEALLLLFILMRKVLHGDISWDPEFMDHLTFAL  296

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             T+ GE+E LAD+VEQ+LPG   RAERWYFLALCYS+AGQN+TA+ LL+KVSG SEA+H+P
Sbjct  297   TICGEYECLADHVEQVLPGTYNRAERWYFLALCYSAAGQNQTAIELLKKVSGCSEAKHKP  356

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             H+ SL+LGAKLCS+DP ++REGI+FA   +D+ +N N+HLL QARKFLG+CYGNAA+I  
Sbjct  357   HLSSLMLGAKLCSKDPKEAREGITFACKVIDAAINPNEHLLGQARKFLGICYGNAARICS  416

Query  1508  SDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGS  1687
             SD+ER  +Q +SLNSL  AA + KED E + +LGLE A QRNL  AFDNA+ YS M +GS
Sbjct  417   SDTERVFFQRESLNSLNHAAHIDKEDPEVMLNLGLENAFQRNLVSAFDNAISYSNMLSGS  476

Query  1688  TAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMET  1867
              AKGWKLLALIVSA+QR  DAE+IVDLALDET +I+QL+ L+LKA LQIA++ P QA+ET
Sbjct  477   CAKGWKLLALIVSAQQRLQDAESIVDLALDETERIEQLELLRLKAILQIAQEQPKQAIET  536

Query  1868  YRILLAMIQAQRQ---SGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTI  2038
             YRILLA++Q+Q +        EV+S RKLE EAWLDLARIY D ++WPDA +CIDK K  
Sbjct  537   YRILLALVQSQTELQAPNSSEEVVSIRKLEGEAWLDLARIYSDLETWPDADICIDKTKAT  596

Query  2039  DIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIA  2218
              I++ + WHT G  FEAQE+ KEALVAFS SLSI+PDYVPSIVS+A VL+K+G Q +PIA
Sbjct  597   KIFNSRGWHTKGTSFEAQEQYKEALVAFSVSLSIEPDYVPSIVSSAGVLIKLGRQNLPIA  656

Query  2219  RSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             RSLLM ALR+EPT HDAWF LG LSK EG  Q AAD+FQAAHELKLS PVQ F
Sbjct  657   RSLLMTALRLEPTNHDAWFLLGVLSKSEGLKQAAADYFQAAHELKLSAPVQDF  709



>ref|XP_010664509.1| PREDICTED: tetratricopeptide repeat protein 7B [Vitis vinifera]
 ref|XP_010664510.1| PREDICTED: tetratricopeptide repeat protein 7B [Vitis vinifera]
Length=706

 Score =   904 bits (2336),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 476/714 (67%), Positives = 572/714 (80%), Gaps = 11/714 (2%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFKFE+   +P+S   LATRDFSASGLSS RTG  DWES+FE+ QVDE EST
Sbjct  1     MLCACSGEQFKFEDAPRSPES---LATRDFSASGLSS-RTG--DWESKFEDTQVDEAEST  54

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             L++ALSLNYEEARALLGRLEYQRGNFDAA QVF GIDI+ L+PRM++AI ERT  RKPR 
Sbjct  55    LRDALSLNYEEARALLGRLEYQRGNFDAAFQVFHGIDIRGLTPRMTRAIVERTWQRKPRT  114

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                 IV +  MS+HSVSLLLEAILLK+KSL  LGR  +AA+ECK ILD V+SA PNGM E
Sbjct  115   KGD-IVSTQEMSMHSVSLLLEAILLKAKSLDELGRTGEAAKECKIILDTVESALPNGMPE  173

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G+GEDCKLQEMFHKALE LPKLW + G +DE++ +YR+ALV+PWNLD +RLAS+QKDLA 
Sbjct  174   GIGEDCKLQEMFHKALELLPKLWTKAGCLDESIAAYRQALVRPWNLDPRRLASVQKDLAA  233

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LL+ GVE  L P+ ++W +T PKNN+EEAILLLF+LM K+   E++WD E+MDHL +AL
Sbjct  234   ILLYGGVETSLPPQLQVWGATTPKNNIEEAILLLFILMRKVASREIDWDPEIMDHLAYAL  293

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             T+ G FE LA+ VEQ LPG+  RAERWYFLALCYS+AGQNE ALNLL+KVSG SEA+H+P
Sbjct  294   TISGRFEFLAEYVEQALPGVYNRAERWYFLALCYSAAGQNEAALNLLKKVSGCSEAKHKP  353

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             H+PS LLGAKLCSQDP  + EGI+FAR  + S+ +Q KH + +  KFLG+CYGNAA+   
Sbjct  354   HLPSFLLGAKLCSQDPKHAHEGINFARKVI-SSHDQTKHFMGETHKFLGICYGNAARACV  412

Query  1508  SDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGS  1687
              DSER + QT SLNSL QA+++  +D E +FSL LE A QRNL  AF NA+ YS+M AGS
Sbjct  413   LDSERVALQTDSLNSLNQASLIGHKDPELIFSLALENAVQRNLDAAFSNAIMYSDMVAGS  472

Query  1688  TAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMET  1867
             + +GWKLLAL+VSAEQRF DAE IVDLALDE G+IDQL+ L+LKA LQIA++ P QA+ET
Sbjct  473   SGRGWKLLALVVSAEQRFKDAETIVDLALDEAGRIDQLELLRLKAVLQIAQEQPKQAIET  532

Query  1868  YRILLAMIQAQRQ---SGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTI  2038
             YRILLA+IQAQR+   +    EV ++R LE + W DLA IY     W DA++C+DKAK+I
Sbjct  533   YRILLALIQAQREVQANKFHSEVSAERNLETQTWQDLANIYTKLGLWSDAEICLDKAKSI  592

Query  2039  DIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIA  2218
             + YS +SWH TG   EAQ   KEALV+FS SLSI+PDYVPSIVSTAEVLMK G  ++PIA
Sbjct  593   EFYSSRSWHKTGISLEAQSLYKEALVSFSVSLSIEPDYVPSIVSTAEVLMKFGKPSLPIA  652

Query  2219  RSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSFV  2380
             RS LMNALR+EPT H+AW +LG +SKMEGS QQAAD+FQAA+ELKLS P+QSFV
Sbjct  653   RSFLMNALRLEPTNHEAWLNLGLVSKMEGSLQQAADYFQAAYELKLSAPIQSFV  706



>ref|XP_011069800.1| PREDICTED: tetratricopeptide repeat protein 7A [Sesamum indicum]
Length=709

 Score =   903 bits (2333),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/712 (66%), Positives = 571/712 (80%), Gaps = 6/712 (1%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFK EE  P       LATRDFSASGLSS RTGT DWES+ E+AQVDE EST
Sbjct  1     MLCACSGEQFKLEEAVPQSPES--LATRDFSASGLSS-RTGTVDWESKLEDAQVDEAEST  57

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDI+ LSPRMSKAI ERTRPRK R 
Sbjct  58    LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIRLLSPRMSKAIAERTRPRKLRS  117

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                  V++GVMSLHSVSLLLEAILLK+KSLA LGR+++AARECK ILD V+ A PNG+  
Sbjct  118   KDRN-VLAGVMSLHSVSLLLEAILLKAKSLAELGRVKEAARECKIILDTVELALPNGIYR  176

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
              + ED KL EMFH+A+E LPKLW+Q G +DEA+ +YRRAL+KPWNLD +RLA +QKDLA 
Sbjct  177   EINEDSKLLEMFHRAMELLPKLWLQAGSLDEAIAAYRRALLKPWNLDPQRLAKVQKDLAA  236

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LL+ GVE  +   +K W ST PK+++EE+ILLLF+LM K+  GE+EWD EVM+HLTFAL
Sbjct  237   TLLYGGVEAGIPSEYKPWGSTFPKSSIEESILLLFILMRKVLHGEIEWDQEVMNHLTFAL  296

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             T+ GEF SLAD+VEQ+LPG   R +RWYFLALCYS+AGQN+TA+NLL+K SG SE   +P
Sbjct  297   TISGEFVSLADHVEQVLPGRYNRVDRWYFLALCYSAAGQNQTAVNLLKKASGFSEDNSKP  356

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             H+ S LLGAKLC+QDP +S EGI+FAR  +D +++QN+H+LSQ  KFLG+CYGN A+ S 
Sbjct  357   HLASFLLGAKLCAQDPNESSEGINFARRVIDVSMDQNEHILSQGHKFLGICYGNVARTSV  416

Query  1508  SDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGS  1687
             SD ER +    SLNSL   ++   +D E   SLGLE A QRNLTPAF+ A+ YS+MTAGS
Sbjct  417   SDIERVTLHRDSLNSLNHISLAGAKDPEISLSLGLENAIQRNLTPAFERAMLYSKMTAGS  476

Query  1688  TAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMET  1867
             +A+GWKLLALI SAEQR  DAEAI+DLALDETG IDQL+ L+LKA +QIA++ P QA+ET
Sbjct  477   SARGWKLLALIASAEQRLKDAEAIIDLALDETGNIDQLELLRLKAVIQIAQEQPKQAIET  536

Query  1868  YRILLAMIQ--AQRQSGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTID  2041
             YRILLA+IQ  ++       ++ ++R LE+EAWLDLA +Y D + W D+ +CI KAK   
Sbjct  537   YRILLALIQGLSEHHDENTSKLQAERTLELEAWLDLAGLYSDHELWLDSDICIKKAKATK  596

Query  2042  IYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIAR  2221
              YSP+ WH TG LFEAQE+ KEA++AFS SLSI+PDYVPSI+STA+VL+KMG++++PIA+
Sbjct  597   FYSPRCWHATGRLFEAQEQHKEAVIAFSVSLSIEPDYVPSIISTADVLIKMGNKSLPIAK  656

Query  2222  SLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             S +MNALR+EPT H+AWF+LG + KMEG  QQAAD FQAAHELKLS PVQSF
Sbjct  657   SFIMNALRLEPTNHEAWFNLGLIYKMEGLVQQAADSFQAAHELKLSAPVQSF  708



>ref|XP_009360728.1| PREDICTED: tetratricopeptide repeat protein 7A [Pyrus x bretschneideri]
 ref|XP_009360733.1| PREDICTED: tetratricopeptide repeat protein 7A [Pyrus x bretschneideri]
Length=715

 Score =   895 bits (2312),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/721 (66%), Positives = 573/721 (79%), Gaps = 16/721 (2%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFKFEEP  +P+S   LATRDFSASGLSS RTG  DWES+FE+ QVDE EST
Sbjct  1     MLCACSGEQFKFEEPPHSPES---LATRDFSASGLSS-RTG--DWESKFEDIQVDEAEST  54

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLE+QRGNFDAALQVFQGI+IK L+PRM+KAI ERTR RKPR 
Sbjct  55    LKEALSLNYEEARALLGRLEFQRGNFDAALQVFQGIEIKNLTPRMAKAIVERTRQRKPRT  114

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMS-  784
                 +V+  VMS+HSVSLL+EAILLK+KSL  LGR  DAA+ECK ILD V+SA PNGM  
Sbjct  115   KGDNVVLPSVMSMHSVSLLIEAILLKAKSLGELGRYMDAAKECKVILDTVESALPNGMLL  174

Query  785   EGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLA  964
             + +GEDCKL +MFHKALE LP LW + G +DEA+ +YRRAL+KPWNL+ +RLA++QK LA
Sbjct  175   QDIGEDCKLPDMFHKALELLPNLWTRAGYLDEAITAYRRALIKPWNLEPERLAAIQKSLA  234

Query  965   IALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFA  1144
               LL+ GVE +L P+ +IW  T PKNN EEAILLL +LM K+   E++WD E+MDHLT+A
Sbjct  235   CTLLYGGVEANLPPQLQIWGITMPKNNTEEAILLLVILMKKVALREIKWDPEIMDHLTYA  294

Query  1145  LTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHE  1324
             ++V G +E LAD+VEQ LPG+  RAERWYFLALCYS+ G+NE ALNLL+KV+G SEA+++
Sbjct  295   VSVTGLYELLADHVEQALPGLYRRAERWYFLALCYSACGKNEVALNLLKKVAGCSEAKNK  354

Query  1325  PHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKIS  1504
             PH PS LLGAKLCSQDP  +REGI F+R A+D   +Q +H + Q  K+LGVCYG+AA+ S
Sbjct  355   PHFPSFLLGAKLCSQDPIHAREGIEFSRKAIDLVNHQCEHFMGQCHKYLGVCYGSAARAS  414

Query  1505  FSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAG  1684
              SDSER  +Q++SLNSL  AA+  KED E +FSLGLE A QRNL  AF NA++YS+M AG
Sbjct  415   LSDSERVYFQSESLNSLNLAALNWKEDPEVLFSLGLENAVQRNLDAAFSNAMKYSDMMAG  474

Query  1685  STAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAME  1864
             S+ +GWKLLAL VSAEQRF DAE IVD ALDE G++DQL+ L+LKA LQ+A++HP QA+E
Sbjct  475   SSGQGWKLLALTVSAEQRFKDAETIVDFALDEAGRVDQLELLRLKAVLQVAQEHPKQAIE  534

Query  1865  TYRILLAMIQAQR---------QSGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVC  2017
             TYR+LL ++QAQR         +   D E   +  LE  AW DLA +Y     W DA++C
Sbjct  535   TYRMLLTVVQAQRDQKAKNSEQEKPFDSEAFEESNLEKGAWRDLATVYTKLGLWTDAEIC  594

Query  2018  IDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMG  2197
             ++KAK I+ YSP SWHTTG  FEAQ + KEAL++FS SLSI+PDYV SIVSTAEVLMK+G
Sbjct  595   VNKAKLIEFYSPHSWHTTGKFFEAQSQYKEALISFSVSLSIEPDYVSSIVSTAEVLMKLG  654

Query  2198  SQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             SQ++PIARS LMNALR+EPT H+AW +LG +SK EGS QQAADFFQAAHEL+LS PV+SF
Sbjct  655   SQSLPIARSFLMNALRLEPTNHEAWLNLGLISKKEGSLQQAADFFQAAHELQLSAPVRSF  714

Query  2378  V  2380
             V
Sbjct  715   V  715



>ref|XP_008393726.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Malus domestica]
 ref|XP_008393728.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Malus domestica]
 ref|XP_008393729.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Malus domestica]
Length=714

 Score =   890 bits (2299),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/720 (65%), Positives = 568/720 (79%), Gaps = 15/720 (2%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFKFEEP  +P+S   LATRDFSAS LSS RTG  DWES+FE+ QVDE EST
Sbjct  1     MLCACSGEQFKFEEPPQSPES---LATRDFSASCLSS-RTG--DWESKFEDIQVDEAEST  54

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLE+QRGNFDAALQVFQGI+I+ L+PRM+KAI ERTR RKPR 
Sbjct  55    LKEALSLNYEEARALLGRLEFQRGNFDAALQVFQGIEIRNLTPRMAKAIVERTRQRKPRT  114

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                 +V+  VMS+HSVSLL+EAILLK+ SL  LGR  DAA+ECK ILD V+SA PNGM +
Sbjct  115   KGDTVVLPSVMSMHSVSLLIEAILLKAISLGELGRYIDAAKECKVILDTVESALPNGMLQ  174

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
              +GEDCKL +MFHKALE LP LW + G +DEA+ +YRRAL+KPWNLD +RLA++QK LA 
Sbjct  175   DIGEDCKLPDMFHKALELLPNLWTKAGYLDEAITAYRRALIKPWNLDPERLAAIQKSLAC  234

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LL+ GVE +L P  +IW  T PKNN EEAILLL +LM K+   E++WD E+MDHLT+AL
Sbjct  235   TLLYGGVEANLPPXSQIWGITMPKNNTEEAILLLVILMKKVALREIKWDPEIMDHLTYAL  294

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             +  G +E LAD+VEQ LPG+  RAERWYFLALCYS+ G+NE ALNLL+KV+G  EA+++P
Sbjct  295   SXTGLYELLADHVEQALPGLYRRAERWYFLALCYSACGKNEVALNLLKKVAGCXEAKNKP  354

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             H PS LLGAKLCSQDP  +REGI F+  A+    +Q +H + Q  K+LGVCYG AA+ S 
Sbjct  355   HFPSFLLGAKLCSQDPIHAREGIEFSHKAIXLVNHQCEHFMGQCHKYLGVCYGGAARASL  414

Query  1508  SDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGS  1687
             SDSER S+Q++SLNSL  AA+  KED E  FSLGLE A QRNL  AF NA++YS+M AGS
Sbjct  415   SDSERVSFQSESLNSLNLAALNGKEDPEVXFSLGLENAVQRNLDAAFSNAMKYSDMVAGS  474

Query  1688  TAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMET  1867
             + +GWKLLALIVSAEQ+F DAE IVD ALDE G++DQL+ L+LKA LQ+A++HP QA+ET
Sbjct  475   SGQGWKLLALIVSAEQQFKDAETIVDFALDEAGRVDQLELLRLKAVLQVAQEHPKQAIET  534

Query  1868  YRILLAMIQAQR---------QSGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCI  2020
             YR+LL ++QAQR         +   D E   +R LE EAW DLA +Y     W DA++C 
Sbjct  535   YRMLLTVVQAQRDQKAKNSEQEKPFDSEAFVERXLEKEAWRDLATVYTKLGLWTDAEICX  594

Query  2021  DKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGS  2200
             +KAK I+ YSP SWHTTG LFEAQ + KEAL++FS SLSI+PDYVPSIVSTAEVLMK+GS
Sbjct  595   NKAKLIEFYSPHSWHTTGKLFEAQSQYKEALISFSVSLSIEPDYVPSIVSTAEVLMKLGS  654

Query  2201  QAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSFV  2380
             Q++PIARS LMNALR+EPT H+AW +LG +SK EG  Q+AADFFQAAHEL+LS PV+SF+
Sbjct  655   QSLPIARSFLMNALRLEPTNHEAWLNLGLISKKEGLLQZAADFFQAAHELQLSAPVRSFL  714



>ref|XP_007225193.1| hypothetical protein PRUPE_ppa002112mg [Prunus persica]
 gb|EMJ26392.1| hypothetical protein PRUPE_ppa002112mg [Prunus persica]
Length=715

 Score =   882 bits (2279),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/720 (66%), Positives = 569/720 (79%), Gaps = 14/720 (2%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFKFEEPEP       LATRDFSASGLSS RTG  DWES+FE+ QVDE EST
Sbjct  1     MLCACSGEQFKFEEPEPPHSPES-LATRDFSASGLSS-RTG--DWESKFEDIQVDEAEST  56

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLE+QRGNFDAALQVFQGIDI++L+PRM+KAI ER R +KPR 
Sbjct  57    LKEALSLNYEEARALLGRLEFQRGNFDAALQVFQGIDIRSLTPRMAKAIVERIRQKKPRP  116

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                 ++ S VMS+HSVSLL+EAILLK++SL  LGR  +AA+ECK ILD V+SA PNGM +
Sbjct  117   KGDHVLPS-VMSMHSVSLLIEAILLKARSLGELGRFIEAAKECKVILDTVESALPNGMLD  175

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
              + EDCKLQ+MFHKALE LP LW++ G +DEA+ +YRRALVKPWNL+ KRLA +QK+LA 
Sbjct  176   DICEDCKLQDMFHKALELLPSLWIKAGYLDEAITAYRRALVKPWNLEPKRLADVQKNLAC  235

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LL+ GVE  L P+ +IW +T PKNN EEAILLL +L+ K+   E++WD E+MDHLT+AL
Sbjct  236   TLLYGGVEASLPPQLQIWGTTMPKNNTEEAILLLLILIKKVALREIKWDPEIMDHLTYAL  295

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             +V G FE LAD+VEQ LPG+  RAERWYFLALCYS+ GQNE ALNLL+KV+G SE +++P
Sbjct  296   SVTGLFELLADHVEQALPGLYRRAERWYFLALCYSACGQNEVALNLLKKVAGCSEGKNKP  355

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             H PS LLGAKLCSQDP  +REGI+F+R A+D   +Q +H + Q  KFLGVCYG+AA+ S 
Sbjct  356   HFPSFLLGAKLCSQDPNHAREGIAFSRKAIDLVNHQCEHFMGQVHKFLGVCYGSAARASV  415

Query  1508  SDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGS  1687
              DSER  +Q +SLNSL  A    KED E +FSLGLE A QRNL  AF+NA++YS M  GS
Sbjct  416   LDSERMLFQRESLNSLNYAVRNEKEDPEVMFSLGLENAVQRNLDAAFNNAMKYSNMMVGS  475

Query  1688  TAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMET  1867
             + +GWKLLAL+VSAEQRF DAE IVD ALDE G++DQL+ L+LKA LQ+A++HP QA+ET
Sbjct  476   SGQGWKLLALVVSAEQRFKDAETIVDFALDEAGRVDQLELLRLKAVLQVAQEHPKQAIET  535

Query  1868  YRILLAMIQAQR---------QSGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCI  2020
             YRILL ++QAQR         +     E   +R LE EAW DLA IY     W DA++C+
Sbjct  536   YRILLTLVQAQRDLQAKNSEQEPTFHSEEFVERNLEKEAWRDLATIYTKLGLWTDAEICV  595

Query  2021  DKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGS  2200
             +KAK I+ YS  SWHTTG LFEAQ + +EAL++FS SLSI+PDYVPSIVSTAEVLMK+GS
Sbjct  596   NKAKLIEFYSAHSWHTTGMLFEAQSQYREALISFSVSLSIEPDYVPSIVSTAEVLMKLGS  655

Query  2201  QAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSFV  2380
             Q++PIARS LMNALR+EPT H AW +LG +SK EGS QQAADFFQAAHEL+LS PVQSFV
Sbjct  656   QSLPIARSFLMNALRLEPTNHKAWLNLGLISKREGSLQQAADFFQAAHELQLSAPVQSFV  715



>ref|XP_004290971.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Fragaria 
vesca subsp. vesca]
Length=704

 Score =   881 bits (2277),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/711 (65%), Positives = 561/711 (79%), Gaps = 7/711 (1%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFKFEEP  +P+S   LATRDFSASGLSS  TG  D  S+F++ QVDE EST
Sbjct  1     MLCACSGEQFKFEEPPQSPES---LATRDFSASGLSSRTTGDWDLGSKFDDIQVDEAEST  57

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLE+QRGNFDAALQVFQGIDI+ L+PRM+KAI ER R RKPR 
Sbjct  58    LKEALSLNYEEARALLGRLEFQRGNFDAALQVFQGIDIRNLTPRMAKAIVERIRHRKPRV  117

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                  V+  VMSLHSVSLL EAILLK++SL  LGR R+AA+ECK ILD V+ A PNGM  
Sbjct  118   KGDSYVILNVMSLHSVSLLTEAILLKARSLGELGRFREAAKECKVILDTVELALPNGMPG  177

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
              +GEDCKLQEMFHKALE LP  W + G ++EA+ +YRRAL+KPWNLD +RLA +QK LA 
Sbjct  178   EIGEDCKLQEMFHKALELLPIFWTKAGYLEEAITAYRRALIKPWNLDPERLAGVQKSLAC  237

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LL+ GVE  L P+ ++W  T P+NN EEAILLL +LM K+   +++WD EVMDHL++AL
Sbjct  238   TLLYCGVEATLPPQLQVWGPTTPRNNTEEAILLLVILMKKVALKQIKWDPEVMDHLSYAL  297

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             +V G+FE LA++ EQ +PG+  RAERWY LALCYS+ GQNE ALNLL+KV+G SEA ++P
Sbjct  298   SVTGQFELLANHFEQAIPGLYGRAERWYLLALCYSACGQNEEALNLLKKVAGCSEARNKP  357

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             H  S LLGAKLCS     + EGI F+R A+D   +Q +H + QA KFLGVCY  AA+ S 
Sbjct  358   HFLSFLLGAKLCSLATAHAHEGIEFSRKAIDLVSDQCEHFMGQAHKFLGVCYSGAARASI  417

Query  1508  SDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGS  1687
             SDSER  +Q +SLNSL  AA+  KED + +FSLGLE A QRNL  AF + ++YS+M AGS
Sbjct  418   SDSERTVFQRESLNSLNHAALNWKEDPDVMFSLGLENAVQRNLDAAFSHTMKYSDMVAGS  477

Query  1688  TAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMET  1867
             + KGWKLLAL+VSAEQRF+DAEAIVD ALDE+G+ DQL+ L+LKA LQ+A++HP QA+ET
Sbjct  478   SVKGWKLLALVVSAEQRFNDAEAIVDFALDESGRRDQLELLRLKAVLQVAQEHPKQAIET  537

Query  1868  YRILLAMIQAQRQSGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIY  2047
             YR+LLA +QAQR S  ++       LE EAW DLA IY   + WPDA++CI+KAK I+ Y
Sbjct  538   YRMLLASVQAQRNSKANNL----ENLEKEAWRDLAGIYTKLNLWPDAEICINKAKLIEFY  593

Query  2048  SPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSL  2227
             SPQSWHTTG LFE Q + KEAL++FS SLSI+PDYVPSIVSTAEVLMK+G+ ++PIARS 
Sbjct  594   SPQSWHTTGVLFEGQSKLKEALISFSVSLSIEPDYVPSIVSTAEVLMKLGTGSLPIARSF  653

Query  2228  LMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSFV  2380
             LMNALR+EPT H+AW +LG+LSKMEGS QQAA+FFQAA EL+LS PVQSFV
Sbjct  654   LMNALRLEPTNHEAWLNLGQLSKMEGSLQQAAEFFQAACELQLSAPVQSFV  704



>ref|XP_008220334.1| PREDICTED: tetratricopeptide repeat protein 7A [Prunus mume]
Length=715

 Score =   876 bits (2264),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/720 (65%), Positives = 570/720 (79%), Gaps = 14/720 (2%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFKFEEPEP       LATRDFSASGLSS RTG  DWES+FE+ QVDE EST
Sbjct  1     MLCACSGEQFKFEEPEPPHSPES-LATRDFSASGLSS-RTG--DWESKFEDIQVDEAEST  56

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLE+QRGNFDAALQVFQGIDI++L+PRM+KAI ER R +KPR 
Sbjct  57    LKEALSLNYEEARALLGRLEFQRGNFDAALQVFQGIDIRSLTPRMAKAIVERIRQKKPRP  116

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
               G ++ S VMS+HSVSLL+EAILLK++SL  LGR  +AA+ECK ILD V+SA PNGM +
Sbjct  117   KGGHVLPS-VMSMHSVSLLIEAILLKARSLGELGRFIEAAKECKVILDTVESALPNGMLD  175

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
              + EDCKLQ+MFHKALE LP LW + G +DEA+ +YRRALVKPWNL+ KRLA +QK+LA 
Sbjct  176   DICEDCKLQDMFHKALELLPSLWTKAGYLDEAITAYRRALVKPWNLEPKRLADVQKNLAC  235

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LL+ GVE  L P+ +IW +T PKNN EEA+LLL +LM K+   E++WD E+MDHLT+AL
Sbjct  236   TLLYGGVEASLPPQLQIWGTTMPKNNTEEALLLLLILMKKVALREIKWDPEIMDHLTYAL  295

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             +V G FE LAD+VEQ LPG+  RAERWYFLALCYS+ GQNE ALNLL+KV+G SEA+++P
Sbjct  296   SVTGLFELLADHVEQALPGLYRRAERWYFLALCYSACGQNEVALNLLKKVAGCSEAKNKP  355

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             H PS LLGAKLCSQDP  +REGI+F+R A+D    Q +H + Q  KFLGVCYG AA+ S 
Sbjct  356   HFPSFLLGAKLCSQDPIHAREGIAFSRKAIDLVNYQCEHFMGQVHKFLGVCYGGAARASV  415

Query  1508  SDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGS  1687
              DSER  +Q +SLNSL  A    +E+ E +FSLGLE A QRNL  AF+NA++YS+M AGS
Sbjct  416   LDSERMFFQKESLNSLNHAVRNKEENPEVMFSLGLENAVQRNLDAAFNNAMKYSDMMAGS  475

Query  1688  TAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMET  1867
             + +GWKLLAL+VSAEQRF DAE +VD ALDE G++DQL+ L+LKA LQ+A+++P QA+ET
Sbjct  476   SGQGWKLLALVVSAEQRFKDAETVVDFALDEAGRVDQLELLRLKAVLQVAQENPKQAIET  535

Query  1868  YRILLAMIQAQR---------QSGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCI  2020
             YRILL ++QAQR         +     E   +  LE EAW DLA IY     W DA++C+
Sbjct  536   YRILLTLVQAQRDLQAKNSEQEPPFHSEAFVESNLEKEAWRDLATIYTKLGLWTDAEICV  595

Query  2021  DKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGS  2200
             +KAK I+ YS  SWHTTG LFEAQ + +EAL++FS SLSI+PDYVPSIVSTAEVLMK+GS
Sbjct  596   NKAKLIEFYSAHSWHTTGMLFEAQSQYREALISFSVSLSIEPDYVPSIVSTAEVLMKLGS  655

Query  2201  QAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSFV  2380
             Q++PIARS LMNALR+EPT H+AW +LG +SK EGS QQAADFFQAAH+L+LS PV+SFV
Sbjct  656   QSLPIARSFLMNALRLEPTNHEAWLNLGLISKREGSLQQAADFFQAAHDLQLSAPVKSFV  715



>ref|XP_010272759.1| PREDICTED: uncharacterized protein LOC104608456 [Nelumbo nucifera]
 ref|XP_010272764.1| PREDICTED: uncharacterized protein LOC104608456 [Nelumbo nucifera]
 ref|XP_010272772.1| PREDICTED: uncharacterized protein LOC104608456 [Nelumbo nucifera]
Length=712

 Score =   876 bits (2263),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/716 (65%), Positives = 566/716 (79%), Gaps = 11/716 (2%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFKFEE   +P+S   LATRDFS SGLSS RTG  DW+SRFE++QVD+VEST
Sbjct  1     MLCACSGEQFKFEEVPLSPES---LATRDFSVSGLSS-RTG-CDWDSRFEDSQVDDVEST  55

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLEYQRGN DAALQVFQGIDI+ L+PRM K+I  RTR RK R 
Sbjct  56    LKEALSLNYEEARALLGRLEYQRGNLDAALQVFQGIDIRGLTPRMIKSIIHRTRQRKGRP  115

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                 + + G+MS+HSVSLLLEAILLK+KSL  LGR+++AARECK ILD V+SA PNGM E
Sbjct  116   KGDNMQM-GIMSMHSVSLLLEAILLKAKSLEELGRVKEAARECKIILDTVESALPNGMPE  174

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G+ EDCKLQEM HKALE LP+LW Q G +DEA+ +YRRAL KPWNLD +RLAS+QK+LA 
Sbjct  175   GITEDCKLQEMLHKALELLPELWKQAGFLDEAIAAYRRALTKPWNLDLQRLASVQKELAS  234

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LL+ GVEV+L P+ +IW    PK++ EEAILLLF+LM K+  GE+ WD EV+DHL FAL
Sbjct  235   LLLYGGVEVNLPPQLQIWGPNTPKSSTEEAILLLFILMKKMAFGEIRWDPEVVDHLAFAL  294

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             +V G+F+ L+D++E+ LPG+  RAERWY L LCYS++GQNE ALNLL+KVSG SEA+HEP
Sbjct  295   SVSGQFKFLSDHIEEALPGVYNRAERWYLLVLCYSASGQNEVALNLLKKVSGRSEAKHEP  354

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             H+P+LLLGAKLCSQ+   + +GI FAR A+D   N NKH + QA  FLG+CYGNAA+ S 
Sbjct  355   HLPALLLGAKLCSQNLGHAHDGIDFARRAIDFANNHNKHFMGQAHHFLGLCYGNAARFSL  414

Query  1508  SDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGS  1687
             SD+ER   Q+ SL  L  AA+L ++D E +FSL LE + QRNL  A  NA  Y +M  GS
Sbjct  415   SDAERVFLQSDSLKYLNTAALLEEKDPEVIFSLSLENSFQRNLNAALQNARIYLDMVGGS  474

Query  1688  TAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMET  1867
             + +GWKLLALI+S EQRF DAE IVD++LDE G  DQL+ L+LKA LQIA++ PN+A+ET
Sbjct  475   SGRGWKLLALIISQEQRFKDAETIVDISLDEVGGRDQLELLRLKAVLQIAQEQPNKAIET  534

Query  1868  YRILLAMIQAQRQ---SGMDHEVL--SDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAK  2032
             +RILLA+IQAQ++      D E +  +D K+E+EAW DLA IY    SWPDA++C+DKAK
Sbjct  535   FRILLALIQAQKERHSKNSDPETMAEADIKIEIEAWQDLAEIYTKFGSWPDAEICLDKAK  594

Query  2033  TIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVP  2212
             +I I+SP+SWH TG LFEAQ   KEALVAFS SLSI PD+VPS+VSTA +L K+G Q +P
Sbjct  595   SIGIFSPRSWHATGILFEAQSLYKEALVAFSISLSIHPDHVPSMVSTATILRKLGRQCLP  654

Query  2213  IARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSFV  2380
             IARS LMNALR+EPT H+AW +LG +SKMEGS QQAADFFQAAHE+K S PVQ F+
Sbjct  655   IARSYLMNALRLEPTNHEAWLNLGFVSKMEGSLQQAADFFQAAHEIKQSAPVQDFL  710



>ref|XP_003523621.1| PREDICTED: tetratricopeptide repeat protein 7A-like isoform X1 
[Glycine max]
 ref|XP_006578052.1| PREDICTED: tetratricopeptide repeat protein 7A-like isoform X2 
[Glycine max]
 ref|XP_006578053.1| PREDICTED: tetratricopeptide repeat protein 7A-like isoform X3 
[Glycine max]
Length=715

 Score =   874 bits (2259),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/722 (65%), Positives = 574/722 (80%), Gaps = 20/722 (3%)
 Frame = +2

Query  248   MLCACS-GEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVES  424
             MLCACS GEQF FEEP  +P+S   LATRDFSASGLSS RTG  +WE +F+E QV+E ES
Sbjct  1     MLCACSSGEQFIFEEPPHSPES---LATRDFSASGLSS-RTG--EWEPKFDETQVEEAES  54

Query  425   TLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkpr  604
              LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIK L+PRM KAI ERT+ RKPR
Sbjct  55    ILKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKGLAPRMIKAIAERTKQRKPR  114

Query  605   ggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMS  784
                  I+V  VMSLHSVSLLLEAILLK++SL  LG+  +AA+EC+ ILD V+SA PNGM 
Sbjct  115   SKAD-IMVPNVMSLHSVSLLLEAILLKARSLEELGQCIEAAKECRIILDTVESALPNGMP  173

Query  785   EGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLA  964
             EG+GEDCKLQEMFH ALE  P LW++ G +DEAV +Y RALVKPWNL+ +RLA++QKDLA
Sbjct  174   EGIGEDCKLQEMFHIALELFPSLWIKAGFLDEAVTAYHRALVKPWNLEPRRLAAVQKDLA  233

Query  965   IALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFA  1144
             + LL+ GVEV L  + ++W  T PK+++EEAIL+L +LM K+   E++WD+E+MDHLTFA
Sbjct  234   MILLYGGVEVSLPSQLQVWSKTAPKSSVEEAILMLLILMSKVAIREIDWDAEIMDHLTFA  293

Query  1145  LTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHE  1324
             L+V G FE LAD+VEQILP + +RAERWYFLALCYS+AG +E ALNLLRK  GSSEA H 
Sbjct  294   LSVTGMFELLADHVEQILPVIYSRAERWYFLALCYSAAGHDEVALNLLRKACGSSEANHR  353

Query  1325  PHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKIS  1504
             PH PS L GAKLCS DP  + EGI+F+R  +D   +QN+H LSQ  KFLG+CYG AA+IS
Sbjct  354   PHFPSFLFGAKLCSLDPHHAHEGINFSREVIDLAKHQNEHFLSQGHKFLGICYGAAARIS  413

Query  1505  FSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAG  1684
               DSER+ +Q +SL+SL  AA+   +D E +FSLGLE A QRNL  A++N +  S+MT G
Sbjct  414   VLDSERSIFQRESLDSLNYAAVSENDDLEVIFSLGLENAIQRNLDAAYNNIMMSSDMTVG  473

Query  1685  STAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAME  1864
             S+ +GW+LLALIVSA+QRF DAE IVD ALDE+G +DQL+ L+LKA LQIA++ P QA+E
Sbjct  474   SS-RGWQLLALIVSAQQRFKDAETIVDCALDESGGMDQLELLRLKAVLQIAQRQPKQAIE  532

Query  1865  TYRILLAMIQAQRQ-----SGMD------HEVLSDRKLEVEAWLDLARIYIDQDSWPDAQ  2011
             TYRILLA+IQA+++     + +D      HE L++RKLE+EAW DLA IY D DS  DA+
Sbjct  533   TYRILLALIQAKKELLIQDNNIDQGQTFRHEALTERKLEMEAWQDLATIYTDVDSLLDAK  592

Query  2012  VCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMK  2191
              C+DKA+ I+ +SP+SWH TG L EAQ   KEA V+FS SLSI+PDY+PSI+STAE+LMK
Sbjct  593   TCVDKAQLIEFFSPRSWHITGMLLEAQSLYKEAFVSFSVSLSIEPDYIPSIISTAELLMK  652

Query  2192  MGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQ  2371
             +G Q++PIARS LMNALR+EPT HDAWF+LG +SKMEGS QQAA+FFQAA+ELKLS PVQ
Sbjct  653   LGMQSLPIARSFLMNALRLEPTNHDAWFNLGLVSKMEGSLQQAAEFFQAAYELKLSAPVQ  712

Query  2372  SF  2377
              F
Sbjct  713   EF  714



>gb|KHN04439.1| Tetratricopeptide repeat protein 7B [Glycine soja]
Length=715

 Score =   874 bits (2257),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/722 (65%), Positives = 571/722 (79%), Gaps = 20/722 (3%)
 Frame = +2

Query  248   MLCACS-GEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVES  424
             MLCACS GEQF FEEP  +P+S   LATRDFSASGLSS RTG  +WE +F+E QV+E ES
Sbjct  1     MLCACSSGEQFIFEEPPHSPES---LATRDFSASGLSS-RTG--EWEPKFDETQVEEAES  54

Query  425   TLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkpr  604
              LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIK L+PRM KAI ERT+ RKPR
Sbjct  55    ILKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKGLAPRMIKAIAERTKQRKPR  114

Query  605   ggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMS  784
                  I+V  VMSL SVSLLLEAILLK++SL  LG+  +AA+EC+ ILD V+SA PNGM 
Sbjct  115   SKAD-IMVPNVMSLRSVSLLLEAILLKARSLEELGQCIEAAKECRIILDTVESALPNGMP  173

Query  785   EGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLA  964
             EG+GEDCKLQEMFHKALE  P LW++ G +DEAV +YRRALVKPWNL+ +RLA++QKDLA
Sbjct  174   EGIGEDCKLQEMFHKALELFPSLWIKAGFLDEAVTAYRRALVKPWNLEPRRLAAVQKDLA  233

Query  965   IALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFA  1144
             + LL+ GVEV L  +  +W  T PK+++EEAIL+L +LM K+   E++WD+E+MDHLTFA
Sbjct  234   MILLYGGVEVSLPSQLLVWSKTSPKSSVEEAILMLLILMSKVAIREIDWDAEIMDHLTFA  293

Query  1145  LTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHE  1324
             L+V G FE LAD+VEQILP + +RAERWYFLALCYS+AG +E ALNLLRK  GSSEA H 
Sbjct  294   LSVTGMFELLADHVEQILPVIYSRAERWYFLALCYSAAGHDEVALNLLRKACGSSEANHR  353

Query  1325  PHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKIS  1504
             PH PS L GAKLCS DP  + EGI+F+R  +D   +QN+H LSQ  KFLG+CYG AA+IS
Sbjct  354   PHFPSFLFGAKLCSLDPHHAHEGINFSREVIDLAKHQNEHFLSQGHKFLGICYGAAARIS  413

Query  1505  FSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAG  1684
               DSER+ +Q +SL+SL  AA+   +D E +FSLGLE A QRNL  A++N +  S+MT G
Sbjct  414   VLDSERSIFQRESLDSLNYAAVSENDDLEVIFSLGLENAIQRNLDAAYNNIMMSSDMTVG  473

Query  1685  STAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAME  1864
             S+ +GW+LLALIVSA+QRF DAE IVD ALDE+G +DQL+ L+LKA LQIA++ P QA+E
Sbjct  474   SS-RGWQLLALIVSAQQRFKDAETIVDCALDESGGMDQLELLRLKAVLQIAQRQPKQAIE  532

Query  1865  TYRILLAMIQAQRQ-----------SGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQ  2011
             TY+ILLA+IQA+++               HE L++RKLE+EAW DLA IY D DS  DA+
Sbjct  533   TYKILLALIQAKKELLIQDNNIDQGQTFSHEALTERKLEMEAWQDLATIYTDVDSLLDAK  592

Query  2012  VCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMK  2191
              C+DKA+ I+ +SP+SWH TG L EAQ   KEA V+FS SLSI+PDY+PSI+STAE+LMK
Sbjct  593   TCVDKAQLIEFFSPRSWHITGMLLEAQSLYKEAFVSFSVSLSIEPDYIPSIISTAELLMK  652

Query  2192  MGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQ  2371
             +G Q++PIARS LMNALR+EPT HDAWF+LG +SKMEGS QQAA+FFQAA+ELKLS PVQ
Sbjct  653   LGMQSLPIARSFLMNALRLEPTNHDAWFNLGLVSKMEGSLQQAAEFFQAAYELKLSAPVQ  712

Query  2372  SF  2377
              F
Sbjct  713   EF  714



>ref|XP_007018491.1| No pollen germination related 1 [Theobroma cacao]
 gb|EOY15716.1| No pollen germination related 1 [Theobroma cacao]
Length=713

 Score =   869 bits (2246),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/720 (65%), Positives = 568/720 (79%), Gaps = 16/720 (2%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFKFE+   +P+S   LATRDFSASGLSS RTG  DWES+ E+ QVDEVEST
Sbjct  1     MLCACSGEQFKFEDAPQSPES---LATRDFSASGLSS-RTG--DWESKLEDVQVDEVEST  54

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGID+K L+PRM++AI ERTR RKPR 
Sbjct  55    LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDVKGLTPRMTRAIVERTRQRKPRS  114

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                 I+   VMS+HSVSLLLEAILLK+KSL  LG  R+AA+ECK ILD+V++A PNGM E
Sbjct  115   KGD-IIPPSVMSMHSVSLLLEAILLKAKSLEELGHFREAAKECKIILDVVEAALPNGMRE  173

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G+GEDCKLQEMFHKALE LP LW++ GL+DEAV +YRRALVKPWNLD +RLAS+QKDLA 
Sbjct  174   GIGEDCKLQEMFHKALELLPNLWIKAGLLDEAVTAYRRALVKPWNLDPQRLASVQKDLAA  233

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LL+ GVE  L P  ++W ST P  N EEAILLL VL+ K+  GE++WD+ ++DHLTFAL
Sbjct  234   TLLYGGVETKLPPHLQVWGSTTPNGNTEEAILLLLVLVQKVAFGEIKWDAAIIDHLTFAL  293

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             +V G+FE LA  +EQ LPG+  RAERWY LAL Y++AGQ+E ALNLL+KV+G SEA+H+P
Sbjct  294   SVSGQFELLAGYLEQALPGIYERAERWYLLALSYAAAGQDEVALNLLKKVAGQSEAKHKP  353

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             H+P+LL GAKL SQDP  +  GI+FAR  +D     N+H   QA KFLGVCYGNAA+IS 
Sbjct  354   HVPALLFGAKLSSQDPKHAHYGITFARNVIDLADQVNEHFKGQAHKFLGVCYGNAARISI  413

Query  1508  SDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGS  1687
             SDSER   Q +SL SL  AA+  KED E +F+L LE A QRNL  AFDNA+ YS M   +
Sbjct  414   SDSERALLQKESLTSLNTAALNIKEDPEVLFNLSLENAVQRNLDVAFDNAMMYSNMVTEN  473

Query  1688  TAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMET  1867
             + +GW+LLALI+S ++RF DAE I+D ALDE G++DQL+ L+LKA LQIA + P QA+ET
Sbjct  474   SGRGWRLLALILSGDKRFKDAETILDFALDEAGRLDQLELLRLKAVLQIAEERPKQAIET  533

Query  1868  YRILLAMIQAQRQ---------SGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCI  2020
             YRILL++IQAQR+            D E  +++ +E+ AW DLA IY    SW DA++C+
Sbjct  534   YRILLSLIQAQREPHSNSTVHAKSSDSESEAEKNMEMAAWQDLAIIYTKFGSWADAEICL  593

Query  2021  DKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGS  2200
             +KAK+I+ +SP+SWHTTG LFEAQ   +EALV+FS SLS++PDYVPSIVSTA VL+ +GS
Sbjct  594   NKAKSIEFFSPKSWHTTGLLFEAQSLYREALVSFSVSLSMEPDYVPSIVSTAAVLINLGS  653

Query  2201  QAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSFV  2380
             Q++PIARS LMNALR++PT HDAW +LG ++KMEGS QQAADFFQAA+ELKLS PV++F 
Sbjct  654   QSLPIARSFLMNALRLDPTNHDAWMNLGLIAKMEGSLQQAADFFQAAYELKLSAPVEAFT  713



>gb|KHG05379.1| Tetratricopeptide repeat 7B [Gossypium arboreum]
Length=716

 Score =   869 bits (2245),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/722 (64%), Positives = 564/722 (78%), Gaps = 19/722 (3%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFKFE+   +P+S   LATRDFSASGLSS RTG  DWES+ ++ QVDE EST
Sbjct  1     MLCACSGEQFKFEDAPQSPES---LATRDFSASGLSS-RTG--DWESKLDDVQVDEAEST  54

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIK L P M++AI ERTR RK R 
Sbjct  55    LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKGLKPSMTRAIVERTRQRKLRS  114

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                 I+   VMSLHSVSLLLEAILLK+KSL  LG  RDAA+EC  ILD+V++AFPNGM E
Sbjct  115   KGD-IIPPSVMSLHSVSLLLEAILLKAKSLDELGHFRDAAKECNIILDVVEAAFPNGMHE  173

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G+ EDCKLQEMFHKALE LP+LW + G + EA+  YRR LVKPWNLD  R+AS+QKDLA 
Sbjct  174   GIAEDCKLQEMFHKALELLPRLWKKAGFLGEAITVYRRVLVKPWNLDPLRVASLQKDLAA  233

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LL+ GVE  L P  ++W S  P  NMEEAILLL VLM K+  GE++WDS++MDHLTFAL
Sbjct  234   NLLYGGVETSLPPHLQVWGSATPNGNMEEAILLLLVLMQKVAYGEIKWDSDIMDHLTFAL  293

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             TV G+FE L   VEQ LPG+  RA RWY LALCY++AGQNE ALNLL+KVSG SEA+H+P
Sbjct  294   TVTGQFELLGSYVEQALPGIYERANRWYLLALCYAAAGQNEVALNLLKKVSGQSEAKHKP  353

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQ--NKHLLSQARKFLGVCYGNAAKI  1501
             HIP+L+ GAKL SQDP  +  GI+FA   +DS  +   N+H  SQA KFLGVCYGNAA+I
Sbjct  354   HIPALIFGAKLSSQDPKHAHYGITFACNVIDSAADDQVNEHFKSQAHKFLGVCYGNAARI  413

Query  1502  SFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTA  1681
             S SD+ER+ +Q +SL SL  AA+  KED E +F+L LE A QRNL  AF+NA+ YS M  
Sbjct  414   SISDAERSVFQKESLASLNSAALNMKEDPELIFNLSLENAVQRNLDVAFENAMVYSNMVT  473

Query  1682  GSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAM  1861
               + +GW+LLALI+SA++RF DAE I+++ALDE G +DQL+ L+L+A LQIA + P QA+
Sbjct  474   EDSGRGWRLLALILSADRRFKDAETILEVALDEAGSLDQLELLRLRAVLQIAEERPKQAI  533

Query  1862  ETYRILLAMIQAQRQS---------GMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQV  2014
             ETYRILL++I+ QR+S           D E +++R LE+ AW DLA IY    SW DA++
Sbjct  534   ETYRILLSLIKTQRESRSNNFESAKSSDSEGVTERVLELAAWQDLATIYTKFGSWLDAEI  593

Query  2015  CIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKM  2194
             C++KAK+I++YSP+SWHT+G LFEAQ   KEALV+FS +LSI+PDYVPSIVSTA VL+ +
Sbjct  594   CVNKAKSIELYSPKSWHTSGLLFEAQSLHKEALVSFSIALSIEPDYVPSIVSTAAVLLHL  653

Query  2195  GSQ-AVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQ  2371
             GSQ ++PIARS LMNALR++PT H+AW +LG ++K+EGS QQAADFFQAA+ELK+S PV+
Sbjct  654   GSQSSLPIARSFLMNALRLDPTNHEAWMNLGLIAKLEGSLQQAADFFQAAYELKMSAPVE  713

Query  2372  SF  2377
             +F
Sbjct  714   AF  715



>gb|KDP41618.1| hypothetical protein JCGZ_16025 [Jatropha curcas]
Length=714

 Score =   866 bits (2238),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/719 (64%), Positives = 564/719 (78%), Gaps = 15/719 (2%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFKFEEP  +P+S   LATRDFSASGLSS  TG  DW+S+ E+ QVDE EST
Sbjct  1     MLCACSGEQFKFEEPPQSPES---LATRDFSASGLSSRTTG--DWDSKLEDIQVDEAEST  55

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLEYQRGNF+AALQVFQGID ++L+P+M KAI ERTR RKPR 
Sbjct  56    LKEALSLNYEEARALLGRLEYQRGNFEAALQVFQGIDSRSLTPKMIKAIAERTRQRKPRA  115

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                 I    +MS+HSVSLLLEAILLK+KSL  LG  R+AA EC  ILDIV+SA PNGM E
Sbjct  116   KGD-ITPPSIMSMHSVSLLLEAILLKAKSLEELGHYREAATECTIILDIVESALPNGMPE  174

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G+GEDCKL+EMFHKALE LP LW++ GL+DEA+ +YRRAL+KPWNL   RLA +QKDLA 
Sbjct  175   GIGEDCKLEEMFHKALELLPILWIKAGLLDEAITAYRRALIKPWNLGPHRLARVQKDLAS  234

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LLF  VE  L    + W    P ++ EEAILLL VLM K+  GE++WD E+M HLT+AL
Sbjct  235   ILLFGAVEAKLPSHLQAWGPWSPSSSTEEAILLLLVLMNKVAYGEIQWDEEIMSHLTYAL  294

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             +++G++E LA++VEQ LPG+  RAERWYFLALCY++AGQNE ALNLL+KVSG SE++H+P
Sbjct  295   SIIGQYELLAEHVEQTLPGVYNRAERWYFLALCYNAAGQNEAALNLLKKVSGFSESKHKP  354

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             HIPS LLGAKLCS+DP  ++EGI+FAR  ++   N N+H + +A KFLGVCYGNAA+I  
Sbjct  355   HIPSYLLGAKLCSEDPKHAQEGINFARKLINLENNPNQHFMVEAHKFLGVCYGNAARICL  414

Query  1508  SDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGS  1687
             SDSER + Q +SL+SL  AA+  +ED E ++SL LE   QRNL  AFDNA+ Y+E  AG+
Sbjct  415   SDSERINLQKESLDSLNHAAVNRQEDPEVMYSLALENTLQRNLDAAFDNAILYTETMAGN  474

Query  1688  TAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMET  1867
             + KGWKLLALIVSA+ RF DAE +V+ ALDE G++DQ + L+LKA LQIA++ P +A+ET
Sbjct  475   SVKGWKLLALIVSAQHRFKDAEIVVEFALDEAGRMDQFELLRLKAVLQIAQEQPKEAIET  534

Query  1868  YRILLAMIQAQRQ---SGMDH------EVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCI  2020
             YRILL++IQAQR       DH      E L++RKLE+  W DLA IY    SW +A++C+
Sbjct  535   YRILLSLIQAQRDLNAKNPDHGHMFESEALAERKLELTVWQDLAAIYTKLGSWSNAKICV  594

Query  2021  DKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGS  2200
             +KAK +D + P+SWHTTG  FEAQ   KEALV+FS +LSI+PDYVPSIVSTA VLMK+GS
Sbjct  595   EKAKLMDFHCPRSWHTTGLYFEAQSLYKEALVSFSVALSIEPDYVPSIVSTAGVLMKLGS  654

Query  2201  QAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             Q+ PIARS LMNALR++PT H+AW +LG +SKMEG+ QQAADFFQAA+EL+LS PVQS 
Sbjct  655   QSFPIARSFLMNALRLDPTNHEAWMNLGLISKMEGALQQAADFFQAAYELRLSAPVQSL  713



>ref|XP_002320688.1| NO POLLEN GERMINATION RELATED 1 family protein [Populus trichocarpa]
 gb|EEE99003.1| NO POLLEN GERMINATION RELATED 1 family protein [Populus trichocarpa]
Length=714

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/720 (63%), Positives = 570/720 (79%), Gaps = 15/720 (2%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFK +EP  +P+S   LATRDFSASGLSS  TG  D ES+ E+ QVDE EST
Sbjct  1     MLCACSGEQFKLDEPPQSPES---LATRDFSASGLSSRTTG--DRESKLEDFQVDEAEST  55

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDI  L+P+M KAI ER + RKPR 
Sbjct  56    LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDISVLTPKMIKAIVERIQYRKPRS  115

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                 IV   VMS+HSVSLL+EAILLK+KSL  L + R+AA+EC  ILDIV+SA PNG+ E
Sbjct  116   KGE-IVPPSVMSMHSVSLLVEAILLKAKSLEELAQYREAAKECGIILDIVESALPNGIPE  174

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G+GEDCKL+EMFHKALE LP LW + GL+D+A+ SYRR L++PWNL+ ++LA +QK+LA 
Sbjct  175   GIGEDCKLEEMFHKALELLPALWTKAGLLDQAIASYRRVLIRPWNLNPQKLAGVQKELAS  234

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LL++ VE  L P+ ++W    P++N+EEAILLL VLM K+  GE++ D E+MDHLT+AL
Sbjct  235   MLLYSAVEATLPPQLQLWGLASPQSNIEEAILLLLVLMSKVACGEIKRDEEIMDHLTYAL  294

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             ++VG+FE LA++VEQ LPG+  RAERWY LALCYS+AGQNE ALNLL+KVSG SE++++P
Sbjct  295   SIVGQFELLAEHVEQALPGIYNRAERWYLLALCYSAAGQNEAALNLLKKVSGCSESKNKP  354

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             HIPS LLGAKLCSQD   + EGI+FAR  +D   +QN+H + QA   LGVC+GNAA+IS 
Sbjct  355   HIPSFLLGAKLCSQDSKHAHEGINFARKVLDLADHQNQHFIGQAHMLLGVCHGNAARISL  414

Query  1508  SDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGS  1687
             SDSER     +SLNSL  AA+  KED E +++LGLE   QRNL  AF+NA+  +EM AG+
Sbjct  415   SDSERVLLHKESLNSLNNAALNRKEDPEVMYNLGLENMLQRNLGAAFENAIVCTEMMAGN  474

Query  1688  TAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMET  1867
             + KGWKLLAL+VSAEQRF DA+ +V++ALDE G+IDQ + L+LKA LQIA++ P QA+ET
Sbjct  475   SVKGWKLLALVVSAEQRFRDAQTVVEIALDEAGRIDQFELLRLKAILQIAQEQPKQAIET  534

Query  1868  YRILLAMIQAQRQSG---------MDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCI  2020
             YRILL++IQAQR S           + EVL++R LE+ AW DLA IY    SW DA++C+
Sbjct  535   YRILLSLIQAQRDSQAKNPEQAHIFNSEVLAERNLELAAWQDLADIYTKIGSWSDAKICV  594

Query  2021  DKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGS  2200
             DKAK ++++SP+SWH TG LFEAQ   KEALV+FS +LS++PDY+PSIV+TAEVLMK G+
Sbjct  595   DKAKLMELHSPRSWHVTGMLFEAQSLHKEALVSFSVALSVEPDYIPSIVATAEVLMKPGT  654

Query  2201  QAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSFV  2380
             Q+  IARS LM+ALR++PT H+AW +LG +SKMEGS +QAA+FFQAAHELKLS P+QSF+
Sbjct  655   QSFSIARSFLMHALRLDPTNHEAWLNLGLISKMEGSLKQAAEFFQAAHELKLSAPIQSFL  714



>ref|XP_007136761.1| hypothetical protein PHAVU_009G071800g [Phaseolus vulgaris]
 gb|ESW08755.1| hypothetical protein PHAVU_009G071800g [Phaseolus vulgaris]
Length=715

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/721 (64%), Positives = 568/721 (79%), Gaps = 18/721 (2%)
 Frame = +2

Query  248   MLCACS-GEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVES  424
             MLCACS GEQFKFEEP  +P S   LATRDFSASGLSS  TG  +WE +F+EAQV++ ES
Sbjct  1     MLCACSSGEQFKFEEPPQSPDS---LATRDFSASGLSSRTTG--EWEPKFDEAQVEQAES  55

Query  425   TLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkpr  604
             TLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIK L+ RM KAI ERT+ RKPR
Sbjct  56    TLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKGLTLRMIKAIAERTKQRKPR  115

Query  605   ggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMS  784
                  IVVS VMSLHSVSLLLEAILLK++SL  LG   +AA+EC+ ILD V+SA PNG+ 
Sbjct  116   SKAD-IVVSNVMSLHSVSLLLEAILLKARSLEELGECIEAAKECRIILDTVESALPNGIP  174

Query  785   EGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLA  964
             EG+GEDCKL+EMFHKALE LP+LW++ G +DEAV +YRRALVKPW+L+ +RLA++QKDLA
Sbjct  175   EGIGEDCKLKEMFHKALELLPRLWIKAGFLDEAVAAYRRALVKPWSLEPQRLAAVQKDLA  234

Query  965   IALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFA  1144
               LL+ GVEV LS + ++W  T P N++EEAI LL +LM K+  GE++WD+E+MDHLTFA
Sbjct  235   TTLLYGGVEVSLSSQLQVWGETTPTNSVEEAIHLLVILMSKVAIGEIDWDAEIMDHLTFA  294

Query  1145  LTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHE  1324
             L+V G FE LAD+VEQILPG+ +RAERWYFLALC+S+AG +E ALNLLRK  GSSEA H+
Sbjct  295   LSVTGMFELLADHVEQILPGIYSRAERWYFLALCFSAAGHDEVALNLLRKACGSSEANHK  354

Query  1325  PHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKIS  1504
             PH PS LLGAKLCS D   + EGI+F+R  ++   +QN+H L Q   FLG+CYG AA+IS
Sbjct  355   PHFPSFLLGAKLCSLDSRHAHEGINFSRKVIELAKHQNEHFLGQGHTFLGICYGAAARIS  414

Query  1505  FSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAG  1684
               DSER+ ++ +SL+SL  AA+   +D E +FSLGLE A QRNL  A++N + +S+MT G
Sbjct  415   VLDSERSIFERESLDSLNCAAVNGNDDLEAIFSLGLENAIQRNLDAAYNNIMMFSDMTVG  474

Query  1685  STAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAME  1864
             S+ +GW+LLALIVS + RF DAE IVD ALDE G +DQL  L+LKA LQIA+Q P QA+E
Sbjct  475   SS-RGWQLLALIVSGQHRFKDAETIVDFALDEAGGMDQLDLLRLKAILQIAQQQPRQAIE  533

Query  1865  TYRILLAMIQAQ----------RQSGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQV  2014
             TYRILLA+IQA+          R+     E L++RKLE+EAW DLA IY D  S  DA+ 
Sbjct  534   TYRILLALIQAKKELWLQDNINREQACRQEALTERKLEMEAWQDLATIYTDIGSLIDAKT  593

Query  2015  CIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKM  2194
             C+DKA+ I+ +SP+SWH TG + EAQ   +EA ++FS SLS++PDYVPSI+STAE+L K+
Sbjct  594   CVDKAQLIEFFSPRSWHITGLMLEAQSLYREAFISFSISLSVEPDYVPSIISTAELLTKL  653

Query  2195  GSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQS  2374
             G Q++PIARS LMNALR+EPT HDAWF+LG +SKMEGS QQAA+FFQAA+ELKLS PVQ 
Sbjct  654   GMQSLPIARSFLMNALRLEPTNHDAWFNLGLVSKMEGSLQQAAEFFQAAYELKLSAPVQK  713

Query  2375  F  2377
             F
Sbjct  714   F  714



>emb|CAN72853.1| hypothetical protein VITISV_013944 [Vitis vinifera]
Length=814

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/715 (65%), Positives = 560/715 (78%), Gaps = 27/715 (4%)
 Frame = +2

Query  245   KMLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVES  424
             KMLCACSGEQFKFE+   +P+S   LATRDFSASGLSS RTG  DWES+FE+ QVDE ES
Sbjct  124   KMLCACSGEQFKFEDAPRSPES---LATRDFSASGLSS-RTG--DWESKFEDTQVDEAES  177

Query  425   TLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkpr  604
             TL++ALSLNYEEARALLGRLEYQRGNFDAA QVF GIDI+ L+PRM++AI ERT  RKPR
Sbjct  178   TLRDALSLNYEEARALLGRLEYQRGNFDAAFQVFHGIDIRGLTPRMTRAIVERTWQRKPR  237

Query  605   ggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMS  784
                  IV +  MS+HSVSLLLEAILLK+KSL  LGR  +AA+ECK ILD V+SA PNGM 
Sbjct  238   TKGD-IVSTQEMSMHSVSLLLEAILLKAKSLDELGRTGEAAKECKIILDTVESALPNGMP  296

Query  785   EGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLA  964
             EG+GEDCKLQEMFHKALE LPKLW + G +DE++ +YR+ALV+PWNLD +RLAS+QKDLA
Sbjct  297   EGIGEDCKLQEMFHKALELLPKLWTKAGCLDESIAAYRQALVRPWNLDPRRLASVQKDLA  356

Query  965   IALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFA  1144
               LL+ GVE  L P+ ++W +T PKNN+EEAILLLF+LM K+   E++WD E+MDHL +A
Sbjct  357   AILLYGGVETSLPPQLQVWGATTPKNNIEEAILLLFILMRKVASREIDWDPEIMDHLAYA  416

Query  1145  LTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHE  1324
             LT+ G FE LA+ VEQ LPG+  RAERWYFLALCYS+AGQNE ALNLL+KVSG SEA+H+
Sbjct  417   LTISGRFEFLAEYVEQALPGVYNRAERWYFLALCYSAAGQNEAALNLLKKVSGCSEAKHK  476

Query  1325  PHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKIS  1504
             PH+PS LLGAKLCSQDP  + EGI+FAR  + S+ +Q KH + +  KFLG+CYGNAA+  
Sbjct  477   PHLPSFLLGAKLCSQDPKHAHEGINFARKVI-SSHDQTKHFMGETHKFLGICYGNAARAC  535

Query  1505  FSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAG  1684
               DSER + QT SLNSL QA+++  +D E +FSL LE            NA+ +     G
Sbjct  536   VLDSERVALQTDSLNSLNQASLIGHKDPELIFSLALE------------NAIWW----PG  579

Query  1685  STAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAME  1864
                +GWKLLAL+VSAEQRF DAE IVDLALDE G+IDQL+ L+LKA LQIA++ P QA+E
Sbjct  580   VPGRGWKLLALVVSAEQRFKDAETIVDLALDEAGRIDQLELLRLKAVLQIAQEQPKQAIE  639

Query  1865  TYRILLAMIQAQRQ---SGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKT  2035
             TYRILLA+IQAQR+   +    EV ++R LE + W DLA IY     W DA++C+DKAK+
Sbjct  640   TYRILLALIQAQREVQANKFHSEVSAERNLETQTWQDLANIYTKLGLWSDAEICLDKAKS  699

Query  2036  IDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPI  2215
             I+ YS +SWH TG   EAQ   KEALV+FS SLSI+PDYVPSIVSTAEVLMK G  ++PI
Sbjct  700   IEFYSSRSWHKTGISLEAQSLYKEALVSFSVSLSIEPDYVPSIVSTAEVLMKFGKPSLPI  759

Query  2216  ARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSFV  2380
             ARS LMNALR+EPT H+AW +LG +SKMEGS QQAAD+FQAA+ELKLS P+QSFV
Sbjct  760   ARSFLMNALRLEPTNHEAWLNLGLVSKMEGSLQQAADYFQAAYELKLSAPIQSFV  814



>ref|XP_010090573.1| Tetratricopeptide repeat protein 7B [Morus notabilis]
 gb|EXB39826.1| Tetratricopeptide repeat protein 7B [Morus notabilis]
Length=715

 Score =   863 bits (2230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/720 (65%), Positives = 567/720 (79%), Gaps = 16/720 (2%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFK EEP  +P+S   LATRDFSASGLSS RTG  DWES+FE+ QVDE EST
Sbjct  1     MLCACSGEQFKLEEPPQSPES---LATRDFSASGLSS-RTG--DWESKFEDIQVDEAEST  54

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLEYQRGNF+AAL VFQGIDIK L+ RM+KAI ERTR RKPR 
Sbjct  55    LKEALSLNYEEARALLGRLEYQRGNFEAALLVFQGIDIKALTARMTKAIVERTRQRKPRS  114

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
               G++V SG+MS+HSVSLL+EAILLK++SL  LGR  DAA+ECK ILD V+ A PNGM E
Sbjct  115   KGGDVVPSGIMSMHSVSLLVEAILLKARSLDELGRHIDAAKECKIILDTVELALPNGMPE  174

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G GEDCKLQ+MFHKALE LP LW + G +D A+ +YRRALVKPWNLDA+ LA++QK LA 
Sbjct  175   GFGEDCKLQDMFHKALELLPNLWTKAGFLDNAIIAYRRALVKPWNLDAESLAAVQKSLAA  234

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LL+ GVE +L  ++++W +T PKN+MEEAILLL +LM K+   E++WD E++DHLT+ L
Sbjct  235   TLLYGGVETNLPLQYQVWGTTTPKNSMEEAILLLLILMRKVALHEIKWDPEIVDHLTYVL  294

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             +V G FE LA++VEQILPG+  RA+RWYFLALCYS+AGQNE ALNLL+KV+G SE  H  
Sbjct  295   SVSGLFELLAEHVEQILPGIYNRADRWYFLALCYSAAGQNEVALNLLKKVAGCSEVNHIS  354

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
               PS L GAKLCSQDP  ++EGI F+R A++   NQ +H   QA KFLGVC+GNAA+ S 
Sbjct  355   RFPSFLYGAKLCSQDPIHAQEGIEFSRKAINLANNQYEHFRGQAHKFLGVCFGNAARASV  414

Query  1508  SDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGS  1687
             SDSER  +Q +SL++L  AA+  K D E +FSL LE A QRNL  AFD+A+ Y+ M AGS
Sbjct  415   SDSERLIFQRESLHALNNAALGEKNDPEVLFSLSLENAVQRNLDAAFDSAMTYTGMVAGS  474

Query  1688  TAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMET  1867
             T +GWKLLAL+VSA+Q+F DAE IVD ALDE  + DQL+ L+LKA LQ+A++ P +A+ET
Sbjct  475   TGRGWKLLALVVSAKQKFEDAETIVDFALDEAVRTDQLELLRLKAVLQVAQEQPKRAIET  534

Query  1868  YRILLAMIQAQRQ---------SGMDHE-VLSDRKLEVEAWLDLARIYIDQDSWPDAQVC  2017
             YR+LLA+ QAQ++            DHE +L+ RKLE EAW DLA IY     WPDA+VC
Sbjct  535   YRVLLALAQAQKELRTKNSSQTDNFDHEALLAQRKLETEAWQDLASIYTKLGLWPDAKVC  594

Query  2018  IDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMG  2197
             +DKAK I+ YSP SWHTTG LFEAQ   KEAL++FS SLSI PDYV SIVSTA+VLMK+G
Sbjct  595   MDKAKLIEFYSPSSWHTTGLLFEAQALYKEALISFSLSLSIQPDYVSSIVSTAKVLMKLG  654

Query  2198  SQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             SQ++PIARS LMNALR+EPT H+AWF+LG LSK EG  QQAA+FFQAAHELK+S PVQS 
Sbjct  655   SQSLPIARSFLMNALRLEPTNHEAWFNLGLLSKSEGLLQQAAEFFQAAHELKMSAPVQSI  714



>ref|XP_011014445.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Populus 
euphratica]
Length=714

 Score =   862 bits (2226),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/720 (63%), Positives = 569/720 (79%), Gaps = 15/720 (2%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFK +EP  +P+S   LATRDFSASGLSS  TG  D ES+ E+ QVDE EST
Sbjct  1     MLCACSGEQFKLDEPPQSPES---LATRDFSASGLSSRTTG--DRESKLEDFQVDEAEST  55

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDI  LSP+M KAI ER + RKPR 
Sbjct  56    LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDISGLSPKMIKAIVERIQYRKPRS  115

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                 IV   VMS+HSVSLL+EAILLK+KSL  L + R+AA+EC  ILDIV+SA P+G+ E
Sbjct  116   KGE-IVPPSVMSMHSVSLLVEAILLKAKSLEELAQYREAAKECGIILDIVESALPSGIPE  174

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G+GEDCKL+EMFHKALE LP LW + GL+D+A+ SYRR L++PWNL+ ++LA++QK+LA 
Sbjct  175   GIGEDCKLEEMFHKALELLPALWTKAGLLDQAIASYRRVLIRPWNLNPQKLAAVQKELAS  234

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LL++ VE  L P+ ++     P++N+EEAILLL VL  K+  GE++WD E+MDHLT+AL
Sbjct  235   MLLYSSVEATLPPQLQLLGFASPQSNIEEAILLLLVLRSKVACGEIKWDEEIMDHLTYAL  294

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             ++VG+FE LA++VEQ LPG+  RA RWY LALCYS+AGQNE ALNLL+KVSG SE++++P
Sbjct  295   SIVGQFELLAEHVEQALPGIYNRAARWYLLALCYSAAGQNEAALNLLKKVSGCSESKNKP  354

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             HIPS LLGAKLCSQD   + EGI+FAR  +D   +QN+H + QA KFLGVC+GNAA+IS 
Sbjct  355   HIPSFLLGAKLCSQDSMHAHEGINFARKVLDLADHQNQHFIGQAHKFLGVCHGNAARISL  414

Query  1508  SDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGS  1687
             SDSER     +SLNSL  AA+  KED E ++SLGLE   QRNL  AF+NA+  +EM AG+
Sbjct  415   SDSERVLLHKESLNSLNNAALNRKEDPEVMYSLGLENMLQRNLGAAFENAIVCTEMMAGN  474

Query  1688  TAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMET  1867
             + KGWKLLAL+VSAEQRF DA+ +V++ALDE G+IDQ + L+LKA LQIA++ P QA+ET
Sbjct  475   SVKGWKLLALVVSAEQRFRDAQTVVEIALDEAGRIDQFELLRLKAILQIAQEQPKQAIET  534

Query  1868  YRILLAMIQAQRQSG---------MDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCI  2020
             YRILL++IQAQR S           + EVL++R LE+ AW DLA IY    SW DA++C+
Sbjct  535   YRILLSLIQAQRDSQAKSPEQAHIFNSEVLAERNLELAAWQDLADIYTKIGSWSDAKICV  594

Query  2021  DKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGS  2200
             DKAK ++ +SP+SWH TG LFEAQ   KEALV+FS +LS++PDYVPSIV+TA VLMK+G+
Sbjct  595   DKAKLMEFHSPRSWHVTGMLFEAQSLHKEALVSFSIALSVEPDYVPSIVATAGVLMKLGA  654

Query  2201  QAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSFV  2380
              +  IARS LM+ALR++PT H+AW +LG +SKMEGS +QAADFFQAAHELKLS P+QSF+
Sbjct  655   LSFSIARSFLMHALRLDPTNHEAWLNLGLISKMEGSLKQAADFFQAAHELKLSAPIQSFL  714



>ref|XP_010999876.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Populus 
euphratica]
Length=714

 Score =   862 bits (2226),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/720 (63%), Positives = 569/720 (79%), Gaps = 15/720 (2%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFK +EP  +P+S   LATRDFSASGLSS  TG  D ES+ E+ QVDE EST
Sbjct  1     MLCACSGEQFKLDEPPQSPES---LATRDFSASGLSSRTTG--DRESKLEDFQVDEAEST  55

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDI  LSP+M KAI ER + RKPR 
Sbjct  56    LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDISGLSPKMIKAIVERIQYRKPRS  115

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                 IV   VMS+HS SLL+EAILLK+KSL  L + R+AA+EC  ILDIV+SA P+G+ E
Sbjct  116   KGE-IVPPSVMSMHSASLLVEAILLKAKSLEELAQYREAAKECGIILDIVESALPSGIPE  174

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G+GEDCKL+EMFHKALE LP LW + GL+D+A+ SYRR L++PWNL+ ++LA++QK+LA 
Sbjct  175   GIGEDCKLEEMFHKALELLPALWTKAGLLDQAIASYRRVLIRPWNLNPQKLAAVQKELAS  234

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LL++ VE  L P+ ++     P++N+EEAILLL VL  K+  GE++WD E+MDHLT+AL
Sbjct  235   MLLYSAVEATLPPQLQLLGFASPQSNIEEAILLLLVLRSKVACGEIKWDEEIMDHLTYAL  294

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             ++VG+FE LA++VEQ LPG+  RAERWY LALCYS+AGQNE ALNLL+KVSG SE++++P
Sbjct  295   SIVGQFELLAEHVEQALPGIYNRAERWYLLALCYSAAGQNEAALNLLKKVSGCSESKNKP  354

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             HIPS LLGAKLCSQD   + EGI+FAR  +D   +QN+H + QA KFLGVC+GNAA+IS 
Sbjct  355   HIPSFLLGAKLCSQDSMHAHEGINFARKVLDLADHQNQHFIGQAHKFLGVCHGNAARISL  414

Query  1508  SDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGS  1687
             SDSER     +SLNSL  AA+  KED E ++SLGLE   QRNL  AF+NA+  +EM AG+
Sbjct  415   SDSERVLLHKESLNSLNNAALNRKEDPEVMYSLGLENMLQRNLGAAFENAIVCTEMMAGN  474

Query  1688  TAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMET  1867
             + KGWKLLAL+VSAEQRF DA+ +V++ALDE G+IDQ + L+LKA LQIA++ P QA+ET
Sbjct  475   SVKGWKLLALVVSAEQRFRDAQTVVEIALDEAGRIDQFELLRLKAILQIAQEQPKQAIET  534

Query  1868  YRILLAMIQAQRQSG---------MDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCI  2020
             YRILL++IQAQR S           + EVL++R LE+ AW DLA IY    SW DA++C+
Sbjct  535   YRILLSLIQAQRDSQAKSPEQAHIFNSEVLAERNLELAAWQDLADIYTKIGSWSDAKICV  594

Query  2021  DKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGS  2200
             DKAK ++ +SP+SWH TG LFEAQ   KEALV+FS +LS++PDYVPSIV+TA VLMK+G+
Sbjct  595   DKAKLMEFHSPRSWHVTGMLFEAQSLHKEALVSFSIALSVEPDYVPSIVATAGVLMKLGA  654

Query  2201  QAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSFV  2380
              +  IARS LM+ALR++PT H+AW +LG +SKMEGS +QAADFFQAAHELKLS P+QSF+
Sbjct  655   LSFSIARSFLMHALRLDPTNHEAWLNLGLISKMEGSLKQAADFFQAAHELKLSAPIQSFL  714



>ref|XP_002302407.2| NO POLLEN GERMINATION RELATED 1 family protein [Populus trichocarpa]
 gb|EEE81680.2| NO POLLEN GERMINATION RELATED 1 family protein [Populus trichocarpa]
Length=708

 Score =   861 bits (2225),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/718 (64%), Positives = 569/718 (79%), Gaps = 21/718 (3%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFKF+EP+ +P+S   LATRDFSASGLSS  TG  DWES+ E+ QVDE EST
Sbjct  1     MLCACSGEQFKFDEPQQSPES---LATRDFSASGLSSRTTG--DWESKLEDIQVDEAEST  55

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLEYQRGN  AALQVFQGIDIK L+P+M KAI ER   RKPR 
Sbjct  56    LKEALSLNYEEARALLGRLEYQRGNLGAALQVFQGIDIKVLTPKMIKAIVERIHYRKPRS  115

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                 I    VMS+HSVSLL+EAILLK+KSL  LG   +AA+EC+ IL+IV+SA PNGM E
Sbjct  116   KGE-IGPPSVMSMHSVSLLVEAILLKAKSLEELGHHIEAAKECRIILNIVESALPNGMPE  174

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G+GEDCKL+EMFHKALE LP LW + GL+DEA+ SYR+ALV+PWNLD + LA +QK+LA 
Sbjct  175   GIGEDCKLEEMFHKALELLPALWTKAGLLDEAIASYRKALVRPWNLDPQNLAGVQKELAS  234

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LL++ VE     R  +  S  P++N+EEAILLL VLM K+ +GE++WD E+MDHLT+AL
Sbjct  235   MLLYSAVEA----RHPLPAS--PQSNIEEAILLLLVLMSKVARGEIKWDEEIMDHLTYAL  288

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             ++VG+FE LA++VEQ LPG+ TRAERWY LALCYS+AGQNE ALNLL+KVSG SE++++P
Sbjct  289   SIVGQFELLAEHVEQALPGVYTRAERWYLLALCYSAAGQNEAALNLLKKVSGCSESKNKP  348

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             HIPS LLGAKLCSQDP  ++EGI+FAR  +D   +QN+H + QA K LG+CYGNAA++S 
Sbjct  349   HIPSFLLGAKLCSQDPMHAQEGINFARKVLDLADHQNQHFIGQAHKCLGICYGNAARVSL  408

Query  1508  SDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGS  1687
             SDSER     +S+NSL  AA+   ED E ++SLGLE   QRNL  AFDNA+  SEM AG+
Sbjct  409   SDSERFLLHKESVNSLNNAALNRNEDPEVMYSLGLENMLQRNLGAAFDNAIVCSEMMAGN  468

Query  1688  TAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMET  1867
             T KGWKLLAL+VSAEQRF DA+ +V+ ALD   +I+Q + L+LKA LQIA++ P QA+ET
Sbjct  469   TVKGWKLLALVVSAEQRFRDAQTVVEFALDAAERIEQFELLRLKAVLQIAQEQPKQAIET  528

Query  1868  YRILLAMIQAQRQ---------SGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCI  2020
             YRILL++IQAQR            +  EVL++R LE+ AW DLA IY    SW DA++C+
Sbjct  529   YRILLSLIQAQRDIQAKNPEQAHILKSEVLAERNLELAAWQDLADIYTKIGSWGDAKICV  588

Query  2021  DKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGS  2200
             DKAK ++++SP+SWH+TG LFE+Q   KEALV+FS SLS++PDYVPSIV+TAEVLMK+G+
Sbjct  589   DKAKLMELHSPRSWHSTGMLFESQSLHKEALVSFSVSLSVEPDYVPSIVATAEVLMKLGT  648

Query  2201  QAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQS  2374
             Q++PIARS LM+ALR++PT H+AW +LG +SKMEGS +QAA+FFQAAHEL LS P+QS
Sbjct  649   QSLPIARSFLMHALRLDPTNHEAWLNLGLISKMEGSLKQAAEFFQAAHELMLSAPIQS  706



>ref|XP_006472300.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X1 
[Citrus sinensis]
 ref|XP_006472301.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X2 
[Citrus sinensis]
 ref|XP_006472302.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X3 
[Citrus sinensis]
Length=721

 Score =   857 bits (2214),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/724 (62%), Positives = 560/724 (77%), Gaps = 16/724 (2%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFKF+  +        LATRDFSASG SS  TG  DW+S+ ++ QVDE EST
Sbjct  1     MLCACSGEQFKFDAEDAPQSPES-LATRDFSASGFSSRATG--DWDSKVDDIQVDEAEST  57

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItert----rpr  595
             LKEALSLNYEEARALLGRLEYQRGN+DAALQVFQGIDI +L+PRM++A+ ERT    + R
Sbjct  58    LKEALSLNYEEARALLGRLEYQRGNYDAALQVFQGIDIVSLTPRMTRAVVERTRPLRKHR  117

Query  596   kprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPN  775
                     +   G+MSLHS+SLLLEAILLK+KSL  LG  ++AA+ECK ILDIV+S  PN
Sbjct  118   SKGEKADSVPPPGLMSLHSISLLLEAILLKAKSLEELGHCKEAAKECKIILDIVESGLPN  177

Query  776   GMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQK  955
             GM EG GEDCKLQEMFHKALE LP LW++ GL++EA+ +YRRALVKPWNLD K++AS+Q+
Sbjct  178   GMPEGFGEDCKLQEMFHKALELLPHLWIKAGLLEEAIIAYRRALVKPWNLDPKKVASVQR  237

Query  956   DLAIALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHL  1135
             DLA+ LL+ GVE  L P  K+W    PK+N+EEAILLL +LM K+   E+EWD+E+MDHL
Sbjct  238   DLAVTLLYGGVEARLPPELKVWGPIAPKDNVEEAILLLLILMEKVASKEMEWDAEIMDHL  297

Query  1136  TFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEA  1315
             T+AL+V G+FE LA+ VEQ LPG+  RAERWY LALCYS+AGQNE ALNLL+K+   SEA
Sbjct  298   TYALSVTGQFELLAEYVEQALPGIYNRAERWYILALCYSAAGQNEAALNLLKKLFCHSEA  357

Query  1316  EHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAA  1495
             +  PHIPS LLGAKLCS D   + EGI F+RG + ST +Q +H L++A KFLG+CYGN A
Sbjct  358   KCRPHIPSFLLGAKLCSLDRKNAHEGIKFSRGVIQSTTSQKEHFLAEAYKFLGICYGNVA  417

Query  1496  KISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEM  1675
             + S SD+ER  +Q ++L SL  A +  +ED E ++ LGLE+A QRN+  AFD A+ YS+ 
Sbjct  418   RKSISDTERVFFQKEALESLNCAFLNEREDPEMMYYLGLEHAVQRNVEAAFDYAIMYSDT  477

Query  1676  TAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQ  1855
              AG++ +GWKLLALI+SA+QR  DA++IVD +LDE G +DQL+ L+LKA LQIA++ P Q
Sbjct  478   VAGNSGRGWKLLALILSADQRLKDAQSIVDFSLDEAGSMDQLELLRLKAVLQIAQEQPKQ  537

Query  1856  AMETYRILLAMIQAQRQ---------SGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDA  2008
             A+ TYRILLAMIQAQR+           +  E  S + LE+  W DLA IY+   S PDA
Sbjct  538   AIGTYRILLAMIQAQRELHSKNFHKTKYITSEAPSVKILEIATWQDLATIYMKLGSLPDA  597

Query  2009  QVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLM  2188
             ++C +KAK+I+ YSP SWHTTG LFEAQ + KEALV+FS SL+I+PDY+PSI+STAE+LM
Sbjct  598   EICTEKAKSIEFYSPGSWHTTGMLFEAQSQYKEALVSFSISLAIEPDYIPSIISTAEILM  657

Query  2189  KMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPV  2368
             K+G Q++PIARS LMNALR+EPT HDAW +LG +SKMEGS QQAAD+FQAA+ELKLS PV
Sbjct  658   KLGRQSMPIARSFLMNALRLEPTNHDAWMNLGLISKMEGSLQQAADYFQAAYELKLSAPV  717

Query  2369  QSFV  2380
             QSFV
Sbjct  718   QSFV  721



>gb|KHN36969.1| Tetratricopeptide repeat protein 7A, partial [Glycine soja]
Length=712

 Score =   850 bits (2196),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/717 (64%), Positives = 563/717 (79%), Gaps = 12/717 (2%)
 Frame = +2

Query  245   KMLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVES  424
             KMLCACSGEQFKFEE  P       LATRDFSASGLSS RTG  DWES+F+E QV++VES
Sbjct  1     KMLCACSGEQFKFEEAPPRSPDS--LATRDFSASGLSS-RTG--DWESKFDETQVEDVES  55

Query  425   TLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkpr  604
             TLKEALSLNYEEARALLGRLEYQRGNFDAALQVF+GIDI+ L+PRM +AI ERT+ RK R
Sbjct  56    TLKEALSLNYEEARALLGRLEYQRGNFDAALQVFEGIDIRALTPRMIRAIAERTKQRKSR  115

Query  605   ggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMS  784
                   V+  VMS+HSVSL+LEAILLKSKS   LGR  +AA+EC+ ++D V+SA PNGM 
Sbjct  116   SKVDN-VLPNVMSMHSVSLILEAILLKSKSSEELGRYTEAAKECRIVVDTVESALPNGMP  174

Query  785   EGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLA  964
             EG+GEDCKLQEMFH+ALE LP LW++ GL+DE V +YRRALVKPWNL+ +RLA +QKDLA
Sbjct  175   EGIGEDCKLQEMFHEALELLPNLWMKAGLLDEVVTAYRRALVKPWNLEPQRLACVQKDLA  234

Query  965   IALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFA  1144
               LL+ GVEV+L P+ ++   T P +  EEAILLL +L GK+   E++WD E+MDHLTF+
Sbjct  235   TTLLYGGVEVNLLPQLQVNGITTPMSGTEEAILLLLILSGKMALQEIDWDPEIMDHLTFS  294

Query  1145  LTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHE  1324
             L+V G FESLAD+VE+ILPG+  RAE+WYFLALCYS+AGQNE ALNLLRK  GSSEA+H 
Sbjct  295   LSVTGMFESLADHVEKILPGVHDRAEQWYFLALCYSAAGQNEVALNLLRKACGSSEAKHR  354

Query  1325  PHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKIS  1504
             PH PS L GAKLCS +P  +REGI F++  +D   +QN+H LSQ +KFLG+C+G AA+IS
Sbjct  355   PHFPSFLFGAKLCSLNPNHAREGIKFSQEVIDLVKHQNEHFLSQGQKFLGICHGAAARIS  414

Query  1505  FSDSERNSYQTQSLNSLTQAAMLC-KEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTA  1681
               DSER  +Q +SL  L  AA+     D E + +LGLE A QRNL  A+DN + YS+M A
Sbjct  415   VLDSERIIFQKESLKFLKDAALNGNNNDPEVMLTLGLENAIQRNLNAAYDNIMMYSDMMA  474

Query  1682  GSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAM  1861
             GS+ +GW+LLAL VSA+QRF DAE IVD ALDE G IDQL+ L+LKA LQI +Q P QA+
Sbjct  475   GSSRRGWQLLALTVSAQQRFQDAETIVDFALDEAGDIDQLELLRLKAVLQITQQQPKQAI  534

Query  1862  ETYRILLAMIQAQRQSGMD-----HEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDK  2026
             ETYRILLA+I+A+++  +      HE L+++KLE+EAW DLA IY D  S+ DA+ C+DK
Sbjct  535   ETYRILLAVIEARKEHWLQAKTFRHEALTEQKLEMEAWQDLATIYADLCSFLDAKACVDK  594

Query  2027  AKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQA  2206
             +++I+ +SP+SWH TG LFEAQ   KEA V+FS SLSI+PDY+P I+STA++ +K+G  +
Sbjct  595   SQSIEFFSPRSWHITGLLFEAQSLHKEAFVSFSVSLSIEPDYIPCIISTAKLFLKLGIPS  654

Query  2207  VPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             +PIARS LMNALR++PT HDAWF+LG +SKMEGS QQAAD FQAA+ELKLS PVQ F
Sbjct  655   LPIARSFLMNALRLDPTNHDAWFNLGLVSKMEGSLQQAADCFQAAYELKLSAPVQKF  711



>ref|XP_003545340.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X1 
[Glycine max]
 ref|XP_006595992.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X2 
[Glycine max]
 ref|XP_006595993.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X3 
[Glycine max]
 ref|XP_006595994.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X4 
[Glycine max]
Length=710

 Score =   849 bits (2194),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/715 (64%), Positives = 561/715 (78%), Gaps = 11/715 (2%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFKFEE  P       LATRDFSASGLSS RTG  DWES+F+E QV++VEST
Sbjct  1     MLCACSGEQFKFEEAPPRSPDS--LATRDFSASGLSS-RTG--DWESKFDETQVEDVEST  55

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLEYQRGNFDAALQVF+GIDI+ L+PRM +AI ER + RKPR 
Sbjct  56    LKEALSLNYEEARALLGRLEYQRGNFDAALQVFEGIDIRALAPRMIRAIAERIKQRKPRS  115

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                   +  VMS+HSVSLLLEAILLKSKSL  LGR  +AA+EC+  +D V+SA PNGM E
Sbjct  116   KVDN-GLPNVMSMHSVSLLLEAILLKSKSLEELGRYTEAAKECRIAVDTVESALPNGMPE  174

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G+GE CKLQEMFH+ALE LP LW++ GL DEAV +YRRALVKPWNL+ +RLA +QKDLA 
Sbjct  175   GIGEACKLQEMFHRALELLPNLWIKAGLPDEAVTAYRRALVKPWNLEPRRLACVQKDLAT  234

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LL+ GVEV+L P+ ++   T P +  EEAILLL +L GK+   E++WD E+MD+LTF+L
Sbjct  235   TLLYGGVEVNLPPQLQVNGLTTPMSGTEEAILLLLILSGKMALQEIDWDPEIMDNLTFSL  294

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             ++ G FESLAD+VE+ILPG+  RAERWYFLALCYS+AGQN+ ALNLLRK  GSSEA+H P
Sbjct  295   SITGMFESLADHVEKILPGVYDRAERWYFLALCYSAAGQNDIALNLLRKACGSSEAKHRP  354

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             H PS L GAKL S +P  +REGI  ++  +D   +QNKH L Q +KFLG+C+G AA+ S 
Sbjct  355   HFPSFLFGAKLYSLNPNHAREGIKLSQEVIDLAKHQNKHFLGQGQKFLGICHGAAARTSV  414

Query  1508  SDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGS  1687
              DSER  +Q +SL  L+ AA+    D E +FSLGLE A QRNL  A+DN + YS+M AGS
Sbjct  415   LDSERIIFQRESLKFLSDAALNGNNDPEVMFSLGLENAIQRNLNAAYDNIMIYSDMMAGS  474

Query  1688  TAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMET  1867
             + +GW+LLALIVSA+QRF DA+ IVD ALDE G IDQL+ L+LKA LQI +Q P QA+ET
Sbjct  475   SRRGWQLLALIVSAQQRFQDAKTIVDFALDEAGSIDQLELLRLKAVLQITQQQPKQAIET  534

Query  1868  YRILLAMIQAQRQSGMD-----HEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAK  2032
             YRILLA+I+A+++  +      HE L+++KLE+EAW DLA IY D  S+ DA+ C+DKA+
Sbjct  535   YRILLAVIEARKEHWLQAKTFRHEALTEQKLEMEAWQDLATIYADISSFLDAKACVDKAQ  594

Query  2033  TIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVP  2212
              I+ +SP+SWH TG LFEAQ   KEA V+FS SLSI+PDY+PSI+STA++L+K+G Q++P
Sbjct  595   LIEFFSPRSWHITGLLFEAQSLHKEAFVSFSVSLSIEPDYIPSIISTAKLLLKLGMQSLP  654

Query  2213  IARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             IARS LMNALR++PT HDAWF+LG +SKMEGS QQAAD FQAA+ELKLS PVQ F
Sbjct  655   IARSFLMNALRLDPTNHDAWFNLGLVSKMEGSLQQAADCFQAAYELKLSAPVQKF  709



>ref|XP_003550305.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X1 
[Glycine max]
 ref|XP_006601259.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X2 
[Glycine max]
 ref|XP_006601260.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X3 
[Glycine max]
Length=711

 Score =   848 bits (2191),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/716 (64%), Positives = 562/716 (78%), Gaps = 12/716 (2%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFKFEE  P       LATRDFSASGLSS RTG  DWES+F+E QV++VEST
Sbjct  1     MLCACSGEQFKFEEAPPRSPDS--LATRDFSASGLSS-RTG--DWESKFDETQVEDVEST  55

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLEYQRGNFDAALQVF+GIDI+ L+PRM +AI ERT+ RK R 
Sbjct  56    LKEALSLNYEEARALLGRLEYQRGNFDAALQVFEGIDIRALTPRMIRAIAERTKQRKSRS  115

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                  V+  VMS+HSVSL+LEAILLKSKS   LGR  +AA+EC+ ++D V+SA PNGM E
Sbjct  116   KVDN-VLPNVMSMHSVSLILEAILLKSKSSEELGRYTEAAKECRIVVDTVESALPNGMPE  174

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G+GEDCKLQEMFH+ALE LP LW++ GL+DE V +YRRALVKPWNL+ +RLA +QKDLA 
Sbjct  175   GIGEDCKLQEMFHEALELLPNLWMKAGLLDEVVTAYRRALVKPWNLEPQRLACVQKDLAT  234

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LL+ GVEV+L P+ ++   T P +  EEAILLL +L GK+   E++WD E+MDHLTF+L
Sbjct  235   TLLYGGVEVNLPPQLQVNGITTPMSGTEEAILLLLILSGKMALQEIDWDPEIMDHLTFSL  294

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             +V G FESLAD+VE+ILPG+  RAE+WYFLALCYS+AGQNE ALNLLRK  GSSEA+H P
Sbjct  295   SVTGMFESLADHVEKILPGVHDRAEQWYFLALCYSAAGQNEVALNLLRKACGSSEAKHRP  354

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             H PS L GAKLCS +P  +REGI F++  +D   +QN+H LSQ +KFLG+C+G AA+IS 
Sbjct  355   HFPSFLFGAKLCSLNPNHAREGIKFSQEVIDLVKHQNEHFLSQGQKFLGICHGAAARISV  414

Query  1508  SDSERNSYQTQSLNSLTQAAMLC-KEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAG  1684
              DSER  +Q +SL  L  AA+     D E + +LGLE A QRNL  A+DN + YS+M AG
Sbjct  415   LDSERIIFQKESLKFLKDAALNGNNNDPEVMLTLGLENAIQRNLNAAYDNIMMYSDMMAG  474

Query  1685  STAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAME  1864
             S+ +GW+LLAL VSA+QRF DAE IVD ALDE G IDQL+ L+LKA LQI +Q P QA+E
Sbjct  475   SSRRGWQLLALTVSAQQRFQDAETIVDFALDEAGDIDQLELLRLKAVLQITQQQPKQAIE  534

Query  1865  TYRILLAMIQAQRQSGMD-----HEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKA  2029
             TYRILLA+I+A+++  +      HE L+++KLE+EAW DLA IY D  S+ DA+ C+DK+
Sbjct  535   TYRILLAVIEARKEHWLQAKTFRHEALTEQKLEMEAWQDLATIYADLCSFLDAKACVDKS  594

Query  2030  KTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAV  2209
             ++I+ +SP+SWH TG LFEAQ   KEA V+FS SLSI+PDY+P I+STA++ +K+G  ++
Sbjct  595   QSIEFFSPRSWHITGLLFEAQSLHKEAFVSFSVSLSIEPDYIPCIISTAKLFLKLGIPSL  654

Query  2210  PIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             PIARS LMNALR++PT HDAWF+LG +SKMEGS QQAAD FQAA+ELKLS PVQ F
Sbjct  655   PIARSFLMNALRLDPTNHDAWFNLGLVSKMEGSLQQAADCFQAAYELKLSAPVQKF  710



>gb|KHN07664.1| Tetratricopeptide repeat protein 7A [Glycine soja]
Length=710

 Score =   847 bits (2189),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/715 (64%), Positives = 560/715 (78%), Gaps = 11/715 (2%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFKFEE  P       LATRDFSASGL S RTG  DWES+F+E QV++VEST
Sbjct  1     MLCACSGEQFKFEEAPPRSPDS--LATRDFSASGLPS-RTG--DWESKFDETQVEDVEST  55

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLEYQRGNFDAALQVF+GIDI+ L+PRM +AI ER + RKPR 
Sbjct  56    LKEALSLNYEEARALLGRLEYQRGNFDAALQVFEGIDIRALAPRMIRAIAERIKQRKPRS  115

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                   +  VMS+HSVSLLLEAILLKSKSL  LGR  +AA+EC+  +D V+SA PNGM E
Sbjct  116   KVDN-GLPNVMSMHSVSLLLEAILLKSKSLEELGRYTEAAKECRIAVDTVESALPNGMPE  174

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G+GE CKLQEMFH+ALE LP LW++ GL DEAV +YRRALVKPWNL+ +RLA +QKDLA 
Sbjct  175   GIGEACKLQEMFHRALELLPNLWIKAGLPDEAVTAYRRALVKPWNLEPRRLACVQKDLAT  234

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LL+ GVEV+L P+ ++   T P +  EEAILLL +L GK+   E++WD E+MD+LTF+L
Sbjct  235   TLLYGGVEVNLPPQLQVNGLTTPMSGTEEAILLLLILSGKMALQEIDWDPEIMDNLTFSL  294

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             ++ G FESLAD+VE+ILPG+  RAERWYFLALCYS+AGQN+ ALNLLRK  GSSEA+H P
Sbjct  295   SITGMFESLADHVEKILPGVYDRAERWYFLALCYSAAGQNDIALNLLRKACGSSEAKHRP  354

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             H PS L GAKL S +P  +REGI  ++  +D   +QNKH L Q +KFLG+C+G AA+ S 
Sbjct  355   HFPSFLFGAKLYSLNPNHAREGIKLSQEVIDLAKHQNKHFLGQGQKFLGICHGAAARTSV  414

Query  1508  SDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGS  1687
              DSER  +Q +SL  L+ AA+    D E +FSLGLE A QRNL  A+DN + YS+M AGS
Sbjct  415   LDSERIIFQRESLKFLSDAALNGNNDPEVMFSLGLENAIQRNLNAAYDNIMIYSDMMAGS  474

Query  1688  TAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMET  1867
             + +GW+LLALIVSA+QRF DA+ IVD ALDE G IDQL+ L+LKA LQI +Q P QA+ET
Sbjct  475   SRRGWQLLALIVSAQQRFQDAKTIVDFALDEAGSIDQLELLRLKAVLQITQQQPKQAIET  534

Query  1868  YRILLAMIQAQRQSGMD-----HEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAK  2032
             YRILLA+I+A+++  +      HE L+++KLE+EAW DLA IY D  S+ DA+ C+DKA+
Sbjct  535   YRILLAVIEARKEHWLQAKTFRHEALTEQKLEMEAWQDLATIYADISSFLDAKACVDKAQ  594

Query  2033  TIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVP  2212
              I+ +SP+SWH TG LFEAQ   KEA V+FS SLSI+PDY+PSI+STA++L+K+G Q++P
Sbjct  595   LIEFFSPRSWHITGLLFEAQSLHKEAFVSFSVSLSIEPDYIPSIISTAKLLLKLGMQSLP  654

Query  2213  IARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             IARS LMNALR++PT HDAWF+LG +SKMEGS QQAAD FQAA+ELKLS PVQ F
Sbjct  655   IARSFLMNALRLDPTNHDAWFNLGLVSKMEGSLQQAADCFQAAYELKLSAPVQKF  709



>ref|XP_004498994.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X1 
[Cicer arietinum]
 ref|XP_004498995.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X2 
[Cicer arietinum]
Length=717

 Score =   846 bits (2186),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/723 (63%), Positives = 565/723 (78%), Gaps = 20/723 (3%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFKFEE   +P+S   LATRDFSASGLSS RTG  DWES+ +E QV++VEST
Sbjct  1     MLCACSGEQFKFEEAPQSPES---LATRDFSASGLSS-RTG--DWESKLDETQVEDVEST  54

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDI++L+PRM +AI+ER + RKPR 
Sbjct  55    LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIRSLTPRMIRAISERNKLRKPRS  114

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
               G  V+  +MS+HSVSLLLEAILLK+KSL  L R  +AA+EC+ I+DI++SA PNGM E
Sbjct  115   KAGT-VLPNLMSMHSVSLLLEAILLKAKSLEELERYAEAAKECRIIVDIIESALPNGMPE  173

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G+GE+CKLQEMFHKALE LP LW++ G +DEAV +YRR L KPWNL+ KRLA +QKDLA 
Sbjct  174   GIGEECKLQEMFHKALELLPNLWIKAGFLDEAVTAYRRTLTKPWNLEPKRLACLQKDLAT  233

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LL+ GVEV+L    ++   T P  N+EEAILLL +L GK+   E++WD+E+MDHL+F+L
Sbjct  234   TLLYGGVEVNLPSHLQVNGPTTPMTNIEEAILLLLILSGKMALQEIDWDAEIMDHLSFSL  293

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             +V G FESLAD VEQILPG+  RAE+WY LALCYS+AG NETALNLLRK  GSSEA+H P
Sbjct  294   SVSGMFESLADCVEQILPGIFDRAEKWYTLALCYSAAGHNETALNLLRKACGSSEAKHMP  353

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             H  S L GAKLCSQ P  + EGI F++  +D   +QN+H L+Q ++ LGVCYG AA+ S 
Sbjct  354   HFRSYLFGAKLCSQYPNHTHEGIKFSQQVIDLAKHQNEHFLNQGQQILGVCYGAAARTSV  413

Query  1508  SDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGS  1687
              DSER  +Q +SLN L +AA+   +DAE  FSLGLE A QRNL  A+ N ++YS+M  GS
Sbjct  414   LDSERIIFQKESLNFLNKAALTGNDDAEATFSLGLENAIQRNLDAAYHNIIRYSDMMVGS  473

Query  1688  TAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMET  1867
             + +GW+LLALIVSA+QRF DAE IVD  LD+ G +DQL+ L+LKA LQIA++ P  A+ET
Sbjct  474   SRRGWQLLALIVSAQQRFKDAETIVDFTLDDAGNVDQLELLRLKAVLQIAQKQPKHAIET  533

Query  1868  YRILLAMIQAQRQSGMD-------------HEVLSDRKLEVEAWLDLARIYIDQDSWPDA  2008
             YR+LLA+I+A+++  +               E L++RKLE+EAW DLA IY D +S+ DA
Sbjct  534   YRVLLAVIEAKKELSLQAKNFEFDPAKIFRDEALTERKLEMEAWQDLATIYADLNSFLDA  593

Query  2009  QVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLM  2188
             + C+DKA+ ++ +SP+SWH TG LFEAQ   KEA V+FS SLSI+PDY+PSI STAE+L+
Sbjct  594   KACVDKAQLLEFFSPRSWHITGMLFEAQSLYKEAFVSFSISLSIEPDYIPSINSTAELLI  653

Query  2189  KMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPV  2368
             K+G Q++PIARS LMNALR+EPT HDAWF+LG +SKMEGS QQAAD FQAA+ELKLSTPV
Sbjct  654   KLGMQSLPIARSFLMNALRLEPTNHDAWFNLGVVSKMEGSLQQAADCFQAAYELKLSTPV  713

Query  2369  QSF  2377
             Q F
Sbjct  714   QKF  716



>ref|XP_006433636.1| hypothetical protein CICLE_v10000426mg [Citrus clementina]
 gb|ESR46876.1| hypothetical protein CICLE_v10000426mg [Citrus clementina]
Length=721

 Score =   843 bits (2177),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/724 (62%), Positives = 559/724 (77%), Gaps = 16/724 (2%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFKFE  +        LATRDFSASG SS  TG  DW+S+ ++ QVDE EST
Sbjct  1     MLCACSGEQFKFEAEDAPQSPES-LATRDFSASGFSSRATG--DWDSKVDDIQVDEAEST  57

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItert----rpr  595
             LKEALSLNYEEARALLGRLEYQRGN+DAALQVFQGIDI +L+PRM++A+ ERT    + R
Sbjct  58    LKEALSLNYEEARALLGRLEYQRGNYDAALQVFQGIDIVSLTPRMTRAVVERTRPLRKHR  117

Query  596   kprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPN  775
                     +   G+MSLHS+SLLLEAILLK+KSL  LG  ++AA+ECK ILDIV+S  PN
Sbjct  118   SKGEKADSVPPPGLMSLHSISLLLEAILLKAKSLEELGHCKEAAKECKIILDIVESGLPN  177

Query  776   GMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQK  955
             GM EG GEDCKLQEMFHKALE LP LW++ GL++EA+ +YRRALVKPWNLD K++AS+Q+
Sbjct  178   GMPEGFGEDCKLQEMFHKALELLPHLWIKAGLLEEAIIAYRRALVKPWNLDPKKVASVQR  237

Query  956   DLAIALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHL  1135
             DLA+ LL+ GVE  L P  K+W    PK+N+EEAILLL +LM K+   E+EWD+E+MDHL
Sbjct  238   DLAVTLLYGGVEARLPPELKVWGPIAPKDNVEEAILLLLILMEKVASKEMEWDAEIMDHL  297

Query  1136  TFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEA  1315
             T+AL+V G+FE LA+ VEQ LPG+  RAERWY L LCYS+AGQNE ALNLL+K+   SEA
Sbjct  298   TYALSVTGQFELLAEYVEQALPGIYNRAERWYILVLCYSAAGQNEAALNLLKKLLCHSEA  357

Query  1316  EHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAA  1495
             +  PHIPS LLGAKLCS D   +REGI FARG + ST +Q +H L++A KFLG+CYGN A
Sbjct  358   KRRPHIPSFLLGAKLCSLDQKNAREGIKFARGVIQSTTSQKEHFLAEAYKFLGICYGNVA  417

Query  1496  KISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEM  1675
             + S SD+ER  +Q ++L SL  A +  +ED E ++ LGLE+A QRN+  AFD A+ YS+ 
Sbjct  418   RKSISDTERVFFQKEALESLNCAFLNEREDPEMMYYLGLEHAVQRNVEAAFDYAIMYSDT  477

Query  1676  TAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQ  1855
              AG++ +GWKLLALI+SA+QR  DA++IVD +LDE G +DQL+ L+LKA LQIA++ P Q
Sbjct  478   VAGNSGRGWKLLALILSADQRLKDAQSIVDFSLDEAGSMDQLELLRLKAVLQIAQEQPKQ  537

Query  1856  AMETYRILLAMIQAQRQ---------SGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDA  2008
             A+ TYRILLAMIQAQR+           +  E  S + LE+  W DLA IY+   S PDA
Sbjct  538   AIGTYRILLAMIQAQRELHSKNFHKTKYITSEAPSVKNLEIATWQDLATIYMKLGSLPDA  597

Query  2009  QVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLM  2188
             ++C +KAK+I+ YSP SWHTTG LFEAQ + KEALV+FS SL+I+PD +PSI+STAE+LM
Sbjct  598   EICTEKAKSIEFYSPGSWHTTGMLFEAQSQYKEALVSFSISLAIEPDCIPSIISTAEILM  657

Query  2189  KMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPV  2368
             K+G Q++PIARS LMNALR+EPT HDAW +LG +SKMEGS QQAAD+FQAA+ELKLS PV
Sbjct  658   KLGRQSMPIARSFLMNALRLEPTNHDAWMNLGLISKMEGSLQQAADYFQAAYELKLSAPV  717

Query  2369  QSFV  2380
             QSFV
Sbjct  718   QSFV  721



>ref|XP_003527736.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X1 
[Glycine max]
 ref|XP_006581267.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X2 
[Glycine max]
 ref|XP_006581268.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X3 
[Glycine max]
 gb|KHN45143.1| Tetratricopeptide repeat protein 7B [Glycine soja]
Length=715

 Score =   842 bits (2176),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/722 (64%), Positives = 564/722 (78%), Gaps = 20/722 (3%)
 Frame = +2

Query  248   MLCACS-GEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVES  424
             MLCACS GEQFKFEEP  +P+S   LATRDFSASGLSS RTG  +WE +F++ QV+E ES
Sbjct  1     MLCACSSGEQFKFEEPPHSPES---LATRDFSASGLSS-RTG--EWEPKFDDTQVEEAES  54

Query  425   TLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkpr  604
             TLK+ALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIK L+PRM KAI ERT+ RK R
Sbjct  55    TLKDALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKGLTPRMIKAIAERTKQRKLR  114

Query  605   ggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMS  784
                  +VV  VMSLHSVSLLLEAILLKS+SL  LG+  +AA+EC+ ILD V+SA PNGM 
Sbjct  115   PKAD-MVVPNVMSLHSVSLLLEAILLKSRSLEELGQCIEAAKECRIILDTVESALPNGMP  173

Query  785   EGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLA  964
             EG+GE CKLQEMFHKALE  P LW++ G +DEAV +YRRALVKPWNL+ ++LA+++KDLA
Sbjct  174   EGIGEGCKLQEMFHKALELFPSLWIKAGFLDEAVTAYRRALVKPWNLEPRKLAAVEKDLA  233

Query  965   IALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFA  1144
             + LL+ GVEV L  + ++W  T PK++ EEAILLL +LM K+   E++WD+E+MDHLTFA
Sbjct  234   MILLYGGVEVSLPSQLQVWGKTAPKSSAEEAILLLLILMSKVAIREIDWDAEIMDHLTFA  293

Query  1145  LTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHE  1324
             L+V G FE LAD+VEQILPG+  RAERWYFLALCYS+AG +  ALNLLRK  GSSEA H 
Sbjct  294   LSVTGMFELLADHVEQILPGIYGRAERWYFLALCYSAAGHDGVALNLLRKACGSSEANHR  353

Query  1325  PHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKIS  1504
             PH PS L GAKLCS DP  + EGI F+R  +     QN+H LSQ  KFLG+CYG AA+IS
Sbjct  354   PHFPSFLFGAKLCSLDPHHAHEGIKFSREVIVIAKQQNEHFLSQGHKFLGICYGAAARIS  413

Query  1505  FSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAG  1684
               DSER+ +Q +SL+SL  AA+   +D E + SLGLE A QRNL  A++N + YS+MT G
Sbjct  414   VLDSERSIFQRESLDSLNCAAVNGSDDLEAIVSLGLENAIQRNLDAAYNNIMMYSDMTVG  473

Query  1685  STAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAME  1864
             S+ +GW+LLALI+SA+QRF DAE IVD ALD++G +DQL+ L+LKA LQI++Q P +A+E
Sbjct  474   SS-RGWQLLALIISAQQRFKDAETIVDFALDDSGGMDQLELLRLKAVLQISQQQPKEAIE  532

Query  1865  TYRILLAMIQAQR-----------QSGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQ  2011
             TYRILLA+IQA++           +    HE L++RKLE+EAW DLA IY D  S  DA+
Sbjct  533   TYRILLALIQAKKELLLQDKNIDQEQAFRHEALTERKLEMEAWQDLATIYTDIGSLLDAK  592

Query  2012  VCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMK  2191
              C+DKA+ I+ +SP+ WH TG L EAQ   KEA V+FS SLSI+PDY+P I+STAE+LMK
Sbjct  593   TCVDKARLIEYFSPRCWHITGMLLEAQSLYKEAFVSFSVSLSIEPDYIPGIISTAELLMK  652

Query  2192  MGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQ  2371
             +G Q++PI RS LMNALR+EPT HDAWF+LG +SKMEGS QQAA+FFQAA+ELKLS PVQ
Sbjct  653   LGMQSLPIVRSFLMNALRLEPTNHDAWFNLGLVSKMEGSLQQAAEFFQAAYELKLSAPVQ  712

Query  2372  SF  2377
              F
Sbjct  713   KF  714



>ref|XP_011017113.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Populus 
euphratica]
 ref|XP_011017114.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Populus 
euphratica]
 ref|XP_011017115.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Populus 
euphratica]
Length=708

 Score =   841 bits (2173),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/718 (63%), Positives = 568/718 (79%), Gaps = 21/718 (3%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFKF+EP+ +P+S   LATRDFSASGLSS  TG  DWES+ E+ QVDE EST
Sbjct  1     MLCACSGEQFKFDEPQQSPES---LATRDFSASGLSSRTTG--DWESKLEDIQVDEAEST  55

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLEYQRGN +AALQVFQGIDIK L+P+M KAI ER   RKPR 
Sbjct  56    LKEALSLNYEEARALLGRLEYQRGNLEAALQVFQGIDIKVLTPKMIKAIVERIHYRKPRS  115

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                 +    VMS+HSVSLL+EAILLK+KSL  LG   +AA+EC+ IL+IV+SA PNGM E
Sbjct  116   KGE-MGPPSVMSMHSVSLLVEAILLKAKSLEELGHHSEAAKECRIILNIVESALPNGMPE  174

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G+GEDCKL+EMFHKALE LP LW + GL+DEA+ SYRRAL +PWNLD + LAS+QK+LA 
Sbjct  175   GIGEDCKLEEMFHKALELLPALWTKAGLLDEAIASYRRALFRPWNLDPQILASVQKELAS  234

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LL++ VE     R  +     P++++EEAILLL +LM K+  GE++WD E+MD LT+AL
Sbjct  235   MLLYSAVEA----RHPL--PAGPQSSIEEAILLLLILMSKVAGGEIKWDEEIMDLLTYAL  288

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             ++VG+FE LA++VEQ LPG+ TRAERWY LALCYS+AGQNE ALNLL+KVSG SE++++P
Sbjct  289   SIVGQFELLAEHVEQALPGVYTRAERWYLLALCYSAAGQNEAALNLLKKVSGCSESKNKP  348

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             HIPS LLGAKLCSQDP  ++EGI+FAR  +D   +QN+H + QA K LG+CYGNAA++S 
Sbjct  349   HIPSFLLGAKLCSQDPMHAQEGINFARKVLDLADHQNQHFIGQAHKCLGICYGNAARVSL  408

Query  1508  SDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGS  1687
             SDSER     +S+NSL  AA+   ED E ++SLGLE   QRNL  AFDNA+  SEM AG+
Sbjct  409   SDSERFLLHKESVNSLNNAALNRNEDPEVMYSLGLENMLQRNLGAAFDNAIVCSEMMAGN  468

Query  1688  TAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMET  1867
             T KGWKLLAL+VSAEQRF DA+ +V+ ALD   +I+Q + L+LKA LQIA++ P QA+ET
Sbjct  469   TMKGWKLLALVVSAEQRFRDAQTVVEFALDAAERIEQFELLRLKAVLQIAQEQPKQAIET  528

Query  1868  YRILLAMIQAQRQ-SGMDH--------EVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCI  2020
             YR+LL++IQAQR     +H        EVL++R LE+ AW DLA IY    SW DA++C+
Sbjct  529   YRVLLSLIQAQRDVQAKNHEQAHILKSEVLAERNLELAAWQDLADIYTKIGSWSDAKICV  588

Query  2021  DKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGS  2200
             DKAK ++ +SP+SWH+TG LFE+Q   KEALV+FS SLS++PDYVPSIV+TAEV+MK+G+
Sbjct  589   DKAKLMEFHSPRSWHSTGMLFESQSLHKEALVSFSVSLSVEPDYVPSIVATAEVMMKLGT  648

Query  2201  QAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQS  2374
             Q++PIARS LM+ALR++PT H+AW +LG +SKMEGS +QAA+FFQAAHELKLS P+QS
Sbjct  649   QSLPIARSFLMHALRLDPTNHEAWLNLGLISKMEGSLKQAAEFFQAAHELKLSAPIQS  706



>ref|XP_007160913.1| hypothetical protein PHAVU_001G027700g [Phaseolus vulgaris]
 ref|XP_007160914.1| hypothetical protein PHAVU_001G027700g [Phaseolus vulgaris]
 gb|ESW32907.1| hypothetical protein PHAVU_001G027700g [Phaseolus vulgaris]
 gb|ESW32908.1| hypothetical protein PHAVU_001G027700g [Phaseolus vulgaris]
Length=710

 Score =   838 bits (2166),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/716 (64%), Positives = 557/716 (78%), Gaps = 13/716 (2%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFKFEE   +P+S   LATRDFSASGLSS RTG  DWES+F+E QVDEVEST
Sbjct  1     MLCACSGEQFKFEEAPQSPES---LATRDFSASGLSS-RTG--DWESKFDETQVDEVEST  54

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKE LSLNYEEARALLGRLE+QRGNFDAAL VF+GIDI+ L+PRM +AI ERT+ RKPR 
Sbjct  55    LKETLSLNYEEARALLGRLEFQRGNFDAALLVFEGIDIRALAPRMIRAIAERTKQRKPRS  114

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                  V+  VMS+HSVSLLLEAILLKSKSL  LGR  +AA+EC+ I+D V+SA P GM E
Sbjct  115   KVDN-VLPNVMSMHSVSLLLEAILLKSKSLEELGRYTEAAKECRIIVDTVESALPKGMPE  173

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G+GEDCKLQEMF+KALE LP LW++ G +DEAV +YRRAL+KPWNL+  RLAS+QKDLA 
Sbjct  174   GIGEDCKLQEMFYKALELLPNLWIKAGFLDEAVTAYRRALIKPWNLEPWRLASVQKDLAT  233

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LL+ GVEV+L  + ++   T P +  EEAILLL +L GK+   E++WD E+MDHLTF+L
Sbjct  234   TLLYGGVEVNLPSQLQVNGLTTPMSGTEEAILLLLILSGKMALQEIDWDPEIMDHLTFSL  293

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             ++ G FESLADN+E+ILPG+  RAERWYFLALCYS+A QNE ALNLLRK  GSSEA+H P
Sbjct  294   SITGMFESLADNLEKILPGLYDRAERWYFLALCYSAARQNEVALNLLRKACGSSEAKHRP  353

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             + PS L GAKLCS  P  + EGI F++  +D   +QN+H L + +KFLG C G AA+IS 
Sbjct  354   YFPSFLFGAKLCSLCPNHAHEGIKFSQEVIDLAKHQNEHFLGEGQKFLGTCQGAAARISV  413

Query  1508  SDSERNSYQTQSLNSLTQAAML-CKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAG  1684
              DSER  +Q QSL+ L  A  L    D E +FSLGLE A QRNL  A+DN + YS+M AG
Sbjct  414   LDSERIIFQRQSLSFLNDAVALNGNNDPEVIFSLGLETAIQRNLNAAYDNLMIYSDMMAG  473

Query  1685  STAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAME  1864
             S+ +GW+LLALIVSA+QRF DAE IVD ALDE   IDQL+ L+LKA LQI +Q P QA+E
Sbjct  474   SSKRGWQLLALIVSAQQRFKDAETIVDFALDEACSIDQLELLRLKAILQITQQQPKQAIE  533

Query  1865  TYRILLAMIQAQRQ-----SGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKA  2029
             TYRILLA+I++Q+          HE L+ +KLE+EAW DLA IY+D  S+ DA+VC+DKA
Sbjct  534   TYRILLAVIESQKDHWLQAKAFRHEALTQQKLEMEAWQDLATIYVDLCSFLDAKVCVDKA  593

Query  2030  KTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAV  2209
             + ID +SP+SWH TG LFE++   KEAL +FS SLSI+PDY+PSI+S A++L+K+G Q +
Sbjct  594   QLIDFFSPRSWHITGLLFESRTMHKEALASFSVSLSIEPDYIPSIISAAKLLLKLGMQPL  653

Query  2210  PIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             PIARS LMNALR++PT HDAWF+LG +SKMEGS QQAAD FQAA+ELKLS PVQ F
Sbjct  654   PIARSFLMNALRLDPTNHDAWFNLGLVSKMEGSLQQAADCFQAAYELKLSAPVQKF  709



>gb|KHG17915.1| Tetratricopeptide repeat 7A [Gossypium arboreum]
Length=712

 Score =   830 bits (2145),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/720 (62%), Positives = 559/720 (78%), Gaps = 17/720 (2%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFKFE+   +P+S   LATRDFSASGLSS    T DWES+ E+ QVDEVEST
Sbjct  1     MLCACSGEQFKFEDAPQSPES---LATRDFSASGLSSL---TGDWESKLEDVQVDEVEST  54

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIK L+PRM+ AI ERTR RK R 
Sbjct  55    LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKGLTPRMTTAIVERTRLRKSRS  114

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                 I+   VMS+HSVSLLLEAI LK+KSL  LG I++AA+ECK ILD+V++A PNGM E
Sbjct  115   KAD-IIPPSVMSMHSVSLLLEAIFLKAKSLEELGHIKEAAKECKLILDVVEAALPNGMHE  173

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G+ EDCKLQEMFH+ALE LP LW++ G ++EA+ +YRRAL+KPWNLD++RLAS+QK+LA 
Sbjct  174   GIAEDCKLQEMFHRALELLPNLWIKIGYLNEAITAYRRALIKPWNLDSQRLASVQKNLAA  233

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LL+ GVE  L P  ++W  T P N +EEAILLL  LM K+  GE++WD+E+MDHL FAL
Sbjct  234   MLLYGGVETSLPPPLRVWGLTTP-NCIEEAILLLLALMQKVAFGEIKWDAEIMDHLNFAL  292

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             +V G FE LA +VEQ+ PG+  RA+RWYFLALCY++AGQNE ALNLL+KVS  SEA+ EP
Sbjct  293   SVSGHFELLAAHVEQVSPGIYERADRWYFLALCYAAAGQNEVALNLLKKVSSQSEAKREP  352

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
              I +LLLGA + SQDP  + +GI+FAR  +D     N H  +QA KFLG+CYGNAA+IS 
Sbjct  353   DILALLLGAYISSQDPKHAHDGITFARYVIDLEDEMNGHFKAQAHKFLGICYGNAARISI  412

Query  1508  SDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGS  1687
             SDSER  +  +SL+SL  AA   KED E +F+L LE A QRNL  AFDNA++YS + A +
Sbjct  413   SDSERALFLKESLSSLNYAAFNMKEDPEVMFNLSLENAVQRNLDLAFDNAMKYSSVVAEN  472

Query  1688  TAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMET  1867
             + +GWKLLALI+SA++RF DAE I++ ALDE    DQ + L+LKA LQIA++ P QA+ET
Sbjct  473   SGRGWKLLALILSADRRFKDAETILEFALDEASGSDQFELLRLKAVLQIAQERPKQAIET  532

Query  1868  YRILLAMIQAQRQSGMDH---------EVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCI  2020
             Y ILL+ IQAQR++  ++         E +++R +E+  W DLA +Y    SWPDA++C+
Sbjct  533   YSILLSQIQAQREAQSNNSGHAKSSHTENIAERNMEMAVWQDLATVYTKFGSWPDAEICL  592

Query  2021  DKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGS  2200
             + AK+I+ YSP+SWHTTG LFEAQ   KEALV+FS SLSI+PDYVP IVSTA VL+K+G 
Sbjct  593   NNAKSIEFYSPKSWHTTGLLFEAQSLYKEALVSFSVSLSIEPDYVPIIVSTAAVLIKLGG  652

Query  2201  QAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSFV  2380
             Q++P+ARS LMNALR++PT HDAW +LG ++KMEGS Q AAD+FQAA+ELKLS PV++F 
Sbjct  653   QSLPVARSFLMNALRLDPTNHDAWMNLGLIAKMEGSLQLAADYFQAAYELKLSAPVEAFT  712



>ref|XP_008444544.1| PREDICTED: tetratricopeptide repeat protein 7B [Cucumis melo]
 ref|XP_008444545.1| PREDICTED: tetratricopeptide repeat protein 7B [Cucumis melo]
 ref|XP_008444546.1| PREDICTED: tetratricopeptide repeat protein 7B [Cucumis melo]
 ref|XP_008444547.1| PREDICTED: tetratricopeptide repeat protein 7B [Cucumis melo]
 ref|XP_008444548.1| PREDICTED: tetratricopeptide repeat protein 7B [Cucumis melo]
 ref|XP_008444549.1| PREDICTED: tetratricopeptide repeat protein 7B [Cucumis melo]
Length=717

 Score =   828 bits (2138),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/723 (62%), Positives = 561/723 (78%), Gaps = 18/723 (2%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFKFEEP  +P+S   LATRDFSAS LSS RTG  DW+ +FE++QVDEVEST
Sbjct  1     MLCACSGEQFKFEEPPQSPES---LATRDFSASCLSS-RTG--DWDLKFEDSQVDEVEST  54

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             L+EALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIK+L+PRM KAITE+TR  KPR 
Sbjct  55    LREALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKSLTPRMVKAITEKTREEKPRP  114

Query  608   gkgeIVV-SGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMS  784
                   + SGVMS+HSVSLLLEAILLK+KSL  LGR  ++A+EC+ ILD V+SA PNGM 
Sbjct  115   KGDSTALPSGVMSMHSVSLLLEAILLKAKSLEELGRYIESAKECRIILDTVESALPNGMP  174

Query  785   EGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLA  964
             E +GEDCKLQEMFH+ALE LP LW++ G +DEA+N+YRR LVKPWNLD  +LA++QK+LA
Sbjct  175   ECIGEDCKLQEMFHRALELLPTLWIKGGYLDEAINAYRRVLVKPWNLDPNKLAAIQKELA  234

Query  965   IALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFA  1144
               LL+ GVE  L  +F ++    PKNN+EEAILLL +LM K+   E+ WD E+M+HLT+A
Sbjct  235   GTLLYGGVEASLPLKFHVFGPRTPKNNVEEAILLLLILMRKVAMQEINWDPEIMNHLTYA  294

Query  1145  LTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHE  1324
             L++  +FE LA++VE+ILPG+ +RAERWYFLALCY++AGQNE ALNLL KV GSSE  H+
Sbjct  295   LSITRQFELLAEHVERILPGIYSRAERWYFLALCYNAAGQNEAALNLLTKVCGSSEVNHK  354

Query  1325  PHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKIS  1504
             PH  S L  AKLCS+D   +R+GI FAR  M+    Q+KH   +A KFLG+CYGN A+ S
Sbjct  355   PHFHSFLFLAKLCSEDTKYARDGIKFARIMMNMASEQSKHFNPEAHKFLGICYGNVARAS  414

Query  1505  FSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAG  1684
              SDSER  +Q +SLNSL  +++  + D E +F++ LE A QRNL  AF +A+ YS M A 
Sbjct  415   VSDSERTLFQKESLNSLRVSSLSRRHDPEVMFNISLENAVQRNLDVAFYSAMAYSNMVAD  474

Query  1685  STAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAME  1864
              + +GWKLL LI+SAE+R +DAE IVD ALDE  ++DQL FL+LKA L+IA++ P QA+E
Sbjct  475   GSGRGWKLLTLILSAEKRLTDAETIVDFALDEVDRMDQLDFLRLKAVLKIAQEQPKQAIE  534

Query  1865  TYRILLAMIQAQ-----------RQSGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQ  2011
             TYRILLA+IQA+           +   ++ E +++R LE  AW DLA IY    SW DA+
Sbjct  535   TYRILLALIQARDEHQLQTKNFDQSKDLELEAVAERNLERAAWQDLAAIYSKLASWADAE  594

Query  2012  VCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMK  2191
             +C++KAK++D + P+ WHTTG  FEA+   KEALV+FS +LSIDPDY+PSI+STAEVLMK
Sbjct  595   ICLNKAKSLDFHCPRGWHTTGKYFEARSLHKEALVSFSVALSIDPDYIPSIISTAEVLMK  654

Query  2192  MGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQ  2371
              G+Q++PIARSLLMNA+R++PT H+AWF+LG LSKMEG   Q+ADFFQAAHEL+LS P Q
Sbjct  655   CGNQSLPIARSLLMNAVRLDPTSHEAWFNLGMLSKMEGLFLQSADFFQAAHELQLSAPPQ  714

Query  2372  SFV  2380
             SFV
Sbjct  715   SFV  717



>gb|EYU25515.1| hypothetical protein MIMGU_mgv1a002318mg [Erythranthe guttata]
Length=688

 Score =   827 bits (2135),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/715 (62%), Positives = 546/715 (76%), Gaps = 35/715 (5%)
 Frame = +2

Query  248   MLCACSGEQFK---FeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEV  418
             MLCACSGEQFK        P     ESLATRDFS SGLSS    T DWES+ E+AQVDE 
Sbjct  1     MLCACSGEQFKTEEAAAAAPPHSPAESLATRDFSVSGLSS----TIDWESKLEDAQVDEA  56

Query  419   ESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprk  598
             ESTLKEALSLNYEEARALLGRLEYQ+GN+DAALQVFQGIDIK LSPRMSKAI E TRPRK
Sbjct  57    ESTLKEALSLNYEEARALLGRLEYQKGNYDAALQVFQGIDIKLLSPRMSKAIAEGTRPRK  116

Query  599   prggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNG  778
              R     + +S  MSLHSVSLLLEAILLKSKSLA LGRI+++A+ECK ILD V+SA PNG
Sbjct  117   SRSRGRNVKLSASMSLHSVSLLLEAILLKSKSLAELGRIKESAKECKLILDTVESALPNG  176

Query  779   MSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKD  958
               + + +D KL E FH ALE LP LW+  G +DE+V +YRRAL+KPWNL  +RLA +QKD
Sbjct  177   THQNINQDTKLLETFHTALELLPTLWLHAGHLDESVTAYRRALLKPWNLHPQRLAKLQKD  236

Query  959   LAIALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLT  1138
             LA  LL++G+                   +EE+ILLLFVLM KI   E+ WD ++MDHLT
Sbjct  237   LASTLLYSGI------------------GIEESILLLFVLMHKILHCEIAWDPQIMDHLT  278

Query  1139  FALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAE  1318
             FAL++ G+FE LA++VEQ+LPG+  R ERWYFLALCYS+AG N TALNLL+KVSG SE  
Sbjct  279   FALSISGQFEYLANHVEQVLPGVYNRVERWYFLALCYSAAGDNRTALNLLKKVSGFSENN  338

Query  1319  HEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNK-HLLSQARKFLGVCYGNAA  1495
              + H+PS LLGAKLCSQDP + +EGI+FA   +++ + +N+ H++SQA KFLG+CYGN A
Sbjct  339   KKTHLPSFLLGAKLCSQDPNECKEGINFAHRVINAPLGKNEHHIVSQAHKFLGLCYGNLA  398

Query  1496  KISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEM  1675
             +IS SD ER     +S++SL +    CK D E +F LG+E A QRNLT AFD A+ YS+ 
Sbjct  399   RISVSDFERVRLHRESIDSLNRT---CK-DPEIIFCLGMENAVQRNLTLAFDRAMVYSKT  454

Query  1676  TAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQ  1855
             + GS+ K WKLLALI SAEQR  DAEAIVD+ALDETG IDQL+ L+LKA +QIA++ P +
Sbjct  455   SGGSSVKVWKLLALIASAEQRLKDAEAIVDVALDETGNIDQLELLRLKAIVQIAQEQPKR  514

Query  1856  AMETYRILLAMIQAQRQSGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKT  2035
             A+ETYRILL+++Q       +  ++ +R+LE+EAWLDLA +Y + + W D+ +CI KA++
Sbjct  515   AIETYRILLSLVQG----NTNEVIVGERRLELEAWLDLAGLYSEHELWVDSDICIKKARS  570

Query  2036  IDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGS-QAVP  2212
             I  YSP+SWHTTG LFEAQE+ KEA+VAFS SLSID DYVPSI+STAE LMKMG+ +++P
Sbjct  571   IQFYSPRSWHTTGRLFEAQEQYKEAIVAFSVSLSIDSDYVPSIISTAETLMKMGNKKSIP  630

Query  2213  IARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             IA+S LMNA+R+EPT HDAWF+LGK+ K+EG  +QAAD FQAAHELKLS PVQSF
Sbjct  631   IAKSFLMNAVRLEPTNHDAWFNLGKIYKIEGLFEQAADSFQAAHELKLSAPVQSF  685



>gb|AES59318.2| TPR 7B-like protein [Medicago truncatula]
Length=717

 Score =   816 bits (2107),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/723 (61%), Positives = 555/723 (77%), Gaps = 20/723 (3%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQ KFEE   +P S   LATRDFSASGLSS RTG  DW+S+  E QV++ ES+
Sbjct  1     MLCACSGEQHKFEEAPQSPDS---LATRDFSASGLSS-RTG--DWDSKLNENQVEDAESS  54

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEA SLNYEEARALLGRLEYQRGNF+AAL V QGIDI TL+PRM +AI ER + RKPR 
Sbjct  55    LKEAASLNYEEARALLGRLEYQRGNFEAALHVLQGIDISTLTPRMIRAIAERNKLRKPRS  114

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
               G  V+  +MS+HSVSLLLEAILLK+KSL  + +  +AA+EC+ I+D ++SA PNGM +
Sbjct  115   KAGT-VLPNLMSMHSVSLLLEAILLKAKSLEEMKQYTEAAKECRIIVDTIESALPNGMPD  173

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G+GE+CKLQEMFHKALE LP LW++ G +DEAV +YRRALVKPWNL+ +RLA +QKDLA 
Sbjct  174   GIGEECKLQEMFHKALELLPNLWIKAGFLDEAVTAYRRALVKPWNLEPRRLACLQKDLAT  233

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LL+ GVEV+L    ++  ST P +N+EEAILLL +L GK+   E++WD+E+  HLTF+L
Sbjct  234   TLLYGGVEVNLPSHLQVNGSTAPMSNIEEAILLLLILSGKMALQEIDWDAEITGHLTFSL  293

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             ++ G F+SLA+ VEQILPG+  RA+RWYFLALCYS+AGQNE ALNLLRK  GSSE+EH P
Sbjct  294   SMTGMFQSLAECVEQILPGIFGRADRWYFLALCYSAAGQNEAALNLLRKACGSSESEHMP  353

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             H PS L GAKLCSQ P  + EGI F++  +D   +QN+H L Q ++ LGVCYG AA+ S 
Sbjct  354   HFPSYLFGAKLCSQYPNHAHEGIKFSQQVIDLAKHQNEHFLVQGQQILGVCYGAAARTSV  413

Query  1508  SDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGS  1687
              DSER  +Q +SLN L +AA+    D E +FSLGLE A QRNL  A+ N ++YS+M  GS
Sbjct  414   VDSERVQFQRESLNFLNEAALTGNNDLEVMFSLGLENAIQRNLDAAYQNIMRYSDMMVGS  473

Query  1688  TAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMET  1867
             + +GW+LLALIVSA+QRF DAE IV+  LD+TG +DQL+ L+LKA LQIA+Q P QA+ET
Sbjct  474   STRGWQLLALIVSAQQRFKDAETIVEFGLDDTGSVDQLELLRLKAVLQIAQQQPKQAIET  533

Query  1868  YRILLAMIQAQRQSGMD-------------HEVLSDRKLEVEAWLDLARIYIDQDSWPDA  2008
             YR LLA+I+A+++  +               E L++RKLE+EAW D+A IY D +S+ DA
Sbjct  534   YRTLLAVIKAKKEILLQAESFEFDQAKIFRDEALTERKLEMEAWQDMATIYTDLNSFLDA  593

Query  2009  QVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLM  2188
             + C+DKA+ ++ +SP+SWH TG LFEAQ   KEA V+FS SLSI+PDY+ SI STA++L+
Sbjct  594   KACVDKAQLLEFFSPRSWHITGMLFEAQSLYKEAFVSFSISLSIEPDYIQSINSTAKLLI  653

Query  2189  KMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPV  2368
             K+G Q++P+ARS LMNALR+EP  HDAWF+LG +SKMEGS +QAAD FQAA+ELKLS PV
Sbjct  654   KLGMQSLPLARSFLMNALRLEPANHDAWFNLGLVSKMEGSLEQAADCFQAAYELKLSAPV  713

Query  2369  QSF  2377
             Q F
Sbjct  714   QQF  716



>ref|XP_004142894.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Cucumis 
sativus]
 ref|XP_004156382.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Cucumis 
sativus]
 gb|KGN62445.1| hypothetical protein Csa_2G354710 [Cucumis sativus]
Length=717

 Score =   815 bits (2106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/723 (62%), Positives = 555/723 (77%), Gaps = 18/723 (2%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFKFEEP  +P+S   LATRDFSAS LSS RTG  DW+ +FE++QVDEVEST
Sbjct  1     MLCACSGEQFKFEEPPQSPES---LATRDFSASCLSS-RTG--DWDLKFEDSQVDEVEST  54

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             L+EALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIK+L+PRM KAITE+TR  KPR 
Sbjct  55    LREALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKSLTPRMVKAITEKTREEKPRP  114

Query  608   gkgeIVV-SGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMS  784
                     SGVMS+HSVSLLLEAILLK+KSL  LGR  ++A+EC+ ILD V+SA PNGM 
Sbjct  115   KGDSTAPPSGVMSMHSVSLLLEAILLKAKSLEELGRYIESAKECRIILDTVESALPNGMP  174

Query  785   EGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLA  964
             E +GEDCKLQEMFH+ALE LP LW   G +DEA+N+YRR LVKPWNLD  +LA++QK+LA
Sbjct  175   ECIGEDCKLQEMFHRALELLPTLWTNGGCLDEAINAYRRVLVKPWNLDPNKLAAIQKELA  234

Query  965   IALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFA  1144
               LL+ GVE  L  +F ++    PKNN+EEAILLL +L+ K+   E+ WD E+M+HLT+A
Sbjct  235   GTLLYGGVEASLPLKFHVFGPRTPKNNVEEAILLLLILVRKVAMQEINWDPEIMNHLTYA  294

Query  1145  LTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHE  1324
             L++  +FE LA++VE+ILPG+ +RAERWYFLALCY++A QNE ALNLL KV GSSE  H+
Sbjct  295   LSITRQFELLAEHVERILPGIYSRAERWYFLALCYNAAEQNEAALNLLTKVCGSSEVNHK  354

Query  1325  PHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKIS  1504
             PH  S LL AKLCS+D   +R+GI FA   M+    Q+KH   +A K+LG+CYGNAA+ S
Sbjct  355   PHFHSFLLLAKLCSEDTKYARDGIKFAHIMMNMASEQSKHFNPEAHKYLGICYGNAARAS  414

Query  1505  FSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAG  1684
              SDSER  +Q +SLNSL  +++  + D E +F++ LE A QRNL  AF +A+ YS M A 
Sbjct  415   VSDSERTLFQKESLNSLRISSLSRRHDPEVMFNISLENAVQRNLDVAFYSAMAYSNMVAD  474

Query  1685  STAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAME  1864
              + +GWKLL LI+SAE+R  DAE IVD ALDE  ++DQL FL+LKA L+IA++ P QA+E
Sbjct  475   GSGRGWKLLTLILSAEKRLMDAETIVDFALDEADRMDQLDFLRLKAVLKIAQEQPKQAIE  534

Query  1865  TYRILLAMIQAQ-----RQSGMDH------EVLSDRKLEVEAWLDLARIYIDQDSWPDAQ  2011
             TYRILLA+IQA+     R    D       E +++R LE  AW DLA IY    SW DA+
Sbjct  535   TYRILLALIQARDEHQLRTKNFDQSKDLELEAVAERNLERAAWQDLAAIYSKLASWADAE  594

Query  2012  VCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMK  2191
             +C++KAK++D + P+ WHTTG  FEA+   KEALV+FS +LSIDPDY+PSI+STAEVLMK
Sbjct  595   ICLNKAKSLDFHCPRGWHTTGKYFEARSLHKEALVSFSVALSIDPDYIPSIISTAEVLMK  654

Query  2192  MGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQ  2371
              G+Q++PIARSLLMNA+R++PT H+AW +LG LSKMEG   QAADFFQAAHEL+LS P Q
Sbjct  655   CGNQSLPIARSLLMNAVRLDPTSHEAWLNLGMLSKMEGLLLQAADFFQAAHELQLSAPPQ  714

Query  2372  SFV  2380
             SFV
Sbjct  715   SFV  717



>gb|KDO81501.1| hypothetical protein CISIN_1g005603mg [Citrus sinensis]
Length=688

 Score =   803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/724 (60%), Positives = 536/724 (74%), Gaps = 49/724 (7%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFKFE  +        LATRDFSASG SS  TG  DW+S+ ++ QVDE EST
Sbjct  1     MLCACSGEQFKFEAEDAPQSPES-LATRDFSASGFSSRATG--DWDSKVDDIQVDEAEST  57

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItert----rpr  595
             LKEALSLNYEEARALLGRLEYQRGN+DAALQVFQGIDI +L+PRM++A+ ERT    + R
Sbjct  58    LKEALSLNYEEARALLGRLEYQRGNYDAALQVFQGIDIVSLTPRMTRAVVERTRPLRKHR  117

Query  596   kprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPN  775
                     +   G+MSLHS+SLLLEAILLK+KSL  LG  ++AA+ECK ILDIV+S  PN
Sbjct  118   SKGEKADSVPPPGLMSLHSISLLLEAILLKAKSLEELGHCKEAAKECKIILDIVESGLPN  177

Query  776   GMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQK  955
             GM EG GEDCKLQEMFHKALE LP LW++ GL++EA+ +YRRALVKPWNLD K++AS+Q+
Sbjct  178   GMPEGFGEDCKLQEMFHKALELLPHLWIKAGLLEEAIIAYRRALVKPWNLDPKKVASVQR  237

Query  956   DLAIALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHL  1135
             DLA+ LL+ GVE  L P  K+W    PK+N+EEAILLL +LM K+   E+EWD+E+MDHL
Sbjct  238   DLAVTLLYGGVEARLPPELKVWGPIAPKDNVEEAILLLLILMEKVASKEMEWDAEIMDHL  297

Query  1136  TFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEA  1315
             T+AL+V G+FE LA+ VEQ LPG+  RAERWY LALCYS+AGQNE ALNLL+K   S   
Sbjct  298   TYALSVTGQFELLAEYVEQALPGIYNRAERWYILALCYSAAGQNEAALNLLKKDQVS---  354

Query  1316  EHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAA  1495
                                           RG + ST +Q +H L++A KFLG+CYGN A
Sbjct  355   ------------------------------RGVIQSTTSQKEHFLAEAYKFLGICYGNVA  384

Query  1496  KISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEM  1675
             + S SD+ER  +Q ++L SL  A +  +ED E ++ LGLE+A QRN+  AFD A+ YS+ 
Sbjct  385   RKSISDTERVFFQKEALESLNCAFLNEREDPEMMYYLGLEHAVQRNVEAAFDYAIMYSDT  444

Query  1676  TAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQ  1855
              AG++ +GWKLLALI+SA+QR  DA++IVD +LDE G +DQL+ L+LKA LQIA++ P Q
Sbjct  445   VAGNSGRGWKLLALILSADQRLKDAQSIVDFSLDEAGSMDQLELLRLKAVLQIAQEQPKQ  504

Query  1856  AMETYRILLAMIQAQRQ---------SGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDA  2008
             A+ TYRILLAMIQAQR+           +  E  S + LE+  W DLA IY+   S PDA
Sbjct  505   AIGTYRILLAMIQAQRELHSKNFHKTKYITSEAPSVKNLEIATWQDLATIYMKLGSLPDA  564

Query  2009  QVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLM  2188
             ++C +KAK+I+ YSP SWHTTG LFEAQ + KEALV+FS SL+I+PDY+PSI+STAE+LM
Sbjct  565   EICTEKAKSIEFYSPGSWHTTGMLFEAQSQYKEALVSFSISLAIEPDYIPSIISTAEILM  624

Query  2189  KMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPV  2368
             K+G Q++PIARS LMNALR+EPT HDAW +LG +SKMEGS QQAAD+FQAA+ELKLS PV
Sbjct  625   KLGRQSMPIARSFLMNALRLEPTNHDAWMNLGLISKMEGSLQQAADYFQAAYELKLSAPV  684

Query  2369  QSFV  2380
             QSFV
Sbjct  685   QSFV  688



>ref|XP_010061675.1| PREDICTED: tetratricopeptide repeat protein 7B [Eucalyptus grandis]
 gb|KCW68652.1| hypothetical protein EUGRSUZ_F02252 [Eucalyptus grandis]
Length=713

 Score =   803 bits (2074),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/720 (63%), Positives = 567/720 (79%), Gaps = 16/720 (2%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFK E+P  +PQS   LATRDFSASGLSS RTG  DWES+FE+ QVDEVEST
Sbjct  1     MLCACSGEQFKIEDPPQSPQS---LATRDFSASGLSS-RTG--DWESKFEDTQVDEVEST  54

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLE+QRGN+DAALQVFQGIDIK L+PRM KAITERTR RKPR 
Sbjct  55    LKEALSLNYEEARALLGRLEFQRGNYDAALQVFQGIDIKVLTPRMKKAITERTRQRKPRS  114

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                 + V+ V+SLHSVSLLLEAI LK++SL GLG   +AA+ECK ILDIV+SA PNGM E
Sbjct  115   RGDNVPVN-VLSLHSVSLLLEAIFLKARSLEGLGCYIEAAKECKIILDIVESALPNGMRE  173

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G+ +DCKLQEMFHKALE  P LW++ GL+DEA+ +YRRAL++PWNL  ++LA++QK+LA 
Sbjct  174   GIADDCKLQEMFHKALELQPDLWIRAGLLDEAIAAYRRALMRPWNLHPQKLATVQKELAS  233

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LL+ G+E  L  +   W  T PK+NMEEAILLL +LM K+  GE++WD ++++HL++AL
Sbjct  234   ILLYGGLEASLPLQLPSWAPTAPKSNMEEAILLLLLLMRKVIFGEIDWDGDIINHLSYAL  293

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             +V G++E LA + EQ+LPG+  RAERWYFLALCY++AG N+TALNLL+K+SGSSEA+H+P
Sbjct  294   SVTGQYELLATHYEQVLPGVYARAERWYFLALCYAAAGHNDTALNLLKKISGSSEAKHKP  353

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             HIPSLLLGAKLCSQ    + +G+ FAR  ++      KH  SQA KFLG+CYGNAA++S 
Sbjct  354   HIPSLLLGAKLCSQGLKHANDGVKFAREVIELGTTCAKHFSSQAHKFLGICYGNAARVSV  413

Query  1508  SDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGS  1687
             SDSER   Q +SLN L  A +  K+D E +++L LE A QRNL  AF++AL YS+  AG+
Sbjct  414   SDSERILLQRESLNYLNHAVLSGKDDPEIMYNLALENAVQRNLEAAFESALMYSDTEAGN  473

Query  1688  TAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMET  1867
             + +  KLL LI+S+EQR+ DAE++VD ALDE G++DQL+ L+LKA LQI R+ P QA+ET
Sbjct  474   SGRCCKLLTLILSSEQRYIDAESVVDFALDEAGKLDQLELLRLKAVLQITREKPQQAIET  533

Query  1868  YRILLAMIQAQRQ---------SGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCI  2020
             YRILLAMIQAQR+           +  E   DR LE+  W DLA +Y    SW DA+ C+
Sbjct  534   YRILLAMIQAQREIEAKTSDQVKQVTSEAQDDRNLEISVWQDLALLYARLGSWADAETCL  593

Query  2021  DKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGS  2200
              KAK+I  YSP+SWHTTG +FEAQ   KEALV+FS SLS++PDYVPSI+STAEVLMK+GS
Sbjct  594   GKAKSIHFYSPRSWHTTGLVFEAQSLYKEALVSFSLSLSLEPDYVPSIISTAEVLMKLGS  653

Query  2201  QAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSFV  2380
              ++PIARS LM+ALR EPT H+AWF+LGKLSKMEGS  QAADFFQAA+EL+LS P+++FV
Sbjct  654   HSLPIARSFLMSALRKEPTNHEAWFNLGKLSKMEGSLHQAADFFQAAYELQLSAPIENFV  713



>ref|XP_008352491.1| PREDICTED: LOW QUALITY PROTEIN: tetratricopeptide repeat protein 
7A-like [Malus domestica]
Length=743

 Score =   796 bits (2057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/752 (58%), Positives = 550/752 (73%), Gaps = 50/752 (7%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLC+CSG+QFKFEEP   P+S   LAT DF AS LSS    T+DW+S+FE+ QVDE EST
Sbjct  1     MLCSCSGQQFKFEEPPHXPES---LATSDFLASALSSR---TSDWDSKFEDIQVDEAEST  54

Query  428   LKEALSLNYE--------------------------------EARALLGRLEYQRGNFDA  511
             LKEALSLNYE                                +   LLGRLE+QRGNF+A
Sbjct  55    LKEALSLNYEVTVFVSLFEIHVLNXKXRKLKTEMVIKRALNLKQELLLGRLEFQRGNFEA  114

Query  512   ALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKSK  691
             ALQVFQ ++I+ L+P M+KAI ERTR RKPR    ++V+  VMS+HSVSLL+EAILLK++
Sbjct  115   ALQVFQVLEIRNLTPGMAKAIVERTRQRKPRTKGNDVVLPSVMSMHSVSLLIEAILLKAR  174

Query  692   SLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGL  871
             S   LGR  +AA+ CK ILD V+SA PNGM E +GEDCKL +MFHKALE LP LW + G 
Sbjct  175   SXGELGRYIEAAKXCKVILDTVESALPNGMPEDIGEDCKLPDMFHKALELLPILWTKAGY  234

Query  872   IDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRFKIWCSTPPKNNME  1051
             +DEA+ +YR AL+KPWN++  RLA++QK LA+ LL+ GVE +L P+ +IW +T PKNN E
Sbjct  235   LDEAITAYRWALIKPWNMEPDRLAAIQKSLALTLLYGGVEANLPPQLQIWGTTLPKNNTE  294

Query  1052  EAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERWY  1231
             EAILLL +LM K+   E++WD E+MDH T+AL+V   +E LAD+VEQ LPG+ TRAE+WY
Sbjct  295   EAILLLVILMKKVALREIKWDPEIMDHRTYALSVTRLYELLADHVEQALPGLYTRAEKWY  354

Query  1232  FLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARG  1411
             FLALCY++ G+NE ALNLL+KV+G SEA+++PH PS LLGAKLCSQ P  +REGI F+R 
Sbjct  355   FLALCYTACGKNEAALNLLKKVAGCSEAKNKPHFPSFLLGAKLCSQYPIHAREGIDFSRK  414

Query  1412  AMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAE  1591
             A+    +Q +H + Q  K+LGVCYG AA+ S SD ER S+Q +SLNSL  AA+  KED +
Sbjct  415   AIGLVNHQCQHFMGQCHKYLGVCYGGAARASVSDFERMSFQRESLNSLNHAALNRKEDPD  474

Query  1592  TVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLA  1771
              +FSLGLE A QRNL  AF+NA++YS+M AGS+ +G KLLALIVSAEQRF   + IVD A
Sbjct  475   VMFSLGLENAVQRNLDAAFENAMKYSDMVAGSSGQGRKLLALIVSAEQRF---KXIVDFA  531

Query  1772  LDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQR---------QSGMDHE  1924
             LD  G++DQL+ L+LKA LQ+A++ P QA+ETYRILL +++AQR         +   D E
Sbjct  532   LDGAGRVDQLELLRLKAVLQVAQELPKQAIETYRILLTLLRAQRDQKANNSEQEKTFDSE  591

Query  1925  VLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCK  2104
                +R LE EA  DLA +Y     W DA++C++KAK ID YS  +WHTTG LFEAQ   K
Sbjct  592   AFVERNLEKEAXRDLAPVYTKLGLWTDAEICVNKAKLIDFYSAHNWHTTGLLFEAQLEYK  651

Query  2105  EALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLG  2284
             EAL+ FS SL I+PD+VPS VSTAEVLMK+GSQ++P+ARS LMNALR+E T H AW +LG
Sbjct  652   EALIXFSVSLYIEPDHVPSTVSTAEVLMKLGSQSLPMARSFLMNALRLELTNHRAWLNLG  711

Query  2285  KLSKMEGSaqqaadffqaaHELKLSTPVQSFV  2380
              +SK EGS QQAADFFQAAHEL+LS PV+SFV
Sbjct  712   LISKKEGSIQQAADFFQAAHELQLSAPVRSFV  743



>emb|CBI19400.3| unnamed protein product [Vitis vinifera]
Length=648

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/714 (62%), Positives = 527/714 (74%), Gaps = 69/714 (10%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFKFE+   +P+S   LATRDFSASGLSS RTG  DWES+FE+ QVDE EST
Sbjct  1     MLCACSGEQFKFEDAPRSPES---LATRDFSASGLSS-RTG--DWESKFEDTQVDEAEST  54

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             L++ALSLNYEEARALLGRLEYQRGNFDAA QVF GIDI+ L+PRM++AI ERT  RKPR 
Sbjct  55    LRDALSLNYEEARALLGRLEYQRGNFDAAFQVFHGIDIRGLTPRMTRAIVERTWQRKPRT  114

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                 IV +  MS+HSVSLLLEAILLK+KSL  LGR  +AA+ECK ILD V+SA PNGM E
Sbjct  115   KGD-IVSTQEMSMHSVSLLLEAILLKAKSLDELGRTGEAAKECKIILDTVESALPNGMPE  173

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G+GEDCKLQEMFHKALE LPKLW + G +DE++ +YR+ALV+PWNLD +RLAS+QKDLA 
Sbjct  174   GIGEDCKLQEMFHKALELLPKLWTKAGCLDESIAAYRQALVRPWNLDPRRLASVQKDLA-  232

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
                                          AILL          G VE             
Sbjct  233   -----------------------------AILLY---------GGVE-------------  241

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
                    SL   ++Q LPG+  RAERWYFLALCYS+AGQNE ALNLL+KVSG SEA+H+P
Sbjct  242   ------TSLPPQLQQALPGVYNRAERWYFLALCYSAAGQNEAALNLLKKVSGCSEAKHKP  295

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             H+PS LLGAKLCSQDP  + EGI+FAR  + S+ +Q KH + +  KFLG+CYGNAA+   
Sbjct  296   HLPSFLLGAKLCSQDPKHAHEGINFARKVI-SSHDQTKHFMGETHKFLGICYGNAARACV  354

Query  1508  SDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGS  1687
              DSER + QT SLNSL QA+++  +D E +FSL LE A QRNL  AF NA+ YS+M AGS
Sbjct  355   LDSERVALQTDSLNSLNQASLIGHKDPELIFSLALENAVQRNLDAAFSNAIMYSDMVAGS  414

Query  1688  TAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMET  1867
             + +GWKLLAL+VSAEQRF DAE IVDLALDE G+IDQL+ L+LKA LQIA++ P QA+ET
Sbjct  415   SGRGWKLLALVVSAEQRFKDAETIVDLALDEAGRIDQLELLRLKAVLQIAQEQPKQAIET  474

Query  1868  YRILLAMIQAQRQ---SGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTI  2038
             YRILLA+IQAQR+   +    EV ++R LE + W DLA IY     W DA++C+DKAK+I
Sbjct  475   YRILLALIQAQREVQANKFHSEVSAERNLETQTWQDLANIYTKLGLWSDAEICLDKAKSI  534

Query  2039  DIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIA  2218
             + YS +SWH TG   EAQ   KEALV+FS SLSI+PDYVPSIVSTAEVLMK G  ++PIA
Sbjct  535   EFYSSRSWHKTGISLEAQSLYKEALVSFSVSLSIEPDYVPSIVSTAEVLMKFGKPSLPIA  594

Query  2219  RSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSFV  2380
             RS LMNALR+EPT H+AW +LG +SKMEGS QQAAD+FQAA+ELKLS P+QSFV
Sbjct  595   RSFLMNALRLEPTNHEAWLNLGLVSKMEGSLQQAADYFQAAYELKLSAPIQSFV  648



>ref|XP_010687990.1| PREDICTED: tetratricopeptide repeat protein 7B [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010687997.1| PREDICTED: tetratricopeptide repeat protein 7B [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010688005.1| PREDICTED: tetratricopeptide repeat protein 7B [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010688013.1| PREDICTED: tetratricopeptide repeat protein 7B [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010688021.1| PREDICTED: tetratricopeptide repeat protein 7B [Beta vulgaris 
subsp. vulgaris]
Length=719

 Score =   785 bits (2028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/723 (59%), Positives = 541/723 (75%), Gaps = 16/723 (2%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTG---------TADWESRFEE  400
             MLCACSGEQF+FEE  P       LATRD+S SGLSS RTG         T D  S++E+
Sbjct  1     MLCACSGEQFRFEEAAPRSPES--LATRDYSVSGLSS-RTGDLKSFSSRTTGDLGSKYED  57

Query  401   AQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAIte  580
             A VDEVESTLKEALSLNYEEARALLGR+EYQ+ NFDAALQ+F+GIDIK L+PRM  AI+E
Sbjct  58    AHVDEVESTLKEALSLNYEEARALLGRIEYQKANFDAALQLFEGIDIKALTPRMINAISE  117

Query  581   rtrprkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVD  760
             RTRPRKP+       ++GVMS HSVSLLLEAILLKSK L  LGRI +AARECK I+DIV+
Sbjct  118   RTRPRKPKSKGDN-SLAGVMSWHSVSLLLEAILLKSKVLEELGRISEAARECKMIVDIVE  176

Query  761   SAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRL  940
             SA PNGM     +D ++QEM HKALE LPKLW + G +DEA+ +YR+ALVKPWNL  + L
Sbjct  177   SALPNGMPAKFSKDSRMQEMLHKALELLPKLWKEAGCLDEAIVAYRQALVKPWNLHPETL  236

Query  941   ASMQKDLAIALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSE  1120
             AS QK LA  L++ GVEV L P+ +IW  + P+NN+EEAILLLF+L+ K    E+EWD E
Sbjct  237   ASAQKKLAAMLIYGGVEVGLPPQLQIWGPSTPRNNLEEAILLLFILIRKASCNEIEWDPE  296

Query  1121  VMDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVS  1300
             +MDHL+FAL+    FE LA++VEQ+LPG+  RAERWY LALCYS+AGQN+ AL+L+RK++
Sbjct  297   IMDHLSFALSTCNGFEFLANHVEQVLPGVYNRAERWYILALCYSAAGQNKAALDLVRKIT  356

Query  1301  GSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVC  1480
             G SE++  PHIPSLLLGAKLC++D   ++EGI++ R   +   + NKH ++QA KFLG C
Sbjct  357   GPSESKQIPHIPSLLLGAKLCTEDLNLAQEGINYCRKVTELAGDGNKHFMAQAHKFLGRC  416

Query  1481  YGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNAL  1660
             Y NAA++S S+ ER  Y+  SL SL  A  + K+D E +F+LGLE A QRNL  +F    
Sbjct  417   YSNAARVSISNLEREMYRKGSLKSLNDALPIAKDDPELIFNLGLENAAQRNLDASFSYTK  476

Query  1661  QYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIAR  1840
              YS M AGS+ +GWKLLAL+ SA+Q+F DAE IVD+ALDET  ID+LQFL+LKA +QIA+
Sbjct  477   LYSNMLAGSSGQGWKLLALVASAQQQFEDAEDIVDIALDETTGIDRLQFLRLKAVIQIAQ  536

Query  1841  QHPNQAMETYRILLAMIQAQRQSG---MDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQ  2011
             ++P QA+E Y +LLA IQA ++     +  E    + LE+EAW DL+ +Y   +SW DA+
Sbjct  537   ENPKQAIENYVLLLAQIQAAKKHNAKSLGLEATEMKLLEMEAWQDLSTLYTRLESWGDAE  596

Query  2012  VCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMK  2191
             +C+++AK+I+ YSPQSWH  G LF+A+++ KEALVAFS SLSIDP+YVP +VS AEV M+
Sbjct  597   ICVERAKSINFYSPQSWHVAGKLFKARQQYKEALVAFSVSLSIDPNYVPGLVSAAEVFME  656

Query  2192  MGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQ  2371
             +   ++PIA+S LMNAL+++PT HDAW  LG + K EG   QAAD FQAA ELK + P+Q
Sbjct  657   LAPTSLPIAKSFLMNALQLDPTNHDAWLHLGLILKKEGLITQAADCFQAACELKSTVPIQ  716

Query  2372  SFV  2380
             SF+
Sbjct  717   SFL  719



>ref|XP_010938984.1| PREDICTED: tetratricopeptide repeat protein 7A [Elaeis guineensis]
 ref|XP_010938985.1| PREDICTED: tetratricopeptide repeat protein 7A [Elaeis guineensis]
 ref|XP_010938986.1| PREDICTED: tetratricopeptide repeat protein 7A [Elaeis guineensis]
Length=718

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/715 (59%), Positives = 540/715 (76%), Gaps = 9/715 (1%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLC CSG+QF+ EE E        LATRDFS SGLSS    T DW+S+F+++QVD+VEST
Sbjct  1     MLCTCSGQQFQLEENEMPQSPES-LATRDFSVSGLSSK---TGDWDSKFDDSQVDDVEST  56

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKE LSLNYEEARALLGRLEYQRGN DAALQVFQGIDI+ L PRM KAI ERT+ RK R 
Sbjct  57    LKETLSLNYEEARALLGRLEYQRGNCDAALQVFQGIDIRGLRPRMIKAIAERTQHRKNRP  116

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                 + V+ +MS+HSVSLLLEAI LKSKSL  LGR +DAA ECK ILDI++SA+P+GM E
Sbjct  117   KGENLQVN-LMSMHSVSLLLEAIFLKSKSLEQLGRHKDAALECKNILDIIESAWPDGMPE  175

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             GV  + KL+EMFHKALE LPKLW Q G ++EA+++YRRALV+ W+LD KR AS+QKDLA 
Sbjct  176   GVRGESKLKEMFHKALELLPKLWKQAGFLEEAISAYRRALVRHWSLDLKRWASLQKDLAT  235

Query  968   ALLFAGVEVDLSPRFK-IWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFA  1144
              LL+ G EV L  +F+ +W    P +N+EEAILLL +LM K+   E+ WD+E+MDHL +A
Sbjct  236   VLLYGGAEVPLPQQFQQVWGHMTPTSNIEEAILLLLILMRKVAFQEINWDAEIMDHLIYA  295

Query  1145  LTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHE  1324
             L++ G+FE LA +VEQ+LPG+ +R ERWY LALCYS+AG ++ ALN+L+K  G SE +H+
Sbjct  296   LSLSGQFELLAGHVEQVLPGIYSRGERWYLLALCYSAAGLDDVALNILKKGLGHSERKHK  355

Query  1325  PHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKIS  1504
             PH+PSLLLGAKLC ++P  + EG +FA  A++ T NQ KHL   A   LGV YG  A+ S
Sbjct  356   PHLPSLLLGAKLCYKNPYHACEGTNFAMKAIEFTNNQEKHLRGVASHLLGVYYGYCAQSS  415

Query  1505  FSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAG  1684
              SDS+R   Q++SL SL  AA + K+D E ++SLG E A QRNL  A ++A++Y +M  G
Sbjct  416   ISDSQRLRLQSESLKSLHHAATIEKDDPEVIYSLGRENAIQRNLNTAVESAIKYLDMVGG  475

Query  1685  STAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAME  1864
             S+  GWKLLAL+VSAEQ F DAEAIVDLA+DETG++D L FL+LKA LQ+A++ P  A++
Sbjct  476   SSVSGWKLLALVVSAEQNFKDAEAIVDLAIDETGKVDHLDFLRLKALLQVAQEQPRNAID  535

Query  1865  TYRILLAMIQAQRQS---GMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKT  2035
             TYRILLAMIQAQ++        E  + + LE+EAW+DL+ IY   +SW D+ VC++KAK+
Sbjct  536   TYRILLAMIQAQKELKSWSTSSEGKAVKDLEMEAWVDLSFIYTKLESWNDSYVCLEKAKS  595

Query  2036  IDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPI  2215
             ++I+SP+ WH TG L EAQ    +ALVAFS +LSI+PDYVPS+VS A VL   G +++ +
Sbjct  596   VEIFSPKCWHATGMLLEAQSLHVDALVAFSVALSIEPDYVPSMVSIAAVLRMFGGKSLSL  655

Query  2216  ARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSFV  2380
             ARS LMNALR+EPT H+AW +LG +SK EGS  QAAD FQAA+EL+ S+PVQ+F 
Sbjct  656   ARSFLMNALRLEPTNHNAWLNLGYISKAEGSLHQAADCFQAAYELRQSSPVQNFT  710



>ref|XP_008808849.1| PREDICTED: tetratricopeptide repeat protein 7B [Phoenix dactylifera]
 ref|XP_008808850.1| PREDICTED: tetratricopeptide repeat protein 7B [Phoenix dactylifera]
 ref|XP_008808851.1| PREDICTED: tetratricopeptide repeat protein 7B [Phoenix dactylifera]
 ref|XP_008808852.1| PREDICTED: tetratricopeptide repeat protein 7B [Phoenix dactylifera]
 ref|XP_008808853.1| PREDICTED: tetratricopeptide repeat protein 7B [Phoenix dactylifera]
Length=710

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/715 (59%), Positives = 541/715 (76%), Gaps = 9/715 (1%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLC CSG+QF+FEE E        LATRDFS SGLSS    T DW+S+F+++QVD+VEST
Sbjct  1     MLCTCSGQQFQFEENEMPQSPES-LATRDFSVSGLSSK---TGDWDSKFDDSQVDDVEST  56

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKE LSLNYEEARALLGRLEYQRGNFDAALQVFQGIDI+ L PR+ KAI ERT+ RK R 
Sbjct  57    LKETLSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIRGLRPRIIKAIAERTQHRKTRP  116

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                 + V+ VMS+HSVSLLLEAILLKSKSL  L R +DAA ECK ILDIV++A+P+GM E
Sbjct  117   KGENLQVN-VMSMHSVSLLLEAILLKSKSLEQLCRHKDAALECKNILDIVEAAWPHGMPE  175

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G+  + KL++M HKALE LPKLW Q G ++EA+++YRRALV+PW+LD KRLAS+QKDLA 
Sbjct  176   GIRGESKLKDMLHKALELLPKLWKQAGFLEEAISAYRRALVRPWSLDLKRLASLQKDLAT  235

Query  968   ALLFAGVEVDLSPRFK-IWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFA  1144
              LL+ G EV L P+F+ +W    P +N+EEAILLL +LM K+   E+ WD+E+MDHL  A
Sbjct  236   ILLYGGAEVPLPPQFQQVWGHMIPTSNIEEAILLLLILMRKVAFQEINWDAEIMDHLIHA  295

Query  1145  LTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHE  1324
             L++ G+FE LA +VEQ+LPG+ +R ERWY LALCYS+AG ++ ALN+L+K    SE +H+
Sbjct  296   LSLSGQFELLAGHVEQVLPGIYSRGERWYLLALCYSAAGLDDVALNILKKGLCHSERKHK  355

Query  1325  PHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKIS  1504
              H+PSLLLGAKLC ++P  + EG +FA  A++ T NQ KHL   A   LGVCYG  A+ S
Sbjct  356   LHLPSLLLGAKLCYKNPNHACEGTNFAMKAIEFTNNQEKHLRGVASHLLGVCYGYCARSS  415

Query  1505  FSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAG  1684
              SDS+R   Q++SL SL  AA + K+  E ++SLG E A QRNL  A ++A++Y +M AG
Sbjct  416   ISDSQRLRLQSESLKSLHCAATIEKDCPEVIYSLGRENALQRNLNTAVESAIRYLDMVAG  475

Query  1685  STAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAME  1864
             S+  GWKLLAL+VSAEQ F +AEAIVDLA+DETG++D L FL+LKA LQ+A++ P  A++
Sbjct  476   SSVSGWKLLALVVSAEQNFKEAEAIVDLAIDETGKMDHLDFLRLKALLQVAQEQPRNAID  535

Query  1865  TYRILLAMIQAQRQS---GMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKT  2035
             TYRILLAMIQAQ++      + EV + + LE EAWLDL+ IY   +SW D+ VC++KAK+
Sbjct  536   TYRILLAMIQAQKELKSWSNNSEVKAVKDLETEAWLDLSFIYTKLESWTDSYVCLEKAKS  595

Query  2036  IDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPI  2215
             ++I+SP+ WH TG L EAQ    +ALVA+S +LS++PDYVPS+VS A VL   G +++ +
Sbjct  596   VEIFSPKCWHATGMLLEAQSLHIDALVAYSVALSLEPDYVPSMVSIAAVLRMFGGKSLSL  655

Query  2216  ARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSFV  2380
             ARS +MNALR+EPT H+AW +LG +SK +GS  QAAD FQAA+EL+ S+PV  F 
Sbjct  656   ARSFVMNALRLEPTNHNAWLNLGYISKADGSLHQAADCFQAAYELRQSSPVHKFT  710



>ref|XP_010556453.1| PREDICTED: tetratricopeptide repeat protein 7A isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010556454.1| PREDICTED: tetratricopeptide repeat protein 7A isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010556455.1| PREDICTED: tetratricopeptide repeat protein 7A isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010556457.1| PREDICTED: tetratricopeptide repeat protein 7A isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010556458.1| PREDICTED: tetratricopeptide repeat protein 7A isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010556459.1| PREDICTED: tetratricopeptide repeat protein 7A isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010556460.1| PREDICTED: tetratricopeptide repeat protein 7A isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010556461.1| PREDICTED: tetratricopeptide repeat protein 7A isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010556462.1| PREDICTED: tetratricopeptide repeat protein 7A isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010556463.1| PREDICTED: tetratricopeptide repeat protein 7A isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010556464.1| PREDICTED: tetratricopeptide repeat protein 7A isoform X2 [Tarenaya 
hassleriana]
Length=697

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/714 (59%), Positives = 526/714 (74%), Gaps = 20/714 (3%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQF+ EEP  +P S   LATRDFSA GLSS RTG  DW+S+ EE QVDE EST
Sbjct  1     MLCACSGEQFRLEEPPQSPDS---LATRDFSARGLSS-RTGNGDWDSKLEEIQVDEAEST  56

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDI+ L+PRM KAI ERTRPRKPR 
Sbjct  57    LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIRALTPRMIKAIKERTRPRKPRS  116

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                 IV   VMS+HSVSLLLEAI LKS+SL  LG  R+AA ECK I D V+SAFP GM  
Sbjct  117   RID-IVPPSVMSMHSVSLLLEAIFLKSRSLEELGSYREAAVECKIIFDTVESAFPKGMPG  175

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G+ + CKLQ++FHKALE LP LW + G + E + SYRRALVKPWNLD ++LA+ QK LA 
Sbjct  176   GISQVCKLQDVFHKALELLPCLWTKAGHLHETIASYRRALVKPWNLDPQKLAATQKALAS  235

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LL+ GVE               K+N +EAILLL +L+ K   GE+EWD E+MDHL+FAL
Sbjct  236   VLLYGGVEAS------------SKDNTQEAILLLLILVKKAVVGEIEWDPELMDHLSFAL  283

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             +V G+FE LA+ VEQILPG+ TR ERWYFL+LCYS+AG NE A+NLL+K SG SEA   P
Sbjct  284   SVTGQFELLANYVEQILPGVYTRGERWYFLSLCYSAAGDNEAAINLLKKASGPSEARQAP  343

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
                SLLLGAKLCS+D   SR+GI FA   +D   NQ++HLL +A +FLG CYGNAA+IS 
Sbjct  344   QASSLLLGAKLCSEDTKNSRDGIDFAHRLLDLANNQSEHLLGRAHRFLGACYGNAARISM  403

Query  1508  SDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGS  1687
             SDSER  +Q + L SL +AA   ++D E +F L +E A QRNL  A D A++YS   AG 
Sbjct  404   SDSERVFFQKKFLQSLNRAAKNAEDDPEVIFDLSVENAVQRNLKTALDGAVEYSSTVAGV  463

Query  1688  TAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMET  1867
             +A+ WK L+L++SAE+R  DAE +++ A++E  +I+QL+ LKLKA LQ+A+  P QA+ T
Sbjct  464   SARAWKHLSLVLSAEKRLEDAENVLEFAMEEADEIEQLELLKLKAVLQMAQDQPKQAIRT  523

Query  1868  YRILLAMIQAQRQ-SGMDHEVLSDRK--LEVEAWLDLARIYIDQDSWPDAQVCIDKAKTI  2038
             Y  +L +I+AQ Q  G       DR+   E+EAW DLA IY +  SW DA+ C++KAK+I
Sbjct  524   YSTMLTIIRAQAQPEGKKSNQYEDRRRNFEMEAWQDLASIYGNLGSWSDAETCLEKAKSI  583

Query  2039  DIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIA  2218
               Y P+ WH TG   EA+   +EAL +F  SLSI+PD+VPSIVSTAEV++K G +++ IA
Sbjct  584   AFYCPRGWHATGLSLEARSLHEEALASFFLSLSIEPDHVPSIVSTAEVMVKSGGESLAIA  643

Query  2219  RSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSFV  2380
             RS LMNALR++PT H+AW +LG ++KM+G  QQAA+F+QAA+ELKLS PVQSF+
Sbjct  644   RSFLMNALRLDPTNHEAWMNLGLIAKMQGLPQQAAEFYQAAYELKLSAPVQSFI  697



>ref|XP_002510094.1| calmodulin binding protein, putative [Ricinus communis]
 gb|EEF52281.1| calmodulin binding protein, putative [Ricinus communis]
Length=651

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/713 (58%), Positives = 509/713 (71%), Gaps = 66/713 (9%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFKFEE   +P+S   LATRDFSASGLSS  TG  DWESR E+ QVDE EST
Sbjct  1     MLCACSGEQFKFEEAPQSPES---LATRDFSASGLSSRTTG--DWESRLEDIQVDEAEST  55

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDI++L+P+M +AI ERTR RKPR 
Sbjct  56    LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIRSLTPKMIRAIIERTRQRKPRA  115

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                 I VS  MS+HSVSLL+EAILLK+KSL  LG   +AA+EC+ ILDIV+SA PNGM E
Sbjct  116   RGD-IAVSSAMSMHSVSLLVEAILLKAKSLDELGHYGEAAKECRIILDIVESALPNGMPE  174

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G+GEDCKL+EMFHKALE LP LW++ GL+DEA+ +YRRAL+KPWNL  +RLA +QKDLA 
Sbjct  175   GIGEDCKLEEMFHKALELLPILWIKAGLLDEAITAYRRALIKPWNLGPERLAGVQKDLAS  234

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LL+  VE  L+P+ + W    P ++ EEAILLL VLM K+  GE++WD E+M+HLT+AL
Sbjct  235   ILLYGAVESKLAPQLQEWGPATPSSSTEEAILLLLVLMKKVAYGEIKWDEEIMNHLTYAL  294

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             +V+G+FE LAD+VEQ LPG+  RA+RWYFLALCYS+AGQNE ALNLL+KVSG SE++H P
Sbjct  295   SVIGQFELLADHVEQALPGVYNRADRWYFLALCYSAAGQNEAALNLLKKVSGFSESKHRP  354

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             HIPS LLGAKLCSQDP  S EGI FA   ++    QN+H + +A KFLGVCYGNAA+I  
Sbjct  355   HIPSFLLGAKLCSQDPKNSHEGIKFAHKVINLANQQNQHFMGEAHKFLGVCYGNAARICL  414

Query  1508  SDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGS  1687
             SDSER+  Q +SLNSL  AA+  +ED E ++SL            A +N LQ +      
Sbjct  415   SDSERHFLQRESLNSLNHAALNRQEDPEMMYSL------------ALENTLQRN------  456

Query  1688  TAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMET  1867
                                     +D A D                +  A      +++ 
Sbjct  457   ------------------------IDAAFDNA--------------MTYAETMGGFSVKG  478

Query  1868  YRIL-LAMIQAQRQSG---MDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKT  2035
             +++L L  +QA+        + E  ++R LE+ AW DLA IY     W DA++C++KAK 
Sbjct  479   WKLLALRDVQAKNTDHAHIFESEAEAERNLELAAWQDLASIYTKLGLWTDAEICLEKAKL  538

Query  2036  IDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPI  2215
             +D +SP+SWHTTGALF+A+   KEALVAFS SLSI+PDYVPSIVSTA+VLMK+GSQ  PI
Sbjct  539   MDFHSPRSWHTTGALFDARSLHKEALVAFSVSLSIEPDYVPSIVSTAKVLMKLGSQLFPI  598

Query  2216  ARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQS  2374
             ARS LMNALRIE   H+AW +LG +SKMEGS QQAADFFQAA+ELKLS  V+S
Sbjct  599   ARSFLMNALRIESMNHEAWLNLGLISKMEGSLQQAADFFQAAYELKLSASVES  651



>ref|XP_006415757.1| hypothetical protein EUTSA_v10006966mg [Eutrema salsugineum]
 gb|ESQ34110.1| hypothetical protein EUTSA_v10006966mg [Eutrema salsugineum]
Length=696

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/713 (57%), Positives = 524/713 (73%), Gaps = 19/713 (3%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQF+FEE   +P+S   LATRDFSASGLSSSRT   DW+S+ EE QVDE EST
Sbjct  1     MLCACSGEQFRFEEQPGSPES---LATRDFSASGLSSSRTRGGDWDSKLEEIQVDEAEST  57

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLEYQRGNFDAALQVF+GIDIK L+PR+ KAI ERTRP KP  
Sbjct  58    LKEALSLNYEEARALLGRLEYQRGNFDAALQVFKGIDIKVLTPRIVKAIVERTRPCKPPR  117

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
              +  IV    MS+HSVSLLLEAILLK++SL  LG  ++AA ECK ILD+V+SA P+GM +
Sbjct  118   SRVAIVPPSSMSMHSVSLLLEAILLKARSLEELGCCKEAAEECKLILDMVESALPSGMPD  177

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
              +    KLQE+F KALE LP LW + G   E + SYRRAL +PWNLD +RLA  QK LA+
Sbjct  178   RISGFGKLQEVFQKALELLPLLWTKAGNFHETIASYRRALSRPWNLDPQRLAITQKSLAL  237

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LL+  VE          C   PK NMEEAI+LL +L+ KI  GE++WD E+MDHLT+AL
Sbjct  238   VLLYGSVEA---------C---PKENMEEAIVLLMLLIKKIVVGEIQWDPELMDHLTYAL  285

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             ++ G+FE LA  +EQILPG+ TR ERWY L+LCYS+AG ++ A+NLL+  SG SE+   P
Sbjct  286   SMTGQFEVLASYLEQILPGVYTRGERWYLLSLCYSAAGIDKAAINLLKMASGPSESRQIP  345

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             H P LL GAKLCS+DP  S +GI+FA+  +D   NQ++H+LS+A +FLGVCYGNAA+ S 
Sbjct  346   HTPWLLFGAKLCSEDPKHSMDGINFAQRLLDLANNQSEHILSEAHRFLGVCYGNAARSSK  405

Query  1508  SDSERNSYQTQSLNSLTQAAMLCKEDAE--TVFSLGLEYATQRNLTPAFDNALQYSEMTA  1681
              DSER  +Q +SL SL +AA    +  E   +F+L +E A QRNL  A D A++YS M  
Sbjct  406   LDSERVLFQKKSLFSLNKAAKRAMDGPEPDVIFNLSVENAVQRNLQVALDGAVEYSSMVG  465

Query  1682  GSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAM  1861
             G + +GWK LA+++SAE+R  DAE+I+D  ++E G I++L+ +KLKA LQ+A++ P QA+
Sbjct  466   GVSTRGWKHLAIVLSAEKRLKDAESILDFTMEEAGDIEKLELMKLKAVLQMAQEQPKQAL  525

Query  1862  ETYRILLAMIQAQRQSGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTID  2041
             +T   LLA+I+AQ +      +L  +K E EAW DLA +Y    SW DA+ C++KA++I 
Sbjct  526   KTCSSLLALIRAQEKPEKSEALL--QKFETEAWQDLASVYGKLGSWSDAETCLEKARSIR  583

Query  2042  IYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIAR  2221
              YSP+ W+ TG   EA+   +EAL++F  SLSI+P++VPSIVS AEV+MK G  ++P A+
Sbjct  584   FYSPRGWNETGLCLEAKSLHEEALISFFLSLSIEPEHVPSIVSIAEVMMKSGGDSLPTAK  643

Query  2222  SLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSFV  2380
             S LMNALR++P  H+AW  LG ++KM+G +QQAA+F+QAA+EL+LS PVQSF+
Sbjct  644   SFLMNALRLDPRNHNAWMKLGDVAKMQGLSQQAAEFYQAAYELELSAPVQSFI  696



>ref|XP_006841113.1| hypothetical protein AMTR_s00086p00090660 [Amborella trichopoda]
 gb|ERN02788.1| hypothetical protein AMTR_s00086p00090660 [Amborella trichopoda]
Length=704

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/714 (57%), Positives = 524/714 (73%), Gaps = 15/714 (2%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFKFEE   +P+S   LATRDFSAS LSS    T DW+SRFEE+Q+++VE T
Sbjct  1     MLCACSGEQFKFEEVPQSPES---LATRDFSASALSSR---TWDWDSRFEESQLEDVECT  54

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLEYQRGNF AALQVFQGIDI+ ++PRMSK+I ER + +K + 
Sbjct  55    LKEALSLNYEEARALLGRLEYQRGNFSAALQVFQGIDIRGIAPRMSKSIAERPKRKKGKS  114

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                    + VMS+HSVSLLLEAILLK+KSL GLGR +DAARECK I+D V+SA PNG+ +
Sbjct  115   KSEP-APTNVMSMHSVSLLLEAILLKAKSLEGLGRYKDAARECKTIIDTVESALPNGIPD  173

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G  ++CK+Q+MFHKALE LPKLW Q GLI+EA+ +YRR L+KPWNLD   LA++Q+DLA 
Sbjct  174   GFIDECKMQDMFHKALESLPKLWKQAGLIEEAIFAYRRVLIKPWNLDPISLAAIQRDLAA  233

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LL++G+E    P  +      P +N EEAILLL +LM K+   E+ WD E+ +HLTFAL
Sbjct  234   VLLYSGIEASPHPDLQTSLKITPMSNTEEAILLLLLLMTKVASQEIPWDQEIFNHLTFAL  293

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             +V G FE L+D++EQI PG+  RA+RWY LALCYS+ G++E ALNLL+K  G SE  +  
Sbjct  294   SVAGLFEPLSDHIEQIFPGVHHRADRWYLLALCYSARGEDEVALNLLKKSLGPSEKPN--  351

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKI-S  1504
             H+PSLLL AKLCSQ+P  + EGI+F + A+D + + ++H    A   LGV YG  A+   
Sbjct  352   HLPSLLLAAKLCSQNPKLTHEGINFGQRAIDCSKDDHRH--GVAHFLLGVNYGKYARHGG  409

Query  1505  FSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAG  1684
              SD+ER   Q +SL SL +A +  ++D   +  LGLE A QRNLT A DN  ++ E+  G
Sbjct  410   VSDTERKVLQGESLKSLQKALLTERQDPYVILCLGLENAVQRNLTEALDNVTKFLEVVGG  469

Query  1685  STAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAME  1864
             S  +GW+LLAL++SAEQ+F DAE IVD+ALDET + + L+FL+LKA LQI+   P+QA+E
Sbjct  470   SLVEGWRLLALVLSAEQQFKDAETIVDIALDETEKDESLRFLRLKAMLQISEGQPSQAIE  529

Query  1865  TYRILLAMIQAQRQS---GMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKT  2035
              YR LL ++QAQR+      D EV   +  E++AW DLA IY     + DA VC+DKAK+
Sbjct  530   IYRTLLTLVQAQREKTPWKTDMEVGFGKNFEMKAWHDLAGIYTRLGMFSDACVCVDKAKS  589

Query  2036  IDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPI  2215
             I  YSP +WH TG LF++Q    EAL+AFS +LSIDPD+VPS++S A+ L + G +++ I
Sbjct  590   ISFYSPMNWHATGELFDSQSLHGEALIAFSIALSIDPDHVPSMISMAKALRQHGKKSLAI  649

Query  2216  ARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             ARS LMNALR++PT H+AW +LG +SKMEGS QQAAD FQA++ELKL  PVQ F
Sbjct  650   ARSFLMNALRLQPTNHEAWLNLGIVSKMEGSLQQAADCFQASYELKLLAPVQDF  703



>ref|XP_006601261.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X4 
[Glycine max]
Length=614

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/615 (63%), Positives = 478/615 (78%), Gaps = 12/615 (2%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFKFEE  P       LATRDFSASGLSS RTG  DWES+F+E QV++VEST
Sbjct  1     MLCACSGEQFKFEEAPPRSPDS--LATRDFSASGLSS-RTG--DWESKFDETQVEDVEST  55

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLEYQRGNFDAALQVF+GIDI+ L+PRM +AI ERT+ RK R 
Sbjct  56    LKEALSLNYEEARALLGRLEYQRGNFDAALQVFEGIDIRALTPRMIRAIAERTKQRKSRS  115

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                  V+  VMS+HSVSL+LEAILLKSKS   LGR  +AA+EC+ ++D V+SA PNGM E
Sbjct  116   KVDN-VLPNVMSMHSVSLILEAILLKSKSSEELGRYTEAAKECRIVVDTVESALPNGMPE  174

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G+GEDCKLQEMFH+ALE LP LW++ GL+DE V +YRRALVKPWNL+ +RLA +QKDLA 
Sbjct  175   GIGEDCKLQEMFHEALELLPNLWMKAGLLDEVVTAYRRALVKPWNLEPQRLACVQKDLAT  234

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LL+ GVEV+L P+ ++   T P +  EEAILLL +L GK+   E++WD E+MDHLTF+L
Sbjct  235   TLLYGGVEVNLPPQLQVNGITTPMSGTEEAILLLLILSGKMALQEIDWDPEIMDHLTFSL  294

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             +V G FESLAD+VE+ILPG+  RAE+WYFLALCYS+AGQNE ALNLLRK  GSSEA+H P
Sbjct  295   SVTGMFESLADHVEKILPGVHDRAEQWYFLALCYSAAGQNEVALNLLRKACGSSEAKHRP  354

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             H PS L GAKLCS +P  +REGI F++  +D   +QN+H LSQ +KFLG+C+G AA+IS 
Sbjct  355   HFPSFLFGAKLCSLNPNHAREGIKFSQEVIDLVKHQNEHFLSQGQKFLGICHGAAARISV  414

Query  1508  SDSERNSYQTQSLNSLTQAAMLC-KEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAG  1684
              DSER  +Q +SL  L  AA+     D E + +LGLE A QRNL  A+DN + YS+M AG
Sbjct  415   LDSERIIFQKESLKFLKDAALNGNNNDPEVMLTLGLENAIQRNLNAAYDNIMMYSDMMAG  474

Query  1685  STAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAME  1864
             S+ +GW+LLAL VSA+QRF DAE IVD ALDE G IDQL+ L+LKA LQI +Q P QA+E
Sbjct  475   SSRRGWQLLALTVSAQQRFQDAETIVDFALDEAGDIDQLELLRLKAVLQITQQQPKQAIE  534

Query  1865  TYRILLAMIQAQRQSGMD-----HEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKA  2029
             TYRILLA+I+A+++  +      HE L+++KLE+EAW DLA IY D  S+ DA+ C+DK+
Sbjct  535   TYRILLAVIEARKEHWLQAKTFRHEALTEQKLEMEAWQDLATIYADLCSFLDAKACVDKS  594

Query  2030  KTIDIYSPQSWHTTG  2074
             ++I+ +SP+SWH TG
Sbjct  595   QSIEFFSPRSWHITG  609



>ref|NP_564285.1| calmodulin-binding protein [Arabidopsis thaliana]
 gb|AAF99738.1|AC004557_17 F17L21.25 [Arabidopsis thaliana]
 gb|AAL16183.1|AF428415_1 At1g27460/F17L21_26 [Arabidopsis thaliana]
 gb|AAQ22600.1| At1g27460/F17L21_26 [Arabidopsis thaliana]
 gb|AEE30834.1| calmodulin-binding protein [Arabidopsis thaliana]
Length=694

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/713 (56%), Positives = 524/713 (73%), Gaps = 21/713 (3%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQF+FE+   +P+S   LATRDFSASGLSS R G  DW+S+ E+ QVDE EST
Sbjct  1     MLCACSGEQFRFEDQPGSPES---LATRDFSASGLSS-RNGGGDWDSKLEDIQVDEAEST  56

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLEYQRGNFDAALQVF+GIDIK L+PR+ KAI E+T P KPR 
Sbjct  57    LKEALSLNYEEARALLGRLEYQRGNFDAALQVFKGIDIKVLTPRIIKAIVEKTLPCKPRS  116

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                 IV    MS+HSVSLLLEAILLK++SL  LG  ++AA ECK ILD+V++A P+GM +
Sbjct  117   KAV-IVPPTTMSMHSVSLLLEAILLKARSLEELGSYKEAAEECKIILDVVENALPSGMPD  175

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G+    KLQ++F KALE LP LW + G   E + SYRRAL +PWNLD +RLA  QK LA+
Sbjct  176   GISGFAKLQDIFQKALELLPLLWKKAGNHHETIASYRRALSRPWNLDPQRLAVTQKSLAL  235

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LL+  VE          C   PK+N+EEAI+LL +L+ K+  G+++WD E+MDHLT+AL
Sbjct  236   VLLYGSVEA---------C---PKDNIEEAIVLLMLLVKKMVVGDIQWDPELMDHLTYAL  283

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             ++ G+FE LA+ +EQ LPG+ TR ERWY L+LCYS+AG ++ A+NLL+   G SE+   P
Sbjct  284   SMTGQFEVLANYLEQTLPGVYTRGERWYLLSLCYSAAGIDKAAINLLKMALGPSESRQIP  343

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             HIP LL GAKLCS+DP  SR+GI+FA   +D   +Q++HLLSQA KFLGVCYGNAA+ S 
Sbjct  344   HIPLLLFGAKLCSKDPKHSRDGINFAHRLLDLGNSQSEHLLSQAHKFLGVCYGNAARSSK  403

Query  1508  SDSERNSYQTQSLNSLTQAAMLCKEDAE--TVFSLGLEYATQRNLTPAFDNALQYSEMTA  1681
              DSER   Q +SL SL +AA   K D E   +F+L +E A QRN+  A D A++YS M  
Sbjct  404   LDSERVFLQKKSLFSLNEAAKRGKADPELDVIFNLSVENAVQRNVQAALDGAVEYSSMVG  463

Query  1682  GSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAM  1861
             G + KGWK LA+++SAE+R  DAE+I+D  ++E G I++++ L+LKA LQ+A++ P +AM
Sbjct  464   GVSTKGWKHLAIVLSAEKRLKDAESILDFTMEEAGDIEKIELLRLKAVLQMAQEQPKKAM  523

Query  1862  ETYRILLAMIQAQRQSGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTID  2041
             +T   LL +I+AQ +S     +L  +K E EAW DLA +Y    SW DA+ C++KA+++ 
Sbjct  524   KTCSSLLGLIRAQEKSEQSESLL--QKFETEAWQDLASVYGKLGSWSDAETCLEKARSMC  581

Query  2042  IYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIAR  2221
              YSP+ W+ TG   EA+   +EAL++F  SLSI+PD+VPSIVS AEV+MK G +++P A+
Sbjct  582   YYSPRGWNETGLCLEAKSLHEEALISFFLSLSIEPDHVPSIVSIAEVMMKSGDESLPTAK  641

Query  2222  SLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSFV  2380
             S LMNALR++P  HDAW  LG ++K +G +QQAA+F+QAA+EL+LS PVQSF+
Sbjct  642   SFLMNALRLDPRNHDAWMKLGHVAKKQGLSQQAAEFYQAAYELELSAPVQSFI  694



>ref|XP_006303919.1| hypothetical protein CARUB_v10008472mg [Capsella rubella]
 gb|EOA36817.1| hypothetical protein CARUB_v10008472mg [Capsella rubella]
Length=694

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/713 (56%), Positives = 525/713 (74%), Gaps = 21/713 (3%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQF+FE+   +P+S   LATRDFSASGLSS RT   DW+S+ ++ QVDE EST
Sbjct  1     MLCACSGEQFRFEDQPGSPES---LATRDFSASGLSS-RTAGGDWDSKLDDIQVDEAEST  56

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLEYQRGNFDAALQVF+GIDIK L+PR+ KAI ERTRP KPR 
Sbjct  57    LKEALSLNYEEARALLGRLEYQRGNFDAALQVFKGIDIKVLAPRIIKAIVERTRPCKPRS  116

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                 +V    MS+HSVSLLLEAILLK++SL  LG  ++AA ECK ILD+V+SA P+GM +
Sbjct  117   KVV-VVPPSSMSMHSVSLLLEAILLKARSLEELGLYKEAADECKIILDVVESALPSGMPD  175

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G+    KLQ++F K+LE LP LW + G   E + SYRRAL +PWNLD +RLA  QK LA+
Sbjct  176   GINGFSKLQDIFQKSLELLPLLWTKAGNHHETIASYRRALSRPWNLDPQRLAVTQKSLAL  235

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LL+  VE          C   PK+N+EEAI+LL +L+ K+  G+++WD ++MDHLT+AL
Sbjct  236   ILLYGSVEA---------C---PKDNIEEAIVLLMLLVKKMVVGDIQWDPDLMDHLTYAL  283

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             ++ G+FE LA+ +EQ LPG+ TR ERWY L+LCYSSAG ++ A+NLL+   G SE+  +P
Sbjct  284   SMTGQFEMLANYLEQTLPGVYTRGERWYLLSLCYSSAGIDKAAINLLKMALGPSESRQKP  343

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             H+P LLLGAKLCS+DP  S++GI+FA   +D   NQ++HL SQA +FLG+CYGN A+ S 
Sbjct  344   HVPWLLLGAKLCSKDPKHSKDGINFAHRLLDLANNQSEHLFSQAHRFLGICYGNTARSSK  403

Query  1508  SDSERNSYQTQSLNSLTQAAMLCKEDAE--TVFSLGLEYATQRNLTPAFDNALQYSEMTA  1681
              DSER   Q +SL SL +AA   K++ E   +F+L  E A QRN+  A D A++YS M  
Sbjct  404   LDSERVFLQKKSLFSLNEAAKRAKDNPEPDIIFNLSFENAVQRNVQAALDGAVEYSSMAG  463

Query  1682  GSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAM  1861
             G + +GWK LA ++SAE+R  DAE+I+D  ++E G I++L+ LKLKA LQ+A++ P QAM
Sbjct  464   GGSTRGWKHLASVLSAEKRLKDAESILDFTMEEAGDIEKLELLKLKAVLQMAQKQPKQAM  523

Query  1862  ETYRILLAMIQAQRQSGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTID  2041
             +T   LL +I+AQ +S     +L  +K E EAW +LA +Y    SW DA+ C+DKA+++ 
Sbjct  524   KTCSSLLGLIRAQEKSEQSKILL--KKFETEAWQELASVYGKLGSWSDAETCLDKARSMC  581

Query  2042  IYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIAR  2221
              YSP+ W+ TG   EA+   +EAL++F  SLS+DPDYVPSIVS AEV+MK G +++P A+
Sbjct  582   YYSPRGWNETGLCLEAKSLHEEALISFFISLSVDPDYVPSIVSVAEVMMKSGGESLPTAK  641

Query  2222  SLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSFV  2380
             S LMNALR++P  HDAW  LG ++KM+G +QQAA+F+QAA+EL+LS PVQSF+
Sbjct  642   SFLMNALRLDPRNHDAWMKLGHVAKMQGLSQQAAEFYQAAYELELSAPVQSFI  694



>ref|XP_009414774.1| PREDICTED: tetratricopeptide repeat protein 7A [Musa acuminata 
subsp. malaccensis]
 ref|XP_009414775.1| PREDICTED: tetratricopeptide repeat protein 7A [Musa acuminata 
subsp. malaccensis]
Length=718

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/721 (56%), Positives = 526/721 (73%), Gaps = 13/721 (2%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTA-----DWESRFEEAQVD  412
             MLCACSGEQ++FEE  P       LATRDFS  GLSS   G +     D +S+ ++ QVD
Sbjct  1     MLCACSGEQYRFEEERPPSPPES-LATRDFSTGGLSSRVGGLSSGAGGDGDSKLDDTQVD  59

Query  413   EV-ESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertr  589
             +V ESTL+E LSLNYEEARALLGRLEYQRGNFDAALQVFQGIDI  L P++ KAI   TR
Sbjct  60    DVVESTLRETLSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIVGLRPKIIKAIAAWTR  119

Query  590   prkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAF  769
              R+ R     +    VMS+HSV+LL+EA+LLKSKSL  +GR +DAA ECK I+DIV+SA+
Sbjct  120   ARQARRRGECLQ-GNVMSIHSVTLLIEAMLLKSKSLEEIGRFKDAAFECKTIIDIVESAW  178

Query  770   PNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASM  949
             P+G+ EG+G+D KL+EMFHKALE  PKLW++ G ++EA+ +YRRAL+KPW+L   R AS+
Sbjct  179   PHGIPEGIGDDSKLKEMFHKALELFPKLWMRAGFLEEAIAAYRRALMKPWDLGFSRWASL  238

Query  950   QKDLAIALLFAGVEVDLSPRF-KIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVM  1126
             QKDLA+ALL+ G E+ L P+  ++W    P +N+EEAILLL +LM K+   E+ WD E+M
Sbjct  239   QKDLAVALLYGGAELSLPPQLQQLWGYAVPTSNIEEAILLLLILMRKVTFQEISWDPEIM  298

Query  1127  DHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGS  1306
             +HL +  ++ G+FE LA +VEQILPG+  R ERWY LALCY +AG ++ ALN+LRK    
Sbjct  299   NHLIYGFSLTGQFEVLAGHVEQILPGIYDRVERWYVLALCYHAAGLDDDALNVLRKALSY  358

Query  1307  SEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYG  1486
             SE +H+PH+PS++LGAKLC + P  + EG  +A  A +   NQ KH L      LGVCYG
Sbjct  359   SEKKHKPHLPSVILGAKLCCKRPLHAWEGAKYAMKANEIFQNQ-KHFLGVTNHLLGVCYG  417

Query  1487  NAAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQY  1666
             N A++S SDS+R   Q +SL +L  AA + K D+E V+SL  E   QRNL  A +NA +Y
Sbjct  418   NCARLSVSDSQRLKLQNESLKTLQHAANIEKNDSEVVYSLARESTMQRNLHIALENATKY  477

Query  1667  SEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQH  1846
              +M AGS+ +GWKLLALIVSAEQ   +AEAIVDLA+ E+G +DQL+FL+LKA LQ+A++ 
Sbjct  478   LDMVAGSSVRGWKLLALIVSAEQNLREAEAIVDLAMYESGTMDQLEFLRLKALLQVAQEQ  537

Query  1847  PNQAMETYRILLAMIQAQRQ---SGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVC  2017
             P  A+ETY+ LLAM++A ++     +  EV + + LE+EAWLDLA +Y    SW D+ VC
Sbjct  538   PKNAIETYKNLLAMVEAWKELQKWSLSSEVKAVKDLEMEAWLDLASLYTKLGSWNDSYVC  597

Query  2018  IDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMG  2197
             +DKAKT +++SP+ WH+ G L EAQ + +EAL+A   SLSI+PDYVPS+V  A +L   G
Sbjct  598   LDKAKTFELFSPKCWHSKGKLLEAQSKQQEALIALLVSLSIEPDYVPSMVLMAAILRTRG  657

Query  2198  SQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
              +++ IARSLLMNALR+EPT H+AW +LG +SK EGS  QAAD FQAA+EL+ S+PVQ+F
Sbjct  658   GKSLAIARSLLMNALRLEPTNHEAWLNLGFISKAEGSLHQAADCFQAAYELRQSSPVQNF  717

Query  2378  V  2380
             V
Sbjct  718   V  718



>ref|XP_010499226.1| PREDICTED: LOW QUALITY PROTEIN: tetratricopeptide repeat protein 
7A-like [Camelina sativa]
Length=694

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/713 (56%), Positives = 523/713 (73%), Gaps = 21/713 (3%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQF+FE+   +P+S   LATRDFSASGLSS RT   DW+S+ ++ QVDE EST
Sbjct  1     MLCACSGEQFRFEDQPGSPES---LATRDFSASGLSS-RTAGGDWDSKLDDIQVDEAEST  56

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLEYQRGNFDAALQVF+GIDIK L+PR+ KAI ERTRP KPR 
Sbjct  57    LKEALSLNYEEARALLGRLEYQRGNFDAALQVFKGIDIKVLTPRIIKAIVERTRPCKPRS  116

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                 IV    MS+HSVSLLLEAILLK++SL  LG  ++AA ECK ILD+V+SA P+GM +
Sbjct  117   KPL-IVPPTSMSMHSVSLLLEAILLKARSLEELGSYKEAAEECKIILDVVESALPSGMPD  175

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G+    KLQ++F KALE LP LW + G   E + SYRRAL +PWNLD +RLA  QK LA+
Sbjct  176   GINGFSKLQDIFQKALELLPLLWTKAGNHHETIASYRRALSRPWNLDPQRLAVTQKSLAL  235

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LL+  VE          C   PK+N+EEAI+LL +L+ K+  G+++WD E+MDHLT+AL
Sbjct  236   ILLYGSVEA---------C---PKDNIEEAIVLLMLLVKKVVVGDIQWDPELMDHLTYAL  283

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             ++ G+FE LA+ +EQILPG+ TR ERWY L+LCYS+AG ++ A+NLL+   G SE+   P
Sbjct  284   SMTGQFEVLANYLEQILPGVYTRGERWYLLSLCYSAAGIDKEAINLLKMSLGPSESRQIP  343

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             H+P LL GAKLCS+DP  SR+GI+FA+  +D   NQ++HL SQA  FLGVCYGN A+ S 
Sbjct  344   HVPWLLFGAKLCSKDPKHSRDGINFAQKLLDLANNQSEHLFSQAHSFLGVCYGNTARSSK  403

Query  1508  SDSERNSYQTQSLNSLTQAAMLCKEDAE--TVFSLGLEYATQRNLTPAFDNALQYSEMTA  1681
              DSER   Q ++L SL +AA   K++ E   +F+L  E A QRN+  A D A++YS M  
Sbjct  404   LDSERVFLQKKTLLSLNEAAKRXKDNPEPDIIFNLSFENAVQRNVQAALDGAVEYSSMVG  463

Query  1682  GSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAM  1861
             G + +GWK LA ++SAE+R  DAE+I+D  ++E G I++L+ LKLK  LQ+A++ P QA+
Sbjct  464   GGSTRGWKHLACVLSAEKRLKDAESILDFTMEEAGDIEKLELLKLKIVLQMAQEQPKQAL  523

Query  1862  ETYRILLAMIQAQRQSGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTID  2041
             +T   LL +I+AQ +S     +L  +K E EAW +LA +Y    SW DA+ C++KA+++ 
Sbjct  524   KTCSSLLGLIRAQDKSEQSEILL--KKCETEAWQELASVYGKLGSWSDAETCLEKARSMC  581

Query  2042  IYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIAR  2221
              YSP+ W+ TG   EA+   +EAL++F  SLSIDPD+VPSIVS AEV+MK G +++P A+
Sbjct  582   YYSPRGWNETGLCLEAKSLHEEALISFFLSLSIDPDHVPSIVSIAEVMMKSGGESLPTAK  641

Query  2222  SLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSFV  2380
             S LMNALR++P  HDAW  LG+++KM+G +QQAA+F+QAA+EL+LS PVQSF 
Sbjct  642   SFLMNALRLDPRNHDAWMKLGRVAKMQGLSQQAAEFYQAAYELELSAPVQSFT  694



>ref|XP_010460505.1| PREDICTED: LOW QUALITY PROTEIN: tetratricopeptide repeat protein 
7B [Camelina sativa]
Length=694

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/713 (56%), Positives = 522/713 (73%), Gaps = 21/713 (3%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQF+FE+   +P+S   LATRDFSASGLSS RT   DW+S+ ++ QVDE EST
Sbjct  1     MLCACSGEQFRFEDQPGSPES---LATRDFSASGLSS-RTAGGDWDSKLDDIQVDEAEST  56

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLEYQRGNFDAALQVF+GIDIK L+PR+ KAI ERTRP KPR 
Sbjct  57    LKEALSLNYEEARALLGRLEYQRGNFDAALQVFKGIDIKVLTPRIIKAIVERTRPCKPRS  116

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                 IV    MS+HSVSLLLEAILLK++SL  LG  ++AA ECK ILD+V+SA P+GM +
Sbjct  117   KPL-IVPPTSMSMHSVSLLLEAILLKARSLEELGSYKEAAEECKIILDVVESALPSGMPD  175

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G+    KLQ +F KALE LP LW + G   E + SYRRAL +PWNLD +RLA  QK LA+
Sbjct  176   GINGFSKLQNIFQKALELLPLLWTKAGNHHETIASYRRALSRPWNLDPQRLAVTQKSLAL  235

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LL+ GVE          C   PK+N+EEAI+LL +L+ K+  G+++WD E+MDHLT+AL
Sbjct  236   ILLYGGVEA---------C---PKDNIEEAIVLLMLLVKKMVVGDIQWDPELMDHLTYAL  283

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             ++ G+FE LA+ +EQILPG+ TR ERWY L+LCYS+AG ++ A+NLL+   G SE+   P
Sbjct  284   SMTGQFEVLANYLEQILPGVYTRGERWYLLSLCYSAAGIDKAAINLLKMSLGPSESRQIP  343

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             H+P LL GAKLCS+DP  SR+GI+FA+  +D   NQ++HL SQA  FLGVCYGN A+ S 
Sbjct  344   HVPWLLFGAKLCSKDPKHSRDGINFAQKLLDLANNQSEHLFSQAHSFLGVCYGNTARSSK  403

Query  1508  SDSERNSYQTQSLNSLTQAAMLCKEDAE--TVFSLGLEYATQRNLTPAFDNALQYSEMTA  1681
              DSER   Q ++L SL +AA   K++ E   +F+L  E A QRN+  A D A++YS M  
Sbjct  404   LDSERVFLQKKTLLSLNEAAKRXKDNPEPDIIFNLSFENAVQRNVQAALDGAVEYSSMVG  463

Query  1682  GSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAM  1861
             G + +GWK LA ++SAE+R  DAE+I+D  ++E G I++L+ LKLK  L +A++ P QA+
Sbjct  464   GGSTRGWKHLACVLSAEKRLKDAESILDFTMEEAGDIEKLELLKLKIVLHMAQEQPKQAL  523

Query  1862  ETYRILLAMIQAQRQSGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTID  2041
             +T   LL +I+AQ +S     +L  +K E+EAW +LA +Y    SW DA+ C++KA+++ 
Sbjct  524   KTCSSLLGLIRAQDKSEQSEILL--KKCEMEAWQELASVYGKLGSWSDAETCLEKARSMC  581

Query  2042  IYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIAR  2221
              YSP+ W+ TG   EA+   +EAL++F  SLSIDPD+VPSIVS AEV+MK G +++P A+
Sbjct  582   YYSPRGWNETGLCLEAKSLHEEALISFFLSLSIDPDHVPSIVSIAEVMMKSGGESLPTAK  641

Query  2222  SLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSFV  2380
             S LMNALR++P  HDAW  LG ++KM+G +QQAA+F+QAA+EL+LS PVQSF 
Sbjct  642   SFLMNALRLDPRNHDAWMKLGHVAKMQGLSQQAAEFYQAAYELELSAPVQSFT  694



>ref|XP_002890729.1| hypothetical protein ARALYDRAFT_890270 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66988.1| hypothetical protein ARALYDRAFT_890270 [Arabidopsis lyrata subsp. 
lyrata]
Length=694

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/713 (56%), Positives = 520/713 (73%), Gaps = 21/713 (3%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQF+FE+   +P+S   LATRDFSASGLSS R G  DW+S+ E+ QVDE EST
Sbjct  1     MLCACSGEQFRFEDQPGSPES---LATRDFSASGLSS-RNGGGDWDSKLEDIQVDEAEST  56

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLEYQR NFDAALQVF+GIDIK L+PR+ KAI ERTRP KPR 
Sbjct  57    LKEALSLNYEEARALLGRLEYQRRNFDAALQVFKGIDIKVLTPRIIKAIVERTRPCKPRS  116

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                  V    MS+HSVSLLLEAILLK++SL  LG  ++AA ECK ILD+V+SA P+GM +
Sbjct  117   KVVS-VPPCTMSMHSVSLLLEAILLKARSLEELGSYQEAAEECKIILDVVESALPSGMPD  175

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G+    KLQE+F KALE LP LW + G   E + SYRRAL +PWNLD +RLA  QK L +
Sbjct  176   GISGFSKLQEIFQKALELLPLLWTKAGNHHETIASYRRALSRPWNLDPQRLAVTQKSLTL  235

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LL+  VE          C   PK+N+EEAI+LL +L+ K+  G+++WD+E+MDHLT+AL
Sbjct  236   VLLYGSVEA---------C---PKDNIEEAIVLLMLLVKKMVVGDIQWDAELMDHLTYAL  283

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             ++ G+FE LA+ +E+ LPG+ TR ERWY L+LCYS+AG +  A+NLL+   G SE+   P
Sbjct  284   SMTGQFEVLANYLEETLPGVYTRGERWYLLSLCYSAAGIDTAAINLLKMALGPSESRQIP  343

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             HIP LL GAKLCS+DP  SR+GI+F+   +D   +Q++HLLSQA KFLGVCYGNAA+ S 
Sbjct  344   HIPWLLFGAKLCSKDPKHSRDGINFSHRLLDLANSQSEHLLSQAHKFLGVCYGNAARSSK  403

Query  1508  SDSERNSYQTQSLNSLTQAAMLCKEDAE--TVFSLGLEYATQRNLTPAFDNALQYSEMTA  1681
              DSER   Q +SL SL +AA   K D E   +F+L +E A QRN+  A D A++YS M  
Sbjct  404   LDSERVFLQKKSLFSLNEAAKRGKADPELDVIFNLSVENAVQRNVQAALDGAVEYSSMVG  463

Query  1682  GSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAM  1861
             G + KGWK LA+++SAE+R  DAE+I+D  ++E G +++L+ LK KA LQ+A++ P QAM
Sbjct  464   GVSTKGWKHLAIVLSAEKRLKDAESILDFTMEEAGDLEKLELLKSKAMLQMAQEQPKQAM  523

Query  1862  ETYRILLAMIQAQRQSGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTID  2041
             +T   LL +I+AQ +S     +L  +K E EAW DLA +Y    SW DA+ C++KA+++ 
Sbjct  524   KTCSNLLGLIRAQEKSEKSEALL--QKFETEAWQDLASVYGKLGSWSDAEACLEKARSMS  581

Query  2042  IYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIAR  2221
              YSP+ W+ TG   EA+   +EAL +F  SLSI+PD+VPSIVS AEV+MK G +++P A+
Sbjct  582   YYSPRGWNETGLCLEAKSLHEEALTSFFLSLSIEPDHVPSIVSIAEVMMKSGGESLPTAK  641

Query  2222  SLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSFV  2380
             S LMNAL+++P  HDAW  LG ++K +G +QQAA+F+QAA+EL+LS PVQSF+
Sbjct  642   SFLMNALKLDPRNHDAWMKLGHVAKKQGMSQQAAEFYQAAYELELSAPVQSFI  694



>ref|XP_009109801.1| PREDICTED: tetratricopeptide repeat protein 7B [Brassica rapa]
Length=703

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/720 (56%), Positives = 517/720 (72%), Gaps = 26/720 (4%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSS-RT-GTADWESRFEEAQVDEVE  421
             MLCACSGEQF+F++   +P+S   LATRDFSASGLSSS RT G ADW+S+ EE+QVDE E
Sbjct  1     MLCACSGEQFRFDDQPGSPES---LATRDFSASGLSSSTRTRGGADWDSKLEESQVDEAE  57

Query  422   STLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkp  601
             STLKEALSLNYEEARALLGRLEYQRGNFDAALQVF+GIDIK L+PR++KAI +RTRP   
Sbjct  58    STLKEALSLNYEEARALLGRLEYQRGNFDAALQVFKGIDIKVLTPRITKAILDRTRPCNK  117

Query  602   rggkgeIVVS----GVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAF  769
                     V+      MS+HSVSLLLEAILLK++SL  LG  ++AA ECK ILD+V+SA 
Sbjct  118   PPRSRASAVTLPPPSSMSMHSVSLLLEAILLKARSLEELGSCKEAAEECKLILDMVESAL  177

Query  770   PNGMSE-GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLAS  946
             P+GM   G+    KLQE+FHKALE LP LW + G   E V SYRRAL +PWNLD +RLA 
Sbjct  178   PSGMPRVGISGFDKLQEVFHKALELLPLLWTKAGDFHETVASYRRALSRPWNLDPQRLAV  237

Query  947   MQKDLAIALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVM  1126
              QK LA+ LL+  VE              PK++MEEAI+LL +L+ K+  G ++WD+E++
Sbjct  238   TQKSLALVLLYGSVEAS------------PKDSMEEAIVLLMLLVKKMVVGGIQWDAELV  285

Query  1127  DHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGS  1306
             DHL +AL++VG+FE LA  +EQILPG+ TR ERWY L+LCYS+AG  +TA+NLL+   G 
Sbjct  286   DHLAYALSMVGQFEVLATYLEQILPGVYTRGERWYLLSLCYSAAGMGKTAINLLKLALGP  345

Query  1307  SEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYG  1486
             SE+   P    LL GAKLCS+DP  SR+GI F++  +D   NQ++HL  QA +FLGVCYG
Sbjct  346   SESRQIPQASWLLFGAKLCSEDPQHSRDGIYFSQRLLDLANNQSEHLFRQAHRFLGVCYG  405

Query  1487  NAAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAE--TVFSLGLEYATQRNLTPAFDNAL  1660
             NAA+ S  DSER S Q +SL SL +AA + K D E   V++L +E A QRNL  A D A+
Sbjct  406   NAARSSKLDSERVSLQKKSLYSLNKAATMAKGDPEPDAVYNLSVENAFQRNLQAALDGAV  465

Query  1661  QYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIAR  1840
             +YS M  G + +GWK LA ++SAE+R  DAE+I+D  ++E G +++L  LKLKA LQ+A+
Sbjct  466   EYSSMVGGVSTRGWKHLAAVLSAEKRLKDAESILDFTMEEAGDMEKLDLLKLKAVLQMAQ  525

Query  1841  QHPNQAMETYRILLAMIQAQRQSGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCI  2020
             + P QA++T    LA+I+AQ +S     +L  +K E EAW DLA +Y    S  DA+ C+
Sbjct  526   EQPKQALKTCSNFLALIRAQEKSEQSETLL--KKYETEAWQDLASVYGKLGSLSDAETCL  583

Query  2021  DKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGS  2200
             DKA++I  YSP+ W+ TG   EA+   +EAL+ F  SLSIDPD+VPSIVS AEV+MK G 
Sbjct  584   DKARSISFYSPRGWNETGLCLEAKSLHEEALIPFFMSLSIDPDHVPSIVSIAEVMMKSGG  643

Query  2201  QAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSFV  2380
               +  A+S LMNALR++P  HDAW  LG ++KM+G +QQAA+F+QAA+EL+LS PVQSF+
Sbjct  644   DTLATAKSFLMNALRLDPRSHDAWMKLGHVAKMQGLSQQAAEFYQAAYELELSAPVQSFI  703



>gb|KFK28981.1| hypothetical protein AALP_AA7G073100 [Arabis alpina]
Length=696

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/714 (56%), Positives = 522/714 (73%), Gaps = 21/714 (3%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQF+F+E   +P+S   LATRDFSASGLSS RTG  DW+S+ E+ QVDE EST
Sbjct  1     MLCACSGEQFRFDEQPGSPES---LATRDFSASGLSS-RTGGPDWDSKLEDIQVDEAEST  56

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLEYQRGNFDAALQVF+GIDI+ L+PR+ KAI E T   +   
Sbjct  57    LKEALSLNYEEARALLGRLEYQRGNFDAALQVFKGIDIRVLTPRIIKAIVESTTRPRKPR  116

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
              +  IV    MS+HSVSLLLEAILLK++SL  LG  ++AA ECK ILDIV+SA P+GM +
Sbjct  117   SRVVIVSPTSMSMHSVSLLLEAILLKARSLEELGSYKEAAGECKIILDIVESALPSGMPD  176

Query  788   -GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLA  964
              G+   CKLQ++F K LE LP LW + G + E + SYRRAL +PWNLD +RLA  QK LA
Sbjct  177   VGISGFCKLQDVFQKGLELLPLLWKKAGDLGETIASYRRALFRPWNLDPQRLAVTQKSLA  236

Query  965   IALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFA  1144
             + LL+  VE          C+   K N EEAI+LL +L+ K+  GE++WDSE+MDHLTFA
Sbjct  237   LVLLYGSVEE---------CT---KANTEEAIVLLMLLVKKMVVGEIQWDSELMDHLTFA  284

Query  1145  LTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHE  1324
             L++ G+FE LA+ +EQ+LPG+ TR ERWY L+LCYS++G ++TA+NLL+  SG SE++  
Sbjct  285   LSMTGQFEVLANYLEQVLPGVYTRGERWYLLSLCYSASGIDKTAINLLKMASGPSESKQI  344

Query  1325  PHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKIS  1504
             PH P LL GAKLCS+DP  SR+GI+FA   +D   NQ++HLLSQA +FLGVCY NAA+ S
Sbjct  345   PHTPWLLFGAKLCSKDPKHSRDGINFAHRVLDLASNQSEHLLSQAHRFLGVCYANAARSS  404

Query  1505  FSDSERNSYQTQSLNSLTQAAMLCKEDAE--TVFSLGLEYATQRNLTPAFDNALQYSEMT  1678
               DSER   Q +SL SL +AA   K+D E   +F+L +E A QRN+  A D A++YS M 
Sbjct  405   RLDSERVLLQKKSLLSLNKAAERAKDDLEPDIIFNLSVENAVQRNIPAALDGAVEYSSMV  464

Query  1679  AGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQA  1858
              G + +GW+ L++++SAE+R  DAE+I++  ++E G I++L+ LKLKA LQ+A++ P QA
Sbjct  465   GGVSTRGWQHLSMVLSAEKRLKDAESILEFTMEEAGDIEKLELLKLKAVLQMAQEQPKQA  524

Query  1859  METYRILLAMIQAQRQSGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTI  2038
             M+T   LLA+I+AQ +      +L   K E EAW DLA +Y    SW DA+ C++KA+ I
Sbjct  525   MKTCSSLLALIRAQEKPEQFKTLL--EKSETEAWEDLASVYRTLGSWSDAETCLEKARAI  582

Query  2039  DIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIA  2218
               YSP+ W+ TG   EA+   +EAL++F  SLSI+PD+VPSIVS A+V+MK G +++  A
Sbjct  583   CFYSPKGWNETGLCQEAKSLHEEALISFFMSLSIEPDHVPSIVSVADVMMKSGGESLATA  642

Query  2219  RSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSFV  2380
             +S LMNALR++P  HDAW  LG ++KM+G +QQAA+F+QAA+EL+LS PVQSF 
Sbjct  643   KSFLMNALRLDPRNHDAWMKLGLVAKMQGLSQQAAEFYQAAYELELSAPVQSFT  696



>emb|CDX90089.1| BnaA08g18950D [Brassica napus]
Length=702

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/719 (55%), Positives = 512/719 (71%), Gaps = 25/719 (3%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSS-RT-GTADWESRFEEAQVDEVE  421
             MLCACSGEQF+F++   +P+S   LATRDFSASGLSSS RT G ADW+S+ EE+QVDE E
Sbjct  1     MLCACSGEQFRFDDQPGSPES---LATRDFSASGLSSSTRTRGGADWDSKLEESQVDEAE  57

Query  422   STLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItert---rp  592
             STLKEALSLNYEEARALLGRLEYQRGNFDAALQVF+GIDIK L+PR+ KAI +RT     
Sbjct  58    STLKEALSLNYEEARALLGRLEYQRGNFDAALQVFKGIDIKVLTPRIIKAIVDRTRPCNK  117

Query  593   rkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFP  772
                      +     MS+HSVSLLLEAILLK++SL  LG  ++AA ECK ILD+V+SA P
Sbjct  118   PTRSSKALTLPPPSSMSMHSVSLLLEAILLKARSLEELGSSKEAAEECKLILDMVESALP  177

Query  773   NGMSE-GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASM  949
             +GM   G+    KLQE+FHKALE LP LW + G   E V SYRRAL +PWNLD +RLA  
Sbjct  178   SGMPRVGISGFDKLQEVFHKALELLPLLWTKAGDFHETVASYRRALSRPWNLDPQRLAVT  237

Query  950   QKDLAIALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMD  1129
             QK LA+ LL+  VE              PK++MEEAI+LL +L+ K+  G ++WD+E++D
Sbjct  238   QKSLALVLLYGSVEAS------------PKDSMEEAIVLLMLLVKKMVVGGIQWDAELVD  285

Query  1130  HLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSS  1309
             HL +AL++VG+FE LA  +EQILPG+ TR  RWY L+LCYS+AG  +TA+NLL+   G S
Sbjct  286   HLAYALSMVGQFEVLASYLEQILPGVYTRGGRWYLLSLCYSAAGMGKTAINLLKLALGPS  345

Query  1310  EAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGN  1489
             E+   P    LL GAKLCS+DP  SR+GI F++  +D   NQ++HL  QA +FLGVCYGN
Sbjct  346   ESRQIPQASWLLFGAKLCSEDPQHSRDGIYFSQRLLDLANNQSEHLFRQAHRFLGVCYGN  405

Query  1490  AAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAE--TVFSLGLEYATQRNLTPAFDNALQ  1663
             AA+ S  DSER S Q +SL SL +AA + K D E   V++L +E A QRNL  A D A++
Sbjct  406   AARSSKLDSERVSLQKKSLYSLNKAATMAKGDPEPDAVYNLSVENAFQRNLQAALDGAVE  465

Query  1664  YSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQ  1843
             YS M  G + +GWK LA ++SAE+R  DAE+I+D  ++E G +++L  LKLKA LQ+A++
Sbjct  466   YSSMVGGVSTRGWKHLAAVLSAEKRLKDAESILDFTMEEAGDMEKLDLLKLKAVLQMAQE  525

Query  1844  HPNQAMETYRILLAMIQAQRQSGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCID  2023
              P QA++T    LA+I+AQ +S     +L  +K E EAW DLA +Y    S  DA+ C+D
Sbjct  526   QPKQALKTCSNFLALIRAQEKSEQSETLL--KKYETEAWQDLASVYGKLGSLSDAETCLD  583

Query  2024  KAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQ  2203
             KA++I  YSP+ W+ TG   EA+   +EAL+ F  SLSIDPD+VPSIVS AEV+MK G  
Sbjct  584   KARSISFYSPRGWNETGLCLEAKSLHEEALIPFFMSLSIDPDHVPSIVSIAEVMMKSGGD  643

Query  2204  AVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSFV  2380
              +  A+S LMNALR++P  HDAW  LG ++KM+G +QQAA+F+QAA+EL+LS PVQSF+
Sbjct  644   TLATAKSFLMNALRLDPRSHDAWMKLGHVAKMQGLSQQAAEFYQAAYELELSAPVQSFI  702



>emb|CDY11807.1| BnaC03g57710D [Brassica napus]
Length=702

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/719 (55%), Positives = 515/719 (72%), Gaps = 25/719 (3%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSS-RT-GTADWESRFEEAQVDEVE  421
             MLCACSGEQF+F++   +P+S   LATRDFSASGLSSS RT G ADW+S+ EE+QVDE E
Sbjct  1     MLCACSGEQFRFDDQPGSPES---LATRDFSASGLSSSTRTRGGADWDSKLEESQVDEAE  57

Query  422   STLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkp  601
             STLKEALSLNYEEARALLGRLEYQRGNFDAALQVF+GIDIK L+PR+ KAI +RTRP   
Sbjct  58    STLKEALSLNYEEARALLGRLEYQRGNFDAALQVFKGIDIKVLTPRIIKAIVDRTRPCNK  117

Query  602   rggkgeIVV---SGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFP  772
                  + V       MS+HSVSLLLEAILLK+ SL  LG  ++AA ECK ILD+V+SA P
Sbjct  118   PPRSSKAVTLPPPTSMSMHSVSLLLEAILLKATSLEELGSCKEAAEECKLILDMVESALP  177

Query  773   NGMS-EGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASM  949
             +GM  +G+    KLQE+FHKALE LP LW + G   E V SYRRAL +PWNLD +RLA  
Sbjct  178   SGMPPQGLSGFDKLQEVFHKALELLPSLWTKAGDFHETVASYRRALSRPWNLDPQRLAVT  237

Query  950   QKDLAIALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMD  1129
             QK LA+ LL+  VE               K++MEEAI+LL +L+ K+  G ++WD+E+MD
Sbjct  238   QKSLALVLLYGSVEAS------------TKDSMEEAIVLLMLLVKKMVVGGIQWDAELMD  285

Query  1130  HLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSS  1309
             HLT++L++VG+FE LA  +EQILPG+ TR  RWY L+LCYS+AG ++TA+NLL+   G S
Sbjct  286   HLTYSLSMVGQFEVLASYLEQILPGVYTRGGRWYLLSLCYSAAGIDKTAINLLKLALGPS  345

Query  1310  EAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGN  1489
             E+   P    LL GAKLCS+DP  SR+GI+ +   +D   NQ++HL  QA +FLGVCYGN
Sbjct  346   ESRQIPQASWLLFGAKLCSEDPQHSRDGINCSHKLLDLANNQSEHLFRQAHRFLGVCYGN  405

Query  1490  AAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAE--TVFSLGLEYATQRNLTPAFDNALQ  1663
             AA+ S  DSER   Q +SL SL +AA + K D E   V++L +E A QRNL  A D A++
Sbjct  406   AARSSKLDSERVLLQKKSLYSLNKAATMAKGDPEPDVVYNLSVENAFQRNLQAALDGAVE  465

Query  1664  YSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQ  1843
             YS M  G + +GWK LA ++SAE+R  DAE+I+D  ++E G +++L  LKLKA LQ+A++
Sbjct  466   YSSMVGGVSTRGWKHLAAVLSAEKRLKDAESILDFTMEEAGDMEKLDLLKLKAVLQMAQE  525

Query  1844  HPNQAMETYRILLAMIQAQRQSGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCID  2023
              P QA++T    LA+I+AQ +S     +L  +K E EAW DLA +Y    S  DA+ C+D
Sbjct  526   QPKQALKTCSNFLALIRAQEKSEQSKTLL--KKYETEAWQDLASVYGKLGSLSDAETCLD  583

Query  2024  KAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQ  2203
             KA++I  YSP+ W+ TG   EA+   +EAL+AF  SLSIDPD+VPSIVS AEV+MK G  
Sbjct  584   KARSISFYSPRGWNETGLCLEAKSLHEEALIAFFMSLSIDPDHVPSIVSIAEVMMKSGGD  643

Query  2204  AVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSFV  2380
              +  A+S LMNALR++P  HDAW  LG ++KM+G +QQAA+F+QAA+EL+LS PVQSF+
Sbjct  644   TLATAKSFLMNALRLDPRSHDAWMKLGHVAKMQGLSQQAAEFYQAAYELELSAPVQSFI  702



>ref|XP_006601262.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X5 
[Glycine max]
Length=558

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/554 (64%), Positives = 435/554 (79%), Gaps = 7/554 (1%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQFKFEE  P       LATRDFSASGLSS RTG  DWES+F+E QV++VEST
Sbjct  1     MLCACSGEQFKFEEAPPRSPDS--LATRDFSASGLSS-RTG--DWESKFDETQVEDVEST  55

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLEYQRGNFDAALQVF+GIDI+ L+PRM +AI ERT+ RK R 
Sbjct  56    LKEALSLNYEEARALLGRLEYQRGNFDAALQVFEGIDIRALTPRMIRAIAERTKQRKSRS  115

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                  V+  VMS+HSVSL+LEAILLKSKS   LGR  +AA+EC+ ++D V+SA PNGM E
Sbjct  116   KVDN-VLPNVMSMHSVSLILEAILLKSKSSEELGRYTEAAKECRIVVDTVESALPNGMPE  174

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G+GEDCKLQEMFH+ALE LP LW++ GL+DE V +YRRALVKPWNL+ +RLA +QKDLA 
Sbjct  175   GIGEDCKLQEMFHEALELLPNLWMKAGLLDEVVTAYRRALVKPWNLEPQRLACVQKDLAT  234

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LL+ GVEV+L P+ ++   T P +  EEAILLL +L GK+   E++WD E+MDHLTF+L
Sbjct  235   TLLYGGVEVNLPPQLQVNGITTPMSGTEEAILLLLILSGKMALQEIDWDPEIMDHLTFSL  294

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             +V G FESLAD+VE+ILPG+  RAE+WYFLALCYS+AGQNE ALNLLRK  GSSEA+H P
Sbjct  295   SVTGMFESLADHVEKILPGVHDRAEQWYFLALCYSAAGQNEVALNLLRKACGSSEAKHRP  354

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             H PS L GAKLCS +P  +REGI F++  +D   +QN+H LSQ +KFLG+C+G AA+IS 
Sbjct  355   HFPSFLFGAKLCSLNPNHAREGIKFSQEVIDLVKHQNEHFLSQGQKFLGICHGAAARISV  414

Query  1508  SDSERNSYQTQSLNSLTQAAMLC-KEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAG  1684
              DSER  +Q +SL  L  AA+     D E + +LGLE A QRNL  A+DN + YS+M AG
Sbjct  415   LDSERIIFQKESLKFLKDAALNGNNNDPEVMLTLGLENAIQRNLNAAYDNIMMYSDMMAG  474

Query  1685  STAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAME  1864
             S+ +GW+LLAL VSA+QRF DAE IVD ALDE G IDQL+ L+LKA LQI +Q P QA+E
Sbjct  475   SSRRGWQLLALTVSAQQRFQDAETIVDFALDEAGDIDQLELLRLKAVLQITQQQPKQAIE  534

Query  1865  TYRILLAMIQAQRQ  1906
             TYRILLA+I+A+++
Sbjct  535   TYRILLAVIEARKE  548



>gb|EMT30224.1| Tetratricopeptide repeat protein 7A [Aegilops tauschii]
Length=726

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/720 (52%), Positives = 507/720 (70%), Gaps = 17/720 (2%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLC CSG+Q KFEE   +P+S   LATRDFSASG S SR G    E+  +++QV+EVES 
Sbjct  5     MLCTCSGDQSKFEEMPRSPES---LATRDFSASG-SCSRPGKR--EATPDDSQVNEVESD  58

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             L+E LSLNYEEARALLGRLEYQRGNFDAALQV QGIDI++L PRM+ A+TE  +P+    
Sbjct  59    LRETLSLNYEEARALLGRLEYQRGNFDAALQVLQGIDIRSLKPRMTSAVTESAKPKVSPR  118

Query  608   gkgeIV--VSGV---MSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFP  772
                     V+G+   MS+HSVSLLLEAILLK++SL  LGR+ DAA EC+ I+DIV+SA+P
Sbjct  119   SSRRKTSQVNGMLVHMSMHSVSLLLEAILLKARSLERLGRVTDAAEECRTIIDIVESAWP  178

Query  773   NGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQ  952
             +G+ EG  EDCKL +MFH ALE+LP LW++ G  +EA+ +YRRAL +PWNLD++R A++Q
Sbjct  179   DGVPEGTSEDCKLIDMFHSALEYLPNLWMKSGCFEEAITAYRRALSRPWNLDSQRSANLQ  238

Query  953   KDLAIALLFAGVEVDLSPRFKIWCS-TPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMD  1129
             KDLA+ LL+ G+EV     F    +   P+NN+EEAILLLFVL+ K+   E++WD ++++
Sbjct  239   KDLAVTLLYCGIEVKSPQEFSQQRNLATPENNIEEAILLLFVLIRKLTLQEIKWDPDLVN  298

Query  1130  HLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSS  1309
             HL +AL++ G +E LA ++E +LPG  +R+ERWY LALCYS+AG +++ALN++R      
Sbjct  299   HLMYALSLSGHYEVLARHLEMLLPGTYSRSERWYVLALCYSAAGMDDSALNIIRNGFRVL  358

Query  1310  EAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGN  1489
             + + +PHIPSLLLGAKLC ++P  + EGI FA  A +S  + + H +S    FLGVCYG 
Sbjct  359   QRKGKPHIPSLLLGAKLCCKNPKHASEGIKFANKARESFRSHDMHFISAVNHFLGVCYGP  418

Query  1490  AAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYS  1669
              A+ S S +E+   Q  +L  L  AA   K + E ++SL  E A QR L  A ++A +  
Sbjct  419   FARSSTSHTEKMRLQDDALRLLQDAAATAKYNPEILYSLAWENAMQRKLNAAIESAAECL  478

Query  1670  EMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHP  1849
             EM  GS+   WKLL L++SA+Q   +AE++ D+ALDE  Q DQ+  L+LKA +Q +R   
Sbjct  479   EMVTGSSVSTWKLLILVLSAQQNLEEAESVADIALDEAEQEDQMDILRLKALIQSSRGQF  538

Query  1850  NQAMETYRILLAMIQAQRQ----SGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVC  2017
               A+E++RILLA+IQA+++    +  D +V S  KLE+EAWLDLA IY   ++W D+ +C
Sbjct  539   KSAVESFRILLAIIQAKKEIWKLTPYD-KVKSLHKLEMEAWLDLASIYTKLEAWNDSNIC  597

Query  2018  IDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMG  2197
             +DKAK+ID  SP+ WH  G + EAQ   +EAL AFSFSLSI+PDYVPS+VS A +L  +G
Sbjct  598   LDKAKSIDFLSPKCWHVKGLILEAQSLHQEALEAFSFSLSINPDYVPSMVSMASILRTLG  657

Query  2198  SQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             +++  IAR+ L +A R+EPT H AW  LG + K EGS  +AAD FQAA+EL   +P+Q F
Sbjct  658   AKSSSIARTFLRSATRLEPTNHQAWMGLGLVLKSEGSVLEAADCFQAAYELLELSPIQDF  717



>gb|EMS66738.1| Tetratricopeptide repeat protein 7A [Triticum urartu]
Length=761

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/755 (49%), Positives = 508/755 (67%), Gaps = 52/755 (7%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLC CSG+Q KFEE   +P+S   LATRDFSASG S SR G    E+  +++QV+EVES 
Sbjct  5     MLCTCSGDQSKFEEMPRSPES---LATRDFSASG-SCSRPGKR--EATPDDSQVNEVESD  58

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             L+E LSLNYEEARALLGRLEYQRGNFDAALQV QGIDI++L PRM+ A+TE  +P+    
Sbjct  59    LRETLSLNYEEARALLGRLEYQRGNFDAALQVLQGIDIRSLKPRMTSAVTESAKPKVSPR  118

Query  608   gkgeIV--VSGV---MSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFP  772
                     V+G+   MS+HSVSLLLEAILLK++SL  LGR+ DAA EC+ I+DIV+SA+P
Sbjct  119   SSRRKTSQVNGMLVHMSMHSVSLLLEAILLKARSLERLGRVTDAAEECRTIIDIVESAWP  178

Query  773   NGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQ  952
             +G+ EG  EDCKL +MFH ALE+LP LW++ G  +EA+ +YRRAL +PWNLD++R A++Q
Sbjct  179   DGVPEGTSEDCKLIDMFHSALEYLPNLWMKSGCFEEAITAYRRALARPWNLDSQRSANLQ  238

Query  953   KDLAIALLFAGVEVDLSPRFKIWCS-TPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMD  1129
             KDLA+ LL+ G+EV     F    +   P+NN+EEAILLLFVL+ K+   E++WD ++++
Sbjct  239   KDLAVTLLYCGIEVKSPQEFSQQRNLATPENNIEEAILLLFVLIRKLTFQEIKWDPDLVN  298

Query  1130  HLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSS  1309
             HL +AL++ G +E LA ++E +LPG  +R+ERWY LALCYS+AG +++ALN++R      
Sbjct  299   HLMYALSLSGHYEVLARHLEMLLPGTYSRSERWYVLALCYSAAGMDDSALNIIRNGFRVL  358

Query  1310  EAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGN  1489
             E + +PHIPSLLLGAKLC ++P  + EGI FA  A +S  + + H +S    FLGVCYG 
Sbjct  359   ERKGKPHIPSLLLGAKLCCKNPKHASEGIKFANKARESFRSHDMHFISAVNHFLGVCYGP  418

Query  1490  AAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYS  1669
              A+ S S +E+   Q  +L  L  AA   K + E ++SL  E A QR L  A ++A +  
Sbjct  419   FARSSTSHTEKMRLQDDALRLLQDAAATAKYNPEILYSLAWENAMQRKLNAAIESAAECL  478

Query  1670  EMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHP  1849
             EM  GS+   WKLL L++SA+Q   +AE++ D+ALDE  Q DQ+  L+LKA +Q +R   
Sbjct  479   EMVTGSSVSTWKLLILVLSAQQNLEEAESVADIALDEAEQEDQMGILRLKALIQSSRGQS  538

Query  1850  NQAMETYRILLAMIQAQRQ----SGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVC  2017
               A+E++RILLA+IQA+++    +  D +V S  +LE+EAWLDLA IY   ++W D+ +C
Sbjct  539   KSAVESFRILLAIIQAKKEIWKLTPYD-KVKSLHELEMEAWLDLASIYTKLEAWNDSNIC  597

Query  2018  IDKAKTIDIYSPQSWH-----------------------------------TTGALFEAQ  2092
             +DKAK+ID  SP+ WH                                   + G + EAQ
Sbjct  598   LDKAKSIDFLSPKCWHVKDIKISKRTLYLFAIIFEFWLSHTIEVDITCMCLSNGLILEAQ  657

Query  2093  ERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAW  2272
                +EAL AFSFSLSI+PDYVPS+VS A +L  +G+++  IAR+ L +A R+EPT H AW
Sbjct  658   SLHQEALEAFSFSLSINPDYVPSMVSMASILRTLGAKSSSIARTFLRSATRLEPTNHQAW  717

Query  2273  FSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
               LG + K EGS  +AAD FQAA+EL   +P+Q F
Sbjct  718   MGLGLVLKSEGSVLEAADCFQAAYELLELSPIQDF  752



>gb|AGT16353.1| tetratricopeptide repeat protein [Saccharum hybrid cultivar R570]
Length=726

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/719 (51%), Positives = 502/719 (70%), Gaps = 15/719 (2%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLC CSG+Q KFE+   +P+S   LATRDFSA+  SS     A  E+  +++QV+EVES 
Sbjct  5     MLCTCSGDQSKFEDLPRSPES---LATRDFSANCSSSK---IASRETTPDDSQVNEVESD  58

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprk--p  601
             LKE LSLNYEEARALLGRLE+QRGNFDAALQV QGIDI++L PRM+ AI E  +PR    
Sbjct  59    LKETLSLNYEEARALLGRLEHQRGNFDAALQVLQGIDIRSLRPRMTSAIAESIKPRTPPR  118

Query  602   rggkgeIVVSGV---MSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFP  772
                +    V+G+   MS+HSVSLLLEAILLK+KSL  LGR+ DAA EC+ I+DI++SA+P
Sbjct  119   SSRRKSSQVNGMLMHMSMHSVSLLLEAILLKAKSLDTLGRVADAAEECRTIIDIIESAWP  178

Query  773   NGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQ  952
              G+ +G  E+CKL ++FH ALE+LPKLW++ G  DEA+ +YRRAL KPWNLD++R A +Q
Sbjct  179   YGVPDGTAEECKLIDIFHSALEYLPKLWMRSGCFDEAIIAYRRALAKPWNLDSQRSAKLQ  238

Query  953   KDLAIALLFAGVEVDLSPRFKIWCS-TPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMD  1129
             KDLA+ LL+ GVEV     F    +   P NN+EEAILLL +L  K+   E++WD ++++
Sbjct  239   KDLAVTLLYCGVEVKFPQEFAQERNLVTPGNNLEEAILLLLMLTRKLSLREIQWDPDLVN  298

Query  1130  HLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSS  1309
             HL +AL++ G +E LA ++E +LPG  TR+ERWY LALCYS+AG +++ALN++R      
Sbjct  299   HLMYALSLSGHYEVLASHLEMLLPGTYTRSERWYILALCYSAAGMDDSALNIIRNGFSVL  358

Query  1310  EAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGN  1489
             E + +PH+PSLLLGAKLC ++P  + EGI FA  AM S  +++ H +S A+ FLGVCYG 
Sbjct  359   ERKGKPHVPSLLLGAKLCCKNPKHASEGIKFANKAMKSFRSRDLHFISTAKHFLGVCYGP  418

Query  1490  AAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYS  1669
              ++   S  E++  +  +L  L  AA   K + E ++SL  E A QR L  A ++A +  
Sbjct  419   FSRSPASHLEKSRLEDDALRLLQDAATTAKYNPEIMYSLAWENAMQRKLNAAVESATECL  478

Query  1670  EMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHP  1849
             EM  G +   WKLL L++SA+Q   +AEA+ D A+DE  + DQL  L+LKA +Q +R   
Sbjct  479   EMVMGGSVNAWKLLILVLSAQQNLQEAEAVADFAMDEAEKNDQLDILRLKAQIQASRGQF  538

Query  1850  NQAMETYRILLAMIQAQRQ---SGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCI  2020
               A+E++R+LLA IQ Q++   S   +EV   +KLE+++WLDLA IY   ++W D+ +C+
Sbjct  539   KSAVESFRVLLATIQVQKEVWKSTTCNEVKCLQKLEMDSWLDLASIYSKLEAWHDSNICL  598

Query  2021  DKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGS  2200
             DKA +ID + P+ WH  G L EAQ   KEAL+AFSF+LSIDPDYVP++V TA +L  +G 
Sbjct  599   DKAISIDFFYPKCWHVRGLLLEAQFLQKEALMAFSFALSIDPDYVPAMVCTAGILRNIGG  658

Query  2201  QAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
              ++ IAR+ L NALR+EPT H AW SLG + K EGS Q+AAD FQAA+EL+  +P+Q F
Sbjct  659   NSLSIARTYLRNALRLEPTHHRAWLSLGLVLKAEGSLQEAADCFQAAYELRELSPIQDF  717



>ref|XP_003558571.1| PREDICTED: tetratricopeptide repeat protein 7A [Brachypodium 
distachyon]
Length=725

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/719 (50%), Positives = 502/719 (70%), Gaps = 16/719 (2%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLC CSG+Q KFEE   +P+S   LATRDFSA+G  SSRTG  + E+  +++QV+EVES 
Sbjct  5     MLCTCSGDQSKFEEMPRSPES---LATRDFSANG--SSRTG--NREATPDDSQVNEVESD  57

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             L+E LSLNYEEARALLGRLEYQRGNF+ ALQV QGIDI +L PRM+ AITE  +P+    
Sbjct  58    LRETLSLNYEEARALLGRLEYQRGNFEGALQVLQGIDIGSLKPRMTSAITESVKPKVSPR  117

Query  608   gkgeIV--VSGV---MSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFP  772
                     V+G+   MS+HSVSLLLEAILLK+KSL  LGR+ DAA +C+ I+DIV+SA+P
Sbjct  118   SSRRKTSQVNGMLMHMSMHSVSLLLEAILLKAKSLESLGRVTDAAEQCRIIIDIVESAWP  177

Query  773   NGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQ  952
              G+ EG  E+CKL +MFH ALE+LP LW++ G  +EA+ +YRRAL +PWNLD++R A++Q
Sbjct  178   CGVPEGASEECKLIDMFHSALEYLPNLWMRSGCFEEAIIAYRRALARPWNLDSQRSANLQ  237

Query  953   KDLAIALLFAGVEVDLSPRFKIWCS-TPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMD  1129
             KDLA+ LL+ G+EV     F    +   P+NN+EEAILLLFVL+ K+   E++WD ++++
Sbjct  238   KDLAVTLLYCGIEVKFPQEFNQQQNLVTPENNIEEAILLLFVLITKLASQEMKWDPDLVN  297

Query  1130  HLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSS  1309
             HL +AL++ G  E LA ++E +LPG  +R+ERWY LALCYS+AG +++ALN++R      
Sbjct  298   HLLYALSLSGHCEILARHLEMLLPGTYSRSERWYILALCYSAAGMDDSALNIIRNGFRVL  357

Query  1310  EAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGN  1489
             + + +PHIPSLLLGAKLC ++P  + EGI FA  AM S  + + HL+     FLGVCYG 
Sbjct  358   QRKGKPHIPSLLLGAKLCCKNPKHASEGIKFANEAMKSFRSHDIHLIGIVNHFLGVCYGP  417

Query  1490  AAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYS  1669
              A+ S S SE+   Q  +L  L  AA + K + + ++SL  E A QR L  A ++A +  
Sbjct  418   FARSSTSHSEKMRLQDDALRFLQDAAAMAKYNPDILYSLAWENAMQRKLNAAVESATKCL  477

Query  1670  EMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHP  1849
             EM  GS+   WKLL L++SA+Q   +AEA+ ++ALDE  + DQ+  L+LKA +Q +R   
Sbjct  478   EMVTGSSVITWKLLILVLSAQQNLQEAEAVANIALDEAEKEDQMDILRLKAQIQASRGQF  537

Query  1850  NQAMETYRILLAMIQAQRQS---GMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCI  2020
               A+E+ RILLA+I+A+++        +V S  KLE+EAWLDLA IY   ++W D+ +C+
Sbjct  538   KSAVESLRILLAIIEAKKEVWKLTPYEKVKSIHKLEMEAWLDLASIYTKLEAWHDSNLCL  597

Query  2021  DKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGS  2200
              KAK+I+ +S + WH  G + EAQ   ++AL AFSFSLSIDPDYVPS+V  A +L  +G 
Sbjct  598   HKAKSINFFSTKCWHVKGLILEAQSMHQDALAAFSFSLSIDPDYVPSMVCMAGILRNLGG  657

Query  2201  QAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             +++ IAR++L +A+R+EPT H AW  LG + K EGS  +A D FQA++EL   +P+Q F
Sbjct  658   KSLSIARTILRSAIRLEPTNHQAWLGLGLVLKSEGSLVEAVDCFQASYELLELSPIQDF  716



>gb|EEE58520.1| hypothetical protein OsJ_09805 [Oryza sativa Japonica Group]
Length=724

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/718 (52%), Positives = 504/718 (70%), Gaps = 15/718 (2%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLC+CSG+Q KFEE   +P+S   LATRD+SA+G SSSR G  + ES  ++ QV EVES 
Sbjct  5     MLCSCSGDQSKFEEMPRSPES---LATRDYSATG-SSSRIG--NRESTPDDNQVSEVESD  58

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             L+E LSLNYEEARALLGRLE+QRGNFDAALQV QGIDI++L PRM+ AI +  +PR P  
Sbjct  59    LRETLSLNYEEARALLGRLEHQRGNFDAALQVLQGIDIRSLMPRMTTAIADSVKPRGPPR  118

Query  608   gkgeIV-VSGV---MSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPN  775
              + +   V+G+   MS+HSVSLLLEAILLK+KSL GLGR+ DAA EC+ I+DIV+SA+P 
Sbjct  119   SRKKTSQVNGMLMHMSMHSVSLLLEAILLKAKSLEGLGRVTDAAEECRTIIDIVESAWPY  178

Query  776   GMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQK  955
             G+ EG  E+CKL ++FH ALE+LPKLW++ G  +EA+ +YRRAL KPWNLD++R A++QK
Sbjct  179   GVPEGTSEECKLIDIFHSALEYLPKLWMRSGCCEEAIIAYRRALAKPWNLDSQRSANLQK  238

Query  956   DLAIALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHL  1135
             DLA+ LL+ G +V  +  F       P+NNMEEAILLL +L  K+   E++WD ++++HL
Sbjct  239   DLAVTLLYCGAQVKFTQEFDQHKPATPRNNMEEAILLLLILTKKLALQEIKWDPDLVNHL  298

Query  1136  TFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEA  1315
              FAL++ G +E LA ++E +LPG   R+ERWY LALCYS+AG +++ALN++R      E 
Sbjct  299   MFALSLSGHYEILASHLEMLLPGTYNRSERWYILALCYSAAGMDDSALNIIRNGFNVLER  358

Query  1316  EHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAA  1495
             + +PHIPSLLLGAKLC ++P ++ EGI FA  AM S    + H +S     LGVCYG  A
Sbjct  359   KGKPHIPSLLLGAKLCCKNPKRASEGIKFADKAMKSFRKHDFHFVSVVNHLLGVCYGPFA  418

Query  1496  KISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEM  1675
             + S S +E+   Q ++L  L  AA + K   E ++SL  E A QR L  A ++A +  EM
Sbjct  419   RSSTSHAEKLRLQDEALRLLQDAAAMAKYSPEIMYSLAWENAMQRKLNAAVESATECVEM  478

Query  1676  TAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQ  1855
               GS    WKLL L++SA+Q   +AEA+ ++A+DE  + DQ+  L+LKA +Q +R     
Sbjct  479   VMGSLVSAWKLLILVLSAQQNLKEAEAVANIAIDEAEKEDQMGILRLKAHIQASRGQFKS  538

Query  1856  AMETYRILLAMIQAQ----RQSGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCID  2023
             A+E++R LLA+IQA+    +Q+  D +V S + LE+EAWLDLA IY   +SW D+ VC+D
Sbjct  539   AVESFRSLLAIIQAKKEIWKQTPYD-KVKSLQNLEMEAWLDLASIYTKLESWHDSNVCLD  597

Query  2024  KAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQ  2203
             KAK+I  +SP+  H  G + +AQ   +EAL AFS SLSIDPDYVPS+V  A +L  +G +
Sbjct  598   KAKSISSFSPKCCHVRGLILQAQSLHQEALTAFSLSLSIDPDYVPSMVCMAGILTILGGK  657

Query  2204  AVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             ++ IAR+ L NALR+EPT H AW  LG + K EGS  +AAD FQAA+EL+  +P+Q F
Sbjct  658   SLSIARTFLRNALRLEPTSHQAWLRLGLVLKSEGSLLEAADCFQAAYELQELSPIQDF  715



>ref|XP_002465691.1| hypothetical protein SORBIDRAFT_01g043840 [Sorghum bicolor]
 gb|EER92689.1| hypothetical protein SORBIDRAFT_01g043840 [Sorghum bicolor]
Length=726

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/719 (51%), Positives = 499/719 (69%), Gaps = 15/719 (2%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLC CS +Q KFE+   +P+S   LATRDFSA+  SS     A  E+  +++QV+EVES 
Sbjct  5     MLCTCSRDQSKFEDLPRSPES---LATRDFSANCSSSK---MASRETTPDDSQVNEVESD  58

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprk--p  601
             LKE LSLNYEEARALLGRLE+QRGNFDAALQV QGIDI++L PRM+ AI E  +PR    
Sbjct  59    LKETLSLNYEEARALLGRLEHQRGNFDAALQVLQGIDIRSLRPRMTSAIAESIKPRTPPR  118

Query  602   rggkgeIVVSGV---MSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFP  772
                +    V+G+   MS+HSVSLLLEAILLK+KSL  LGR+ DAA EC+ I+DI++SA+P
Sbjct  119   SSRRKSSQVNGMLMHMSMHSVSLLLEAILLKAKSLDTLGRVADAAEECRTIIDIIESAWP  178

Query  773   NGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQ  952
              G+ +G  E+CKL ++FH ALE+LPKLW++ G  DEA+ +YRRAL KPWNLD++R A MQ
Sbjct  179   YGVPDGTAEECKLIDIFHSALEYLPKLWMRSGCFDEAIIAYRRALAKPWNLDSQRSAKMQ  238

Query  953   KDLAIALLFAGVEVDLSPRFKIWCS-TPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMD  1129
             KDLA+ LL+ GVEV     F    +   P NN+EEAILLL +L  K+   E++WD ++++
Sbjct  239   KDLAVTLLYCGVEVKFPQEFAQERNLVTPGNNLEEAILLLLMLTRKLSLREIQWDPDLVN  298

Query  1130  HLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSS  1309
             HL +AL++ G +E LA ++E +LPG  TR+ERWY LALCY +AG +++ALN++R      
Sbjct  299   HLMYALSLSGHYEVLASHLEMLLPGTYTRSERWYILALCYGAAGMDDSALNIIRNGFSVL  358

Query  1310  EAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGN  1489
             E + +PH+PSLLLGAKLC ++P  + EGI FA  AM S   ++ H +S A+ FLGVCYG 
Sbjct  359   ERKGKPHVPSLLLGAKLCCKNPKHASEGIKFANKAMKSFGRRDLHFISTAKHFLGVCYGP  418

Query  1490  AAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYS  1669
              ++ S S  E++  +  +L  L  AA   K + E ++SL  E A QR L  A ++A +  
Sbjct  419   FSRSSASHLEKSRLEDNALRLLQDAATTAKYNPEIMYSLAWENAMQRKLNAAVESATECL  478

Query  1670  EMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHP  1849
             EM  G +   WKLL L++SA+Q   +AEA+ D A+DE  + DQL  L+LKA +Q +R   
Sbjct  479   EMVMGGSVSAWKLLILVLSAQQNLQEAEAVADFAMDEAEKNDQLDILRLKAQIQASRGQF  538

Query  1850  NQAMETYRILLAMIQAQR---QSGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCI  2020
               A+E++R+LLA IQ ++   +S   +EV   +KLE+++WLDLA IY   ++W D+ +C+
Sbjct  539   KSAVESFRVLLASIQVKKDIWKSTTCNEVKCLQKLEMDSWLDLASIYSKLEAWHDSNICL  598

Query  2021  DKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGS  2200
             DKA +I+ + P+ WH  G L EAQ   KEAL+AFSF+LSIDPDYVPS+V  A +L  +G 
Sbjct  599   DKAISINFFYPKCWHVRGLLLEAQFLHKEALMAFSFALSIDPDYVPSMVCMAGILRDIGG  658

Query  2201  QAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
              ++ IAR+ L NALR+EPT H AW SLG + K EGS Q+AAD FQAA+EL+  +P+Q F
Sbjct  659   NSLSIARTYLRNALRLEPTNHRAWLSLGLVLKAEGSLQEAADCFQAAYELRELSPIQDF  717



>ref|XP_008664767.1| PREDICTED: uncharacterized protein LOC100216592 isoform X1 [Zea 
mays]
 ref|XP_008664771.1| PREDICTED: uncharacterized protein LOC100216592 isoform X1 [Zea 
mays]
 ref|XP_008664779.1| PREDICTED: uncharacterized protein LOC100216592 isoform X1 [Zea 
mays]
 ref|XP_008664787.1| PREDICTED: uncharacterized protein LOC100216592 isoform X1 [Zea 
mays]
 gb|ACN25227.1| unknown [Zea mays]
 tpg|DAA43943.1| TPA: hypothetical protein ZEAMMB73_152276 [Zea mays]
 tpg|DAA43944.1| TPA: hypothetical protein ZEAMMB73_152276 [Zea mays]
Length=726

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/719 (51%), Positives = 498/719 (69%), Gaps = 15/719 (2%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLC CSG+Q KFE+   +P+S   LATRDFSA+  SS     A  E+  +++QV+EVES 
Sbjct  5     MLCTCSGDQSKFEDLPRSPES---LATRDFSANCSSSK---MASRETTPDDSQVNEVESD  58

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprk--p  601
             LKE LSLNYEEARALLGRLE+QRGNFDAALQV QGIDI++L PRM+ AI E  +PR    
Sbjct  59    LKETLSLNYEEARALLGRLEHQRGNFDAALQVLQGIDIRSLRPRMTTAIAESVKPRMPPR  118

Query  602   rggkgeIVVSGV---MSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFP  772
                +    V+G+   MS+HSVSLLLEAILLK+KSL  LGR  DAA EC+ I+DI++SA+P
Sbjct  119   SSRRKSSQVNGMLMHMSMHSVSLLLEAILLKAKSLDTLGRAADAAEECRTIIDIIESAWP  178

Query  773   NGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQ  952
              G+ +G  E+CKL ++FH ALE+LPKLW++ G  DEA+ +YRRAL KPWNL ++R A +Q
Sbjct  179   YGVPDGTSEECKLIDIFHSALEYLPKLWMRSGCFDEAIIAYRRALAKPWNLGSQRSAKLQ  238

Query  953   KDLAIALLFAGVEVDLSPRFKIWCS-TPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMD  1129
             K+LA++LL+ GVEV     F    +   P NN+EEAILLL +L  K+   E++WD ++++
Sbjct  239   KELAVSLLYCGVEVKFPQEFSQERNLVTPGNNLEEAILLLLMLTRKLFLREIQWDPDLVN  298

Query  1130  HLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSS  1309
             HL +AL++ G +E LA ++E +LPG  TR+ERWY LALCYS+AG +++ALN++R      
Sbjct  299   HLVYALSLSGHYEVLASHLEMLLPGTYTRSERWYILALCYSAAGMDDSALNIIRNGFSVL  358

Query  1310  EAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGN  1489
             E + +PH+PSLLLGAKLC ++P  + EGI FA  AM S  +++ H +S  + FLGVCYG 
Sbjct  359   ERKGKPHVPSLLLGAKLCCKNPKHASEGIKFANKAMKSFRSRDLHFISTTKHFLGVCYGP  418

Query  1490  AAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYS  1669
              ++ S S  +++  Q  +L  L  AA   K + E ++SL  E A QR L  A ++A +  
Sbjct  419   FSRSSTSYLDKSRLQDNALRLLQDAATTAKYNPEIMYSLAWENAMQRKLNAAVESATECL  478

Query  1670  EMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHP  1849
             EM  G +   WKLL L++SA+Q   +AEA+ D A+DE  + DQL  L+LKA +Q +R   
Sbjct  479   EMVMGGSVSAWKLLILVLSAQQNLQEAEAVADFAMDEAEKNDQLDILRLKAQIQASRGQF  538

Query  1850  NQAMETYRILLAMIQAQRQS---GMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCI  2020
               A+ET+R+LLA IQ +++       +EV   +KLE++AWLDLA IY   ++W D+ +C+
Sbjct  539   KSAVETFRVLLAAIQVKKEVWKLTTCNEVKCLQKLEMDAWLDLASIYSKLEAWHDSNICL  598

Query  2021  DKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGS  2200
             DKA +ID Y P+ WH  G L EAQ   KEAL+AFSF+LSIDPDYVP +V  A +L  +G 
Sbjct  599   DKAISIDFYYPKCWHVRGLLLEAQFLHKEALMAFSFALSIDPDYVPGMVCMAGILRNIGG  658

Query  2201  QAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
              ++ IAR+ L NALR+EPT H AW SLG + K EGS Q+AAD FQAA+EL+  +P+Q F
Sbjct  659   DSLSIARTYLRNALRLEPTNHRAWLSLGLVLKAEGSLQEAADCFQAAYELRELSPIQDF  717



>ref|XP_004985317.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Setaria 
italica]
Length=726

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/719 (50%), Positives = 502/719 (70%), Gaps = 15/719 (2%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLC CSG+  KFE+   +P+S   LATRDFSA+G SS     A  E+  +++QV+EVES 
Sbjct  5     MLCTCSGDHSKFEDLPRSPES---LATRDFSANGSSSK---MASRETTPDDSQVNEVESD  58

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprk--p  601
             L+E LSLNYEEARALLGRLE+QRGNFDAALQV QGIDI++L PRM+ AI E  +PR    
Sbjct  59    LRETLSLNYEEARALLGRLEHQRGNFDAALQVLQGIDIRSLRPRMTAAIAESIKPRVPPR  118

Query  602   rggkgeIVVSGV---MSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFP  772
                +    V+G+   MS+HSVSLLLEAILLK+KSL  LGR+ DAA EC+ I+DI++SA+P
Sbjct  119   SSRRKSSQVNGMLMHMSMHSVSLLLEAILLKAKSLDALGRVTDAAEECRIIIDIIESAWP  178

Query  773   NGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQ  952
              G+ +G+ E+CKL ++FH ALE+LPKLW++ G  D+A+ +YRRAL KPWNLD++R A++Q
Sbjct  179   YGVPDGIAEECKLIDIFHSALEYLPKLWMRSGCFDKAIIAYRRALAKPWNLDSQRSANLQ  238

Query  953   KDLAIALLFAGVEVDLSPRFKIWCS-TPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMD  1129
             KDLA+ LL+ GV+V     F    +   P NN+EEAILLL +L  K+   E++WD ++++
Sbjct  239   KDLAVTLLYCGVDVKFPQEFAQERNLVSPGNNIEEAILLLLILTRKLSLQEIKWDPDLVN  298

Query  1130  HLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSS  1309
             HL +AL++ G  E LA ++E +LPG  TR+ERWY LALCYS+AG +++ALN++R      
Sbjct  299   HLMYALSLSGHTEVLASHLEMLLPGTYTRSERWYILALCYSAAGMDDSALNIIRNGYCVL  358

Query  1310  EAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGN  1489
             E + +PHIPSLLLGAKLC ++P  + EGI FA  AM S  + + H +S    FLGVCYG 
Sbjct  359   ERKGKPHIPSLLLGAKLCCKNPKHASEGIKFANKAMKSFRSCDMHFISIVNHFLGVCYGP  418

Query  1490  AAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYS  1669
              ++ S S  +++  Q  +L  L  AA + + + E ++SL  E A QR L  A ++A +  
Sbjct  419   FSRSSTSHLDKSRLQDDALRLLQDAAAMAEYNPEILYSLAWENAMQRKLNAAVESATECL  478

Query  1670  EMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHP  1849
             EM  G +   WKLL L++SA+Q   +AEA+ D A+DE  + DQL  L+LKA +Q +R   
Sbjct  479   EMVMGGSVSAWKLLILVLSAQQNLQEAEAVADFAMDEAEKDDQLDILRLKAQIQASRGQF  538

Query  1850  NQAMETYRILLAMIQAQRQ---SGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCI  2020
               A+E++++LL+ IQA+++   S    EV S +KLE++AWLDLA IY   ++W D+ VC+
Sbjct  539   KSAVESFQVLLSTIQAKKEVWKSTTCKEVKSLQKLEMDAWLDLASIYSKLEAWHDSNVCL  598

Query  2021  DKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGS  2200
             DKA +ID++ P+ WH  G L EAQ   +EAL+AFSF+LSIDPDYVP +V  A +L  +G 
Sbjct  599   DKAISIDLFYPKCWHIRGLLLEAQSLHQEALMAFSFALSIDPDYVPGMVCMAGILRNIGG  658

Query  2201  QAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             +++ IAR+ L NALR+EPT H AW SLG + K EGS  +AAD FQAA+EL+  +P+Q F
Sbjct  659   KSLSIARTFLRNALRLEPTNHRAWLSLGLVLKAEGSLVEAADCFQAAYELRELSPIQDF  717



>ref|XP_006649575.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Oryza brachyantha]
Length=708

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/719 (50%), Positives = 487/719 (68%), Gaps = 33/719 (5%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLC+CSG+Q KFEE   +P+S   LATRDFSA+G SSSR                     
Sbjct  5     MLCSCSGDQSKFEEMPRSPES---LATRDFSATG-SSSRIAN------------------  42

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
              +E+   + +EARALLGRLE+QRGNFDAALQV QGIDI++L PRM+ AI +  +PR P  
Sbjct  43    -RESTPDDNQEARALLGRLEHQRGNFDAALQVLQGIDIRSLIPRMTGAIADSVKPRGPPR  101

Query  608   gkgeIV--VSGV---MSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFP  772
                +    V+G+   MS+HSVSLLLEAILLK+KSL GLGR+ DAA EC+ I+DIV+SA+P
Sbjct  102   SSRKKTSQVNGMLMQMSMHSVSLLLEAILLKAKSLEGLGRMTDAAEECRTIIDIVESAWP  161

Query  773   NGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQ  952
              G+ EG+ E+CKL ++FH ALEFLPKLW++ G  +EA+ +YRRAL KPWNLD++R A++Q
Sbjct  162   YGVPEGISEECKLIDIFHSALEFLPKLWMKSGCFEEAIIAYRRALAKPWNLDSQRSANLQ  221

Query  953   KDLAIALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDH  1132
             KDLA+ LL+ G EV  +  F       P+NNMEEAILLL +L  ++   E+ WD ++++H
Sbjct  222   KDLAVTLLYCGTEVKFTQDFDQHKPATPRNNMEEAILLLLILTKRLALQEIRWDPDLVNH  281

Query  1133  LTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSE  1312
             L FAL++ G +E LA ++E +LPG   R+ERWY LALCYS+AG +++ALN++R      E
Sbjct  282   LMFALSLSGHYEVLASHLEMLLPGTYNRSERWYILALCYSAAGMDDSALNIIRNGFHVLE  341

Query  1313  AEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNA  1492
              +   HIPSLLLGAKLC ++P  + EGI FA  AM S    + H +S    FLGVCYG  
Sbjct  342   RKARHHIPSLLLGAKLCCKNPKHALEGIKFADKAMKSFRRHDFHFVSVVNHFLGVCYGPF  401

Query  1493  AKISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSE  1672
             A+ S S +E+   Q Q+L  L  AA + K   E ++SL  E A QR L  A ++A +  E
Sbjct  402   ARSSTSHAEKLRLQDQALRLLQDAAAMAKYSPEIMYSLAWENAMQRKLNAAVESATECVE  461

Query  1673  MTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPN  1852
             M  GS+   WKLL L++SA+Q   +AEA+ ++A+DE  + DQ+  L+LKA +Q  R    
Sbjct  462   MVMGSSVSAWKLLILVLSAQQNLKEAEAVANIAIDEAEKEDQMGILRLKAHIQATRGQFK  521

Query  1853  QAMETYRILLAMIQAQRQ----SGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCI  2020
              A+E++R LLA+IQA+++    +  D +V S + LE+EAWLDLA IY   ++W D+ VC+
Sbjct  522   SAVESFRSLLAIIQAKKEIWKLTPYD-KVKSLQNLEMEAWLDLASIYTKLEAWHDSNVCL  580

Query  2021  DKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGS  2200
              KAK+I+ +SP+ WH  G + EA+   +EAL AFSF+LSIDPDYVPS++  A +L  +G 
Sbjct  581   GKAKSINFFSPKCWHVRGLILEAKSLHEEALTAFSFALSIDPDYVPSMICMAGILTILGG  640

Query  2201  QAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             +++ IAR+ L NALR+EPT H AW SLG   K EGS  +AAD FQAA+EL+  +P+Q F
Sbjct  641   KSLSIARTFLRNALRLEPTSHRAWLSLGLALKSEGSLLEAADCFQAAYELQELSPIQDF  699



>ref|XP_010480675.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Camelina 
sativa]
Length=817

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/636 (54%), Positives = 452/636 (71%), Gaps = 26/636 (4%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLCACSGEQF+FE+   +P+S   LATRDFSASGLSS RT   DW+S+ ++ QVDE EST
Sbjct  1     MLCACSGEQFRFEDQPGSPES---LATRDFSASGLSS-RTAGGDWDSKLDDIQVDEAEST  56

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             LKEALSLNYEEARALLGRLEYQRGNFDAALQVF+GIDIK L+PR+ KAI ERTRP KPR 
Sbjct  57    LKEALSLNYEEARALLGRLEYQRGNFDAALQVFKGIDIKVLTPRIIKAIVERTRPCKPRS  116

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                 IV    MS+HSVSLLLEAILLK++SL  LG  ++AA ECK ILD+V+SA P+GM +
Sbjct  117   KPL-IVPPTSMSMHSVSLLLEAILLKARSLEELGSYKEAAEECKIILDVVESALPSGMPD  175

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G+    KLQ++F KALE LP LW + G   E + SYRRAL +PWNLD +RLA  QK LA+
Sbjct  176   GINGFSKLQDIFQKALELLPLLWTKAGNHHETIASYRRALSRPWNLDPQRLAVTQKSLAL  235

Query  968   ALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFAL  1147
              LL+  VE          C   PK+N+EEAI+LL +L+ K+  G+++WD E+MDHLT+AL
Sbjct  236   ILLYGSVEA---------C---PKDNIEEAIVLLMLLVKKMVVGDIQWDPELMDHLTYAL  283

Query  1148  TVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP  1327
             ++ G+FE LA+ +EQILPG+ TR ERWY L+LCYS+AG ++ A+NLL+   G SE+   P
Sbjct  284   SMTGQFEVLANYLEQILPGVYTRGERWYLLSLCYSAAGIDKAAINLLKMSLGPSESRQIP  343

Query  1328  HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISF  1507
             H+P LL GAKLCS+DP  SR+GI+FA+  +D   NQ++HL SQA  FLGVCYGN A+ S 
Sbjct  344   HVPWLLFGAKLCSKDPKHSRDGINFAQKLLDLANNQSEHLFSQAHSFLGVCYGNTARSSK  403

Query  1508  SDSERNSYQTQSLNSLTQAAMLCKEDAE--TVFSLGLEYATQRNLTPAFDNALQYSEMTA  1681
              DSER   Q ++L SL +AA   K++ E   +++L  E A QRN+  A D A++YS M  
Sbjct  404   LDSERVFLQKKTLLSLNEAAKRAKDNPEPDIIYNLSFENAVQRNVQAALDGAVEYSSMVG  463

Query  1682  GSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAM  1861
             G + KGWK LA ++SAE+R  DAE+I+D  ++E G I++L+ LKLK  LQ+A++ P QA+
Sbjct  464   GGSTKGWKHLACVLSAEKRLKDAESILDFTMEEAGDIEKLELLKLKIVLQMAQEQPKQAL  523

Query  1862  ETYRILLAMIQAQRQSGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTID  2041
             +T   LL +I+AQ +S     +L  +K E EAW +LA +Y    SW DA+ C++KA+++ 
Sbjct  524   KTCSSLLGLIRAQDKSEQSEILL--KKCETEAWQELASVYGKLGSWSDAETCLEKARSMC  581

Query  2042  IYSPQSWHTTG-----ALFEAQERCKEALVAFSFSL  2134
              YSP+ W+ TG      +  A++R K+A     F++
Sbjct  582   YYSPRGWNETGWKHLACVLSAEKRLKDAESILDFTM  617


 Score =   207 bits (528),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 119/233 (51%), Positives = 168/233 (72%), Gaps = 2/233 (1%)
 Frame = +2

Query  1682  GSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAM  1861
             G    GWK LA ++SAE+R  DAE+I+D  ++E G I++L+ LKLK  LQ+A++ P QA+
Sbjct  587   GWNETGWKHLACVLSAEKRLKDAESILDFTMEEAGDIEKLELLKLKIVLQMAQEQPKQAL  646

Query  1862  ETYRILLAMIQAQRQSGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTID  2041
             +T   LL +I+AQ +S     +L  +K E EAW +LA +Y    SW DA+ C++KA+++ 
Sbjct  647   KTCSSLLGLIRAQDKSEQSEILL--KKCETEAWQELASVYGKLGSWSDAETCLEKARSMC  704

Query  2042  IYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIAR  2221
              YSP+ W+ TG   EA+   +EALV+F  SLSIDPD+VPSIVS AEV+M  G +++P A+
Sbjct  705   YYSPRGWNETGLCLEAKSLHEEALVSFFLSLSIDPDHVPSIVSIAEVMMTSGGESLPTAK  764

Query  2222  SLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSFV  2380
             S LMNALR++P  HDAW  LG ++KM+G +QQAA+F+QAA+EL+LS PVQSF 
Sbjct  765   SFLMNALRLDPRNHDAWMKLGHVAKMQGLSQQAAEFYQAAYELELSAPVQSFT  817



>gb|ABF94492.1| TPR Domain containing protein, expressed [Oryza sativa Japonica 
Group]
Length=707

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/718 (50%), Positives = 489/718 (68%), Gaps = 32/718 (4%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLC+CSG+Q KFEE   +P+S   LATRD+SA+G SSSR G                   
Sbjct  5     MLCSCSGDQSKFEEMPRSPES---LATRDYSATG-SSSRIGN------------------  42

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
              +E+   + +EARALLGRLE+QRGNFDAALQV QGIDI++L PRM+ AI +  +PR P  
Sbjct  43    -RESTPDDNQEARALLGRLEHQRGNFDAALQVLQGIDIRSLMPRMTTAIADSVKPRGPPR  101

Query  608   gkgeIV-VSGV---MSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPN  775
              + +   V+G+   MS+HSVSLLLEAILLK+KSL GLGR+ DAA EC+ I+DIV+SA+P 
Sbjct  102   SRKKTSQVNGMLMHMSMHSVSLLLEAILLKAKSLEGLGRVTDAAEECRTIIDIVESAWPY  161

Query  776   GMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQK  955
             G+ EG  E+CKL ++FH ALE+LPKLW++ G  +EA+ +YRRAL KPWNLD++R A++QK
Sbjct  162   GVPEGTSEECKLIDIFHSALEYLPKLWMRSGCCEEAIIAYRRALAKPWNLDSQRSANLQK  221

Query  956   DLAIALLFAGVEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHL  1135
             DLA+ LL+ G +V  +  F       P+NNMEEAILLL +L  K+   E++WD ++++HL
Sbjct  222   DLAVTLLYCGAQVKFTQEFDQHKPATPRNNMEEAILLLLILTKKLALQEIKWDPDLVNHL  281

Query  1136  TFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEA  1315
              FAL++ G +E LA ++E +LPG   R+ERWY LALCYS+AG +++ALN++R      E 
Sbjct  282   MFALSLSGHYEILASHLEMLLPGTYNRSERWYILALCYSAAGMDDSALNIIRNGFNVLER  341

Query  1316  EHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAA  1495
             + +PHIPSLLLGAKLC ++P ++ EGI FA  AM S    + H +S     LGVCYG  A
Sbjct  342   KGKPHIPSLLLGAKLCCKNPKRASEGIKFADKAMKSFRKHDFHFVSVVNHLLGVCYGPFA  401

Query  1496  KISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEM  1675
             + S S +E+   Q ++L  L  AA + K   E ++SL  E A QR L  A ++A +  EM
Sbjct  402   RSSTSHAEKLRLQDEALRLLQDAAAMAKYSPEIMYSLAWENAMQRKLNAAVESATECVEM  461

Query  1676  TAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQ  1855
               GS    WKLL L++SA+Q   +AEA+ ++A+DE  + DQ+  L+LKA +Q +R     
Sbjct  462   VMGSLVSAWKLLILVLSAQQNLKEAEAVANIAIDEAEKEDQMGILRLKAHIQASRGQFKS  521

Query  1856  AMETYRILLAMIQAQ----RQSGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCID  2023
             A+E++R LLA+IQA+    +Q+  D +V S + LE+EAWLDLA IY   +SW D+ VC+D
Sbjct  522   AVESFRSLLAIIQAKKEIWKQTPYD-KVKSLQNLEMEAWLDLASIYTKLESWHDSNVCLD  580

Query  2024  KAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQ  2203
             KAK+I  +SP+  H  G + +AQ   +EAL AFS SLSIDPDYVPS+V  A +L  +G +
Sbjct  581   KAKSISSFSPKCCHVRGLILQAQSLHQEALTAFSLSLSIDPDYVPSMVCMAGILTILGGK  640

Query  2204  AVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             ++ IAR+ L NALR+EPT H AW  LG + K EGS  +AAD FQAA+EL+  +P+Q F
Sbjct  641   SLSIARTFLRNALRLEPTSHQAWLRLGLVLKSEGSLLEAADCFQAAYELQELSPIQDF  698



>ref|XP_008664794.1| PREDICTED: uncharacterized protein LOC100216592 isoform X2 [Zea 
mays]
Length=700

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/719 (49%), Positives = 477/719 (66%), Gaps = 41/719 (6%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLC CSG+Q KFE+   +P+S   LATRDFSA+  SS     A  E+  +++QV+EVES 
Sbjct  5     MLCTCSGDQSKFEDLPRSPES---LATRDFSANCSSSK---MASRETTPDDSQVNEVESD  58

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprk--p  601
             LKE LSLNYEEARALLGRLE+QRGNFDAALQV QGIDI++L PRM+ AI E  +PR    
Sbjct  59    LKETLSLNYEEARALLGRLEHQRGNFDAALQVLQGIDIRSLRPRMTTAIAESVKPRMPPR  118

Query  602   rggkgeIVVSGV---MSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFP  772
                +    V+G+   MS+HSVSLLLEAILLK+KSL  LGR  DAA EC+ I+DI++SA+P
Sbjct  119   SSRRKSSQVNGMLMHMSMHSVSLLLEAILLKAKSLDTLGRAADAAEECRTIIDIIESAWP  178

Query  773   NGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQ  952
              G+ +G  E                          E++ +YRRAL KPWNL ++R A +Q
Sbjct  179   YGVPDGTSE--------------------------ESIIAYRRALAKPWNLGSQRSAKLQ  212

Query  953   KDLAIALLFAGVEVDLSPRFKIWCS-TPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMD  1129
             K+LA++LL+ GVEV     F    +   P NN+EEAILLL +L  K+   E++WD ++++
Sbjct  213   KELAVSLLYCGVEVKFPQEFSQERNLVTPGNNLEEAILLLLMLTRKLFLREIQWDPDLVN  272

Query  1130  HLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSS  1309
             HL +AL++ G +E LA ++E +LPG  TR+ERWY LALCYS+AG +++ALN++R      
Sbjct  273   HLVYALSLSGHYEVLASHLEMLLPGTYTRSERWYILALCYSAAGMDDSALNIIRNGFSVL  332

Query  1310  EAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGN  1489
             E + +PH+PSLLLGAKLC ++P  + EGI FA  AM S  +++ H +S  + FLGVCYG 
Sbjct  333   ERKGKPHVPSLLLGAKLCCKNPKHASEGIKFANKAMKSFRSRDLHFISTTKHFLGVCYGP  392

Query  1490  AAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYS  1669
              ++ S S  +++  Q  +L  L  AA   K + E ++SL  E A QR L  A ++A +  
Sbjct  393   FSRSSTSYLDKSRLQDNALRLLQDAATTAKYNPEIMYSLAWENAMQRKLNAAVESATECL  452

Query  1670  EMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHP  1849
             EM  G +   WKLL L++SA+Q   +AEA+ D A+DE  + DQL  L+LKA +Q +R   
Sbjct  453   EMVMGGSVSAWKLLILVLSAQQNLQEAEAVADFAMDEAEKNDQLDILRLKAQIQASRGQF  512

Query  1850  NQAMETYRILLAMIQAQRQS---GMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCI  2020
               A+ET+R+LLA IQ +++       +EV   +KLE++AWLDLA IY   ++W D+ +C+
Sbjct  513   KSAVETFRVLLAAIQVKKEVWKLTTCNEVKCLQKLEMDAWLDLASIYSKLEAWHDSNICL  572

Query  2021  DKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGS  2200
             DKA +ID Y P+ WH  G L EAQ   KEAL+AFSF+LSIDPDYVP +V  A +L  +G 
Sbjct  573   DKAISIDFYYPKCWHVRGLLLEAQFLHKEALMAFSFALSIDPDYVPGMVCMAGILRNIGG  632

Query  2201  QAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
              ++ IAR+ L NALR+EPT H AW SLG + K EGS Q+AAD FQAA+EL+  +P+Q F
Sbjct  633   DSLSIARTYLRNALRLEPTNHRAWLSLGLVLKAEGSLQEAADCFQAAYELRELSPIQDF  691



>ref|XP_010941503.1| PREDICTED: uncharacterized protein LOC105059771 isoform X2 [Elaeis 
guineensis]
Length=701

 Score =   546 bits (1406),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 314/691 (45%), Positives = 450/691 (65%), Gaps = 16/691 (2%)
 Frame = +2

Query  323   ATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGN  502
             + R+ S +GL+     TA+ E++ +E  + E ES+L+E LSLNYEEARALLGRLEYQRGN
Sbjct  17    SVREVSINGLT---MKTAEVEAKLDEGNIQEAESSLREGLSLNYEEARALLGRLEYQRGN  73

Query  503   FDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILL  682
              ++AL+VF GID++T   R+    +E+   R+ R     I     +S H+ SL+LEAI L
Sbjct  74    VESALRVFDGIDLQTAIQRLQPTFSEKPASRRNRSRTESI---HQVSQHAASLVLEAIYL  130

Query  683   KSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQ  862
             KS SL  L +  +AA+ECK++LD V+  F +G+ + + E  KLQE   KA+E LP+LW Q
Sbjct  131   KSMSLQRLNKATEAAQECKSVLDAVEKIFQHGIPDVLVEQ-KLQETVSKAVEVLPELWKQ  189

Query  863   EGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPP  1036
              G   EA+ SYRRAL+  WNLD +    +QK  A+ LL+ GVE    P    +I  S  P
Sbjct  190   AGRHQEALASYRRALLSQWNLDEECCVRIQKRFAVFLLYGGVEAS-PPSLASQIEGSFIP  248

Query  1037  KNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTR  1216
             KNN+EEAILLL +L+ K   G+ EWD  VM+H TFAL++ GE   L  + E+++PG+  R
Sbjct  249   KNNLEEAILLLMILLRKWYLGKTEWDPSVMEHFTFALSLCGETSVLGRHFEEVMPGIYPR  308

Query  1217  AERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGI  1396
              ERWY LALCYS AGQ+ +ALNLLRK     E+ ++  I +LLL AK+CS+D   + EG+
Sbjct  309   CERWYSLALCYSGAGQSRSALNLLRKSLNRHESPND--IMALLLAAKICSEDCLLASEGV  366

Query  1397  SFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLC  1576
              +AR A+ +  + ++HL   A +FLG+C G  AKI+ SD ER   Q ++L SL +A  L 
Sbjct  367   EYARRAITNARSVDEHLKCVALRFLGICLGKQAKIALSDHERTRLQAEALRSLDEAIALD  426

Query  1577  KEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEA  1756
             + + + +F LGLEYA QRN+  A   A ++ + T GS +KGW+LLAL++SA+QR+S+AE 
Sbjct  427   RNNPDLIFDLGLEYAEQRNMNAALRCAKEFIDATGGSISKGWRLLALVLSAQQRYSEAEV  486

Query  1757  IVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQ----SGMDHE  1924
             + D ALDET + +Q   L++KA L++A+  P  A+E+YR LLA++QAQR+    S    +
Sbjct  487   VTDAALDETAKWEQGPLLRIKAKLKVAQLLPTDAVESYRFLLALVQAQRKAFGSSKNSTK  546

Query  1925  VLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCK  2104
             V  D+  E E W  LA +Y     W DA++C++KA+ +  YS    HT G+++E +   K
Sbjct  547   VEDDKVTEFEVWQGLANLYSSLSHWKDAEICLEKARALKPYSAAILHTEGSMYEVRGETK  606

Query  2105  EALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLG  2284
             +AL A+S +LS++ D+VP  VS   +L K+GS+++P+ARS L +ALR+EPT   AW+ LG
Sbjct  607   DALAAYSNALSMELDHVPCKVSIGSLLSKIGSKSLPVARSFLSDALRLEPTNQLAWYYLG  666

Query  2285  KLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
              + + EG    A D FQAA  L+ S PV+SF
Sbjct  667   LVHRNEGRLADAVDCFQAASMLEESDPVESF  697



>ref|XP_010262408.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Nelumbo 
nucifera]
Length=731

 Score =   543 bits (1399),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 326/696 (47%), Positives = 442/696 (64%), Gaps = 23/696 (3%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             M C CSGEQ +    +    S ESLATRD+SASG SS      + E + +   ++E ES+
Sbjct  22    MKCLCSGEQLR---ADEMVPSSESLATRDYSASGYSSK---AGESEQKPDTGNIEEAESS  75

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             L+E+  LNYEEARALLGRLEYQRGN  AAL VF+GIDI  ++ R+  +I +R   R+   
Sbjct  76    LRESGCLNYEEARALLGRLEYQRGNVQAALHVFEGIDIAAVTQRIKFSIAQRKERRRRHS  135

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                   VS  M +H+VSLL EAI LK+KSL  LGR ++AA+ CK ILD V+SA P G  E
Sbjct  136   QSD---VSPPMPMHAVSLLFEAIFLKAKSLQDLGRFQEAAQSCKIILDTVESALPEGFPE  192

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
              +G DCKLQE  ++A+E LP+LW   G   EA+ SYR AL+  W+LDA+  A +QKD AI
Sbjct  193   NMGTDCKLQETLNRAVELLPELWKLAGFPHEAILSYRHALLHHWSLDAETTAKIQKDFAI  252

Query  968   ALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLT  1138
              LL+ G   D SP   R ++  S  P+NN+EEAILLLF+L+ K     +EWD  +MDHL+
Sbjct  253   FLLYGGY--DASPPDLRSQMEGSFVPRNNIEEAILLLFILLRKFALKRIEWDPSIMDHLS  310

Query  1139  FALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAE  1318
             FAL+V GE  +LA+ +E+ LPG   R ER+Y LALCY + G+N  ALNLLRK+  S E  
Sbjct  311   FALSVSGELRALANQIEESLPGSMDRKERYYTLALCYHAEGENVVALNLLRKLLTSRENP  370

Query  1319  HEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAK  1498
             +   + +LLL +K+C ++    +EG +FA  A+     +   + S     LGV     A+
Sbjct  371   NS--MAALLLASKICVENLNLPQEGEAFACRAIAPLQGECNQMGSVTNYLLGVSLSAQAR  428

Query  1499  ISFSDSERNSYQTQSLNSLTQAAMLCKE-DAETVFSLGLEYATQRNLTPAFDNALQYSEM  1675
              S SD +R+  Q ++L +L  A    +E +   +F L LE A QR L  A + A Q  ++
Sbjct  429   SSGSDYDRSIRQAKALEALEAAEKEMREREPRVIFYLSLENAEQRKLDVALNYAKQLLKL  488

Query  1676  TAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQ  1855
              AGS  KGW LLA I+SA++RF DAE I++ ALD+TG+ DQ + L+ KA LQIA+     
Sbjct  489   EAGSNVKGWILLARILSAQKRFGDAETIINAALDQTGRWDQGELLRTKAKLQIAQGQLKN  548

Query  1856  AMETYRILLAMIQAQRQS-GMDHEVLS-----DRKLEVEAWLDLARIYIDQDSWPDAQVC  2017
             A+ETY  LLA++Q Q +S G+  ++L      DR LE+E W DLA +YI    W DA+VC
Sbjct  549   AVETYTHLLAVLQVQSKSFGVSKKLLKKNRDRDRSLEMETWHDLAHVYISLSQWRDAEVC  608

Query  2018  IDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMG  2197
             + K+K I+ +S   WHTTG L EA+   KEAL AFS +L I+P +VPS+VSTA VL K+G
Sbjct  609   LSKSKAINPHSASRWHTTGLLHEAKGLHKEALKAFSGALDIEPTHVPSLVSTAIVLRKLG  668

Query  2198  SQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEG  2305
              Q++ + R  L +ALR++ T H AW++LG L K EG
Sbjct  669   EQSLAVVRGFLTDALRLDRTNHSAWYNLGLLCKAEG  704



>ref|XP_010941502.1| PREDICTED: uncharacterized protein LOC105059771 isoform X1 [Elaeis 
guineensis]
Length=709

 Score =   538 bits (1386),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 314/699 (45%), Positives = 450/699 (64%), Gaps = 24/699 (3%)
 Frame = +2

Query  323   ATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGN  502
             + R+ S +GL+     TA+ E++ +E  + E ES+L+E LSLNYEEARALLGRLEYQRGN
Sbjct  17    SVREVSINGLT---MKTAEVEAKLDEGNIQEAESSLREGLSLNYEEARALLGRLEYQRGN  73

Query  503   FDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILL  682
              ++AL+VF GID++T   R+    +E+   R+ R     I     +S H+ SL+LEAI L
Sbjct  74    VESALRVFDGIDLQTAIQRLQPTFSEKPASRRNRSRTESI---HQVSQHAASLVLEAIYL  130

Query  683   KSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQ  862
             KS SL  L +  +AA+ECK++LD V+  F +G+ + + E  KLQE   KA+E LP+LW Q
Sbjct  131   KSMSLQRLNKATEAAQECKSVLDAVEKIFQHGIPDVLVEQ-KLQETVSKAVEVLPELWKQ  189

Query  863   EGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPP  1036
              G   EA+ SYRRAL+  WNLD +    +QK  A+ LL+ GVE    P    +I  S  P
Sbjct  190   AGRHQEALASYRRALLSQWNLDEECCVRIQKRFAVFLLYGGVEAS-PPSLASQIEGSFIP  248

Query  1037  KNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTR  1216
             KNN+EEAILLL +L+ K   G+ EWD  VM+H TFAL++ GE   L  + E+++PG+  R
Sbjct  249   KNNLEEAILLLMILLRKWYLGKTEWDPSVMEHFTFALSLCGETSVLGRHFEEVMPGIYPR  308

Query  1217  AERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGI  1396
              ERWY LALCYS AGQ+ +ALNLLRK     E+ ++  I +LLL AK+CS+D   + EG+
Sbjct  309   CERWYSLALCYSGAGQSRSALNLLRKSLNRHESPND--IMALLLAAKICSEDCLLASEGV  366

Query  1397  SFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLC  1576
              +AR A+ +  + ++HL   A +FLG+C G  AKI+ SD ER   Q ++L SL +A  L 
Sbjct  367   EYARRAITNARSVDEHLKCVALRFLGICLGKQAKIALSDHERTRLQAEALRSLDEAIALD  426

Query  1577  KEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEA  1756
             + + + +F LGLEYA QRN+  A   A ++ + T GS +KGW+LLAL++SA+QR+S+AE 
Sbjct  427   RNNPDLIFDLGLEYAEQRNMNAALRCAKEFIDATGGSISKGWRLLALVLSAQQRYSEAEV  486

Query  1757  IVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQ----SGMDHE  1924
             + D ALDET + +Q   L++KA L++A+  P  A+E+YR LLA++QAQR+    S    +
Sbjct  487   VTDAALDETAKWEQGPLLRIKAKLKVAQLLPTDAVESYRFLLALVQAQRKAFGSSKNSTK  546

Query  1925  VLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTG--------AL  2080
             V  D+  E E W  LA +Y     W DA++C++KA+ +  YS    HT G        ++
Sbjct  547   VEDDKVTEFEVWQGLANLYSSLSHWKDAEICLEKARALKPYSAAILHTEGGYQTSHPCSM  606

Query  2081  FEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTC  2260
             +E +   K+AL A+S +LS++ D+VP  VS   +L K+GS+++P+ARS L +ALR+EPT 
Sbjct  607   YEVRGETKDALAAYSNALSMELDHVPCKVSIGSLLSKIGSKSLPVARSFLSDALRLEPTN  666

Query  2261  HDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
               AW+ LG + + EG    A D FQAA  L+ S PV+SF
Sbjct  667   QLAWYYLGLVHRNEGRLADAVDCFQAASMLEESDPVESF  705



>ref|XP_008802400.1| PREDICTED: tetratricopeptide repeat protein 7A [Phoenix dactylifera]
 ref|XP_008802402.1| PREDICTED: tetratricopeptide repeat protein 7A [Phoenix dactylifera]
 ref|XP_008802403.1| PREDICTED: tetratricopeptide repeat protein 7A [Phoenix dactylifera]
Length=729

 Score =   524 bits (1349),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 317/697 (45%), Positives = 439/697 (63%), Gaps = 25/697 (4%)
 Frame = +2

Query  245   KMLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVES  424
             KM C CSGEQ K +E   + +S   + T+D SASG SS      +   R + + ++E ES
Sbjct  21    KMKCLCSGEQLKVDEMIQSSES---VNTKDRSASGYSSQ---NGEGGQRLDTSNIEEAES  74

Query  425   TLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkpr  604
             +L+E + LNYEEARALLGRLEYQRGN +AAL+VF GIDI  ++P+M  +I++RT  RK R
Sbjct  75    SLREGVRLNYEEARALLGRLEYQRGNTEAALRVFDGIDIAAIAPKMKISISKRTERRKFR  134

Query  605   ggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMS  784
                       +MS H+VSLL+EAI LK+++L  LGR ++AA+ C  ILD V+SA P G+ 
Sbjct  135   SHWDV----PLMSKHAVSLLVEAIYLKARALQDLGRFKEAAQTCNIILDTVESASPEGLP  190

Query  785   EGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLA  964
             E    DCKLQE   KA+E LP+LW   G   E + SYRRAL+  W+LDA+ +A +QK+ A
Sbjct  191   ENFTTDCKLQETVCKAVELLPELWKLAGFSHEGILSYRRALLSHWSLDAESVAKIQKEFA  250

Query  965   IALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHL  1135
             I LL+ G   D SP   R ++  S  P+NN+EEAILLL +L+ K     +EWD  ++DHL
Sbjct  251   IFLLYGGC--DASPPNLRSQMDGSFIPRNNIEEAILLLMILLRKFSLKRIEWDPSIIDHL  308

Query  1136  TFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEA  1315
              FAL+V G+  SLA  +E++LPG+  R ER+Y LALCY     N TALNLL+K+  + E 
Sbjct  309   IFALSVSGQLNSLASQIEELLPGVLDRKERYYTLALCYLGEDDNLTALNLLKKLLSAME-  367

Query  1316  EHEPH-IPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNA  1492
               +P+ + +LLL +K+C  +   + EG+SFAR A+ +       + S A   LG+   + 
Sbjct  368   --DPNCVKALLLASKVCGGNSAYAEEGVSFARRALSNLDRGCDQMESVANCLLGISLSSQ  425

Query  1493  AKISFSDSERNSYQTQSLNSLTQAA-MLCKEDAETVFSLGLEYATQRNLTPAFDNALQYS  1669
             A+ S SDSER S Q ++L  L +A  M+  +D   +F+L LE A QR L  A   A Q  
Sbjct  426   ARSSASDSERVSRQNEALEVLEKAERMMLGKDHRILFNLSLENAEQRKLDAALRYAKQLL  485

Query  1670  EMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHP  1849
             ++ AGS  KGW LLA I SA++RF DAE IV+ ALD+TG+  Q + L+ KA +QIA+   
Sbjct  486   KLEAGSNVKGWILLARIFSAQKRFVDAETIVNAALDQTGKWSQGELLRSKAKVQIAQGKL  545

Query  1850  NQAMETYRILLAMIQAQRQ---SGMDHEV--LSDRKLEVEAWLDLARIYIDQDSWPDAQV  2014
               A++TY  LLA IQ Q +    G+        DR LE+E W DLA IYI    W DA+V
Sbjct  546   KNAVDTYTHLLATIQLQTKISSVGIKSSKGGKCDRSLEIETWHDLANIYISMSQWRDAEV  605

Query  2015  CIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKM  2194
             C+ K K+   YS   WH TG L+EA+   KEAL A++ +L ++P +V S+VSTA VL ++
Sbjct  606   CLSKLKSTSPYSAFGWHATGKLYEAKGLLKEALGAYTKALDLEPTHVASLVSTATVLRQL  665

Query  2195  GSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEG  2305
             G++ + + RS L +AL+++ T H  WF+LG L K EG
Sbjct  666   GNRPMAVVRSFLTDALQLDRTNHITWFNLGLLYKAEG  702



>gb|KDP37741.1| hypothetical protein JCGZ_05231 [Jatropha curcas]
Length=701

 Score =   521 bits (1343),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 305/689 (44%), Positives = 435/689 (63%), Gaps = 14/689 (2%)
 Frame = +2

Query  326   TRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNF  505
              R+  A+G+      T + E++ +E  + E ES+L+E LSLN+EEARALLGRLEYQRGN 
Sbjct  18    VRELCANGIC---IKTTEVEAKLDEGNIQEAESSLREGLSLNFEEARALLGRLEYQRGNV  74

Query  506   DAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLK  685
             + AL+VF GID++    R+  ++ E+   +K R           +S H+ SL+LEAI LK
Sbjct  75    EGALRVFDGIDLQAAIERLQPSVAEKQPVKKGRPRSES---QHAVSQHAASLVLEAIYLK  131

Query  686   SKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQE  865
             +KSL  LGR+ DAA ECK++LD V+  F  G+ + V  D +LQ+   +A+E LP+LW Q 
Sbjct  132   AKSLQKLGRLNDAANECKSVLDAVERIFYQGIPD-VQVDSRLQDTVSQAVELLPELWKQA  190

Query  866   GLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVD-LSPRFKIWCSTPPKN  1042
             G  DEA+++YRRAL+  WNLD    A +QK  AI LL +GVE   LS  ++I  S  PK+
Sbjct  191   GSYDEAMSAYRRALLSQWNLDHDCCARIQKAFAIFLLHSGVEAGPLSLAYQIDGSYVPKH  250

Query  1043  NMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAE  1222
             N+EEA+LLL +LM K   G+ +WDS VM+HLTFAL++  +   LA  +E+ILPG+  R E
Sbjct  251   NLEEAVLLLMILMRKFYLGKTKWDSSVMEHLTFALSLCSQTSILAKQLEEILPGLFHRVE  310

Query  1223  RWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISF  1402
             RW  LALCYS AGQN  ALNLLRK     + E    + +LLL AK+CS+D   + EG+ +
Sbjct  311   RWNTLALCYSGAGQNNVALNLLRK--SLHKHEQPDDVTALLLAAKICSEDSDIAAEGVEY  368

Query  1403  ARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKE  1582
             A+ A+ +    ++HL   A + LG+C G  AK+S SD ER+  Q+++L SL  A      
Sbjct  369   AQRAIKNAKGIDEHLKGVAIRVLGLCLGKQAKVSSSDFERSHLQSEALKSLDGAVAFEPN  428

Query  1583  DAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIV  1762
             + + +F LG++YA QRNL  A   A ++ + T GS  KGW+LLAL++SA++RFS+AE + 
Sbjct  429   NPDLIFELGVQYAEQRNLNAALRYAKEFIDATGGSILKGWRLLALVLSAQKRFSEAEVVT  488

Query  1763  DLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQSGMDHEVLS---  1933
             D ALDET + +Q   L+LKA L+I++  P  A+ETYR LLA++QA+R+S      +S   
Sbjct  489   DAALDETAKWEQGPLLRLKAKLKISQSQPMDAIETYRYLLALVQARRKSFGPLRNISQAD  548

Query  1934  DRKL-EVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEA  2110
             D K+ E E W  LA +Y     W D +VC+ KA+ +  YS    HT G + + + + +EA
Sbjct  549   DEKVNEFEVWQGLAELYSRLSHWKDVEVCLGKARELKHYSAGLLHTEGIMSQGRGQLQEA  608

Query  2111  LVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKL  2290
             +  F+ +L  +P YVP  +     L KMG  A+P+ARS+L +ALRIEPT   AW+ LG +
Sbjct  609   MCNFTNALLFEPSYVPCKILIGATLSKMGPNALPVARSILSDALRIEPTSRMAWYYLGMV  668

Query  2291  SKMEGSaqqaadffqaaHELKLSTPVQSF  2377
              + +G    A D F AA  L+ S P++SF
Sbjct  669   HRDDGRMADATDCFLAAAMLEESDPIESF  697



>ref|XP_002986849.1| hypothetical protein SELMODRAFT_124742 [Selaginella moellendorffii]
 gb|EFJ12179.1| hypothetical protein SELMODRAFT_124742 [Selaginella moellendorffii]
Length=680

 Score =   520 bits (1338),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 298/686 (43%), Positives = 449/686 (65%), Gaps = 15/686 (2%)
 Frame = +2

Query  332   DFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDA  511
             D +ASGLS+    T + E++ +E  ++E ES+L+EALSLN+EEARALLGRLEYQRGN +A
Sbjct  2     DAAASGLSAK---TMEGEAKLDEGNIEEAESSLREALSLNFEEARALLGRLEYQRGNVEA  58

Query  512   ALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSG-VMSLHSVSLLLEAILLKS  688
             ALQVF GIDI T+ PRM  ++ ER R R+ R        SG  +SLH+ SLLLEAI LK+
Sbjct  59    ALQVFDGIDITTIVPRMRHSLAERGRHRRGRSRTE----SGQSISLHAASLLLEAIYLKA  114

Query  689   KSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEG  868
             KSL  LGR+ DAA+EC++ILD +DSA P G+ E      KLQ++  KA+E LP+L+ + G
Sbjct  115   KSLQKLGRLNDAAQECRSILDTIDSALPQGIPESWS-GSKLQDIVSKAVELLPELYKEAG  173

Query  869   LIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPKN  1042
             L  EA+++YRRAL+ PWNLD++    +QK  A+ LL+ GVE   +P    ++  +  PKN
Sbjct  174   LYQEAISAYRRALLNPWNLDSECSGRIQKSFAVLLLYGGVEAG-APSLAAQVEGAFTPKN  232

Query  1043  NMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAE  1222
             N+EEAILL  +L+ K    ++ WD  +M+HL+FAL++ G+  +LA   E++LPG   R++
Sbjct  233   NVEEAILLFQILLRKNTLRKLPWDYTIMEHLSFALSICGQSHALAQQFEEVLPGTYGRSD  292

Query  1223  RWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISF  1402
             RWY LALCYS+AGQ +TA+N+L+K    S  E    +PSLLL AKLC + P  +R+G+ +
Sbjct  293   RWYNLALCYSAAGQGKTAVNVLKK--SLSHLERPNDVPSLLLAAKLCVESPDLTRDGVEY  350

Query  1403  ARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKE  1582
              R A+  +  +  +L  ++R  LG   G  A+ + SD+ER + +  +L +L  A  + K+
Sbjct  351   GRRAILFSEGKLGYLKGRSRHLLGAALGKEARNAKSDAERCALEDDALRTLQDAVAIEKK  410

Query  1583  DAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIV  1762
             D   +   G+E A + +L+ A D A  + E+T GS+   W+ LAL++SA+QR  DAE ++
Sbjct  411   DPYAILDFGMESAEKGDLSTALDCAKSFLELTGGSSIIAWRFLALVLSAQQRHVDAEVVI  470

Query  1763  DLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQ-SGMDHEVLSDR  1939
             + AL+ET + +Q + L+ K  LQ+A+   ++A++T+ +LLA++QAQR+ +G   +   D 
Sbjct  471   NAALEETAKWEQAELLRTKGKLQLAQMQTSEAIKTFMLLLALVQAQRKTTGSSSKNGGDS  530

Query  1940  KLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVA  2119
               EVE W DLA +Y     W DA++C++KA+        +W  TG L+E + + ++A+ +
Sbjct  531   VSEVEVWQDLAGVYTSLSQWRDAEMCLEKAQAFKKSPATTWFQTGYLYECRGQEEQAMAS  590

Query  2120  FSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKM  2299
             ++ +L +DPD+VPS V+    L + GS+A P+ARS L  ALR+EP  + AWF+LG + + 
Sbjct  591   YNNALCLDPDHVPSQVALGGALKRSGSKAFPVARSYLTAALRLEPKNYLAWFNLGLVHEE  650

Query  2300  EGSaqqaadffqaaHELKLSTPVQSF  2377
             E   + AA  FQAA+ L+ S PV+ F
Sbjct  651   EVRLKDAAACFQAAYLLEQSAPVEKF  676



>ref|XP_002969261.1| hypothetical protein SELMODRAFT_91665 [Selaginella moellendorffii]
 gb|EFJ29349.1| hypothetical protein SELMODRAFT_91665 [Selaginella moellendorffii]
Length=680

 Score =   519 bits (1337),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 298/686 (43%), Positives = 449/686 (65%), Gaps = 15/686 (2%)
 Frame = +2

Query  332   DFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDA  511
             D +ASGLS+    T + E++ +E  ++E ES+L+EALSLN+EEARALLGRLEYQRGN +A
Sbjct  2     DAAASGLSAK---TMEGEAKLDEGNIEEAESSLREALSLNFEEARALLGRLEYQRGNVEA  58

Query  512   ALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSG-VMSLHSVSLLLEAILLKS  688
             ALQVF GIDI T+ PRM  ++ ER R R+ R        SG  +SLH+ SLLLEAI LK+
Sbjct  59    ALQVFDGIDITTIVPRMRHSLAERGRHRRGRSRTE----SGQSISLHAASLLLEAIYLKA  114

Query  689   KSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEG  868
             KSL  LGR+ DAA+EC++ILD +DSA P G+ E      KLQ++  KA+E LP+L+ + G
Sbjct  115   KSLQKLGRLNDAAQECRSILDTIDSALPQGIPESWS-GSKLQDIVSKAVELLPELYKEAG  173

Query  869   LIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPKN  1042
             L  EA+++YRRAL+ PWNLD++    +QK  A+ LL+ GVE   +P    ++  +  PKN
Sbjct  174   LYQEAISAYRRALLNPWNLDSECSGRIQKSFAVLLLYGGVEAG-APSLAAQVEGAFTPKN  232

Query  1043  NMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAE  1222
             N+EEAILL  +L+ K    ++ WD  +M+HL+FAL++ G+  +LA   E++LPG   R++
Sbjct  233   NVEEAILLFQILLRKNTLRKLPWDYTIMEHLSFALSICGQSYALAQQFEEVLPGTYGRSD  292

Query  1223  RWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISF  1402
             RWY LALCYS+AGQ +TA+N+L+K    S  E    +PSLLL AKLC + P  +R+G+ +
Sbjct  293   RWYNLALCYSAAGQGKTAVNVLKK--SLSHLERPNDVPSLLLAAKLCVESPDLTRDGVEY  350

Query  1403  ARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKE  1582
              R A+  +  +  +L  ++R  LG   G  A+ + SD+ER + +  +L +L  A  + K+
Sbjct  351   GRRAILFSEGKLGYLKGRSRHLLGAALGKEARNAKSDAERCALEDDALRTLQDAVAIEKK  410

Query  1583  DAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIV  1762
             D   +   G+E A + +L+ A D A  + E+T GS+   W+ LAL++SA+QR  DAE ++
Sbjct  411   DPYAILDFGMESAEKGDLSTALDCAKSFLELTGGSSIIAWRFLALVLSAQQRHVDAEVVI  470

Query  1763  DLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQ-SGMDHEVLSDR  1939
             + AL+ET + +Q + L+ K  LQ+A+   ++A++T+ +LLA++QAQR+ +G   +   D 
Sbjct  471   NAALEETAKWEQAELLRTKGKLQLAQMQTSEAIKTFMLLLALVQAQRKTTGSSSKNGGDS  530

Query  1940  KLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVA  2119
               EVE W DLA +Y     W DA++C++KA+        +W  TG L+E + + ++A+ +
Sbjct  531   VSEVEVWQDLAGVYTSLSQWRDAEMCLEKAQAFKKSPAATWFQTGYLYECRGQEEQAMAS  590

Query  2120  FSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKM  2299
             ++ +L +DPD+VPS V+    L + GS+A P+ARS L  ALR+EP  + AWF+LG + + 
Sbjct  591   YNNALCVDPDHVPSQVALGGALKRSGSKAFPVARSYLTAALRLEPKNYLAWFNLGLVHEE  650

Query  2300  EGSaqqaadffqaaHELKLSTPVQSF  2377
             E   + AA  FQAA+ L+ S PV+ F
Sbjct  651   EVRLKDAAACFQAAYLLEQSAPVEKF  676



>ref|XP_009406365.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Musa acuminata 
subsp. malaccensis]
Length=713

 Score =   519 bits (1337),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 306/689 (44%), Positives = 447/689 (65%), Gaps = 15/689 (2%)
 Frame = +2

Query  329   RDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFD  508
             R+ S +GLS     TA+ E++ ++  ++E ES+L+E LSLNYEEARALLGRLEYQRGN +
Sbjct  32    REVSVNGLS---MKTAEVEAKLDDGNIEEAESSLREGLSLNYEEARALLGRLEYQRGNIE  88

Query  509   AALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKS  688
             +A++VF GID++    R+  +++E+   R+ R     +    ++S  + SL+LEAI LKS
Sbjct  89    SAVRVFDGIDLQAAIQRIQPSVSEKPATRRGRSRGDSM---HMVSQRAASLVLEAIYLKS  145

Query  689   KSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEG  868
              SL  LG+  +AA+ECK ILD V+  F +G+ + + E  KLQE   +A+E LP+LW Q G
Sbjct  146   MSLRKLGKATEAAQECKGILDTVEKMFQHGIPDVLVEQ-KLQETVSRAVELLPELWKQAG  204

Query  869   LIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPKN  1042
                EA+ SYR+AL+  WNLD +  A +QK  A  LL++G+E    P    ++  +  PKN
Sbjct  205   SYHEALASYRQALLSQWNLDDESCARIQKRFAAFLLYSGIEAG-PPNLATQVDGTFVPKN  263

Query  1043  NMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAE  1222
             N+EEAILLL V++ K   G+++WD  VM+HL+FAL+V  +   LA + E+ +PG+  R +
Sbjct  264   NLEEAILLLMVVLRKWHLGKIQWDPSVMEHLSFALSVCSQTFVLARHFEEAMPGIYPRCD  323

Query  1223  RWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISF  1402
             RWY LALCYS+AGQN +ALNLLR+     E+ ++  I +LLL AK+CS+D   S EG+ +
Sbjct  324   RWYSLALCYSAAGQNHSALNLLRQALKKDESPND--IMALLLAAKICSEDRLLSAEGVEY  381

Query  1403  ARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKE  1582
             AR A+ +    ++HL S    FLG C G  AKI+ SD ER++ + ++L SL +A  L + 
Sbjct  382   ARRAIANAQAADEHLKSVGLHFLGNCLGKQAKIASSDYERSNLRIEALKSLDEAVALERH  441

Query  1583  DAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIV  1762
             + + +F LGLEY+ Q N   A   A ++ + T GS  KGW+LL+LI+SA+QRF++AE + 
Sbjct  442   NPDILFDLGLEYSEQHNTNAALRCAKEFIDATGGSVLKGWRLLSLILSAQQRFTEAEIVT  501

Query  1763  DLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQSGM---DHEVLS  1933
             D ALDET + +Q   L++KA L++A+  P  A+E YR LLA++QAQR+SG    + EV  
Sbjct  502   DAALDETAKWEQGPLLRIKAKLKVAQTLPMDAIEAYRFLLALVQAQRKSGSVKNNTEVED  561

Query  1934  DRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEAL  2113
             D   E E W  LA +Y     W DA++C++KA  +  +S    HT G++ EA  + +EAL
Sbjct  562   DDFNEFEVWQGLANLYSGLSHWRDAEICLEKAGALKPFSSSILHTEGSMLEAHGQMQEAL  621

Query  2114  VAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLS  2293
               FS +LS++ D VPS VS   +L K GS+++P+ARS L +ALR+EP    AW+ LG + 
Sbjct  622   ATFSNALSLELDDVPSKVSIGALLSKKGSKSLPVARSFLSDALRLEPANRLAWYYLGIIH  681

Query  2294  KMEGSaqqaadffqaaHELKLSTPVQSFV  2380
             + EG    AAD FQAA  L+ S P++SF 
Sbjct  682   RDEGRIADAADCFQAASLLEESDPIESFT  710



>ref|XP_010054175.1| PREDICTED: tetratricopeptide repeat protein 7B [Eucalyptus grandis]
 ref|XP_010054182.1| PREDICTED: tetratricopeptide repeat protein 7B [Eucalyptus grandis]
 gb|KCW89804.1| hypothetical protein EUGRSUZ_A02045 [Eucalyptus grandis]
Length=701

 Score =   518 bits (1335),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 312/690 (45%), Positives = 431/690 (62%), Gaps = 14/690 (2%)
 Frame = +2

Query  323   ATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGN  502
             + R+  A+GL      T + E++ +E  + E ES+L+E LSLN+EEARALLGRLEYQRGN
Sbjct  17    SVREVRANGLC---MKTTEVEAKLDEGNIQEAESSLREGLSLNFEEARALLGRLEYQRGN  73

Query  503   FDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILL  682
              + AL+VF+GID++    R+     E+   RK R          V+S H+ SL+LEAI L
Sbjct  74    VEGALRVFEGIDLQAAIQRLQPFAAEKQTSRKSRSRTES---PHVVSQHAASLVLEAIYL  130

Query  683   KSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQ  862
             K+KSL  LGR+ +AA ECK++LD V+  F  G+ + V  D KLQE    A+E LP+LW Q
Sbjct  131   KAKSLQKLGRLSEAANECKSVLDAVERIFHQGIPD-VQVDFKLQETVSHAVELLPELWKQ  189

Query  863   EGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDL-SPRFKIWCSTPPK  1039
              G   EA+ SYRRAL+  WNLD    A +QK  A+ LL++GVE    S   +I  S  PK
Sbjct  190   AGCYPEAMLSYRRALLSQWNLDNDCCARIQKAFAVFLLYSGVEAGPPSLAVQIDGSYVPK  249

Query  1040  NNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRA  1219
             NN+EEAILLL +LM K   G V+WD  VM+HLTFAL + G+   LA  VE+I+PG+  R 
Sbjct  250   NNLEEAILLLMILMRKFYLGIVQWDPSVMEHLTFALCLCGQTSVLAKQVEEIMPGVYHRI  309

Query  1220  ERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGIS  1399
             +RW  LALCYS AGQN  ALNLLRK     + E    + +LLL AK+CS D   + EG+ 
Sbjct  310   DRWNTLALCYSGAGQNRVALNLLRK--SLHKHERPDDLTALLLAAKICSDDSLLAAEGVG  367

Query  1400  FARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCK  1579
             +AR A+ ++    +HL   + + LG+C G  AK+S SD ER+  Q+++L SL  A +L  
Sbjct  368   YARRAITASKGVEEHLKGVSLRVLGLCLGKQAKVSSSDFERSRLQSEALKSLEAALVLEP  427

Query  1580  EDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAI  1759
              + + +F LG++YA  RNL  A   A  + + T GS  KGW+LLAL++SA+QRFS+AE +
Sbjct  428   NNTDLIFELGVQYAEHRNLDTALRFAKLFIDATGGSVLKGWRLLALVLSAQQRFSEAEVV  487

Query  1760  VDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQSGMDHEVLS--  1933
              D ALDE  + +Q   L+LKA L+I +  P  A+ETY+ LLA++QAQR+S      +S  
Sbjct  488   TDAALDENAKWEQGPLLRLKAKLRICQSLPLDAIETYKYLLALVQAQRKSFGPARSISQA  547

Query  1934  --DRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKE  2107
               DR  E E W  LA +Y     W DA++C+ KA+    YS ++  T G ++E + +  E
Sbjct  548   EDDRDNEFEVWHGLATLYSSLSHWKDAEICLAKARESKAYSAEALQTEGIMYEKRGQIHE  607

Query  2108  ALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGK  2287
             AL A+  +L ++P YVP  +  + +L+KM   A+P+AR LL +ALRIEPT   AW+ LG 
Sbjct  608   ALSAYINALLLEPAYVPCKILISGLLLKMSPAALPVARGLLADALRIEPTNRLAWYYLGL  667

Query  2288  LSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             + K +G    A D FQAA  L+ S PV+SF
Sbjct  668   VHKDDGRMADATDCFQAASMLEESDPVESF  697



>ref|XP_010244719.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Nelumbo 
nucifera]
 ref|XP_010244720.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Nelumbo 
nucifera]
Length=702

 Score =   516 bits (1330),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 310/693 (45%), Positives = 448/693 (65%), Gaps = 17/693 (2%)
 Frame = +2

Query  320   LATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRG  499
             +A ++  A+GLS     T++ E++ +E  + E ES+L+E LSLN+EEARALLGRLEYQRG
Sbjct  16    MAVQEVCANGLS---MKTSEVEAKLDEGNIQEAESSLREGLSLNFEEARALLGRLEYQRG  72

Query  500   NFDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAIL  679
             N + AL+VF GID++    R+  ++TE+   R+ R     +    + S H+ SL+LEAI 
Sbjct  73    NVEGALRVFDGIDLQAAIQRLQPSLTEKPPSRRNRSRTESL---NIASQHAASLVLEAIY  129

Query  680   LKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWV  859
             LK+KSL  LGR  +AA+EC+++LD V+  F +G+ + V  D KLQE   KA+E LP+LW 
Sbjct  130   LKAKSLQMLGRATEAAQECRSVLDAVERIFQHGIPD-VLVDNKLQETVSKAVELLPELWK  188

Query  860   QEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDL-SPRFKIWCSTPP  1036
             Q G   EA+++YRRAL+  WNLD +  A +QK+ AI LL++GVE    S   +I  S  P
Sbjct  189   QAGHYQEAMSAYRRALLSQWNLDNECCARIQKNFAIFLLYSGVEAGPPSLAVQIDGSYVP  248

Query  1037  KNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTR  1216
             +NN+EEAILLL +L+ K   G+  WD  VM+H TFAL++ G+   LA  +E+ILPG+  R
Sbjct  249   RNNLEEAILLLMILLRKFYLGKTIWDPSVMEHFTFALSLCGQTSILARQIEEILPGIFHR  308

Query  1217  AERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGI  1396
              +RW  LALCYS AGQNE+ALNLLRK   + E   +  + +LLL A++CS+D   + EG+
Sbjct  309   CDRWNTLALCYSGAGQNESALNLLRKSLHNHEKPDD--LLALLLAARICSEDSLLALEGV  366

Query  1397  SFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLC  1576
              +A+ A+ +    N+HL       LG C G  AK++ SD ER+  Q+++L SL  A    
Sbjct  367   GYAQRAIANAQGVNEHLKGVGLHMLGRCLGKQAKVASSDFERSHLQSEALKSLDAAIAFE  426

Query  1577  KEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEA  1756
              ++ + +F LGL+YA  RN  PA   A Q+ + T GS  KGW+LLAL++SA+QR+S+AE 
Sbjct  427   CDNPDLIFDLGLQYAEHRNSHPALRCAKQFIDATGGSILKGWRLLALVLSAQQRYSEAEV  486

Query  1757  IVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQ------SGMD  1918
             + D ALDET + +Q   L++KA L+I++  P  A+ TYR LLA++QAQR+      SG+ 
Sbjct  487   VTDAALDETAKWEQGPLLRMKAQLKISQSLPMDAIGTYRFLLALVQAQRKSFGPLRSGIP  546

Query  1919  HEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQER  2098
              +V  D+  E E W DLA +Y     W DA+VC++KA+++  YS  + H+ G + E + +
Sbjct  547   -QVEDDKVSEFEVWQDLANLYASLSHWRDAEVCLEKARSLRQYSAATLHSEGFMNEGRGQ  605

Query  2099  CKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFS  2278
              +EAL A+S  L +D  YVPS V    +L KMG +A+P+ARS L +ALR+EPT   AW+ 
Sbjct  606   IQEALAAYSNGLLLDLSYVPSRVFMGALLRKMGPKALPVARSFLSDALRLEPTNRAAWYH  665

Query  2279  LGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             LG + K +G    A D FQAA  L+ + P++SF
Sbjct  666   LGMIHKDDGRIADACDCFQAASMLEEADPIESF  698



>ref|XP_010688836.1| PREDICTED: uncharacterized protein LOC104902676 [Beta vulgaris 
subsp. vulgaris]
Length=699

 Score =   514 bits (1323),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 291/688 (42%), Positives = 442/688 (64%), Gaps = 16/688 (2%)
 Frame = +2

Query  329   RDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFD  508
             R+F A+G S     TA+ E++ +E  + E ES+L+E LSLN+EEARALLGRLEYQRGN +
Sbjct  19    REFRANGNS---MKTAEVEAKLDEGNIQEAESSLREGLSLNFEEARALLGRLEYQRGNVE  75

Query  509   AALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKS  688
              AL+VF+GID+     R   ++ ++   +     +    V      H+  L+LEAI LK+
Sbjct  76    GALRVFEGIDLHAAIQRFQPSLGDKPSKKGRPRTESVHNVPQ----HATGLVLEAIYLKA  131

Query  689   KSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEG  868
             KSL  LGR+ +AA ECK++LD V+  F +G+ + +  D +LQE   +A+E LP+LW Q G
Sbjct  132   KSLQKLGRLTEAAGECKSVLDAVEKIFQHGIPD-LQVDGRLQETVSQAVELLPELWRQAG  190

Query  869   LIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVE-VDLSPRFKIWCSTPPKNN  1045
               DE + +YRRAL+  WNLD    A +QK  A+ LL++GVE V  S   +I  S  P+NN
Sbjct  191   SHDETIAAYRRALLSQWNLDNDCCARIQKKFAVFLLYSGVEAVAPSLSVQIDGSYIPRNN  250

Query  1046  MEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAER  1225
             +EEAILLL +L+ K   G+ +WD  VM+HLTFAL++  +  +LA  +E+++PG   R +R
Sbjct  251   LEEAILLLMILIRKCALGKTKWDPSVMEHLTFALSLCSQTSALARQLEEVMPGTFNRIDR  310

Query  1226  WYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFA  1405
             W  LALC+S A +N  ALNLLRK     E E    + +LLL AK+CS+DP  + EG+ +A
Sbjct  311   WIALALCHSGAWENGEALNLLRK--SLHENERPNDLMALLLAAKICSEDPLLAAEGVEYA  368

Query  1406  RGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKED  1585
             R A+ ++ + ++H+   + + LG+C G   K+S SD ER+  Q+++L SL +A      +
Sbjct  369   RRAI-TSASDDEHMKGVSLRMLGLCLGKQTKVSSSDYERSILQSEALKSLEEALTFESNN  427

Query  1586  AETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVD  1765
              + +  L ++YA  RN+  A   A Q+ + T GS  KGW+LLALI+S+++R+S+A+ ++D
Sbjct  428   PDLLLELAVQYAEHRNVHAALRYAKQFIDATGGSVLKGWRLLALILSSQKRYSEAQVVID  487

Query  1766  LALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQS----GMDHEVLS  1933
              ALDET + +Q   L++KA L+I +  P  A+ETYR LLA++QAQR+S      +H++  
Sbjct  488   AALDETAKWEQGPLLRMKAKLKIFQSLPMDAIETYRYLLALVQAQRKSFGPVKANHQIDD  547

Query  1934  DRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEAL  2113
             D+  E E WL LA +Y     W D +VC++KA ++  YS ++ HT G ++E +   KEAL
Sbjct  548   DKVNEFEVWLGLANLYSSLSHWKDVEVCLEKALSLRQYSAETLHTEGVMYEGRGLVKEAL  607

Query  2114  VAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLS  2293
              +++ ++ +DP+YVP  +    +L KMG QA+P+AR+LL +ALR++PT  +AW+ LG + 
Sbjct  608   ASYTNAVLLDPNYVPCKILLGSLLSKMGPQALPVARNLLSDALRLDPTNRNAWYYLGMVH  667

Query  2294  KMEGSaqqaadffqaaHELKLSTPVQSF  2377
             + +G    AA+ FQAA  L  S P++SF
Sbjct  668   RDDGRNSDAAECFQAASMLDESDPIESF  695



>gb|KHG27385.1| Tetratricopeptide repeat 7A [Gossypium arboreum]
Length=732

 Score =   514 bits (1325),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 308/696 (44%), Positives = 438/696 (63%), Gaps = 22/696 (3%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             M C C+GEQ +  + +    S ESLA +D+S SG SS + G    E + +   ++E E +
Sbjct  23    MKCLCTGEQLR--KVDKMIPSSESLAAKDYSLSGYSS-KVGVP--EKKPDTRNIEEAELS  77

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             L+E+ SLNYEEARALLGR+EYQ+GN +AAL VF+GIDI  +SP+M   +++R   RK R 
Sbjct  78    LRESSSLNYEEARALLGRIEYQKGNIEAALHVFEGIDIAAISPKMKLTLSKRVDRRKRRS  137

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                       MS+H+VSLLLEAI LK+KSL  L R R+AA+ C  ILDIV+S+ P G+ E
Sbjct  138   HD---YAPPPMSIHAVSLLLEAIFLKAKSLQHLQRFREAAQSCTVILDIVESSLPEGLPE  194

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
               G DCKLQE   KA+E LP+LW       EA+ SYRRAL+  WNLDA+  A +QK  AI
Sbjct  195   NFGADCKLQETLIKAVELLPELWKFGDSPHEAILSYRRALLHQWNLDAETTARIQKQFAI  254

Query  968   ALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLT  1138
              LL+ G E   SP     +I  S  P+NN+EEAILLL +L+ K+    +EWD  ++DHL+
Sbjct  255   FLLYCGGEA--SPPNLHCQIDSSFVPRNNIEEAILLLMILLRKVSLKRIEWDPSILDHLS  312

Query  1139  FALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAE  1318
             FA ++ G+  +LA+ +E++LPG+ +R ER+ FLALCY  AG++  ALNLLRK+  S+E  
Sbjct  313   FAFSMSGDLRALANQIEELLPGVISRKERYNFLALCYYGAGEDLVALNLLRKLLQSNE--  370

Query  1319  HEPH-IPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAA  1495
              +PH +P+LL+ +++C + P  + EGI FA  A++S   +   L       LG+     +
Sbjct  371   -DPHCVPALLMASRICGEKPNLAEEGIKFAHRALESLDEECSELEGTGNLLLGLARSTHS  429

Query  1496  KISFSDSERNSYQTQSLNSLTQA-AMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSE  1672
             K + SDSER S Q+++L +L +A  +   +D   ++ L LE A QR L  A   A    +
Sbjct  430   KSALSDSERVSRQSEALQALERAWKITSMKDPNILYYLCLENAEQRKLEAALYYAKYLLK  489

Query  1673  MTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPN  1852
             +  GS  KGW LLA I+SA++RF D E +++ ALD+TG+ DQ + L+ KA LQIA+    
Sbjct  490   LEGGSNIKGWLLLARILSAQKRFVDGEIVLNAALDQTGKWDQGELLRTKAKLQIAQGQLK  549

Query  1853  QAMETYRILLAMIQAQRQSGMD----HEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCI  2020
              A+ETY  LLA++Q Q +S       H+  S R  E E W DLA +YI    + DA++C+
Sbjct  550   SAIETYSQLLAVLQVQSKSFGSGKRLHKDRSSRSFEQEIWHDLAYLYISLSQYQDAEICL  609

Query  2021  DKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGS  2200
              K+K I+ YS    H TG L+E +   KEAL A+  +L +DP++ PS++S A VL ++G 
Sbjct  610   SKSKAINSYSAIRSHATGVLYEGKGLLKEALEAYWNALGMDPNHAPSLISAAVVLGQLGG  669

Query  2201  QAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGS  2308
             Q+  + +SLLMNALR++     AW++LG L K E S
Sbjct  670   QSDAVVKSLLMNALRVDRMNPSAWYTLGLLHKDEDS  705



>gb|KDP26494.1| hypothetical protein JCGZ_17652 [Jatropha curcas]
Length=711

 Score =   514 bits (1323),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 316/724 (44%), Positives = 452/724 (62%), Gaps = 28/724 (4%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             M C CSGEQ +    +    S ESLAT+D+S  G SS    T     + + + ++E E T
Sbjct  1     MKCLCSGEQSR--PVDEMVPSSESLATKDYSLGGYSSKNGET---NQKPDTSNIEEAELT  55

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             L+E+ SLNYEEARALLGR+EYQ+GN +AAL VF+GIDI  L+P+M  A+  +   RK   
Sbjct  56    LRESGSLNYEEARALLGRIEYQKGNIEAALHVFEGIDIAALTPKMKVALARKEESRKRHS  115

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                    +  MS+H+VSLLLEA+ LK+KSL  LGR  +AA+ CK ILDIV+++ P G+ E
Sbjct  116   QFS----TPPMSVHAVSLLLEAVFLKAKSLQHLGRFNEAAQSCKVILDIVETSLPEGLPE  171

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
                 DCKLQE   KA+E LP+LW       EA+ SYRRAL+  W+LDA+  A +QK  AI
Sbjct  172   NFAADCKLQETLSKAVELLPQLWKLADSPREAIMSYRRALLHHWSLDAETTARIQKAFAI  231

Query  968   ALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLT  1138
              LL++G E   SP   R ++  S  P+NN+EEA+LLL +L+ K+    +EWD  ++DHL+
Sbjct  232   FLLYSGGEA--SPPDLRSQMDSSFVPRNNIEEAVLLLMILLRKVSLKRIEWDESILDHLS  289

Query  1139  FALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAE  1318
             FALTV G+  +LA  VE++ PG+  + E +Y LALCY  AG++  ALNLLRK+     A 
Sbjct  290   FALTVSGDLRALASQVEELPPGIIDKREMYYMLALCYHGAGEDLAALNLLRKL---LHAR  346

Query  1319  HEPH-IPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAA  1495
              +P  +P+LL+ +K+C   P  + EGI+++R A+++  +      S A   LGV     +
Sbjct  347   GDPKCVPALLMASKVCGTTPKLAEEGINYSRKALENLESGCDQWESTANCLLGVSLSAHS  406

Query  1496  KISFSDSERNSYQTQSLNSLTQAAMLCK-EDAETVFSLGLEYATQRNLTPAFDNALQYSE  1672
             K++ +DSER   Q+++L  L  A  + + ED+  V+ L +E A QR L  A   A ++ +
Sbjct  407   KLAVADSERVKRQSEALQILESAGKMTRMEDSHIVYHLCVENAEQRKLDTALYYAKRFLK  466

Query  1673  MTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPN  1852
             + +G+  KGW LLA I+SA++R+ DAEA++   LD++ + DQ + L+  A LQIA+    
Sbjct  467   LESGANIKGWLLLARILSAQKRYLDAEAVICAVLDQSVKWDQGELLRTHAKLQIAQGQLK  526

Query  1853  QAMETYRILLAMIQAQRQS-GMDHEVL-----SDRKLEVEAWLDLARIYIDQDSWPDAQV  2014
              A++TY  LLA++Q Q +S G   +V      S R LE++ W DLA +YI+   W DA++
Sbjct  527   NAIKTYAQLLAILQVQNKSFGSGKKVHKGNGKSARSLELDVWHDLASVYINLSQWRDAEI  586

Query  2015  CIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKM  2194
             C+ K+K I  YS   +HTTG L+  +   KEAL AF  +L IDPD+ PS+VS A VL ++
Sbjct  587   CLSKSKAISSYSASRYHTTGLLYRKKGLHKEALKAFRGALEIDPDHAPSLVSMAVVLKQL  646

Query  2195  GSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqq---aadffqaaHELKLSTP  2365
             GSQ+  + R  LM+ALR++     AW +LG L K EGSA     AA+ F+AA  L+ S P
Sbjct  647   GSQSNEVIRGFLMDALRLDRMNPSAWHNLGLLYKSEGSASSFQEAAECFEAAAFLEESAP  706

Query  2366  VQSF  2377
             VQ F
Sbjct  707   VQPF  710



>ref|XP_009589150.1| PREDICTED: tetratricopeptide repeat protein 7A [Nicotiana tomentosiformis]
Length=702

 Score =   512 bits (1319),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 301/692 (43%), Positives = 446/692 (64%), Gaps = 17/692 (2%)
 Frame = +2

Query  323   ATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGN  502
             + R   A+G+    T     E++ +E  + E ES L++ LSLN+EEARALLGRLEYQRGN
Sbjct  17    SVRQVCANGICMQTTVV---EAKLDEGNIQEAESALRDGLSLNFEEARALLGRLEYQRGN  73

Query  503   FDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILL  682
              + AL+VF GID+++   RM  ++TE+   +K R    E  V GV S H+  L+LEAI L
Sbjct  74    VEGALRVFDGIDLQSAIQRMQPSVTEKQPSKKGRTRSVE-SVPGV-SQHAAGLVLEAIYL  131

Query  683   KSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQ  862
             K+KSL  LGR+ +AAREC+++LD V+  F NG+ + + E+ KLQE    A+E LP+LW Q
Sbjct  132   KAKSLQKLGRLTEAARECQSVLDAVEKIFDNGIPDVLVEN-KLQETVSHAVELLPELWKQ  190

Query  863   EGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRFKIWC--STPP  1036
              G   EA+ +YRRAL+  WNLD    A +QK  A+ LL++GVEV   P   +    S  P
Sbjct  191   AGCYSEAMTAYRRALLSQWNLDNDCCARIQKAFAVFLLYSGVEV-CPPSLAVQIDDSYVP  249

Query  1037  KNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTR  1216
             +NN+EEAILL  +LM K+  G+++WD  V++HLTFAL+V  +   LA  +E+++PG+ +R
Sbjct  250   RNNLEEAILLFMILMRKVYLGKIKWDPSVLEHLTFALSVCSQTSVLAKQLEEVMPGVLSR  309

Query  1217  AERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPH-IPSLLLGAKLCSQDPCKSREG  1393
              +RW  LALCYS+AGQN+T+L+LLRK   S   + EP  I SLLL AK+CS++   + EG
Sbjct  310   IDRWRALALCYSAAGQNKTSLSLLRK---SLHKDEEPDDILSLLLAAKICSEEVFLAAEG  366

Query  1394  ISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAML  1573
             + +A+ A+ +    N+HL     + LG+C G  AK++ SD ER+  Q+++L SL  A  L
Sbjct  367   VKYAQRAITNAQGLNEHLKGVGLRMLGLCLGKQAKVATSDFERSRLQSEALKSLDGAMAL  426

Query  1574  CKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAE  1753
               E+++ +F LG++YA  RNL  A   A +Y ++T GS  +GW+LLAL++SA+QR+++AE
Sbjct  427   ENENSDLMFELGVQYAEHRNLDAALCYAKKYLDVTGGSAVRGWRLLALVLSAQQRYTEAE  486

Query  1754  AIVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQSGMDH----  1921
              + D AL+ET + DQ   L++KA L+I++     A+ETYR LLA++QAQR+S        
Sbjct  487   VVTDAALEETVKWDQGPLLRMKAKLKISQSRHMDAIETYRYLLALVQAQRKSYGPFRNAP  546

Query  1922  EVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERC  2101
             ++  D   E E W  LA +Y +   W DA+ C++KA+ +  YS  + HT G + E Q   
Sbjct  547   QLEEDNVNEYEVWHGLANLYSNLSHWKDAETCLEKARALIEYSADTLHTEGVMLERQGEN  606

Query  2102  KEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSL  2281
              +AL A+  +L ++P++V   +    +L KMGS+ +P+AR+L  +AL+IEPT   AW+ L
Sbjct  607   DKALAAYVNALLVEPNHVQCKILLGALLAKMGSKMLPLARALFSDALKIEPTNRIAWYHL  666

Query  2282  GKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             G + + +G    AAD FQAA  L+ S P++SF
Sbjct  667   GLVHRDDGRVADAADCFQAASMLEESDPIESF  698



>gb|EYU32843.1| hypothetical protein MIMGU_mgv1a002198mg [Erythranthe guttata]
Length=702

 Score =   512 bits (1318),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 299/692 (43%), Positives = 441/692 (64%), Gaps = 17/692 (2%)
 Frame = +2

Query  323   ATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGN  502
             + R F A+G+      T ++E + +   + E ES L++ LSLN+EEARALLG+LEYQRGN
Sbjct  17    SVRQFVANGIC---MKTNEFEEKLDAGNIQEAESALRDGLSLNFEEARALLGKLEYQRGN  73

Query  503   FDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILL  682
              ++AL+VF GID++    RM  ++ ++   +K R     +     +S H+ +L+LEAI L
Sbjct  74    LESALRVFDGIDLQAAVQRMQHSLGDKQPSKKGRSRSESL---SAVSQHATNLVLEAIYL  130

Query  683   KSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQ  862
             K+KSL  LG++ +AA+EC+++LD V+  F +G+ + + E+ KLQE    A+E LP+LW Q
Sbjct  131   KAKSLQKLGKLPEAAQECRSVLDAVEKIFTDGIPDVLVEN-KLQETVSHAVELLPELWKQ  189

Query  863   EGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDL-SPRFKIWCSTPPK  1039
              G   EA+++YRRAL+  WNLD +  A +QK  A+ LL++GVEV   S   +I  S  PK
Sbjct  190   AGNYTEAMSAYRRALLSQWNLDNECCARVQKAFAVFLLYSGVEVGPPSLAVQIDGSYVPK  249

Query  1040  NNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRA  1219
             NN+EEAILLL +LM K   G+ +WD  V++HLTF+L++  +   L   +E+ +PG   R 
Sbjct  250   NNLEEAILLLMILMRKFYLGKTKWDPSVLEHLTFSLSLCSQTSVLVKQIEEAIPGEIQRI  309

Query  1220  ERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPH-IPSLLLGAKLCSQDPCKSREGI  1396
             ERW  +AL  S AGQN +AL+LLR    S     EP+ + SLLL AK+CS++   + EG+
Sbjct  310   ERWKAMALSLSGAGQNSSALDLLRM---SLHKHEEPNDVMSLLLAAKICSENVLLASEGV  366

Query  1397  SFARGAMDSTVNQNK-HLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAML  1573
              +A+ A+ ++   N  HL     + LG+C G  AK+S SD ER+  Q+++L SL  A  L
Sbjct  367   KYAQNAIANSNGPNSSHLKGVGLRMLGLCLGKQAKLSSSDFERSRLQSEALKSLDSALSL  426

Query  1574  CKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAE  1753
               E+++ +F LG+ YA  RN+  A   A QY + T GS  +GW+LLAL++S++QRF +AE
Sbjct  427   EPENSDLIFELGVHYAEHRNMDAALRYAKQYLDATGGSMIRGWRLLALVLSSQQRFLEAE  486

Query  1754  AIVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQS----GMDH  1921
              + D ALDET + DQ   L++KA L+I++     A+ETYR LLA++QAQR+S    G+  
Sbjct  487   VVTDAALDETSKWDQGSLLRMKAKLKISQSLHKDAIETYRYLLALVQAQRKSYGPLGVAP  546

Query  1922  EVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERC  2101
             +V  D   E E W  LA++Y     W DA+VC++KA+T+  YS +S HT G + E Q R 
Sbjct  547   QVEDDNIDEYEVWHGLAKLYSILSHWKDAEVCLEKARTLKEYSAESLHTEGVMHEKQGRV  606

Query  2102  KEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSL  2281
              EAL A+  +L ++P YVP  +    V+ KMG + +P+AR+LL +ALRIEPT + AW+ L
Sbjct  607   SEALAAYINALLLEPKYVPCKILIGNVMCKMGPKMLPVARTLLSDALRIEPTNYMAWYHL  666

Query  2282  GKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             G + K +G    A D FQAA  L+ S P++SF
Sbjct  667   GIVHKDDGRIADAVDCFQAASVLEESEPIESF  698



>ref|XP_002283407.1| PREDICTED: tetratricopeptide repeat protein 7B [Vitis vinifera]
 ref|XP_010648460.1| PREDICTED: tetratricopeptide repeat protein 7B [Vitis vinifera]
 ref|XP_010648461.1| PREDICTED: tetratricopeptide repeat protein 7B [Vitis vinifera]
 ref|XP_010648462.1| PREDICTED: tetratricopeptide repeat protein 7B [Vitis vinifera]
 emb|CBI20811.3| unnamed protein product [Vitis vinifera]
Length=702

 Score =   512 bits (1318),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 300/692 (43%), Positives = 433/692 (63%), Gaps = 16/692 (2%)
 Frame = +2

Query  320   LATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRG  499
             L+  +  A+GL      T + E++ +E  ++E ES+L+E LSLN+EEARALLGRLEYQRG
Sbjct  17    LSVGEVRANGLCMK---TTEVEAKLDEGNIEEAESSLREGLSLNFEEARALLGRLEYQRG  73

Query  500   NFDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAIL  679
             N + AL+VF GID++    R+  + +ER  PRK R     ++    +S H+  L+LEAI 
Sbjct  74    NVEGALRVFDGIDLQAAIQRLQPSFSERLHPRKGRSRIESLIT---VSQHAAGLVLEAIY  130

Query  680   LKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWV  859
             LK+KSL  LGR+ +AA ECK++LD V+  F +G+   V  D KLQE   +A+E  P+LW 
Sbjct  131   LKAKSLQKLGRLTEAAHECKSVLDAVERIFHHGIP-NVQVDSKLQETVSQAVELFPELWK  189

Query  860   QEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRFKIWC--STP  1033
             Q G   EA+++YRRAL+  WNLD    A +QK  A+ LL++GVE    P   +    S  
Sbjct  190   QAGCYHEAMSAYRRALLSQWNLDNDCCARIQKGFAVFLLYSGVEAA-PPSLAVQMDGSYV  248

Query  1034  PKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKT  1213
             P+NN+EEAILLL +LM KI  G+ +WD  VM+HLTFAL++  +   LA  +E+++PG+  
Sbjct  249   PRNNLEEAILLLMILMKKIYLGKTKWDPSVMEHLTFALSLCSQTSVLAKQLEEVMPGVFH  308

Query  1214  RAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREG  1393
             R +RW  LALCYS AGQN T+LNLLRK     + E    + +LLL AK+CS+D   + EG
Sbjct  309   RVDRWITLALCYSGAGQNSTSLNLLRK--SLHKHERPDDLMALLLAAKICSEDSLLAAEG  366

Query  1394  ISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAML  1573
             + +A+ A+ +T   + H      + LG+C    +K S SD+ER   Q+++L  L +A   
Sbjct  367   VGYAQRAISNTQGTDHHFKGVGLRMLGLCLAKQSKASLSDAERARLQSEALKKLNEAVPF  426

Query  1574  CKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAE  1753
              +++ + +F LG++YA  RNL  A   A ++ + T GS +KGW+LL +I+SA+QRFS+AE
Sbjct  427   ERDNLDLIFELGVQYAEHRNLNVALRYAKRFIDATGGSISKGWRLLVMILSAQQRFSEAE  486

Query  1754  AIVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQS----GMDH  1921
             A+ D AL+ T + +Q   L+LKA L+I+   P  A+ET+  LLA+ QAQR+S       H
Sbjct  487   AVTDAALNVTAKWEQGPLLRLKAKLKISESLPMDAIETFCSLLALAQAQRKSLGPRPSVH  546

Query  1922  EVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERC  2101
             +V  DR  E E W  +A +Y     W DA++C+ KA+ +  YS +  H  G  FE   + 
Sbjct  547   QVDDDRVNEFEVWYGVATLYSSLSHWRDAEICLGKARELKEYSVELLHAEGVKFEGHGQI  606

Query  2102  KEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSL  2281
             +EAL A+  +L +DP YVP  +    +L+KMGS+A P+ RSLL +ALRIEPT   AW+ L
Sbjct  607   QEALAAYINALLLDPGYVPCKILIGALLLKMGSKAFPVVRSLLSDALRIEPTNRMAWYYL  666

Query  2282  GKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             G   + +G    A D FQAA  L+ S P++SF
Sbjct  667   GMAHRDDGRIADATDCFQAASILEESDPIESF  698



>ref|XP_003534319.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X1 
[Glycine max]
 ref|XP_006587636.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X2 
[Glycine max]
Length=694

 Score =   511 bits (1316),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 301/691 (44%), Positives = 440/691 (64%), Gaps = 14/691 (2%)
 Frame = +2

Query  320   LATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRG  499
             ++ R+F A+G   SR  T++ E++ +E  + E E  L+E LSLN+EEARALLG+LEYQRG
Sbjct  9     MSYREFHANG---SRMVTSEVEAKLDEGNIQEAEDALREGLSLNFEEARALLGKLEYQRG  65

Query  500   NFDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAIL  679
             N + AL+VF GID++    R+  + +E+T  +K R           +S H+ SL+LEAI 
Sbjct  66    NVEGALRVFDGIDLQAAIQRLQPSFSEKTPVKKGRTRTES---PSSVSQHAASLVLEAIY  122

Query  680   LKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWV  859
             LKSKSL  LG+  +AA +CK ILD V+  F  G+ + +  D +LQE+   A+E LP+LW 
Sbjct  123   LKSKSLQKLGKFTEAANDCKRILDAVEKIFYLGVPD-IQVDNRLQEIVSHAVELLPELWK  181

Query  860   QEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDL-SPRFKIWCSTPP  1036
             Q G  DEA+++YRRAL+  WNLD    A +QK   I LL++GVE    S   +I  S  P
Sbjct  182   QAGCYDEAISAYRRALLSQWNLDNDCCARIQKSFVIFLLYSGVETSPPSLAVQIDGSYVP  241

Query  1037  KNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTR  1216
             KNN+EEAILLL + +     G+++WD  VM+HLTFAL++      LA  +E++ PG+  R
Sbjct  242   KNNLEEAILLLMIFLKNFCLGKMKWDPSVMEHLTFALSICSGTTVLAKQLEELNPGVYHR  301

Query  1217  AERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGI  1396
              + W  LALCYS AGQN++ALNLLRK     E  ++  + SLLL A++CS+DP  + EG+
Sbjct  302   IDCWNTLALCYSGAGQNDSALNLLRKSLHKHERPND--LTSLLLAARICSEDPYLAAEGV  359

Query  1397  SFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLC  1576
             + A+ A+ +    N+HL   A + LG+C G  AK++ SD ER+  Q+++L SL  A  L 
Sbjct  360   NHAQRAISNAHGPNEHLKGVALRMLGLCLGKQAKVASSDFERSRLQSKALESLVAAIRLE  419

Query  1577  KEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEA  1756
               +++ +F L ++YA  RNL  A  +A  +   T GS +K W+LLALI+SA+QRFS+AE 
Sbjct  420   PNNSDLIFELAVQYAEHRNLPAALRSARHFFNKTGGSVSKAWRLLALILSAQQRFSEAEV  479

Query  1757  IVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQS----GMDHE  1924
             + D ALD+T + +Q   L+LKA L+I++  P  A+ETY+ LLA++QAQ++S     +  +
Sbjct  480   VTDAALDQTSRWEQGPLLRLKAKLKISQSRPMDAIETYQYLLALVQAQKKSFGSLQISSK  539

Query  1925  VLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCK  2104
             V  D+  E + W  LA +Y     W DA++C+ KA+ +  YS    HT G LFE + + +
Sbjct  540   VEYDKVNEFDIWHGLANLYASLSHWKDAEICLQKARELKEYSAALMHTEGVLFEGRGQNE  599

Query  2105  EALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLG  2284
             EAL A   ++ ++P+YVP  +    ++ K+G++ + IARSLL +ALRIEPT   AW++LG
Sbjct  600   EALCATINAILLEPNYVPCKILMGALIQKLGTKHLAIARSLLSDALRIEPTNRKAWYNLG  659

Query  2285  KLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
              L K EG    AAD FQAA  L+ S P++SF
Sbjct  660   LLHKHEGRISDAADCFQAASMLEESDPIESF  690



>ref|XP_009762835.1| PREDICTED: tetratricopeptide repeat protein 7A [Nicotiana sylvestris]
Length=702

 Score =   511 bits (1315),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 302/691 (44%), Positives = 444/691 (64%), Gaps = 15/691 (2%)
 Frame = +2

Query  323   ATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGN  502
             + R   A+G+    T     E++ +E  + E ES L++ LSLN+EEARALLGRLEYQRGN
Sbjct  17    SVRQVCANGICMQTTVV---EAKLDEGNIQEAESALRDGLSLNFEEARALLGRLEYQRGN  73

Query  503   FDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILL  682
              + AL+VF GID+++   RM  ++TE+   +K R    E  V GV S H+  L+LEAI L
Sbjct  74    VEGALRVFDGIDLQSAIQRMQPSVTEKQPSKKGRTRSVE-SVPGV-SQHAAGLVLEAIYL  131

Query  683   KSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQ  862
             K+KSL  LGR+ +AAREC+++LD V+  F NG+ + + E+ KLQE    A+E LP+LW Q
Sbjct  132   KAKSLQKLGRLTEAARECQSVLDAVEKIFDNGIPDVLVEN-KLQETVSHAVELLPELWKQ  190

Query  863   EGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEV-DLSPRFKIWCSTPPK  1039
              G   EA+ +YRRAL+  WNLD    A +QK  A+ LL++GVEV   S   +I  S  P+
Sbjct  191   TGCYSEAMTAYRRALLSQWNLDNDCCARIQKAFAVFLLYSGVEVCPPSLAVQIDGSYVPR  250

Query  1040  NNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRA  1219
             NN+EEAILLL +LM K+  G+++WD  V++HLTFAL+V  +   LA  +E+++PG+  R 
Sbjct  251   NNLEEAILLLMILMRKVYLGKIKWDPSVLEHLTFALSVCSQTSVLAKQLEEVMPGVLNRI  310

Query  1220  ERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPH-IPSLLLGAKLCSQDPCKSREGI  1396
             +RW  LALCYS+AGQN+T+L+LLRK   S   + EP  I SLLL AK+CS++   + EG+
Sbjct  311   DRWRALALCYSAAGQNKTSLSLLRK---SLHKDEEPDDILSLLLAAKICSEEVFLAAEGV  367

Query  1397  SFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLC  1576
              +A+ A+ +    N+HL     + LG+C G  AK++ SD ER+  Q+++L SL  A  L 
Sbjct  368   KYAQRAITNAQGSNEHLKGVGLRMLGLCLGKQAKVATSDFERSRLQSEALKSLDGAMALE  427

Query  1577  KEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEA  1756
              E+++ +F LG++YA  RNL  A   A +Y + T GS  +GW+LLAL++SA+QR+++AE 
Sbjct  428   NENSDLMFELGVQYAEHRNLDAALGYAKKYLDTTGGSALRGWRLLALVLSAQQRYTEAEV  487

Query  1757  IVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQSGMDH----E  1924
             + D AL+ET + DQ   L++KA L+I++     A+ETYR LLA++QAQR+S        +
Sbjct  488   VTDAALEETVKWDQGPLLRMKAKLKISQSRHMDAVETYRYLLALVQAQRKSYGPFRNAPQ  547

Query  1925  VLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCK  2104
                D   E E W  LA +Y     W DA+ C++KA+ +  YS  + HT G + E +    
Sbjct  548   AEEDNVNEYEVWHGLANLYSSLSHWKDAETCLEKARALIEYSADTLHTEGVMLEKRGEND  607

Query  2105  EALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLG  2284
             +AL A+  +L ++P++V   +    +L KMGS+ +P+AR+L  +AL+IEPT   AW+ LG
Sbjct  608   KALAAYVNALLVEPNHVQCKILLGALLSKMGSKMLPLARALFSDALKIEPTNRVAWYHLG  667

Query  2285  KLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
              + + +G    AAD FQAA  L+ S P++SF
Sbjct  668   LVHRDDGRVADAADCFQAASMLEESDPIESF  698



>ref|XP_011081247.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Sesamum 
indicum]
 ref|XP_011081249.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Sesamum 
indicum]
Length=701

 Score =   511 bits (1315),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 301/692 (43%), Positives = 433/692 (63%), Gaps = 18/692 (3%)
 Frame = +2

Query  323   ATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGN  502
             + R   A+G   +R  T   E++ +E  + E ES L+E LSLN+EEARALLG+LEYQRGN
Sbjct  17    SVRQVVANG---ARMRTNVVEAKLDEGNIQEAESALREGLSLNFEEARALLGKLEYQRGN  73

Query  503   FDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILL  682
              + AL+VF GID++    RM  +I+++  P+K R     I     +  ++ S++LEAI L
Sbjct  74    VEGALRVFDGIDLQEAIQRMQPSISDKQAPKKGRSRTESITA---VPQNASSVVLEAIYL  130

Query  683   KSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQ  862
             K+KSL  LG++ +AA ECK +LD V+  F +G+ + V  + KLQE   +A+E LP+LW  
Sbjct  131   KAKSLQKLGKLSEAAEECKRVLDAVEKIFSDGIPD-VWVENKLQETVSRAVELLPELWKL  189

Query  863   EGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRFKIWC--STPP  1036
              G   EAV++YRRAL+  WN+D +  A +QK  A+ LL++G+EV   P   +    S  P
Sbjct  190   AGCYSEAVSAYRRALLSQWNVDNECCARIQKAFAVFLLYSGIEVG-PPNLAVQTEGSYVP  248

Query  1037  KNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTR  1216
             KNN+EEAILLL VLM K   G+++WD  V +HLTFAL++  +   LA  +E+++PG+  R
Sbjct  249   KNNLEEAILLLMVLMRKCYLGKIKWDPSVREHLTFALSICSQTSVLAKQLEEVMPGLIHR  308

Query  1217  AERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPH-IPSLLLGAKLCSQDPCKSREG  1393
             AERW  +AL +S AGQN +AL+LLRK   S     EP  I S LL AK+CS++   + EG
Sbjct  309   AERWKTMALSFSGAGQNNSALDLLRK---SLHQHEEPDDIMSSLLAAKICSENVFLAAEG  365

Query  1394  ISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAML  1573
             + +A   + +    N HL     + LG+C G  AK S SD ER+  Q+++L SL  A  L
Sbjct  366   VKYANRVIANAHGSNAHLKGVGLRMLGLCLGKQAKTSSSDFERSRLQSEALKSLDSALAL  425

Query  1574  CKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAE  1753
               +++  +F LGL+YA  RNL  A   A QY + T GS  +GW+LLAL++SA+QRFS+AE
Sbjct  426   EPKNSNLIFELGLQYAEHRNLDAALRYAKQYLDATGGSMIRGWRLLALVLSAQQRFSEAE  485

Query  1754  AIVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQS----GMDH  1921
              + D ALDET + DQ   L++KA L++++     A+ETYR LLA++QAQR+S        
Sbjct  486   VVTDAALDETSKWDQGPLLRMKAKLKVSQSQHKDAIETYRYLLALVQAQRKSSGPLATGS  545

Query  1922  EVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERC  2101
             ++  D   E E W  LA++Y     W DA+VC+ KA+ +  YS ++ HT G + E Q   
Sbjct  546   QMEEDNINEYEVWHGLAKLYSSLSHWKDAEVCLGKARKLKEYSAETLHTEGVIHEKQGHT  605

Query  2102  KEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSL  2281
              EAL ++   L ++P YVP  +    VL K+GS+ +P+AR+LL +ALRIEPT   AW+ L
Sbjct  606   SEALASYINGLLLEPRYVPCKILLGAVLSKIGSKMLPVARTLLSDALRIEPTNSMAWYHL  665

Query  2282  GKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             G + K +G    A D FQAA+ L+ S P++SF
Sbjct  666   GTVHKEDGRIADAVDCFQAAYMLQESEPIESF  697



>ref|XP_007158148.1| hypothetical protein PHAVU_002G128400g [Phaseolus vulgaris]
 gb|ESW30142.1| hypothetical protein PHAVU_002G128400g [Phaseolus vulgaris]
Length=693

 Score =   510 bits (1314),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 299/693 (43%), Positives = 442/693 (64%), Gaps = 19/693 (3%)
 Frame = +2

Query  320   LATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRG  499
             ++ R+F A+G   SR   ++ E++ ++  + E E +LKE LSLN+EEARALLG+LEYQRG
Sbjct  9     VSVREFHANG---SRMVASEVEAKLDQGNIQEAEDSLKEGLSLNFEEARALLGKLEYQRG  65

Query  500   NFDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAIL  679
             N + AL+VF GID++    R+  + +E+T  +K R     + VS     H+ SL+LEAI 
Sbjct  66    NVEGALRVFDGIDLQAAIQRLQSSFSEKTPVKKGRAPTESVSVSQ----HAASLVLEAIY  121

Query  680   LKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWV  859
             LK+KSL  LG+  +AA  CK ILD V+  F  G+++ +  D KLQE+   A+E LP+LW 
Sbjct  122   LKAKSLQKLGKFTEAANNCKHILDAVEKIFYLGITD-IQVDNKLQEIVSHAVELLPELWK  180

Query  860   QEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSP---RFKIWCST  1030
             Q G  DEA+++YRRAL+  WNLD    A +QK   I LL++GVE   SP     ++  S 
Sbjct  181   QAGCYDEAISAYRRALLSKWNLDNDYCARIQKSFVIILLYSGVEA--SPPSLAVQVEGSY  238

Query  1031  PPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMK  1210
              PKNN+EEAILLL +L+ K   G+++WD  VM+HLTFAL++  +   LA  +E+++PG+ 
Sbjct  239   VPKNNLEEAILLLMILLRKFSLGKMKWDPSVMEHLTFALSICTQTSILAKQLEELMPGVY  298

Query  1211  TRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSRE  1390
              R + W  LALCYS AGQNE AL+LLRK     E  ++  + SLLL A++CS+D   + E
Sbjct  299   HRIDCWNSLALCYSGAGQNECALSLLRKSLHKHERPND--LTSLLLAARICSEDSHFAAE  356

Query  1391  GISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAM  1570
             G+++A  A+++  +Q +HL   A + LG+C G  AK+S SDSER+  Q+++L SL  A  
Sbjct  357   GVNYALRAVNNAHDQKEHLKGVALRMLGLCLGKQAKVSSSDSERSHLQSKALESLVAAIK  416

Query  1571  LCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDA  1750
             L   + + +F L + YA  RNL+ A  +A  +   T GS  K W+LLALI+SA+QRFS+A
Sbjct  417   LEPNNCDLIFELAVHYAQHRNLSAALRSARHFFNQTGGSVLKAWRLLALILSAQQRFSEA  476

Query  1751  EAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQS----GMD  1918
             E ++D ALD+T + +Q   L+LKA L+I++  P  A+ETYR LLA++QAQ++S     + 
Sbjct  477   EVVIDAALDQTARWEQGPLLRLKAKLKISQSRPMDAIETYRYLLALVQAQKKSFGSFQIS  536

Query  1919  HEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQER  2098
              +VL D+  E + W  LA +Y     W DA++C+ K + +  YS    HT G LFE + +
Sbjct  537   SKVLDDKINEFDIWHGLANLYGSLSHWKDAEICLQKGRELKKYSAALMHTQGVLFEGRGQ  596

Query  2099  CKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFS  2278
              ++AL+A    + I+P++VP  +    ++ K+G + +  ARS + +A+RIEPT   AW  
Sbjct  597   YEDALLATINGVLIEPNHVPCKILMGSMIQKIGPKYLAAARSSMSDAIRIEPTNRMAWHY  656

Query  2279  LGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             LG L+K +G    AAD FQAA  L+ S P++SF
Sbjct  657   LGLLNKKDGRISDAADCFQAASMLEESDPIESF  689



>ref|XP_002526575.1| calmodulin binding protein, putative [Ricinus communis]
 gb|EEF35853.1| calmodulin binding protein, putative [Ricinus communis]
Length=736

 Score =   512 bits (1318),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 306/698 (44%), Positives = 434/698 (62%), Gaps = 22/698 (3%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             M C CSGE  +    +    S ESLA +D+S  G SS + G AD +       ++E E T
Sbjct  23    MKCLCSGELSR--PVDEMVPSSESLANKDYSLGGYSS-KNGEADSKPDTSTINIEEAELT  79

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             L+E  SLNYEEARALLGR+EYQ+GN +AAL VF+GIDI  ++P+M   ++ +   RK   
Sbjct  80    LRERGSLNYEEARALLGRIEYQKGNVEAALHVFEGIDIAAVTPKMKVTLSRKGEHRKRNS  139

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                    +  MS+H+V+LLLEA+ LK+KSL  LGR  +AA+ CK ILDIV+++ P G+ E
Sbjct  140   QN---FATPPMSIHAVNLLLEAVFLKAKSLQHLGRFNEAAQSCKVILDIVETSLPEGLPE  196

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
                 DCKLQE  +KA+E LP+LW       EA+ SYRR+L+  WNLDA+  A +QKD AI
Sbjct  197   NFAADCKLQETINKAVELLPELWKLADSPREAIMSYRRSLLHHWNLDAETTARIQKDFAI  256

Query  968   ALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLT  1138
              LL++G E   SP   R ++  S  P+NN+EEAILLL +L+ K+    +EWD  ++DHL+
Sbjct  257   FLLYSGGEA--SPPNLRSQMDSSFVPRNNVEEAILLLMILLRKVSLKRIEWDESILDHLS  314

Query  1139  FALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAE  1318
             FAL+V G+ ++LA+ VE++LPG+  R E +Y LALCY  AG++  ALNLLRK+  S E  
Sbjct  315   FALSVSGDLKALANQVEELLPGIVGRREMYYMLALCYHGAGEDLVALNLLRKLLHSRE--  372

Query  1319  HEPH-IPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAA  1495
              +P  +P+LL+ +K+C   P  + EGI ++R A+++  +    L S     LGV     +
Sbjct  373   -DPKCVPALLMASKICGNTPTLAEEGIKYSRRALENLESGCNQLESITNCLLGVSLSAHS  431

Query  1496  KISFSDSERNSYQTQSLNSLTQAAMLCK-EDAETVFSLGLEYATQRNLTPAFDNALQYSE  1672
             K+  +DSER   Q+++L  L  A    + +D   ++ L LE A QR L  A   A    +
Sbjct  432   KLLIADSERILRQSEALQVLELAGKTTQIQDPYILYHLTLESADQRKLEVALFYAKCLLK  491

Query  1673  MTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPN  1852
             +  GS   GW LLA I+SA++R+ DAE I+  ALD+TG+ DQ + L+ +A LQIA+    
Sbjct  492   LENGSNINGWLLLARILSAQKRYVDAETIISAALDQTGKWDQGELLRTRARLQIAQGQLK  551

Query  1853  QAMETYRILLAMIQAQRQS-GMDHEVLSD-----RKLEVEAWLDLARIYIDQDSWPDAQV  2014
              A++TY  LLA++Q Q +S G   + L       R LE+E W DLA +YI    W DA++
Sbjct  552   SAIKTYGQLLAILQVQTKSFGSAKKPLKGNGKPIRSLELEVWHDLASVYISLSQWHDAEI  611

Query  2015  CIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKM  2194
             C+ K+K I  YS    HT GAL+E +   KEAL AF+ +L IDP +VPS+VS A  L ++
Sbjct  612   CLSKSKAISSYSASRCHTAGALYERKGLHKEALKAFTSALEIDPAHVPSLVSGAVALRRL  671

Query  2195  GSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGS  2308
             G+Q+  + R  LM+ALR++     AW++LG L K EGS
Sbjct  672   GNQSNEVIRGFLMDALRLDRMNSSAWYNLGLLYKAEGS  709



>emb|CDP03773.1| unnamed protein product [Coffea canephora]
Length=731

 Score =   511 bits (1316),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 310/697 (44%), Positives = 434/697 (62%), Gaps = 20/697 (3%)
 Frame = +2

Query  239   RRKMLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEV  418
             R+ M C CSGE  K    +    S ESLAT+D+S S + SS+ G A  E + +   ++E 
Sbjct  20    RKVMNCLCSGELAK---ADEMIPSSESLATKDYSTS-VYSSQAGEA--ERKPDAGNIEEA  73

Query  419   ESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprk  598
             ES+L+E+ SLNYEEARALLGR EYQ+GN +AAL VF+GIDI  ++P+M   +  R    +
Sbjct  74    ESSLRESGSLNYEEARALLGRYEYQKGNIEAALHVFEGIDIAAVTPKMKITLARRGDHPR  133

Query  599   prggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNG  778
              +        S  MSLH+VSLLLEAILLK+KSL  LGR ++AA+ C  ILDIV+S+ P G
Sbjct  134   KQSQNYS---SLPMSLHAVSLLLEAILLKAKSLEALGRYKEAAQSCSVILDIVESSLPAG  190

Query  779   MSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKD  958
             + E    DCKLQE    A+E LP+LW       E + SYRR+L+ PWNLDA+ +A +QK+
Sbjct  191   LPENFAADCKLQETLSNAVELLPELWKLADFPGETIISYRRSLLHPWNLDAETVARIQKE  250

Query  959   LAIALLFAGVEVDLSP--RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDH  1132
              A+ LL++G E +  P  R ++  S  P+NN+EEAILLL +L+ K+    +EWD  V+DH
Sbjct  251   FAVFLLYSGGEAN-PPNLRSQMDSSFVPRNNIEEAILLLMILLRKVSLNRIEWDPSVLDH  309

Query  1133  LTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSE  1312
             LT+AL+V G   +LA  VE++LP    + +R+  LALCY   G    ALNLLRK+   S 
Sbjct  310   LTYALSVSGGLRALAYQVEELLPRTIEQKDRYEKLALCYYGEGDEWAALNLLRKL--LSR  367

Query  1313  AEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNA  1492
             A     +P+LLL +KLC      + +GISFA+ A++S   +   L   A    G+   N+
Sbjct  368   AVDPTCVPALLLASKLCGDSCSYAEDGISFAQRAIESLKGRCDQLTGVANFLKGISLSNS  427

Query  1493  AKISFSDSERNSYQTQSLNSLTQAAMLCK-EDAETVFSLGLEYATQRNLTPAFDNALQYS  1669
             ++ + SDS+R   QT++L+SL  A  + + +D   ++ L LE A QR L  AF  A    
Sbjct  428   SRSAVSDSQRVQRQTEALHSLEIAGKITQMKDPMIIYHLSLENAEQRKLDSAFYYAKFLL  487

Query  1670  EMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHP  1849
             E+  GS  + W L A I+SA++RF DAE+I++ ALD+TG+ DQ   L+ KA LQIA+   
Sbjct  488   ELENGSNPRAWLLCARILSAQKRFVDAESIINAALDQTGRWDQGDLLRTKAKLQIAQGQV  547

Query  1850  NQAMETYRILLAMIQAQRQSGMDHEVL-----SDRKLEVEAWLDLARIYIDQDSWPDAQV  2014
               A+ETY  LLA++Q Q +S    + L      +R LE+E W DLA IYI    W DA++
Sbjct  548   KNAIETYTQLLAVLQVQLKSFGSGQKLEGGWKQNRNLELETWHDLASIYIRLSQWRDAEI  607

Query  2015  CIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKM  2194
             C+ K++ I+ +S   WHT G L EA+ + KEAL AF+ +LSIDP  VPS+VS A VL +M
Sbjct  608   CLSKSEGINRHSAVRWHTAGMLHEAKGQHKEALKAFAHALSIDPSQVPSLVSLAVVLRRM  667

Query  2195  GSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEG  2305
             G+Q+    RS L  A+R++     AW++LG + K EG
Sbjct  668   GTQSPATVRSFLTEAIRLDRMNASAWYNLGLVFKDEG  704



>ref|XP_004493802.1| PREDICTED: uncharacterized protein LOC101495754 isoform X1 [Cicer 
arietinum]
 ref|XP_004493803.1| PREDICTED: uncharacterized protein LOC101495754 isoform X2 [Cicer 
arietinum]
 ref|XP_004493804.1| PREDICTED: uncharacterized protein LOC101495754 isoform X3 [Cicer 
arietinum]
Length=731

 Score =   511 bits (1316),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 316/732 (43%), Positives = 457/732 (62%), Gaps = 24/732 (3%)
 Frame = +2

Query  230   HCRRR---KMLCACSGEQFKFeepepapqspesLATRDF---SASGLSSSRTGTADWESR  391
             H R+R    M C CSGE    EE    P S ESLAT+D+   + SG+S    G  +  +R
Sbjct  7     HRRKRLQKIMKCLCSGELVVREEDTMVPNSSESLATKDYYSSTVSGISGQDIGQVE-RTR  65

Query  392   FEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKA  571
              +   + EVES+L+E+  LNYEEARALLGR EYQ GN +AAL VF+GIDI +++P++   
Sbjct  66    PDSGNIQEVESSLRESGVLNYEEARALLGRYEYQEGNIEAALHVFEGIDIASVTPKIKNF  125

Query  572   ItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILD  751
             + +     K R        + +MS+H+  LLLEAILLK+K L  LGR +++ + CK ILD
Sbjct  126   LAKSRERPKRRSRN---YTTPLMSIHTSGLLLEAILLKAKCLQVLGRFKESGQTCKVILD  182

Query  752   IVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDA  931
             +++S+ P G+    G +CKLQE   KA+E LP+LW       E + SYR AL+  WNLDA
Sbjct  183   MIESSLPEGLPGNFGAECKLQETLSKAVELLPELWKLADCPREVILSYRHALLHRWNLDA  242

Query  932   KRLASMQKDLAIALLFAGVEVDLSP--RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEV  1105
             +  A +QK+ AI LL++G E ++ P  R  +  S  P+NN+EEAILLL +L  KI   ++
Sbjct  243   ETTAKIQKEFAIFLLYSGEE-EIPPDLRSHMDSSFVPRNNIEEAILLLMILQRKISLNKI  301

Query  1106  EWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNL  1285
             EWD  +++HL+FAL+V G+  +LA+  E++LPG   R ER++ LALCY  A ++  ALNL
Sbjct  302   EWDPSILEHLSFALSVSGDLTALANQWEELLPGTINRRERYHALALCYYGADKDLVALNL  361

Query  1286  LRKVSGSSEAEHEP-HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQAR  1462
             LRK+  S E   +P H+P+LL+ +K+C ++P  +++G+SFA   ++S   + + L S A 
Sbjct  362   LRKLLSSRE---DPKHVPALLMASKICCENPDFAKDGVSFASRVLESLDERCQQLESLAN  418

Query  1463  KFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCK-EDAETVFSLGLEYATQRNLT  1639
               LGV     +K++ ++SE    Q+++L+SL  A+ + +  D   ++   LE A QR L 
Sbjct  419   CLLGVSLSTYSKLAVTNSETFERQSEALHSLEAASTMTRMSDPLVLYYYSLECAEQRKLD  478

Query  1640  PAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklk  1819
              A   A +   + AGS  KGW LLA I+SA++ F DAE+I+D ALD TG  DQ   L+ K
Sbjct  479   SALHYAKRLLNLEAGSNIKGWLLLARILSAQKHFLDAESIIDAALDRTGIWDQGDLLRTK  538

Query  1820  aalqIARQHPNQAMETYRILLAMIQAQRQS-GMDHEVLSD-----RKLEVEAWLDLARIY  1981
             A LQIA+     A++TY  LLA++  QR++ G   ++  D     R LEVE W DLA +Y
Sbjct  539   AKLQIAQGKLPGAIKTYTQLLAILLVQRKTFGSRKKLYKDDRDHARNLEVEIWHDLANVY  598

Query  1982  IDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPS  2161
             I    W DA+VC+ K+K I +YS    H  G ++EAQ   KEAL AF  +L++DP++V S
Sbjct  599   ISLSQWQDAEVCLSKSKAIKLYSASRCHVIGTIYEAQGLYKEALKAFRDALNLDPEHVAS  658

Query  2162  IVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaa  2341
             ++STA VL + G Q+ P  RS LM+ALR++ +   AW+ LG L K EG   +AA+ FQAA
Sbjct  659   LISTALVLRRYGPQSNPAVRSFLMDALRLDKSNASAWYHLGILHKAEGRLLEAAECFQAA  718

Query  2342  HELKLSTPVQSF  2377
             + L+ S PV+ F
Sbjct  719   NSLEESEPVEPF  730



>ref|XP_010934257.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Elaeis guineensis]
 ref|XP_010934258.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Elaeis guineensis]
 ref|XP_010934259.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Elaeis guineensis]
 ref|XP_010934260.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Elaeis guineensis]
 ref|XP_010934261.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Elaeis guineensis]
Length=729

 Score =   511 bits (1315),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 309/699 (44%), Positives = 431/699 (62%), Gaps = 25/699 (4%)
 Frame = +2

Query  239   RRKMLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEV  418
             R KM C  SGEQ +  +   + +S   ++T+D SASG SS      + E R +   ++E 
Sbjct  19    RNKMKCLFSGEQLRMNDMIRSSES---MSTKDCSASGYSSQ---NVECEQRLDTGNIEEA  72

Query  419   ESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprk  598
             ES+L++ + LNYEEARALLGRLEYQRGN +AAL+VF GIDI  ++P+M  +I++ T+  K
Sbjct  73    ESSLRDGVCLNYEEARALLGRLEYQRGNIEAALRVFNGIDIAAIAPKMKISISKITKRHK  132

Query  599   prggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNG  778
              R           MS+H+V LL+EAI LK+++L  LGR R+AA+ C  ILD V+SA P  
Sbjct  133   SRSRWDV----PPMSIHAVGLLVEAIYLKARALQDLGRFREAAQTCNIILDTVESALPEA  188

Query  779   MSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKD  958
             + E    DCKLQE   KA E LP+LW   G + EA++SYRRAL+  WNLD++ LA +QK+
Sbjct  189   LPENFTADCKLQETVCKAAELLPELWKLAGFLHEAISSYRRALLSHWNLDSETLAKIQKE  248

Query  959   LAIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMD  1129
              AI LL+ G   D SP   R  +  S  P+NN EEAILLL +L+ K    +VEWD   +D
Sbjct  249   FAIFLLYGG--CDASPSNLRSHMDGSFIPRNNTEEAILLLMILLRKFSLKKVEWDPSAID  306

Query  1130  HLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSS  1309
             HL FAL+V G+  SLA+ +E+ LP +  R E +Y LALCY     N TALNLL+K+  + 
Sbjct  307   HLIFALSVSGQLNSLANQIEESLPDVSERKECYYTLALCYLGEDDNLTALNLLKKLLSAR  366

Query  1310  EAEHEPH-IPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYG  1486
             E   +P+ + +LLL +K+C +    + EG+SFAR A+ +       + S A   LG+   
Sbjct  367   E---DPNCVKALLLASKICGEHSAYAEEGVSFARRALSNLHKGCDQMDSVANCLLGISLS  423

Query  1487  NAAKISFSDSERNSYQTQSLNSLTQA-AMLCKEDAETVFSLGLEYATQRNLTPAFDNALQ  1663
               A+ S SDS+R S Q ++L  L +A  M+  +D   +F+L LE A QR L  A   A Q
Sbjct  424   AQARSSTSDSDRVSRQAEALVVLEKAEQMMLGKDHRILFNLSLENAEQRKLDAALHYAKQ  483

Query  1664  YSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQ  1843
               ++ AGS  K W LLA I+SA++RF DAE +V+ ALD+TG+  Q + LK KA +QIA+ 
Sbjct  484   LLKIAAGSNVKEWILLARILSAQKRFIDAETMVNAALDQTGKWSQGELLKTKAKVQIAQG  543

Query  1844  HPNQAMETYRILLAMIQAQRQSGMDHEVLS-----DRKLEVEAWLDLARIYIDQDSWPDA  2008
                 A+ETY  +L++I  Q +S       S     DR LE+E WLDLA +YI    W DA
Sbjct  544   QLKNAIETYTHVLSIIHLQAKSSSIVIKSSKGGKCDRSLEMETWLDLANVYISMSQWRDA  603

Query  2009  QVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLM  2188
             +VC+ K K     S   WH  G L+EA+   KEAL A++ +L ++P +V S++STA VL 
Sbjct  604   EVCLSKLKGFSPLSALGWHAAGKLYEAKGLQKEALGAYTKALDLEPRHVASLISTATVLR  663

Query  2189  KMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEG  2305
             ++G Q + + RS L +ALR++ T H AWF+LG L + EG
Sbjct  664   QIGDQPMAVVRSFLTDALRLDRTNHIAWFNLGLLYESEG  702



>ref|XP_007048892.1| Tetratricopeptide repeat (TPR)-containing protein isoform 3 [Theobroma 
cacao]
 gb|EOX93049.1| Tetratricopeptide repeat (TPR)-containing protein isoform 3 [Theobroma 
cacao]
Length=680

 Score =   509 bits (1310),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 292/693 (42%), Positives = 433/693 (62%), Gaps = 34/693 (5%)
 Frame = +2

Query  320   LAT-RDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQR  496
             LAT R+  A+G+      T D E++ +E  + E ES+L+E LSLN+EEARALLGRLEYQR
Sbjct  11    LATVRELCANGVCMR---TTDVEAKLDEGNIHEAESSLREGLSLNFEEARALLGRLEYQR  67

Query  497   GNFDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAI  676
             GN + AL+VF GID++    R+                      S  +S H+ SL+LE +
Sbjct  68    GNVEGALRVFDGIDLQAAIQRLQP--------------------STAVSQHAASLVLEGV  107

Query  677   LLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLW  856
              LK+KSL  LGR  +AA++C  +LD V   FP G+  GV  + +LQE   +A+E LP+LW
Sbjct  108   YLKAKSLQKLGRFTEAAQDCTNVLDAVGRIFPQGIP-GVQVENRLQETVSQAVELLPELW  166

Query  857   VQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCST  1030
              Q G   EA+++YRR L+  WNLD    A +QK  A+ LL++G+E    P    ++  + 
Sbjct  167   KQAGNYQEAMSAYRRGLLHLWNLDNDCCARIQKAFAVFLLYSGLEAG-PPSLGAQVDGAY  225

Query  1031  PPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMK  1210
              PKNN+EEAILLL VL+ KI QG ++WD  VMDHLT+AL++  +   L+  +E++ PG+ 
Sbjct  226   VPKNNLEEAILLLMVLVQKIHQGIIQWDPSVMDHLTYALSLCSQTPVLSKQLEELKPGVV  285

Query  1211  TRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSRE  1390
              R +RW  LALC S+AGQN+ ALNLLRK     + E    + +LLL AK+CS+D   + +
Sbjct  286   QRIDRWNTLALCCSAAGQNKYALNLLRK--SLHKHERPDDLTALLLAAKICSEDSHLAAD  343

Query  1391  GISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAM  1570
             G+ +A+ A+++    + HL     + LG+C    AKI+F D+ER+  Q+++L  L  A  
Sbjct  344   GVGYAQRAINNAQGVDGHLKGVGFRMLGLCLRQLAKIAFKDTERSHLQSEALLFLDAAIF  403

Query  1571  LCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDA  1750
               +++A+ +F LG+++A QRNL  A   A +Y ++T GS  KGW+LLAL++SA+ RFS+A
Sbjct  404   FEQDNADIIFELGVQHAEQRNLNAALHYAKKYIDVTGGSVLKGWRLLALVLSAQHRFSEA  463

Query  1751  EAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQS----GMD  1918
               + D ALDET + +Q   L+LKA L+I++  P  A+ETYR LLA++QAQR+S     +D
Sbjct  464   AVVTDAALDETAKWEQGPLLRLKAKLEISQSRPMDAIETYRYLLALVQAQRKSFGPMRID  523

Query  1919  HEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQER  2098
              +V  D+  E E W  LA +Y     W D ++C+ KA+ +  YS +   T G + + +  
Sbjct  524   SQVGDDKVNEFEVWHGLANLYSSLSHWKDVEICLRKAREMKQYSAKLLQTEGVMCQERGE  583

Query  2099  CKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFS  2278
              +EA+ A+  ++ ++P Y P  V  + +L KMGS +VP+AR+LL +ALRIEPT H AW+ 
Sbjct  584   IQEAMSAYINAILLEPSYAPCKVLISAMLSKMGSNSVPVARTLLSDALRIEPTNHKAWYY  643

Query  2279  LGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             LG + K +G   +A +  QAA+ L+ S PV+SF
Sbjct  644   LGMIQKDDGRLTEAIESLQAAYILEESDPVESF  676



>ref|XP_003579080.1| PREDICTED: uncharacterized protein LOC100821058 [Brachypodium 
distachyon]
Length=715

 Score =   508 bits (1309),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 304/680 (45%), Positives = 439/680 (65%), Gaps = 11/680 (2%)
 Frame = +2

Query  353   SSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQG  532
             +S+ T +   E+R ++  + E ES+L+E LSLNYEEARALLGRLEYQRGN +AAL+VF G
Sbjct  39    TSAVTASESSEARVDDGNIQEAESSLREGLSLNYEEARALLGRLEYQRGNVEAALRVFDG  98

Query  533   IDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGR  712
             ID++    R   +++E+T  ++    + +   SG  S H+ SL+LEAI LKS SL  LG+
Sbjct  99    IDLQAAIQRFQPSLSEKTSSKRNNKLRSDSSNSG--SQHAASLVLEAIYLKSMSLHKLGK  156

Query  713   IRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNS  892
               +AA++CK++LD V+S F  G+ + + E  KLQE   K++E LP+LW Q G   E++ S
Sbjct  157   PMEAAQQCKSVLDAVESIFQRGIPDVMVEQ-KLQETVSKSVELLPELWKQAGAYQESLAS  215

Query  893   YRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPKNNMEEAILL  1066
             YRRAL+  WNLD +    +QK  A+ LL+ GVE    P    +   S  PKNN+EEAILL
Sbjct  216   YRRALLSQWNLDDECCRRIQKRFAVFLLYGGVEAS-PPSLASQTEGSFVPKNNLEEAILL  274

Query  1067  LFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALC  1246
             L +L+ K   G+  WD  VM+HLTFAL++ GE   LA ++E++LPG+  R ERWY LALC
Sbjct  275   LMILLKKWYLGKTHWDPSVMEHLTFALSLCGETSVLAKHLEEVLPGIYPRTERWYSLALC  334

Query  1247  YSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDST  1426
             YS+A  NE ALNLL+K    +E  ++  I +LLL AK+CS D   + EG+ +AR A+ + 
Sbjct  335   YSAASDNEAALNLLKKSLNRNETPND--INALLLAAKICSSDYFLASEGVEYARRAVTNA  392

Query  1427  VNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSL  1606
              + + H  S A  F+G C  N +KIS SD +R+  Q ++L SL++A  L + + + +F +
Sbjct  393   ESSDGHFKSVALHFVGSCLANKSKISSSDHQRSLLQAEALKSLSEALSLDRHNPDLIFDM  452

Query  1607  GLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETG  1786
             G+EYA QRN+  A   A Q+ + T GS AKGW+LL+L++SA+QR+S+AE + D ALDET 
Sbjct  453   GVEYAEQRNMHAALKCAKQFIDSTGGSVAKGWRLLSLVLSAQQRYSEAEVVTDAALDETT  512

Query  1787  QIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQ---SGMDHEVLSDRKLEVEA  1957
             + +Q   L+++A L++A+  P +A+E YR LLA++QAQR+   S  + +  +D+  E E 
Sbjct  513   KWEQGHLLRIRAKLKVAQSLPMEAVEAYRTLLALVQAQRKTYGSVKNGKEEADKVSEFEV  572

Query  1958  WLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLS  2137
             W  LA +Y     W DA VC+ KAK +  YS  + H  G + E + +  +AL A+  +LS
Sbjct  573   WQGLANLYASLSYWRDADVCLQKAKALKTYSATTLHAEGDMHEVRAQTHDALAAYLNALS  632

Query  2138  IDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqq  2317
              + D+VPS VS   +L K G + +P+ARS L +ALR+EPT   AWF LG++ K +G    
Sbjct  633   TEVDHVPSKVSIGALLSKQGPKYLPVARSFLSDALRLEPTNRTAWFFLGQVHKHDGRLAD  692

Query  2318  aadffqaaHELKLSTPVQSF  2377
             AAD FQAA  L+ S PV+S 
Sbjct  693   AADCFQAASMLEESDPVESL  712



>ref|XP_008235621.1| PREDICTED: tetratricopeptide repeat protein 7B [Prunus mume]
Length=737

 Score =   507 bits (1306),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 300/700 (43%), Positives = 436/700 (62%), Gaps = 24/700 (3%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             M C CSGEQ +    E  P   ES+AT+D + S  SSSR    +   +     ++E ES+
Sbjct  22    MKCLCSGEQLR-AADEMVPSENESIATKDRTTSE-SSSRA--VEVTKKPHTGNIEEAESS  77

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             L+E+  LNYEEARALLGR EYQ+GN +AAL VF+GIDI  L+P++   +      R+ R 
Sbjct  78    LRESGCLNYEEARALLGRYEYQKGNIEAALHVFEGIDIAALTPKIKNTLARGGERRRRRS  137

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                    +  MS+++V+LLLEAILLK+KSL  LGR ++ A+ C+ ILD+V+S+ P+G+ +
Sbjct  138   QSFS---TPPMSINAVTLLLEAILLKAKSLQDLGRFKEGAQSCQVILDVVESSLPDGLPQ  194

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
               G DCKLQE+  K++E LP+LW       EA+ SYRRAL+  WNL+ +  A +QK+ A+
Sbjct  195   NFGADCKLQEIVSKSVELLPELWKLADCPHEAILSYRRALLHHWNLEVETTAKIQKEFAV  254

Query  968   ALLFAGVEVDLSPRFK--IWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTF  1141
              LL++G E    P F+  +  S  P+N++EEAILLL +L+ K+    + WD  ++DHL+F
Sbjct  255   FLLYSGAEAS-PPNFRSQMDSSFVPRNSLEEAILLLMILLRKVCLKRIHWDPSILDHLSF  313

Query  1142  ALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEH  1321
             AL+V G+  +LA  VE++LPG   R E +Y LALCY  A ++  ALNLLR++   SE   
Sbjct  314   ALSVSGDTRALASQVEELLPGFMDRKEIFYKLALCYYGADEHSVALNLLRRLLSKSE---  370

Query  1322  EPH-IPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAK  1498
             +P   P+LLL  K+C ++P  + EG+ FA  A++S   +  HL S A   LG+     +K
Sbjct  371   DPMCFPALLLALKICGENPSHAEEGVGFALRAIESLDGKCDHLKSTAACLLGISLSAHSK  430

Query  1499  ISFSDSERNSYQTQSLNSL-TQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEM  1675
              + +D ER   Q ++L +L T   M    D   ++ L LEYA QR L  A D A Q  ++
Sbjct  431   SAVADYERVKRQAEALQALETAGRMTSMSDPIILYHLSLEYAEQRKLDAAVDCAKQMLKL  490

Query  1676  TAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQ  1855
               GS  K W LL+ I+SA++RF DAE I++ ALD++G+ +Q + L+ KA LQIA+ H   
Sbjct  491   EGGSNIKSWLLLSRILSAQKRFVDAETIIEAALDQSGKWEQGELLRTKAKLQIAQGHFKN  550

Query  1856  AMETYRILLAMIQAQRQS-GMDHEVLSDR-----KLEVEAWLDLARIYIDQDSWPDAQVC  2017
             A+ TY  LLA +Q Q +S G  +++L        +LE+E W DLA +YI+   W DA++C
Sbjct  551   AIATYTQLLAFLQVQSKSYGYGNKLLKSNGNFSGRLELEIWHDLAYVYINLSQWSDAEIC  610

Query  2018  IDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMG  2197
             + KAK I+ YS    H TG L+E +   KEAL AFS +L IDP +V S++STA VL ++G
Sbjct  611   LSKAKAINAYSANRCHATGVLYETKGLYKEALRAFSEALDIDPSHVLSLISTAVVLRRLG  670

Query  2198  SQA---VPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGS  2308
              ++     + RS LMNAL ++ T H AW++LG L + +G+
Sbjct  671   DRSHHLYTVVRSFLMNALSLDRTNHSAWYNLGLLYESQGT  710



>ref|XP_004151995.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Cucumis 
sativus]
 ref|XP_004163481.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Cucumis 
sativus]
 gb|KGN58169.1| hypothetical protein Csa_3G576340 [Cucumis sativus]
Length=734

 Score =   507 bits (1305),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 307/713 (43%), Positives = 444/713 (62%), Gaps = 22/713 (3%)
 Frame = +2

Query  200   IKLAFLTGRAHCRRRKMLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTAD  379
             IK    TG+    R+ M C CSGE+   +  +    + +S +  + S SG  SSRTG  +
Sbjct  7     IKRGRSTGKGENIRKIMKCLCSGEK---KAGDNMIPALKSPSAFENSGSG-HSSRTG--E  60

Query  380   WESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPR  559
               ++ E   ++E ES+L+E+  LNYEEARALLGR EYQ+GN +AAL VF+GIDI  ++ +
Sbjct  61    IINKPEIGNIEEAESSLRESGCLNYEEARALLGRYEYQKGNIEAALHVFEGIDITAITSK  120

Query  560   MSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECK  739
             +  +I+ R    + R        +  MS+H+VSLLLEAILLK+KSL GLGR  +AA+ CK
Sbjct  121   IMISISRRGDRLRKRSQN---FTAPPMSMHAVSLLLEAILLKAKSLEGLGRFGEAAQSCK  177

Query  740   AILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPW  919
              ILDI++S+FP G+ E  G DCKLQE   KA+E LP+LW       EA+ SYRRAL+  W
Sbjct  178   VILDILESSFPEGLPENFGADCKLQETVTKAVELLPELWKLADASQEAILSYRRALLHQW  237

Query  920   NLDAKRLASMQKDLAIALLFAGVEV-DLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQ  1096
             NLDA+  A +QK+ AI LL++G E    + R ++  S  PKNN+EEAILL  +L+ K+  
Sbjct  238   NLDAETTARIQKEFAIFLLYSGSEACPPNLRSQMDSSFVPKNNIEEAILLFMILLRKVVL  297

Query  1097  GEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETA  1276
               ++WD  ++DHL+FAL + G+  +LA  +E++ PG+  R E  + LALCY  AG+N TA
Sbjct  298   KRIDWDPSILDHLSFALIISGDTRALAGQIEELPPGILHRQELHHALALCYYGAGENLTA  357

Query  1277  LNLLRKVSGSSEAEHEPH-IPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLS  1453
             LNLLRKV GS E   +P  +P+LL+ +K+C ++   + EG S A  A+ +   +   L  
Sbjct  358   LNLLRKVLGSHE---DPKSLPALLMASKICGENCDLAEEGTSIAHRALQNLDRECDQLEG  414

Query  1454  QARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCK-EDAETVFSLGLEYATQR  1630
              A   LGV     +K + +DSE+ + Q++++ +L  A    +  D+  ++ L LEYA +R
Sbjct  415   VANCLLGVSLSVYSKSATADSEKFTRQSEAIEALEAARKKTRMTDSNVLYHLSLEYANER  474

Query  1631  NLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqfl  1810
              L  A   A +  ++  GS  K W LLA I+SA++RF+D+E+I++ ALD+TG+ DQ + L
Sbjct  475   KLDSALHYAKKCLKLEGGSNIKTWLLLARILSAQKRFADSESIINAALDQTGKWDQAELL  534

Query  1811  klkaalqIARQHPNQAMETYRILLAMIQAQRQS---GMDHEVLSDR----KLEVEAWLDL  1969
             + KA L IA+     A+ETY  LLA  Q Q +S   G    + S R    +L++E W DL
Sbjct  535   QTKAKLLIAQDEFKGAIETYSQLLAFFQVQSKSFNLGDKKLLKSSRNYAGRLQLEVWHDL  594

Query  1970  ARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPD  2149
             A +YI    W DA+ C+ K+K I  YS    H TG L+EA+   KEAL  F  +L IDP 
Sbjct  595   ALVYIRLSQWHDAEACLSKSKAISSYSASRCHITGMLYEAKGLYKEALRGFMAALEIDPI  654

Query  2150  YVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGS  2308
             +VPS+VS+A V+  +G Q+ P+ RS LM+ALR++ T H+AW++LG   K EG+
Sbjct  655   HVPSLVSSAVVIRHLGHQSHPVIRSFLMDALRLDQTNHNAWYNLGLFYKSEGT  707



>ref|XP_010920330.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Elaeis guineensis]
Length=729

 Score =   507 bits (1305),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 306/696 (44%), Positives = 430/696 (62%), Gaps = 23/696 (3%)
 Frame = +2

Query  245   KMLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVES  424
             KM C CSGEQ K +E   + +S   + T+D SASG SS      + E R +   ++E ES
Sbjct  21    KMKCLCSGEQLKVDEMIRSSES---VTTKDLSASGYSSQ---NGEGEQRLDTINIEEAES  74

Query  425   TLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkpr  604
             +L+E + LNYEEARALLGRLEYQRGN +AAL+VF GIDI  ++P++  +I++RT  RK R
Sbjct  75    SLREGVHLNYEEARALLGRLEYQRGNTEAALRVFDGIDIAAIAPKIKISISKRTEHRKFR  134

Query  605   ggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMS  784
                       +MS+H+VSLL+EAI  K+++L  LGR ++AA+ C  ILD V+SA P G+ 
Sbjct  135   SHWDV----PLMSIHAVSLLVEAIYFKARALQDLGRFKEAAQTCNIILDTVESASPEGLP  190

Query  785   EGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLA  964
             E    DCKLQE   KA+E LP+LW   G   E ++SYRRAL+  WNL+A+ +A +QK+  
Sbjct  191   ENFTTDCKLQETVCKAVELLPELWKLAGFSHETISSYRRALLGHWNLNAESVAKIQKEFV  250

Query  965   IALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHL  1135
             I LL+ G   D SP   R ++  S  P+NN+EEAILLL +L+ K     +EWD  ++DHL
Sbjct  251   IILLYGGC--DASPPNLRSQMDGSFIPRNNIEEAILLLMILLRKFTLKRIEWDPSIIDHL  308

Query  1136  TFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEA  1315
              FAL++ G+  SLA  +E++LP +  R ER+Y LALCY   G+++    L       S  
Sbjct  309   IFALSISGQLNSLASQIEELLPRVLERKERYYTLALCY--LGEDDNLTALSLLKKLLSAM  366

Query  1316  EHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAA  1495
             E    + +LLL +K+C  +   + EG+SFAR A+ +       + S A   LG+   + A
Sbjct  367   EDPNCVKALLLASKVCGGNSTYAEEGVSFARRALSNLDRGCDQMESVANCLLGISLSSQA  426

Query  1496  KISFSDSERNSYQTQSLNSLTQAA-MLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSE  1672
             + S SDSER S Q ++L  L +A  M+  +D   +F+L LE A QR L  A   A Q  +
Sbjct  427   RSSASDSERVSRQNEALEVLERAERMMLGKDHRILFNLCLENAEQRKLDAALRYAKQLLK  486

Query  1673  MTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPN  1852
             + AGS  KGW LLA I+SA++RF DAE IV+ ALD+TG+  Q + L+ KA +QIA+    
Sbjct  487   LEAGSNVKGWILLARILSAQKRFVDAETIVNAALDQTGKWSQGELLRTKAKVQIAQGKLR  546

Query  1853  QAMETYRILLAMIQAQRQS---GMDHEV--LSDRKLEVEAWLDLARIYIDQDSWPDAQVC  2017
              A++TY  +LA IQ + +S   G+        DR LE+E W DLA IYI    W DA+VC
Sbjct  547   NAVDTYTHILATIQLRTKSFSVGIKSSKGGKCDRSLEIETWHDLANIYISMSQWRDAEVC  606

Query  2018  IDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMG  2197
             + K K I  YS   WH TG L+EA+   KEAL A++ +L ++P +V S+VS A VL ++ 
Sbjct  607   LSKLKGISPYSAFGWHATGKLYEAKGLLKEALGAYTKALDLEPTHVASLVSIATVLRQLS  666

Query  2198  SQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEG  2305
             ++ +P+ R  L NAL+++ T H  WF+LG L K EG
Sbjct  667   NRPMPVVRGFLTNALQLDRTDHITWFNLGLLYKAEG  702



>ref|XP_006443778.1| hypothetical protein CICLE_v10019014mg [Citrus clementina]
 ref|XP_006443779.1| hypothetical protein CICLE_v10019014mg [Citrus clementina]
 ref|XP_006443780.1| hypothetical protein CICLE_v10019014mg [Citrus clementina]
 ref|XP_006479481.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X1 
[Citrus sinensis]
 ref|XP_006479482.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X2 
[Citrus sinensis]
 gb|ESR57018.1| hypothetical protein CICLE_v10019014mg [Citrus clementina]
 gb|ESR57019.1| hypothetical protein CICLE_v10019014mg [Citrus clementina]
 gb|ESR57020.1| hypothetical protein CICLE_v10019014mg [Citrus clementina]
Length=737

 Score =   507 bits (1305),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 292/692 (42%), Positives = 427/692 (62%), Gaps = 17/692 (2%)
 Frame = +2

Query  260   CSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEA  439
             CSGEQ K    +    S ES+ T+D SAS  SS      +     +   ++E E +L+E 
Sbjct  27    CSGEQLK--AVDEMVPSSESIGTKDCSASDYSSK---AGEVVKHPDIGNIEEAEWSLRET  81

Query  440   LSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprggkge  619
              SLNYEEARALLGR+EYQ+GN +AAL VF+GIDI   +P+M  A+    R  +    + +
Sbjct  82    SSLNYEEARALLGRIEYQKGNIEAALHVFEGIDIAAATPKMKIALALANRKGERHKRRSQ  141

Query  620   IVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGE  799
              + S  MS+H++SLLLEAI LK+K L GLGR ++AA+ CK ILDIV+S+F  G  E +G 
Sbjct  142   NLSSPPMSVHAISLLLEAIFLKAKCLQGLGRFKEAAQSCKVILDIVESSFAEGFPENLGA  201

Query  800   DCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLF  979
             DCKLQE  ++A+E LP+LW       E + SYRRAL+  WNLDA+  A +QK+ AI LL+
Sbjct  202   DCKLQETLNRAVELLPELWKLADAPRETIMSYRRALLPCWNLDAETTAKLQKEFAIFLLY  261

Query  980   AGVEV-DLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVV  1156
              G E    + R ++  S  P+NN+EEAILLL +L+ K+    +EWD  ++DHL+FA ++ 
Sbjct  262   CGGETCPPNLRSQMGSSFVPRNNIEEAILLLMILLRKVALKRIEWDPSILDHLSFAFSIA  321

Query  1157  GEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPH-I  1333
             G+  SLA  +E++LPG+  R ER++ LALCY  AG++  ALNLLRK+   SE   +P  +
Sbjct  322   GDLSSLATQIEELLPGIINRKERYHILALCYYGAGEDLVALNLLRKLLSGSE---DPKCL  378

Query  1334  PSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSD  1513
             P+LL+ +K+C + P  + EG +FA  A++   +    + S A   LG+     +K++ +D
Sbjct  379   PALLIASKICGEYPDLAEEGATFASRALECLGDGCDQMESTANCLLGISLSAQSKVAITD  438

Query  1514  SERNSYQTQSLNSLTQAAMLCK-EDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGST  1690
              +R + Q ++L +L  AA      D   ++ L LEYA QR L  A   A    ++  GS 
Sbjct  439   FDRATRQAKALQALVSAARSTNMRDLSILYRLSLEYAEQRKLNAAHYYAKMLLKLEGGSN  498

Query  1691  AKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMETY  1870
              KGW L+A I+SA++R+ DAE I++ ALD+TG+ +Q + L+ KA +Q+ +     A+ETY
Sbjct  499   LKGWLLMARILSAQKRYEDAETILNAALDQTGKWEQGELLRTKAKVQLVQGQLKGAVETY  558

Query  1871  RILLAMIQAQRQSGMDHEVLSD------RKLEVEAWLDLARIYIDQDSWPDAQVCIDKAK  2032
               LLA +Q Q ++    +          R LE+E WLDLA IYI+   W DA++C+ K++
Sbjct  559   THLLAALQVQTKTFSSDKRFYKGSANHARSLELEVWLDLAFIYINLSQWHDAEICLSKSE  618

Query  2033  TIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVP  2212
              I  YS    H TG L+E +   KEA+ AF  +L+IDP +VPS++STA VL K+  Q+  
Sbjct  619   AISSYSASKCHATGVLYEKKGLYKEAIKAFRSALNIDPAHVPSLISTAVVLRKLSDQSNA  678

Query  2213  IARSLLMNALRIEPTCHDAWFSLGKLSKMEGS  2308
             + RS LM ALR++     AW++LG   K +G+
Sbjct  679   VIRSFLMAALRLDGMNSSAWYNLGLFYKSQGT  710



>ref|XP_007201775.1| hypothetical protein PRUPE_ppa001953mg [Prunus persica]
 gb|EMJ02974.1| hypothetical protein PRUPE_ppa001953mg [Prunus persica]
Length=737

 Score =   506 bits (1304),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 300/700 (43%), Positives = 434/700 (62%), Gaps = 24/700 (3%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             M C CSGEQ +    E  P   ESLAT+D + S  SSSR    +   +     ++E ES+
Sbjct  22    MKCLCSGEQLR-AADEMVPSENESLATKDRTTSE-SSSRA--VEVTKKPHTGNIEEAESS  77

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             L+E+  LNYEEARALLGR EYQ+GN +AAL VF+GIDI  L+P++   +      R+ R 
Sbjct  78    LRESGCLNYEEARALLGRYEYQKGNIEAALHVFEGIDIAALTPKIKNTLARVGERRRRRS  137

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                    +  MS+++V+LLLEAILLK+KSL  LGR ++ A+ C+ ILD+V+S+ P+G+ +
Sbjct  138   QSFS---TPPMSINAVTLLLEAILLKAKSLQDLGRFKEGAQSCQVILDVVESSLPDGLPQ  194

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
                 DCKLQE+  K++E LP+LW       EA+ SYRRAL+  WNL+ +  A +QK+ A+
Sbjct  195   NFVADCKLQEIVSKSVELLPELWKLADCPHEAILSYRRALLHHWNLEVETTAKIQKEFAV  254

Query  968   ALLFAGVEVDLSPRFK--IWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTF  1141
              LL++G E    P F+  +  S  P+N++EEAILLL +L+ K+    ++WD  ++DHL+F
Sbjct  255   FLLYSGAEAS-PPNFRSQMDSSFVPRNSLEEAILLLMILLRKVCLKRIQWDPSILDHLSF  313

Query  1142  ALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEH  1321
             AL+V G+  +LA  VE++LPG   R E +Y LALCY  AG++  ALNLLR++   SE   
Sbjct  314   ALSVSGDTRALASQVEELLPGFMDRKEIFYKLALCYYGAGEHSVALNLLRRLLSKSE---  370

Query  1322  EPH-IPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAK  1498
             +P   P+LLL  K+C ++P  + EG+ FA  AM S   +  HL S A   LG+     +K
Sbjct  371   DPMCFPALLLALKICGENPSHAEEGVGFALRAMQSVDGKCDHLKSTAACLLGISLSVHSK  430

Query  1499  ISFSDSERNSYQTQSLNSL-TQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEM  1675
              + +D ER   Q ++L +L T   M    D   ++ L LEYA QR L  A D A Q  ++
Sbjct  431   SAVADYERVKRQAEALQALETAGRMTTMSDPIILYHLSLEYAEQRKLDAALDCAKQMLKL  490

Query  1676  TAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQ  1855
               GS  K W LL+ I+SA++RF DAE I++ ALD++G+ +Q + L+ KA LQ A+     
Sbjct  491   EGGSNIKSWLLLSRILSAQKRFVDAETIIEAALDQSGKWEQGELLRTKAKLQTAQGQFKN  550

Query  1856  AMETYRILLAMIQAQRQS-GMDHEVLSDR-----KLEVEAWLDLARIYIDQDSWPDAQVC  2017
             A+ TY  LLA +  Q +S G  +++L        +LE+E W DLA +YI+   W DA++C
Sbjct  551   AIATYTQLLAFLHVQSKSYGYGNKLLKSNGNFSGRLELEIWHDLAYVYINLSQWSDAEIC  610

Query  2018  IDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMG  2197
             + KAK I+ YS    H TG L+E +   KEAL AFS +L IDP +VPS++STA VL ++G
Sbjct  611   LSKAKAINAYSANRCHATGVLYETKGLYKEALRAFSEALDIDPSHVPSLISTAVVLRRLG  670

Query  2198  SQA---VPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGS  2308
              ++     + RS LMNAL ++ T H AW++LG L + +G+
Sbjct  671   DRSNHLYTVVRSFLMNALSLDRTNHSAWYNLGLLYESQGT  710



>ref|XP_010265002.1| PREDICTED: tetratricopeptide repeat protein 7A-like isoform X3 
[Nelumbo nucifera]
Length=736

 Score =   506 bits (1303),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 311/702 (44%), Positives = 439/702 (63%), Gaps = 30/702 (4%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDF-SASGLSSSRTGTADWESRFEEAQVDEVES  424
             M C CSGEQ      +    S ES  T+DF   +G SSS+ G    + + +   ++E ES
Sbjct  22    MKCLCSGEQL---GADEMVLSSESPGTKDFFVVAGESSSKVGGG--KKKPDIGNIEEAES  76

Query  425   TLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkpr  604
             +L+E+  LNYEEARALLGRLEYQRGN +AAL VF+GIDI +++P++  +I   T+  + R
Sbjct  77    SLRESGFLNYEEARALLGRLEYQRGNVEAALHVFEGIDIASVTPKIKLSILSITQRGEHR  136

Query  605   ggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMS  784
               +    V+  MS+H+ SLL EAI LK++SL  LGR ++AA+ CK ILD V+SA P G+ 
Sbjct  137   KRRSHSDVAPPMSMHAASLLFEAIYLKARSLQDLGRFQEAAQSCKVILDTVESALPEGLP  196

Query  785   EGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLA  964
             E  G D KLQE  +K +E LP+LW   G   EA+ SYRRAL+  WNLD   +A ++K+ A
Sbjct  197   ENFGTDFKLQETLNKTVELLPELWKLAGFPHEAILSYRRALLHHWNLDPDTIAKIEKEFA  256

Query  965   IALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHL  1135
             I LL+ G   D SP   R ++  S  PKNN+EEAILLL +L+ K     +EWD  ++DHL
Sbjct  257   IFLLYGGC--DASPPNLRSQMEGSFVPKNNIEEAILLLLILLKKFALRRIEWDPSIIDHL  314

Query  1136  TFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEA  1315
             +FAL+V GE  +LA+ VE++LP +  + ER+Y LALCY + G+N  ALNLLRK+    E 
Sbjct  315   SFALSVSGELRTLANQVEELLPEILDKKERYYTLALCYYAEGENVVALNLLRKLLSGRE-  373

Query  1316  EHEPH-IPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNA  1492
                P+ I +LLL +K+  +D     EG +FAR A+         ++S     LG+     
Sbjct  374   --NPNCIGALLLASKISGEDLNLPEEGEAFARKAIALLHGGCNRMISVTNYLLGISLSAQ  431

Query  1493  AKISFSDSERNSYQTQSLNSLTQAAMLCKE-DAETVFSLGLEYATQRNLTPAFDNALQYS  1669
             A++  SDSER+  Q  +L +L  A    +E + + +F L LE A QR L  A   A Q  
Sbjct  432   ARLVRSDSERSMRQIDALRALETAEKKMREREPKVIFYLSLENAEQRKLDVALYYAKQLL  491

Query  1670  EMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHP  1849
             ++ AGS  KGW LLA I+SA++RF DAE I++ ALD+TG+ DQ + L+ KA LQI +   
Sbjct  492   KLEAGSNIKGWILLARILSAQKRFVDAETIINAALDQTGRWDQGELLRTKAKLQIVQGQL  551

Query  1850  NQAMETYRILLAMIQAQRQS----------GMDHEVLSDRKLEVEAWLDLARIYIDQDSW  1999
               A++TY  LLA+++ QR++           +DH    +R LE+E W DLA IY     W
Sbjct  552   KNAIKTYTHLLAVLEVQRRNFSVSKKILKGSVDH----NRALEMETWHDLAYIYTSLSQW  607

Query  2000  PDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAE  2179
              DA+VC+ K+K I+ +S   WH TGAL+EA+   +EAL AF+ +L I+P++VPS+VSTA 
Sbjct  608   QDAEVCLTKSKQINPHSASRWHATGALYEAKSLYREALKAFASALDIEPNHVPSLVSTAV  667

Query  2180  VLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEG  2305
             VL K+G  ++P+ R  L +ALR++ T H AW++LG + K EG
Sbjct  668   VLGKLGEPSLPVVRGFLTDALRLDKTNHFAWYNLGLIYKAEG  709



>ref|XP_006588689.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Glycine 
max]
Length=714

 Score =   505 bits (1300),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 303/697 (43%), Positives = 440/697 (63%), Gaps = 24/697 (3%)
 Frame = +2

Query  323   ATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGN  502
             A +DFSAS    +      ++ + +   ++E ES+L+E+  LNYEEARALLGR EYQ+GN
Sbjct  29    AIKDFSAS---ENSCLAEQFDKKPDTGNIEEAESSLRESGILNYEEARALLGRYEYQKGN  85

Query  503   FDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILL  682
               AAL VF+GIDI  ++P++  A++     RK             MS+HSV LLLEA+ L
Sbjct  86    IVAALHVFEGIDIGVVTPKIKIALSRSRERRKRHSQNH---AEPQMSIHSVGLLLEAVFL  142

Query  683   KSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQ  862
             K+KSL  L R ++AA+ CK ILDIV+S+ P GM +  G +CKLQE  +KA+E LP+LW  
Sbjct  143   KAKSLQVLERFKEAAQSCKVILDIVESSLPEGMPDNFGAECKLQETLNKAVELLPELWKL  202

Query  863   EGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSP---RFKIWCSTP  1033
                  EA+ SYRRAL+  WNLDA+ +A +QK+  + LL++G E   +P   R ++  S  
Sbjct  203   ADCPREAILSYRRALLHHWNLDAETIAKIQKEFVVFLLYSGGEA--TPPNLRSQMDGSFV  260

Query  1034  PKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKT  1213
             P+NN+EEAILLL +L+ K+    +EWD  ++DHL+FAL+V G+  +LA+ +E++LP    
Sbjct  261   PRNNIEEAILLLMILLRKVSLNRIEWDPSILDHLSFALSVSGDLTALANQLEELLPATIH  320

Query  1214  RAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREG  1393
             R+ER+Y LALCY  AG++  AL+LLRK+  S E +H  H+P LL+ +K+C ++   + EG
Sbjct  321   RSERYYALALCYYGAGKDLVALDLLRKLLRSREDQH--HVPGLLMASKICCENSTLAEEG  378

Query  1394  ISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAML  1573
             +SFA+  + +   +   L + A  FLGV     +K++ SDSER   Q+++L++L  A  +
Sbjct  379   VSFAKRVLQNLDGRCNQLENHANFFLGVSLSAHSKLAASDSERLKRQSEALHALETAGRM  438

Query  1574  CKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAE  1753
                +   ++ L LEYA QR L  AF  A  + ++  GS  KGW LLA I+SA+++F DAE
Sbjct  439   --RNPLVLYHLSLEYAEQRKLDAAFYYAKCFLKLEGGSNVKGWLLLARILSAQKQFLDAE  496

Query  1754  AIVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQS-GMDHEVL  1930
             +IV+ ALD+TG+ DQ   L+ KA LQIA+     A+ETY  LLA++Q Q +  G   ++ 
Sbjct  497   SIVNTALDQTGKWDQGDLLRTKAKLQIAQGQLRNAIETYTQLLAVLQIQSKGFGSGKKLY  556

Query  1931  SD-----RKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQE  2095
              D     R LEVE W D+A +YI    W DA+VC+ K++ I   S    H  G ++EA+ 
Sbjct  557   KDNRDRARNLEVEIWHDIAYVYISLLQWHDAEVCLSKSEAIKPLSASRCHAIGIVYEAKG  616

Query  2096  RCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWF  2275
             + KEAL AF  +L IDP +V SI+STA VL +  +++ P  +S LM+ALR +     AW+
Sbjct  617   QYKEALKAFGDALDIDPGHVLSIISTAVVLKRCSNKSNPAVKSFLMDALRHDRFNASAWY  676

Query  2276  SLGKLSKMEG---SaqqaadffqaaHELKLSTPVQSF  2377
             +LG L K EG   S  +AA+ FQAAH L+ S PV+ F
Sbjct  677   NLGLLHKAEGTASSLVEAAECFQAAHFLEESAPVEPF  713



>ref|XP_003548710.1| PREDICTED: uncharacterized protein LOC100811897 [Glycine max]
Length=694

 Score =   504 bits (1298),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 296/691 (43%), Positives = 432/691 (63%), Gaps = 14/691 (2%)
 Frame = +2

Query  320   LATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRG  499
             +  R+F A+G   S     + E++ +E  + E ES L+E LSLN+EEARALLG+LEYQRG
Sbjct  9     VTIREFCANG---SCMEAKELEAKLDEGNIQEAESALREGLSLNFEEARALLGKLEYQRG  65

Query  500   NFDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAIL  679
             N + AL+VF GID++    R+  +++E+T  +K             +S H+ +L+LEAI 
Sbjct  66    NVEGALRVFDGIDLEAAIQRLQSSLSEKTPVKKGPTRSES---PSSVSQHAATLVLEAIY  122

Query  680   LKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWV  859
             LK+KSL  L +  +AA+ECK +LD V+  F  G+ +    D KLQE+   A+E LP+LW 
Sbjct  123   LKAKSLQKLDKFTEAAKECKRVLDAVEKIFGQGIPD-TQVDNKLQEIVSHAVELLPELWK  181

Query  860   QEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDL-SPRFKIWCSTPP  1036
             Q G  +EA+++YR AL+  WNLD    A +Q   A+ +L++GVE    S   +I  S  P
Sbjct  182   QTGCYNEALSAYRNALLSQWNLDNDCCARIQMAFAVFMLYSGVEASPPSLAVQIDGSYVP  241

Query  1037  KNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTR  1216
             KNN+EEAILLL +L+ K   G++ WD  +M+HLTFAL+  G+   LA   E++ PG+  R
Sbjct  242   KNNLEEAILLLMILLRKFSLGKINWDPSIMEHLTFALSACGQTSILAKQFEELAPGVYHR  301

Query  1217  AERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGI  1396
              +RW FLALC S AG+NE+ALNLLR      + E    + SLLL AK+CS+DP  + EG 
Sbjct  302   IDRWNFLALCNSGAGENESALNLLRM--SLHKHERPDDLISLLLAAKICSEDPHHAAEGA  359

Query  1397  SFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLC  1576
              +A+ A++     + HL     + LG+C G  AK+S SD ER+  Q+++L SL +A  L 
Sbjct  360   GYAQRAINIAQGLDGHLKGVGLRMLGLCLGKQAKVSSSDFERSMLQSKALQSLEEAVRLE  419

Query  1577  KEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEA  1756
             + + + +F L ++YA  RNLT A   A Q+ + T GS  KGW+LLAL++SA++RFS+AE 
Sbjct  420   QNNYDLIFELAIQYAEHRNLTAALSCAKQFFDKTGGSKLKGWRLLALVLSAQKRFSEAEV  479

Query  1757  IVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQSG----MDHE  1924
             + D ALDET + +Q   L+LKA L+I++  P  A+E YR LLA++QAQR+S     +  +
Sbjct  480   VTDAALDETAKWEQGPLLRLKAKLKISQLRPMDAIEIYRYLLALVQAQRKSSGPLKLSSQ  539

Query  1925  VLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCK  2104
             V      E E W  LA +Y     W DA++C+ KA+ +  YS  + HT G +F+ +   +
Sbjct  540   VEDYTINEFEVWHGLANLYASLSHWKDAEICLQKARELKEYSAATIHTEGIMFDGRGEYQ  599

Query  2105  EALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLG  2284
             EAL+    ++  +P+YVPS +  A +++KMG +A P+ARSLL +ALRIEPT   AW+ LG
Sbjct  600   EALIGTFNAVLFEPNYVPSKILMASLILKMGFKASPVARSLLSDALRIEPTNRMAWYYLG  659

Query  2285  KLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
                K +G    AAD FQAA  L+ S P+++F
Sbjct  660   LTHKADGRLVDAADCFQAASMLEESDPIENF  690



>ref|XP_010265000.1| PREDICTED: tetratricopeptide repeat protein 7A-like isoform X1 
[Nelumbo nucifera]
Length=750

 Score =   506 bits (1302),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 311/702 (44%), Positives = 439/702 (63%), Gaps = 30/702 (4%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDF-SASGLSSSRTGTADWESRFEEAQVDEVES  424
             M C CSGEQ      +    S ES  T+DF   +G SSS+ G    + + +   ++E ES
Sbjct  36    MKCLCSGEQL---GADEMVLSSESPGTKDFFVVAGESSSKVGGG--KKKPDIGNIEEAES  90

Query  425   TLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkpr  604
             +L+E+  LNYEEARALLGRLEYQRGN +AAL VF+GIDI +++P++  +I   T+  + R
Sbjct  91    SLRESGFLNYEEARALLGRLEYQRGNVEAALHVFEGIDIASVTPKIKLSILSITQRGEHR  150

Query  605   ggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMS  784
               +    V+  MS+H+ SLL EAI LK++SL  LGR ++AA+ CK ILD V+SA P G+ 
Sbjct  151   KRRSHSDVAPPMSMHAASLLFEAIYLKARSLQDLGRFQEAAQSCKVILDTVESALPEGLP  210

Query  785   EGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLA  964
             E  G D KLQE  +K +E LP+LW   G   EA+ SYRRAL+  WNLD   +A ++K+ A
Sbjct  211   ENFGTDFKLQETLNKTVELLPELWKLAGFPHEAILSYRRALLHHWNLDPDTIAKIEKEFA  270

Query  965   IALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHL  1135
             I LL+ G   D SP   R ++  S  PKNN+EEAILLL +L+ K     +EWD  ++DHL
Sbjct  271   IFLLYGGC--DASPPNLRSQMEGSFVPKNNIEEAILLLLILLKKFALRRIEWDPSIIDHL  328

Query  1136  TFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEA  1315
             +FAL+V GE  +LA+ VE++LP +  + ER+Y LALCY + G+N  ALNLLRK+    E 
Sbjct  329   SFALSVSGELRTLANQVEELLPEILDKKERYYTLALCYYAEGENVVALNLLRKLLSGRE-  387

Query  1316  EHEPH-IPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNA  1492
                P+ I +LLL +K+  +D     EG +FAR A+         ++S     LG+     
Sbjct  388   --NPNCIGALLLASKISGEDLNLPEEGEAFARKAIALLHGGCNRMISVTNYLLGISLSAQ  445

Query  1493  AKISFSDSERNSYQTQSLNSLTQAAMLCKE-DAETVFSLGLEYATQRNLTPAFDNALQYS  1669
             A++  SDSER+  Q  +L +L  A    +E + + +F L LE A QR L  A   A Q  
Sbjct  446   ARLVRSDSERSMRQIDALRALETAEKKMREREPKVIFYLSLENAEQRKLDVALYYAKQLL  505

Query  1670  EMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHP  1849
             ++ AGS  KGW LLA I+SA++RF DAE I++ ALD+TG+ DQ + L+ KA LQI +   
Sbjct  506   KLEAGSNIKGWILLARILSAQKRFVDAETIINAALDQTGRWDQGELLRTKAKLQIVQGQL  565

Query  1850  NQAMETYRILLAMIQAQRQS----------GMDHEVLSDRKLEVEAWLDLARIYIDQDSW  1999
               A++TY  LLA+++ QR++           +DH    +R LE+E W DLA IY     W
Sbjct  566   KNAIKTYTHLLAVLEVQRRNFSVSKKILKGSVDH----NRALEMETWHDLAYIYTSLSQW  621

Query  2000  PDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAE  2179
              DA+VC+ K+K I+ +S   WH TGAL+EA+   +EAL AF+ +L I+P++VPS+VSTA 
Sbjct  622   QDAEVCLTKSKQINPHSASRWHATGALYEAKSLYREALKAFASALDIEPNHVPSLVSTAV  681

Query  2180  VLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEG  2305
             VL K+G  ++P+ R  L +ALR++ T H AW++LG + K EG
Sbjct  682   VLGKLGEPSLPVVRGFLTDALRLDKTNHFAWYNLGLIYKAEG  723



>ref|XP_011070117.1| PREDICTED: tetratricopeptide repeat protein 7A-like isoform X1 
[Sesamum indicum]
 ref|XP_011070118.1| PREDICTED: tetratricopeptide repeat protein 7A-like isoform X1 
[Sesamum indicum]
Length=701

 Score =   504 bits (1298),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 295/691 (43%), Positives = 437/691 (63%), Gaps = 16/691 (2%)
 Frame = +2

Query  323   ATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGN  502
             + R FSA+G+S     T++ E++ +E  + E ES L++ LSLN+EEARALLG+LEYQRGN
Sbjct  17    SVRQFSANGVSMQ---TSEVEAKLDEGNIQEAESALRDGLSLNFEEARALLGKLEYQRGN  73

Query  503   FDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILL  682
              + AL VF GID++    R+  ++ ++   RK R        S  +S +S +L+LEAI L
Sbjct  74    LEGALLVFDGIDLQATVQRVQHSLEDKPPSRKGRTRSE---TSFAVSQNSTNLVLEAIYL  130

Query  683   KSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQ  862
             K+KSL  LG++ +AA+ECK++LD V+  F  G+ + V  D KLQE    A+E LP+LW +
Sbjct  131   KAKSLQKLGKLTEAAQECKSVLDAVEKIFVEGIPD-VLLDNKLQETISHAVELLPELWKK  189

Query  863   EGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRFKIWC--STPP  1036
              G   EA+++YRRAL+  WN+D +  A +QK  A+ LL++GV+   +P   +    S  P
Sbjct  190   AGCYSEAMSAYRRALLSQWNIDNECCARIQKAFAVFLLYSGVDF-CAPSLSVQIDGSYIP  248

Query  1037  KNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTR  1216
             +NN+EEAILLL +LM K   G+++WD  V+DHLT A+++ G+   LA  +E+++PG   R
Sbjct  249   RNNLEEAILLLMILMRKAYHGKIKWDPSVLDHLTCAISLCGQTSVLAKQLEEVMPGAIHR  308

Query  1217  AERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGI  1396
              +RW  +AL +S +GQ  +AL+LL+K     EA ++  I SLLL AK+CS+D   + +G+
Sbjct  309   TDRWKTMALSFSGSGQKRSALDLLKKSLNQHEAPND--IVSLLLAAKICSEDVLLAADGV  366

Query  1397  SFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLC  1576
              +A+ A+ +    N HL     + LG+C G  AK+S SD ER+  Q+++L SL  A  L 
Sbjct  367   KYAQRAIANANELNAHLKGIGLRMLGLCLGKQAKVSSSDFERSLLQSEALKSLDSAVALE  426

Query  1577  KEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEA  1756
               + + +F LG+ YA  RNL  A   A QY + T GS  +GW+LLAL++SA+QRFS+AE 
Sbjct  427   CHNPDLIFELGILYAEHRNLDAALQCAKQYLDQTGGSMIRGWRLLALVLSAQQRFSEAEV  486

Query  1757  IVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQS----GMDHE  1924
             + D ALDET + DQ   L++KA L+I++     A+ETYR LLA++QAQ++S    G   +
Sbjct  487   VTDAALDETSKWDQGPLLRMKAKLKISQSLHMDAVETYRYLLALVQAQKKSYGPLGSSPQ  546

Query  1925  VLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCK  2104
             V  ++  E E W  LA +Y     W DA++C+ KA+ +  YS ++ HT G + E      
Sbjct  547   VEHEKVDEYEVWHGLASLYASLSRWKDAEICLGKARALKQYSAETLHTEGMMHEKLGDAD  606

Query  2105  EALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLG  2284
              AL A+  +  ++P YVPS +    +L KMG + +P+AR+LL +ALRIEPT + AW+ LG
Sbjct  607   NALAAYINAHLLEPKYVPSKILIGSLLCKMGGKMLPVARTLLSDALRIEPTNYMAWYYLG  666

Query  2285  KLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             ++ K EG    A D FQAA  LK S PV+SF
Sbjct  667   RIHKDEGRIADAVDCFQAASMLKESDPVESF  697



>ref|XP_006841599.1| hypothetical protein AMTR_s00003p00208040 [Amborella trichopoda]
 gb|ERN03274.1| hypothetical protein AMTR_s00003p00208040 [Amborella trichopoda]
Length=711

 Score =   504 bits (1298),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 306/716 (43%), Positives = 454/716 (63%), Gaps = 16/716 (2%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             MLC  SGEQ + EE        + ++ ++  A+GL      T++ E++ +E  + E ES+
Sbjct  1     MLCTFSGEQVRIEEGGGGVSEND-MSVKEVCANGLC---MKTSEVEAKLDEGNIQEAESS  56

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             L+E LSLN EEARALLGRLEYQRGN +AA +VF GID++    R+   I E++  R+ R 
Sbjct  57    LREGLSLNLEEARALLGRLEYQRGNIEAAFRVFDGIDLQAAIQRLQPTIPEKSHSRRGRS  116

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                 +     +S H+ SL+LEAI LKS  L  LGR+ +AA+ECK++LD V+  FP+G+ E
Sbjct  117   RSESV---HSVSQHAASLVLEAIYLKSMCLQMLGRVSEAAQECKSVLDAVEKIFPHGIPE  173

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
              +  D KLQE   KA+E LP LW Q G   EA +SYRRAL+  WNLD++  A +QK  A+
Sbjct  174   -ILLDNKLQETVSKAVELLPDLWKQAGSHQEAASSYRRALLSQWNLDSECCARIQKAFAV  232

Query  968   ALLFAGVEVDL-SPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFA  1144
              LL+ GVE    S  ++   S  PKNN+EEAILLL +L+ K   G+ EWD  +M H TFA
Sbjct  233   FLLYGGVEAGPPSLAYQTDGSFVPKNNLEEAILLLMILLRKSFLGKTEWDPSIMQHFTFA  292

Query  1145  LTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHE  1324
             L++ G+   LA ++E++LPG+  R ERW  LALCY  +GQ++ ALNLLRK    ++ E+ 
Sbjct  293   LSLCGQTSILAKHIEEVLPGIYPRCERWNDLALCYLGSGQSKVALNLLRK--SLNKNENP  350

Query  1325  PHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNK-HLLSQARKFLGVCYGNAAKI  1501
              ++ +LL+ AK CS+D   + EG+ +A  A+  +  +N+ H+     + LG C G  A++
Sbjct  351   NNLLALLMAAKACSEDCLLASEGVGYAERAIAISKGRNRRHMKGAYLRLLGKCLGKQARV  410

Query  1502  SFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTA  1681
             + SD ER   Q ++L +L +A    + + E +  LGLEYA  RN + A   A ++ + T 
Sbjct  411   ASSDHERTRLQAEALKALDKAIQFERNNPEFILDLGLEYAEHRNSSGAVRCAKEFIDATG  470

Query  1682  GSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAM  1861
             GS  KGW+ LAL++SA++R+ +AE ++D ALDETG+ +Q   L++KA L+IA+     A+
Sbjct  471   GSVLKGWRFLALVLSAQRRYPEAEVVIDAALDETGKWEQGALLRMKAKLKIAQSLTMDAV  530

Query  1862  ETYRILLAMIQAQRQS----GMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKA  2029
             ETYR+LLA++QAQR+S       ++   +   E E W DLA +Y     W DA+ C+DKA
Sbjct  531   ETYRLLLALVQAQRKSFGPMRTFNQAEEENVNEYEVWQDLANLYSSLSHWSDAETCLDKA  590

Query  2030  KTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAV  2209
             + +  YS  ++HT G ++EA+ + ++AL A+S SLSID ++VP  VS   +L + GS ++
Sbjct  591   RALKFYSASTFHTEGMIYEARGQIRDALAAYSNSLSIDLNHVPCKVSIGALLWRSGSMSL  650

Query  2210  PIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             P+ARS L +ALR+EPT   AW+ LG + + +G    A++ FQAA  L+ S P++SF
Sbjct  651   PVARSFLSDALRLEPTNRMAWYYLGMVHRDDGRLSDASECFQAACMLEESDPIESF  706



>ref|XP_007050216.1| No pollen germination related 2 [Theobroma cacao]
 gb|EOX94373.1| No pollen germination related 2 [Theobroma cacao]
Length=734

 Score =   504 bits (1299),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 304/696 (44%), Positives = 434/696 (62%), Gaps = 24/696 (3%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             M C C+GE     + +    S ESLAT+D+S SG SS     +D E + +   ++E E +
Sbjct  23    MKCLCTGE--PITKVDKMIPSSESLATKDYSLSGYSSK---VSDSEKKPDSRNIEEAELS  77

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             L+E+ SLNYEEARALLGR+EYQ+GN +AAL VF+GIDI  ++P+M   ++ R   RK R 
Sbjct  78    LRESSSLNYEEARALLGRIEYQKGNIEAALHVFEGIDIAAITPKMKLTLSRRVERRKRRS  137

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                       MS+H+VSLLLEAI LK+KSL  L R ++AA+ CK ILDIV+S+ P G+ E
Sbjct  138   HD---YAPPPMSIHAVSLLLEAIFLKAKSLQHLQRFKEAAKTCKVILDIVESSLPEGLPE  194

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
               G DCKLQE  +KA+E LP+LW       EA+ SYRRAL+  WNLDA+  A +QK  AI
Sbjct  195   NFGADCKLQETLNKAVELLPELWKFSDSSREAILSYRRALLHQWNLDAETTARIQKQFAI  254

Query  968   ALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLT  1138
              LL+ G E   SP   R  +  S  P+NN+EEAILLL +L+ K+    +EWD  ++DHL+
Sbjct  255   FLLYCGGEA--SPPNLRSLMDSSFVPRNNIEEAILLLMILLRKVSLKRIEWDPSILDHLS  312

Query  1139  FALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAE  1318
             FAL++ G+  +LA+ +E++LPG+  R ER++ LALCY  AG++  ALNLLRK+  S E  
Sbjct  313   FALSMSGDLRALANQIEELLPGIINRKERYHILALCYYGAGEDLVALNLLRKLLSSRE--  370

Query  1319  HEPH-IPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAA  1495
              +P  + +LL+ +++C +    + EGISFAR A++S  ++   L       LGV     +
Sbjct  371   -DPDCVQALLMASRICGEKLNFAEEGISFARRALESLDDECSELEGTGNFLLGVALLGHS  429

Query  1496  KISFSDSERNSYQTQSLNSLTQAAMLCK-EDAETVFSLGLEYATQRNLTPAFDNALQYSE  1672
             K + S+SER + Q+++L +L  A  +   +D   ++ L L  A QR L  A   A    +
Sbjct  430   KSAPSNSERFARQSEALQALGSAGKITSMKDPNFLYYLSLGNAEQRKLEAALYYAKSSLK  489

Query  1673  MTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPN  1852
             +  GS  +GW LLA I+SA++RF D E +++ ALD+TG+ DQ + L+ KA LQIA+    
Sbjct  490   LEGGSNIRGWLLLARILSAQKRFMDGEIVLNAALDQTGKWDQGELLRTKAKLQIAQGRLK  549

Query  1853  QAMETYRILLAMIQAQRQSGMDHEVL------SDRKLEVEAWLDLARIYIDQDSWPDAQV  2014
              A+ETY  LLA++Q Q +S    + L      S R  E E W DLA +YI    W DA++
Sbjct  550   SAIETYTQLLAVLQVQSKSFGSGKKLHKDCGYSSRSFEQEIWHDLAYLYISLSQWRDAEI  609

Query  2015  CIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKM  2194
             C+ K+  I  YS    H TG L+E +   KEAL A+  +L +DP++VPS+ S A VL ++
Sbjct  610   CLSKSAAISSYSAVRNHATGVLYERKGLLKEALKAYRNALDMDPNHVPSLTSAAGVLRQL  669

Query  2195  GSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKME  2302
             GSQ++ I +S+LMNALR++     AW++LG L K E
Sbjct  670   GSQSIAIIKSMLMNALRVDRMNPSAWYNLGLLHKAE  705



>gb|KHN05875.1| Tetratricopeptide repeat protein 7A [Glycine soja]
Length=714

 Score =   503 bits (1296),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 302/697 (43%), Positives = 440/697 (63%), Gaps = 24/697 (3%)
 Frame = +2

Query  323   ATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGN  502
             A +DFSAS    +      ++ + +   ++E ES+L+E+  LNYEEARALLGR EYQ+GN
Sbjct  29    AIKDFSAS---ENSCLAEQFDKKPDTGNIEEAESSLRESGILNYEEARALLGRYEYQKGN  85

Query  503   FDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILL  682
               AAL VF+GIDI  ++P++  A++     RK             MS+HSV LLLEA+ L
Sbjct  86    IVAALHVFEGIDIGVVTPKIKIALSRSRERRKRHSQNH---AEPQMSIHSVGLLLEAVFL  142

Query  683   KSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQ  862
             K+KSL  L R ++AA+ CK ILDIV+S+ P GM +  G +CKLQE  +KA+E LP+LW  
Sbjct  143   KAKSLQVLERFKEAAQSCKVILDIVESSLPEGMPDNFGAECKLQETLNKAVELLPELWKL  202

Query  863   EGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSP---RFKIWCSTP  1033
                  E++ SYRRAL+  WNLDA+ +A +QK+  + LL++G E   +P   R ++  S  
Sbjct  203   ADCPRESILSYRRALLHHWNLDAETIAKIQKEFVVFLLYSGGEA--TPPNLRSQMDGSFV  260

Query  1034  PKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKT  1213
             P+NN+EEAILLL +L+ K+    +EWD  ++DHL+FAL+V G+  +LA+ +E++LP    
Sbjct  261   PRNNIEEAILLLMILLRKVSLNRIEWDPSILDHLSFALSVSGDLTALANQLEELLPATIH  320

Query  1214  RAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREG  1393
             R+ER+Y LALCY  AG++  AL+LLRK+  S E +H  H+P LL+ +K+C ++   + EG
Sbjct  321   RSERYYALALCYYGAGKDLVALDLLRKLLRSREDQH--HVPGLLMASKICCENSTLAEEG  378

Query  1394  ISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAML  1573
             +SFA+  + +   +   L + A  FLGV     +K++ SDSER   Q+++L++L  A  +
Sbjct  379   VSFAKRVLQNLDGRCNQLENHANFFLGVSLSAHSKLAASDSERLKRQSEALHALETAGRM  438

Query  1574  CKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAE  1753
                +   ++ L LEYA QR L  AF  A  + ++  GS  KGW LLA I+SA+++F DAE
Sbjct  439   --RNPLVLYHLSLEYAEQRKLDAAFYYAKCFLKLEGGSNVKGWLLLARILSAQKQFLDAE  496

Query  1754  AIVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQS-GMDHEVL  1930
             +IV+ ALD+TG+ DQ   L+ KA LQIA+     A+ETY  LLA++Q Q +  G   ++ 
Sbjct  497   SIVNTALDQTGKWDQGDLLRTKAKLQIAQGQLRNAIETYTQLLAVLQIQSKGFGSGKKLY  556

Query  1931  SD-----RKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQE  2095
              D     R LEVE W D+A +YI    W DA+VC+ K++ I   S    H  G ++EA+ 
Sbjct  557   KDNRDRARNLEVEIWHDIAYVYISLLQWHDAEVCLSKSEAIKPLSASRCHAIGIVYEAKG  616

Query  2096  RCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWF  2275
             + KEAL AF  +L IDP +V SI+STA VL +  +++ P  +S LM+ALR +     AW+
Sbjct  617   QYKEALKAFGDALDIDPGHVLSIISTAVVLKRCSNKSNPAVKSFLMDALRHDRFNASAWY  676

Query  2276  SLGKLSKMEG---SaqqaadffqaaHELKLSTPVQSF  2377
             +LG L K EG   S  +AA+ FQAAH L+ S PV+ F
Sbjct  677   NLGLLHKAEGTASSLVEAAECFQAAHFLEESAPVEPF  713



>ref|XP_006446844.1| hypothetical protein CICLE_v10014459mg [Citrus clementina]
 gb|ESR60084.1| hypothetical protein CICLE_v10014459mg [Citrus clementina]
Length=698

 Score =   503 bits (1295),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 306/675 (45%), Positives = 431/675 (64%), Gaps = 13/675 (2%)
 Frame = +2

Query  371   TADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTL  550
              A+ E++ +E  + E ES+L+E LSLN+EEARALLGRLEYQRGN + AL+VF GID+   
Sbjct  27    AAEVEAKLDEGNIQEAESSLREGLSLNFEEARALLGRLEYQRGNVEGALRVFDGIDLHAA  86

Query  551   SPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAAR  730
               R+  + +E++  +K R      V    +S H+ SL+LEAI LK+KSL  LGR+ +AA 
Sbjct  87    IQRLQPSFSEKSASKKCRSRSDSHVS---VSQHAASLVLEAIYLKAKSLQKLGRLTEAAN  143

Query  731   ECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALV  910
             ECK++LD V+  F  G+ +    D +LQE   +A+E LP+LW Q G   +A+ +YRRA++
Sbjct  144   ECKSVLDAVERIFQQGIPD-AQVDNRLQETVSRAVELLPELWKQVGCDHDALAAYRRAVL  202

Query  911   KPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPKNNMEEAILLLFVLMG  1084
               WNLD +  A +QK  A+ LL +GVE    P    ++  S  PKNN+EEAILLL +LM 
Sbjct  203   SQWNLDNECCARIQKRFAVFLLHSGVEAG-PPSLGSQVEGSYAPKNNLEEAILLLLILMK  261

Query  1085  KIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQ  1264
             K   G+++WD  VM+HLT+AL++  +   LA  +E+I+PG+  R++RW  LALCYS+ GQ
Sbjct  262   KYHLGKIKWDPAVMEHLTYALSLCSQTSILAKQLEEIMPGVFLRSDRWNALALCYSAIGQ  321

Query  1265  NETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKH  1444
             N+ ALNLLRK     E  H+  + +LLL AK+CS+D   + EGI +AR A+ +   +++H
Sbjct  322   NDAALNLLRKSLHKHERPHD--LMALLLAAKICSEDCHLAAEGIQYARTALSNAQGKDEH  379

Query  1445  LLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYAT  1624
             L     + LG+C G  AK+S SD ER+  Q+++L SL  A+     +A+  F LG+ YA 
Sbjct  380   LKGVGLRMLGLCLGRHAKVSSSDYERSRLQSEALKSLDGASTFENNNADLFFDLGVHYAE  439

Query  1625  QRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlq  1804
             QRNL+ A   A QY + T GS  KGWKLLAL++SA+QRFS+AE + D ALDET + +Q  
Sbjct  440   QRNLSTALRYAKQYIDATGGSVLKGWKLLALVLSAQQRFSEAEVVTDAALDETTKWEQGP  499

Query  1805  flklkaalqIARQHPNQAMETYRILLAMIQAQRQSGMDHEVLS----DRKLEVEAWLDLA  1972
              L+LKA L+IA+  P  A+ETYR LLA++QAQR+S      LS    D+  E + W  LA
Sbjct  500   ILRLKAKLKIAQALPMDAIETYRYLLALVQAQRKSFGPLRCLSQIEDDKVNEFQVWHGLA  559

Query  1973  RIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDY  2152
              +Y     W D  +C+ KA+ +  YS +  HT G + E   +  EAL A+  +L I+P Y
Sbjct  560   NLYSGLSHWKDVAICMGKARELKAYSAEMLHTEGVMHEGCGQTHEALRAYINALLIEPSY  619

Query  2153  VPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadff  2332
             VP  V    +  K+G +A+P+ARSLL +ALRIEPT   AW+ LG + K +G    AAD F
Sbjct  620   VPCKVLVGSLFSKLGPKALPVARSLLSDALRIEPTNRKAWYYLGLVHKDDGRIADAADCF  679

Query  2333  qaaHELKLSTPVQSF  2377
             QAA  L+ S P++SF
Sbjct  680   QAASMLEESDPIESF  694



>ref|XP_008777058.1| PREDICTED: uncharacterized protein LOC103697066 [Phoenix dactylifera]
Length=700

 Score =   503 bits (1295),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 304/691 (44%), Positives = 435/691 (63%), Gaps = 16/691 (2%)
 Frame = +2

Query  323   ATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGN  502
             + R  S +GL+     TA+ E++ +E  + E ES+L+E LSLNYEEARALLGRLEYQRG+
Sbjct  16    SVRGVSMNGLT---MKTAEVEAKIDEGNIQEAESSLREGLSLNYEEARALLGRLEYQRGD  72

Query  503   FDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILL  682
              ++A +VF GID++    R+    +E+   R+ R     I     +S H+ SL+LEAI L
Sbjct  73    VESAFRVFDGIDLQAAIQRLQPTFSEKPASRRNRPRTRSI---HQVSQHAASLVLEAIYL  129

Query  683   KSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQ  862
             KS SL  LG+  +AARECK++LD V+  F +G+++ + E  KLQE   KA+E LP+LW Q
Sbjct  130   KSMSLQRLGKATEAARECKSVLDAVEKIFQHGIADVLVEQ-KLQETISKAVEVLPELWKQ  188

Query  863   EGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPP  1036
              G   EA+ SYRRAL+  WNLD +  A +QK  A+ LL+ GVE +  P    ++  S  P
Sbjct  189   AGRHQEALASYRRALLSQWNLDEECCARIQKSFAVFLLYGGVEAN-PPSLAAQVEGSFIP  247

Query  1037  KNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTR  1216
             KNN+EE+ILLL +L+ K   G+ EWD  VM+HLTFAL++ G+   L  + E+++PG+  R
Sbjct  248   KNNLEESILLLMILLRKWYLGKTEWDPSVMEHLTFALSLCGQTSVLGRHYEEVMPGIYPR  307

Query  1217  AERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGI  1396
              ERW  LALCYS AGQN +ALNLLRK     E+ ++  + +LL+ AK+CS+D   + EG+
Sbjct  308   CERWCSLALCYSGAGQNRSALNLLRKSLNRHESPND--VMTLLMAAKICSEDCLLASEGV  365

Query  1397  SFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLC  1576
              +AR A+ +  N ++HL S    FLG C G  AKI+ SD ER   Q ++L SL +A  L 
Sbjct  366   EYARRAIANAQNGDEHLKSVGLHFLGTCLGKQAKIASSDHERTRLQVEALKSLDEAIALD  425

Query  1577  KEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEA  1756
                 + +F LGLEYA QRN   A   A ++   T GS +KGW+LLAL++SA+QR+ +AE 
Sbjct  426   CSHPDLIFDLGLEYAEQRNTNAALRYAKEFINATGGSISKGWRLLALVLSAQQRYLEAEV  485

Query  1757  IVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQ----SGMDHE  1924
             + D ALDET + +Q   L++KA L++AR  P  A+  Y  LLA++QAQR+    S    +
Sbjct  486   VTDAALDETSKWEQGPLLRIKAKLKVARSLPMDAIGVYSFLLALVQAQRKTFGSSKNSTQ  545

Query  1925  VLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCK  2104
             V  D+  E E W  LA +Y     W DA+VC++KA+ +  Y+       G+++EA+   K
Sbjct  546   VEDDKVSEFEVWQGLAILYSSLSHWKDAEVCLEKARALKPYTAAILQMEGSMYEARGETK  605

Query  2105  EALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLG  2284
             +AL A+S +L ++ D VP  VS   +L K  S+++P+ARS L++ALR+EPT   AW  LG
Sbjct  606   DALAAYSNALLMELDNVPCKVSIGCLLSKKSSKSLPVARSFLLDALRLEPTNRLAWCYLG  665

Query  2285  KLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
              + + +G    AAD F AA  L+ S PV+ F
Sbjct  666   LVHRDDGRLADAADCFLAASMLEESDPVEGF  696



>ref|XP_002514581.1| o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus 
communis]
 gb|EEF47687.1| o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus 
communis]
Length=701

 Score =   503 bits (1294),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 294/689 (43%), Positives = 434/689 (63%), Gaps = 14/689 (2%)
 Frame = +2

Query  326   TRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNF  505
              R+  A+G+      T + E++ +E  + E ES+L+E LSLN+EEARALLGRLEYQRGN 
Sbjct  18    VREVCANGICMK---TTEVEAKLDEGNIQEAESSLREGLSLNFEEARALLGRLEYQRGNV  74

Query  506   DAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLK  685
             + AL+VF GID++    R+  A +++   +K R           +S H+ SL+LEAI LK
Sbjct  75    EGALRVFDGIDLQAAIERLQPAFSDKQSSKKGRPRSDS---QHAVSQHAASLVLEAIYLK  131

Query  686   SKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQE  865
             +KSL  LGRI DAA+ECK++LD V+  F  G+ +    D +LQ+   +A+E LP+LW Q 
Sbjct  132   AKSLQKLGRINDAAKECKSVLDAVEKIFHQGIPDA-QVDNRLQDTVSQAVELLPELWKQV  190

Query  866   GLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVD-LSPRFKIWCSTPPKN  1042
             G  DEA+++YRRAL+  WNLD +  A +QK  A+ LL +GVE   LS    I  S  PK+
Sbjct  191   GCYDEAMSAYRRALLSQWNLDDECCARIQKGFAVFLLHSGVEAGPLSLAAHIDGSYVPKH  250

Query  1043  NMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAE  1222
             N+EEA+LLL +L+ K   G+ +WDS V++HLTFAL++  +   LA  +E+I+PG+  R +
Sbjct  251   NLEEAVLLLMILIRKSYLGKTKWDSSVVEHLTFALSLCSQTSILAKQLEEIMPGLFHRVD  310

Query  1223  RWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISF  1402
             RW  LALCY  AG+++ A+NLLRK     + E    + +LLL AK+CS+D   + EG+ +
Sbjct  311   RWNTLALCYCGAGKHDVAINLLRK--SLHKHERPDDLMALLLAAKICSEDSHLAAEGVGY  368

Query  1403  ARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKE  1582
             A+ A+ ++   ++HL   A + LG+C G  AK+S SD ER+  Q+++L SL  A      
Sbjct  369   AQRAISNSQGIDEHLKGVAIRMLGLCLGRQAKVSSSDFERSRLQSEALKSLDGAITFEPN  428

Query  1583  DAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIV  1762
             + + VF LG++YA QRNL  A   A Q+ + T GS  KGW+LLAL++SA+QRF +AE + 
Sbjct  429   NPDLVFDLGVQYAEQRNLNAALRFAKQFIDATGGSILKGWRLLALVLSAQQRFPEAEVVT  488

Query  1763  DLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQS----GMDHEVL  1930
             D ALDET + +Q   L+LKA L+I++  P  A+ETYR LLA++QA+R+S        +  
Sbjct  489   DAALDETAKWEQGPLLRLKAKLKISQSLPMDAVETYRYLLALVQARRKSFGPLRSSSQAE  548

Query  1931  SDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEA  2110
              ++  E E W  LA +Y     W D +VC+ KA+ +  YS +  +T G + E + + +EA
Sbjct  549   DEKVNEFEVWQGLAGLYSRLSHWKDVEVCLGKARELKPYSAELLYTEGIMCEGRGQVQEA  608

Query  2111  LVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKL  2290
             +  +  +L +DP YVP  +    +L K+G  A+P+ARS+L +ALRIEPT   AW+ LG +
Sbjct  609   MCCYINALLLDPSYVPCKILIGALLSKIGPNALPVARSILSDALRIEPTNRMAWYYLGMV  668

Query  2291  SKMEGSaqqaadffqaaHELKLSTPVQSF  2377
              + +G    A D F AA  L+ S P++SF
Sbjct  669   HRDDGRMADATDCFLAASMLEESDPIESF  697



>ref|XP_007048890.1| Tetratricopeptide repeat (TPR)-containing protein isoform 1 [Theobroma 
cacao]
 gb|EOX93047.1| Tetratricopeptide repeat (TPR)-containing protein isoform 1 [Theobroma 
cacao]
Length=710

 Score =   503 bits (1295),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 293/703 (42%), Positives = 437/703 (62%), Gaps = 24/703 (3%)
 Frame = +2

Query  320   LAT-RDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQR  496
             LAT R+  A+G+      T D E++ +E  + E ES+L+E LSLN+EEARALLGRLEYQR
Sbjct  11    LATVRELCANGVCMR---TTDVEAKLDEGNIHEAESSLREGLSLNFEEARALLGRLEYQR  67

Query  497   GNFDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVV----------SGVMSL  646
             GN + AL+VF GID++    R+  ++ E +           I               +S 
Sbjct  68    GNVEGALRVFDGIDLQAAIQRLQPSVNENSNSSSFSSYSSSISSHKKGRANRDSQTAVSQ  127

Query  647   HSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFH  826
             H+ SL+LE + LK+KSL  LGR  +AA++C  +LD V   FP G+  GV  + +LQE   
Sbjct  128   HAASLVLEGVYLKAKSLQKLGRFTEAAQDCTNVLDAVGRIFPQGIP-GVQVENRLQETVS  186

Query  827   KALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSP  1006
             +A+E LP+LW Q G   EA+++YRR L+  WNLD    A +QK  A+ LL++G+E    P
Sbjct  187   QAVELLPELWKQAGNYQEAMSAYRRGLLHLWNLDNDCCARIQKAFAVFLLYSGLEAG-PP  245

Query  1007  RF--KIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLAD  1180
                 ++  +  PKNN+EEAILLL VL+ KI QG ++WD  VMDHLT+AL++  +   L+ 
Sbjct  246   SLGAQVDGAYVPKNNLEEAILLLMVLVQKIHQGIIQWDPSVMDHLTYALSLCSQTPVLSK  305

Query  1181  NVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKL  1360
              +E++ PG+  R +RW  LALC S+AGQN+ ALNLLRK     + E    + +LLL AK+
Sbjct  306   QLEELKPGVVQRIDRWNTLALCCSAAGQNKYALNLLRK--SLHKHERPDDLTALLLAAKI  363

Query  1361  CSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQ  1540
             CS+D   + +G+ +A+ A+++    + HL     + LG+C    AKI+F D+ER+  Q++
Sbjct  364   CSEDSHLAADGVGYAQRAINNAQGVDGHLKGVGFRMLGLCLRQLAKIAFKDTERSHLQSE  423

Query  1541  SLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALI  1720
             +L  L  A    +++A+ +F LG+++A QRNL  A   A +Y ++T GS  KGW+LLAL+
Sbjct  424   ALLFLDAAIFFEQDNADIIFELGVQHAEQRNLNAALHYAKKYIDVTGGSVLKGWRLLALV  483

Query  1721  VSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQ  1900
             +SA+ RFS+A  + D ALDET + +Q   L+LKA L+I++  P  A+ETYR LLA++QAQ
Sbjct  484   LSAQHRFSEAAVVTDAALDETAKWEQGPLLRLKAKLEISQSRPMDAIETYRYLLALVQAQ  543

Query  1901  RQS----GMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHT  2068
             R+S     +D +V  D+  E E W  LA +Y     W D ++C+ KA+ +  YS +   T
Sbjct  544   RKSFGPMRIDSQVGDDKVNEFEVWHGLANLYSSLSHWKDVEICLRKAREMKQYSAKLLQT  603

Query  2069  TGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRI  2248
              G + + +   +EA+ A+  ++ ++P Y P  V  + +L KMGS +VP+AR+LL +ALRI
Sbjct  604   EGVMCQERGEIQEAMSAYINAILLEPSYAPCKVLISAMLSKMGSNSVPVARTLLSDALRI  663

Query  2249  EPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             EPT H AW+ LG + K +G   +A +  QAA+ L+ S PV+SF
Sbjct  664   EPTNHKAWYYLGMIQKDDGRLTEAIESLQAAYILEESDPVESF  706



>ref|XP_003516493.1| PREDICTED: tetratricopeptide repeat protein 7A-like isoform X1 
[Glycine max]
 ref|XP_006573484.1| PREDICTED: tetratricopeptide repeat protein 7A-like isoform X2 
[Glycine max]
Length=694

 Score =   502 bits (1293),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 299/695 (43%), Positives = 434/695 (62%), Gaps = 22/695 (3%)
 Frame = +2

Query  320   LATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRG  499
             ++ R+F A+G   SR  T++ E++ ++  + E E  L+E LSLN+EEARALLG+LEYQRG
Sbjct  9     MSFREFHANG---SRMVTSEVEAKLDQGNIQEAEEALREGLSLNFEEARALLGKLEYQRG  65

Query  500   NFDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAIL  679
             N + AL+VF GID++    R+  + +E+T  +K R           +S H+ SL+LEAI 
Sbjct  66    NVEGALRVFDGIDLQAAIQRLQPSFSEKTPVKKGRTRTES---PSSVSQHAASLVLEAIY  122

Query  680   LKSKSLAGLGRIRDAARECKAILDIVDSAF----PNGMSEGVGEDCKLQEMFHKALEFLP  847
             LKSKSL  LG+  +AA +C+ ILD V+  F    P+     +  D +LQ +   A+E LP
Sbjct  123   LKSKSLQKLGKFTEAANDCRRILDAVEKIFYLDNPD-----IQVDNRLQGIVSHAVELLP  177

Query  848   KLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDL-SPRFKIWC  1024
             +LW Q G  DEA+++YRRAL+  WNL     A +QK   I LL++GVE    S   +I  
Sbjct  178   ELWKQAGCYDEAISAYRRALLGQWNLHNDFCARIQKSFVIFLLYSGVEASPPSLAVQIDG  237

Query  1025  STPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPG  1204
             S  PKNN+EEAILLL   +     G+++WD  VM+HLTFAL++ G    LA  +E++ PG
Sbjct  238   SYVPKNNLEEAILLLMNFLKDFCLGKMKWDPSVMEHLTFALSICGGTSILAKQLEELRPG  297

Query  1205  MKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKS  1384
             +  R + W  LALCYS AGQN++ALNLLRK     E  ++  + SLLL AK+CS+DP  +
Sbjct  298   VYHRIDCWNTLALCYSGAGQNDSALNLLRKSLHKHERPND--LTSLLLAAKICSEDPYLA  355

Query  1385  REGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQA  1564
              EG++ A+ A+ +    N+HL   A + LG+C G  AK++ SD ER+  Q+++L SL  A
Sbjct  356   AEGVNHAQRAISNAHGPNEHLKGVALRMLGLCLGKQAKVASSDFERSHLQSKALESLVAA  415

Query  1565  AMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFS  1744
               L   +++ +F L ++YA  RNL  A  +A  +   T GS +K W+LLALI+SA+QRFS
Sbjct  416   IRLEPNNSDLIFELAVQYAEHRNLPAALRSARHFFNKTGGSVSKSWRLLALILSAQQRFS  475

Query  1745  DAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQS----G  1912
             +AE + D ALD+T + +Q   L+LKA L I++  P  A+ETYR LLA++QAQ++S     
Sbjct  476   EAEVVTDAALDQTARWEQGPLLRLKAKLMISQSRPMDAIETYRYLLALVQAQKKSFGPLQ  535

Query  1913  MDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQ  2092
             +  +V  D+  E + W  LA +Y     W DA++C+ K + +  YS    HT G LFE +
Sbjct  536   ISSKVEEDKVNEFDTWHGLANLYASLSHWKDAEICLQKVRELKEYSAALMHTEGVLFEGR  595

Query  2093  ERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAW  2272
              + +EAL A   ++ ++P+YVP  +S   ++ KMGS+ + +ARS L +ALRIEPT   AW
Sbjct  596   GQNEEALCATINAILLEPNYVPCKISMGALIQKMGSKYLAVARSSLSDALRIEPTNRKAW  655

Query  2273  FSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             + LG L K EG    AA+ FQAA  L+ S P++SF
Sbjct  656   YYLGLLHKHEGRISDAAECFQAASMLEESDPIESF  690



>ref|XP_006664108.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Oryza brachyantha]
Length=717

 Score =   503 bits (1294),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 297/671 (44%), Positives = 436/671 (65%), Gaps = 12/671 (2%)
 Frame = +2

Query  383   ESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRM  562
             E++ ++  + E ES+L+E LSLNYEEARALLGRLEYQRGN +AAL+VF GID++    R 
Sbjct  50    EAKVDDGNIQEAESSLREGLSLNYEEARALLGRLEYQRGNVEAALRVFDGIDLQAAIQRF  109

Query  563   SKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKA  742
               +++E+   ++    + +   SG  S H+ SL+LEAI LKS SL  LG+  +AA++C++
Sbjct  110   QPSLSEKPPSKRSNKLRSDSSNSG--SQHAASLVLEAIYLKSMSLQKLGKAMEAAQQCRS  167

Query  743   ILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWN  922
             +LD V+S F  G+ + + E  KLQE   K++E LP+LW Q G   EA+ SYRRAL+  WN
Sbjct  168   VLDAVESIFQRGIPDVMVEQ-KLQETVSKSVELLPELWKQAGACQEALASYRRALLSQWN  226

Query  923   LDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPKNNMEEAILLLFVLMGKIQQ  1096
             LD      +QK  A+ LL+ GVE   SP    +   S  PKNN+EEAILLL +++ K   
Sbjct  227   LDDDCCTRIQKRFAVFLLYGGVEAT-SPSLASQTEGSYVPKNNLEEAILLLMIILKKWYL  285

Query  1097  GEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETA  1276
             G+  WD  VM+HLTFAL++ G+   LA ++E++LPG+  R ERWY LALC  ++  NE A
Sbjct  286   GKTHWDPSVMEHLTFALSLCGQTSILAKHLEEVLPGIYHRTERWYSLALCNYASSHNEAA  345

Query  1277  LNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQ  1456
             LNLLRK+   +E+  +  I +LLL AKLCS D   + EG+ +AR A+ +  + + HL S 
Sbjct  346   LNLLRKLLNKNESPGD--IMALLLAAKLCSSDYSLASEGVEYARRAVTNAESLDGHLKST  403

Query  1457  ARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNL  1636
             A  FLG C    ++I+ SD +R+  QT+SL SL++A  L + + E ++ +G+EYA QRN+
Sbjct  404   ALHFLGSCLAKKSRIATSDYQRSLLQTESLKSLSEAISLDRHNPELIYDMGIEYAEQRNM  463

Query  1637  TPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflkl  1816
               A   A ++ + T GS +KGW+LL+L++SA+QR+S+AE + D ALDET + +Q   L++
Sbjct  464   HAALKCAKEFIDATGGSVSKGWRLLSLVLSAQQRYSEAEVVTDAALDETTKWEQGPLLRI  523

Query  1817  kaalqIARQHPNQAMETYRILLAMIQAQRQS----GMDHEVLSDRKLEVEAWLDLARIYI  1984
             KA L++A+  P +A+E YR LLA++QAQR++        E + D+  E E W  LA +Y 
Sbjct  524   KAKLKVAQSLPMEAVEAYRALLALVQAQRKAYGTVKNGTEEVDDKVSEFEVWQGLANLYA  583

Query  1985  DQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSI  2164
                 W DA++C+ KAKT+  +S  + H  G   E +E+ ++AL A+  ++S + ++VPS 
Sbjct  584   SLSYWRDAEICLQKAKTLKSFSATTLHAEGYTHEVREQVQDALAAYFNAVSTELEHVPSK  643

Query  2165  VSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaH  2344
             VS   +L K G + +P+ARS L +ALR+EPT   AWF LGK+ K +G    AAD FQAA 
Sbjct  644   VSIGALLSKQGPKYLPVARSFLSDALRLEPTNRMAWFYLGKVHKHDGRLADAADCFQAAS  703

Query  2345  ELKLSTPVQSF  2377
              L+ S P++SF
Sbjct  704   MLEESDPIESF  714



>ref|XP_004296388.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Fragaria 
vesca subsp. vesca]
Length=731

 Score =   503 bits (1294),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 303/698 (43%), Positives = 450/698 (64%), Gaps = 24/698 (3%)
 Frame = +2

Query  236   RRRKML-CACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVD  412
             R +KML C  SGEQF+ E+   +  S   LATRD+SASG SS RTG  + E++ + + ++
Sbjct  17    RLQKMLKCMRSGEQFRVEDVAHSSDS---LATRDYSASGYSS-RTG--EVEAKVDNSNIE  70

Query  413   EVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrp  592
             E ES+L+E+  LNYEEARALLGRLEYQ+GN  AALQVF+GIDI  + P++  +I+ R   
Sbjct  71    EAESSLRESGYLNYEEARALLGRLEYQKGNTQAALQVFEGIDIGAVIPKIKVSISRRCES  130

Query  593   rkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFP  772
              + R     +     MS+H+VSLLLEA+LLK+KSL GLGR  +AA+ CK ILD V++A P
Sbjct  131   NRRRSQSDAV---PPMSMHAVSLLLEAVLLKAKSLQGLGRFGEAAQSCKIILDTVETALP  187

Query  773   NGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQ  952
              G+      DCKLQE   KA+E LP+LW+  G   EA+ SYR+AL+  W+LD +  + ++
Sbjct  188   EGLPLNFASDCKLQETVGKAVELLPELWILAGDPQEAILSYRQALLYQWSLDIESTSKIE  247

Query  953   KDLAIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEV  1123
             K+ A+ LL++G   D SP   R ++  S  P+NN+EEA+LLL +L+ K   G + WD  +
Sbjct  248   KEFAVFLLYSG--CDASPPNLRSQMESSFVPRNNIEEAVLLLLILLRKFVVGRIGWDPSI  305

Query  1124  MDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSG  1303
             ++HL+FAL++ G+  +LA ++E+++PG+  R ER++ LALCY   G+N  ALNLLR +  
Sbjct  306   VEHLSFALSISGKLSALAHHIEELIPGIMGRKERYFTLALCYYGEGENSVALNLLRNILN  365

Query  1304  SSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCY  1483
               E+     I  LLL +K+CS++     +GI FA  A+     +   LLS A   LGV  
Sbjct  366   DRESTD--CILELLLASKICSENLVCIEDGIKFACKALSGLDGKCYPLLSIANCLLGVSL  423

Query  1484  GNAAKISFSDSERNSYQTQSLNSLTQAAMLCKE-DAETVFSLGLEYATQRNLTPAFDNAL  1660
                ++   SDSER   Q+++L +L  A  + +E +   VF L LE+A QR L  A   A 
Sbjct  424   SVKSRSVSSDSERILKQSEALQALETAETIMRERNPYIVFHLCLEHAEQRKLDVALSYAK  483

Query  1661  QYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIAR  1840
             +  ++ AGS+ K + LLA I+SA++RF DAE +++ ALD+TG+ DQ + L+ KA LQIA+
Sbjct  484   ELLKLEAGSSIKAYTLLARILSAQKRFIDAETVINAALDQTGKWDQGELLRTKAKLQIAQ  543

Query  1841  QHPNQAMETYRILLAMIQAQRQS-GMDHEVLSDRK-----LEVEAWLDLARIYIDQDSWP  2002
                  A++TY  LLA++Q + ++ G++  +L  R+     LE+E W DLA +Y +   W 
Sbjct  544   GQLKNAIDTYTHLLAVLQVRSKNFGVEKRLLKSRRNHNRSLEMETWHDLANLYTNLSQWR  603

Query  2003  DAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEV  2182
             DA+VC+ K++ I+ +S   WH TG L+EA+   +EAL +F  +L ++P +VPS++STA +
Sbjct  604   DAEVCLSKSQAINPHSASRWHCTGLLYEAKGLHQEALKSFRKALDVEPTHVPSLISTACI  663

Query  2183  LMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSK  2296
             L K G Q+ P+ RS LM+ALR++ +   AW++LG L K
Sbjct  664   LRKFGGQSFPVVRSFLMDALRLDRSNPSAWYNLGLLYK  701



>ref|XP_004512392.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X1 
[Cicer arietinum]
 ref|XP_004512393.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X2 
[Cicer arietinum]
Length=695

 Score =   501 bits (1290),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 302/690 (44%), Positives = 431/690 (62%), Gaps = 14/690 (2%)
 Frame = +2

Query  323   ATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGN  502
             + R+  A+G   SR   ++ E++ +E  + E ES L+E LSLN+EEARALLG+LEYQRGN
Sbjct  11    SVREVHANG---SRMAASEVEAKLDEGNIQEAESALREGLSLNFEEARALLGKLEYQRGN  67

Query  503   FDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILL  682
              + AL+VF GID+     R+  + +E+   +K R           +S H+ SL+LEAI L
Sbjct  68    VEGALRVFDGIDLHAAIQRLQPSFSEKPPVKKSRPRTES---PSSVSQHAASLVLEAIYL  124

Query  683   KSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQ  862
             K+KS   LG+  +AA +CK ILD V+  F  G+ +    D KLQE+   A+E LP+LW Q
Sbjct  125   KAKSQQKLGKFAEAANDCKRILDAVEKIFYQGILD-FQVDSKLQEIVSHAVELLPELWKQ  183

Query  863   EGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDL-SPRFKIWCSTPPK  1039
              G  DEA+++YRRAL+  WNLD    + +QK   + LL++GVE    S   +I  S  PK
Sbjct  184   GGYYDEAISAYRRALLSQWNLDNDCCSRIQKSFVVFLLYSGVEASPPSLAVQIEGSYVPK  243

Query  1040  NNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRA  1219
             NN+EEAILLL VL+ K   G+++WD  +M+HLTFAL+V  +   LA   E ++PG+  R 
Sbjct  244   NNLEEAILLLMVLIRKFCFGKIKWDPSIMEHLTFALSVCSQTSVLAKQFEDLVPGVYHRI  303

Query  1220  ERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGIS  1399
             +RW  LALC+  AGQN +ALNLLRK     + E    + SLLL AK+CS+DP  + EG+ 
Sbjct  304   DRWNSLALCHCGAGQNVSALNLLRK--SLHKHERPDDLTSLLLAAKICSEDPYLAAEGVC  361

Query  1400  FARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCK  1579
              A+ A+ +    N+HL   A + LG+C G  AK++ SD ER+  Q+++L SL QA  L +
Sbjct  362   HAQRAIINAHGPNEHLKGVALRMLGLCLGKQAKVASSDFERSRLQSKALESLEQAVRLER  421

Query  1580  EDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAI  1759
              +++ +F L ++YA  RNL  A  +A  +   T GS  K W LLALI+SA+QRFS+AE +
Sbjct  422   NNSDLIFELAVQYAKHRNLVAALRSARHFFHETGGSIVKSWILLALILSAQQRFSEAEVV  481

Query  1760  VDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQSGMDHEVLS--  1933
              D ALD+  + +Q   LKLKA L+I++  P  A+ETYR LLA++QAQR+S     V S  
Sbjct  482   TDAALDQIARWEQGPLLKLKAKLKISQSKPMDAIETYRHLLALVQAQRKSSGSFRVGSKI  541

Query  1934  --DRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKE  2107
               D+  E + W  LA +Y     W DA++C+ KAK +  YS     T G LFE + + +E
Sbjct  542   EDDKVNEFDIWHGLANLYASLSHWKDAEICLQKAKELKEYSAAILATEGILFEGRGKNQE  601

Query  2108  ALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGK  2287
             AL A   ++ ++P++VPS +  + ++ KMGS+A+  ARS+L +ALRIEPT   AW+ LG 
Sbjct  602   ALNATINAILLEPNHVPSKILMSALVQKMGSKALSAARSMLSDALRIEPTNRMAWYYLGL  661

Query  2288  LSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             + K +G    AAD FQAA  L+ S P++SF
Sbjct  662   VHKHDGRVGDAADCFQAASMLEESDPIESF  691



>gb|KHN47639.1| Tetratricopeptide repeat protein 7B [Glycine soja]
Length=695

 Score =   501 bits (1289),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 296/692 (43%), Positives = 433/692 (63%), Gaps = 15/692 (2%)
 Frame = +2

Query  320   LATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRG  499
             +  R+F A+G   S     + E++ +E  + E ES L+E LSLN+EEARALLG+LEYQRG
Sbjct  9     VTIREFCANG---SCMEAKELEAKLDEGNIQEAESALREGLSLNFEEARALLGKLEYQRG  65

Query  500   NFDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAIL  679
             N + AL+VF GID++    R+  +++E+T  +K             +S H+ +L+LEAI 
Sbjct  66    NVEGALRVFDGIDLEAAIQRLQSSLSEKTPVKKGPTRSES---PSSVSQHAATLVLEAIY  122

Query  680   LKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWV  859
             LK+KSL  L +  +AA+ECK +LD V+  F  G+ +    D KLQE+   A+E LP+LW 
Sbjct  123   LKAKSLQKLDKFTEAAKECKRVLDAVEKIFGQGIPD-TQVDNKLQEIVSHAVELLPELWK  181

Query  860   QEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDL-SPRFKIWCSTPP  1036
             Q G  +EA+++YR AL+  WNLD    A +Q   A+ +L++GVE    S   +I  S  P
Sbjct  182   QTGCYNEALSAYRNALLSQWNLDNDCCARIQMAFAVFMLYSGVEASPPSLAVQIDGSYVP  241

Query  1037  KNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTR  1216
             KNN+EEAILLL +L+ K   G++ WD  +M+HLTFAL+  G+   LA   E++ PG+  R
Sbjct  242   KNNLEEAILLLMILLRKFSLGKINWDPSIMEHLTFALSACGQTSILAKQFEELAPGVYHR  301

Query  1217  AERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGI  1396
              +RW FLALC S AG+NE+ALNLLR      + E    + SLLL AK+CS+DP  + EG 
Sbjct  302   IDRWNFLALCNSGAGENESALNLLRM--SLHKHERPDDLISLLLAAKICSEDPHHAAEGA  359

Query  1397  SFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLC  1576
              +A+ A++     + HL     + LG+C G  AK+S SD ER+  Q+++L SL +A  L 
Sbjct  360   GYAQRAINIAQGLDGHLKGVGLRMLGLCLGKQAKVSSSDFERSMLQSKALQSLEEAVRLE  419

Query  1577  KEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEA  1756
             + + + +F L ++YA  RNLT A   A Q+ + T GS  KGW+LLAL++SA++RFS+AE 
Sbjct  420   RNNYDLIFELAIQYAEHRNLTAALSCAKQFFDKTGGSKLKGWRLLALVLSAQKRFSEAEV  479

Query  1757  IVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQSG----MDHE  1924
             + D ALDET + +Q   L+LKA L+I++  P  A+E YR LLA++QAQR+S     +  +
Sbjct  480   VTDAALDETAKWEQGPLLRLKAKLKISQLRPMDAIEIYRYLLALVQAQRKSSGPLKLSSQ  539

Query  1925  VLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGA-LFEAQERC  2101
             V      E E W  LA +Y     W DA++C+ KA+ +  YS  + HT G+ +F+ +   
Sbjct  540   VEDYTINEFEVWHGLANLYASLSHWKDAEICLQKARELKEYSAATIHTEGSIMFDGRGEY  599

Query  2102  KEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSL  2281
             +EAL+    ++  +P+YVPS +  A +++KMG +A P+ARSLL +ALRIEPT   AW+ L
Sbjct  600   QEALIGTFNAVLFEPNYVPSKILMASLILKMGFKASPVARSLLSDALRIEPTNRMAWYYL  659

Query  2282  GKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             G   K +G    AAD FQAA  L+ S P+++F
Sbjct  660   GLTHKADGRLVDAADCFQAASMLEESDPIENF  691



>gb|KHN11830.1| Tetratricopeptide repeat protein 7A [Glycine soja]
Length=700

 Score =   501 bits (1289),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 301/697 (43%), Positives = 438/697 (63%), Gaps = 20/697 (3%)
 Frame = +2

Query  320   LATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRG  499
             ++ R+F A+G   SR  T++ E++ +E  + E E  L+E LSLN+EEARALLG+LEYQRG
Sbjct  9     MSYREFHANG---SRMVTSEVEAKLDEGNIQEAEDALREGLSLNFEEARALLGKLEYQRG  65

Query  500   NFDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAIL  679
             N + AL+VF GID++    R+  + +E+T  +K R           +S H+ SL+LEAI 
Sbjct  66    NVEGALRVFDGIDLQAAIQRLQPSFSEKTPVKKGRTRTES---PSSVSQHAASLVLEAIY  122

Query  680   LKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWV  859
             LKSKSL  LG+  +AA +CK ILD V+  F  G+ + +  D +LQE+   A+E LP+LW 
Sbjct  123   LKSKSLQKLGKFTEAANDCKRILDAVEKIFYLGVPD-IQVDNRLQEIVSHAVELLPELWK  181

Query  860   QEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDL-SPRFKIWCSTPP  1036
             Q G  DEA+++YRRAL+  WNLD    A +QK   I LL++GVE    S   +I  S  P
Sbjct  182   QAGCYDEAISAYRRALLSQWNLDNDCCARIQKSFVIFLLYSGVETSPPSLAVQIDGSYVP  241

Query  1037  KNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTR  1216
             KNN+EEAILLL   +     G+++WD  VM+HLTFAL++      LA  +E++ PG+  R
Sbjct  242   KNNLEEAILLLMNFLKNFCLGKMKWDPSVMEHLTFALSICSGTTVLAKQLEELNPGVYHR  301

Query  1217  AERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGI  1396
              + W  LALCYS AGQN++ALNLLRK     E  ++  + SLLL A++CS+DP  + EG+
Sbjct  302   IDCWNTLALCYSGAGQNDSALNLLRKSLHKHERPND--LTSLLLAARICSEDPYLAAEGV  359

Query  1397  SFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLC  1576
             + A+ A+ +    N+HL   A + LG+C G  AK++ SD ER+  Q+++L SL  A  L 
Sbjct  360   NHAQRAISNAHGPNEHLKGVALRMLGLCLGKQAKVASSDFERSRLQSKALESLVAAIRLE  419

Query  1577  KEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEA  1756
               +++ +F L ++YA  RNL  A  +A  +   T GS +K W+LLALI+SA+QRFS+AE 
Sbjct  420   PNNSDLIFELAVQYAEHRNLPAALRSARHFFNKTGGSVSKAWRLLALILSAQQRFSEAEV  479

Query  1757  IVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQS----GMDHE  1924
             + D ALD+T + +Q   L+LKA L+I++  P  A+ETY+ LLA++QAQ++S     +  +
Sbjct  480   VTDAALDQTSRWEQGPLLRLKAKLKISQSRPMDAIETYQYLLALVQAQKKSFGSLQISSK  539

Query  1925  VLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTG------ALFE  2086
             V  D+  E + W  LA +Y     W DA++C+ KA+ +  YS    HT G       LFE
Sbjct  540   VEYDKVNEFDIWHGLANLYASLSHWKDAEICLQKARELKEYSAALMHTEGKTKSFCVLFE  599

Query  2087  AQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHD  2266
              + + +EAL A   ++ ++P+YVP  +    +  K+G++ + IARSLL +ALRIEPT   
Sbjct  600   GRGQNEEALCATINAILLEPNYVPCKILMGALFQKLGTKHLAIARSLLSDALRIEPTNRK  659

Query  2267  AWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             AW++LG L K EG    AAD FQAA  L+ S P++SF
Sbjct  660   AWYNLGLLHKHEGRISDAADCFQAASMLEESDPIESF  696



>ref|XP_008447403.1| PREDICTED: tetratricopeptide repeat protein 7A isoform X1 [Cucumis 
melo]
Length=732

 Score =   501 bits (1291),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 304/713 (43%), Positives = 438/713 (61%), Gaps = 24/713 (3%)
 Frame = +2

Query  200   IKLAFLTGRAHCRRRKMLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTAD  379
             IK    TG+    R+ M C CSGE+            P S +  + S SG  SSRTG  +
Sbjct  7     IKRGRSTGKGKNIRKIMKCLCSGEK-----KAGDNMIPASPSAFENSGSG-RSSRTG--E  58

Query  380   WESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPR  559
               ++ E   ++E ES+L+E+  LNYEEARALLGR EYQ+GN +AAL VF+GIDI  ++  
Sbjct  59    IINKPEIGNIEEAESSLRESGCLNYEEARALLGRYEYQKGNIEAALHVFEGIDITAIT--  116

Query  560   MSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECK  739
              SK +    R       + +   +  MS+H+VSLLLEAILLK+KSL GLGR  +AA+ CK
Sbjct  117   -SKIMISIARRGDRPRKRSQNFTAPPMSMHAVSLLLEAILLKAKSLEGLGRFGEAAQSCK  175

Query  740   AILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPW  919
              ILDI++S+FP G+ E  G DCKLQE   KA+E LP+LW       EA+ SYRRAL+  W
Sbjct  176   VILDILESSFPQGLPENFGADCKLQETVTKAVELLPELWKLADASQEAILSYRRALLHQW  235

Query  920   NLDAKRLASMQKDLAIALLFAGVEV-DLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQ  1096
             NLD    A +QK+ AI LL +G E    + R ++  S  PKNN+EEAILLL +L+ K+  
Sbjct  236   NLDVGITARIQKEFAIFLLHSGSEACPPNLRSQMDSSFVPKNNIEEAILLLMILLRKVVL  295

Query  1097  GEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETA  1276
               ++WD  ++DHL+FAL + G+  +LA  +E++ PG+  R E ++ LALCY  AG+N TA
Sbjct  296   KRIDWDPSILDHLSFALIISGDTRALAGQIEELPPGILHRQELYHALALCYYGAGENLTA  355

Query  1277  LNLLRKVSGSSEAEHEPH-IPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLS  1453
             LNLLRK+ GS E   +P  +P+LL+ +K+C ++   + EG SFA  A+ +  ++   L  
Sbjct  356   LNLLRKLLGSHE---DPKSLPALLMASKICGENCDLAEEGTSFAHRALQNLDHECDQLEG  412

Query  1454  QARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCK-EDAETVFSLGLEYATQR  1630
              A   LGV     +K + +DSE+ + Q++++ +L  A    +  D   ++ L LEYA +R
Sbjct  413   VANCLLGVSLSVYSKSATADSEKFTRQSEAIEALEAARKKTRMTDPNVLYHLSLEYANER  472

Query  1631  NLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqfl  1810
              L  A   A +  ++  GS  + W LLA I+SA++R++D+++I++ ALD+TG+ DQ + L
Sbjct  473   KLDSALHYAKKCLKLEGGSNIRTWLLLARILSAQKRYTDSKSIINAALDQTGKWDQAELL  532

Query  1811  klkaalqIARQHPNQAMETYRILLAMIQAQRQS---GMDHEVLSDR----KLEVEAWLDL  1969
             + KA + IA+     A+ETY  LLA  Q Q +S   G    + S R    +L++E W DL
Sbjct  533   QTKAKILIAQDEFKGAIETYSQLLAFFQVQSKSFNLGDKKLLKSSRNYAGRLQLEVWHDL  592

Query  1970  ARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPD  2149
             A +YI    W DA+ C+ K+K I  YS    H TG L+EA+   KEAL  F  +L IDP 
Sbjct  593   ALVYIRLSQWHDAEACLSKSKAISSYSASRCHITGMLYEAKGLYKEALNGFMAALEIDPI  652

Query  2150  YVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGS  2308
             +VPS+VS+A V+  +G Q+ P+ RS LM+ALR++ T H AW++LG   K EG+
Sbjct  653   HVPSLVSSAVVIRHLGHQSHPVIRSFLMDALRLDQTNHSAWYNLGLFYKSEGT  705



>emb|CDO98411.1| unnamed protein product [Coffea canephora]
Length=707

 Score =   501 bits (1289),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 300/700 (43%), Positives = 434/700 (62%), Gaps = 26/700 (4%)
 Frame = +2

Query  323   ATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGN  502
             + R   A+G+    T     E++ +E  + E ES L+E LSLN+EEARALLGRLEYQRGN
Sbjct  17    SVRQVCANGICMQTTVV---EAKLDEGNIQEAESALREGLSLNFEEARALLGRLEYQRGN  73

Query  503   FDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILL  682
              + AL+VF GID++    RM     +    +         V +G  S H+ SL+LEA+ L
Sbjct  74    VEGALRVFDGIDLQAAIQRMQPQAEKPPSKKGRSRSDS--VHAG--SQHAASLVLEAVYL  129

Query  683   KSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQ  862
             K+KSL  LGR+ +AA+ECK++LD V+  F +G+ + V  D KLQE    A+E LP+LW Q
Sbjct  130   KAKSLQKLGRVNEAAQECKSVLDAVEKIFCDGIPD-VLVDSKLQETVSHAVELLPELWKQ  188

Query  863   EGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDL-SPRFKIWCSTPPK  1039
              G   EA+++YRRAL+  WNLD    A +QK  A+ LL++GVE    S   +I  S  P+
Sbjct  189   AGSNSEAMSAYRRALLSQWNLDNDCCARIQKAFAVFLLYSGVEFGPPSLAVQIDGSYVPR  248

Query  1040  NNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRA  1219
             NN+EEAILL  +LM K   G+++WD  +++HLTFAL++ G+   LA  +E+++PG+  R 
Sbjct  249   NNLEEAILLFMILMRKFYIGKIKWDPSIIEHLTFALSLCGQTSVLAKQLEEVMPGVIHRT  308

Query  1220  ERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP--HIPSLLLGAKLCSQDPCKSREG  1393
             +RW  LALC+S AGQN+TALNLLRK    S  +HE    I SLLL AK+CS+D   + EG
Sbjct  309   DRWKTLALCHSGAGQNDTALNLLRK----SLHKHEDPDDIFSLLLAAKICSEDTFLAAEG  364

Query  1394  ISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAML  1573
             + +A+ A+ ++   N+HL     + LG+C G  AK+S SD ER+  Q+++L SL  A  L
Sbjct  365   VEYAQRAIANSSGLNEHLKGVGFRVLGLCLGKQAKVSSSDFERSRLQSEALRSLASATAL  424

Query  1574  CKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAE  1753
              KE+ + +  LG++YA  RNL  A   A +Y + T GS   GW+LLAL++SA+QR+S+A 
Sbjct  425   EKENTDLILELGVQYAEHRNLNAALRYARRYIDATGGSVLGGWRLLALVLSAQQRYSEAV  484

Query  1754  AIVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQS----GMDH  1921
              ++D ALDET + DQ   L++KA LQI++     A+ETYR LLA++QAQR+S     +  
Sbjct  485   VVIDAALDETAKWDQGPLLRMKAKLQISQSLHTDAIETYRYLLALVQAQRKSYGPLRVFP  544

Query  1922  EVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTI-------DIYSPQSWHTTGAL  2080
             +V  D+  E + W  LA +Y     W DA++C+ KA+ +       + Y       +G +
Sbjct  545   QVEDDKVNEYDVWHGLANLYSSLSHWKDAEICLGKARALVEFSADTNFYILSFVTVSGLM  604

Query  2081  FEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTC  2260
              E +    EAL A++ +L ++P YVP  +    +L KMG + +P+AR+LL +ALRIEPT 
Sbjct  605   LERRGELHEALSAYTNALLLEPSYVPCKILLGSLLCKMGLKMLPLARTLLSDALRIEPTN  664

Query  2261  HDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSFV  2380
               AW+ LG + + +G    A D FQAA  L+ S PV+SF 
Sbjct  665   RTAWYHLGLVHRDDGRMADAVDCFQAASMLEESDPVESFT  704



>ref|XP_008383718.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Malus domestica]
Length=734

 Score =   501 bits (1291),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 301/701 (43%), Positives = 445/701 (63%), Gaps = 21/701 (3%)
 Frame = +2

Query  236   RRRKML-CACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVD  412
             R  KML C  SGEQ + +E   +  S   LATRD+SASG +   + T + E++ + + ++
Sbjct  17    RLDKMLKCMRSGEQLRVDEVPHSSDS---LATRDYSASGGTGHSSRTGEIETKMDNSNIE  73

Query  413   EVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrp  592
             E ES+L+E+  LNYEEARALLGRLEYQ+GN +AAL VF+GIDI  + P+M  +I+ R   
Sbjct  74    EAESSLRESGYLNYEEARALLGRLEYQKGNTEAALHVFEGIDIAGVIPKMKVSISRRCET  133

Query  593   rkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFP  772
              + R     +     MS+H+VSLLLEAI LK+KSL GLGR  +AA+ CK ILD V+SA P
Sbjct  134   NRRRSQSDAV---PPMSMHAVSLLLEAIFLKAKSLQGLGRFGEAAQSCKLILDTVESALP  190

Query  773   NGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQ  952
             +G+ E    DCKLQE   KA+E LP+LW+  G   EA+ SYR+AL+  WNLD +  + M+
Sbjct  191   DGLPENFASDCKLQETVGKAVELLPELWILAGAAQEAILSYRQALLYHWNLDIELASKME  250

Query  953   KDLAIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEV  1123
             K+ A+ LL++G   D +P   R ++  S  P+NN+EEAILLL VL+ K   G + WD  +
Sbjct  251   KEFAVFLLYSG--CDXNPPNLRSQMESSFVPRNNIEEAILLLLVLLRKFVAGRIGWDPSI  308

Query  1124  MDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSG  1303
             +DHL+FAL++ G+  +LA  VE+++PG+  R ER+  LALCY   G++  ALNLL+ V  
Sbjct  309   LDHLSFALSISGKVRALAHQVEELIPGIMGRQERYCTLALCYYGEGEDLVALNLLKNVFN  368

Query  1304  SSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCY  1483
             +   E+   I  LLL +K+CS++     +G  +A  A+     +   +LS A   LGV  
Sbjct  369   NR--ENTDCILELLLASKICSENSVCIEDGTKYAYKALSELDGKCCQMLSIANCLLGVSL  426

Query  1484  GNAAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAE-TVFSLGLEYATQRNLTPAFDNAL  1660
                ++   SDSER   Q+++L +L  A  + KE +   V+ L LE+A QR L  A   A 
Sbjct  427   SAKSRSVASDSERILKQSEALQALQTADKITKERSPYVVYHLCLEHAEQRKLDIALYYAK  486

Query  1661  QYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIAR  1840
             Q  ++ AGS  K + LLA I+SA++RF DAE +++ ALD+TG+ DQ + L+ KA L IA+
Sbjct  487   QLLKLEAGSNIKSYALLARILSAQKRFIDAETVINAALDQTGKWDQGELLRTKAKLHIAQ  546

Query  1841  QHPNQAMETYRILLAMIQAQRQS-GMDHEVLSDRK-----LEVEAWLDLARIYIDQDSWP  2002
                  A+ETY  LLA++Q + ++ G++  +L  R+     LE+E W DLA +Y     W 
Sbjct  547   GQLKNAIETYTHLLAVLQVRTKNFGVEKRLLKSRRNHNRSLEMETWHDLANLYTSLSQWR  606

Query  2003  DAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEV  2182
             DA+VC+ K+++I+ +S   WH+TG L+EA+   +EAL +F  +L ++P +VPS++STA +
Sbjct  607   DAEVCLSKSQSINPHSASRWHSTGLLYEAKGLQQEALESFRKALDVEPTHVPSLISTACI  666

Query  2183  LMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEG  2305
             L + G Q++P+ RS LM+ALR++     AW++LG L K + 
Sbjct  667   LRQFGGQSLPVVRSFLMDALRLDRGNPSAWYNLGLLYKADA  707



>ref|XP_004305854.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Fragaria 
vesca subsp. vesca]
Length=719

 Score =   501 bits (1289),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 295/687 (43%), Positives = 440/687 (64%), Gaps = 14/687 (2%)
 Frame = +2

Query  332   DFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDA  511
             +FSA+G S   T  A   ++ +E  + E ES+L+E LSLN+EEARALLG+LEYQRGN + 
Sbjct  38    EFSANGNSMKATDVA---AKLDEGNIQEAESSLREGLSLNFEEARALLGKLEYQRGNLEG  94

Query  512   ALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKSK  691
             AL+VF GID++    R+  +I E+T  +K R           +S H+ +L+L+AI LK+K
Sbjct  95    ALRVFDGIDLQAAIERLQPSIAEKTPSKKGRSRPDS---QHSVSQHAATLVLDAIYLKAK  151

Query  692   SLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGL  871
             SL  LGR+ +AA ECK +LD V+  F  G+ +    D +LQE   +A+E LP+LW Q G 
Sbjct  152   SLHKLGRLTEAAHECKRVLDAVEKIFHQGIPD-AQVDSRLQETVSRAVELLPELWKQAGS  210

Query  872   IDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDL-SPRFKIWCSTPPKNNM  1048
               E + +YRRAL+  WNLD    A +QK  A+ LL++G+E    S   ++  S  PKNN+
Sbjct  211   YQETITAYRRALLGQWNLDNDCCARIQKAFAVFLLYSGLEAGPPSLGVQVEGSYVPKNNL  270

Query  1049  EEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERW  1228
             EEAILLL +L+  + +G+++WD  +++HLTFAL++  +   LA  +E+I+PG+  R +RW
Sbjct  271   EEAILLLMILLRNLSEGKLKWDPSLIEHLTFALSICNQTSVLAKQIEEIMPGVYPRVDRW  330

Query  1229  YFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFAR  1408
               LALCYS AGQN+ ALNLLRK     E   E  +  LLL AK+CS+D   + EG+ +A+
Sbjct  331   NSLALCYSGAGQNKAALNLLRKSLHKHERPDE--LMPLLLAAKICSEDSHVAAEGVGYAQ  388

Query  1409  GAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKEDA  1588
              A+ ++  +++HL + A +FLG+C G  A  S SD ER+  Q+++L SL++A  L K ++
Sbjct  389   RAVSNSQGKDEHLKAVALRFLGLCLGKQATTSSSDFERSRIQSEALKSLSEAISLEKNNS  448

Query  1589  ETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDL  1768
             + +F LG++YA  RNL  A   A Q+ + T GS  KGW+LLAL++SA+QRFS+A  + D 
Sbjct  449   DLIFELGVQYAEHRNLNAALRYAKQFIDETGGSALKGWRLLALVLSAQQRFSEAHVVTDA  508

Query  1769  ALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQS----GMDHEVLSD  1936
             ALDET + +Q   L+LKA L+I++  P  A+ETYR LLA++QAQR+S     ++ +   D
Sbjct  509   ALDETAKWEQGPLLRLKAKLKISQSLPMDAIETYRNLLALVQAQRKSFGPLRVNSQTEDD  568

Query  1937  RKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALV  2116
             +  E+E W  L+ +Y     W DA++C+ KA+ +  ++ ++ H  G + E   R  EALV
Sbjct  569   KVNELEVWHGLSNLYASLSYWRDAEICLGKARELKQFAAETLHAEGIILEGCGRSHEALV  628

Query  2117  AFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSK  2296
              +  +L  +P YVP  +  A ++ KMG +A+P+ARSLL +ALR+ P    AW+ LG + +
Sbjct  629   TYINALMQEPYYVPGKIGVAVLMSKMGPKALPVARSLLSDALRLNPNNRKAWYHLGIIHR  688

Query  2297  MEGSaqqaadffqaaHELKLSTPVQSF  2377
              +G    AAD FQAA  L+ S P++SF
Sbjct  689   DDGRMADAADCFQAATMLEESDPIESF  715



>ref|XP_004170906.1| PREDICTED: LOW QUALITY PROTEIN: tetratricopeptide repeat protein 
7B-like [Cucumis sativus]
Length=732

 Score =   501 bits (1290),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 304/698 (44%), Positives = 438/698 (63%), Gaps = 22/698 (3%)
 Frame = +2

Query  242   RKML-CACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEV  418
             RKM+ C  SG+Q + +E   +  S   LATRD+SASG SS RTG  + E + +   ++E 
Sbjct  19    RKMINCIRSGDQLRVDEMAHSSDS---LATRDYSASGFSS-RTG-GEVEQKVDNGNIEEA  73

Query  419   ESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprk  598
             ES+L+E+  LNYEEARALLGRLEYQ+GN +AAL VF+GIDI  +  R+  + + R    +
Sbjct  74    ESSLRESGYLNYEEARALLGRLEYQKGNIEAALHVFEGIDIAAVISRIKASFSTRYEQNR  133

Query  599   prggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNG  778
              +     +     MS+H++SLLLEAI LK+KSL GLGR  +AA+ CK ILD V+S+FP G
Sbjct  134   RQSQSDAV---PTMSMHAISLLLEAIFLKAKSLHGLGRYVEAAKSCKLILDTVESSFPEG  190

Query  779   MSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKD  958
             + E    DCKLQE   KA++ LP+LW   G   E++ SYRRAL+  WNL+ +  A ++K+
Sbjct  191   LPENFANDCKLQETLTKAVDLLPELWKSAGSPQESILSYRRALLYQWNLEMEARARIEKE  250

Query  959   LAIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMD  1129
              AI LL++G   D SP   R ++  S  P+NNMEEAILLL  LM K   G + WD  +++
Sbjct  251   FAIFLLYSG--CDASPPNLRSQMDSSFVPRNNMEEAILLLMDLMRKYTLGLIVWDPSIIE  308

Query  1130  HLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSS  1309
             HL+FAL+V GEF +LA  VEQ+ PG+  R E++  LALCY   G++  ALNLL+     S
Sbjct  309   HLSFALSVSGEFGALASEVEQLPPGIIGRKEKYCILALCYYGEGKSLVALNLLKNF--LS  366

Query  1310  EAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGN  1489
               E+   +  LLL +KLC ++     EG+++    +     +   L S A   LGV    
Sbjct  367   NIENVDCMLELLLASKLCGENLVCLDEGVAYTMRVLSQLHGKCIQLASVANCLLGVLLSA  426

Query  1490  AAKISFSDSERNSYQTQSLNSLTQAAMLCKE-DAETVFSLGLEYATQRNLTPAFDNALQY  1666
              +K+  SDS++   Q+++L +L  A  L ++ D   V+ L +EYA QR L  A   A Q 
Sbjct  427   MSKLVASDSQKTLKQSEALKALQTAEQLMRQRDPFIVYHLCIEYAEQRKLDFALYYAKQL  486

Query  1667  SEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQH  1846
              ++ AGS+ K + LLA I+SA++ F DAE +++ AL++TG+ +Q + L+ KA LQIA+  
Sbjct  487   VKLEAGSSLKSYVLLARILSAQKWFVDAETVLNAALEQTGKWEQGELLRTKAKLQIAQGQ  546

Query  1847  PNQAMETYRILLAMIQAQRQSG---MDHEVLS-DRKLEVEAWLDLARIYIDQDSWPDAQV  2014
                 +ETY  LLA+IQ Q +S    +  +V   DR LEV+ W DLA IY     W DA++
Sbjct  547   XKNGIETYSHLLAIIQVQNKSSGKMLPKDVRKYDRSLEVDTWHDLANIYTGLSQWRDAEI  606

Query  2015  CIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKM  2194
             C+ K + ID YS   WH+TG L+E++   ++AL A++ +L IDP +VPS++STA +L ++
Sbjct  607   CLSKLQAIDPYSASKWHSTGLLYESKGLPRDALQAYNKALDIDPGHVPSLISTARLLQQL  666

Query  2195  -GSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEG  2305
              GSQ+ P+ RSLL +ALR++     AW+SLG L K +G
Sbjct  667   GGSQSFPVVRSLLTDALRLDRANPSAWYSLGMLYKADG  704



>ref|XP_006589285.1| PREDICTED: tetratricopeptide repeat protein 7A-like isoform X2 
[Glycine max]
 ref|XP_006589286.1| PREDICTED: tetratricopeptide repeat protein 7A-like isoform X3 
[Glycine max]
Length=730

 Score =   501 bits (1289),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 308/698 (44%), Positives = 446/698 (64%), Gaps = 23/698 (3%)
 Frame = +2

Query  236   RRRKML-CACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVD  412
             R RKM+ C CS EQ + EE   + +S   LATRD+SASG  SSR G  D   + +   ++
Sbjct  15    RLRKMIKCICSREQLRVEELSYSSES---LATRDYSASGGLSSRPGEID--PKVDNTNIE  69

Query  413   EVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrp  592
             E ES+L+E+  LNYEEARALLGRLEYQ+GN +AAL VF+GIDI  + P++  +I+ R  P
Sbjct  70    EAESSLRESGYLNYEEARALLGRLEYQKGNIEAALHVFEGIDIAAVIPKLKVSISRRCEP  129

Query  593   rkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFP  772
              K R     +     MS+H+VSLLLEA+ LK+KS   LGR +DAA+ CK ILD V+SA P
Sbjct  130   NKRRSQSDAM---PPMSMHAVSLLLEAVFLKAKSFQALGRFQDAAQSCKTILDTVESALP  186

Query  773   NGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQ  952
              G  E    DCKLQE    A+E LP+LW   G   + ++SYRRAL+  WNLD +  A +Q
Sbjct  187   EGWPENFVSDCKLQETVGNAVELLPELWKLAGSPQDIMSSYRRALLYHWNLDIEATARIQ  246

Query  953   KDLAIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEV  1123
             K+ +  LL++G E   SP   R ++  S  P+NN+EEA+LLL +L+ K   G + WD  +
Sbjct  247   KEFSFFLLYSGCEA--SPPALRSQLDGSFVPRNNIEEAVLLLLILLRKSILGYIAWDPSL  304

Query  1124  MDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSG  1303
             +DHL+FAL+V GEF++LA  +E++LP    R ER+Y LALCY   G++ TAL+LLR  + 
Sbjct  305   LDHLSFALSVSGEFKTLAQQIEELLPESMERKERYYTLALCYCGEGEHITALDLLR--NS  362

Query  1304  SSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCY  1483
              +  E+   I  LLL +K+C+ +     EGI ++  A+     +   +++ A   LGV  
Sbjct  363   LNHRENSNCIKELLLASKICADNKVCVEEGIKYSCKAISQFNGKCMQMVAIANCLLGVLL  422

Query  1484  GNAAKISFSDSERNSYQTQSLNSLTQA-AMLCKEDAETVFSLGLEYATQRNLTPAFDNAL  1660
              + ++ + S+SE+   Q+++L++L  A  M+ + D   V  L LEYA QR L+ A D+A 
Sbjct  423   SSKSRSAASESEKVFMQSEALSALKAAEGMMRESDPYIVLHLCLEYADQRKLSIALDHAK  482

Query  1661  QYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIAR  1840
             +  ++  GS+  G+ LLA I+SA+Q+F DAE ++D ALD++G+ DQ + L+ KA L+IA+
Sbjct  483   KLIKLEDGSSVSGYILLARILSAQQKFVDAELVIDAALDQSGKWDQGELLRTKAKLRIAQ  542

Query  1841  QHPNQAMETYRILLAMIQAQRQS-GMDHEVLS-----DRKLEVEAWLDLARIYIDQDSWP  2002
                  A+ETY  LLA++Q Q +S G   +V+      DR+LE+E WLDLA +Y     W 
Sbjct  543   GKLKNAVETYTFLLAVLQVQNKSLGTASKVVKNKGNRDRRLEMEIWLDLANVYTALSQWQ  602

Query  2003  DAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEV  2182
             DA+VC+ K++ I+ YS   WHT G L EA+   +EAL +F  +L I+P++VPS++STA V
Sbjct  603   DAEVCLAKSEAINPYSASRWHTKGLLSEARGFHQEALKSFRKALDIEPNHVPSLISTACV  662

Query  2183  LMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSK  2296
             L ++G Q+  I RSLL +ALR++ T   AW++LG L K
Sbjct  663   LRQLGGQSSSIVRSLLTDALRLDRTNPSAWYNLGLLYK  700



>ref|XP_004962744.1| PREDICTED: uncharacterized protein LOC101760798 [Setaria italica]
Length=716

 Score =   500 bits (1288),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 296/673 (44%), Positives = 434/673 (64%), Gaps = 16/673 (2%)
 Frame = +2

Query  383   ESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRM  562
             E++ ++  + E ES+L+E LSLNYEEARALLGRLEYQRGN +AAL+VF GID++    R 
Sbjct  49    EAKVDDGNIQEAESSLREGLSLNYEEARALLGRLEYQRGNVEAALRVFDGIDLQAAIQRF  108

Query  563   SKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKA  742
               +++E+   ++    + +   SG  S H+ SL+LEAI LKS SL  LG+  +AA++CK+
Sbjct  109   QPSVSEKPLSKRSNKLRSDSSNSG--SQHAASLVLEAIYLKSMSLQKLGKAMEAAKQCKS  166

Query  743   ILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWN  922
             +LD V+S F  G+  GV  + KLQE   K++E LP+LW Q G   EA+ SYRRAL+  WN
Sbjct  167   VLDAVESIFQCGIP-GVMVEQKLQETVSKSVELLPELWKQAGAYQEALASYRRALLSQWN  225

Query  923   LDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPKNNMEEAILLLFVLMGKIQQ  1096
             LD +    +QK  A+ LL+ GVE    P    +   S  P+NN+EEAILLL +L+ K   
Sbjct  226   LDDECCTRIQKRFAVFLLYGGVEAS-PPSLASQTEGSFVPRNNLEEAILLLMILLKKWFL  284

Query  1097  GEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETA  1276
             G+  WD  VM+HLTFAL+V G+   LA ++E++LPG+  R ERWY LALCY +A  NE A
Sbjct  285   GKTHWDPSVMEHLTFALSVCGQTSVLAKHLEEVLPGIYPRTERWYSLALCYFAASHNEAA  344

Query  1277  LNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQ  1456
             LNLL++    +E+ ++  I +LLL AK+CS     + EG+ +AR A+    + + HL S 
Sbjct  345   LNLLKRSLNKNESPND--IMALLLAAKICSSSYLLASEGVDYARRAVKDVESSDGHLKSV  402

Query  1457  ARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNL  1636
             A  FLG C    ++++ SD +R+  QT++L SL +A  L + + E ++ +G+EYA QRNL
Sbjct  403   ALHFLGSCLAKKSRVASSDHQRSLLQTEALKSLNEAFSLDRHNPELIYDMGIEYAEQRNL  462

Query  1637  TPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflkl  1816
               A   A ++ + T GS +KGW+LL+L++SA+QR+S+AE + D ALDET + +Q   L++
Sbjct  463   HAALKYAKEFIDATGGSVSKGWRLLSLVLSAQQRYSEAEVVTDAALDETAKWEQGPLLRI  522

Query  1817  kaalqIARQHPNQAMETYRILLAMIQAQRQS------GMDHEVLSDRKLEVEAWLDLARI  1978
             +A L++A+  P +A+E YR LLA++QAQR++      G + +   D+  E E W  LA +
Sbjct  523   RAKLKVAQSLPMEAVEAYRTLLALVQAQRKAYGSIKNGAEED--EDKVSEFEVWQGLANL  580

Query  1979  YIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVP  2158
             Y     W DA++C+ KAK +  YS  + H  G + E +E+ ++AL A+  +LS + ++VP
Sbjct  581   YSSLSYWRDAEICLQKAKALKTYSATTLHAEGNIHEVREKIQDALAAYFNALSTEIEHVP  640

Query  2159  SIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqa  2338
             S VS   +L K G + +P+AR  L +ALR+EPT   AWF LGK+ K +G    AAD FQA
Sbjct  641   SKVSIGALLAKKGPKYLPVARCFLSDALRLEPTNRMAWFYLGKVHKHDGRLVDAADCFQA  700

Query  2339  aHELKLSTPVQSF  2377
             A  L+ S PV+SF
Sbjct  701   ASMLEDSDPVESF  713



>ref|XP_006468967.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Citrus sinensis]
Length=698

 Score =   499 bits (1286),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 310/691 (45%), Positives = 436/691 (63%), Gaps = 16/691 (2%)
 Frame = +2

Query  323   ATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGN  502
             + R+  A+G        A+ E++ +E  + E ES+L+E LSLN+EEARALLGRLEYQRGN
Sbjct  14    SVRELCANGAC---MKAAEVEAKLDEGNIQEAESSLREGLSLNFEEARALLGRLEYQRGN  70

Query  503   FDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILL  682
              + AL+VF GID+     R+  + +E++  +K R      V    +S H+ SL+LEAI L
Sbjct  71    VEGALRVFDGIDLHAAIQRLQPSFSEKSASKKCRSRSDSHVS---VSQHAASLVLEAIYL  127

Query  683   KSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQ  862
             K+KSL  LGR+ +AA ECK++LD V+  F  G+ +    D +LQE   +A+E LP+LW Q
Sbjct  128   KAKSLQKLGRLTEAANECKSVLDAVERIFQQGIPDA-QVDNRLQETVSRAVELLPELWKQ  186

Query  863   EGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPP  1036
              G   +AV +YRRAL+  WNLD +  A +QK  A+ LL +GVE    P    ++  S  P
Sbjct  187   VGCDHDAVAAYRRALLSQWNLDNECCARIQKRFAVFLLHSGVEAG-PPSLGSQVEGSYVP  245

Query  1037  KNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTR  1216
             KNN+EEAILLL +LM K   G+++WD  VM+HLT+AL++  +   LA  +E+I+PG+  R
Sbjct  246   KNNLEEAILLLLILMKKYHLGKIKWDPAVMEHLTYALSLCSQTSILAKQLEEIMPGVFLR  305

Query  1217  AERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGI  1396
             ++RW  LALCYS+ GQN+ ALNLLRK     E  ++  + +LLL AK+CS+D   + EGI
Sbjct  306   SDRWNALALCYSAIGQNDAALNLLRKSLHKHERPND--LMALLLAAKICSEDCHLAAEGI  363

Query  1397  SFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLC  1576
              +AR A+ +   +++HL     + LG+C G  AK+S SD ER+  Q+++L SL  A    
Sbjct  364   QYARTALSNAQGKDEHLKGVGLRMLGLCLGRHAKVSSSDYERSRLQSEALKSLDGAITFE  423

Query  1577  KEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEA  1756
               +A+  F LG+ YA QRNL+ A   A QY + T GS  KGWKLLAL++SA+QRFS+AE 
Sbjct  424   NNNADLFFDLGVRYAEQRNLSTALRYAKQYIDATGGSVLKGWKLLALVLSAQQRFSEAEV  483

Query  1757  IVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQSGMDHEVLS-  1933
             + D ALDET + +Q   L+LKA L+IA+  P  A+ETYR LLA++QAQR+S      LS 
Sbjct  484   VTDAALDETTKWEQGPILRLKAKLKIAQALPMDAIETYRYLLALVQAQRKSFGPLRSLSQ  543

Query  1934  ---DRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCK  2104
                D+  E + W  LA +Y     W D  +C+ KA+ +  YS +  HT G + E   +  
Sbjct  544   IEDDKVNEFQVWHGLANLYSGLSHWKDVAICMGKARELKAYSAEMLHTEGVMHEGCGQTH  603

Query  2105  EALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLG  2284
             EAL A+  +L I+P YVP  V    +  K+G +A+P+ARSLL +ALRIEPT   AW+ LG
Sbjct  604   EALRAYINALLIEPSYVPCKVLVGSLFSKLGPKALPVARSLLSDALRIEPTNRKAWYYLG  663

Query  2285  KLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
              + K +G    AAD FQAA  L+ S P++SF
Sbjct  664   LVHKDDGRIADAADCFQAASMLEESDPIESF  694



>ref|XP_008777130.1| PREDICTED: uncharacterized protein LOC103697114 [Phoenix dactylifera]
Length=659

 Score =   498 bits (1282),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 291/647 (45%), Positives = 411/647 (64%), Gaps = 13/647 (2%)
 Frame = +2

Query  455   EEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSG  634
             +EARALLGRLEYQRGN ++AL+VF GID++T   R+    +E+   R+ R     I    
Sbjct  16    KEARALLGRLEYQRGNVESALRVFDGIDLQTAIQRLQPTFSEKPASRRNRSRTESI---H  72

Query  635   VMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQ  814
              +S H+ SL+LEAI LKS SL  LG+  +AA+ECK++LD V+  F +G+ + + E  KLQ
Sbjct  73    QVSQHAASLVLEAIYLKSMSLQRLGKATEAAQECKSVLDAVEKIFQHGIPDVLVEQ-KLQ  131

Query  815   EMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEV  994
             E   KA+E LP+LW Q G   EA+ SYRRAL+  WNLD +    +QK  A+ LL+ GVE 
Sbjct  132   ETVSKAVEVLPELWKQAGRHQEALASYRRALLSQWNLDEECCVRIQKRFAVFLLYGGVEA  191

Query  995   DLSPRF--KIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFE  1168
                P    ++  S  PKNN+EEAILLL +L+ K   G+ EWD  VM+H TFAL++ GE  
Sbjct  192   S-PPSLASQVEGSFIPKNNLEEAILLLMILLRKWYLGKTEWDPSVMEHFTFALSLCGETS  250

Query  1169  SLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLL  1348
              L  + E+++PG+  R ERWY LALCYS AGQN +ALNLLRK     E+ ++  I +LLL
Sbjct  251   VLGRHFEEVMPGIYPRCERWYSLALCYSGAGQNRSALNLLRKSLNRHESPND--IMALLL  308

Query  1349  GAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNS  1528
              AK+CS D   + EG+ +AR A+ +  N ++HL     +FLG C    AKI+ SD  R  
Sbjct  309   AAKICSDDCLLASEGVEYARRAITNARNGDEHLKCVGLRFLGTCLAKQAKIALSDHARIR  368

Query  1529  YQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKL  1708
              Q ++L SL +A  L   + + +F LGLEYA QRN+  A   A ++ + T GS +KGW+L
Sbjct  369   LQAEALRSLDEAIALDCHNPDLIFDLGLEYAEQRNMNVALRCAKEFIDATGGSISKGWRL  428

Query  1709  LALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAM  1888
              AL++SA+QR+S+AE + D ALDET + +Q   L++KA L++A+  P  A+E YR LLA+
Sbjct  429   FALVLSAQQRYSEAEVVTDAALDETAKWEQGPLLRIKAKLKVAQSSPTDAVEAYRFLLAL  488

Query  1889  IQAQRQ----SGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQ  2056
             +QAQR+    S    +V  D+  E E W  LA +Y     W DA++C++KA+ +  YS  
Sbjct  489   VQAQRKTFGSSKNSTQVEDDKVSEFEVWQGLANLYSSLSHWKDAEICLEKARALKPYSAA  548

Query  2057  SWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMN  2236
               HT G+++E +   K+AL A+S +LS++ D+VP  VS   +L K G +++P+ARS L +
Sbjct  549   VLHTEGSMYEVRGETKDALAAYSNALSMELDHVPCKVSVGSLLSKKGLKSLPVARSFLSD  608

Query  2237  ALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             ALR+E T   AW+ LG + + EG    AAD FQAA  L+ S PV+ F
Sbjct  609   ALRLESTSRLAWYYLGLVHRDEGRLVDAADCFQAASMLEESDPVECF  655



>ref|XP_006589284.1| PREDICTED: tetratricopeptide repeat protein 7A-like isoform X1 
[Glycine max]
Length=743

 Score =   500 bits (1288),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 308/698 (44%), Positives = 446/698 (64%), Gaps = 23/698 (3%)
 Frame = +2

Query  236   RRRKML-CACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVD  412
             R RKM+ C CS EQ + EE   + +S   LATRD+SASG  SSR G  D   + +   ++
Sbjct  28    RLRKMIKCICSREQLRVEELSYSSES---LATRDYSASGGLSSRPGEID--PKVDNTNIE  82

Query  413   EVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrp  592
             E ES+L+E+  LNYEEARALLGRLEYQ+GN +AAL VF+GIDI  + P++  +I+ R  P
Sbjct  83    EAESSLRESGYLNYEEARALLGRLEYQKGNIEAALHVFEGIDIAAVIPKLKVSISRRCEP  142

Query  593   rkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFP  772
              K R     +     MS+H+VSLLLEA+ LK+KS   LGR +DAA+ CK ILD V+SA P
Sbjct  143   NKRRSQSDAM---PPMSMHAVSLLLEAVFLKAKSFQALGRFQDAAQSCKTILDTVESALP  199

Query  773   NGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQ  952
              G  E    DCKLQE    A+E LP+LW   G   + ++SYRRAL+  WNLD +  A +Q
Sbjct  200   EGWPENFVSDCKLQETVGNAVELLPELWKLAGSPQDIMSSYRRALLYHWNLDIEATARIQ  259

Query  953   KDLAIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEV  1123
             K+ +  LL++G E   SP   R ++  S  P+NN+EEA+LLL +L+ K   G + WD  +
Sbjct  260   KEFSFFLLYSGCEA--SPPALRSQLDGSFVPRNNIEEAVLLLLILLRKSILGYIAWDPSL  317

Query  1124  MDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSG  1303
             +DHL+FAL+V GEF++LA  +E++LP    R ER+Y LALCY   G++ TAL+LLR  + 
Sbjct  318   LDHLSFALSVSGEFKTLAQQIEELLPESMERKERYYTLALCYCGEGEHITALDLLR--NS  375

Query  1304  SSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCY  1483
              +  E+   I  LLL +K+C+ +     EGI ++  A+     +   +++ A   LGV  
Sbjct  376   LNHRENSNCIKELLLASKICADNKVCVEEGIKYSCKAISQFNGKCMQMVAIANCLLGVLL  435

Query  1484  GNAAKISFSDSERNSYQTQSLNSLTQA-AMLCKEDAETVFSLGLEYATQRNLTPAFDNAL  1660
              + ++ + S+SE+   Q+++L++L  A  M+ + D   V  L LEYA QR L+ A D+A 
Sbjct  436   SSKSRSAASESEKVFMQSEALSALKAAEGMMRESDPYIVLHLCLEYADQRKLSIALDHAK  495

Query  1661  QYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIAR  1840
             +  ++  GS+  G+ LLA I+SA+Q+F DAE ++D ALD++G+ DQ + L+ KA L+IA+
Sbjct  496   KLIKLEDGSSVSGYILLARILSAQQKFVDAELVIDAALDQSGKWDQGELLRTKAKLRIAQ  555

Query  1841  QHPNQAMETYRILLAMIQAQRQS-GMDHEVLS-----DRKLEVEAWLDLARIYIDQDSWP  2002
                  A+ETY  LLA++Q Q +S G   +V+      DR+LE+E WLDLA +Y     W 
Sbjct  556   GKLKNAVETYTFLLAVLQVQNKSLGTASKVVKNKGNRDRRLEMEIWLDLANVYTALSQWQ  615

Query  2003  DAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEV  2182
             DA+VC+ K++ I+ YS   WHT G L EA+   +EAL +F  +L I+P++VPS++STA V
Sbjct  616   DAEVCLAKSEAINPYSASRWHTKGLLSEARGFHQEALKSFRKALDIEPNHVPSLISTACV  675

Query  2183  LMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSK  2296
             L ++G Q+  I RSLL +ALR++ T   AW++LG L K
Sbjct  676   LRQLGGQSSSIVRSLLTDALRLDRTNPSAWYNLGLLYK  713



>ref|XP_008438486.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Cucumis 
melo]
 ref|XP_008438487.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Cucumis 
melo]
 ref|XP_008438488.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Cucumis 
melo]
 ref|XP_008438489.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Cucumis 
melo]
Length=732

 Score =   500 bits (1287),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 308/698 (44%), Positives = 443/698 (63%), Gaps = 22/698 (3%)
 Frame = +2

Query  242   RKML-CACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEV  418
             RKM+ C  SG+Q + +E   +  S   LATRD+SASG SS RTG  + E + +   ++E 
Sbjct  19    RKMINCIRSGDQLRVDEMAHSSDS---LATRDYSASGFSS-RTG-GEVEQKVDNGNIEEA  73

Query  419   ESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprk  598
             ES+L+E+  LNYEEARALLGRLEYQ+GN +AAL VF+GIDI  +  R+ KA       + 
Sbjct  74    ESSLRESGYLNYEEARALLGRLEYQKGNIEAALHVFEGIDIAAVISRI-KASFSTRYEQN  132

Query  599   prggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNG  778
              R  + ++V +  MS+H++SLLLEAI LK+KSL GLGR  +AA+ CK ILD V+S+FP G
Sbjct  133   RRQSQSDVVPT--MSMHAISLLLEAIFLKAKSLQGLGRFVEAAKSCKLILDTVESSFPEG  190

Query  779   MSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKD  958
             + E    DCKLQE   KA++ LP+LW   G   E++ SYRRAL+  WNL+ +  A ++K+
Sbjct  191   LPENFANDCKLQETLTKAVDLLPELWKSAGSPQESILSYRRALLYQWNLEMEARARIEKE  250

Query  959   LAIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMD  1129
              AI LL++G   D SP   R ++  S  P+NNMEEAILLL  LM K   G + WD  V++
Sbjct  251   FAIFLLYSG--CDASPPNLRSQMDSSFVPRNNMEEAILLLMDLMRKYTLGLIVWDPSVIE  308

Query  1130  HLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSS  1309
             HL+FAL++ GEF +LA+ VEQ+ PG+  R E++  LALCY   G++  ALNLL+     S
Sbjct  309   HLSFALSISGEFGALANEVEQLPPGIIGRKEKYCILALCYYGEGKSLVALNLLKNF--LS  366

Query  1310  EAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGN  1489
               E+   +  LLL +KLC ++     EG+++    +     +   L S A   LGV    
Sbjct  367   NIENVDCLLELLLASKLCGENLVCLDEGVAYTMRVLSQLHGKCIQLASVANCLLGVLLSA  426

Query  1490  AAKISFSDSERNSYQTQSLNSLTQAAMLCKE-DAETVFSLGLEYATQRNLTPAFDNALQY  1666
              +K+  SDS++   Q+++L +L  A  L ++ D   ++ LGLEYA QR L  A   A Q 
Sbjct  427   TSKLVASDSQKALKQSEALKALQTAEQLMRQRDPFIIYHLGLEYAEQRKLDFALYYAKQL  486

Query  1667  SEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQH  1846
              ++ AGS+ K + LLA I+SA++RF DAE +++ AL++TG+ +Q + L+ KA LQIA+  
Sbjct  487   VKLEAGSSLKSYVLLARILSAQKRFVDAETVLNAALEQTGKWEQGELLRTKAKLQIAQGQ  546

Query  1847  PNQAMETYRILLAMIQAQRQSG---MDHEVLS-DRKLEVEAWLDLARIYIDQDSWPDAQV  2014
                 +ETY  LLA+IQ Q +S    +  +V   DR LEV+ W DLA IY     W DA++
Sbjct  547   LKNGIETYSHLLAIIQVQNKSSGKMLPKDVSKYDRSLEVDTWHDLADIYTGLSQWRDAEI  606

Query  2015  CIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKM  2194
             C+ K + ID YS   WH+TG L+E++   ++AL A++ +L IDP +VPS++STA +L ++
Sbjct  607   CLSKLQAIDPYSASKWHSTGLLYESKGLPRDALQAYNKALDIDPGHVPSLISTARLLQQL  666

Query  2195  -GSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEG  2305
              GSQ+ P+ RSLL +ALR++     AW+SLG L K + 
Sbjct  667   GGSQSFPVVRSLLTDALRLDRANPSAWYSLGMLYKADA  704



>gb|KHG28092.1| Tetratricopeptide repeat protein 7A [Gossypium arboreum]
Length=734

 Score =   500 bits (1287),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 299/697 (43%), Positives = 429/697 (62%), Gaps = 22/697 (3%)
 Frame = +2

Query  242   RKMLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVE  421
             +KM C C+GE  K  + E      ESLA  D S  G SS     ++ E++ +   ++E E
Sbjct  21    QKMKCLCAGE--KLIKVEQMIPPSESLAVEDHSLCGHSSK---FSNGENKPDTGNIEEAE  75

Query  422   STLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkp  601
              +L+E+ SLNYEEARALLGR+EYQ+GN +AAL VF+GIDI  + P+M  ++T +   RK 
Sbjct  76    LSLRESSSLNYEEARALLGRIEYQKGNIEAALHVFEGIDIAAIIPKMKLSLTRKVERRKR  135

Query  602   rggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGM  781
             +           MS+H++SLLLEAI LK++SL  L R R+AA+ CK ILD+++S+ P+G+
Sbjct  136   QSHD---YAPPPMSVHTISLLLEAIFLKAQSLQHLQRFREAAQTCKVILDVIESSLPDGL  192

Query  782   SEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDL  961
              E  G DCKLQE  +KA+E LP+LW       EA+ SYR AL+  WNLD +  A +QK  
Sbjct  193   PENFGADCKLQETLNKAVELLPELWKLSDSPFEAILSYRWALLHIWNLDVETTARIQKCF  252

Query  962   AIALLFAGVEV-DLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLT  1138
             A+ LL+ G E    + R ++  S  P+NN+EEAILLL +L+ K+    +EWD  ++DHL+
Sbjct  253   AVFLLYCGDEACPPNLRSQMGSSFVPRNNIEEAILLLMILLRKVALKRIEWDPSILDHLS  312

Query  1139  FALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAE  1318
             FAL+V G+  +LA  +E++LPG+  R ER+  L+LCY  AG++  AL LLRK+  S+E  
Sbjct  313   FALSVCGDLRALAKQIEELLPGVINRKERYRILSLCYHGAGEDSAALILLRKLLNSNE--  370

Query  1319  HEPH-IPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAA  1495
              +P  +P L++ +++C + P  + EGISFA  A++S   +   L   +   LGV     +
Sbjct  371   -DPRCVPGLMMASRICGEKPILAEEGISFAHRALESLEEECNELEGTSNFLLGVACSMHS  429

Query  1496  KISFSDSERNSYQTQSLNSLTQAAMLCK-EDAETVFSLGLEYATQRNLTPAFDNALQYSE  1672
             K   SD ER + Q+++L +L  A  +   +D   ++ L LE A QR L  A   A    +
Sbjct  430   KSVLSDFERVAIQSEALQALESAWKITNMKDPSILYHLSLENAEQRKLGAALYYAKSLLK  489

Query  1673  MTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPN  1852
             +  GS  KGW LLA I+SA++RF D E ++D ALD+TG+ DQ + L+ KA LQIAR    
Sbjct  490   LEGGSNIKGWLLLARILSAQKRFVDGEIVLDAALDQTGKWDQGELLRTKAKLQIARGQLK  549

Query  1853  QAMETYRILLAMIQAQRQSGM-------DHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQ  2011
              A+ETY  LLA++Q Q +S +       DH   S    E E W DLA +YI    W DA+
Sbjct  550   NAVETYSQLLALLQVQCKSFVLGKKLHKDHRY-SLTGFEQEIWHDLAYLYISLSQWRDAE  608

Query  2012  VCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMK  2191
             +C+ K+K I  YS   +H TG L+E +   KEA+ AF  +L IDPD+VPS++S A VL +
Sbjct  609   ICLSKSKAISSYSAVRFHATGVLYERKGLLKEAMEAFRTALDIDPDHVPSMISAAAVLRR  668

Query  2192  MGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKME  2302
             +G Q   + +SLLMNALR++     AW++LG L K E
Sbjct  669   VGGQCNAVIKSLLMNALRVDQMNGLAWYNLGLLHKTE  705



>ref|XP_010265001.1| PREDICTED: tetratricopeptide repeat protein 7A-like isoform X2 
[Nelumbo nucifera]
Length=749

 Score =   500 bits (1288),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 311/702 (44%), Positives = 438/702 (62%), Gaps = 31/702 (4%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDF-SASGLSSSRTGTADWESRFEEAQVDEVES  424
             M C CSGEQ      +    S ES  T+DF   +G SSS+ G    + + +   ++E ES
Sbjct  36    MKCLCSGEQL---GADEMVLSSESPGTKDFFVVAGESSSKVGGG--KKKPDIGNIEEAES  90

Query  425   TLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkpr  604
             +L+E+  LNYEEARALLGRLEYQRGN +AAL VF+GIDI +++P++  +I   T+  + R
Sbjct  91    SLRESGFLNYEEARALLGRLEYQRGNVEAALHVFEGIDIASVTPKIKLSILSITQRGEHR  150

Query  605   ggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMS  784
               +    V+  MS+H+ SLL EAI LK++SL  LGR + AA+ CK ILD V+SA P G+ 
Sbjct  151   KRRSHSDVAPPMSMHAASLLFEAIYLKARSLQDLGRFQ-AAQSCKVILDTVESALPEGLP  209

Query  785   EGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLA  964
             E  G D KLQE  +K +E LP+LW   G   EA+ SYRRAL+  WNLD   +A ++K+ A
Sbjct  210   ENFGTDFKLQETLNKTVELLPELWKLAGFPHEAILSYRRALLHHWNLDPDTIAKIEKEFA  269

Query  965   IALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHL  1135
             I LL+ G   D SP   R ++  S  PKNN+EEAILLL +L+ K     +EWD  ++DHL
Sbjct  270   IFLLYGGC--DASPPNLRSQMEGSFVPKNNIEEAILLLLILLKKFALRRIEWDPSIIDHL  327

Query  1136  TFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEA  1315
             +FAL+V GE  +LA+ VE++LP +  + ER+Y LALCY + G+N  ALNLLRK+    E 
Sbjct  328   SFALSVSGELRTLANQVEELLPEILDKKERYYTLALCYYAEGENVVALNLLRKLLSGRE-  386

Query  1316  EHEPH-IPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNA  1492
                P+ I +LLL +K+  +D     EG +FAR A+         ++S     LG+     
Sbjct  387   --NPNCIGALLLASKISGEDLNLPEEGEAFARKAIALLHGGCNRMISVTNYLLGISLSAQ  444

Query  1493  AKISFSDSERNSYQTQSLNSLTQAAMLCKE-DAETVFSLGLEYATQRNLTPAFDNALQYS  1669
             A++  SDSER+  Q  +L +L  A    +E + + +F L LE A QR L  A   A Q  
Sbjct  445   ARLVRSDSERSMRQIDALRALETAEKKMREREPKVIFYLSLENAEQRKLDVALYYAKQLL  504

Query  1670  EMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHP  1849
             ++ AGS  KGW LLA I+SA++RF DAE I++ ALD+TG+ DQ + L+ KA LQI +   
Sbjct  505   KLEAGSNIKGWILLARILSAQKRFVDAETIINAALDQTGRWDQGELLRTKAKLQIVQGQL  564

Query  1850  NQAMETYRILLAMIQAQRQS----------GMDHEVLSDRKLEVEAWLDLARIYIDQDSW  1999
               A++TY  LLA+++ QR++           +DH    +R LE+E W DLA IY     W
Sbjct  565   KNAIKTYTHLLAVLEVQRRNFSVSKKILKGSVDH----NRALEMETWHDLAYIYTSLSQW  620

Query  2000  PDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAE  2179
              DA+VC+ K+K I+ +S   WH TGAL+EA+   +EAL AF+ +L I+P++VPS+VSTA 
Sbjct  621   QDAEVCLTKSKQINPHSASRWHATGALYEAKSLYREALKAFASALDIEPNHVPSLVSTAV  680

Query  2180  VLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEG  2305
             VL K+G  ++P+ R  L +ALR++ T H AW++LG + K EG
Sbjct  681   VLGKLGEPSLPVVRGFLTDALRLDKTNHFAWYNLGLIYKAEG  722



>gb|KHG28093.1| Tetratricopeptide repeat protein 7A [Gossypium arboreum]
Length=755

 Score =   500 bits (1287),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 299/697 (43%), Positives = 429/697 (62%), Gaps = 22/697 (3%)
 Frame = +2

Query  242   RKMLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVE  421
             +KM C C+GE  K  + E      ESLA  D S  G SS     ++ E++ +   ++E E
Sbjct  42    QKMKCLCAGE--KLIKVEQMIPPSESLAVEDHSLCGHSSK---FSNGENKPDTGNIEEAE  96

Query  422   STLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkp  601
              +L+E+ SLNYEEARALLGR+EYQ+GN +AAL VF+GIDI  + P+M  ++T +   RK 
Sbjct  97    LSLRESSSLNYEEARALLGRIEYQKGNIEAALHVFEGIDIAAIIPKMKLSLTRKVERRKR  156

Query  602   rggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGM  781
             +           MS+H++SLLLEAI LK++SL  L R R+AA+ CK ILD+++S+ P+G+
Sbjct  157   QSHD---YAPPPMSVHTISLLLEAIFLKAQSLQHLQRFREAAQTCKVILDVIESSLPDGL  213

Query  782   SEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDL  961
              E  G DCKLQE  +KA+E LP+LW       EA+ SYR AL+  WNLD +  A +QK  
Sbjct  214   PENFGADCKLQETLNKAVELLPELWKLSDSPFEAILSYRWALLHIWNLDVETTARIQKCF  273

Query  962   AIALLFAGVEV-DLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLT  1138
             A+ LL+ G E    + R ++  S  P+NN+EEAILLL +L+ K+    +EWD  ++DHL+
Sbjct  274   AVFLLYCGDEACPPNLRSQMGSSFVPRNNIEEAILLLMILLRKVALKRIEWDPSILDHLS  333

Query  1139  FALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAE  1318
             FAL+V G+  +LA  +E++LPG+  R ER+  L+LCY  AG++  AL LLRK+  S+E  
Sbjct  334   FALSVCGDLRALAKQIEELLPGVINRKERYRILSLCYHGAGEDSAALILLRKLLNSNE--  391

Query  1319  HEPH-IPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAA  1495
              +P  +P L++ +++C + P  + EGISFA  A++S   +   L   +   LGV     +
Sbjct  392   -DPRCVPGLMMASRICGEKPILAEEGISFAHRALESLEEECNELEGTSNFLLGVACSMHS  450

Query  1496  KISFSDSERNSYQTQSLNSLTQAAMLCK-EDAETVFSLGLEYATQRNLTPAFDNALQYSE  1672
             K   SD ER + Q+++L +L  A  +   +D   ++ L LE A QR L  A   A    +
Sbjct  451   KSVLSDFERVAIQSEALQALESAWKITNMKDPSILYHLSLENAEQRKLGAALYYAKSLLK  510

Query  1673  MTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPN  1852
             +  GS  KGW LLA I+SA++RF D E ++D ALD+TG+ DQ + L+ KA LQIAR    
Sbjct  511   LEGGSNIKGWLLLARILSAQKRFVDGEIVLDAALDQTGKWDQGELLRTKAKLQIARGQLK  570

Query  1853  QAMETYRILLAMIQAQRQSGM-------DHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQ  2011
              A+ETY  LLA++Q Q +S +       DH   S    E E W DLA +YI    W DA+
Sbjct  571   NAVETYSQLLALLQVQCKSFVLGKKLHKDHRY-SLTGFEQEIWHDLAYLYISLSQWRDAE  629

Query  2012  VCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMK  2191
             +C+ K+K I  YS   +H TG L+E +   KEA+ AF  +L IDPD+VPS++S A VL +
Sbjct  630   ICLSKSKAISSYSAVRFHATGVLYERKGLLKEAMEAFRTALDIDPDHVPSMISAAAVLRR  689

Query  2192  MGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKME  2302
             +G Q   + +SLLMNALR++     AW++LG L K E
Sbjct  690   VGGQCNAVIKSLLMNALRVDQMNGLAWYNLGLLHKTE  726



>ref|XP_004289975.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Fragaria 
vesca subsp. vesca]
Length=731

 Score =   499 bits (1284),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 299/699 (43%), Positives = 427/699 (61%), Gaps = 28/699 (4%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             M C CSGEQ      +      ESLATRD  +    SSR      +S      + E ES+
Sbjct  22    MNCLCSGEQLS-GPDDLIFSDSESLATRDHKSE--LSSRVAAVTNKS---HTNILEAESS  75

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             L+E   LNYEEARALLGR EY++GN + AL VF+GIDI  ++P++   +      R+ R 
Sbjct  76    LRETGGLNYEEARALLGRCEYRKGNIELALHVFEGIDIAAVTPKIKVTLARAGEHRRRRS  135

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                +   +  MS+++VSLLLEAI LK+KSL  LG + +AAR CK ILD V+S+ P G+ +
Sbjct  136   QSND---TPPMSVNAVSLLLEAIFLKAKSLQSLGTLEEAARSCKVILDTVESSLPGGLPQ  192

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
               G DCKL ++  +++E LP+LW   G   EA+ SYRR+L+  WNL  + +A +QK+ A+
Sbjct  193   SFGADCKLHDIVSQSVELLPELWKFAGCQHEAILSYRRSLLSHWNLATQTIAKIQKEFAV  252

Query  968   ALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLT  1138
              LL+ G E   SP   RF++   T PK+N+EEAILLL +L+ K+    +EWD  ++DHL+
Sbjct  253   FLLYCGDEA--SPPNLRFQMDRFT-PKSNLEEAILLLMILLRKVSLKRIEWDPSILDHLS  309

Query  1139  FALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAE  1318
             FAL+V G   +LA   E++LPG     +R+Y LALCY  AG++  ALNLLRK+ G+    
Sbjct  310   FALSVSGNSRALATQFEELLPGFINPEDRFYRLALCYYGAGEDSVALNLLRKLLGNG---  366

Query  1319  HEPH-IPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAA  1495
              +P   P+LL+ +K+C  + C + EG+SFA  +++S   +   L S A   LG+     +
Sbjct  367   MDPMCFPALLMASKICGDNRCHAEEGVSFALRSLESADGKCDKLKSTATCLLGISLSAHS  426

Query  1496  KISFSDSERNSYQTQSLNSL-TQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSE  1672
             K +  DSER + QT++L +L T   M    D   ++ L LEYA QRNL  A D A Q   
Sbjct  427   KSAVGDSERVTRQTKALEALKTAGQMTVMSDPIILYHLSLEYAEQRNLDAAVDCAKQMLN  486

Query  1673  MTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPN  1852
             +  GS  KGW LL  I+SA++RF DAE I+D ALD+TG+ DQ + L+ KA LQ+A     
Sbjct  487   LEGGSNVKGWLLLTRILSAQRRFVDAETIIDGALDQTGKWDQGELLRTKAKLQLAEGQIK  546

Query  1853  QAMETYRILLAMIQAQRQS-GMDHEVLS------DRKLEVEAWLDLARIYIDQDSWPDAQ  2011
             +A+ETY  LLA++Q Q++S G             DR LE+E W DLA +YI+   W DA+
Sbjct  547   RAIETYTQLLALLQVQKKSLGYGKRSFKSTRRHFDRNLELEIWHDLAHVYINLAQWSDAE  606

Query  2012  VCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMK  2191
             +C+ K+K I  YS    H TG L+E +   KEA+ AF  +L+IDP ++PS+VS A V+ +
Sbjct  607   ICLFKSKAIRTYSATRCHATGVLYEKKGLYKEAVKAFQEALTIDPSHIPSLVSNAVVVNR  666

Query  2192  MGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGS  2308
             +G+  V + +S LMNAL ++   H AW++LG L K +G+
Sbjct  667   LGNSEV-VVKSFLMNALSLDRMNHSAWYNLGLLYKSQGT  704



>ref|XP_004134050.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Cucumis 
sativus]
 gb|KGN56834.1| hypothetical protein Csa_3G134820 [Cucumis sativus]
Length=732

 Score =   499 bits (1284),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 304/698 (44%), Positives = 437/698 (63%), Gaps = 22/698 (3%)
 Frame = +2

Query  242   RKML-CACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEV  418
             RKM+ C  SG+Q + +E   +  S   LATRD+SASG SS RTG  + E + +   ++E 
Sbjct  19    RKMINCIRSGDQLRVDEMAHSSDS---LATRDYSASGFSS-RTG-GEVEQKVDNGNIEEA  73

Query  419   ESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprk  598
             ES+L+E+  LNYEEARALLGRLEYQ+GN +AAL VF+GIDI  +  R+  + + R    +
Sbjct  74    ESSLRESGYLNYEEARALLGRLEYQKGNIEAALHVFEGIDIAAVISRIKASFSTRYEQNR  133

Query  599   prggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNG  778
              +       V   MS+H++SLLLEAI LK+KSL GLGR  +AA+ CK ILD V+S+FP G
Sbjct  134   RQSQSN---VVPTMSMHAISLLLEAIFLKAKSLHGLGRYVEAAKSCKLILDTVESSFPEG  190

Query  779   MSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKD  958
             + E    DCKLQE   KA++ LP+LW   G   E++ SYRRAL+  WNL+ +  A ++K+
Sbjct  191   LPENFANDCKLQETLTKAVDLLPELWKSAGSPQESILSYRRALLYQWNLEMEARARIEKE  250

Query  959   LAIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMD  1129
              AI LL++G   D SP   R ++  S  P+NNMEEAILLL  LM K   G + WD  +++
Sbjct  251   FAIFLLYSG--CDASPPNLRSQMDSSFVPRNNMEEAILLLMDLMRKYTLGLIVWDPSIIE  308

Query  1130  HLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSS  1309
             HL+FAL+V GEF +LA  VEQ+ PG+  R E++  LALCY   G++  ALNLL+     S
Sbjct  309   HLSFALSVSGEFGALASEVEQLPPGIIGRKEKYCILALCYYGEGKSLVALNLLKNF--LS  366

Query  1310  EAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGN  1489
               E+   +  LLL +KLC ++     EG+++    +     +   L S A   LGV    
Sbjct  367   NIENVDCMLELLLASKLCGENLVCLDEGVAYTMRVLSQLHGKCIQLASVANCLLGVLLSA  426

Query  1490  AAKISFSDSERNSYQTQSLNSLTQAAMLCKE-DAETVFSLGLEYATQRNLTPAFDNALQY  1666
              +K+  SDS++   Q+++L +L  A  L ++ D   V+ L +EYA QR L  A   A Q 
Sbjct  427   MSKLVASDSQKTLKQSEALKALQTAEQLMRQRDPFIVYHLCIEYAEQRKLDFALYYAKQL  486

Query  1667  SEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQH  1846
              ++ AGS+ K + LLA I+SA++ F DAE +++ AL++TG+ +Q + L+ KA LQIA+  
Sbjct  487   VKLEAGSSLKSYVLLARILSAQKWFVDAETVLNAALEQTGKWEQGELLRTKAKLQIAQGQ  546

Query  1847  PNQAMETYRILLAMIQAQRQSG---MDHEVLS-DRKLEVEAWLDLARIYIDQDSWPDAQV  2014
                 +ETY  LLA+IQ Q +S    +  +V   DR LEV+ W DLA IY     W DA++
Sbjct  547   LKNGIETYSHLLAIIQVQNKSSGKMLPKDVRKYDRSLEVDTWHDLANIYTGLSQWRDAEI  606

Query  2015  CIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKM  2194
             C+ K + ID YS   WH+TG L+E++   ++AL A++ +L IDP +VPS++STA +L ++
Sbjct  607   CLSKLQAIDPYSASKWHSTGLLYESKGLPRDALQAYNKALDIDPGHVPSLISTARLLQQL  666

Query  2195  -GSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEG  2305
              GSQ+ P+ RSLL +ALR++     AW+SLG L K + 
Sbjct  667   GGSQSFPVVRSLLTDALRLDRANPSAWYSLGMLYKADA  704



>ref|XP_002443375.1| hypothetical protein SORBIDRAFT_08g018430 [Sorghum bicolor]
 gb|EES17213.1| hypothetical protein SORBIDRAFT_08g018430 [Sorghum bicolor]
Length=715

 Score =   498 bits (1282),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 295/673 (44%), Positives = 436/673 (65%), Gaps = 16/673 (2%)
 Frame = +2

Query  383   ESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRM  562
             E++ ++  + E ES+L+E LSLNYEEARALLGRLEYQRGN +AAL+VF GID++    R 
Sbjct  48    EAKVDDGNIQEAESSLREGLSLNYEEARALLGRLEYQRGNVEAALRVFDGIDLQAAIQRF  107

Query  563   SKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKA  742
               +++E+   ++    + +   SG  S H+ SL+LEAI LKS SL  LG+  +AA++CK+
Sbjct  108   QPSLSEKPLSKRSNKLRSDSSNSG--SQHAASLVLEAIYLKSMSLQKLGKAMEAAKQCKS  165

Query  743   ILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWN  922
             +LD V+S F  G+  GV  + KLQE   K++E LP+LW Q G   EA+ SYRRAL+  WN
Sbjct  166   VLDAVESIFQCGIP-GVMVEPKLQETVSKSVELLPELWKQAGAYQEALASYRRALLSQWN  224

Query  923   LDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPKNNMEEAILLLFVLMGKIQQ  1096
             LD +    +QK  A+ LL+ GVEV   P    +   S  P+NN+EEAILLL +L+ K   
Sbjct  225   LDDECCTRIQKRFAVFLLYGGVEVT-PPSLASQTEGSFVPRNNVEEAILLLMILLKKWFL  283

Query  1097  GEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETA  1276
             G+  WD  VM+HLTFAL++ G+   LA ++E++LPG+  R ERWY LALCY +A  NE A
Sbjct  284   GKTHWDPSVMEHLTFALSLCGQTSILAKHLEEVLPGIYPRTERWYSLALCYFAASHNEAA  343

Query  1277  LNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQ  1456
             LNLLRK    +E+ ++  I +LLL AK+C  +   S EG+ +A+ A+  + + + HL S 
Sbjct  344   LNLLRKSLNKNESPND--IMALLLAAKICGSNYLLSSEGVEYAKRAVKDSESSDGHLKSV  401

Query  1457  ARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNL  1636
             A   LG C    +K++ SD +R+  QT++L SL +A  L +++ E +F +G+EYA QRN+
Sbjct  402   ALHVLGSCLSKKSKVASSDHQRSLLQTEALKSLNEAISLDRQNPELIFDMGIEYAEQRNM  461

Query  1637  TPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflkl  1816
               A   A ++ + T GS +KGW+LL+L++SA+QR+S+AE + D ALDET + +Q   L++
Sbjct  462   HAALKCAKEFIDATGGSVSKGWRLLSLVLSAQQRYSEAEVVTDAALDETAKWEQGPLLRI  521

Query  1817  kaalqIARQHPNQAMETYRILLAMIQAQRQS------GMDHEVLSDRKLEVEAWLDLARI  1978
             +A L++A+  P +A+E YR LLA++QAQR++      G + +   D+  E E W  LA +
Sbjct  522   RAKLKVAQSLPMEAVEAYRTLLALVQAQRKAYGSAKNGTEDD--EDKVSEFEVWQGLANL  579

Query  1979  YIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVP  2158
             Y     W DA++C+ KAK +  YS  + H  G + E  E+ ++AL A+  +LS++ ++VP
Sbjct  580   YSSLSYWRDAEICLQKAKALKTYSATTLHAEGNIHEVHEKIQDALAAYFNALSMEVEHVP  639

Query  2159  SIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqa  2338
             S VS   +L K G + +P+AR  L +ALR++PT   AWF LG++ K +G    AAD FQA
Sbjct  640   SKVSIGALLSKQGPKFLPVARCFLSDALRLQPTNRMAWFYLGEVHKQDGRLADAADCFQA  699

Query  2339  aHELKLSTPVQSF  2377
             A  L+ S PV+SF
Sbjct  700   ASMLEDSDPVESF  712



>emb|CAN65476.1| hypothetical protein VITISV_018246 [Vitis vinifera]
Length=753

 Score =   499 bits (1285),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 312/733 (43%), Positives = 452/733 (62%), Gaps = 28/733 (4%)
 Frame = +2

Query  224   RAHCRRRK---MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRF  394
             R   RRR    M C CSGE+ +    +      E LAT D+SAS    S +  A+ E + 
Sbjct  33    RGGIRRRVEKIMKCLCSGEELR---ADKMIPLSEILATNDYSAS---CSSSRAAELEQKQ  86

Query  395   EEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAI  574
             +   ++E ES+L+E+  LNYEEARALLGR EYQ+GN +AAL VF+GIDI  ++P+M   +
Sbjct  87    DIGNIEEAESSLRESGCLNYEEARALLGRYEYQKGNIEAALHVFEGIDIAAVTPKMKLTL  146

Query  575   tertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDI  754
              +R   R+          +  MS+H+VSLLLEAI LK+KSL GLGR ++AA+ C  ILDI
Sbjct  147   AKRGERRRRHSQSD---AAPPMSIHAVSLLLEAIFLKAKSLQGLGRFKEAAQSCNVILDI  203

Query  755   VDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAK  934
             V+S+ P G+    G DCKLQE  +KA+E LP+LW       EA+ SYRRAL+  WN+D +
Sbjct  204   VESSLPEGLHVNFGSDCKLQETLNKAIELLPELWKLADSPHEAILSYRRALLHAWNIDVE  263

Query  935   RLASMQKDLAIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEV  1105
               A +QK+ AI LL++G E   SP   R ++  S  P+NN+EEAILLL +L+ KI   ++
Sbjct  264   TNAKIQKEFAIFLLYSGGEA--SPPELRSQMDSSFVPRNNIEEAILLLIILLRKISLEKI  321

Query  1106  EWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNL  1285
             EWD  ++DHL++AL++ G   +LA+ VE++LPG   R ER++ LALCY   G + TALN+
Sbjct  322   EWDPSILDHLSYALSLSGGLRALANQVEELLPGTMNRKERYHTLALCYYGDGDSLTALNM  381

Query  1286  LRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARK  1465
             L+K+   S AE+  ++P+LL+ +K+C ++P  + EGISFAR A+ S     + + S A  
Sbjct  382   LKKL--LSNAENPNYLPALLMASKICGENPNFAEEGISFARRALQSLQGGCEEMGSVANC  439

Query  1466  FLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCK-EDAETVFSLGLEYATQRNLTP  1642
              LG+     +K   +DSER S Q ++L++L  A  + K  D + V+ L LE A QR L  
Sbjct  440   LLGISLSAHSKSVVADSERVSRQAEALHALETAGRMIKVRDPKVVYHLSLENAEQRKLDA  499

Query  1643  AFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklka  1822
             A   A  + ++  GS+ KGW LL  I+SA++RF DAEA+++ A+D+TG+ DQ + L+ KA
Sbjct  500   ALYYAKYFIKLEGGSSVKGWLLLTRILSAQKRFKDAEAVINAAIDQTGKWDQGELLRTKA  559

Query  1823  alqIARQHPNQAMETYRILLAMIQAQRQS-GMDHEVLS-----DRKLEVEAWLDLARIYI  1984
              LQIAR    QA+ETY  LLA++Q QR+S G  ++ L      DR LE+ AW DLA +YI
Sbjct  560   KLQIARGRLKQAVETYTHLLAVLQVQRKSFGSGNKFLKGSGYPDRSLELNAWHDLAYLYI  619

Query  1985  DQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSI  2164
                 W +A++C+ K+  I  YS    H  G L+E +   KEAL AF+  L I+P ++P +
Sbjct  620   SLSRWQEAEICLSKSWAISPYSAARCHVMGLLYEKRGLHKEALKAFANGLDIEPTHIPCL  679

Query  2165  VSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaH  2344
             +S A VL  +G+Q+  + RS L  AL+++      W++LG + K +G+A           
Sbjct  680   ISIAVVLRHLGTQSDAVVRSFLTEALQLDRMNPSTWYNLGLVYKAQGAASSQEAAECFEA  739

Query  2345  E--LKLSTPVQSF  2377
                L+ STPV+ F
Sbjct  740   AALLEESTPVEPF  752



>ref|XP_006857444.1| hypothetical protein AMTR_s00067p00173740 [Amborella trichopoda]
 gb|ERN18911.1| hypothetical protein AMTR_s00067p00173740 [Amborella trichopoda]
Length=714

 Score =   498 bits (1282),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 321/723 (44%), Positives = 453/723 (63%), Gaps = 25/723 (3%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             M C CSGEQ      +  PQSPESLATRD+SASG SS      + E R +   ++E ES+
Sbjct  1     MQCLCSGEQL---IGDEMPQSPESLATRDYSASGYSSR---VEEGEPRVDRGNIEEAESS  54

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             L+E + LNYEEARALLGRLEYQRGN +AAL VF+GID+  + P+M  +I  R    + R 
Sbjct  55    LREGICLNYEEARALLGRLEYQRGNIEAALHVFEGIDVGAIVPKMKLSIARRVERSRRRS  114

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                  V    MS+H+VSLLLEAI LK+KSL  L R ++AA  CK +LD V+SA P GM E
Sbjct  115   RSD--VTPPPMSMHAVSLLLEAIFLKAKSLQDLKRFKEAAESCKVVLDTVESALPEGMPE  172

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
               G DCKLQE   KALE LP+LW Q GL  EA++SYRRAL+  WNL+ + LA++QK+ AI
Sbjct  173   NFGADCKLQETLSKALELLPELWKQLGLYQEAISSYRRALINHWNLEPEPLANIQKEFAI  232

Query  968   ALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLT  1138
              LL+ G   D SP   R ++  S  PKNN+EEAILLL +L+ K     ++WD  ++DHLT
Sbjct  233   FLLYGG--TDASPPNLRSQMEASFIPKNNLEEAILLLLILLRKFSLNRIKWDPSIIDHLT  290

Query  1139  FALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAE  1318
             FAL++ G F SLA+ +E+ LPG+  R +RWY L+LCY + G +   ++L       S  E
Sbjct  291   FALSMSGGFLSLANQIEEFLPGVLQREDRWYTLSLCYLAEGLD--GVSLNLLKKLLSSRE  348

Query  1319  HEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQN---KHLLSQARKFLGVCYGN  1489
                 + +LLL +K+C +D   ++EG  +A+  + S   ++   + L S A   +GV    
Sbjct  349   RPDCVRALLLASKICGEDKNLAQEGTYYAQRVLTSLKRKSVECQILESVANCLMGVSLST  408

Query  1490  AAKISFSDSERNSYQTQSLNSLTQAAMLCKE-DAETVFSLGLEYATQRNLTPAFDNALQY  1666
              ++ + SDSER + Q+++L +   A     + D E ++ + LE A QR L  A D A   
Sbjct  409   QSRHAESDSERVTKQSEALQAFEAAEKFTGDNDIEIIYRISLENAEQRRLEVALDYAKGL  468

Query  1667  SEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQH  1846
              +M  GS+ +GW LLA ++SA++RFSDAE ++D AL++TG+ D  + LK KA +Q+A+  
Sbjct  469   LKMEGGSSIRGWILLARVLSAQKRFSDAEMVLDAALEQTGKWDHGRLLKTKAKVQVAKSQ  528

Query  1847  PNQAMETYRILLAMIQAQRQS-GMDHEVLS----DRKLEVEAWLDLARIYIDQDSWPDAQ  2011
                A+ETY  LLA++Q + +  G+   +L     DR LE+E W DLA +Y+    W DA+
Sbjct  529   YKNAIETYTRLLAVLQVRSKCFGVGKRLLKGEDDDRSLEMETWHDLAHVYMSMSQWRDAE  588

Query  2012  VCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMK  2191
             VC+ K+K I+  S   WH TGAL+EA+ +  EAL AFS +L I+P + PS+VS A +L +
Sbjct  589   VCLLKSKAINPCSASRWHATGALYEAKGQNAEALKAFSNALEIEPTHAPSLVSMAAILRQ  648

Query  2192  MGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKME-GSaqqaadffqaaHELKLSTPV  2368
              G +++  ARS L  AL+ + T   AWF+LG + K + GS  +A + FQAA  L+ + PV
Sbjct  649   SGGRSLAAARSFLSEALKHDTTDFSAWFNLGLVYKEDKGSLNEALECFQAAVLLQETAPV  708

Query  2369  QSF  2377
             +SF
Sbjct  709   ESF  711



>gb|KHN01088.1| Tetratricopeptide repeat protein 7A [Glycine soja]
Length=712

 Score =   497 bits (1279),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 304/691 (44%), Positives = 441/691 (64%), Gaps = 22/691 (3%)
 Frame = +2

Query  254   CACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLK  433
             C CS EQ + EE   + +S   LATRD+SASG  SSR G  D   + +   ++E ES+L+
Sbjct  4     CICSREQLRVEELSYSSES---LATRDYSASGGLSSRPGEID--PKVDNTNIEEAESSLR  58

Query  434   EALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprggk  613
             E+  LNYEEARALLGRLEYQ+GN +AAL VF+GIDI  + P++  +I+ R  P K R   
Sbjct  59    ESGYLNYEEARALLGRLEYQKGNIEAALHVFEGIDIAAVIPKLKVSISRRCEPNKRRSQS  118

Query  614   geIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGV  793
               +     MS+H+VSLLLEA+ LK+KS   LGR +DAA+ CK ILD V+SA P G  E  
Sbjct  119   DAM---PPMSMHAVSLLLEAVFLKAKSFQALGRFQDAAQSCKTILDTVESALPEGWPENF  175

Query  794   GEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIAL  973
               DCKLQE    A+E LP+LW   G   + ++SYRRAL+  WNLD +  A +QK+ +  L
Sbjct  176   VSDCKLQETVGNAVELLPELWKLAGSPQDIMSSYRRALLYHWNLDIEATARIQKEFSFFL  235

Query  974   LFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFA  1144
             L++G E   SP   R ++  S  P+NN+EEA+LLL +L+ K   G + WD  ++DHL+FA
Sbjct  236   LYSGCEA--SPPALRSQLDGSFVPRNNIEEAVLLLLILLRKSILGYIAWDPSLLDHLSFA  293

Query  1145  LTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHE  1324
             L+V GEF++LA  +E++LP    R ER+Y LALCY   G++ TAL+LLR  +  +  E+ 
Sbjct  294   LSVSGEFKTLAQQIEELLPESMERKERYYTLALCYCGEGEHITALDLLR--NSLNHRENS  351

Query  1325  PHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKIS  1504
               I  LLL +K+C+ +     EGI ++  A+     +   +++ A   LGV   + ++ +
Sbjct  352   NCIKELLLASKICADNKVCVEEGIKYSCKAISQFNGKCMQMVAIANCLLGVLLSSKSRSA  411

Query  1505  FSDSERNSYQTQSLNSLTQA-AMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTA  1681
              S+SE+   Q+++L++L  A  M+ + D   V  L LEYA QR L+ A D+A +  ++  
Sbjct  412   ASESEKVFMQSEALSALKAAEGMMRESDPYIVLHLCLEYADQRKLSIALDHAKKLIKLED  471

Query  1682  GSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAM  1861
             GS+  G+ LLA I+SA+Q+F DAE ++D ALD++G+ DQ + L+ KA L+IA+     A+
Sbjct  472   GSSVSGYILLARILSAQQKFVDAELVIDAALDQSGKWDQGELLRTKAKLRIAQGKLKNAV  531

Query  1862  ETYRILLAMIQAQRQS-GMDHEVLS-----DRKLEVEAWLDLARIYIDQDSWPDAQVCID  2023
             ETY  LLA++Q Q +S G   +V+      DR+LE+E WLDLA +Y     W DA+VC+ 
Sbjct  532   ETYTFLLAVLQVQNKSLGTASKVVKNKGNRDRRLEMEIWLDLANVYTALSQWQDAEVCLA  591

Query  2024  KAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQ  2203
             K++ I+ YS   WHT G L EA+   +EAL +F  +L I+P++VPS++STA VL ++G Q
Sbjct  592   KSEAINPYSASRWHTKGLLSEARGFHQEALKSFRKALDIEPNHVPSLISTACVLRQLGGQ  651

Query  2204  AVPIARSLLMNALRIEPTCHDAWFSLGKLSK  2296
             +  I RSLL +ALR++ T   AW++LG L K
Sbjct  652   SSSIVRSLLTDALRLDRTNPSAWYNLGLLYK  682



>gb|AES95557.2| calmodulin-binding protein [Medicago truncatula]
Length=696

 Score =   496 bits (1277),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 295/693 (43%), Positives = 434/693 (63%), Gaps = 17/693 (2%)
 Frame = +2

Query  320   LATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRG  499
              + R+  A+G   SR   ++ E++ +E  + E ES L+E LSLN+EEARALLG+LEYQRG
Sbjct  10    FSVREVHANG---SRMAASEVEAKLDEGNIQEAESALREGLSLNFEEARALLGKLEYQRG  66

Query  500   NFDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAIL  679
             N + AL+VF GID+     R+  + +E++  +K R           +S H+ +L+LEAI 
Sbjct  67    NVEGALRVFDGIDLHAAIQRLQPSFSEKSPVKKGRTRTES---PSSVSQHAATLVLEAIY  123

Query  680   LKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWV  859
             LK+KS   LG+  +AA +CK ILD V+  F  G+ +    D KLQE+   A+E LP+LW 
Sbjct  124   LKAKSQQKLGKFAEAANDCKRILDAVEKIFYQGIPD-FQVDGKLQEIVSHAVELLPELWK  182

Query  860   QEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRFKIWC--STP  1033
             Q G  DEA+++YRRAL+  WNLD    + +QK   + LL++GVE    P   +    S  
Sbjct  183   QGGCYDEAISAYRRALLSQWNLDNDCCSRIQKSFVVFLLYSGVEAS-PPSLAVQVDGSYV  241

Query  1034  PKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKT  1213
             PKNN+EEAILLL +L+ K   G+++WD  +M+HLTFAL+V  +   LA   E ++PG+  
Sbjct  242   PKNNLEEAILLLMILIRKFGHGKIKWDPSIMEHLTFALSVCSQTSVLAMQFEDLMPGVYH  301

Query  1214  RAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREG  1393
             R +RW  LALC+ +AGQN +ALNLLRK     + E    + SLLL AK+CS++ C + EG
Sbjct  302   RIDRWNSLALCHCAAGQNVSALNLLRK--SLHKHERPDDLTSLLLAAKICSENTCLAGEG  359

Query  1394  ISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAML  1573
             +  A+ A+ +    N+HL   A + LG+C G  AK++ SD ER+ +Q+++L SL +   L
Sbjct  360   VGHAQRAIKNAHGPNEHLKGVALRMLGLCLGKQAKVASSDFERSRFQSKALESLEEGTRL  419

Query  1574  CKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAE  1753
              K +++ +F L ++YA  RNLT A  +A  +   T GS  K W LLALI+SA+QRF +AE
Sbjct  420   EKNNSDLIFELAVQYAEHRNLTSALRSARHFFNETGGSVVKAWILLALILSAQQRFPEAE  479

Query  1754  AIVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQS----GMDH  1921
              + D ALD+T + +Q   LKLKA L+I++  P  A+ETYR LLA++QAQR+S     +  
Sbjct  480   VVTDAALDQTVRWEQGPLLKLKAKLKISQSKPMDAIETYRYLLALVQAQRKSFGSFQISS  539

Query  1922  EVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERC  2101
             +V  D+  E + W  LA +Y     W DA++C+ KA+ +  YS +   T G LFE   + 
Sbjct  540   KVEDDKVNEFDIWHGLANLYASLSRWKDAEICLQKARELKEYSVEILRTEGILFEGHGQN  599

Query  2102  KEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVP-IARSLLMNALRIEPTCHDAWFS  2278
             +EAL A   ++ ++P++VPS +  + ++ K+GS+A+P  ARS+L +ALRIEPT   AW+ 
Sbjct  600   QEALNAAINAILLEPNHVPSKILMSALIHKIGSKALPAAARSMLSDALRIEPTNPMAWYY  659

Query  2279  LGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             LG + K +G    AAD FQAA  L+   P++SF
Sbjct  660   LGLIHKHDGRMGDAADCFQAASMLEEFDPIESF  692



>ref|XP_004241633.1| PREDICTED: tetratricopeptide repeat protein 7A [Solanum lycopersicum]
Length=702

 Score =   496 bits (1277),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 295/673 (44%), Positives = 433/673 (64%), Gaps = 16/673 (2%)
 Frame = +2

Query  383   ESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRM  562
             E++ +E  + E ES L+E LSLN+EEARALLGRLEYQRGN + AL+VF GID++    RM
Sbjct  34    EAKLDEGNIQEAESALREGLSLNFEEARALLGRLEYQRGNVEGALRVFDGIDLQAAIQRM  93

Query  563   SKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKA  742
               ++TE+   +K R    E  V GV S H+  L+LEAI LK+KSL  LGR+ DAAREC +
Sbjct  94    QPSVTEKQPSKKGRTKSVE-SVPGV-SQHAAGLVLEAIYLKAKSLQKLGRLTDAARECLS  151

Query  743   ILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWN  922
             +LD V+  F +G+ + + E+ KLQE    A+E LP+LW Q G   EA+++YRRAL+  WN
Sbjct  152   VLDAVEKIFESGIPDVLVEN-KLQETVSHAVELLPELWKQAGSYSEAMSAYRRALLSQWN  210

Query  923   LDAKRLASMQKDLAIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQ  1093
             LD    A +QK  A+ LL++GVEV  SP     +I  S  P+NN+EEAILLL +LM K+ 
Sbjct  211   LDNDCCARIQKAFAVFLLYSGVEV--SPPSLAVQIDGSYVPRNNLEEAILLLMILMRKVY  268

Query  1094  QGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNET  1273
              G+++WD  V++HLTFAL+V G+   LA  +E+++PG+  R +RW  LALCY +AGQN+ 
Sbjct  269   LGKIKWDPSVLEHLTFALSVCGQTSVLAKQLEEVMPGVLNRIDRWRCLALCYFAAGQNKN  328

Query  1274  ALNLLRKVSGSSEAEHEPH-IPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLL  1450
             AL+LLRK   S     EP+ + SL+L +K+CS+D   + EG+ +A+ A+ +    N+HL 
Sbjct  329   ALSLLRK---SLHKHEEPNDVLSLVLASKICSEDVLLAAEGVKYAQRAITNAAGSNEHLK  385

Query  1451  SQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQR  1630
                 + LG+C G  AK++ SD ER+  Q+++L SL  A  L  E+++ +F LG++YA  R
Sbjct  386   GVGLRVLGLCLGKQAKVATSDFERSQLQSEALKSLDGAMALEHENSDLMFELGVQYAEHR  445

Query  1631  NLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqfl  1810
             NL  A   A +Y + T GST +GW+LLAL++SA+ R+S+AE + D A DET + DQ   L
Sbjct  446   NLDAALQYARKYVDATGGSTLRGWRLLALVLSAQHRYSEAEVVTDAAFDETTKWDQGPLL  505

Query  1811  klkaalqIARQHPNQAMETYRILLAMIQAQRQSGMDH----EVLSDRKLEVEAWLDLARI  1978
             ++KA L+ ++     A+E YR LL+++QAQR+S        +V  D+  E E W  LA +
Sbjct  506   RMKAKLKTSQSRYIDAVEPYRHLLSLVQAQRKSFGPFRNAPQVEEDKVNEYEVWHGLADL  565

Query  1979  YIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVP  2158
             Y     + DA+ C++KA+ +  YS  + +T G +FE Q    +AL A+  +L ++P++V 
Sbjct  566   YSSLSHFKDAETCLEKARGLIEYSADTLYTEGMMFERQGENDKALSAYINALLVEPNHVQ  625

Query  2159  SIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqa  2338
               +    +L KM    +P+A++LL +ALRIEPT   AW+ LG + + +G    AAD FQA
Sbjct  626   CKILLGSLLTKMDPGMLPLAKALLSDALRIEPTNRVAWYHLGLVHRDDGRVADAADCFQA  685

Query  2339  aHELKLSTPVQSF  2377
             A  L+ S P++ F
Sbjct  686   ASMLEESDPIEKF  698



>ref|XP_007144057.1| hypothetical protein PHAVU_007G125100g [Phaseolus vulgaris]
 ref|XP_007144058.1| hypothetical protein PHAVU_007G125100g [Phaseolus vulgaris]
 ref|XP_007144059.1| hypothetical protein PHAVU_007G125100g [Phaseolus vulgaris]
 ref|XP_007144061.1| hypothetical protein PHAVU_007G125100g [Phaseolus vulgaris]
 gb|ESW16051.1| hypothetical protein PHAVU_007G125100g [Phaseolus vulgaris]
 gb|ESW16052.1| hypothetical protein PHAVU_007G125100g [Phaseolus vulgaris]
 gb|ESW16053.1| hypothetical protein PHAVU_007G125100g [Phaseolus vulgaris]
 gb|ESW16055.1| hypothetical protein PHAVU_007G125100g [Phaseolus vulgaris]
Length=727

 Score =   496 bits (1278),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 304/691 (44%), Positives = 446/691 (65%), Gaps = 20/691 (3%)
 Frame = +2

Query  236   RRRKML-CACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVD  412
             R RKM+ C CSGEQ K +E   + +S   LATRD+SASG  SSR G  D  ++ +   ++
Sbjct  15    RLRKMIKCMCSGEQLKVDELGYSSES---LATRDYSASGGYSSRPGEND--TKVDNTNIE  69

Query  413   EVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrp  592
             E ES+L+E+  LNYEEARALLGRLEYQ+GN +AAL VF+GIDI T+ P++  +I+    P
Sbjct  70    EAESSLRESGYLNYEEARALLGRLEYQKGNVEAALHVFEGIDIATVVPKIKVSISRSCEP  129

Query  593   rkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFP  772
              + R           MS+H+VSL+LEA+ LK+KSL  LGR +DAA+ CK +LD V+SA P
Sbjct  130   NRRRSQSD---THPPMSMHAVSLILEAVFLKAKSLQALGRFQDAAQSCKIVLDTVESALP  186

Query  773   NGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQ  952
              G  E    DCKLQE    A+E LP+LW   G   + ++S+RRAL+  WNL  K  A +Q
Sbjct  187   EGWPENFVSDCKLQETVANAVELLPELWKLTGSPQDVISSFRRALLYHWNLGTKATARIQ  246

Query  953   KDLAIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEV  1123
             K+ A  LL++G E   SP   R ++  S  P++N+EEA+LLL +L+ K   G + WD  +
Sbjct  247   KEFAFFLLYSGCEA--SPPALRSQLDGSFVPRSNLEEAVLLLLILLRKSILGYIVWDPSL  304

Query  1124  MDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSG  1303
             +DHL+FAL+V GEF +LA  VE++LP    R ER+Y LALCYS  G++ T+L+LLR  + 
Sbjct  305   IDHLSFALSVSGEFMTLAQQVEELLPENMDRKERYYTLALCYSGEGEHTTSLDLLR--NS  362

Query  1304  SSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCY  1483
              +  E+   I  LLL +K+C++    + EGI ++  A+     +   +++ A   LGV  
Sbjct  363   LNHRENSDCIKELLLVSKICAEKNIYTEEGIKYSVKAISQLNGKCMQMVAIANCLLGVLL  422

Query  1484  GNAAKISFSDSERNSYQTQSLNSLTQAAMLCKE-DAETVFSLGLEYATQRNLTPAFDNAL  1660
              + +K + S+SE+   Q+++L++L  +    +E D   V  L LEYA QR L+ A D+A 
Sbjct  423   SSKSKSAASESEKVVLQSEALSALKDSERTMRESDPYIVLHLCLEYAEQRKLSIAIDHAK  482

Query  1661  QYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIAR  1840
             +  ++  GS+ +G+ LLA I+SA+++F DAE ++D ALD++G+ DQ + L+ KA L+IA+
Sbjct  483   KLIKLEGGSSVRGYILLARILSAQRKFEDAELVIDAALDQSGKWDQGELLRTKAKLRIAQ  542

Query  1841  QHPNQAMETYRILLAMIQAQRQS-GMDHEVLS--DRKLEVEAWLDLARIYIDQDSWPDAQ  2011
                N A+ETY  LLA++Q Q +S G   ++    D++LE+E W DLA +Y     W DA+
Sbjct  543   GKLNNAVETYTFLLAVLQVQNKSLGTASKIKGNRDKRLEMEIWHDLANVYATLSQWRDAE  602

Query  2012  VCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMK  2191
             VC+ K++ I+ YS   WHT G LFEA+   +EAL +F  +L I+P+YVPS++STA VL +
Sbjct  603   VCLAKSENINPYSASRWHTKGLLFEARGLHQEALKSFRKALDIEPNYVPSLISTACVLRQ  662

Query  2192  MGSQAVPIARSLLMNALRIEPTCHDAWFSLG  2284
             +G Q+  I RSLL +ALR++ T   AW++LG
Sbjct  663   LGGQSSSIVRSLLTDALRLDRTNPSAWYNLG  693



>ref|XP_007144060.1| hypothetical protein PHAVU_007G125100g [Phaseolus vulgaris]
 gb|ESW16054.1| hypothetical protein PHAVU_007G125100g [Phaseolus vulgaris]
Length=738

 Score =   497 bits (1279),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 315/724 (44%), Positives = 465/724 (64%), Gaps = 22/724 (3%)
 Frame = +2

Query  236   RRRKML-CACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVD  412
             R RKM+ C CSGEQ K +E   + +S   LATRD+SASG  SSR G  D  ++ +   ++
Sbjct  26    RLRKMIKCMCSGEQLKVDELGYSSES---LATRDYSASGGYSSRPGEND--TKVDNTNIE  80

Query  413   EVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrp  592
             E ES+L+E+  LNYEEARALLGRLEYQ+GN +AAL VF+GIDI T+ P++  +I+    P
Sbjct  81    EAESSLRESGYLNYEEARALLGRLEYQKGNVEAALHVFEGIDIATVVPKIKVSISRSCEP  140

Query  593   rkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFP  772
              + R           MS+H+VSL+LEA+ LK+KSL  LGR +DAA+ CK +LD V+SA P
Sbjct  141   NRRRSQSD---THPPMSMHAVSLILEAVFLKAKSLQALGRFQDAAQSCKIVLDTVESALP  197

Query  773   NGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQ  952
              G  E    DCKLQE    A+E LP+LW   G   + ++S+RRAL+  WNL  K  A +Q
Sbjct  198   EGWPENFVSDCKLQETVANAVELLPELWKLTGSPQDVISSFRRALLYHWNLGTKATARIQ  257

Query  953   KDLAIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEV  1123
             K+ A  LL++G E   SP   R ++  S  P++N+EEA+LLL +L+ K   G + WD  +
Sbjct  258   KEFAFFLLYSGCEA--SPPALRSQLDGSFVPRSNLEEAVLLLLILLRKSILGYIVWDPSL  315

Query  1124  MDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSG  1303
             +DHL+FAL+V GEF +LA  VE++LP    R ER+Y LALCYS  G++ T+L+LLR  + 
Sbjct  316   IDHLSFALSVSGEFMTLAQQVEELLPENMDRKERYYTLALCYSGEGEHTTSLDLLR--NS  373

Query  1304  SSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCY  1483
              +  E+   I  LLL +K+C++    + EGI ++  A+     +   +++ A   LGV  
Sbjct  374   LNHRENSDCIKELLLVSKICAEKNIYTEEGIKYSVKAISQLNGKCMQMVAIANCLLGVLL  433

Query  1484  GNAAKISFSDSERNSYQTQSLNSLTQAAMLCKE-DAETVFSLGLEYATQRNLTPAFDNAL  1660
              + +K + S+SE+   Q+++L++L  +    +E D   V  L LEYA QR L+ A D+A 
Sbjct  434   SSKSKSAASESEKVVLQSEALSALKDSERTMRESDPYIVLHLCLEYAEQRKLSIAIDHAK  493

Query  1661  QYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIAR  1840
             +  ++  GS+ +G+ LLA I+SA+++F DAE ++D ALD++G+ DQ + L+ KA L+IA+
Sbjct  494   KLIKLEGGSSVRGYILLARILSAQRKFEDAELVIDAALDQSGKWDQGELLRTKAKLRIAQ  553

Query  1841  QHPNQAMETYRILLAMIQAQRQS-GMDHEVLS--DRKLEVEAWLDLARIYIDQDSWPDAQ  2011
                N A+ETY  LLA++Q Q +S G   ++    D++LE+E W DLA +Y     W DA+
Sbjct  554   GKLNNAVETYTFLLAVLQVQNKSLGTASKIKGNRDKRLEMEIWHDLANVYATLSQWRDAE  613

Query  2012  VCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMK  2191
             VC+ K++ I+ YS   WHT G LFEA+   +EAL +F  +L I+P+YVPS++STA VL +
Sbjct  614   VCLAKSENINPYSASRWHTKGLLFEARGLHQEALKSFRKALDIEPNYVPSLISTACVLRQ  673

Query  2192  MGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKME--GSaqqaadffqaaHELKLSTP  2365
             +G Q+  I RSLL +ALR++ T   AW++LG   + +   SA +A + F+AA  L+ STP
Sbjct  674   LGGQSSSIVRSLLTDALRLDRTNPSAWYNLGLFYRADLGTSAMEAVECFEAAAFLEESTP  733

Query  2366  VQSF  2377
             ++ F
Sbjct  734   IEPF  737



>emb|CBI23683.3| unnamed protein product [Vitis vinifera]
Length=725

 Score =   496 bits (1276),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 304/701 (43%), Positives = 430/701 (61%), Gaps = 26/701 (4%)
 Frame = +2

Query  236   RRRKML-CACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVD  412
             R RKM+ C CSGEQ + +E  P+ +S   LATRD+SASG SS R G  D E + + + ++
Sbjct  11    RLRKMMKCICSGEQLRVDEIIPSSES---LATRDYSASGYSS-RAG--DNERKPDTSNIE  64

Query  413   EVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrp  592
             E ES+L+E+  LNYEEARALLGRLEYQ+GN +AAL VF+GIDI  ++P+M  +I  R   
Sbjct  65    EAESSLRESGFLNYEEARALLGRLEYQKGNIEAALHVFEGIDIAAVTPKMKLSIARRCEL  124

Query  593   rkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFP  772
              + R     I     MS+H+VSLL+EAI LK+KSL  LGR  +AA+ CK ILD V+SA P
Sbjct  125   HRRRSQSEAI---PPMSMHAVSLLIEAIFLKAKSLQALGRFGEAAQSCKVILDTVESALP  181

Query  773   NGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQ  952
              G+ E    DCKL E  +KA+E LP+LW   G   EA+ SYR+AL+  WNLD +    ++
Sbjct  182   EGLPENFAADCKLLETLNKAVELLPELWKLAGSPQEAILSYRQALLHNWNLDMETATKIE  241

Query  953   KDLAIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEV  1123
             K+ AI LL++G   D SP   R ++  S  P+NN+EEAILLL +L+ K     + WD  +
Sbjct  242   KEFAIFLLYSG--SDASPPNLRSQMEGSFVPRNNIEEAILLLMILLRKFVLKRIAWDPSI  299

Query  1124  MDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSG  1303
             +DHL+FAL+V GE  +LA  VE +LPG+  R ER+  LALCY   G++  ALN    +  
Sbjct  300   IDHLSFALSVSGELRTLAHQVELLLPGIMERKERFSTLALCYHGEGEDMVALN---LLRN  356

Query  1304  SSEAEHEPHIP-SLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVC  1480
                    P     LLL +K+C ++   + EG  +A  A+     + K + S A   LGV 
Sbjct  357   LLNNRDNPDCTLELLLASKICGENVDCTDEGTDYAHKALSKLQGRCKQMASVANCLLGVS  416

Query  1481  YGNAAKISFSDSERNSYQTQSLNSL-TQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNA  1657
                 ++ S SD +R   Q ++L +L T    +   D   +F L LE A QR L  A   A
Sbjct  417   LSAKSRSSPSDYDRILRQYEALEALETAERTMIDRDPNVLFHLSLENAEQRKLDAALHYA  476

Query  1658  LQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIA  1837
              Q  ++ AGS+ KGW LLA I+SA+++F DAE +++ A+D+TG+ DQ + L+ KA LQIA
Sbjct  477   RQLLKIEAGSSVKGWILLARILSAQKQFEDAECVINAAMDQTGKWDQGELLRTKAKLQIA  536

Query  1838  RQHPNQAMETYRILLAMIQAQRQSG------MDHEVLSDRKLEVEAWLDLARIYIDQDSW  1999
             +     A+ETY  LLA++Q + ++       + +     R+LE+E W DLA +Y     W
Sbjct  537   QGRLKNAIETYTHLLAVLQVRNKNFRVGKQLLKNRANHHRRLEMETWHDLANVYTSLSQW  596

Query  2000  PDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAE  2179
              DA+VC+ K+K I  +S   WH+TG L+EA+   KEAL +F  +L ++P +VPS++STA 
Sbjct  597   RDAEVCLSKSKAIGSHSASRWHSTGLLYEAKGLHKEALKSFGKALDVEPSHVPSLISTAT  656

Query  2180  VLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKME  2302
             VL K+  Q++P  RS L +ALRI+ T   AW++LG + K E
Sbjct  657   VLRKLSDQSLPAVRSFLTDALRIDRTNPSAWYNLGLVCKAE  697



>ref|XP_002285371.2| PREDICTED: tetratricopeptide repeat protein 7A-like [Vitis vinifera]
 ref|XP_010650120.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Vitis vinifera]
 ref|XP_010650121.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Vitis vinifera]
Length=731

 Score =   495 bits (1275),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 304/701 (43%), Positives = 430/701 (61%), Gaps = 26/701 (4%)
 Frame = +2

Query  236   RRRKML-CACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVD  412
             R RKM+ C CSGEQ + +E  P+ +S   LATRD+SASG SS R G  D E + + + ++
Sbjct  17    RLRKMMKCICSGEQLRVDEIIPSSES---LATRDYSASGYSS-RAG--DNERKPDTSNIE  70

Query  413   EVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrp  592
             E ES+L+E+  LNYEEARALLGRLEYQ+GN +AAL VF+GIDI  ++P+M  +I  R   
Sbjct  71    EAESSLRESGFLNYEEARALLGRLEYQKGNIEAALHVFEGIDIAAVTPKMKLSIARRCEL  130

Query  593   rkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFP  772
              + R     I     MS+H+VSLL+EAI LK+KSL  LGR  +AA+ CK ILD V+SA P
Sbjct  131   HRRRSQSEAI---PPMSMHAVSLLIEAIFLKAKSLQALGRFGEAAQSCKVILDTVESALP  187

Query  773   NGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQ  952
              G+ E    DCKL E  +KA+E LP+LW   G   EA+ SYR+AL+  WNLD +    ++
Sbjct  188   EGLPENFAADCKLLETLNKAVELLPELWKLAGSPQEAILSYRQALLHNWNLDMETATKIE  247

Query  953   KDLAIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEV  1123
             K+ AI LL++G   D SP   R ++  S  P+NN+EEAILLL +L+ K     + WD  +
Sbjct  248   KEFAIFLLYSG--SDASPPNLRSQMEGSFVPRNNIEEAILLLMILLRKFVLKRIAWDPSI  305

Query  1124  MDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSG  1303
             +DHL+FAL+V GE  +LA  VE +LPG+  R ER+  LALCY   G++  ALN    +  
Sbjct  306   IDHLSFALSVSGELRTLAHQVELLLPGIMERKERFSTLALCYHGEGEDMVALN---LLRN  362

Query  1304  SSEAEHEPHIP-SLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVC  1480
                    P     LLL +K+C ++   + EG  +A  A+     + K + S A   LGV 
Sbjct  363   LLNNRDNPDCTLELLLASKICGENVDCTDEGTDYAHKALSKLQGRCKQMASVANCLLGVS  422

Query  1481  YGNAAKISFSDSERNSYQTQSLNSL-TQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNA  1657
                 ++ S SD +R   Q ++L +L T    +   D   +F L LE A QR L  A   A
Sbjct  423   LSAKSRSSPSDYDRILRQYEALEALETAERTMIDRDPNVLFHLSLENAEQRKLDAALHYA  482

Query  1658  LQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIA  1837
              Q  ++ AGS+ KGW LLA I+SA+++F DAE +++ A+D+TG+ DQ + L+ KA LQIA
Sbjct  483   RQLLKIEAGSSVKGWILLARILSAQKQFEDAECVINAAMDQTGKWDQGELLRTKAKLQIA  542

Query  1838  RQHPNQAMETYRILLAMIQAQRQSG------MDHEVLSDRKLEVEAWLDLARIYIDQDSW  1999
             +     A+ETY  LLA++Q + ++       + +     R+LE+E W DLA +Y     W
Sbjct  543   QGRLKNAIETYTHLLAVLQVRNKNFRVGKQLLKNRANHHRRLEMETWHDLANVYTSLSQW  602

Query  2000  PDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAE  2179
              DA+VC+ K+K I  +S   WH+TG L+EA+   KEAL +F  +L ++P +VPS++STA 
Sbjct  603   RDAEVCLSKSKAIGSHSASRWHSTGLLYEAKGLHKEALKSFGKALDVEPSHVPSLISTAT  662

Query  2180  VLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKME  2302
             VL K+  Q++P  RS L +ALRI+ T   AW++LG + K E
Sbjct  663   VLRKLSDQSLPAVRSFLTDALRIDRTNPSAWYNLGLVCKAE  703



>ref|XP_003542433.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Glycine 
max]
 gb|KHN48932.1| Tetratricopeptide repeat protein 7A [Glycine soja]
Length=712

 Score =   494 bits (1272),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 298/697 (43%), Positives = 434/697 (62%), Gaps = 24/697 (3%)
 Frame = +2

Query  323   ATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGN  502
             A +DFSAS    +       + + +   ++E ES+L+E+  LNYEEARALLGR EYQ+GN
Sbjct  27    AIKDFSAS---ENSCLAEQLDKKPDTGNIEEAESSLRESGVLNYEEARALLGRYEYQKGN  83

Query  503   FDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILL  682
               AAL VF+GIDI  ++P++  A++     RK             MS+HSV LLLEA+ L
Sbjct  84    IVAALHVFEGIDIGVVTPKIKIALSRSRERRKRHSQNH---AEPQMSIHSVGLLLEAVFL  140

Query  683   KSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQ  862
             K+KSL  L R ++AA+ CK ILDIV+S+ P GM +  G +CKLQE  +KA+E LP+LW  
Sbjct  141   KAKSLQVLERFKEAAQSCKVILDIVESSLPEGMPDNFGAECKLQETLNKAVELLPELWKL  200

Query  863   EGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSP---RFKIWCSTP  1033
                  EA+ SYRRAL+  WNLDA+ +A +QK+ A+ LL++G E   +P   R ++  S  
Sbjct  201   ADCPREAILSYRRALLHHWNLDAETIAKIQKEFAVFLLYSGGEA--TPPNLRSQMDGSFV  258

Query  1034  PKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKT  1213
             P+NN+EEAILLL +L+ K+    +EWD  ++DHL+FAL+V G+  +LA+ +E++LPG   
Sbjct  259   PRNNIEEAILLLMILLRKVSLNRIEWDPSILDHLSFALSVSGDLTALANQLEELLPGTIH  318

Query  1214  RAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREG  1393
             R+ER+Y LALCY    ++  AL+LLRK+  S E +H  H+P LL+ +K+C ++   + EG
Sbjct  319   RSERYYALALCYYGTSKDLVALDLLRKLLRSREDQH--HVPGLLMASKICCENSTLAEEG  376

Query  1394  ISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAML  1573
             +SFA   + +   +   L + A  FLGV     +K++ SDS+R   Q+++L +L  A   
Sbjct  377   VSFAWQVLQNLDGRCNQLENHANFFLGVSLSAHSKLAVSDSDRFKRQSEALQALETAGR-  435

Query  1574  CKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAE  1753
                +   ++ L LEYA QR L  A   A  + ++  GS  KGW LLA I+SA ++F DAE
Sbjct  436   -TGNPFVLYHLSLEYAEQRKLDAALYYAKCFLKLEGGSNVKGWLLLARILSALKQFLDAE  494

Query  1754  AIVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQS-GMDHEVL  1930
             +I++ ALD+TG+ DQ   L+ KA LQIA+     A+ETY  LLA++Q Q +  G   ++ 
Sbjct  495   SIINTALDQTGKWDQGDLLRTKAKLQIAQGQLRNAIETYTQLLAVLQIQSKGFGSGKKLY  554

Query  1931  SD-----RKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQE  2095
              +     R LEVE W D+A +YI    W DA+VC+ K+K I   S    H  G ++EA+ 
Sbjct  555   KENRDRARNLEVEIWHDIAYVYISLLQWHDAEVCLSKSKAIKPLSASRCHAIGIMYEAKG  614

Query  2096  RCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWF  2275
               KEAL AF  +L +DP +VPS++STA VL +  +++ P  +S L++ALR +     AW+
Sbjct  615   HYKEALKAFGDALDVDPGHVPSLISTAVVLKRCSNKSNPAVKSFLVDALRHDRFNASAWY  674

Query  2276  SLGKLSKMEG---SaqqaadffqaaHELKLSTPVQSF  2377
             +LG L K EG   S  +AA+ FQAAH L+ S PV+ F
Sbjct  675   NLGLLHKAEGTASSLVEAAECFQAAHFLEESAPVEPF  711



>ref|XP_008464649.1| PREDICTED: tetratricopeptide repeat protein 7B [Cucumis melo]
Length=708

 Score =   493 bits (1270),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 295/691 (43%), Positives = 439/691 (64%), Gaps = 14/691 (2%)
 Frame = +2

Query  320   LATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRG  499
             +  R+  A+G+S     T + E++ +E  + E ES+L+E LSLN+EEARALLG+LEYQRG
Sbjct  23    IVVREVCANGIS---IKTTEVEAKLDEGNIQEAESSLREGLSLNFEEARALLGKLEYQRG  79

Query  500   NFDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAIL  679
             N + AL+VF GID++    R+   I E+T P+K R           +S H+ +L+LEAI 
Sbjct  80    NVEGALRVFDGIDLQAAIQRLQPCIAEKTPPKKGRLRSES---QHAVSQHAANLVLEAIY  136

Query  680   LKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWV  859
             LK KSL  LGR+ +AA EC ++LD V+  F  G+ +G   D +LQ+   +A+E LP+LW 
Sbjct  137   LKVKSLQKLGRVTEAADECTSVLDAVEKIFHQGIPDG-QVDSRLQDTVSQAVELLPELWK  195

Query  860   QEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDL-SPRFKIWCSTPP  1036
             Q G   EA+++YRRAL+  WNL+ +  A +QK  A+ LL++GVE    S   ++  S  P
Sbjct  196   QAGCFQEAISAYRRALLSQWNLNNESCARIQKGFAVFLLYSGVEAGPPSLAVQLEGSYVP  255

Query  1037  KNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTR  1216
             KNN+EEAILLL VL+ K   G+++WD  VM+HL +AL++  +   LA  +E+++PG+  R
Sbjct  256   KNNLEEAILLLMVLVKKCYLGKIKWDPSVMEHLIYALSLCSQTSVLAKQLEEVMPGVYHR  315

Query  1217  AERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGI  1396
              +RW  LALCY +AGQN+ ALNLLRK     + E    + +LLL AK+CS+DP  + EG+
Sbjct  316   VDRWKSLALCYCAAGQNKVALNLLRK--SLHKHEQPDDVAALLLAAKICSEDPYLAAEGV  373

Query  1397  SFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLC  1576
              +A+ AM + +   +HL     + LG+C G  AK+S SD ER+  Q+++L SL  A+ L 
Sbjct  374   GYAQRAMSNCIENEEHLKGVGLRLLGLCLGKQAKMSSSDFERSRLQSEALKSLEAASGLE  433

Query  1577  KEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEA  1756
               + + +  LG++Y+  RNL  A   A ++ + T GS  KGW+LLAL++SA++RFS+AE 
Sbjct  434   SNNLDLMLELGVQYSEYRNLNAALQYAKKFIDETGGSVLKGWQLLALVLSAQKRFSEAEV  493

Query  1757  IVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQS----GMDHE  1924
             + D A+DET + +Q   L+LKA L++++     A+ETYR LLA++QAQ++S     +  +
Sbjct  494   VTDAAMDETTKWEQGPLLRLKAKLKVSQSLHMDAIETYRYLLALVQAQKKSFGPLRIVPQ  553

Query  1925  VLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCK  2104
             V  D+  E E W  LA +Y     W DA++C+ KA+ +  +SP+  HT G + E +E+ +
Sbjct  554   VEDDKVNEFEVWNGLANLYSSLSHWKDAEICLGKARELKEFSPEVLHTEGLMCEGREKIQ  613

Query  2105  EALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLG  2284
             EAL A+  +L ++P YVP  V    +  K G  A+PIARSLL +ALR++PT   AWF LG
Sbjct  614   EALAAYINALLLEPTYVPCKVLIGALWSKAGPDALPIARSLLSDALRLDPTNRKAWFYLG  673

Query  2285  KLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
              + + EG    A D FQAA  L+ S P++SF
Sbjct  674   VIHRDEGRMADAIDCFQAAAMLEESDPIESF  704



>ref|XP_009781614.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Nicotiana 
sylvestris]
Length=723

 Score =   494 bits (1271),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 293/694 (42%), Positives = 436/694 (63%), Gaps = 23/694 (3%)
 Frame = +2

Query  239   RRKMLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEV  418
             R+ M C CSGEQ + ++ + +      LAT+D++ + L SSR   A  E + +   ++E 
Sbjct  17    RKIMKCFCSGEQLQIDDRDES------LATKDYT-TRLRSSRAREA--EQKPDIGDIEEA  67

Query  419   ESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprk  598
             ES+L+E+ +LNYEEARALLGR EYQ+GN +AAL VF+GIDI +++ ++   +  R R +K
Sbjct  68    ESSLRESGALNYEEARALLGRYEYQKGNIEAALHVFEGIDIASVTTKIKVTLAIRARTKK  127

Query  599   prggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNG  778
              R  K +      MS+H+VSLLLEA+ LK+KSL  LGR ++AA+ C  ILDIV+S+ P G
Sbjct  128   RRSQKYD---KSPMSIHAVSLLLEAVFLKAKSLQVLGRCKEAAQSCTVILDIVESSLPEG  184

Query  779   MSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKD  958
             + E  G DCKLQE    A+E LP+LW+      EA+ SYRRAL+  WNLD +  A +QK+
Sbjct  185   LPENFGADCKLQETLSNAVELLPQLWILADSPREAIISYRRALLHRWNLDVQTNAKIQKE  244

Query  959   LAIALLFAGVE-VDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHL  1135
              +I LL++G E +  S RF++  S  P+ N+EEAILLL +L+ K+    +EWD  ++DHL
Sbjct  245   FSIFLLYSGSEYIPPSLRFQMDSSFVPRTNIEEAILLLMILLRKVTLQSIEWDPSILDHL  304

Query  1136  TFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEA  1315
             ++AL++     +LA+ VE++LP    + ER+  LALCY   G N TALNLLRK+  SSE 
Sbjct  305   SYALSISDGLTALANQVEELLPRNIDQRERYLILALCYYGGGDNFTALNLLRKLLSSSE-  363

Query  1316  EHEPH-IPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNA  1492
               +P  +P LLL +++C++    + +GI+FAR A++    +   L+  A   LG+     
Sbjct  364   --DPTCVPGLLLASRICAESLEYAGDGINFARRAIERMQGRCDRLIGVANYVLGLSLSTQ  421

Query  1493  AKISFSDSERNSYQTQSLNSLTQAAMLCK-EDAETVFSLGLEYATQRNLTPAFDNALQYS  1669
             ++    DSER   Q+++L SL  A  L    D+  ++ L +E A QR L  A   A    
Sbjct  422   SRAVLKDSERVKMQSEALQSLESAGELTTMNDSNVIYHLCVENAEQRKLDMALHYAKCLL  481

Query  1670  EMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHP  1849
             ++  GST KGW LLA ++SA+++F +AE I+D ALD++G+ DQ + L+ KA LQIA+   
Sbjct  482   KLEDGSTLKGWMLLARVLSAQKQFPEAETIIDAALDQSGKWDQGELLRTKAKLQIAQGQV  541

Query  1850  NQAMETYRILLAMIQAQRQS-----GMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQV  2014
               A+ETYR LLA++Q QR+S      +  E   +R +E+E W DLA IYI    W DA++
Sbjct  542   KSAIETYRQLLAVLQVQRKSFGLAENLKEEGNRNRTMELEMWHDLASIYIKSSQWQDAEI  601

Query  2015  CIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKM  2194
             C+ K++ I  YS    + +G L +++   K AL  ++ +L+IDP ++PS++STA VL ++
Sbjct  602   CLSKSEAISFYSASRLYISGLLQQSKGLYKAALRDYTKALAIDPCHIPSLISTAVVLRQI  661

Query  2195  GSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSK  2296
             G  +  I RS LM ALR++ T   AW +LG L K
Sbjct  662   GDHSPGIVRSFLMEALRLDRTSASAWHNLGLLYK  695



>ref|XP_002275620.1| PREDICTED: tetratricopeptide repeat protein 7A [Vitis vinifera]
 ref|XP_010652392.1| PREDICTED: tetratricopeptide repeat protein 7A [Vitis vinifera]
 ref|XP_010652393.1| PREDICTED: tetratricopeptide repeat protein 7A [Vitis vinifera]
Length=732

 Score =   494 bits (1271),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 310/733 (42%), Positives = 449/733 (61%), Gaps = 28/733 (4%)
 Frame = +2

Query  224   RAHCRRRK---MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRF  394
             R   RRR    M C CSGE+ +    +      E LAT D+SAS    S +  A+ E + 
Sbjct  12    RGGIRRRVEKIMKCLCSGEELR---ADKMIPLSEILATNDYSAS---GSSSRAAELEQKQ  65

Query  395   EEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAI  574
             +   ++E ES+L+E+  LNYEEARALLGR EYQ+GN +AAL VF+GIDI  ++P+M   +
Sbjct  66    DIGNIEEAESSLRESGCLNYEEARALLGRYEYQKGNIEAALHVFEGIDIAAVTPKMKLTL  125

Query  575   tertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDI  754
              +R   R+ R        +  MS+H+VSLLLEAI LK+KSL GLGR ++AA+ C  ILDI
Sbjct  126   AKRGERRRRRSQSD---AAPPMSIHAVSLLLEAIFLKAKSLQGLGRFKEAAQSCNVILDI  182

Query  755   VDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAK  934
             V+S+ P G+    G DCKLQE  +KA+E LP+LW       EA+ SYRRAL+  WN+D +
Sbjct  183   VESSLPEGLHVNFGSDCKLQETLNKAIELLPELWKLADSPHEAILSYRRALLHAWNIDVE  242

Query  935   RLASMQKDLAIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEV  1105
               A +QK+ AI LL++G E   SP   R ++  S  P+NN+EEAILLL +L+ KI   ++
Sbjct  243   TNAKIQKEFAIFLLYSGGEA--SPPELRSQMDSSFVPRNNIEEAILLLIILLRKISLEKI  300

Query  1106  EWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNL  1285
             EWD  ++DHL++AL++ G   +LA+ VE++LPG   R ER++ LALCY   G  ++   L
Sbjct  301   EWDPSILDHLSYALSLSGGLRALANQVEELLPGTMNRKERYHTLALCYY--GDGDSLTAL  358

Query  1286  LRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARK  1465
                    S AE+  ++P+LL+ +K+C ++P  + EGISFAR A+ S     + + S A  
Sbjct  359   NLLKKLLSNAENPNYLPALLMASKICGENPNFAEEGISFARRALQSLQGGCEEMGSVANC  418

Query  1466  FLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCK-EDAETVFSLGLEYATQRNLTP  1642
              LG+     +K   +DSER S Q ++L++L  A  + K  D + V+ L LE A QR L  
Sbjct  419   LLGISLSAHSKSVVADSERVSRQAEALHALETAGRMIKVRDPKVVYHLSLENAEQRKLDA  478

Query  1643  AFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklka  1822
             A   A  + ++  GS+ KGW LL  I+SA++RF DAEA+++ A+D+TG+ DQ + L+ KA
Sbjct  479   ALYYAKYFIKLEGGSSVKGWLLLTRILSAQKRFKDAEAVINAAIDQTGKWDQGELLRTKA  538

Query  1823  alqIARQHPNQAMETYRILLAMIQAQRQS-GMDHEVLS-----DRKLEVEAWLDLARIYI  1984
              LQIAR    QA+ETY  LLA++Q QR+S G  ++ L      DR LE++AW DLA +YI
Sbjct  539   KLQIARGRLKQAVETYTHLLAVLQVQRKSFGSGNKFLKGSGYPDRSLELDAWHDLAYLYI  598

Query  1985  DQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSI  2164
                 W +A++C+ K++ I  YS    H  G L+E Q   KEAL AF+  L I+P ++P +
Sbjct  599   SLSRWHEAEICLSKSRAISPYSAARCHAMGLLYEKQGLHKEALKAFANGLDIEPTHIPCL  658

Query  2165  VSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaH  2344
             +S A VL  +G+Q+  + RS L  AL+++     AW++LG + K +G+A           
Sbjct  659   ISIAVVLRHLGTQSDAVVRSFLTQALQLDRMNPSAWYNLGLVYKAQGAASLQEAAECFEA  718

Query  2345  E--LKLSTPVQSF  2377
                L+ STPV+ F
Sbjct  719   AALLEESTPVEPF  731



>ref|NP_001064828.1| Os10g0471400 [Oryza sativa Japonica Group]
 gb|ABB47781.1| TPR Domain containing protein, expressed [Oryza sativa Japonica 
Group]
 gb|ABB47782.1| TPR Domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF26742.1| Os10g0471400 [Oryza sativa Japonica Group]
 gb|EEE51120.1| hypothetical protein OsJ_31862 [Oryza sativa Japonica Group]
Length=727

 Score =   492 bits (1267),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 297/702 (42%), Positives = 428/702 (61%), Gaps = 21/702 (3%)
 Frame = +2

Query  224   RAHCRRRKMLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEA  403
             R   RR  M C CSGEQ +  +            T+D SASG SS      + E   +  
Sbjct  12    RGFVRRMAMECLCSGEQLRAADEIIRSPESAI--TKDCSASGYSSQ---NGEIEQYLDNG  66

Query  404   QVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAIter  583
              ++E E +L+E + LNYEEARALLGRLEYQRG+ +AAL+VF GIDI  L P+M  +I  +
Sbjct  67    NIEEAELSLREGVCLNYEEARALLGRLEYQRGHVEAALRVFDGIDIPALVPKMKISIARK  126

Query  584   trprkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDS  763
                RK R        S  M LH+VSLL+EAI LKS++L  LG+ ++AA+EC+ ILDIV++
Sbjct  127   VDRRKTRSQWD----SPPMPLHAVSLLMEAIYLKSRALHDLGKFKEAAQECRMILDIVEA  182

Query  764   AFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLA  943
             A P G+  G G+DCKL E+  KA+E LP+LW   G   EA++SYRR+L+  WNLD + +A
Sbjct  183   AVPEGLPAGFGKDCKLNEIICKAVELLPELWKLGGFSLEAISSYRRSLLNNWNLDGETIA  242

Query  944   SMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDS  1117
              +QK+ AI LL++G E    P    ++  S  P+NNMEEAILLL +L+ K     VE D 
Sbjct  243   RIQKEFAIFLLYSGCEAR-PPNLHSQLDGSFVPRNNMEEAILLLMILLRKFNLKRVERDP  301

Query  1118  EVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKV  1297
              +M HLTFAL++ G+ +SLA   E++LPGM  + E  Y +ALCY +   + TALNLL+++
Sbjct  302   TIMHHLTFALSISGQLKSLAVQFEELLPGMLDKREWSYNVALCYLAEEDDSTALNLLKRI  361

Query  1298  SGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGV  1477
               S   +   +   LLL +K C++   ++ EG S+A+ A+ +     + +   A   LGV
Sbjct  362   LKS--GDDSDNFKELLLASKACTERSAQT-EGASYAQRAIANMQGGCEQMAGVADLLLGV  418

Query  1478  CYGNAAKISFSDSERNSYQTQSLNSLTQAA-MLCKEDAETVFSLGLEYATQRNLTPAFDN  1654
                N A+ + SD+ER S+Q ++L  L  A   +  +D   ++SL LE A QR L  A   
Sbjct  419   NLSNQARCATSDTERASWQCEALEVLENAENKMHGKDPRAMYSLSLENADQRKLDAAAFY  478

Query  1655  ALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqI  1834
             A +  ++ AGS  + W LLA I+SA+++F+DAE I+D ALD+TG+  Q   L+ KA +Q 
Sbjct  479   AKKLVKLEAGSELRSWLLLARILSAQKQFADAETIIDAALDQTGKWSQGDLLRTKARIQA  538

Query  1835  ARQHPNQAMETYRILLAMIQAQRQS-----GMDHEVLSDRKLEVEAWLDLARIYIDQDSW  1999
             A+     A+ETY  LLA+IQ + +S      +      D  LE+E W DLA +Y+    W
Sbjct  539   AQGQLRNAVETYTKLLAVIQLRTKSLSAGIFLAKGTKDDISLEIETWYDLALLYLRMSQW  598

Query  2000  PDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAE  2179
              DA+VC+ K +TI  YS  +WH  G L+EA+ + KEAL ++  +L +D  +VPS++STA 
Sbjct  599   RDAEVCVSKIRTISPYSALAWHVKGKLYEAKGQPKEALGSYFRALDLDRKHVPSLISTAS  658

Query  2180  VLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEG  2305
             VL ++G++ +P  R  L +AL+++ T H AWF+LG L K EG
Sbjct  659   VLREIGNRPLPSVRCFLTDALQLDRTNHAAWFNLGLLYKEEG  700



>ref|XP_011026195.1| PREDICTED: tetratricopeptide repeat protein 7A [Populus euphratica]
 ref|XP_011026196.1| PREDICTED: tetratricopeptide repeat protein 7A [Populus euphratica]
 ref|XP_011026197.1| PREDICTED: tetratricopeptide repeat protein 7A [Populus euphratica]
Length=701

 Score =   491 bits (1264),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 296/690 (43%), Positives = 433/690 (63%), Gaps = 16/690 (2%)
 Frame = +2

Query  326   TRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNF  505
             +R+  A+G+      T++ E++ +E  + E ES+L+E LSLN+EEARALLGRLEYQRGN 
Sbjct  18    SREVWANGIC---MKTSEVEAKLDEGNIQEAESSLREGLSLNFEEARALLGRLEYQRGNV  74

Query  506   DAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLK  685
             +AAL VF GID++    R+  + +E+   RK R           +S HS SL+LEAI LK
Sbjct  75    EAALHVFDGIDLQVAIQRLQPSFSEKQPSRKGRSRGDS---QHAVSQHSASLVLEAIYLK  131

Query  686   SKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQE  865
             +KSL  LGR+ DAA ECK +LD V+  F  G+ + V  D +LQ+   +A+E LP+L  Q 
Sbjct  132   AKSLQKLGRLNDAAHECKRVLDAVEKIFHQGIPD-VQVDNRLQDTVRQAVELLPELLKQA  190

Query  866   GLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPK  1039
             G   EA+++YRRAL+  WNLD    + +QK  A+ L+ +GVE    P    ++  S  PK
Sbjct  191   GCYQEAMSAYRRALLSQWNLDDDNCSRIQKAFAVFLMHSGVEAG-PPSLAAQVDGSYVPK  249

Query  1040  NNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRA  1219
             +N+EEAILLL +L+ K   G++ WD  V++HLTFAL++ G+   LA  +E+I+PG+  R 
Sbjct  250   HNLEEAILLLMILVRKFYLGKIVWDPSVLEHLTFALSLCGQTSVLAKELEEIMPGVFHRV  309

Query  1220  ERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGIS  1399
             +RW  LALCYS+ GQN  ALNLLRK     + E    + +LLL AK+C +D   + EG+ 
Sbjct  310   DRWNTLALCYSAVGQNTAALNLLRK--SLHKHEQPDDLIALLLAAKICCEDSHLAAEGVG  367

Query  1400  FARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCK  1579
             +A+ A+ +   +N+HL   A + LG+C G  A IS SD ER+  Q+++L  L  A  L K
Sbjct  368   YAQRAIANAQGRNEHLKGVAIRILGLCSGKQATISPSDFERSRLQSEALKLLDAAISLEK  427

Query  1580  EDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAI  1759
              + + +F LG+ YA QRNL  A   A Q+ + T GS  KGW+LLALI+SA+QRFS+AE +
Sbjct  428   NNPDLLFELGMLYAEQRNLNTALRYAKQFVDATGGSLLKGWRLLALILSAQQRFSEAEVV  487

Query  1760  VDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQSGMDHEVLS--  1933
             +D ALDET + +Q   L+LKA L+ ++  P  A+ETYR LLA++QAQR+S      +S  
Sbjct  488   IDAALDETAKWEQGPLLRLKAKLKTSQSLPMDAIETYRYLLALVQAQRKSFGPLRSVSQA  547

Query  1934  --DRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKE  2107
               DR  E E W  LA +Y     W D +VC+ KA  +  YS +  +T G + + + + +E
Sbjct  548   GDDRVNEYEVWHGLADLYSRLSHWKDMEVCLGKAGELKQYSAEVLYTEGVMLQGRGKVEE  607

Query  2108  ALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGK  2287
             A+ ++  +L +DP +V   +    +L K  + A+P+ARS+L +AL+IEPT   AW+ LG 
Sbjct  608   AMSSYINALLLDPSFVRCKILIGALLSKRDTNALPVARSILSDALKIEPTNRMAWYYLGI  667

Query  2288  LSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             + +++G    AAD FQAA  L+ S P+++F
Sbjct  668   IHRVDGRIADAADCFQAASMLEESDPIENF  697



>ref|XP_010275890.1| PREDICTED: uncharacterized protein LOC104610799 [Nelumbo nucifera]
Length=652

 Score =   489 bits (1259),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 284/651 (44%), Positives = 418/651 (64%), Gaps = 18/651 (3%)
 Frame = +2

Query  455   EEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSG  634
             EEARALLGRLEYQRGN + AL+VF G D++    R+   +TE+   R+ R     +    
Sbjct  4     EEARALLGRLEYQRGNLEGALRVFDGADLQAAIQRLQPTLTEKAASRRNRSRTESM---Q  60

Query  635   VMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQ  814
             +++ +S +L+LEA+ LK+KSL  LGRI +A  ECK +LDIV+  F N + + +  D KLQ
Sbjct  61    IVTQNSANLVLEAMYLKAKSLQKLGRITEATEECKNVLDIVERVFHNCILD-MASDNKLQ  119

Query  815   EMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEV  994
             E   +A+E LP+LW Q G   EA++SYRRAL+  WNLD +  A +QK  A+ LL++GVE 
Sbjct  120   ETVSRAVELLPELWKQAGGFQEAMSSYRRALLSQWNLDNECCARIQKKFALFLLYSGVEA  179

Query  995   DLSPRF--KIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFE  1168
                P    +I  S  P+NN+EEAILLL +L+ K   G+++WD  +M++LTFAL++ G+  
Sbjct  180   G-PPNLASQIDGSYVPRNNLEEAILLLMILLRKFHLGKIKWDPSIMEYLTFALSLCGKTS  238

Query  1169  SLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLL  1348
              LA  +E+ILPG+  R +RW  +ALCYS+AG+N  ALNLLRK     E   E  I +LLL
Sbjct  239   ILARQMEEILPGVFHRCDRWNIMALCYSAAGENAVALNLLRKSLNKHEKPDE--ILALLL  296

Query  1349  GAKLCSQDPCKSREGISFARGAMDST--VNQNKHLLSQARKFLGVCYGNAAKISFSDSER  1522
              A++CS DP  + EG+ +A+ A+ +   V+ ++HL     + LG+C G  AK++ SD ER
Sbjct  297   AARICSGDPLLAAEGVGYAQRAIATAQGVHVHEHLKGVGFRMLGLCLGKQAKVASSDHER  356

Query  1523  NSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGW  1702
             +  QT++L SL  A    + + + +F LGL++A  RN   A   A Q+ + T GS  KGW
Sbjct  357   SHLQTEALKSLDAAIAFEQNNPDLIFDLGLQHAEHRNSHAALRCAKQFIDATGGSMLKGW  416

Query  1703  KLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILL  1882
             +LLAL++SA+QR+S+A+ I+D ALDET + +Q   L++KA L+I++  P  A+ETYR LL
Sbjct  417   RLLALVLSAQQRYSEAQVIIDAALDETAKWEQGPLLRMKAKLKISQSLPMDAVETYRFLL  476

Query  1883  AMIQAQRQ------SGMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDI  2044
             A++QAQR+      S + H V  D+  E+E W  LA +Y     W DA++C++KA+ +  
Sbjct  477   ALVQAQRKSFGPLRSSILH-VEDDKISELEVWQGLANLYSSLSHWHDAEICLEKARALMQ  535

Query  2045  YSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARS  2224
             Y P + H  G +++ + +  EAL A+S  +S+DP YVPS V    +L KMG  ++P+A+S
Sbjct  536   YCPATLHAEGIMYDGRGQMLEALAAYSNGISLDPSYVPSRVLIGALLRKMGPNSLPVAKS  595

Query  2225  LLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
              L +ALR+EPT   AW+ LG + K +G    A D FQAA  L+ + P++SF
Sbjct  596   FLSDALRLEPTNRAAWYYLGMIHKDDGRISDACDCFQAASMLEEADPIESF  646



>ref|NP_001067047.1| Os12g0565300 [Oryza sativa Japonica Group]
 gb|ABA98977.1| calmodulin-binding protein MPCBP, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF30066.1| Os12g0565300 [Oryza sativa Japonica Group]
 dbj|BAG93734.1| unnamed protein product [Oryza sativa Japonica Group]
Length=726

 Score =   492 bits (1266),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 293/669 (44%), Positives = 430/669 (64%), Gaps = 12/669 (2%)
 Frame = +2

Query  389   RFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSK  568
             R ++  + E ES+L+E LSLNYEEARALLGRLEYQRGN +AAL+VF GID++    R   
Sbjct  61    RVDDGNIQEAESSLREGLSLNYEEARALLGRLEYQRGNVEAALRVFDGIDLQAAIQRFQP  120

Query  569   AItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAIL  748
             +++E+   ++    + +   SG  S H+ SL+LEAI LKS SL  LG+  +AA++C+++L
Sbjct  121   SLSEKPPSKRSNKLRSDSSNSG--SQHAASLVLEAIYLKSMSLQKLGKAVEAAQQCRSVL  178

Query  749   DIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLD  928
             D V+S F  G+ + + E  KLQE   K++E LP+LW Q G   EA+ SYRRAL+  WNLD
Sbjct  179   DAVESIFQRGIPDVMVEQ-KLQETVSKSVELLPELWKQAGAYQEALASYRRALLSQWNLD  237

Query  929   AKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPKNNMEEAILLLFVLMGKIQQGE  1102
                   +QK  A+ LL+ GVE    P    +   S  PKNN+EEAILLL +++ K   G+
Sbjct  238   DDCCTRIQKRFAVFLLYGGVEAS-PPSLASQTEGSYVPKNNLEEAILLLMIILKKWYLGK  296

Query  1103  VEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALN  1282
               WD  VM+HLTFAL++ G+   LA ++E++LPG+  R  RWY LALC  +A  NE ALN
Sbjct  297   THWDPSVMEHLTFALSLCGQTSVLAKHLEEVLPGIYPRTGRWYSLALCNYAASHNEAALN  356

Query  1283  LLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQAR  1462
             LLRK+   +E+  +  I +LLL AKLCS D   + EG+ +AR A+ +  + + HL S A 
Sbjct  357   LLRKLLNKNESPGD--IMALLLAAKLCSSDYSLASEGVEYARRAVTNVDSSDGHLKSAAL  414

Query  1463  KFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTP  1642
              FLG C    ++I+ SD +R+  QT+SL SL++A  L + + + ++ +G+EYA QRN+  
Sbjct  415   HFLGSCLAKKSRIATSDHQRSLLQTESLKSLSEAISLDRHNPDLIYDMGIEYAEQRNMQA  474

Query  1643  AFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklka  1822
             A   A ++ + T GS +KGW+LL+L++SA+QR+S+AE + D ALDET + +Q   L++KA
Sbjct  475   ALKCAKEFIDATGGSVSKGWRLLSLVLSAQQRYSEAEVVTDAALDETTKWEQGPLLRIKA  534

Query  1823  alqIARQHPNQAMETYRILLAMIQAQRQS----GMDHEVLSDRKLEVEAWLDLARIYIDQ  1990
              L++A+  P +A+E YR LLA++QAQR++        E + ++  E E W  LA +Y   
Sbjct  535   KLKVAQSLPMEAVEAYRALLALVQAQRKAYGTVKNGTEEVDNKVSEFEVWQGLANLYASL  594

Query  1991  DSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVS  2170
               W DA++C+ KAK +  +S  + H  G   E +E+ ++AL A+  ++S + ++VPS VS
Sbjct  595   SYWRDAEICLQKAKALKSFSAITLHAEGYTREVREQTQDALAAYFNAVSTEVEHVPSKVS  654

Query  2171  TAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHEL  2350
                +L K G + +P+ARS L +ALR EPT   AWF LGK+ K +G    AAD FQAA  L
Sbjct  655   IGALLSKQGPKYLPVARSFLSDALRHEPTNRMAWFYLGKVHKHDGRLADAADCFQAASML  714

Query  2351  KLSTPVQSF  2377
             + S P++SF
Sbjct  715   EESDPIESF  723



>ref|XP_008785177.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Phoenix 
dactylifera]
 ref|XP_008785179.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Phoenix 
dactylifera]
 ref|XP_008785180.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Phoenix 
dactylifera]
Length=708

 Score =   491 bits (1263),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 305/696 (44%), Positives = 431/696 (62%), Gaps = 25/696 (4%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             M C  SGEQ +  E   + +S   +AT+D SASG SS      + E R +   ++E E +
Sbjct  1     MKCLFSGEQLRVNELIRSSES---VATKDCSASGYSSQ---NGEGEQRLDTGNIEEAEYS  54

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             L++ + LNYEEARALLGRLEYQRGN +AAL VF GIDI  ++P+M  +I++RT+  K R 
Sbjct  55    LRDGICLNYEEARALLGRLEYQRGNIEAALCVFNGIDIAAIAPKMKISISKRTKCCKSRS  114

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                    +  MS+H+VSLL+EAI LK+++L  LGR ++AA+ C  ILD V++A P  + E
Sbjct  115   HWD----APPMSIHAVSLLVEAIYLKARALQDLGRFKEAAQTCNIILDTVETALPEALPE  170

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
                 DCKLQE   KA+E LP+LW   G   EA++S+RRAL+  WNLD++ +A +QK+ AI
Sbjct  171   NFTADCKLQETVCKAVELLPELWKLAGFSHEAISSFRRALLSHWNLDSETVAKIQKEFAI  230

Query  968   ALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLT  1138
              LL+ G   D SP   R ++  S  P+NN EEAILLL +L+ K    +VEWD   +DHL 
Sbjct  231   FLLYGG--CDASPPDLRSQMDGSFIPRNNTEEAILLLMILLRKFSLKKVEWDPSAIDHLI  288

Query  1139  FALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAE  1318
             FAL+V G+  SLA+ ++++LP +  R E +Y LALCY   G N TALNLL+K+     A 
Sbjct  289   FALSVSGQLNSLANQIDELLPDVLERKECYYTLALCYLGEGDNLTALNLLKKL---LRAR  345

Query  1319  HEPH-IPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAA  1495
              +P+ + +LLL +K+C ++   + EG+SFAR A+ +       + S A   LG+     A
Sbjct  346   EDPNCVKALLLASKVCGENSAYAEEGVSFARRALSNLHRGCDQMDSVANCLLGISLSAQA  405

Query  1496  KISFSDSERNSYQTQSLNSLTQAA-MLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSE  1672
             + S SDS+R S Q ++L +L +A  M+  +D   +F+L LE A QR L  A   A Q  +
Sbjct  406   RSSTSDSDRVSRQAEALAALEKAEQMMLGKDHRILFNLSLENAEQRKLDAALHYAKQLLK  465

Query  1673  MTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPN  1852
               AGS  K W LL  I+SA++RF DAE IV+ ALD+TG+  Q + LK KA +QIA+    
Sbjct  466   FEAGSNVKEWILLIQILSAQKRFVDAETIVNAALDQTGKWSQGELLKTKAKIQIAQGQLK  525

Query  1853  QAMETYRILLAMIQAQRQSGMDHEVLS-----DRKLEVEAWLDLARIYIDQDSWPDAQVC  2017
              +++TY  +L++I  Q +S       S     DR LE+E WLDLA +YI    W DA+VC
Sbjct  526   NSIDTYAHILSIIHLQAKSSSIAIKSSKGGKCDRNLEMETWLDLANVYISMSQWRDAEVC  585

Query  2018  IDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMG  2197
             + K K I   S   WH TG L+E +   KEAL A++ +L ++P +V S++STA VL K+G
Sbjct  586   LSKLKGISPLSALGWHATGKLYEGKGLHKEALGAYTKALDLEPTHVASLISTATVLRKIG  645

Query  2198  SQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEG  2305
                + + RS L +AL ++ T H AWF+LG L K EG
Sbjct  646   DWPMAVVRSFLTDALWLDRTNHIAWFNLGLLYKSEG  681



>ref|XP_010093076.1| Tetratricopeptide repeat protein 7A [Morus notabilis]
 gb|EXB53504.1| Tetratricopeptide repeat protein 7A [Morus notabilis]
Length=733

 Score =   491 bits (1265),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 296/700 (42%), Positives = 429/700 (61%), Gaps = 24/700 (3%)
 Frame = +2

Query  239   RRKMLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEV  418
             ++ M C CS EQ +         S ESLA  D  +   S +    A+   + +   ++E 
Sbjct  21    QKIMKCLCSEEQLR--AANEMIPSSESLAIDDHGSEIFSRA----AELAKKPDTGNIEEA  74

Query  419   ESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprk  598
             E +L+E+  LNYEEARALLGR EYQ+GN +AAL VF+GIDI  ++P++   +  R   R+
Sbjct  75    ELSLRESGCLNYEEARALLGRYEYQKGNVEAALHVFEGIDISAVAPKIKSTLARRGDRRR  134

Query  599   prggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNG  778
                       +  +S+H+V+LLLEAI LKSKSL  LGR ++AA  CK ILDIV+S+ P G
Sbjct  135   RSSQN---FATPPLSIHAVTLLLEAIFLKSKSLQALGRFKEAAESCKVILDIVESSLPEG  191

Query  779   MSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKD  958
             + E    +CKLQE   K +E LP+LW      +EA+ SYR+AL+ PWNLD +  A +QK+
Sbjct  192   LPEHFSAECKLQETLAKVVELLPELWKLADCPNEAILSYRQALLHPWNLDTETTAGIQKE  251

Query  959   LAIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMD  1129
              AI LL++G E   SP   R ++  S  P+NN+EEAILL  +L+ K+    +EWD  + D
Sbjct  252   FAIFLLYSGGEA--SPPTLRSQMDSSFVPRNNLEEAILLFMILLRKVSLKRIEWDPSIFD  309

Query  1130  HLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSS  1309
             HL+FAL++ G+ ++L + VE++LPG+  R ER+Y LALCY  AG++  ALNLL+K+  + 
Sbjct  310   HLSFALSISGDTKALGNQVEELLPGIIDRKERYYALALCYYGAGEDFVALNLLKKLLSNG  369

Query  1310  EAEHEPHIPS-LLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYG  1486
             E   +P+  S LL+ +K+  +DP  + EG+ FAR A++S   +   L S A   LG    
Sbjct  370   E---DPNCTSALLMASKISGEDPNLADEGVQFARRALESLDGKCDQLESTANYLLGASLS  426

Query  1487  NAAKISFSDSERNSYQTQSLNSL-TQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQ  1663
               +K   +DSER S Q+++L  L T   ++   D   ++ L LE A QR L  A   A  
Sbjct  427   AQSKAVVTDSERVSKQSEALQVLETARRIIGMSDPIVLYHLSLENAEQRKLNAALFYAKN  486

Query  1664  YSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQ  1843
               +   GS  KGW LLA ++SA++RF+DAE ++D ALD+TG  DQ + L+ KA L IA+ 
Sbjct  487   MLKQEGGSNVKGWLLLARVLSAQKRFADAETVIDAALDQTGNWDQGELLRTKAKLHIAQG  546

Query  1844  HPNQAMETYRILLAMIQAQRQS----GMDHEV-LSDRKLEVEAWLDLARIYIDQDSWPDA  2008
             H  +A+ETY  LLA++Q Q ++     M ++     R LE+E W DLA +YI    W DA
Sbjct  547   HLRRAIETYTQLLAVLQVQHKNLGPGKMSYKSGQRSRSLELEIWHDLAYMYISLSQWRDA  606

Query  2009  QVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLM  2188
             ++C+ K+K+I  YS   WH TG L+E++   KEAL AF  +L IDP  V S++STA++L 
Sbjct  607   EICLSKSKSITSYSAVRWHVTGVLYESKGLYKEALKAFLGALDIDPTLVASLISTAKILR  666

Query  2189  KMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGS  2308
             K+G+Q+  + RS LM ALR++   H AW++LG   +  GS
Sbjct  667   KLGNQSETVVRSFLMEALRLDRMNHSAWYNLGLFYEARGS  706



>ref|XP_009587004.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Nicotiana 
tomentosiformis]
Length=760

 Score =   492 bits (1267),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 301/720 (42%), Positives = 450/720 (63%), Gaps = 21/720 (3%)
 Frame = +2

Query  239   RRKMLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEV  418
             R+ M C CSGEQ + ++ + +      LAT D++A  L SSR   A  E + +   ++E 
Sbjct  54    RKIMKCFCSGEQLQIDDRDES------LATEDYTAR-LRSSRAREA--EQKPDIGDIEEA  104

Query  419   ESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprk  598
             ES+L+E+ +LNYEEARALLGR EYQ+GN +AAL VF+GIDI +++ ++   +  R R +K
Sbjct  105   ESSLRESGALNYEEARALLGRYEYQKGNIEAALHVFEGIDIASVTTKIKVTLAIRARTKK  164

Query  599   prggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNG  778
              R  K +      MS+H+VSLLLEA+ LK+KSL  LGR ++AA+ C  ILDIV+S+ P G
Sbjct  165   RRSQKYD---KSPMSIHAVSLLLEAVFLKAKSLQVLGRCKEAAQSCTVILDIVESSLPEG  221

Query  779   MSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKD  958
             + E  G DCKLQE     +E LP+LW+      EA+ SYRRAL+  WNLD +  A +QK+
Sbjct  222   LPENFGADCKLQETLSNTVELLPQLWILADSPREAIISYRRALLHQWNLDVQTNAKIQKE  281

Query  959   LAIALLFAGVE-VDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHL  1135
              +I LL++G E +  S RF++  S  P+ N+EEAILLL +L+ K+    +EWD  ++DHL
Sbjct  282   FSIFLLYSGSEYIPPSLRFQMDSSFVPRTNIEEAILLLMILLRKVTLQSIEWDPSILDHL  341

Query  1136  TFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEA  1315
             ++AL++     +LA+ VE++LP    + ER++ LALCY   G N TALNLLRK+  S  A
Sbjct  342   SYALSISDGLTALANQVEELLPRNIDQRERYHILALCYYGGGDNFTALNLLRKLLSS--A  399

Query  1316  EHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAA  1495
             E    +P LLL +K+C++    + +GI+FAR A++    +   L+  A   LG+     +
Sbjct  400   EDPTCVPGLLLASKICAESLEYAGDGINFARRAIERLQGRCDRLIGVANYVLGLSLSTQS  459

Query  1496  KISFSDSERNSYQTQSLNSLTQAAMLCK-EDAETVFSLGLEYATQRNLTPAFDNALQYSE  1672
             +    DSER   Q+++L SL  A  L    D+  ++ L +E A QR L  A   A    +
Sbjct  460   RAVLKDSERVKMQSEALQSLESAGKLTTMNDSNVIYHLCVENAEQRKLDTALHYAKCLLK  519

Query  1673  MTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPN  1852
             +  GST KGW LLA ++SA+++F +AE I+D ALD++G+ DQ + L+ KA LQIA+    
Sbjct  520   LEGGSTLKGWMLLARVLSAQKQFPEAETIIDAALDQSGKWDQGELLRTKAKLQIAQGQVK  579

Query  1853  QAMETYRILLAMIQAQRQS-----GMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVC  2017
              A+ETYR LLA++Q QR+S      +  E   +R +E+E W DLA IYI      DA++C
Sbjct  580   NAIETYRQLLAVLQIQRKSFRLAENLKEEGNRNRTVELEMWHDLASIYIKSSQRQDAEIC  639

Query  2018  IDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMG  2197
             + K++ I  YS    + +G L +++   K AL  ++ +L+IDP +VPS++STA  L ++G
Sbjct  640   LSKSEAISCYSASRLYISGLLQQSKGLYKAALRDYTKALAIDPCHVPSLISTAVALRQIG  699

Query  2198  SQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
               +  I +S LM ALR++ T   AW +LG + K EG++ +AA+ FQAA  L+ + P++ F
Sbjct  700   DHSPGIVKSFLMEALRLDRTSASAWHNLGLVYKEEGASMEAAECFQAAILLQETEPIEPF  759



>tpg|DAA47027.1| TPA: calmodulin-binding protein MPCBP [Zea mays]
Length=714

 Score =   490 bits (1262),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 292/671 (44%), Positives = 430/671 (64%), Gaps = 12/671 (2%)
 Frame = +2

Query  383   ESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRM  562
             E++ ++  + E ES+L+E LSLNYEEARALLGRLEYQRGN +AAL+VF GID++    R 
Sbjct  47    EAKVDDGNIQEAESSLREGLSLNYEEARALLGRLEYQRGNVEAALRVFDGIDLQAAIQRF  106

Query  563   SKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKA  742
               +++++   ++    + +   SG  S H+ SL+LEAI LKS SL  LG+  +AA++CK+
Sbjct  107   QPSLSDKPLSKRSNKLRADSSNSG--SQHAASLVLEAIYLKSMSLQKLGKAMEAAKQCKS  164

Query  743   ILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWN  922
             +LD V+S F  G+  GV  + KLQE   K++E LP+LW Q G   EA+ SYRRAL+  WN
Sbjct  165   VLDAVESIFQCGIP-GVMVEQKLQETVSKSVELLPELWKQAGAYQEALASYRRALLSQWN  223

Query  923   LDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPKNNMEEAILLLFVLMGKIQQ  1096
             LD +    +QK  A+ LL+ GVE    P    +   S  P+NN+EEAILLL +L+ K   
Sbjct  224   LDDECCTRIQKRFAVFLLYGGVEA-APPSLASQTEGSFVPRNNLEEAILLLMILLKKWFL  282

Query  1097  GEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETA  1276
             G+  WD  VM+HLTFAL++ G+   +A ++E++LPG+  R ERWY LALCY +   NE A
Sbjct  283   GKTHWDPSVMEHLTFALSLCGQTSIIAKHLEEVLPGIYPRTERWYSLALCYFAVSHNEAA  342

Query  1277  LNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQ  1456
             LNLLRK    +E+ ++  I +LLL AK+CS +   S EG+ +A+ A+    + + HL S 
Sbjct  343   LNLLRKSLNKNESPND--IMALLLAAKICSSNNLLSSEGVEYAKRAVRDAESSDGHLKSV  400

Query  1457  ARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNL  1636
             A   LG C    +K++ SD +R+  Q ++L SL +A  L + + E +F LG+EYA QRN+
Sbjct  401   ALHVLGSCLSRKSKVASSDHQRSVLQAEALKSLNEAISLDRHNPELLFELGIEYAEQRNM  460

Query  1637  TPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflkl  1816
               A   A ++ ++T GS +KGW+LL L++SA+QR+S+AE + D ALDET + +Q   L++
Sbjct  461   HAALKCAKEFIDVTGGSVSKGWRLLLLVLSAQQRYSEAEVVTDAALDETAKWEQGPLLRI  520

Query  1817  kaalqIARQHPNQAMETYRILLAMIQAQRQS----GMDHEVLSDRKLEVEAWLDLARIYI  1984
             +A L++A+  P +A+E YR LLA++QAQR++        E   D+  EVE W  LA +Y 
Sbjct  521   RAKLKVAQALPMEAVEAYRTLLALVQAQRKAYGSVKNGTEDNEDKVREVEVWHGLANLYS  580

Query  1985  DQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSI  2164
                 W DA++C+ KAK +  YS  + H  G   E  E+ ++A+ A+  ++S++ ++VPS 
Sbjct  581   SLSYWRDAEICLQKAKALKTYSATTLHVEGNKHELHEKIQDAVAAYFNAISMEVEHVPSK  640

Query  2165  VSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaH  2344
             VS   +L K G + +P+AR  L +ALR+EPT   AWF LG++ K +G    AAD FQAA 
Sbjct  641   VSIGALLSKQGPKFLPVARCFLSDALRLEPTNRMAWFYLGEVHKQDGRLADAADCFQAAS  700

Query  2345  ELKLSTPVQSF  2377
              L+ S PV+SF
Sbjct  701   MLEDSDPVESF  711



>ref|XP_002314490.2| NO POLLEN GERMINATION RELATED 2 family protein [Populus trichocarpa]
 gb|EEF00661.2| NO POLLEN GERMINATION RELATED 2 family protein [Populus trichocarpa]
Length=729

 Score =   490 bits (1262),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 304/723 (42%), Positives = 449/723 (62%), Gaps = 25/723 (3%)
 Frame = +2

Query  242   RKMLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVE  421
             + M C  SGEQ + ++   + +S   LATRD+S S  SS   G    +++ E + ++E E
Sbjct  20    KMMKCIRSGEQLRLDDMASSSES---LATRDYSVS-YSSQAAGV---DTKVENSNIEEAE  72

Query  422   STLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkp  601
             S+L+E+  LNYEEARALLGRLEYQ+GN +AALQVF+GIDI ++S ++  +++ R    + 
Sbjct  73    SSLRESGYLNYEEARALLGRLEYQKGNIEAALQVFEGIDIASVSSKIKLSLSRRCEQNRR  132

Query  602   rggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGM  781
             R        +  MS+H++SLLLEAI LK KSL GLG+  +AA+ CK ILD +++A P G+
Sbjct  133   RSQSD---AAPPMSMHAISLLLEAIFLKVKSLQGLGQFEEAAQSCKVILDTIETALPEGI  189

Query  782   SEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDL  961
              E V  DCKLQ++ +KA+E LP+LW   G   EA+ SYRRAL+  WNLD +  + ++K+L
Sbjct  190   PESVSADCKLQDILNKAVELLPELWKLTGSPQEAILSYRRALLYYWNLDTETTSKIEKEL  249

Query  962   AIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDH  1132
             AI LL++G   D SP   R ++  S  P+NN+EEAILLL +L+ K    ++EWD  +M H
Sbjct  250   AIFLLYSG--SDASPPNLRSQVDGSFVPRNNIEEAILLLLILLRKFAVKKIEWDPTIMYH  307

Query  1133  LTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSE  1312
             L+FAL++ GE  +LA  VE++LPG+  R ER+  LALCY   G+ E  + L    +    
Sbjct  308   LSFALSISGEQRALAHQVEELLPGIMERRERYSILALCYH--GEGEEMIALNLLRNLLFN  365

Query  1313  AEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNA  1492
               +   +  LLL + +C+++     EGIS+A  A+     +   + S A    G+     
Sbjct  366   RGNPDCVLELLLASNICAKNTVCVEEGISYASRALSELCGRCNQMESVANCLQGILLSTQ  425

Query  1493  AKISFSDSERNSYQTQSLNSLTQA-AMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYS  1669
             ++   SDSER S Q+++L  L  A  M+ + D   +F L LE A QR L  A  +A Q  
Sbjct  426   SRSVASDSERISKQSEALEMLESAEKMMIERDPSIIFHLSLENAEQRKLDAALYHAKQLL  485

Query  1670  EMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHP  1849
             ++ AGS+ + + LLA I+SA++RF DAE +++  LD+TG+ DQ + L+ KA LQIA+   
Sbjct  486   KLEAGSSVRSYILLARILSAQKRFVDAENVINATLDQTGKWDQGELLRTKAKLQIAQGQL  545

Query  1850  NQAMETYRILLAMIQAQRQS-GMDHEVLSDRK----LEVEAWLDLARIYIDQDSWPDAQV  2014
              +A+ETY  LLA+IQ Q +S G   ++  +++    LE+E W DLA +Y     W DA+V
Sbjct  546   KKAIETYTRLLAIIQIQTKSLGAGKKLAKNQRNSWSLEMETWHDLANVYTSLSQWRDAEV  605

Query  2015  CIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKM  2194
             C+ K+KT+  YS   WH+TG L+EA+   +EAL AF  +L  +P++VPS+VSTA VL ++
Sbjct  606   CLSKSKTLSPYSASRWHSTGLLYEAKGLHQEALKAFKAALDAEPNHVPSLVSTACVLRRL  665

Query  2195  GSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKL--STPV  2368
             GSQ++PI RS L +A+R++ T H AW++LG L K + SA              L  S PV
Sbjct  666   GSQSIPIIRSFLTDAIRLDKTNHSAWYNLGLLYKADPSASALEAAECFEAAAFLEDSAPV  725

Query  2369  QSF  2377
             +SF
Sbjct  726   ESF  728



>ref|XP_006365398.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Solanum 
tuberosum]
Length=702

 Score =   489 bits (1260),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 292/671 (44%), Positives = 430/671 (64%), Gaps = 12/671 (2%)
 Frame = +2

Query  383   ESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRM  562
             E++ +E  + E ES L+E LSLN+EEARALLGRLEYQRGN + AL+VF GID++    RM
Sbjct  34    EAKLDEGNIQEAESALREGLSLNFEEARALLGRLEYQRGNVEGALRVFDGIDLQAAIQRM  93

Query  563   SKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKA  742
               ++TE+   +K R    E  V GV S H+  L+LEAI LK+KSL  LGR+ DAA EC +
Sbjct  94    QPSVTEKQPSKKGRTKSIE-SVPGV-SQHAAGLVLEAIYLKAKSLQKLGRLTDAAHECLS  151

Query  743   ILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWN  922
             +LD V+  F +G+ + + E+ KLQE    A+E LP+LW Q G   EA+++YRRAL+  WN
Sbjct  152   VLDAVEKIFDSGIPDVLVEN-KLQETVSHAVELLPELWKQAGSYSEAMSAYRRALLSQWN  210

Query  923   LDAKRLASMQKDLAIALLFAGVEV-DLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQG  1099
             LD    A +QK  A+ LL++GVEV   S   +I  S  P+NN+EEAILLL +LM K+  G
Sbjct  211   LDNDCCARIQKAFAVFLLYSGVEVCPPSLAVQIDGSYVPRNNLEEAILLLMILMRKVYLG  270

Query  1100  EVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETAL  1279
             +++WD  V++HLTFAL+V G+   LA  +E+++PG+  R +RW  LALCY +AGQN+ AL
Sbjct  271   KIKWDPSVLEHLTFALSVCGQTSVLAKQLEEVMPGVLNRIDRWRSLALCYFAAGQNKNAL  330

Query  1280  NLLRKVSGSSEAEHEPH-IPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQ  1456
             +LLRK   S     EP  + SL+L +++CS+D   + EG+ +A+ A+ +    N+HL   
Sbjct  331   SLLRK---SLHKHEEPDDVLSLVLASRICSEDVFLAAEGVKYAQRAITNAEGSNEHLKGV  387

Query  1457  ARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNL  1636
               + LG+C G  AK++ SD ER+  Q+++L SL  A  L  E+++ +F LG++YA  RNL
Sbjct  388   GLRVLGLCLGKQAKVATSDFERSQLQSEALKSLDGAMALEHENSDLMFELGVQYAEHRNL  447

Query  1637  TPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflkl  1816
               A   A +Y + T GST +GW+LLAL++SA+ R+S+AE + D A DET + DQ   L++
Sbjct  448   DAALQYARKYVDATGGSTLRGWRLLALVLSAQHRYSEAEVVTDAAFDETTKWDQGPLLRM  507

Query  1817  kaalqIARQHPNQAMETYRILLAMIQAQRQSGMDH----EVLSDRKLEVEAWLDLARIYI  1984
             KA L+ ++     A+E YR LL+++QAQR+S        +V  D+  E E W  LA +Y 
Sbjct  508   KAKLKTSQSRYIDAVEPYRHLLSLVQAQRKSFGPFRNAPQVEEDKVNEYEVWHGLADLYS  567

Query  1985  DQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSI  2164
                 + DA+ C++KA+ +  YS  + +T G +FE Q    +AL A+  +L ++P++V   
Sbjct  568   SLSHFKDAETCLEKARGLIEYSADTLYTEGMMFERQGENDKALSAYINALLVEPNHVQCK  627

Query  2165  VSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaH  2344
             +    +L KM    +P+A++LL +ALRIEPT   AW+ LG + + +G    AAD FQAA 
Sbjct  628   ILLGSLLTKMDPGMLPLAKALLSDALRIEPTNRVAWYHLGLVHRDDGRVADAADCFQAAS  687

Query  2345  ELKLSTPVQSF  2377
              L+ S P++ F
Sbjct  688   MLEESDPIEKF  698



>ref|XP_006364568.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X1 
[Solanum tuberosum]
 ref|XP_006364569.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X2 
[Solanum tuberosum]
 ref|XP_006364570.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X3 
[Solanum tuberosum]
 ref|XP_006364571.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X4 
[Solanum tuberosum]
Length=723

 Score =   490 bits (1262),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 304/720 (42%), Positives = 447/720 (62%), Gaps = 24/720 (3%)
 Frame = +2

Query  239   RRKMLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEV  418
             R+ M C CSGEQ +  +  P P SP   AT+D+ AS + SSR G        +   ++E 
Sbjct  20    RKMMKCFCSGEQLQRGDMVPLPDSP---ATKDYRAS-VRSSRAG--------DTGNIEEA  67

Query  419   ESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprk  598
             ES+L+E+ +LNYEEARALLGR EYQ GN +AAL VF+GIDI +++ +M   + +R + +K
Sbjct  68    ESSLRESGALNYEEARALLGRYEYQNGNIEAALHVFEGIDIASVTTKMKVTLAKRAQIQK  127

Query  599   prggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNG  778
              R  K +      MS+H+VSLLLEA+ LK+KSL  LGR ++AA+ C  ILDIV+S+ P G
Sbjct  128   RRSQKYD---PPPMSIHAVSLLLEAVFLKAKSLQALGRFKEAAQSCTVILDIVESSLPEG  184

Query  779   MSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKD  958
             + E  G DCKLQE    A+E LP+LW+      EA+ SYRRAL++ WNLD +  A ++K+
Sbjct  185   LPENFGADCKLQETLSNAVELLPQLWILADAPKEAIMSYRRALLRQWNLDVQTNAKIKKE  244

Query  959   LAIALLFAGVEVD-LSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHL  1135
              AI LL++G E +  S RF++  S  P+ N+EEAILLL +L+ K+    +EWD  ++DHL
Sbjct  245   FAIFLLYSGNEYNPPSLRFQMDSSFVPRTNIEEAILLLMILLRKVTLQIIEWDPSIVDHL  304

Query  1136  TFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEA  1315
             ++AL++ G   +LA+ VE++LP      ER + LALCY   G N TALNLLRK+  S  A
Sbjct  305   SYALSISGGLWALANQVEELLPRNIDLCERHHILALCYYGEGDNFTALNLLRKLLSS--A  362

Query  1316  EHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAA  1495
             E    +P LLL +++C++    + +GI+FAR A++S   +  HL+  A   LG+     +
Sbjct  363   EDPTCVPGLLLASRICAESLECAEDGINFARRAIESLQGRCNHLMGVANYVLGLSLSAQS  422

Query  1496  KISFSDSERNSYQTQSLNSLTQAAMLCK-EDAETVFSLGLEYATQRNLTPAFDNALQYSE  1672
             + + +DSER   Q+++L SL  A  L K  D+  ++ L +E A QRNL  A   A  + E
Sbjct  423   RAAMTDSERVRMQSEALQSLESAGRLTKMNDSNVIYHLCVENAEQRNLDTALHYARCFVE  482

Query  1673  MTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPN  1852
             +   ST KGW L A ++SA+++F +AE I+D A+D++G+ DQ   L+ KA LQIA+    
Sbjct  483   LEGESTLKGWMLWARVLSAQKKFPEAETIIDEAVDQSGKWDQGALLRTKAKLQIAQGQVK  542

Query  1853  QAMETYRILLAMIQAQRQS-----GMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVC  2017
              A+ TY  LL  +Q QR+S      +  E   +R +E+E W DLA IYI    W DA+ C
Sbjct  543   NAIGTYVQLLVDLQIQRKSFGLEENLKKEKDFNRTMELETWHDLASIYIKSSRWQDAEFC  602

Query  2018  IDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMG  2197
             + K++ I  YS    +  G L +++   K AL  F+ +L++DP +VPS++STA VL ++G
Sbjct  603   LSKSEAISCYSASRLYIAGLLHQSKGLHKAALTDFTNALAVDPSHVPSLISTAVVLRQLG  662

Query  2198  SQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             + +     S L  ALR++ T   AW +LG + K EGSA +AA+ F+ A  L+ S P++ F
Sbjct  663   NHSPATLISYLRGALRLDRTNVAAWHNLGLIYKEEGSAMEAAECFETAWFLEESEPIEPF  722



>ref|XP_011024445.1| PREDICTED: tetratricopeptide repeat protein 7A-like isoform X2 
[Populus euphratica]
Length=733

 Score =   490 bits (1261),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 302/700 (43%), Positives = 432/700 (62%), Gaps = 25/700 (4%)
 Frame = +2

Query  242   RKMLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVE  421
             R M C  SG+Q +    +    S ESLAT++ + +G  SS  G  D E   + + ++E E
Sbjct  21    RLMECLSSGDQSR--AMDGMRLSSESLATKE-NPAGAYSSNNGVLDVEP--DTSNLEEAE  75

Query  422   STLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkp  601
              +L+   SLNYEEARALLGR+EYQ+GN +AAL VF+GI+I  ++PRM   + +R    K 
Sbjct  76    LSLRGRGSLNYEEARALLGRMEYQKGNIEAALHVFEGINIAAVTPRMKVTLAKRQEHHKR  135

Query  602   rggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGM  781
                      +  MS+H+ SLL+EAI LK+KSL  LGR ++AA+ CK I+DIV+S+F  GM
Sbjct  136   HSQN---FATPSMSIHAASLLMEAIFLKAKSLQHLGRFKEAAQSCKVIVDIVESSFSEGM  192

Query  782   SEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDL  961
              E    D KLQE  +KA+E LP+LW       EA+ SYRRAL+  WNLD +  A +QKD 
Sbjct  193   PENFAADFKLQETLNKAVELLPELWKLADSPREAIMSYRRALLYHWNLDVETTARIQKDF  252

Query  962   AIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDH  1132
             AI LL++G E   SP   R  +  S  PKNNMEEAILLL +L+ K+    +EWD  + DH
Sbjct  253   AIYLLYSGGEA--SPPNLRSVMDSSFAPKNNMEEAILLLMILLRKMILTRIEWDPSIFDH  310

Query  1133  LTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSE  1312
             L+FAL+V G  ++LA  VE++LPG+  R ER++ L+LCY  AG+   AL+LLRK+  S+E
Sbjct  311   LSFALSVSGSLKALAGQVEELLPGIIDRRERYHILSLCYYGAGEELVALDLLRKLLHSNE  370

Query  1313  AEHEP-HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGN  1489
                +P  +P+LL+ +K+C +    + EGI++AR A+ S  N    L S A   LGV    
Sbjct  371   ---DPKRVPALLMASKICGKTSKHAEEGINYARRALQSLENDCNQLESVANYLLGVSLSA  427

Query  1490  AAKISFSDSERNSYQTQSLNSLTQAAMLCK-EDAETVFSLGLEYATQRNLTPAFDNALQY  1666
              ++++ +DSER + Q ++L +L  A  + K +D+  ++ L LE A QR L  A   A   
Sbjct  428   HSQVAVADSERFTKQYEALEALESAGRMTKMQDSNILYHLSLENAEQRKLDVALYYAKHL  487

Query  1667  SEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQH  1846
              ++ +GS+ KGW LLA I+SA++++ DAE +++ ALD+TG+ DQ + L+ KA LQIA+  
Sbjct  488   LKLESGSSIKGWLLLARILSAQRQYRDAETVINAALDQTGKWDQGELLRTKARLQIAQGQ  547

Query  1847  PNQAMETYRILLAMIQAQRQS-GMDHEVLSDR-----KLEVEAWLDLARIYIDQDSWPDA  2008
                 +E+Y  LLA++Q Q +S G   ++  D       LE+E W D+A +YI    W DA
Sbjct  548   LENGIESYIQLLAVLQIQSKSFGPGTKLYKDSGNPPCHLELEVWHDMASVYIRLSRWHDA  607

Query  2009  QVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLM  2188
             + C+ K+K I  YS    HTTG L+E +   K AL AF  +L ID  +VPS+VSTA VL 
Sbjct  608   ETCLSKSKAISSYSASRCHTTGVLYEQRGLYKAALKAFVSALDIDSTHVPSLVSTAVVLR  667

Query  2189  KMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGS  2308
             ++  Q+    RS LM ALR++     AW++LG L K EG+
Sbjct  668   RLSMQS-NATRSFLMAALRLDRMSSSAWYNLGLLYKAEGA  706



>ref|XP_009356570.1| PREDICTED: uncharacterized protein LOC103947392 [Pyrus x bretschneideri]
Length=694

 Score =   488 bits (1257),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 293/688 (43%), Positives = 437/688 (64%), Gaps = 16/688 (2%)
 Frame = +2

Query  332   DFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDA  511
             +FSA+G S   T   + +++ +E  + E ES+L+E LSLN+EEARALLG+LEYQRGN + 
Sbjct  13    EFSANGNSMKAT---EVQAKLDEGNIQEAESSLREGLSLNFEEARALLGKLEYQRGNLEG  69

Query  512   ALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKSK  691
             AL+VF GID++    R+   + E+T  +K R           +  H+ +L+L+AI LK+K
Sbjct  70    ALRVFDGIDLQAAIERLQPNLAEKTPSKKGRSRSDS---QHTVPQHAATLVLDAIYLKAK  126

Query  692   SLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGL  871
             SL  LGR+++AA EC  +LD V+  F  G+ +    D +LQE  ++++E LP+LW Q G 
Sbjct  127   SLQKLGRLKEAASECNNVLDAVEKIFHQGIPDA-QVDGRLQETVNQSVELLPELWKQAGY  185

Query  872   IDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPKNN  1045
               EA+++YRRAL+  WNLD  R A +QK  A+ LL++GVE    P    ++  S  PKNN
Sbjct  186   PQEAISAYRRALLSQWNLDNDRCARIQKGFAVFLLYSGVEAG-PPSLGAQVEGSYVPKNN  244

Query  1046  MEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAER  1225
             +EEAILLL +L+ K+  G+ +WDS +M+HLTFAL++  +   LA+ +E+I+PG+  R +R
Sbjct  245   LEEAILLLMILLRKLSLGKTKWDSSLMEHLTFALSLCNQTFVLAEQLEEIMPGVYHRVDR  304

Query  1226  WYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFA  1405
             W  LALCY  AGQN+ ALNLLRK     E   E  + +LLL AK+CS+D   + EG+ +A
Sbjct  305   WNSLALCYCGAGQNQEALNLLRKSLHKHERPEE--LMALLLAAKICSEDSHVATEGVGYA  362

Query  1406  RGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKED  1585
             + A+ +    +++L     + LG+C    AK+S SD ER+  Q+++L SL +A  L   +
Sbjct  363   QRAISNAQGLDEYLKGVGLRLLGLCLVKQAKVSSSDFERSRLQSEALKSLNEAINLEPNN  422

Query  1586  AETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVD  1765
             ++  F LG+ YA  RNL  A   A ++ + T G   KGW+LLAL++SA+QRFS+A  + D
Sbjct  423   SDLAFELGVHYAEHRNLDTALRYAKKFIDQTGGCLIKGWRLLALVLSAQQRFSEAHVVTD  482

Query  1766  LALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQS----GMDHEVLS  1933
              ALDET + +Q   L+LKA L+I++  P  A+ETYR LLA++QAQR+S     +  +V  
Sbjct  483   AALDETTKWEQGPLLRLKAKLKISQSLPMDAIETYRNLLALVQAQRKSLGSLRISLQVED  542

Query  1934  DRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEAL  2113
             D+  E E W  L+ +Y     W DA++C+ KA+ +  +S ++ H  G +FE Q + +EAL
Sbjct  543   DKVNEFEVWHGLSDLYSSLSYWKDAEICLSKARELKQHSAETLHAEGVIFEGQGQIQEAL  602

Query  2114  VAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLS  2293
               +   L ++P YVP  +  A +L KMGS A+P+ARSLL +ALRI+P+   AW+ LG + 
Sbjct  603   ATYIDCLLLEPCYVPCKILIAALLSKMGSTALPVARSLLSDALRIDPSNRKAWYYLGMIH  662

Query  2294  KMEGSaqqaadffqaaHELKLSTPVQSF  2377
             + +G    A D FQAA  L+ S P++SF
Sbjct  663   RDDGRIGDAIDCFQAASMLEESDPIESF  690



>ref|XP_004495349.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X1 
[Cicer arietinum]
 ref|XP_004495350.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X2 
[Cicer arietinum]
 ref|XP_004495351.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X3 
[Cicer arietinum]
 ref|XP_004495352.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X4 
[Cicer arietinum]
Length=739

 Score =   490 bits (1261),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 303/695 (44%), Positives = 441/695 (63%), Gaps = 19/695 (3%)
 Frame = +2

Query  242   RKML-CACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEV  418
             RKM+ C CS E+   EE   + +S   LATRD+SA+  S   +   + ES+ + + ++E 
Sbjct  24    RKMIKCVCSSEKLDLEEMNYSSES---LATRDYSATA-SGYSSRPRENESKVDNSNIEEA  79

Query  419   ESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprk  598
             ES+L+E+  LNYEEARALLGRLEYQ+GN +AAL VF+GIDI  + P+M   I++R     
Sbjct  80    ESSLRESGYLNYEEARALLGRLEYQKGNIEAALHVFEGIDIAAVIPKMKMCISKRCESNN  139

Query  599   prggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNG  778
              RG + + V S  MS+H+VSLLLEA+ LK+KSL  LG+ ++AA+ CK ILD V+SA P G
Sbjct  140   KRGSQSDSVPS--MSIHAVSLLLEAVFLKAKSLQTLGKFQEAAQSCKTILDTVESALPEG  197

Query  779   MSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKD  958
               E    DCKLQE   KA+E LP+LW   G   + + S+R+AL+  WNL  +  + +QK+
Sbjct  198   WPENFVSDCKLQETVTKAVELLPELWNLAGSPQDVILSFRKALLYHWNLGIEATSRIQKE  257

Query  959   LAIALLFAGVEVDLSP--RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDH  1132
              A+ LL++G E   SP  R ++  S  P+NN+EEA+LLL +LM K   G +  D  ++ H
Sbjct  258   FALFLLYSGCEAT-SPSLRSQLDGSFVPRNNIEEAVLLLLILMRKSVIGSIGKDPSIIHH  316

Query  1133  LTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSE  1312
             L+FAL+V GEF +LA  VE+++P    R ER+Y LALCY   G+N  AL+LLR    + E
Sbjct  317   LSFALSVCGEFLTLAKQVEELVPEDMKRRERYYTLALCYCGEGENMVALDLLRNFLNNRE  376

Query  1313  AEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNA  1492
               +   I  L+L +K+C+ +     +GI F+  A+     + K + + A   LGV     
Sbjct  377   --NSDCIEELVLASKICADNKVCVEDGIKFSSKAIAQMYGKCKQMEAIANCLLGVLLSTK  434

Query  1493  AKISFSDSERNSYQTQSLNSLTQAAMLCKE-DAETVFSLGLEYATQRNLTPAFDNALQYS  1669
             +K S S+SE+   Q+Q+ ++L  A  L KE D   V +L LEYA  RNL  AFD+A +  
Sbjct  435   SKSSASESEKILIQSQAFSALQGAEALMKENDPYIVLNLCLEYAEHRNLRIAFDHAKKLV  494

Query  1670  EMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHP  1849
             +M  GS+  G+ LLA I+SA+++F DAE ++D A+D++G+ DQ + L+ KA LQIA+   
Sbjct  495   KMEGGSSVTGYILLARILSAQKKFVDAEIVIDAAIDQSGKWDQGELLRTKAKLQIAQGRL  554

Query  1850  NQAMETYRILLAMIQAQRQS-GMDHEVL-----SDRKLEVEAWLDLARIYIDQDSWPDAQ  2011
               A+ETY   LA++Q Q +S G  ++V+     S+R+LE+E W DLA +Y     W DA+
Sbjct  555   KNAIETYTFFLAVLQVQNKSIGTSNKVMKWKRNSNRRLEMEVWHDLANLYTSLSQWSDAE  614

Query  2012  VCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMK  2191
             VC+ K++ I+ YS   WH+TG L+EA+   +EAL ++  +L IDP++V S++STA VL K
Sbjct  615   VCLAKSQAINPYSASRWHSTGLLYEARGLHQEALKSYKKALDIDPNHVASLISTACVLRK  674

Query  2192  MGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSK  2296
              G ++  I RSLL +ALRI+ T   AW++LG L K
Sbjct  675   HGGESCSIVRSLLNDALRIDRTNSSAWYNLGLLYK  709



>ref|XP_004240483.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X1 
[Solanum lycopersicum]
Length=724

 Score =   489 bits (1259),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 304/721 (42%), Positives = 446/721 (62%), Gaps = 25/721 (3%)
 Frame = +2

Query  239   RRKMLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEV  418
             R+ M C CSGEQ +  +  P P SP   AT+D+ AS + SSR G        +   ++E 
Sbjct  20    RKMMKCFCSGEQLQIGDMVPLPDSP---ATKDYRAS-VRSSRAG--------DIGNIEEA  67

Query  419   ESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprk  598
             ES+L+E+ +LNYEEARALLGR EYQ+GN +AAL VF+GIDI +++ +M   +  R + +K
Sbjct  68    ESSLRESGALNYEEARALLGRYEYQKGNIEAALHVFEGIDIASVTTKMKVTLANRAQIQK  127

Query  599   prggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNG  778
              R  K +   +  MS+H+VSLLLEA+ LK+KSL  LGR ++AA+ C  ILDIVDS+ P G
Sbjct  128   RRSQKYD---TPPMSIHAVSLLLEAVFLKAKSLQALGRFKEAAQSCTVILDIVDSSLPEG  184

Query  779   MSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKD  958
             + E  G DCKLQE    A+E LP+LW+      EA+ SYRRAL++ WNLD +  A ++K+
Sbjct  185   LPENFGADCKLQETLTNAVELLPQLWILADAPKEAIMSYRRALLRQWNLDVQTNAKIKKE  244

Query  959   LAIALLFAGVEVD-LSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHL  1135
              AI LL++G E +  S RF++  S  P+ N+EEAILLL +L+ K+    +EWD  + DHL
Sbjct  245   FAIFLLYSGYEYNPPSLRFQMDSSFVPRTNIEEAILLLMILLRKVTLQIIEWDPSIFDHL  304

Query  1136  TFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEA  1315
             ++AL++ G   +LA+ VE++LP      ER + LALCY   G N TALNLLRK+  S  A
Sbjct  305   SYALSISGGLWALANQVEELLPRNIDLCERHHMLALCYYGKGDNFTALNLLRKLLSS--A  362

Query  1316  EHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAA  1495
             E    +P LLL +++C++    + +GI+FAR A++S   +  HL+  A   LG+     +
Sbjct  363   EDPTCVPGLLLASRICAESLECAEDGINFARRAIESLQGRCNHLMGVANYVLGLSLSAQS  422

Query  1496  KISFSDSERNSYQTQSLNSLTQAAMLCK-EDAETVFSLGLEYATQRNLTPAFDNALQYSE  1672
             + + +DSER   Q+++L SL  A  L K  D+  ++ L +E A +R L  A   A  + E
Sbjct  423   RAAMTDSERFRMQSEALQSLESAGRLTKMNDSNVIYHLCVENAEKRKLDTALHYAKCFVE  482

Query  1673  MTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPN  1852
             +   ST KGW LLA ++SA+++F +AE I+D ALD++G+ DQ   L+ KA LQ+A+    
Sbjct  483   LEGESTLKGWMLLARVLSAQKKFPEAETIIDAALDQSGKWDQGALLRTKAKLQVAQGQVK  542

Query  1853  QAMETYRILLAMIQAQRQS-----GMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVC  2017
              A+ TY  LLA +Q QR+S      +  E   +R +E+E W DL  IYI    W DA+ C
Sbjct  543   NAIGTYVQLLADLQIQRKSFELEENLKKEKDFNRTMELETWHDLVSIYIKSSRWQDAEFC  602

Query  2018  IDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMG  2197
             + K+  I  YS    +  G L +++   K AL  ++ +L++DP +VPS++STA VL ++G
Sbjct  603   LSKSDAISCYSASRLYIAGLLHQSKGLYKAALTEYTNALAVDPSHVPSLISTAVVLRQLG  662

Query  2198  SQAVPIARSLLMNALRIEPTCHDAWFSLGKLSK-MEGSaqqaadffqaaHELKLSTPVQS  2374
             + +     S L  ALR++ T   AW +LG + K  EGSA +AA+ F+ A  L+ S PV+ 
Sbjct  663   NHSPATLVSYLREALRLDQTNVAAWHNLGLIYKEEEGSAIKAAECFETAWFLEESEPVEP  722

Query  2375  F  2377
             F
Sbjct  723   F  723



>ref|XP_010524113.1| PREDICTED: uncharacterized protein LOC104802285 [Tarenaya hassleriana]
 ref|XP_010524114.1| PREDICTED: uncharacterized protein LOC104802285 [Tarenaya hassleriana]
Length=703

 Score =   488 bits (1257),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 304/693 (44%), Positives = 432/693 (62%), Gaps = 20/693 (3%)
 Frame = +2

Query  326   TRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNF  505
              R   A+G+      T + E++ +E  + E ES+L+E LSLN+EEARALLGRLEYQRGN 
Sbjct  18    VRKLCANGIC---MKTTEVEAKLDEGNIQEAESSLREGLSLNFEEARALLGRLEYQRGNL  74

Query  506   DAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLK  685
             + AL+VF+GID+     R+  ++ E+  P+K R       VS     H+VSLLLEAI LK
Sbjct  75    EGALRVFEGIDLHAAIQRLQASVPEKPAPKKNRSRDSNHSVSQ----HAVSLLLEAIYLK  130

Query  686   SKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQE  865
             +KSL  LGR+ +AARECK++LD V+  F  G+ +    D +LQE   +A+E LP+LW + 
Sbjct  131   AKSLQKLGRLTEAARECKSVLDSVEKIFQLGIPDA-QVDNRLQETVSQAVELLPELWKEA  189

Query  866   GLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPK  1039
             G   EA+++YRRAL+  WNLD  R A +QK  A+ LL  GVE    P    +I  S  P+
Sbjct  190   GDYQEAISAYRRALLSQWNLDNDRCARIQKCFAVFLLHCGVEAS-PPSLGSQIEGSYVPR  248

Query  1040  NNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRA  1219
             NN+EEAILLL +L+ K   G+ +WD  V++HLTFAL++  +   LA  +E+I+PG+  R 
Sbjct  249   NNLEEAILLLMILLKKFNLGKAKWDPSVIEHLTFALSLCSQTSVLAKQLEEIMPGVFNRV  308

Query  1220  ERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGIS  1399
             ERW  +AL YS+AGQ+  A+NLLRK     + E    + +LL+ AKLCS+DP  + EG S
Sbjct  309   ERWNSMALSYSAAGQSSAAVNLLRK--SLHKHEQPDDLVALLMAAKLCSEDPRLAEEGAS  366

Query  1400  FARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCK  1579
             +A+  +D     ++HL     + LG+C G  AKIS SD ER+ +Q+++L +L  A     
Sbjct  367   YAQRGIDHAQGMDEHLKGVGLRMLGLCLGKRAKISSSDFERSRFQSEALKALDGAVAFEH  426

Query  1580  EDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAI  1759
              + + +F LG++YA QRNL  A   A ++ + T GS  KGW+ LAL++SA+QRFS+AE +
Sbjct  427   NNPDLIFELGVQYAEQRNLKAASRYAKEFIDATGGSVLKGWRFLALVLSAQQRFSEAEVV  486

Query  1760  VDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQS-GMDHEVLS-  1933
             VD ALDET + DQ   L+LKA L+IA+  P +A+ETYR LLA++QAQR+S G    V   
Sbjct  487   VDAALDETAKWDQGPLLRLKAKLKIAQSKPTEAIETYRYLLALVQAQRKSFGPLRSVTQL  546

Query  1934  --DRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKE  2107
               D+  E E W  LA +Y     W D +VC++KA+ +  YS    HT G ++  +   K 
Sbjct  547   EEDKVNEFEVWHGLANLYSSLSHWNDVEVCLEKARELKQYSASMLHTEGRMWVGRGDGKA  606

Query  2108  ALVAFSFSLSIDPDYVPSIVSTAEVLMKMG---SQAVPIARSLLMNALRIEPTCHDAWFS  2278
             A+ AF   L +DP  VP IV  + +L + G   S  +P+ RSLL +AL+++PT   AW+ 
Sbjct  607   AISAFLDGLLLDPTSVPCIVELSSLLSERGKDHSPTLPVVRSLLSDALKLDPTNRMAWYY  666

Query  2279  LGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             LG + K +G    A D FQAA  L+ S P++SF
Sbjct  667   LGMVHKHDGRVADATDCFQAASMLEESDPIESF  699



>ref|XP_009413033.1| PREDICTED: uncharacterized protein LOC103994427 [Musa acuminata 
subsp. malaccensis]
Length=704

 Score =   488 bits (1257),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 306/689 (44%), Positives = 440/689 (64%), Gaps = 17/689 (2%)
 Frame = +2

Query  329   RDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFD  508
             R+ S +GLS     T++ E++ ++  + E ES+L+E LSLNYEEARALLGRLEYQRGN +
Sbjct  23    REVSVNGLS---MKTSEVEAKLDDGNIQEAESSLREGLSLNYEEARALLGRLEYQRGNIE  79

Query  509   AALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKS  688
             AAL+VF GID++    R+  +          R  +   V    +S H+ SL+LEAI LKS
Sbjct  80    AALRVFDGIDLQAAIQRLQPS----PEKPPSRRSRSHSVSIHSVSQHAASLVLEAIYLKS  135

Query  689   KSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEG  868
              SL  LG+  +AA+EC+++LD V+  F +G+ + + E  KLQE   KA+E LP+LW Q G
Sbjct  136   MSLQKLGKATEAAQECRSVLDAVEKIFQHGIPDVLVEQ-KLQETVSKAVELLPELWKQAG  194

Query  869   LIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPKN  1042
                EA+ SYRRAL+  WNLD +  A +QK  A+ LL+ GVE    P    +I  S  PKN
Sbjct  195   HYQEALASYRRALLSQWNLDDECCARIQKRFAVFLLYGGVEAS-PPSLASQIDGSFVPKN  253

Query  1043  NMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAE  1222
             N+EEAILLL +L+ K   G+ +WD  V++HL+FAL++ G+   LA + E+++PG   R +
Sbjct  254   NLEEAILLLIILLRKWYLGKTQWDPSVIEHLSFALSMCGQTSVLARHFEELIPGTYARCD  313

Query  1223  RWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISF  1402
             RWY LALCYS+A QN +ALNLL+K+    E+    +I +LLL AK+CS D   S EG+ +
Sbjct  314   RWYSLALCYSAADQNHSALNLLKKLLRKDESPD--YIMALLLAAKICSDDCLFSAEGVEY  371

Query  1403  ARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKE  1582
             AR A+ +     +HL     +FLG C G  AKI+ SD ER+S Q+++L SL +   L + 
Sbjct  372   ARRAIANAQVAYEHLKCVGLRFLGNCLGKLAKIASSDHERSSLQSEALRSLDEVVSLERH  431

Query  1583  DAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIV  1762
             + E +F L LEYA QRN   A   A ++ + T GS +KGWKLLAL++SA+QR+SDAE ++
Sbjct  432   NPEILFDLALEYAEQRNTNAALRYAKEFIDATGGSISKGWKLLALVLSAQQRYSDAEIVI  491

Query  1763  DLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQSGMDH----EVL  1930
             D ALDET + +Q   L++KA L++A+     A+E YR+LLA++QAQR+S        EV 
Sbjct  492   DAALDETVKWEQGPLLRIKAKLKVAQSLHMDAVEAYRLLLALVQAQRKSFGSFKNIIEVE  551

Query  1931  SDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEA  2110
              +   E E W  LA +Y     W DA++C++K++T+  YS  + H  G + EA  + ++A
Sbjct  552   DENVSEFEVWRGLANLYSGLSHWRDAEICLEKSRTLKPYSASTLHIEGRMLEAHGQMQQA  611

Query  2111  LVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKL  2290
             L  ++ +LS++ D+VPS VS   +L K GS+++P+ARS L +ALR+EP    AW+ LG +
Sbjct  612   LATYANALSVELDHVPSKVSIGALLSKRGSKSLPVARSFLSDALRLEPMNRLAWYYLGVI  671

Query  2291  SKMEGSaqqaadffqaaHELKLSTPVQSF  2377
              + EG    AAD FQAA  L  S P++SF
Sbjct  672   HRDEGRMVDAADCFQAASLLDESDPIESF  700



>ref|XP_002303124.2| hypothetical protein POPTR_0002s26100g [Populus trichocarpa]
 gb|EEE82397.2| hypothetical protein POPTR_0002s26100g [Populus trichocarpa]
Length=733

 Score =   489 bits (1259),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 292/674 (43%), Positives = 421/674 (62%), Gaps = 23/674 (3%)
 Frame = +2

Query  320   LATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRG  499
             LAT++ + +G  SS  G  D E   + + ++E E +L+   SLNYEEARALLGR+EYQ+G
Sbjct  45    LATKE-NPTGAYSSNNGVLDLEP--DTSNLEEAELSLRGRGSLNYEEARALLGRMEYQKG  101

Query  500   NFDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAIL  679
             N +AAL VF+GI+I  ++PRM   + +R    K          +  MS+H+ SLL+EAI 
Sbjct  102   NIEAALHVFEGINIAAVTPRMKVTLAKRQEHHKRHSQS---FATPSMSIHAASLLMEAIF  158

Query  680   LKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWV  859
             LK+KSL  LGR R+AA+ CK I+DIV+S+F  GM E    D KLQE  +KA+E LP+LW 
Sbjct  159   LKAKSLQHLGRFREAAQSCKVIVDIVESSFSEGMPENFAADFKLQETLNKAVELLPELWK  218

Query  860   QEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSP---RFKIWCST  1030
                   EA+ SYRRAL+  WNLD +  A +QKD AI LL++G E   SP   R  +  S 
Sbjct  219   LADSPREAIMSYRRALLHHWNLDVETTARIQKDFAIFLLYSGGEA--SPPNLRSLMDSSF  276

Query  1031  PPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMK  1210
              PK+N+EEAILLL +L+ K+    +EWD  ++DHL+FAL+V G  ++LA  VE++LPG+ 
Sbjct  277   APKSNIEEAILLLMILLRKMILTRIEWDPSILDHLSFALSVSGSLKALAGQVEELLPGII  336

Query  1211  TRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP-HIPSLLLGAKLCSQDPCKSR  1387
              R ER++ L+LCY  AG+   AL+LLRK+  S+E   +P  +P+LL+ +K+C +    + 
Sbjct  337   DRRERYHILSLCYYGAGEELVALDLLRKLLHSNE---DPKRVPALLMASKICGKSSKHAE  393

Query  1388  EGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAA  1567
             EGI++AR A+ S  N    L S A   LGV     ++++ +DSER + Q ++L +L  A 
Sbjct  394   EGINYARRALQSLENDCNQLESVANYLLGVSLSAHSQVAVADSERFTKQYEALEALESAG  453

Query  1568  MLCK-EDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFS  1744
              + K +D+  ++ L LE A QR L  A   A    ++ +GST +GW LLA I+SA++ + 
Sbjct  454   RMTKMQDSNILYHLSLENAEQRKLDVALYYAKHLLKLESGSTIRGWLLLARILSAQRLYK  513

Query  1745  DAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQS-GMDH  1921
             DAE +++ ALD+TG+ DQ + L+ KA LQIA+      +E+Y  LLA++Q Q +S G   
Sbjct  514   DAETVINAALDQTGKWDQGELLRTKAKLQIAQGQLENGIESYIQLLAVLQIQSKSLGPGT  573

Query  1922  EVLSDR-----KLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFE  2086
             ++  D       LE+E W D+A +YI    W DA+ C+ ++K I  YS    HTTG L+E
Sbjct  574   KLYKDNGNPPSHLELEVWHDMASVYIRLSRWHDAEACLSRSKAISSYSASRCHTTGVLYE  633

Query  2087  AQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHD  2266
              +    EAL AF  +L IDP +VPS+VSTA VL ++  Q+    RS LM ALR++     
Sbjct  634   QRGLYNEALKAFVSALDIDPTHVPSLVSTAVVLRRLRMQS-NATRSFLMAALRLDRMSSS  692

Query  2267  AWFSLGKLSKMEGS  2308
             AW++LG L K EG+
Sbjct  693   AWYNLGLLYKAEGA  706



>ref|XP_004149521.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Cucumis 
sativus]
 ref|XP_004165730.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Cucumis 
sativus]
 gb|KGN54956.1| O-linked n-acetylglucosamine transferase, ogt [Cucumis sativus]
Length=708

 Score =   488 bits (1257),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 292/691 (42%), Positives = 438/691 (63%), Gaps = 14/691 (2%)
 Frame = +2

Query  320   LATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRG  499
             +  R+  A+G+S     T + E++ +E  + E ES+L+E LSLN+EEARALLG+LEYQRG
Sbjct  23    IVVREVCANGIS---IKTTEVEAKLDEGNIQEAESSLREGLSLNFEEARALLGKLEYQRG  79

Query  500   NFDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAIL  679
             N + AL+VF GID++    R+   I ++T P+K R           +S H+ +L+LEAI 
Sbjct  80    NVEGALRVFDGIDLQAAIQRLQPCIADKTPPKKGRSRSES---QHAVSQHAANLVLEAIY  136

Query  680   LKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWV  859
             LK KSL  LGR+ +AA EC ++LD V+  F  G+ +G   D +LQ+   +A+E LP+LW 
Sbjct  137   LKVKSLQKLGRVTEAADECTSVLDAVEKIFHQGIPDG-QVDSRLQDTVSQAVELLPELWK  195

Query  860   QEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDL-SPRFKIWCSTPP  1036
             Q G   EA+++YRRAL+  WNL+ +  A +QK  A+ LL++GVE    S   ++  S  P
Sbjct  196   QAGCFQEAISAYRRALLSQWNLNNESCARIQKGFAVFLLYSGVEAGPPSLAVQLEGSYVP  255

Query  1037  KNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTR  1216
             KNN+EEAILLL VL+ K   G+++WD  VM+HL +AL++  +   LA  +E+++PG+  R
Sbjct  256   KNNLEEAILLLMVLVKKCYLGKIKWDPSVMEHLIYALSLCSQTSVLAKQLEEVMPGVYHR  315

Query  1217  AERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGI  1396
              +RW  LALCY +AGQN+ ALNLLRK     + E    + +LLL AK+CS+DP  + EG+
Sbjct  316   VDRWKSLALCYCAAGQNKIALNLLRK--SLHKHEQPDDVAALLLAAKICSEDPYLAAEGV  373

Query  1397  SFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLC  1576
              +A+ A+ + +   +HL     + LG+C G  AK+S SD ER+  Q+++L SL  A+ L 
Sbjct  374   GYAQRALSNCIENEEHLKGVGLRLLGLCLGKQAKMSSSDFERSRLQSEALKSLEAASGLE  433

Query  1577  KEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEA  1756
               + + +  LG++Y+  RNL  A   A ++ + T GS  KGW+LLAL++SA++RFS+AE 
Sbjct  434   SNNLDLMLELGVQYSEYRNLNAALQYAKKFIDETGGSVLKGWQLLALVLSAQKRFSEAEV  493

Query  1757  IVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQS----GMDHE  1924
             + D A+DET + +Q   L+LKA L++++     A+ETYR LLA++QAQ++S     +  +
Sbjct  494   VTDAAMDETTKWEQGPLLRLKAKLKVSQSLHMDAIETYRYLLALVQAQKKSFGPLRIVPQ  553

Query  1925  VLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCK  2104
             V  D+  E E W  LA +Y     W DA++C+ KA+ +  +SP+  HT G + E + + +
Sbjct  554   VEDDKVNEFEVWNGLANLYSSLSHWKDAEICLGKARELKEFSPEVLHTEGLMCEGRVKIQ  613

Query  2105  EALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLG  2284
             EAL A+  +L ++P YVP  V    +  K G  A+PIARSLL +ALR++PT   AWF LG
Sbjct  614   EALAAYINALLLEPTYVPCKVLIGALWSKAGPDALPIARSLLSDALRLDPTNRKAWFYLG  673

Query  2285  KLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
              + + EG    A D FQAA  L+ S P++SF
Sbjct  674   VIHRDEGRMADAIDCFQAAAMLEESDPIESF  704



>ref|XP_002303125.2| hypothetical protein POPTR_0002s26100g [Populus trichocarpa]
 gb|EEE82398.2| hypothetical protein POPTR_0002s26100g [Populus trichocarpa]
Length=736

 Score =   489 bits (1258),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 293/677 (43%), Positives = 423/677 (62%), Gaps = 26/677 (4%)
 Frame = +2

Query  320   LATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRG  499
             LAT++ + +G  SS  G  D E   + + ++E E +L+   SLNYEEARALLGR+EYQ+G
Sbjct  45    LATKE-NPTGAYSSNNGVLDLEP--DTSNLEEAELSLRGRGSLNYEEARALLGRMEYQKG  101

Query  500   NFDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAIL  679
             N +AAL VF+GI+I  ++PRM   + +R    K          +  MS+H+ SLL+EAI 
Sbjct  102   NIEAALHVFEGINIAAVTPRMKVTLAKRQEHHKRHSQS---FATPSMSIHAASLLMEAIF  158

Query  680   LKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWV  859
             LK+KSL  LGR R+AA+ CK I+DIV+S+F  GM E    D KLQE  +KA+E LP+LW 
Sbjct  159   LKAKSLQHLGRFREAAQSCKVIVDIVESSFSEGMPENFAADFKLQETLNKAVELLPELWK  218

Query  860   QEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSP---RFKIWCST  1030
                   EA+ SYRRAL+  WNLD +  A +QKD AI LL++G E   SP   R  +  S 
Sbjct  219   LADSPREAIMSYRRALLHHWNLDVETTARIQKDFAIFLLYSGGEA--SPPNLRSLMDSSF  276

Query  1031  PPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMK  1210
              PK+N+EEAILLL +L+ K+    +EWD  ++DHL+FAL+V G  ++LA  VE++LPG+ 
Sbjct  277   APKSNIEEAILLLMILLRKMILTRIEWDPSILDHLSFALSVSGSLKALAGQVEELLPGII  336

Query  1211  TRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEP-HIPSLLLGAKLCSQDPCKSR  1387
              R ER++ L+LCY  AG+   AL+LLRK+  S+E   +P  +P+LL+ +K+C +    + 
Sbjct  337   DRRERYHILSLCYYGAGEELVALDLLRKLLHSNE---DPKRVPALLMASKICGKSSKHAE  393

Query  1388  EGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAA  1567
             EGI++AR A+ S  N    L S A   LGV     ++++ +DSER + Q ++L +L  A 
Sbjct  394   EGINYARRALQSLENDCNQLESVANYLLGVSLSAHSQVAVADSERFTKQYEALEALESAG  453

Query  1568  MLCK-EDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFS  1744
              + K +D+  ++ L LE A QR L  A   A    ++ +GST +GW LLA I+SA++ + 
Sbjct  454   RMTKMQDSNILYHLSLENAEQRKLDVALYYAKHLLKLESGSTIRGWLLLARILSAQRLYK  513

Query  1745  DAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQS---GM  1915
             DAE +++ ALD+TG+ DQ + L+ KA LQIA+      +E+Y  LLA++Q Q +S   G 
Sbjct  514   DAETVINAALDQTGKWDQGELLRTKAKLQIAQGQLENGIESYIQLLAVLQIQSKSLGPGT  573

Query  1916  D-HEVLSDR-----KLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGA  2077
               +++L D       LE+E W D+A +YI    W DA+ C+ ++K I  YS    HTTG 
Sbjct  574   KLYKILQDNGNPPSHLELEVWHDMASVYIRLSRWHDAEACLSRSKAISSYSASRCHTTGV  633

Query  2078  LFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPT  2257
             L+E +    EAL AF  +L IDP +VPS+VSTA VL ++  Q+    RS LM ALR++  
Sbjct  634   LYEQRGLYNEALKAFVSALDIDPTHVPSLVSTAVVLRRLRMQS-NATRSFLMAALRLDRM  692

Query  2258  CHDAWFSLGKLSKMEGS  2308
                AW++LG L K EG+
Sbjct  693   SSSAWYNLGLLYKAEGA  709



>ref|XP_011024442.1| PREDICTED: tetratricopeptide repeat protein 7A-like isoform X1 
[Populus euphratica]
 ref|XP_011024443.1| PREDICTED: tetratricopeptide repeat protein 7A-like isoform X1 
[Populus euphratica]
 ref|XP_011024444.1| PREDICTED: tetratricopeptide repeat protein 7A-like isoform X1 
[Populus euphratica]
Length=736

 Score =   489 bits (1258),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 302/703 (43%), Positives = 433/703 (62%), Gaps = 28/703 (4%)
 Frame = +2

Query  242   RKMLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVE  421
             R M C  SG+Q +    +    S ESLAT++ + +G  SS  G  D E   + + ++E E
Sbjct  21    RLMECLSSGDQSR--AMDGMRLSSESLATKE-NPAGAYSSNNGVLDVEP--DTSNLEEAE  75

Query  422   STLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkp  601
              +L+   SLNYEEARALLGR+EYQ+GN +AAL VF+GI+I  ++PRM   + +R    K 
Sbjct  76    LSLRGRGSLNYEEARALLGRMEYQKGNIEAALHVFEGINIAAVTPRMKVTLAKRQEHHKR  135

Query  602   rggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGM  781
                      +  MS+H+ SLL+EAI LK+KSL  LGR ++AA+ CK I+DIV+S+F  GM
Sbjct  136   HSQN---FATPSMSIHAASLLMEAIFLKAKSLQHLGRFKEAAQSCKVIVDIVESSFSEGM  192

Query  782   SEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDL  961
              E    D KLQE  +KA+E LP+LW       EA+ SYRRAL+  WNLD +  A +QKD 
Sbjct  193   PENFAADFKLQETLNKAVELLPELWKLADSPREAIMSYRRALLYHWNLDVETTARIQKDF  252

Query  962   AIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDH  1132
             AI LL++G E   SP   R  +  S  PKNNMEEAILLL +L+ K+    +EWD  + DH
Sbjct  253   AIYLLYSGGEA--SPPNLRSVMDSSFAPKNNMEEAILLLMILLRKMILTRIEWDPSIFDH  310

Query  1133  LTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSE  1312
             L+FAL+V G  ++LA  VE++LPG+  R ER++ L+LCY  AG+   AL+LLRK+  S+E
Sbjct  311   LSFALSVSGSLKALAGQVEELLPGIIDRRERYHILSLCYYGAGEELVALDLLRKLLHSNE  370

Query  1313  AEHEP-HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGN  1489
                +P  +P+LL+ +K+C +    + EGI++AR A+ S  N    L S A   LGV    
Sbjct  371   ---DPKRVPALLMASKICGKTSKHAEEGINYARRALQSLENDCNQLESVANYLLGVSLSA  427

Query  1490  AAKISFSDSERNSYQTQSLNSLTQAAMLCK-EDAETVFSLGLEYATQRNLTPAFDNALQY  1666
              ++++ +DSER + Q ++L +L  A  + K +D+  ++ L LE A QR L  A   A   
Sbjct  428   HSQVAVADSERFTKQYEALEALESAGRMTKMQDSNILYHLSLENAEQRKLDVALYYAKHL  487

Query  1667  SEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQH  1846
              ++ +GS+ KGW LLA I+SA++++ DAE +++ ALD+TG+ DQ + L+ KA LQIA+  
Sbjct  488   LKLESGSSIKGWLLLARILSAQRQYRDAETVINAALDQTGKWDQGELLRTKARLQIAQGQ  547

Query  1847  PNQAMETYRILLAMIQAQRQS---GMD-HEVLSDR-----KLEVEAWLDLARIYIDQDSW  1999
                 +E+Y  LLA++Q Q +S   G   +++  D       LE+E W D+A +YI    W
Sbjct  548   LENGIESYIQLLAVLQIQSKSFGPGTKLYKIFQDSGNPPCHLELEVWHDMASVYIRLSRW  607

Query  2000  PDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAE  2179
              DA+ C+ K+K I  YS    HTTG L+E +   K AL AF  +L ID  +VPS+VSTA 
Sbjct  608   HDAETCLSKSKAISSYSASRCHTTGVLYEQRGLYKAALKAFVSALDIDSTHVPSLVSTAV  667

Query  2180  VLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGS  2308
             VL ++  Q+    RS LM ALR++     AW++LG L K EG+
Sbjct  668   VLRRLSMQS-NATRSFLMAALRLDRMSSSAWYNLGLLYKAEGA  709



>ref|XP_011030454.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Populus 
euphratica]
 ref|XP_011030455.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Populus 
euphratica]
 ref|XP_011030456.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Populus 
euphratica]
 ref|XP_011030457.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Populus 
euphratica]
 ref|XP_011030458.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Populus 
euphratica]
 ref|XP_011030459.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Populus 
euphratica]
Length=729

 Score =   488 bits (1256),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 302/723 (42%), Positives = 448/723 (62%), Gaps = 25/723 (3%)
 Frame = +2

Query  242   RKMLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVE  421
             + M C  SGEQ + ++   + +S   LATRD+S S  SS   G    +++ E + ++E E
Sbjct  20    KMMKCIRSGEQLRLDDMASSSES---LATRDYSVS-YSSQAAGV---DTKVENSNIEEAE  72

Query  422   STLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkp  601
             S+L+E+  LNYEEARALLGRLEYQ+GN +AAL VF+GIDI ++S ++  +++ R    + 
Sbjct  73    SSLRESGYLNYEEARALLGRLEYQKGNIEAALHVFEGIDIASVSSKIKLSLSRRCEQNRR  132

Query  602   rggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGM  781
             R        +  MS+H++SLLLEAI LK KSL GLG+  +AA+ CK ILD +++A P G+
Sbjct  133   RSQSD---AAPPMSMHAISLLLEAIFLKVKSLQGLGKFEEAAQSCKVILDTIETALPEGI  189

Query  782   SEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDL  961
              E V  DCKLQ++ +KA+E LP+LW   G   EA+ SYRRAL+  WNLD +  + ++K+ 
Sbjct  190   PESVSADCKLQDILNKAVELLPELWKLVGSPQEAILSYRRALLYYWNLDTETTSKIEKEF  249

Query  962   AIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDH  1132
             A+ LL++G   D SP   R ++  S  P+NN+EEAILLL +L+ K    ++EWD  +M H
Sbjct  250   AVFLLYSG--SDASPPNLRSQVDGSFVPRNNIEEAILLLLILLRKFAVKKIEWDPTIMYH  307

Query  1133  LTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSE  1312
             L+FAL+V GE  +LA  VE++LPG+  R ER+  LALCY   G+ E  + L    +    
Sbjct  308   LSFALSVSGEQRALAHQVEELLPGIMERRERYSILALCYH--GEGEEMIALNLLRNLLFN  365

Query  1313  AEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNA  1492
               +   +  LLL + +C+++     EG+S+A  A+     +   + S A    G+     
Sbjct  366   RGNPDCVLELLLASNICAKNTVCVEEGLSYASRALSELCGRCNQMESVANCLQGILLSTQ  425

Query  1493  AKISFSDSERNSYQTQSLNSLTQA-AMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYS  1669
             +++  SDSER S Q+++L  L  A  M+ + D   +F L LE A QR L  A  +A Q  
Sbjct  426   SRLVASDSERISKQSEALEMLESAEKMMIERDPSIIFHLSLENAEQRKLDAALYHAKQLL  485

Query  1670  EMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHP  1849
             ++ AGS+ + + LLA I+SA++RF DAE +++ ALD+TG+ DQ + L+ KA LQIA+   
Sbjct  486   KLEAGSSVRSYILLARILSAQKRFVDAENVINAALDQTGKWDQGELLRTKAKLQIAQGQL  545

Query  1850  NQAMETYRILLAMIQAQRQS-GMDHEVLSDRK----LEVEAWLDLARIYIDQDSWPDAQV  2014
               A+ETY  LLA+IQ Q +S G   ++  +++    LE+E W DLA +Y     W DA+V
Sbjct  546   KNAIETYTRLLAIIQVQTKSLGAGKKLAMNQRNSWSLEMETWHDLANVYTSLSQWRDAEV  605

Query  2015  CIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKM  2194
             C+ K+KT+  YS   WH+TG L+EA+   +EAL AF  +L  +P++VPS+VSTA VL ++
Sbjct  606   CLSKSKTLSPYSASRWHSTGLLYEAKGLHQEALKAFKAALYAEPNHVPSLVSTACVLRRL  665

Query  2195  GSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKL--STPV  2368
             GSQ++PI RS L +A+R++ T H AW++LG L K + SA              L  S PV
Sbjct  666   GSQSIPIIRSFLTDAIRLDKTNHSAWYNLGLLYKADPSASALEAAECFEAAAFLEDSAPV  725

Query  2369  QSF  2377
             +SF
Sbjct  726   ESF  728



>ref|XP_008382827.1| PREDICTED: tetratricopeptide repeat protein 7A [Malus domestica]
Length=738

 Score =   488 bits (1256),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 300/702 (43%), Positives = 432/702 (62%), Gaps = 27/702 (4%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             M C  SGEQ +    E  P   ESLAT+D   S  SSSR G A    +     ++E ES+
Sbjct  22    MKCFRSGEQLR-AADEMVPWENESLATKDDKLSE-SSSRAGEAT--KKPHTGNIEEAESS  77

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             L+E+  LNYEEARALLGR EYQ+GN +AAL VF+GIDI  L+P++   +      RK R 
Sbjct  78    LRESGCLNYEEARALLGRYEYQKGNIEAALHVFEGIDIGALTPKIKITLARGGERRKRRS  137

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                    +  +S+++V+LLLEAI LK+KSL  LGR ++AA+ CK +LDIV+S+ P+G+ +
Sbjct  138   QS---FSTPPLSINAVTLLLEAIYLKAKSLEALGRFKEAAQSCKVVLDIVESSLPDGLPQ  194

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
               G DCKLQE+  K++E LP+LW       EA+ SYR+AL+  WNL+ +  A +QKD A+
Sbjct  195   NFGADCKLQEIISKSVELLPELWKLSDCPHEAILSYRQALLHHWNLEVETTAKIQKDFAV  254

Query  968   ALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLT  1138
              LL++G E   SP   RF++  S  PKN++EEAILLL +L+ K     ++WD  ++DHL+
Sbjct  255   LLLYSGCEG--SPPNLRFQMDSSFVPKNSLEEAILLLMILLRKASLRRIQWDPSILDHLS  312

Query  1139  FALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAE  1318
             FAL+V G+  +LA+ VE++LPG   R E +Y LALCY  AG++  AL+LLRK+   SE  
Sbjct  313   FALSVAGDTMALANQVEELLPGFMDRKEIFYKLALCYYGAGEDSAALDLLRKLLSKSE--  370

Query  1319  HEPH-IPSLLLGAKLCSQDPCKSR--EGISFARGAMDSTVNQNKHLLSQARKFLGVCYGN  1489
              +P   P+LLL +K+C ++P  S   EG+ FAR A++S   +  HL   A   LG+    
Sbjct  371   -DPMCFPALLLASKICGENPSPSHAEEGVGFARRALESLDGKCDHLKCTATCLLGISLSV  429

Query  1490  AAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYS  1669
              +K + +D ER + Q ++L +L  A  +   D   ++ L LEYA QR L  A D A +  
Sbjct  430   HSKSAVADFERVTRQDEALQALETAGRMTMSDPIALYHLSLEYAEQRKLDAALDCAKKML  489

Query  1670  EMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHP  1849
             ++  G   +GW LL+ I+SA++RF DAE I++ ALD+TG+ +Q + L+ KA LQIA+   
Sbjct  490   KLEGGCNIRGWLLLSRILSAQKRFVDAETIIEAALDQTGKWEQGELLRTKAKLQIAQGQF  549

Query  1850  NQAMETYRILLAMIQAQRQS-GMDHEVLSDR-----KLEVEAWLDLARIYIDQDSWPDAQ  2011
               A+ TY  LLA +Q Q +S G   +          +L++E W DLA  YI+   W DA 
Sbjct  550   KNAIATYTQLLAFVQVQNKSFGYGKKPPESTGNLPGRLDLEIWNDLAYFYINLSQWRDAX  609

Query  2012  VCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMK  2191
              C+ K+K    +S    H TG L+E +   KE+L A+S +L IDP +VPS++S A VL +
Sbjct  610   ACLSKSKGRRAFSANRCHATGLLYEKKCLYKESLRAYSEALDIDPSHVPSLISMAAVLRR  669

Query  2192  MGS---QAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGS  2308
             +G     +  + RSLLM+AL I+ T H AW++LG L K +G+
Sbjct  670   LGDSSHHSHTVVRSLLMHALSIDRTNHSAWYNLGLLYKSQGT  711



>gb|KEH42485.1| TPR 7B-like protein [Medicago truncatula]
Length=713

 Score =   487 bits (1253),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 295/699 (42%), Positives = 429/699 (61%), Gaps = 22/699 (3%)
 Frame = +2

Query  320   LATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRG  499
             L TRDF +    S   G  D   + +   ++E E +L+E+  LNYEEARALLGR EYQ+G
Sbjct  23    LITRDFFSGSDHSFLPGKLD--QKLDTGNIEEAELSLRESGVLNYEEARALLGRYEYQKG  80

Query  500   NFDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAIL  679
             N  AAL VF+GIDI  ++P++  A+++    RK             MS+HSV LL EA+ 
Sbjct  81    NLVAALHVFEGIDIGAVTPKIKIALSKNRERRKKHSHNHG---EPEMSIHSVGLLFEALF  137

Query  680   LKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWV  859
             LK+KSL  L R ++AA+ CK I+DIV+S+ P G+ +  G +CKLQE   KA+E LP+LW 
Sbjct  138   LKAKSLQALERFKEAAQSCKVIMDIVESSLPEGLPDNFGAECKLQETVSKAVELLPELWK  197

Query  860   QEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSP--RFKIWCSTP  1033
                   EA  SYRRAL+  WNLD   +A +QK+  + LL++G EV + P  R ++  S  
Sbjct  198   LADCPREATLSYRRALLHKWNLDPGTIAKIQKEFVVFLLYSGGEV-MPPNLRSQMDGSFV  256

Query  1034  PKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKT  1213
             P NN+EEAILLL +L+ K+    +EWD  ++DHL+FAL+V G+  SLA+++E++LPG   
Sbjct  257   PGNNIEEAILLLMILLRKVTLNRIEWDPSILDHLSFALSVSGDLSSLANHLEELLPGTLH  316

Query  1214  RAERWYFLALCYSSAGQNETALNLLRK-VSGSSEAEHEPHIPSLLLGAKLCSQDPCKSRE  1390
             R+ER++ LALC   AG++  AL+LLRK ++G    E   H+P LL+ +K+C ++P  + E
Sbjct  317   RSERFHDLALCNYGAGKDLVALDLLRKLLTGRERPE---HVPGLLMASKICCENPSLAEE  373

Query  1391  GISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAM  1570
             G+SF++ A++S   + K L + A+ +LGV     +K++ SD E+   Q+++L +L  A  
Sbjct  374   GVSFSQRALESLDGRCKQLENVAKFYLGVSSSAHSKLAVSDFEKFKRQSEALQALETAGR  433

Query  1571  LCK-EDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSD  1747
                  D   ++ L LEYA QR L  A   A    ++  GS  KGW LLA I+SA+++F +
Sbjct  434   TTGMRDPLVLYHLSLEYAEQRKLNDALYYAKCVVKLEGGSNVKGWLLLARILSAQKQFLE  493

Query  1748  AEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQSGMDHEV  1927
             AE+I++ ALD+TG+ DQ   L+ KA +QIA      A+ETY  LLA++Q Q +S    + 
Sbjct  494   AESIINAALDQTGKWDQGDLLRTKAKIQIALGQLKNAIETYTQLLAVLQIQSKSFGSWKK  553

Query  1928  LSD------RKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEA  2089
             L        R LEVE W DLA +YI    W DA+ C+ K+K I  YS    H  G ++EA
Sbjct  554   LYKGNRDRARNLEVEIWHDLAHVYISLSQWHDAEACLSKSKAIKPYSASRCHALGIMYEA  613

Query  2090  QERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDA  2269
             +   KE+L AF  +L IDP +V S++STAEVL    +++ P  R+ L +ALR +     A
Sbjct  614   KGLYKESLKAFRDALDIDPGHVRSLISTAEVLRHCSNKSNPAVRTFLTDALRHDRLNASA  673

Query  2270  WFSLGKLSKMEG---SaqqaadffqaaHELKLSTPVQSF  2377
             W++LG   K EG   S  +A + FQAAH L+ STP++ F
Sbjct  674   WYNLGLFHKAEGKISSLVEATECFQAAHSLEESTPLEPF  712



>ref|NP_001151614.1| LOC100285248 [Zea mays]
 gb|ACG43518.1| calmodulin-binding protein MPCBP [Zea mays]
Length=714

 Score =   487 bits (1253),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 291/671 (43%), Positives = 429/671 (64%), Gaps = 12/671 (2%)
 Frame = +2

Query  383   ESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRM  562
             E++ ++  + E ES+L+E LSLNYEEARALL RLEYQRGN +AAL+VF GID++    R 
Sbjct  47    EAKVDDGNIQEAESSLREGLSLNYEEARALLWRLEYQRGNVEAALRVFDGIDLQAAIQRF  106

Query  563   SKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKA  742
               +++++   ++    + +   SG  S H+ SL+LEAI LKS SL  LG+  +AA++CK+
Sbjct  107   QPSLSDKPLSKRSNKLRADSSNSG--SQHAASLVLEAIYLKSMSLQKLGKAMEAAKQCKS  164

Query  743   ILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWN  922
             +LD V+S F  G+  GV  + KLQE   K++E LP+LW Q G   EA+ SYRRAL+  WN
Sbjct  165   VLDAVESIFQCGIP-GVMVEQKLQETVSKSVELLPELWKQAGAYQEALASYRRALLSQWN  223

Query  923   LDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPKNNMEEAILLLFVLMGKIQQ  1096
             LD +    +QK  A+ LL+ GVE    P    +   S  P+NN+EEAILLL +L+ K   
Sbjct  224   LDDECCTRIQKRFAVFLLYGGVEA-APPSLASQTEGSFVPRNNLEEAILLLMILLKKWFL  282

Query  1097  GEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETA  1276
             G+  WD  VM+HLTFAL++ G+   +A ++E++LPG+  R ERWY LALCY +   NE A
Sbjct  283   GKTHWDPSVMEHLTFALSLCGQTSIIAKHLEEVLPGIYPRTERWYSLALCYFAVSHNEAA  342

Query  1277  LNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQ  1456
             LNLLRK    +E+ ++  I +LLL AK+CS +   S EG+ +A+ A+    + + HL S 
Sbjct  343   LNLLRKSLNKNESPND--IMALLLAAKICSSNNLLSSEGVEYAKRAVRDAESSDGHLKSV  400

Query  1457  ARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNL  1636
             A   LG C    +K++ SD +R+  Q ++L SL +A  L + + E +F LG+EYA QRN+
Sbjct  401   ALHVLGSCLSRKSKVASSDHQRSVLQAEALKSLNEAISLDRHNPELLFELGIEYAEQRNM  460

Query  1637  TPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflkl  1816
               A   A ++ ++T GS +KGW+LL L++SA+QR+S+AE + D ALDET + +Q   L++
Sbjct  461   HAALKCAKEFIDVTGGSVSKGWRLLLLVLSAQQRYSEAEVVTDAALDETAKWEQGPLLRI  520

Query  1817  kaalqIARQHPNQAMETYRILLAMIQAQRQS----GMDHEVLSDRKLEVEAWLDLARIYI  1984
             +A L++A+  P +A+E YR LLA++QAQR++        E   D+  EVE W  LA +Y 
Sbjct  521   RAKLKVAQALPMEAVEAYRTLLALVQAQRKAYGSVKNGTEDNEDKVREVEVWHGLANLYS  580

Query  1985  DQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSI  2164
                 W DA++C+ KAK +  YS  + H  G   E  E+ ++A+ A+  ++S++ ++VPS 
Sbjct  581   SLSYWRDAEICLQKAKALKTYSATTLHVEGNKHELHEKIQDAVAAYFNAISMEVEHVPSK  640

Query  2165  VSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaH  2344
             VS   +L K G + +P+AR  L +ALR+EPT   AWF LG++ K +G    AAD FQAA 
Sbjct  641   VSIGALLSKQGPKFLPVARCFLSDALRLEPTNRMAWFYLGEVHKQDGRLADAADCFQAAS  700

Query  2345  ELKLSTPVQSF  2377
              L+ S PV+SF
Sbjct  701   MLEDSDPVESF  711



>dbj|BAK01306.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=717

 Score =   487 bits (1253),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 297/672 (44%), Positives = 429/672 (64%), Gaps = 18/672 (3%)
 Frame = +2

Query  389   RFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSK  568
             R ++  + E ES+L+E LSLNYEEARALLGRLEYQRGN +AAL+VF GID++    R   
Sbjct  52    RVDDGNIQEAESSLREGLSLNYEEARALLGRLEYQRGNVEAALRVFDGIDLQAAIQRFQP  111

Query  569   AItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAIL  748
             +++E+   ++    + +   SG  S H+ SL+LEAI LK+ SL  LG+  +AA++CK++L
Sbjct  112   SLSEKPSSKRNNKLRSDSSNSG--SQHAASLVLEAIYLKAMSLQKLGKAIEAAQQCKSVL  169

Query  749   DIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLD  928
             D V+S F  G+ + + E  KLQE   K++E LP+LW Q G   EA+ SYRRAL+  WNLD
Sbjct  170   DAVESIFQRGIPDVMVEQ-KLQETVSKSVELLPELWKQAGAYQEALASYRRALLSQWNLD  228

Query  929   AKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPKNNMEEAILLLFVLMGKIQQGE  1102
              +    +QK  ++ LL+ GVE    P    +   S  PKNN+EEAILLL +L+ K   G+
Sbjct  229   DECCTRIQKRFSVFLLYGGVEAS-PPSLASQTEGSFVPKNNLEEAILLLMILLKKWYLGK  287

Query  1103  VEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALN  1282
               WD  VM+HLTFAL++ G+   LA + E++LPG+  R ERWY LALCYS+A  NE ALN
Sbjct  288   THWDPSVMEHLTFALSLCGQTSVLAKHFEEVLPGIYPRTERWYSLALCYSAASDNEAALN  347

Query  1283  LLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQAR  1462
             LL+K    +E+ ++  I +LLL AK+CS D   + EG+ +A+ A+      + HL S A 
Sbjct  348   LLKKSLNKNESPND--INALLLAAKICSSDYHLASEGVEYAKRAIADDELSDGHLRSVAL  405

Query  1463  KFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTP  1642
               LG C  N +KI+ SD +R+  Q ++L SL +A  L + + + +F +G+EYA QRN+  
Sbjct  406   HLLGSCLANKSKIASSDHQRSLLQAEALKSLGEAFSLDRHNPDLIFDMGVEYAEQRNMQA  465

Query  1643  AFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklka  1822
             A   A Q+ + T GS +KGW+LL+L++SA+QR+S+AE + D ALDET + +Q   L++KA
Sbjct  466   ALKCAKQFIDTTGGSVSKGWRLLSLVLSAQQRYSEAEVVTDAALDETAKWEQGPLLRIKA  525

Query  1823  alqIARQHPNQAMETYRILLAMIQAQRQS------GMDHEVLSDRKL-EVEAWLDLARIY  1981
              L+ A+  P +A+E YR LLA++QAQR++      G + +   D K+ E E W  LA +Y
Sbjct  526   KLKAAQSLPMEAVEAYRTLLALVQAQRKAYGSLKNGTEEK---DYKVSEFEVWQGLANLY  582

Query  1982  IDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPS  2161
                    DA++C+ KAK +  YS  + H  G + E +E+ + AL A+  +LS + D+VPS
Sbjct  583   ASLSYCRDAEICLQKAKALKTYSATTLHAEGDMHEVREQTQHALAAYLNALSTEVDHVPS  642

Query  2162  IVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaa  2341
              VS   +L K G + +P+ARS L +ALR+EPT   AWF LG++ K +G    AAD FQAA
Sbjct  643   KVSIGALLSKQGPKYLPVARSYLSDALRLEPTNRMAWFYLGQVHKHDGRLADAADCFQAA  702

Query  2342  HELKLSTPVQSF  2377
               L+ S PV+S 
Sbjct  703   SMLEESDPVESL  714



>gb|KDO63443.1| hypothetical protein CISIN_1g005499mg [Citrus sinensis]
Length=693

 Score =   486 bits (1250),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 302/675 (45%), Positives = 427/675 (63%), Gaps = 18/675 (3%)
 Frame = +2

Query  371   TADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTL  550
              A+ E++ +E  + E ES+L+E LSLN+EEARALLGRLEYQRGN + AL+VF GID+   
Sbjct  27    AAEVEAKLDEGNIQEAESSLREGLSLNFEEARALLGRLEYQRGNVEGALRVFDGIDLHAA  86

Query  551   SPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAAR  730
               R+  + +E++  +K R      V    +S H+ SL+LEAI LK+KSL  LGR+ +AA 
Sbjct  87    IQRLQPSFSEKSASKKCRSRSDSHVS---VSQHAASLVLEAIYLKAKSLQKLGRLTEAAN  143

Query  731   ECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALV  910
             ECK++LD V+  F  G+ +    D +LQE   +A+E LP+LW Q G   +A+ +YRRA++
Sbjct  144   ECKSVLDAVERIFQQGIPD-AQVDNRLQETVSRAVELLPELWKQVGCDHDALAAYRRAVL  202

Query  911   KPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPKNNMEEAILLLFVLMG  1084
               WNLD +  A +QK  A+ LL +GVE    P    ++  S  PKNN+EEAILLL +LM 
Sbjct  203   SQWNLDNECCARIQKRFAVFLLHSGVEAG-PPSLGSQVEGSYAPKNNLEEAILLLLILMK  261

Query  1085  KIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQ  1264
             K   G+++WD  VM+HLT+AL++  +   LA  +E+I+PG+  R++RW  LALCYS+ GQ
Sbjct  262   KYHLGKIKWDPAVMEHLTYALSLCSQTSILAKQLEEIMPGVFLRSDRWNALALCYSAIGQ  321

Query  1265  NETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKH  1444
             N+ ALNLLRK     E  ++  + +LLL AK+CS+D   + EGI +AR A+ +   +++H
Sbjct  322   NDAALNLLRKSLHKHERPND--LMALLLAAKICSEDCHLAAEGIQYARTALSNAQGKDEH  379

Query  1445  LLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYAT  1624
             L     + LG+C G  AK+S SD ER+  Q+++L SL  A+     +A+  F L      
Sbjct  380   LKGVGLRMLGLCLGRHAKVSSSDYERSRLQSEALKSLDGASTFENNNADLFFDL-----E  434

Query  1625  QRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlq  1804
             QRNL+ A   A QY + T GS  KGWKLLAL++SA+QRFS+AE + D ALDET + +Q  
Sbjct  435   QRNLSTALRYAKQYIDATGGSVLKGWKLLALVLSAQQRFSEAEVVTDAALDETTKWEQGP  494

Query  1805  flklkaalqIARQHPNQAMETYRILLAMIQAQRQSGMDHEVLS----DRKLEVEAWLDLA  1972
              L+LKA L+IA+  P  A+ETYR LLA++QAQR+S      LS    D+  E + W  LA
Sbjct  495   ILRLKAKLKIAQALPMDAIETYRYLLALVQAQRKSFGPLRCLSQIEDDKVNEFQVWHGLA  554

Query  1973  RIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDY  2152
              +Y     W D  +C+ KA+ +  YS +  HT G + E   +  EAL A+  +L I+P Y
Sbjct  555   NLYSGLSHWKDVAICMGKARELKAYSAEMLHTEGVMHEGCGQTHEALRAYINALLIEPSY  614

Query  2153  VPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadff  2332
             VP  V    +  K+G +A+P+ARSLL +ALRIEPT   AW+ LG + K +G    AAD F
Sbjct  615   VPCKVLVGSLFSKLGPKALPVARSLLSDALRIEPTNRKAWYYLGLVHKDDGRIADAADCF  674

Query  2333  qaaHELKLSTPVQSF  2377
             QAA  L+ S P++SF
Sbjct  675   QAASMLEESDPIESF  689



>gb|KEH20324.1| calmodulin-binding protein MPCBP protein [Medicago truncatula]
Length=689

 Score =   486 bits (1250),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 288/690 (42%), Positives = 430/690 (62%), Gaps = 18/690 (3%)
 Frame = +2

Query  329   RDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFD  508
             R+F A+G S     TA+ E++ ++  + + E+ L++ LSL  EEA+ALLG+LEYQRGN +
Sbjct  7     REFCANGTS---MDTAEVEAKLDQGNIQDAETALRDGLSLTSEEAQALLGKLEYQRGNVE  63

Query  509   AALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKS  688
              AL+VF GID+K    R+  +  E+   +K             ++ H+ S++LEAI LK+
Sbjct  64    GALRVFDGIDLKAAIQRLQPSFLEKPPVKKGPSRAES---PSSVTQHAASMVLEAIYLKA  120

Query  689   KSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEG  868
             KSL  LG+  +AA ECK +LD V+  F  G+S+    D +LQE+   A+E LP+LW Q G
Sbjct  121   KSLQKLGKFDEAANECKQVLDAVEKVFSQGISD-TQVDSRLQEIVSCAVELLPELWKQAG  179

Query  869   LIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPR---FKIWCSTPPK  1039
               DEA+ +YR AL+  WNLD    A +QK  A+ LL++GVE   SPR    +I  S  PK
Sbjct  180   CYDEAITAYRNALLSQWNLDNDCCARIQKAFAVFLLYSGVEA--SPRSFSVQIEGSYVPK  237

Query  1040  NNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRA  1219
             NN+EEAILLL +++ K   G++++D  VM+HLTFAL+  GE   LA   E++LPG+  R 
Sbjct  238   NNLEEAILLLMIVLRKFSLGKIKYDPSVMEHLTFALSACGETSILAKQFEEMLPGVYHRI  297

Query  1220  ERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGIS  1399
             +RW  LALC S AGQN++ALNLLRK     + E    + +LLL A++CS+DP  + EG  
Sbjct  298   DRWNSLALCLSGAGQNKSALNLLRK--SLHKHERPDDLLALLLAARICSEDPHLAAEGAG  355

Query  1400  FARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCK  1579
             +A+ A+D     N+HL     + LG+C G  AK++ SD ER+  Q+++L SL +A  L +
Sbjct  356   YAQRAIDKAQGLNEHLEGVGLRMLGLCLGKQAKVASSDFERSMLQSKALQSLEEAVRLEQ  415

Query  1580  EDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAI  1759
              + + +F L ++YA  RNL  A   A Q+ + T GS  KGW+LL+L++SA++RF++AE +
Sbjct  416   NNFDLIFELAIQYAEHRNLAVALRYAKQFFDKTGGSKLKGWRLLSLVLSAQKRFTEAEVV  475

Query  1760  VDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQSGMDHEVLS--  1933
              D A+DET + +Q    ++KA L+IA   P  A+E YR LLA++QAQ++S     + S  
Sbjct  476   TDAAIDETSKWEQGPLFRIKAKLKIAELRPMDAIEIYRYLLALVQAQKKSVGTQRLSSQD  535

Query  1934  --DRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKE  2107
               D+  E + W  LA +Y     W DA++C+ KA+ +  YS  +  T G +FE   +  +
Sbjct  536   EEDQINEFDVWHGLANLYASLSHWKDAEICLQKARELKEYSAATMQTEGIVFEGCGQSGK  595

Query  2108  ALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGK  2287
              L A   ++ ++P++VPS +    +++K GS+A P++RSLL +ALRIEPT  +AW+ LG 
Sbjct  596   GLAAAINAILVEPNHVPSKILMGSLMLKSGSKASPVSRSLLSDALRIEPTNRNAWYHLGL  655

Query  2288  LSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
               K +G    AAD FQAA  L+ S P++SF
Sbjct  656   THKEDGRMGDAADCFQAASMLEESDPIESF  685



>ref|XP_007214841.1| hypothetical protein PRUPE_ppa002261mg [Prunus persica]
 gb|EMJ16040.1| hypothetical protein PRUPE_ppa002261mg [Prunus persica]
Length=694

 Score =   486 bits (1250),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 303/687 (44%), Positives = 436/687 (63%), Gaps = 14/687 (2%)
 Frame = +2

Query  332   DFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDA  511
             +FSA+G S   T   D +++ +E  + E ES+L+E LSLN+EEARALLG+LEYQRGN + 
Sbjct  13    EFSANGNSMKAT---DVQAKLDEGNIQEAESSLREGLSLNFEEARALLGKLEYQRGNLEG  69

Query  512   ALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKSK  691
             AL+VF GID++    R+  ++ E+T  RK R           +S H+ SL+L+AI LKSK
Sbjct  70    ALRVFDGIDLQAAIERLQPSLAEKTPSRKGRTRSDS---QHTVSQHAASLVLDAIYLKSK  126

Query  692   SLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGL  871
             SL  LGR+ +AA ECK +LD V+  F  GM +    D +LQE   +A+E LP+LW Q G 
Sbjct  127   SLQKLGRLTEAASECKNVLDAVEKIFHQGMHDA-QVDGRLQETVSQAVELLPELWKQAGY  185

Query  872   IDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDL-SPRFKIWCSTPPKNNM  1048
               EA+++YRRAL+  WNLD    A +QK  A+ LL++GVE    S   ++  S  PKNN+
Sbjct  186   YHEAISAYRRALLSQWNLDNDCCARIQKGFAVFLLYSGVEAGPPSLGVQVEGSYVPKNNL  245

Query  1049  EEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERW  1228
             EEAILLL +L+ K+  G+ + D  +M+HLTFAL++  +   LA  +E+I+PG+  R +RW
Sbjct  246   EEAILLLMILLRKLSLGKTKCDPSLMEHLTFALSLCNQTSVLAKQLEEIMPGVYHRVDRW  305

Query  1229  YFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFAR  1408
               LALCYS AG N  ALNLLRK     E   E  + +LLL AK CS+D   + EG+ +A+
Sbjct  306   NSLALCYSGAGHNNEALNLLRKSLHKHERPDE--LTALLLAAKTCSEDSHVAAEGVGYAQ  363

Query  1409  GAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKEDA  1588
              A+ S    ++HL     + LG+C G  AK+S SD ER+  Q+++L SL +A  L + + 
Sbjct  364   RAISSAQGMDEHLKGVGLRLLGLCLGKQAKVSSSDFERSRLQSEALKSLNEAIALEQNNL  423

Query  1589  ETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDL  1768
             + +F LG++YA  RNL  A   A Q+ + T GS  KGW+LLAL++SA+QR+S+A  + D 
Sbjct  424   DLIFELGVQYAEHRNLNAALRYAKQFIDRTGGSIIKGWRLLALVLSAQQRYSEAHVVTDA  483

Query  1769  ALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQS----GMDHEVLSD  1936
             ALDET + +Q   L+LKA L+I++  P  A+ETYR LLA++QAQR+S     + ++V  D
Sbjct  484   ALDETAKWEQGPLLRLKAKLKISQSLPMDAIETYRYLLALVQAQRKSFGPLRISNQVEDD  543

Query  1937  RKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALV  2116
             +  E E W  LA +Y     W DA++C+ KA  +  +S +  HT G + E + + +EAL 
Sbjct  544   KVDEFEVWHGLADLYSSLSHWKDAEICLSKASELKRHSAEMLHTEGVILEGRGQIQEALA  603

Query  2117  AFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSK  2296
             A+  +L ++P YVP  +  A +L KMGS A+P+ARSLL +ALRI+P    AW+ LG + +
Sbjct  604   AYIDALLLEPYYVPCKILIAALLSKMGSVALPVARSLLSDALRIDPNNRKAWYYLGMIHR  663

Query  2297  MEGSaqqaadffqaaHELKLSTPVQSF  2377
              +G    A D FQAA  L+ S P++SF
Sbjct  664   DDGRIADAIDCFQAASMLEESDPIESF  690



>ref|XP_008229599.1| PREDICTED: tetratricopeptide repeat protein 7B [Prunus mume]
Length=694

 Score =   486 bits (1250),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 302/687 (44%), Positives = 437/687 (64%), Gaps = 14/687 (2%)
 Frame = +2

Query  332   DFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDA  511
             +FSA+G S   T   D +++ +E  + E ES+L+E LSLN+EEARALLG+LEYQRGN + 
Sbjct  13    EFSANGNSMKAT---DVQAKLDEGNIQEAESSLREGLSLNFEEARALLGKLEYQRGNLEG  69

Query  512   ALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKSK  691
             AL+VF GID++    R+  ++ E+T  RK R           +S H+ SL+L+AI LKSK
Sbjct  70    ALRVFDGIDLQAAIERLQPSLAEKTPSRKGRSRSDS---QHTVSQHAASLVLDAIYLKSK  126

Query  692   SLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGL  871
             SL  LGR+ +AA ECK +LD V+  F  G+ +    D +LQE   +A+E LP+LW Q G 
Sbjct  127   SLQKLGRLTEAASECKNVLDAVEKIFHQGIHDA-QVDGRLQETVSQAVELLPELWKQAGY  185

Query  872   IDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDL-SPRFKIWCSTPPKNNM  1048
               EA+++YRRAL+  WNLD    A +QK  A+ LL++GVE    S   ++  S  PKNN+
Sbjct  186   YHEAISAYRRALLSQWNLDNDCCARIQKGFAVFLLYSGVEAGPPSLGVQVEGSYVPKNNL  245

Query  1049  EEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERW  1228
             EEAILLL +L+ K+  G+ + D  +M+HLTFAL++  +   LA  +E+I+PG+  R +RW
Sbjct  246   EEAILLLMILLRKLSLGKTKCDPSLMEHLTFALSLCNQTSVLAKQLEEIMPGVYHRVDRW  305

Query  1229  YFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFAR  1408
               LALCYS AG N  ALNLLRK     E   E  + +LLL AK CS+D   + EG+ +A+
Sbjct  306   NSLALCYSGAGHNNEALNLLRKSLHKHERPDE--LTALLLAAKTCSEDSHVAAEGVGYAQ  363

Query  1409  GAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKEDA  1588
              A+ S    ++HL     + LG+C G  AK+S SD ER   Q+++L SL +A  L + + 
Sbjct  364   RAISSAQGMDEHLKGVGLRLLGLCLGKQAKVSSSDFERFRLQSEALKSLNEAIALEQNNL  423

Query  1589  ETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDL  1768
             + +F LG++YA  RNL  A   A Q+ + T GS  KGW+LLAL++SA+QR+S+A  + D 
Sbjct  424   DLIFELGVQYAEHRNLNAALRYAKQFIDRTGGSIIKGWRLLALVLSAQQRYSEAHVVTDA  483

Query  1769  ALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQS----GMDHEVLSD  1936
             ALDET + +Q   L+LKA L+I++  P  A+ETYR LLA++QAQR+S     + ++V  D
Sbjct  484   ALDETAKWEQGPLLRLKAKLKISQSLPMDAIETYRYLLALVQAQRKSFGPLRISNQVEDD  543

Query  1937  RKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALV  2116
             +  E E W  LA +Y     W DA++C+ KA  + ++S ++ HT G + E + + +EAL 
Sbjct  544   KVDEFEVWHGLADLYSSLSHWKDAEICLSKASELKLHSAETLHTEGVILEGRGQIEEALA  603

Query  2117  AFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSK  2296
             A+  +L ++P YVP  +  A +L KMGS A+P+ARSLL +ALRI+P    AW+ LG + +
Sbjct  604   AYIDALLLEPYYVPCKILIAALLSKMGSVALPVARSLLSDALRIDPNNRKAWYYLGMIHR  663

Query  2297  MEGSaqqaadffqaaHELKLSTPVQSF  2377
              +G    A D FQAA  L+ S P++SF
Sbjct  664   DDGRIADAIDCFQAASMLEESDPIESF  690



>emb|CBI37151.3| unnamed protein product [Vitis vinifera]
Length=696

 Score =   485 bits (1249),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 299/698 (43%), Positives = 435/698 (62%), Gaps = 22/698 (3%)
 Frame = +2

Query  320   LATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRG  499
             LAT D+SAS    S +  A+ E + +   ++E ES+L+E+  LNYEEARALLGR EYQ+G
Sbjct  8     LATNDYSAS---GSSSRAAELEQKQDIGNIEEAESSLRESGCLNYEEARALLGRYEYQKG  64

Query  500   NFDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAIL  679
             N +AAL VF+GIDI  ++P+M   + +R   R+ R        +  MS+H+VSLLLEAI 
Sbjct  65    NIEAALHVFEGIDIAAVTPKMKLTLAKRGERRRRRSQSD---AAPPMSIHAVSLLLEAIF  121

Query  680   LKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWV  859
             LK+KSL GLGR ++AA+ C  ILDIV+S+ P G+    G DCKLQE  +KA+E LP+LW 
Sbjct  122   LKAKSLQGLGRFKEAAQSCNVILDIVESSLPEGLHVNFGSDCKLQETLNKAIELLPELWK  181

Query  860   QEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSP---RFKIWCST  1030
                   EA+ SYRRAL+  WN+D +  A +QK+ AI LL++G E   SP   R ++  S 
Sbjct  182   LADSPHEAILSYRRALLHAWNIDVETNAKIQKEFAIFLLYSGGEA--SPPELRSQMDSSF  239

Query  1031  PPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMK  1210
              P+NN+EEAILLL +L+ KI   ++EWD  ++DHL++AL++ G   +LA+ VE++LPG  
Sbjct  240   VPRNNIEEAILLLIILLRKISLEKIEWDPSILDHLSYALSLSGGLRALANQVEELLPGTM  299

Query  1211  TRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSRE  1390
              R ER++ LALCY   G  ++   L       S AE+  ++P+LL+ +K+C ++P  + E
Sbjct  300   NRKERYHTLALCYY--GDGDSLTALNLLKKLLSNAENPNYLPALLMASKICGENPNFAEE  357

Query  1391  GISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAM  1570
             GISFAR A+ S     + + S A   LG+     +K   +DSER S Q ++L++L  A  
Sbjct  358   GISFARRALQSLQGGCEEMGSVANCLLGISLSAHSKSVVADSERVSRQAEALHALETAGR  417

Query  1571  LCK-EDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSD  1747
             + K  D + V+ L LE A QR L  A   A  + ++  GS+ KGW LL  I+SA++RF D
Sbjct  418   MIKVRDPKVVYHLSLENAEQRKLDAALYYAKYFIKLEGGSSVKGWLLLTRILSAQKRFKD  477

Query  1748  AEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQS-GMDHE  1924
             AEA+++ A+D+TG+ DQ + L+ KA LQIAR    QA+ETY  LLA++Q QR+S G  ++
Sbjct  478   AEAVINAAIDQTGKWDQGELLRTKAKLQIARGRLKQAVETYTHLLAVLQVQRKSFGSGNK  537

Query  1925  VLS-----DRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEA  2089
              L      DR LE++AW DLA +YI    W +A++C+ K++ I  YS    H  G L+E 
Sbjct  538   FLKGSGYPDRSLELDAWHDLAYLYISLSRWHEAEICLSKSRAISPYSAARCHAMGLLYEK  597

Query  2090  QERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDA  2269
             Q   KEAL AF+  L I+P ++P ++S A VL  +G+Q+  + RS L  AL+++     A
Sbjct  598   QGLHKEALKAFANGLDIEPTHIPCLISIAVVLRHLGTQSDAVVRSFLTQALQLDRMNPSA  657

Query  2270  WFSLGKLSKMEGSaqqaadffqaaHE--LKLSTPVQSF  2377
             W++LG + K +G+A              L+ STPV+ F
Sbjct  658   WYNLGLVYKAQGAASLQEAAECFEAAALLEESTPVEPF  695



>ref|XP_009369434.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Pyrus x 
bretschneideri]
 ref|XP_009369436.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Pyrus x 
bretschneideri]
 ref|XP_009369437.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Pyrus x 
bretschneideri]
Length=738

 Score =   487 bits (1253),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 298/703 (42%), Positives = 430/703 (61%), Gaps = 28/703 (4%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             M C  SGEQ +    E  P   ESLAT+D     L  S     +   +     ++E E +
Sbjct  21    MKCFRSGEQLR-AADEMVPAENESLATKD---DKLHESLLRAGEATKKPHAGNIEEAELS  76

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             L+E+  LNYEEARALLGR EYQ+GN +AAL VF+GIDI  L+P++   +      RK R 
Sbjct  77    LRESGCLNYEEARALLGRYEYQKGNIEAALHVFEGIDIGALTPKIKITLARGGERRKRRS  136

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                    +  +S+++V+LLLEAI LK+KSL  LGR ++AA+ CK +LDIV+S+FP+G+ +
Sbjct  137   QS---FSTPPLSMNAVTLLLEAIFLKAKSLEALGRFKEAAQSCKVVLDIVESSFPDGLPQ  193

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
               G DCKLQE+  K++E LP+LW       EA+ SYR+AL+  WNL+ +  A +QKD A+
Sbjct  194   NFGADCKLQEIISKSVELLPELWKLSDCPHEAILSYRQALLHHWNLEVETTAKIQKDFAV  253

Query  968   ALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLT  1138
              LL++G E   SP   RF+I  S  PKN++EEAILLL +L+ K     ++WD  ++DHL+
Sbjct  254   LLLYSGCEG--SPPNLRFQIDSSFVPKNSLEEAILLLMILLRKASLRRIQWDPSILDHLS  311

Query  1139  FALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAE  1318
             FAL+V G+  +LA+ VE++LPG   R E +Y LALCY   G++  AL+LLRK+   SE  
Sbjct  312   FALSVAGDTMALANQVEELLPGFMDRKEIFYKLALCYYGVGEDSVALDLLRKLLSKSE--  369

Query  1319  HEPH-IPSLLLGAKLCSQDPCKSR--EGISFARGAMDSTVNQNKHLLSQARKFLGVCYGN  1489
              +P   P+LLL +K+C ++P  S   EG+ FAR A++S   +  HL S A   LG+    
Sbjct  370   -DPMCFPALLLASKICGENPSPSHAEEGVGFARRALESLDGKCDHLKSTATCLLGISLSV  428

Query  1490  AAKISFSDSERNSYQTQSLNSL-TQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQY  1666
              +K + +D ER + Q ++L +L T   M    D   ++ L LEYA QR L  A D A + 
Sbjct  429   HSKSAVADFERVTRQDEALQALETAGRMTTMSDPFALYHLSLEYAEQRKLDAALDCAKKM  488

Query  1667  SEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQH  1846
              ++  G   KGW LL+ I+SA++RF DAE I++ ALD+TG+ +Q + L+ KA LQIA+  
Sbjct  489   LKLEGGCNIKGWLLLSRILSAQKRFVDAETIIEAALDQTGKWEQGELLRTKAKLQIAQGQ  548

Query  1847  PNQAMETYRILLAMIQAQRQSGMDHEVLSDR------KLEVEAWLDLARIYIDQDSWPDA  2008
                A+ TY  LLA +Q Q +S    +   +R      +L++E W DLA  YI+   W DA
Sbjct  549   FKNAIATYTQLLAFVQVQNKSFGYGKKPPERTGNLPGRLDLEIWNDLAYFYINLSQWHDA  608

Query  2009  QVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLM  2188
             + C+ K+K    YS    + TG L+E +   KE+L A+S +L IDP +VPS++S A VL 
Sbjct  609   EACLSKSKARRAYSANRCNATGLLYEKKCLYKESLKAYSEALDIDPSHVPSLISMAAVLR  668

Query  2189  KMGS---QAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGS  2308
             ++G     +  + RSLLM+AL I+ T H AW++LG L K +G+
Sbjct  669   RLGDSSHHSHTVVRSLLMHALSIDRTNHSAWYNLGLLYKSQGT  711



>ref|XP_007225212.1| hypothetical protein PRUPE_ppa001985mg [Prunus persica]
 gb|EMJ26411.1| hypothetical protein PRUPE_ppa001985mg [Prunus persica]
Length=732

 Score =   486 bits (1252),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 300/708 (42%), Positives = 444/708 (63%), Gaps = 27/708 (4%)
 Frame = +2

Query  215   LTGRAHCRRRKML-CACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESR  391
             + GR H    KML C  SGEQ + +E   +  S   LATRD+SASG  S R G  + E++
Sbjct  14    IKGRLH----KMLKCMRSGEQLRVDEIAHSSDS---LATRDYSASGGYSGRAG--EIETK  64

Query  392   FEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKA  571
              + + ++E ES+L+E+  LNYEEARALLGRLEYQ+GN +AAL VF+GIDI  + P+M  +
Sbjct  65    VDNSNIEEAESSLRESGYLNYEEARALLGRLEYQKGNTEAALHVFEGIDIAAVIPKMKVS  124

Query  572   ItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILD  751
             I+ R  P + R     +     MS+H+VSLLLEAI LK+KSL GLGR  +AA+ CK ILD
Sbjct  125   ISRRCEPNRRRSQSDAV---PPMSMHAVSLLLEAIFLKAKSLQGLGRFGEAAQSCKLILD  181

Query  752   IVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDA  931
              V+SA P G+ E    DCKLQE   KA+E LP+LW+  G   EA+ SYR+AL+  WNLD 
Sbjct  182   TVESALPEGLPENFASDCKLQETVGKAVELLPELWILAGAPQEAILSYRQALLYHWNLDI  241

Query  932   KRLASMQKDLAIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGE  1102
             +  + ++K+ A+ LL++G   D +P   R ++  S  P+NN+EEA+LLL +L+ K   G 
Sbjct  242   EVTSKIEKEFAVFLLYSG--CDANPPNLRSQMESSFVPRNNIEEAVLLLLILLRKFVAGR  299

Query  1103  VEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALN  1282
             +EWD  ++DHL+FAL++ G+  +LA  +E+++PG+  R ER+  LALCY   G +  ALN
Sbjct  300   IEWDPSILDHLSFALSISGKIRALAHQIEELIPGIMGRQERYCTLALCYYGEGDDLVALN  359

Query  1283  LLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQAR  1462
                  +  +  E+   I  LLL +K+CS++     +G  +A  A+     +   +LS A 
Sbjct  360   --LLRNVLNNRENTDCILELLLASKICSENLVCIDDGTKYAYKALGRLDGKCSQMLSIAN  417

Query  1463  KFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAE-TVFSLGLEYATQRNLT  1639
               LGV     ++   SDSER   Q+++L +L  A  + +E +   VF L LE+A QR L 
Sbjct  418   CLLGVSLSVKSRSVASDSERILKQSEALQALQSAEKIMRERSPYVVFHLCLEHADQRKLD  477

Query  1640  PAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklk  1819
              A   A Q  ++ AGS+ K + LLA I+SA++RF DAE +++ ALD+TG+ DQ + L+ K
Sbjct  478   FALYYAKQLLKLEAGSSTKAYTLLARILSAQKRFIDAETVINAALDQTGKWDQGELLRTK  537

Query  1820  aalqIARQHPNQAMETYRILLAMIQAQRQS-GMDHEVLS-----DRKLEVEAWLDLARIY  1981
             A L IA+     A+ETY  LLA++Q + ++ G +  +L      +R LE+E W DLA +Y
Sbjct  538   AKLHIAQGQLKNAIETYTHLLAVLQVRTKNLGAEKRLLKSRSEINRSLEMETWHDLANLY  597

Query  1982  IDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPS  2161
                  W DA+VC+ K++ I+ +S   WH+TG L+EA+   +EAL +F  +L ++P +VPS
Sbjct  598   TSLSQWRDAEVCLSKSQAINPHSASRWHSTGLLYEAKGLHQEALESFRKALDVEPTHVPS  657

Query  2162  IVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEG  2305
             ++STA +L + G Q++P+ RS LM+ALR++     AW++LG L K + 
Sbjct  658   LISTACILRQFGGQSLPVVRSFLMDALRLDRGNPSAWYNLGLLYKADA  705



>gb|KDP40367.1| hypothetical protein JCGZ_02365 [Jatropha curcas]
Length=731

 Score =   486 bits (1251),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 308/724 (43%), Positives = 457/724 (63%), Gaps = 25/724 (3%)
 Frame = +2

Query  242   RKMLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVE  421
             + M C  SGEQ + ++   + +S   LATRD+SASG SS R G  D +++ + + ++E E
Sbjct  20    KMMKCIRSGEQLRVDDMVASSES---LATRDYSASGYSS-RAG--DMDTKLDNSNIEEAE  73

Query  422   STLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkp  601
             S+L+E+  LNYEEARALLGRLEYQ+GN +AAL VF+GIDI  ++ +M  +++ R    + 
Sbjct  74    SSLRESGYLNYEEARALLGRLEYQKGNIEAALHVFEGIDIAAVTSKMKISLSRRCEQNRR  133

Query  602   rggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGM  781
             R        +  MSLH+VSLLLEAILLK+KSL GLGR  +AA+ CK ILD V+S+ P GM
Sbjct  134   RSQSD---AAPPMSLHAVSLLLEAILLKAKSLQGLGRFAEAAQSCKVILDTVESSLPEGM  190

Query  782   SEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDL  961
              E    D KLQE+ +KA+E LP+LW   G+  EA+ SYRRAL+  WNL+ +    ++K+ 
Sbjct  191   PENFSADSKLQEILNKAVELLPELWKLAGVPLEAILSYRRALLYHWNLEPEITTKIEKEF  250

Query  962   AIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDH  1132
             A+ LL++G   D SP   R ++  S  P+NN+EEA+LLL +L+ K     + WD  ++DH
Sbjct  251   AVFLLYSG--TDASPPNLRSQMEGSFVPRNNIEEAVLLLLILLRKFACKRIGWDPSILDH  308

Query  1133  LTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSE  1312
             L+FAL+V GE  +LA  +E++LPG+  R ER+  LALCY   G+ E  + L    +  + 
Sbjct  309   LSFALSVSGEPWALAHQIEELLPGILERRERYCSLALCY--LGEGEDTVALNLLRNLFNN  366

Query  1313  AEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNA  1492
              E+   I  LLL +K+C+++     EG+++   A+         ++S A   LG+     
Sbjct  367   RENPDCILELLLASKVCAENMIYVDEGLAYTSKALCELNGTCGQMVSVANCLLGLLLSAK  426

Query  1493  AKISFSDSERNSYQTQSLNSLTQAAMLCKE-DAETVFSLGLEYATQRNLTPAFDNALQYS  1669
             A++  SDSER S Q+++L +L  +  + +E D   +F L LE A QR L  A   A Q  
Sbjct  427   ARLVLSDSERTSKQSEALKALETSEKVMRERDPHIIFHLSLENAEQRKLDIALYYAKQLL  486

Query  1670  EMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHP  1849
             ++ AGS  + + L A I+SA++RF DAEA+++ ALD+TG+ DQ + L+ KA LQIA+   
Sbjct  487   KVEAGSNVRSYILSARILSAKKRFVDAEAVINAALDQTGKWDQGELLRTKAKLQIAQGQF  546

Query  1850  NQAMETYRILLAMIQAQRQS-GMDHEVLS-----DRKLEVEAWLDLARIYIDQDSWPDAQ  2011
               A++TY  LLA+ Q + ++ G   ++L      DR+LE+E W DLA++Y     W DA+
Sbjct  547   KNAVQTYTNLLAVFQVRTKTFGGGKKLLKSRGNHDRRLEIETWHDLAKVYTSLSQWRDAE  606

Query  2012  VCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMK  2191
             +C+ K+K I+ YS   WHT G L+EA+   +EAL AF  +L +DP ++PS+VS+A VL +
Sbjct  607   ICLAKSKAINPYSASRWHTAGLLYEAKGLHQEALKAFRAALDVDPTHIPSLVSSANVLRR  666

Query  2192  MGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKME--GSaqqaadffqaaHELKLSTP  2365
             + SQ+ PI RS L +ALR++   H AW++LG L K +   SA +AA+ F+AA  L+ S P
Sbjct  667   LYSQSTPIIRSFLTDALRLDKMNHSAWYNLGLLYKADANASAHEAAECFEAAAFLEESEP  726

Query  2366  VQSF  2377
             V+ F
Sbjct  727   VEPF  730



>ref|XP_010023877.1| PREDICTED: tetratricopeptide repeat protein 7B isoform X1 [Eucalyptus 
grandis]
 ref|XP_010023878.1| PREDICTED: tetratricopeptide repeat protein 7B isoform X1 [Eucalyptus 
grandis]
 ref|XP_010023879.1| PREDICTED: tetratricopeptide repeat protein 7B isoform X1 [Eucalyptus 
grandis]
 ref|XP_010023880.1| PREDICTED: tetratricopeptide repeat protein 7B isoform X1 [Eucalyptus 
grandis]
 ref|XP_010023881.1| PREDICTED: tetratricopeptide repeat protein 7B isoform X1 [Eucalyptus 
grandis]
Length=731

 Score =   486 bits (1250),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 300/702 (43%), Positives = 443/702 (63%), Gaps = 32/702 (5%)
 Frame = +2

Query  236   RRRKML-CACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVD  412
             R +KML C  SGEQ + +E   + +S   LATRD+SASG SS R G  + E + +++ ++
Sbjct  17    RLKKMLKCIFSGEQVRVDEMIDSSES---LATRDYSASGYSS-RAG--EPEPKVDKSNIE  70

Query  413   EVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrp  592
             E ES+L+E+  LNYEEARALLGRLEYQ+GN +AAL VF+GIDI  ++P+M  +I+ R   
Sbjct  71    EAESSLRESGYLNYEEARALLGRLEYQKGNIEAALHVFEGIDIAAVTPKMRVSISRRGDY  130

Query  593   rkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFP  772
              +          +  MS+H+VSLL EAI LK+KSL  LGR  DAA+ CK ILD V+SA P
Sbjct  131   NRRHSQSD---AAPTMSMHAVSLLFEAIFLKAKSLEHLGRFDDAAQSCKIILDTVESALP  187

Query  773   NGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQ  952
             +G+ E    DCK+QE  +K +E LP+L    G   EA+ SYRRAL+  WNL+ +  + +Q
Sbjct  188   DGLPESFKTDCKIQETLNKVVELLPELLKLAGDFQEAILSYRRALLYHWNLEVETASKIQ  247

Query  953   KDLAIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEV  1123
             K+ AI LL++GVE   SP   R +I  S  P+NN+EEA+LLL +L+ K   G ++WD  +
Sbjct  248   KEFAIFLLYSGVEA--SPPNLRSQIDSSFVPRNNIEEAVLLLLILLRKRALGMIKWDPSI  305

Query  1124  MDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSG  1303
             MDHL+FAL+V G  ++LA  VE++LPG   R +R+  L+LCY   G++  ALNLLR +  
Sbjct  306   MDHLSFALSVSGGLKALAHQVEELLPGTLERNDRYCILSLCYLGEGEDMVALNLLRNLFR  365

Query  1304  SSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCY  1483
             +   EH   I  L+L +K+C+++     EGI +A  A+  +  +     S +   LG   
Sbjct  366   NR--EHPDCILELMLASKICAKNEVCIEEGIGYACKALKESQRRCSQKASISNCLLGTLL  423

Query  1484  GNAAKISFSDSERNSYQTQSLNSLTQAAMLCKE-DAETVFSLGLEYATQRNLTPAFDNAL  1660
                ++   SDSER   Q+++L +L  +  + K+ D   V  L LE A QR L  A  +A 
Sbjct  424   SAKSRSVSSDSERTLEQSKALAALEASGRMMKDRDPFVVHQLCLENAEQRKLDIALYHAK  483

Query  1661  QYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIAR  1840
             Q  ++ AG++ KG+ LLA I+SA++RF DAE +++ ALD+TG+ DQ + L+ KA LQ+A+
Sbjct  484   QLLKLEAGASVKGYILLARILSAQKRFVDAETVINAALDQTGKWDQGELLRTKAKLQVAQ  543

Query  1841  QHPNQAMETYRILLAMIQAQ----------RQSGMDHEVLSDRKLEVEAWLDLARIYIDQ  1990
                N A+ETY  LLA++Q Q          R+S   H     + LE++ W DLA +Y   
Sbjct  544   DQLNNAIETYSQLLAVLQVQTKSARVGNKNRKSRGQHY----KSLELDTWNDLANVYTSL  599

Query  1991  DSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVS  2170
               W DA+VC+ K++ I  +S   +H+ G L+EA+   ++AL +F  +L+++P++VPS++S
Sbjct  600   SQWRDAEVCLSKSEAISPFSASRYHSNGLLYEAKGLHQDALKSFKEALNVEPNHVPSLIS  659

Query  2171  TAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSK  2296
             TA VL ++GS A+P+ RSLL +ALR++ T   AWF+LG + K
Sbjct  660   TACVLRQLGSGALPVIRSLLTDALRLDRTNPSAWFNLGLVYK  701



>gb|EPS66209.1| hypothetical protein M569_08567, partial [Genlisea aurea]
Length=701

 Score =   484 bits (1247),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 289/692 (42%), Positives = 437/692 (63%), Gaps = 18/692 (3%)
 Frame = +2

Query  323   ATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGN  502
             +TR F+A+G+   R  T + E++ +E  + E ES L+E LSLN+EEARALLG+LEYQRGN
Sbjct  18    STRHFTANGV---RMKTDEVEAKLDEGNIQEAESALREGLSLNFEEARALLGKLEYQRGN  74

Query  503   FDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILL  682
              ++AL VF GID++    R+ ++++++   ++ R        S  +S H+ +L+LEAI L
Sbjct  75    VESALHVFDGIDLQAAIQRLQQSLSDKQPSKRGRSRS---DASSSVSQHATNLVLEAIYL  131

Query  683   KSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQ  862
             K+KSL  LG++ +AA EC+++LD V+  F +G+ + + E+ +LQE    A+E LP+L+ Q
Sbjct  132   KAKSLQKLGKLNEAAVECRSVLDAVEKIFSDGVPDVMVEN-RLQETVCHAVELLPELFKQ  190

Query  863   EGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPP  1036
              G   EA+++YRRAL+  WNLD++  A +QK+ A+ LL++GVE    P    +I  S  P
Sbjct  191   AGSYSEAMSAYRRALLSQWNLDSECCARIQKEFAVFLLYSGVEAG-PPSLAAQIDGSYVP  249

Query  1037  KNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTR  1216
             +NN+EEAILLL +LM K   G+++WD  V++HLTFAL++  +   LA  +E+I+PG+  R
Sbjct  250   RNNLEEAILLLMILMRKFYLGKIKWDPSVLEHLTFALSLCSQTSVLAKKLEEIMPGVLNR  309

Query  1217  AERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPH-IPSLLLGAKLCSQDPCKSREG  1393
              +RW  +AL +  A QN++AL+LLRK    +E   EP+ I  LLL +K+CS +   + EG
Sbjct  310   IDRWKTMALAFCGAKQNQSALDLLRKTLHQNE---EPNDIMPLLLASKICSANALLAAEG  366

Query  1394  ISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAML  1573
               +A  A+      N HL   A + LG+C G  AKIS SD ER+  Q+++L SL  A  L
Sbjct  367   AKYALRAVAVAEETNHHLKGVAFRMLGLCLGKQAKISPSDFERSRLQSEALKSLDAAVSL  426

Query  1574  CKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAE  1753
               ++ + +F LG++YA  RN+  A   A +Y + T GS  +GW+LLAL++SA+QR S+AE
Sbjct  427   EADNPDLIFELGIQYAELRNIDAALRYAKRYLDTTGGSVIRGWRLLALVLSAQQRLSEAE  486

Query  1754  AIVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQS----GMDH  1921
              + D ALDET + DQ   L++KA L+ ++     A+ETYR LLA++QAQR+S    G   
Sbjct  487   VVTDTALDETSKWDQGPLLRMKAKLKCSQSLHKDAIETYRYLLALVQAQRKSYAPTGNPP  546

Query  1922  EVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERC  2101
             +   +   E E W  L ++Y     W DA++C+ KA+    YS +  HT G + E Q   
Sbjct  547   QDDDENVNEYEVWHGLGKLYSSLSHWKDAEICLGKARDFKPYSAEILHTEGVMLEKQGER  606

Query  2102  KEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSL  2281
              +AL ++  +L ++P YVP  +    +L K GS+ +P+AR+LL +ALRIEP    AWF L
Sbjct  607   SKALASYINALLLEPKYVPCKILLGGLLAKTGSKMLPVARTLLSDALRIEPMNSMAWFHL  666

Query  2282  GKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             G + K +G    AA+ FQAA  L+ S P++SF
Sbjct  667   GSVHKEDGRWSDAAECFQAASLLEESEPIESF  698



>gb|EMT24866.1| Tetratricopeptide repeat protein 7A [Aegilops tauschii]
Length=726

 Score =   485 bits (1248),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 295/703 (42%), Positives = 424/703 (60%), Gaps = 21/703 (3%)
 Frame = +2

Query  224   RAHCRRRKMLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEA  403
             R   RR  M C CSGEQ K  +            T+DFSASG SS R G    E   +  
Sbjct  11    RNFVRRMAMECLCSGEQLKGADDTIRSSDSTF--TKDFSASGYSS-RNGEV--EQYLDNG  65

Query  404   QVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAIter  583
              ++E E +L+E + LNYEEARALLGRLEYQRG+ +AAL+VF GIDI +L P+M  +I  +
Sbjct  66    NIEEAELSLREGVCLNYEEARALLGRLEYQRGHVEAALRVFDGIDISSLVPKMKISIARK  125

Query  584   trprkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDS  763
                RK R        +  M LH+VSLL+EAI LK+++L  LG+ +DAA+EC+ ILDIV++
Sbjct  126   AHRRKTRSQWD----APPMPLHAVSLLMEAIYLKARALHDLGKFKDAAQECRMILDIVEA  181

Query  764   AFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLA  943
             A P G+  G G+ CKL E+  KA+EFLP+LW   G   EA++ YRR+L+  WNLD + +A
Sbjct  182   AVPEGLPAGFGKGCKLNEIICKAVEFLPELWKLAGFSLEAISDYRRSLLNNWNLDGETIA  241

Query  944   SMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDS  1117
              +QK+ A+ LL++G E    P    ++  S  P+NNMEEA LLL +L+ K     VE D 
Sbjct  242   KIQKEFAVFLLYSGCEAR-PPNLHSQLDGSFVPRNNMEEATLLLMILLRKFNLRRVERDP  300

Query  1118  EVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKV  1297
              VM HLTFAL++ G+ + LA   E++LPG+  + E  Y +ALCY +   + TALNLL+++
Sbjct  301   TVMHHLTFALSMSGQLKPLAVQFEELLPGLLDKREWSYNVALCYLAEKDDSTALNLLKRI  360

Query  1298  SGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGV  1477
                   +   ++  LLL +K+C +    + EG ++AR A+ +     K L   A   LGV
Sbjct  361   --LKFGQDSDNLKELLLASKVCVEKGAHA-EGAAYARRAITNIQGGCKQLAGVADLLLGV  417

Query  1478  CYGNAAKISFSDSERNSYQTQSLNSLTQAAM-LCKEDAETVFSLGLEYATQRNLTPAFDN  1654
                N A+ + SD+ER S+Q ++L  L  A   +  +D   +++L LE A QR L  A   
Sbjct  418   SLSNQARYAISDTERASWQCEALEVLGSAEKNMHGQDCRIMYNLSLENAEQRKLDAAVFY  477

Query  1655  ALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqI  1834
             A +  ++ AGS  + W LLA I+SA++ F+DAE +VD ALD+TG+ +Q   L+ KA +Q 
Sbjct  478   AKKLVKLEAGSELRSWLLLARILSAQKLFTDAETVVDAALDQTGKWNQGDLLRTKARIQA  537

Query  1835  ARQHPNQAMETYRILLAMIQAQRQSGMDHEVLS-----DRKLEVEAWLDLARIYIDQDSW  1999
             A+     A+ TY  LLA+IQ + +S      L+     D+ LE E W DLA +Y+    W
Sbjct  538   AQGQLRDAVGTYTQLLALIQLRTKSFGAGISLAKGGEDDKSLETETWYDLALLYLGMSQW  597

Query  2000  PDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAE  2179
              DA+VC+ K +  + YS  +WH TG L EA++  KEAL A+  +L  D  +VPS++STA 
Sbjct  598   RDAEVCVSKIRATNCYSAFAWHATGKLCEAKDLPKEALGAYFRALDFDSKHVPSLISTAT  657

Query  2180  VLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGS  2308
             +L ++G + +P  R  L +AL+++ T H AWF+LG L K EG 
Sbjct  658   ILRQLGDRPLPSVRCFLTDALQLDRTNHMAWFNLGLLYKEEGG  700



>ref|XP_010106172.1| hypothetical protein L484_012717 [Morus notabilis]
 gb|EXC08260.1| hypothetical protein L484_012717 [Morus notabilis]
Length=659

 Score =   483 bits (1242),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 291/687 (42%), Positives = 420/687 (61%), Gaps = 42/687 (6%)
 Frame = +2

Query  320   LATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRG  499
             +A+R+  A+G+    T   D E++ +E  + E ES+L+E LSLN+EEARALLG+LEYQRG
Sbjct  10    MASREVCANGVCMKAT---DVEAKLDEGNIQEAESSLREGLSLNFEEARALLGKLEYQRG  66

Query  500   NFDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAIL  679
             N + AL+VF+GID++    R+  ++ E+   +K R           +S H+ SL+LEAI 
Sbjct  67    NVEGALRVFEGIDLQAAIQRLQPSLVEKPPSKKGRTRTES---QHAVSQHAASLVLEAIY  123

Query  680   LKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWV  859
             LK+KSL  LGR+ ++A+ECK++LD V+  F  G+ + V  D KLQE+   A+E LP+LW 
Sbjct  124   LKAKSLQKLGRLTESAQECKSVLDAVEKIFKQGIPD-VEVDNKLQEIVSHAVELLPELWK  182

Query  860   QEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDL-SPRFKIWCSTPP  1036
             Q G   EA+++YRRAL+  WNL+      +QK  A+ LL++GVE    S   +I  S  P
Sbjct  183   QAGWHQEAISAYRRALLGLWNLENDCCTRIQKAFAVFLLYSGVEAGPPSLGVQIDSSYVP  242

Query  1037  KNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTR  1216
             KNN+EEAILLL +L+ K   G+ +WD  VM+HLTFAL+V  +   LA  VE+I+PG+  R
Sbjct  243   KNNLEEAILLLMILLRKFHLGKTKWDPSVMEHLTFALSVCNQTSVLAKQVEEIMPGIYHR  302

Query  1217  AERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGI  1396
              +RW  LALCYS AGQN+ ALNLLRK     + E    + +LLL AK+CS+D   + EG+
Sbjct  303   VDRWNSLALCYSGAGQNKAALNLLRK--SLHKHERPDDLMALLLAAKICSEDSYLAAEGV  360

Query  1397  SFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLC  1576
              +A+ A+ +   Q +HL       LG+C G  AKI  SD ER+   +++L SL  A  L 
Sbjct  361   GYAKRAISNAEQQAEHLKGVGLHMLGLCLGKQAKICSSDFERSRLHSEALKSLDGAIALE  420

Query  1577  KEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEA  1756
               +++ +F LG++YA  RNL  A   A ++ + T GS  KGW+LLAL++SA+QRFS++E 
Sbjct  421   HNNSDLIFDLGVQYAEHRNLNAALRYAKEFIDETGGSVIKGWRLLALVLSAQQRFSESEV  480

Query  1757  IVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQSGMDHEVLSD  1936
             + D A DET + DQ   L+LKA L+I++  P  A+ETYR LLA++QAQR+S     V   
Sbjct  481   VTDAAFDETAKWDQGPLLRLKAKLKISQSLPMDAIETYRYLLALVQAQRKSFGPFRV---  537

Query  1937  RKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALV  2116
                                   + QV  DK    ++     WH  G +FE + + +EAL 
Sbjct  538   ----------------------NPQVEDDKFNEFEV-----WH--GVMFEGRGQTQEALG  568

Query  2117  AFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSK  2296
              +  +  +DP YVP  +    +++KMGS A+P+ RSLL +ALRI+PT   AW+ LG + +
Sbjct  569   TYIGAFLVDPHYVPCKILLGSLMLKMGSDALPVTRSLLSDALRIDPTNRKAWYYLGMVHR  628

Query  2297  MEGSaqqaadffqaaHELKLSTPVQSF  2377
              +G    A D FQAA  L+ S P++SF
Sbjct  629   DDGRIADATDCFQAASMLEESDPIESF  655



>ref|XP_004509538.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Cicer arietinum]
Length=695

 Score =   484 bits (1245),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 285/692 (41%), Positives = 436/692 (63%), Gaps = 16/692 (2%)
 Frame = +2

Query  320   LATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRG  499
             ++ R+  A+G   +   T + E++ ++  + + E+ L+E LSL++EEAR+LLG+LEYQRG
Sbjct  10    VSVREVCANG---NCMKTTEVEAKLDQGNIQDAETALREGLSLSFEEARSLLGKLEYQRG  66

Query  500   NFDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAIL  679
             N + AL+VF GID+K    R+  +++E+T  +K             +S H+ SL+LEAI 
Sbjct  67    NIEGALRVFDGIDLKAAIQRLLPSLSEKTPVKKGPARSDS---PSSVSQHAASLVLEAIY  123

Query  680   LKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWV  859
             LK+K L   G+  +A  ECK +LD V+  F  G+ +    D KLQE+   A+E LP+LW 
Sbjct  124   LKAKCLQKQGKFNEAVNECKHVLDAVEKIFSQGIPD-TQVDNKLQEIVSCAVELLPELWK  182

Query  860   QEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTP  1033
             Q G  DEA++SYR AL+  WNLD +  A +QK  A+ LL++GVE    P F  +I  S  
Sbjct  183   QAGSYDEAMSSYRHALLSQWNLDNECCARIQKAFAVFLLYSGVEAS-PPSFAVQIEGSYV  241

Query  1034  PKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKT  1213
             PK+N+EEAILLL +L+ K   G+++WD  +M+HLTFAL+  G+   LA   E+++PG+  
Sbjct  242   PKSNLEEAILLLMILLRKFSLGKIKWDPSIMEHLTFALSACGQTSILAKQFEELMPGVYH  301

Query  1214  RAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREG  1393
             R +RW  +ALC+S AGQN++ALNLLRK     + E    + +LLL A++CS+DP  + EG
Sbjct  302   RIDRWNSIALCHSGAGQNKSALNLLRK--SLHKHERPDDVIALLLAARICSEDPHLAAEG  359

Query  1394  ISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAML  1573
               +A+ A+D     N+HL     + LG+C G  A  + SD ER+  Q+++L SL +A  L
Sbjct  360   SEYAQRAIDKAHGLNEHLKGVGLRMLGLCLGKQANAATSDFERSMLQSKALESLEEAVRL  419

Query  1574  CKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAE  1753
              + + + +F L ++YA  RNL  A   A Q+ + T GS  KGW+LLAL++SA++RFS+AE
Sbjct  420   EQNNFDLIFELAIQYAKHRNLAVALRYAKQFFDKTGGSKLKGWRLLALVLSAQKRFSEAE  479

Query  1754  AIVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQSGMDHEVLS  1933
              + D A+DET + +Q    +LKA L+I++  P  A+E YR LLA++QAQ++S     + S
Sbjct  480   VVTDAAVDETAKWEQGPLFRLKAKLKISQLRPMDAIEIYRYLLALVQAQKKSFGPQTLSS  539

Query  1934  ----DRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERC  2101
                 D+  E + W  LA +Y     W DA++C+ KA+ +  YS  +  T G +F+ + + 
Sbjct  540   QDEDDKISEFDVWHGLADLYASLSHWKDAEICLQKARELKEYSAATIQTEGVVFDGRGKN  599

Query  2102  KEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSL  2281
              EAL A + ++ ++P++VPS +  + +++KMGS+A+P++RSLL +ALRIEP    AW+ L
Sbjct  600   DEALAAAANAVMVEPNHVPSKILMSSLMLKMGSKALPVSRSLLSDALRIEPANRMAWYYL  659

Query  2282  GKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             G   K +G    AAD FQAA  L+ S P++SF
Sbjct  660   GLTHKDDGRINDAADCFQAASMLEESDPIESF  691



>ref|XP_010091891.1| Tetratricopeptide repeat protein 7B [Morus notabilis]
 gb|EXB46747.1| Tetratricopeptide repeat protein 7B [Morus notabilis]
Length=718

 Score =   484 bits (1245),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 299/695 (43%), Positives = 440/695 (63%), Gaps = 24/695 (3%)
 Frame = +2

Query  254   CACSGEQFKFeep----epapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVE  421
             C  SGEQ K  E          S +SLATRD+SASG SS R G  + E + + + ++E E
Sbjct  4     CIRSGEQMKKAENEYDDNEMDHSSDSLATRDYSASGYSS-RPG--EVEQKVDTSNIEEAE  60

Query  422   STLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkp  601
             S+L+E+  LNYEEARALLGRLEYQ+GN +AAL VF+GIDI  ++P++  AI+ R    + 
Sbjct  61    SSLRESGYLNYEEARALLGRLEYQKGNIEAALHVFEGIDIAAVTPKIRVAISRRCEQNRR  120

Query  602   rggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGM  781
             R        +  MS+H+VSLLLEA+ LKSKSL GL R  +AA+ CK ILD V+SA P G+
Sbjct  121   RSQSD---AAPPMSMHAVSLLLEAVFLKSKSLQGLARYEEAAQSCKIILDNVESALPEGL  177

Query  782   SEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDL  961
              E    DCKLQE    A+E LP+LW   G + EA+ SYRRAL+  WNLD +  A +QK+ 
Sbjct  178   PENFTSDCKLQETLAVAVELLPELWKLAGSLPEAILSYRRALLYKWNLDNETTAKIQKEF  237

Query  962   AIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDH  1132
             A+ LL++G   D SP   R ++  S  P+NN+EEAILLL +L+ K+  G + WD  V+DH
Sbjct  238   AVFLLYSG--CDASPPNLRSQMEGSFVPRNNLEEAILLLVILLRKLVLGRIVWDPSVIDH  295

Query  1133  LTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSE  1312
             L++AL+V GE  SLA +VE++LP    R ER+  LALCY + G++  ALNLL+ +   ++
Sbjct  296   LSYALSVSGELRSLAHHVEELLPTTMERRERYCILALCYYAEGKDLVALNLLKNI--LND  353

Query  1313  AEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNA  1492
              E++     LLL AK+C ++     EGI F+  ++ ++  +   ++  +    GV     
Sbjct  354   RENKDCTLELLLAAKICGENSVCIDEGIGFSCKSLSTSGRKCSQIVGISNCLHGVLLSAK  413

Query  1493  AKISFSDSERNSYQTQSLNSLTQAAMLCKE-DAETVFSLGLEYATQRNLTPAFDNALQYS  1669
             ++ + SDSER   Q+++L +L  +    +E +   V+ L LE+A QR L  A   A Q  
Sbjct  414   SRSATSDSERILKQSEALQALETSERTMRERNPYVVYHLCLEHAEQRKLDCALYYAKQLL  473

Query  1670  EMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHP  1849
              + AGS+ KG+ +LA I+SA++RF+DAE +++ A+++TG+ D  + L+ KA LQIA+   
Sbjct  474   MLEAGSSVKGYIILARILSAQKRFADAETVINAAIEQTGKWDHGELLRTKAKLQIAQDQL  533

Query  1850  NQAMETYRILLAMIQAQRQS-GMDHEVLS-----DRKLEVEAWLDLARIYIDQDSWPDAQ  2011
               A++TY  LLA+IQ   +S G +  +L      DR LE+E W DLA++Y     W DA+
Sbjct  534   KNAIDTYTHLLAVIQVWTKSVGAEKRLLKNRIKHDRSLEMETWHDLAKLYTSLLQWRDAE  593

Query  2012  VCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMK  2191
             +C+ K++ I+ +S   W+  G L EA+   +EAL AF  +L +DP +VPS++STA +L +
Sbjct  594   ICLSKSQAINPHSASRWYCAGLLNEAKGLHQEALKAFRKALDVDPTHVPSLISTARILRQ  653

Query  2192  MGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSK  2296
             +GS+++P+ RS LM+ALRI+ T   AW++LG L K
Sbjct  654   LGSESLPVVRSFLMDALRIDRTNPSAWYNLGLLYK  688



>ref|XP_004495072.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Cicer arietinum]
Length=713

 Score =   483 bits (1244),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 290/698 (42%), Positives = 432/698 (62%), Gaps = 20/698 (3%)
 Frame = +2

Query  320   LATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRG  499
             L T DF ++   S   G  D   + +   ++E E +L+E+  LNYEEARALLGR EYQ+G
Sbjct  23    LVTMDFFSASSHSFLPGKFD--KKPDTGNIEEAELSLRESGVLNYEEARALLGRYEYQKG  80

Query  500   NFDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAIL  679
             N  AAL VF+GIDI  ++P++  A++     RK             MS+H+V LLLEA+ 
Sbjct  81    NVVAALHVFEGIDIGVVTPKIKLALSRNRERRKKHSHNH---AEPEMSIHAVGLLLEALF  137

Query  680   LKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWV  859
             LK+KSL  L R ++AA+ CK I+DIV+S+ P+G+ +  G +CKLQ+   KA+E LP+LW 
Sbjct  138   LKAKSLQVLERFKEAAQSCKVIMDIVESSLPDGLPDNFGAECKLQDTVSKAVELLPELWK  197

Query  860   QEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSP--RFKIWCSTP  1033
                   EA  SYRRAL+  WNLDA   A +QK+  + LL++G EV + P  R ++  S  
Sbjct  198   LADCPREATLSYRRALLHQWNLDAGTTAKIQKEFVVFLLYSGAEV-MPPNLRTQMEGSFV  256

Query  1034  PKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKT  1213
             P +N+EEAILLL +L+ KI    +EWD  ++DHL+FAL++ G+  +LA+++E+++PG   
Sbjct  257   PGDNIEEAILLLMILLRKISLNRIEWDPSILDHLSFALSISGDLSTLANHLEELIPGTIH  316

Query  1214  RAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREG  1393
             R+ER++ LALCY  AG++  AL+LLRK+   SE  +  ++P LL+ +K+C ++P  + EG
Sbjct  317   RSERFHALALCYYGAGKDSVALDLLRKLLSGSERPN--YVPGLLMASKICCENPTLAEEG  374

Query  1394  ISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAML  1573
             +SFA+  ++S   + K L + A  +LGV     +K++ SD E+   Q+++L +L  A  +
Sbjct  375   VSFAQRGLESLDGRCKQLENVANFYLGVSLSAQSKLAISDFEKLKRQSEALQALETAGRM  434

Query  1574  CK-EDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDA  1750
              +  D   ++ L LEYA QR L  A   A    ++  GS  KGW L+A I+SA+++F DA
Sbjct  435   TRMRDPVVLYHLSLEYAEQRKLDAAVYYAKCVVKLEGGSDVKGWLLVARILSAQKQFLDA  494

Query  1751  EAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQS-GMDHEV  1927
             E+I++ ALD+TG+ DQ   L+ KA +QIA+     A++TY  LLA++Q Q +S G   ++
Sbjct  495   ESIINAALDQTGKWDQGDLLRAKAKIQIAQGQLKSAIDTYTQLLAVLQIQSKSFGSWKKL  554

Query  1928  LSD-----RKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQ  2092
               D     R LEVE W DLA +YI    W DA+ C+ K+K I  YS    H  G ++EA+
Sbjct  555   YKDNRDRARNLEVEIWHDLAHVYISLSQWHDAEACLSKSKAIKPYSASRCHALGVMYEAR  614

Query  2093  ERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAW  2272
                KEAL AF  +L IDP +V S++STA+VL     ++ P  +S  M+ALR +     AW
Sbjct  615   GLHKEALKAFGDALDIDPGHVLSLISTAKVLRHCSKRSNPPVKSFFMDALRHDRLNASAW  674

Query  2273  FSLGKLSKMEG---SaqqaadffqaaHELKLSTPVQSF  2377
             ++LG   K EG   S  +A + FQAA  L+ STP++ F
Sbjct  675   YNLGLFYKSEGTISSLVEATECFQAAQNLEESTPLEPF  712



>ref|XP_006661855.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Oryza brachyantha]
Length=726

 Score =   483 bits (1244),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 294/694 (42%), Positives = 426/694 (61%), Gaps = 21/694 (3%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             M C CSGEQ K  +            T+D SASG SS R G  + E   +   ++E E +
Sbjct  19    MECLCSGEQLKGADEILRSPESAI--TKDCSASGYSS-RNG--EIEQYLDNGNIEEAELS  73

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             L+E + LN+EEARALLGRLEYQRG+ +AAL+VF GIDI  L P+M  +I  +   RK R 
Sbjct  74    LREGVCLNHEEARALLGRLEYQRGHVEAALRVFDGIDISALVPKMKISIARKADRRKSRS  133

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                    S  M LH+VSLL+EAI LKS++L  LG+ ++AA+EC+ ILDIV++A P G+  
Sbjct  134   QWD----SPPMPLHAVSLLMEAIYLKSRALYDLGKFKEAAQECRMILDIVEAAVPEGLPA  189

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
             G G+DCKL E+  KA+E LP+LW   G   EA++SYRR+L+  WNLD + +A +QK  AI
Sbjct  190   GFGKDCKLNEIICKAVELLPELWKLGGFSLEAISSYRRSLLNKWNLDGETIARIQKKFAI  249

Query  968   ALLFAGVEVDLSPRF--KIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTF  1141
              LL++G E    P    ++  S  P+NNMEEAILLL +L+ K     VE D  VM HLTF
Sbjct  250   FLLYSGCEAR-PPNLHSQLDGSFVPRNNMEEAILLLMILLRKFNLNRVERDPTVMHHLTF  308

Query  1142  ALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEH  1321
             AL++ G+ + LA   E++LPG+    E  Y +ALCY +   + TALNLL+++  S   + 
Sbjct  309   ALSISGQLKPLAVQFEELLPGLLDNREWSYNVALCYLAEEDDLTALNLLKRILKS--GDD  366

Query  1322  EPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKI  1501
                I  LLL +K C+     + EG SFAR A+ +     + +   A   LGV   N A+ 
Sbjct  367   SDKIQELLLASKACTGRSAHT-EGASFARRAITNIQGGCEQMAGVADLLLGVNLSNQARC  425

Query  1502  SFSDSERNSYQTQSLNSLTQA-AMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMT  1678
             + SD+ER S+Q ++L  L  A   +  +D+  ++SL LE A QR L  A   A +  ++ 
Sbjct  426   APSDTERASWQCEALEVLENAEKKMHGKDSRAMYSLSLENAEQRKLDAAAFYAKKLVKLE  485

Query  1679  AGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQA  1858
             AGS  + W LLA +++A+++F+DAE IVD ALD+TG+ ++   L+ KA +Q A++    A
Sbjct  486   AGSELRSWLLLARVLTAQKQFADAETIVDAALDQTGKWNEGDLLRTKARIQAAQRQLRNA  545

Query  1859  METYRILLAMIQAQRQS-----GMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCID  2023
             +ETY  LLA+IQ +++S      +      DR LE+E W DLA +Y+    W DA+VC+ 
Sbjct  546   VETYTKLLAVIQLRKKSLSAGIFLIKGTKDDRSLELETWYDLALLYLCMSQWRDAEVCVS  605

Query  2024  KAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQ  2203
             + + I  YS  +WH TG L+EA+ + KEAL ++  +L +D  +VPS++S A V+ ++G++
Sbjct  606   RIRVISPYSALAWHATGKLYEAKGQSKEALGSYFRALDLDRKHVPSLISIAIVIREVGNR  665

Query  2204  AVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEG  2305
              +P  R  L +AL+++ T H AWF+LG L K EG
Sbjct  666   PLPSVRCFLTDALQLDRTNHVAWFNLGLLYKEEG  699



>ref|XP_002311687.2| NO POLLEN GERMINATION RELATED 2 family protein [Populus trichocarpa]
 gb|EEE89054.2| NO POLLEN GERMINATION RELATED 2 family protein [Populus trichocarpa]
Length=741

 Score =   483 bits (1244),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 306/724 (42%), Positives = 454/724 (63%), Gaps = 26/724 (4%)
 Frame = +2

Query  242   RKMLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVE  421
             + M C  SGEQ + ++   + +S   LATRD+SAS   SSR   AD   + E + ++E E
Sbjct  20    KMMKCIRSGEQLRLDDMASSSES---LATRDYSAS--YSSRAAEADI--KIENSNIEEAE  72

Query  422   STLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkp  601
             S+L+E+  LNYEEARALLGRLEYQ+GN + AL VF+GIDI +++ ++  +++ R    + 
Sbjct  73    SSLRESGYLNYEEARALLGRLEYQKGNIEGALHVFEGIDIASVTSKIKVSLSRRCEQNRR  132

Query  602   rggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGM  781
             R        +  MS+H++SLLLEAI LK KSL GLGR  +AA+ CK ILD ++SA P G+
Sbjct  133   RSQSD---AAPPMSMHAISLLLEAIYLKVKSLHGLGRFEEAAQSCKVILDTLESALPEGI  189

Query  782   SEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDL  961
              E V  D KLQ++ +KA+E LP+LW   G + EA+ SYRRAL+  WNL+ +  A ++K+ 
Sbjct  190   PESVSADWKLQDILNKAVELLPELWKLAGSLQEAILSYRRALLYNWNLNMETTAKLEKEF  249

Query  962   AIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDH  1132
             A+ LL++G   D SP   R ++  S  P+NN+EEAILLL +L+ K    ++EWD  +M H
Sbjct  250   AVFLLYSGC--DASPPNLRSQVDGSFVPRNNIEEAILLLLLLLRKFAAKKIEWDPTIMYH  307

Query  1133  LTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSE  1312
             L+FAL+V GE  +LA  VE++LPG+  R ER+  LALCY   G+ E  + L    +  + 
Sbjct  308   LSFALSVSGEQRALAHQVEELLPGIMERRERYSILALCYH--GEGEQMIALNLLRNLLNN  365

Query  1313  AEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNA  1492
              E+   +  LLL +K+C+ +     EGI++A  A+     +   + S A    G+     
Sbjct  366   RENPDCVLELLLASKICATNMICVDEGITYACKALSKLRGRCDQMASVANCLQGILLSTQ  425

Query  1493  AKISFSDSERNSYQTQSLNSLTQAAMLCKE-DAETVFSLGLEYATQRNLTPAFDNALQYS  1669
             ++   SD+ER S QT++L  L  A  + +E D   +F L LE A QR L  A  +A Q  
Sbjct  426   SRSVASDTERISKQTEALEVLESAETMMRERDPSIIFHLSLENAEQRKLDTALYHAKQLL  485

Query  1670  EMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHP  1849
             ++ AGS  + + L+A I+SA+++F DAE +++ ALD+TG+ DQ + L+ KA LQIA+   
Sbjct  486   KLEAGSNVRSYILMARILSAQKQFVDAENVINAALDQTGKWDQGELLRTKAKLQIAQGKL  545

Query  1850  NQAMETYRILLAMIQAQRQSGMDHEVL------SDRKLEVEAWLDLARIYIDQDSWPDAQ  2011
               A++TY  LLA++Q + +S    + L      SDR LE+E W DLA +Y     W DA+
Sbjct  546   QNAIDTYIYLLAIVQVRTKSSGSGKKLPKNRRNSDRSLEMETWHDLANLYTSLSKWRDAE  605

Query  2012  VCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMK  2191
              C+ K+K I  YS   WH+TG L+EA+   +EAL AF  +L ++P++VPS+VSTA +L +
Sbjct  606   ACLSKSKIISPYSASRWHSTGLLYEAKGLHQEALKAFRAALDVEPNHVPSLVSTACILRR  665

Query  2192  MGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSK--MEGSaqqaadffqaaHELKLSTP  2365
             +GSQ++PI RS L +A+R++ T H AW++LG L K  +  SA +A + F+AA  L+ S P
Sbjct  666   LGSQSIPIIRSFLTDAIRLDKTNHSAWYNLGLLYKADVSASALEAVECFEAAAFLEDSAP  725

Query  2366  VQSF  2377
             V+SF
Sbjct  726   VESF  729



>ref|XP_011029780.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Populus 
euphratica]
 ref|XP_011029781.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Populus 
euphratica]
 ref|XP_011029782.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Populus 
euphratica]
 ref|XP_011029783.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Populus 
euphratica]
Length=730

 Score =   483 bits (1242),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 306/724 (42%), Positives = 454/724 (63%), Gaps = 26/724 (4%)
 Frame = +2

Query  242   RKMLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVE  421
             + M C  SGEQ + ++   + +S   LATRD+SAS   SSR   AD   + E + ++E E
Sbjct  20    KMMKCIRSGEQLRLDDMASSSES---LATRDYSAS--YSSRAAEADI--KIENSNIEEAE  72

Query  422   STLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkp  601
             S+L+E+  LNYEEARALLGRLEYQ+GN + AL VF+GIDI +++ ++  +++ R    + 
Sbjct  73    SSLRESGYLNYEEARALLGRLEYQKGNIEGALHVFEGIDIASVTSKIKVSLSRRCEQNRR  132

Query  602   rggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGM  781
             R        +  MS+H++SLLLEAI LK KSL GLGR  +AA+ CK ILD ++SA P G+
Sbjct  133   RSQSD---AAPPMSMHAISLLLEAIYLKVKSLQGLGRFEEAAQSCKVILDTLESALPEGI  189

Query  782   SEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDL  961
              E V  D KLQ++ +KA+E LP+LW   G + EA+ SYRRAL+  WNL+ + +A +QK+ 
Sbjct  190   PESVSADRKLQDILNKAVELLPELWKLAGSLQEAILSYRRALLYNWNLNMETIAKLQKEF  249

Query  962   AIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDH  1132
             A+ LL++G   D SP   R ++  S  P+NN+EEAILLL +L+ K    ++EWD  +M H
Sbjct  250   AVFLLYSGC--DASPPNLRSQVDVSFVPRNNIEEAILLLLILLRKFAVKKIEWDPTIMYH  307

Query  1133  LTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSE  1312
             L+FAL+V GE  +LA  VE++LPG+  R ER+  LALCY   G+ E  + L    +  + 
Sbjct  308   LSFALSVSGEQRALAHQVEELLPGIMERRERYSILALCYH--GEGEQMIALNLLRNLLNN  365

Query  1313  AEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNA  1492
              E+   +  LLL +K+C+ +     EGI++A  A+     +   + S A    G+     
Sbjct  366   RENPDCVLELLLASKICATNMICVDEGITYACKALSKLRGRCDQMASVANCLQGILLSTQ  425

Query  1493  AKISFSDSERNSYQTQSLNSLTQAAMLCKE-DAETVFSLGLEYATQRNLTPAFDNALQYS  1669
             ++   SD+ER S QT++L  L  A  + +E D   +F L LE A QR L  A  +A Q  
Sbjct  426   SRSVASDTERISKQTEALELLESAETMMRERDPSIIFHLSLENAEQRKLDTALYHAKQLL  485

Query  1670  EMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHP  1849
             ++ AGS  + + L+A I+SA+++F DAE +++  LD+TG+ DQ + L+ KA LQIA+   
Sbjct  486   KLEAGSNVRSYILMARILSAQKQFVDAENVINAGLDQTGKWDQGELLRTKAKLQIAQGKL  545

Query  1850  NQAMETYRILLAMIQAQRQSGMDHEVL------SDRKLEVEAWLDLARIYIDQDSWPDAQ  2011
               A++TY  LLA++Q + +S    + L      SDR LE+E W DLA +Y     W DA+
Sbjct  546   QNAIDTYIYLLAIVQVRTKSSGSGKKLPKNWRNSDRSLEMETWHDLANLYTSLSKWRDAE  605

Query  2012  VCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMK  2191
              C+ K+K I  YS   WH+TG L+EA+   +EAL AF  +L ++P++VPS+VSTA +L +
Sbjct  606   ACLSKSKIISPYSASRWHSTGLLYEAKGLHQEALKAFRAALDVEPNHVPSLVSTACILRR  665

Query  2192  MGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSK--MEGSaqqaadffqaaHELKLSTP  2365
             +GSQ++PI RS L +A+R++ T H AW++LG L K  +  SA +A + F+AA  L+ S P
Sbjct  666   LGSQSIPIIRSFLTDAIRLDKTNHSAWYNLGLLYKADVSASALEAVECFEAAAFLEDSAP  725

Query  2366  VQSF  2377
             V+SF
Sbjct  726   VESF  729



>ref|XP_008224139.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Prunus mume]
 ref|XP_008224140.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Prunus mume]
Length=732

 Score =   483 bits (1242),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 299/708 (42%), Positives = 443/708 (63%), Gaps = 27/708 (4%)
 Frame = +2

Query  215   LTGRAHCRRRKML-CACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESR  391
             + GR H    KML C  SGEQ + +E   +  S   LATRD+SASG  S R G  + E++
Sbjct  14    IKGRLH----KMLKCMRSGEQLRVDEIAHSSDS---LATRDYSASGGYSGRAG--EIETK  64

Query  392   FEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKA  571
              + + ++E ES+L+E+  LNYEEARALLGRLEYQ+GN +AAL VF+GIDI  + P+M  +
Sbjct  65    VDNSNIEEAESSLRESGYLNYEEARALLGRLEYQKGNTEAALHVFEGIDIAAVIPKMKVS  124

Query  572   ItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILD  751
             I+ R  P + R     +     MS+H+VSLLLEAI LK+KSL GLGR  +AA+ CK ILD
Sbjct  125   ISRRCEPNRRRSQSDAV---PPMSMHAVSLLLEAIFLKAKSLQGLGRFGEAAQSCKLILD  181

Query  752   IVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDA  931
              V+SA P G+ E    DCKLQE   KA+E L +LW+  G   EA+ SYR+AL+  WNLD 
Sbjct  182   TVESALPEGLPENFASDCKLQETVGKAVELLSELWILAGAPQEAILSYRQALLYHWNLDI  241

Query  932   KRLASMQKDLAIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGE  1102
             +  + ++K+ A+ LL++G   D +P   R ++  S  P+NN+EEA+LLL +L+ K   G 
Sbjct  242   EVTSKIEKEFAVFLLYSG--CDANPPNLRSQMESSFVPRNNIEEAVLLLLILLRKFVAGR  299

Query  1103  VEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALN  1282
             +EWD  ++DHL+FAL++ G+  +LA  +E+++PG+  R ER+  LALCY   G +  ALN
Sbjct  300   IEWDPSILDHLSFALSISGKIRALAHQIEELIPGIMGRQERYCTLALCYYGEGDDLVALN  359

Query  1283  LLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQAR  1462
                  +  +  E+   I  LLL +K+CS++     +G  +A  A+     +   +LS A 
Sbjct  360   --LLRNVLNNRENTDCILELLLASKICSENLVCIDDGTKYAYKALGRLDGKCSQMLSIAN  417

Query  1463  KFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAE-TVFSLGLEYATQRNLT  1639
               LGV     ++   SDSER   Q+++L +L  A  + +E +   VF L LE+A QR L 
Sbjct  418   CLLGVSLSVKSRSVASDSERILKQSEALQALQTAEKIMRERSPYVVFHLCLEHADQRKLD  477

Query  1640  PAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklk  1819
              A   A Q  ++ AGS+ K + LLA I+SA++RF DAE +++ ALD+TG+ DQ + L+ K
Sbjct  478   FALYYAKQLLKLEAGSSTKAYTLLARILSAQKRFIDAETVINAALDQTGKWDQGELLRTK  537

Query  1820  aalqIARQHPNQAMETYRILLAMIQAQRQS-GMDHEVLS-----DRKLEVEAWLDLARIY  1981
             A L IA+     A+ETY  LLA++Q + ++ G +  +L      +R LE+E W DLA +Y
Sbjct  538   AKLHIAQGQLKNAIETYTHLLAVLQVRTKNLGAEKRLLKSRSKINRSLEMETWHDLANLY  597

Query  1982  IDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPS  2161
                  W DA+VC+ K++ I+ +S   WH+TG L+EA+   +EAL +F  +L ++P +VPS
Sbjct  598   TSLSQWRDAEVCLSKSQAINPHSASRWHSTGLLYEAKGLHQEALESFRKALDVEPTHVPS  657

Query  2162  IVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEG  2305
             ++STA +L + G Q++P+ RS LM+ALR++     AW++LG L K + 
Sbjct  658   LISTACILRQFGGQSLPVVRSFLMDALRLDRGNPSAWYNLGLLYKADA  705



>ref|XP_009133568.1| PREDICTED: uncharacterized protein LOC103858044 [Brassica rapa]
 ref|XP_009133569.1| PREDICTED: uncharacterized protein LOC103858044 [Brassica rapa]
 ref|XP_009133570.1| PREDICTED: uncharacterized protein LOC103858044 [Brassica rapa]
Length=706

 Score =   481 bits (1239),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 296/693 (43%), Positives = 422/693 (61%), Gaps = 17/693 (2%)
 Frame = +2

Query  326   TRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNF  505
             TR   A+GL      T + E++ +E  + E ES+L+E LSLN EEARALLGRLEYQRGN 
Sbjct  18    TRQLCANGLF---MKTTEVEAKLDEGNIQEAESSLREGLSLNSEEARALLGRLEYQRGNL  74

Query  506   DAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLK  685
             + AL++F+GID++    R+  +     +P   +    E     V   H+ SL+LEAI LK
Sbjct  75    EGALRLFEGIDLQAEIQRLQASAPPPEKPVTKKNRPREPQQQPVPQ-HAASLVLEAIYLK  133

Query  686   SKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQE  865
             +KSL  LGR  +AARECK++LD V+  F  G+S+    D +LQE    A+E LP L+   
Sbjct  134   AKSLQKLGRTTEAARECKSVLDSVEKVFQQGISDA-QVDTRLQETVSHAVELLPALFKDS  192

Query  866   GLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPK  1039
             G   EA+++YRRAL+  WNLD    A +QKD A+ LL +GVE    P    ++  S  P+
Sbjct  193   GDYQEAISAYRRALLSQWNLDNDSCARIQKDFAVFLLHSGVEAS-PPSLASQVEGSYTPR  251

Query  1040  NNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRA  1219
             NN+EEAILLL +L+ K   G+ +WD  V++H+TFAL++  +   +A  +E+++PG+ TR 
Sbjct  252   NNLEEAILLLMILIKKFNSGKAKWDPSVIEHITFALSLCSQTSVVAKQLEEVMPGVFTRV  311

Query  1220  ERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGIS  1399
             ERW  LALCYS+AGQ   A+NLLRK     + E    + +LLL AKLCS++P  + EG  
Sbjct  312   ERWNSLALCYSAAGQTSAAVNLLRK--SLHKHEQPDDLVALLLAAKLCSEEPSLAAEGAG  369

Query  1400  FARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCK  1579
             +A   + +    ++HL     + LG+C G  AK+  SD ER+  Q++SL +L  A     
Sbjct  370   YAERGVKNAQGMDEHLKGVGLRMLGLCLGKQAKVPTSDFERSRLQSESLKALDGAIAFEH  429

Query  1580  EDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAI  1759
              + + +F LG++YA QRNL  A   A ++ + T GS  KGW+ LAL++SA+QRFS+AE +
Sbjct  430   NNPDLIFELGVQYAEQRNLKAASRYAKEFIDATGGSVLKGWRFLALVLSAQQRFSEAEVV  489

Query  1760  VDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQSGMDHEVLS--  1933
              D ALDET + DQ   L+LKA L+I++ +P +A+ETYR LLA++QAQR+S      LS  
Sbjct  490   TDAALDETAKWDQGPLLRLKAKLKISQSNPTEAVETYRYLLALVQAQRKSFGPLRTLSQM  549

Query  1934  --DRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKE  2107
               D+  E E W  LA +Y     W D +VC+ KA  +  YS    HT G ++E ++  K 
Sbjct  550   EEDKVNEFEVWHGLAYLYSSLSHWNDVEVCLKKAGELKQYSASMLHTEGRMWEGRKEFKP  609

Query  2108  ALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQ---AVPIARSLLMNALRIEPTCHDAWFS  2278
             AL AF   L +D   VP  V+   +L + G +    +P+ARSLL +ALRI+PT   AW+ 
Sbjct  610   ALAAFLDGLLLDESSVPCKVAVGALLCERGKEYQPTLPVARSLLSDALRIDPTNRKAWYY  669

Query  2279  LGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             LG + K +G    A D FQAA  L+ S P++SF
Sbjct  670   LGMVHKHDGRITDATDCFQAASMLEESDPIESF  702



>ref|XP_009334224.1| PREDICTED: uncharacterized protein LOC103927049 [Pyrus x bretschneideri]
Length=734

 Score =   482 bits (1241),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 295/701 (42%), Positives = 438/701 (62%), Gaps = 21/701 (3%)
 Frame = +2

Query  236   RRRKML-CACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVD  412
             R  KML C  SGEQ + +E   +  S   LATRD+SASG +   + T + E++ + + ++
Sbjct  17    RLDKMLKCMRSGEQLRVDEVPHSSDS---LATRDYSASGGTGHSSRTGEIETKVDNSNIE  73

Query  413   EVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrp  592
             E ES+L+E+  LNYEEARALLGRLEYQ+GN +AAL VF+GIDI  + P+M  +I+ R   
Sbjct  74    EAESSLRESGYLNYEEARALLGRLEYQKGNTEAALHVFEGIDIAGVIPKMKVSISRRCET  133

Query  593   rkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFP  772
              + R           MS+H+VSLLLEAI LK+KSL GLGR  +AA+ CK ILD V+SA P
Sbjct  134   NRRRSQSD---AGPPMSMHAVSLLLEAIFLKAKSLQGLGRFGEAAQSCKLILDTVESALP  190

Query  773   NGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQ  952
             +G+ E    DCKLQE   KA+E LP+LW+  G   EA+ SYR+AL+  WNLD +  + ++
Sbjct  191   DGLPENFASDCKLQETVGKAVELLPELWILAGAAQEAILSYRQALLYHWNLDIELASKIE  250

Query  953   KDLAIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEV  1123
             K+ A+ LL++G   D +P   R ++  S  P+NN+EEAILLL VL+ K   G + WD  +
Sbjct  251   KEFAVFLLYSG--CDANPPNLRSQMESSFVPRNNIEEAILLLLVLLRKFVAGRIGWDPSI  308

Query  1124  MDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSG  1303
             +DHL+FAL++ G+  +LA  VE+++PG+  R ER+  LALCY   G+ E  + L    + 
Sbjct  309   LDHLSFALSISGKVRALAHQVEELIPGIMGRQERYCTLALCY--YGEGEDLVALNLLKNV  366

Query  1304  SSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCY  1483
              +  E+   I  LLL +K+CS++     +G  +   A+     +    LS A   LGV  
Sbjct  367   LNNRENTDCILELLLASKICSENSVCIEDGTKYVYKALSELDGKCCQRLSIANCLLGVSL  426

Query  1484  GNAAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAE-TVFSLGLEYATQRNLTPAFDNAL  1660
                ++   SDSER   Q+++L +L  A  + KE +   V+ L LE+A QR L  A   A 
Sbjct  427   SAKSRSVASDSERILKQSEALQALQTADKITKERSPYVVYHLCLEHAEQRKLDIALYYAK  486

Query  1661  QYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIAR  1840
             Q  ++ AGS  K + LLA I+SA++RF DAE +++ ALD+TG+ DQ + L+ KA L IA+
Sbjct  487   QLLKLEAGSNIKSYALLARILSAQKRFIDAETVINAALDQTGKWDQGELLRTKAKLHIAQ  546

Query  1841  QHPNQAMETYRILLAMIQAQRQS-GMDHEVLSDRK-----LEVEAWLDLARIYIDQDSWP  2002
                  A+ETY  LLA++Q + ++ G++  +L  R+     LE+E W DLA +Y     W 
Sbjct  547   GQLKNAIETYTHLLAVLQVRTKNFGVEKRLLKSRRNHNRSLEMETWHDLANLYTSLSQWR  606

Query  2003  DAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEV  2182
             DA+VC+ K+++I+ +S   WH+TG L+EA+   +EAL +F  +L ++P +VPS++STA +
Sbjct  607   DAEVCLSKSQSINPHSASRWHSTGLLYEAKGLQQEALESFRKALDVEPTHVPSLISTACI  666

Query  2183  LMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEG  2305
             L + G Q++P+ RS LM+ALR++     AW++LG L K + 
Sbjct  667   LRQFGGQSLPVVRSFLMDALRLDRGNPSAWYNLGLLYKADA  707



>ref|XP_011080086.1| PREDICTED: tetratricopeptide repeat protein 7A [Sesamum indicum]
 ref|XP_011080087.1| PREDICTED: tetratricopeptide repeat protein 7A [Sesamum indicum]
 ref|XP_011080088.1| PREDICTED: tetratricopeptide repeat protein 7A [Sesamum indicum]
Length=731

 Score =   482 bits (1240),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 297/693 (43%), Positives = 431/693 (62%), Gaps = 18/693 (3%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             M C CSGEQ           S ESLAT+D+SAS + SSR G  + E + +   ++E E++
Sbjct  23    MQCLCSGEQ---SLGNQMVPSSESLATKDYSAS-VHSSRPG--ETEKKPDIGNIEEAETS  76

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             L+E+  LNYEEARALLGR EYQ+GN  AAL VF+GIDI  ++P+M   ++++    K R 
Sbjct  77    LRESGCLNYEEARALLGRYEYQKGNIQAALHVFEGIDIAAVTPKMKITLSKKVETHKRRS  136

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                    +  MS+H+VSLL EAI LK++SL  LGR ++AA+ C  ILDI +S+ P G+ E
Sbjct  137   QN---YATPPMSIHAVSLLFEAIFLKARSLQALGRYKEAAQSCSVILDIAESSLPAGLPE  193

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
               G DCKLQE  +KA+E LP+LW       +A+ SYRRAL+  WNLDA+  A +QK+ AI
Sbjct  194   NFGADCKLQETLNKAVELLPELWKLADSPRDAILSYRRALLHQWNLDAQTTAKIQKEFAI  253

Query  968   ALLFAGVE-VDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFA  1144
              LL++G E +  + RF++  +  PKNN+EEAILLL +L+ K+    +EWDS ++DHL+FA
Sbjct  254   FLLYSGAEAIPPTLRFQMGNAFVPKNNVEEAILLLIILLRKVSLKRIEWDSSILDHLSFA  313

Query  1145  LTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHE  1324
             L++ G  + LA+ VE++LPG     E ++ LALCY   G++ TAL+L +K+  +   E  
Sbjct  314   LSISGGLKGLANQVEELLPGAIGWKEWYHILALCYHGEGEDFTALDLWKKLLKTH--EDS  371

Query  1325  PHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKIS  1504
              ++P+LL  +K+C        +GIS AR A++++      LL  A+  LG+        +
Sbjct  372   TYLPALLFVSKICGASSTYVEDGISSARRAVENSHVGCDQLLGVAQCMLGISLSANCGSA  431

Query  1505  FSDSERNSYQTQSLNSLTQAAMLCKE-DAETVFSLGLEYATQRNLTPAFDNALQYSEMTA  1681
              SDS+R   QT++L SL  AA + K  +   ++ L LE A QR L  A ++A    ++  
Sbjct  432   VSDSKRVERQTEALKSLENAARMTKMLNPVIIYHLCLENAEQRKLDAALNHAKHLLKLEG  491

Query  1682  GSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAM  1861
             GS  +GW LLA I+SA++ F +AE I++ AL +TG  +Q + L+ KA LQI +    +A+
Sbjct  492   GSNIRGWILLARILSAQKCFPEAETIINAALSQTGVWEQGELLRTKAKLQIVQGLMKEAI  551

Query  1862  ETYRILLAMIQAQRQS-GMDHEVLSDR----KLEVEAWLDLARIYIDQDSWPDAQVCIDK  2026
             ETY  LLA++Q QR+S G   ++  DR     LE+E W DLA IYI    W DA++C+ K
Sbjct  552   ETYSQLLAVLQVQRKSLGSGKKLKEDRSHIQNLELETWHDLASIYIKLCRWHDAELCLSK  611

Query  2027  AKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQA  2206
             ++ I  +S   WH  G L EA+++ KEAL A+  +L IDP +VPS+VS A VL +MG Q+
Sbjct  612   SEAISAFSASRWHAAGLLHEARDQRKEALKAYGLALEIDPTHVPSLVSKARVLRQMGCQS  671

Query  2207  VPIARSLLMNALRIEPTCHDAWFSLGKLSKMEG  2305
             + I RS L  ALR++     AW++L  L K  G
Sbjct  672   LAIIRSFLTEALRLDRMNASAWYNLSLLYKDGG  704



>ref|XP_006350695.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X1 
[Solanum tuberosum]
 ref|XP_006350696.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X2 
[Solanum tuberosum]
Length=730

 Score =   482 bits (1240),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 315/727 (43%), Positives = 460/727 (63%), Gaps = 27/727 (4%)
 Frame = +2

Query  236   RRRKML-CACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVD  412
             R RKM+ C CSGEQ + E+  P+ +S   LATRD+SASG SS R G    +++ + + ++
Sbjct  17    RLRKMMKCICSGEQLRIEDIIPSSES---LATRDYSASGYSS-RAGD---DAKADTSNIE  69

Query  413   EVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrp  592
             E ES+L+E+  LNYEEARALLGRLEYQ+GN +AAL VF+GIDI  + P++  +I  R   
Sbjct  70    EAESSLRESGILNYEEARALLGRLEYQKGNIEAALHVFEGIDIAAVVPKIKLSIARRGEV  129

Query  593   rkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFP  772
              +       I     MS+H+VSLL EAILLK+ SL  LGR  +AA+ C  ILD V+SA P
Sbjct  130   PRRNSLSDAI---PPMSMHAVSLLFEAILLKATSLQALGRFTEAAQSCTVILDTVESALP  186

Query  773   NGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQ  952
             +G+ E    DCKL E  +KA+E LP+L        EA+ SYRRAL+  WNLD +  + ++
Sbjct  187   DGLPENFSTDCKLLETLNKAVELLPELLKLACAPQEAILSYRRALLYCWNLDVETRSKIE  246

Query  953   KDLAIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEV  1123
             K+ A+ LL++G   D +P   R +   S  P+NN+EEAILLL VL+ +    ++ WD  +
Sbjct  247   KEYAVFLLYSG--TDAAPPNLRAQAEGSFIPRNNIEEAILLLLVLLRRYILNKIVWDPSI  304

Query  1124  MDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSG  1303
             +DHL+FAL++ GEF +LA  VE++LPG+  R +++  LALCY + G +  ALNLLR +  
Sbjct  305   LDHLSFALSIAGEFRALARQVEELLPGIVVRRQKYTILALCYYAEGDDMAALNLLRNLMN  364

Query  1304  SSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCY  1483
             S + ++   I  L+L AK+C++ P    EG+ +AR  +     +   + S A+  LG+  
Sbjct  365   SRDNKN--GIFELVLAAKICAEYPNLLEEGMRYARKVLPKIEGKCNQMASVAKCLLGLLL  422

Query  1484  GNAAKISFSDSERNSYQTQSLNSLTQA-AMLCKEDAETVFSLGLEYATQRNLTPAFDNAL  1660
                ++   SDSER S   ++L SL  A  M    +   +F L LE A QR L  A   A 
Sbjct  423   SGRSRAIVSDSERTSRLCEALESLDSAHKMTGGRNPNVLFYLSLENAEQRKLDIALYYAK  482

Query  1661  QYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIAR  1840
             Q  ++  GST KGW LLA I+SA++R+ DAE+I++ ALDETG+ +Q + L+ KA LQIA+
Sbjct  483   QLLKLEGGSTLKGWLLLARILSAQKRYIDAESIINAALDETGKWNQGELLRTKAKLQIAQ  542

Query  1841  QHPNQAMETYRILLAMIQAQRQS-GMDHEVLSD-----RKLEVEAWLDLARIYIDQDSWP  2002
              H   A+ETY  LLA++Q QR+S G+  +++ +     R LE+E W DLA +Y +   W 
Sbjct  543   GHLRDAVETYTHLLAVLQVQRKSFGVQKKLVKNMRNNSRSLEMETWHDLANVYTNLSQWR  602

Query  2003  DAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEV  2182
             DA+VC+ K++ ID +S    H+ G L++A+   KEAL +F  SL I+P++VPS+VSTA V
Sbjct  603   DAEVCLIKSEAIDPHSASRCHSAGLLYQARGLHKEALQSFQKSLDIEPNHVPSLVSTAIV  662

Query  2183  LMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEG--SaqqaadffqaaHELKL  2356
             L ++  Q++P+ +S L +ALR++ T   AW++LG + K E   SA +AA+ F+AA  L+ 
Sbjct  663   LRQLDGQSLPVMKSFLTDALRLDRTNPSAWYNLGLVYKSENGVSALEAAECFEAAELLQE  722

Query  2357  STPVQSF  2377
             S PV+ F
Sbjct  723   SAPVEPF  729



>ref|XP_008342319.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Malus domestica]
 ref|XP_008342320.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Malus domestica]
Length=694

 Score =   480 bits (1235),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 298/688 (43%), Positives = 434/688 (63%), Gaps = 16/688 (2%)
 Frame = +2

Query  332   DFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDA  511
             +FSA+G S   T   + +++ +E  + E ES+L+E LSLN+EEARALLG+LEYQRGN + 
Sbjct  13    EFSANGNSMKAT---EVQAKLDEGNIQEAESSLREGLSLNFEEARALLGKLEYQRGNLEG  69

Query  512   ALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKSK  691
             AL+VF GID++    R+   + E+T  +K R           +S H+ +L+L+AI LK+K
Sbjct  70    ALRVFDGIDLQAAIGRLQPNLAEKTPSKKGRTRSDS---QHTVSQHAATLILDAIYLKAK  126

Query  692   SLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGL  871
             SL  LGR+++AA EC  +LD V+  F  G+ +    D +LQE   +A+E LP+LW Q G 
Sbjct  127   SLQKLGRLKEAANECNNVLDAVEKIFHQGIPDA-QVDGRLQETVSQAVELLPELWKQSGX  185

Query  872   IDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPKNN  1045
               EA+++YRRAL+  WNLD    A +QK  A+ LL++GVE    P    ++  S  PKNN
Sbjct  186   PQEAISAYRRALLSQWNLDNDCCARIQKGFAVFLLYSGVEAG-PPSLGAQVEGSYVPKNN  244

Query  1046  MEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAER  1225
             +EEAILLL +L+ K+  G+ +WD  +M+HLTFAL++  +   LA  +E+I+PG+  R +R
Sbjct  245   LEEAILLLMILLRKLSLGKTKWDPSLMEHLTFALSLCNQTFVLAKQLEEIMPGVYHRVDR  304

Query  1226  WYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFA  1405
             W  LALCYS AGQNE ALNLLRK     E   E  + +LLL AK+CS+D   + EG+ +A
Sbjct  305   WNSLALCYSGAGQNEEALNLLRKSLHKHERPDE--LMALLLAAKICSEDSHVAAEGVGYA  362

Query  1406  RGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKED  1585
             + A+ +    ++HL     + LG+  G  AK+S SD ER+  Q+++L SL +A +L   +
Sbjct  363   QRAISNAQGLDEHLRGVGLRLLGLSLGKQAKVSSSDFERSRLQSEALKSLNEAIILEPNN  422

Query  1586  AETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVD  1765
             ++  F LG+ YA  RNL  A   A Q+ + T GS  KGW+LLAL++SA+QRFS+A  + D
Sbjct  423   SDLAFELGVHYAEHRNLNTALRYAKQFIDQTGGSLIKGWRLLALVLSAQQRFSEAHVVTD  482

Query  1766  LALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQS----GMDHEVLS  1933
               LDET + +Q   L+LKA L+I++  P  A+ETYR LLA++QAQR+S     M  +   
Sbjct  483   ATLDETAKWEQGPLLRLKAKLKISQSLPMDAIETYRNLLALVQAQRKSFGPLRMSPQAED  542

Query  1934  DRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEAL  2113
             D+  E E W  L+ +Y     W DA++C+ KA+ +  +S ++ H  G +FE Q + +EAL
Sbjct  543   DKVNEFEVWHGLSDLYSSLSYWKDAEICLSKARELKQHSAETLHIEGVIFEGQGQIQEAL  602

Query  2114  VAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLS  2293
                   L ++P YVP  +  A +L KMGS A+P+ARSLL +ALRI+P+   AW+ LG + 
Sbjct  603   AXXIDXLLLEPCYVPCKILIAALLSKMGSTALPVARSLLSDALRIDPSNRKAWYYLGMIH  662

Query  2294  KMEGSaqqaadffqaaHELKLSTPVQSF  2377
             + +G    A D FQAA  L+ S PV+SF
Sbjct  663   RDDGRIGDAIDCFQAASMLEESDPVESF  690



>ref|XP_002528816.1| o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus 
communis]
 gb|EEF33550.1| o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus 
communis]
Length=731

 Score =   481 bits (1238),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 291/695 (42%), Positives = 434/695 (62%), Gaps = 23/695 (3%)
 Frame = +2

Query  242   RKMLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVE  421
             + M C  SGEQ + +E   + +S   LATRD+SASG SS R G  D  ++ + + ++E E
Sbjct  20    KMMKCIRSGEQLRVDEMVASSES---LATRDYSASGYSS-RAGEVD--TKIDNSNIEEAE  73

Query  422   STLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkp  601
             S+L+E+  LNYEEARALLGRLE+Q+GN +AAL VF+GIDI  ++ +M  +++ R    + 
Sbjct  74    SSLRESGYLNYEEARALLGRLEFQKGNIEAALHVFEGIDIAAVTSKMKVSLSRRCEQNRR  133

Query  602   rggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGM  781
             R     +     MS+H++SLLLEAI LK KSL GLGR  DAA+ CK ILD V+SA P+G+
Sbjct  134   RSQSDAV---QPMSMHAISLLLEAIFLKVKSLQGLGRFGDAAQSCKIILDTVESALPDGL  190

Query  782   SEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDL  961
              E V  DCKLQE+  +A+E LP+LW       EA+ SYR+AL+  WNL+A+  A ++K+ 
Sbjct  191   PESVSADCKLQEILSRAVELLPELWKLARAPQEAILSYRQALLYNWNLEAEIKAKIEKEF  250

Query  962   AIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDH  1132
             A+ LL++G   D +P   R ++  S  P+NN+EEA+LLL +L+ K     + WD  ++DH
Sbjct  251   AVFLLYSGT--DANPPNLRSQMDGSFVPRNNVEEAVLLLLILLRKFAYRRIGWDPTIIDH  308

Query  1133  LTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSE  1312
             L+FAL+V GE  +LA  +E++LPG+  R ER+  LALCY   G+ E  + L    +  + 
Sbjct  309   LSFALSVSGELRALAHQIEELLPGILERRERYCTLALCYH--GEGEDVVALNLLRNLLNN  366

Query  1313  AEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNA  1492
              E+   I  LLL +++C++      EG+++   A+     +   ++S A    G+     
Sbjct  367   RENPDCIMELLLASRICAEKMISVEEGMTYTSKALSELHGRCDQMVSVANCLQGLLLSAQ  426

Query  1493  AKISFSDSERNSYQTQSLNSLTQAAMLCKE-DAETVFSLGLEYATQRNLTPAFDNALQYS  1669
             ++   SDSER   Q+++L +L  A  + +E D + ++ L LE A QR L  A   A +  
Sbjct  427   SRSVASDSERTCKQSEALEALETAHKVMRERDPQIIYHLSLENAEQRKLDIALSFAKRLL  486

Query  1670  EMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHP  1849
             ++ AGS+ + + LLA I+SA++RF DAE +V+ ALD+TG+ DQ + L+ KA LQIA+   
Sbjct  487   KLEAGSSVRTYILLARILSAQKRFVDAETVVNAALDQTGKWDQGELLRTKAKLQIAQGQL  546

Query  1850  NQAMETYRILLAMIQAQRQSGMDHEVL------SDRKLEVEAWLDLARIYIDQDSWPDAQ  2011
               A++TY  LLA++Q + ++    + L       DR+LE+E W DLA +Y     W DA+
Sbjct  547   KNAIQTYTHLLAVVQVRTKTFAGGKRLLKSRGNHDRRLEMETWHDLANVYTSLSQWRDAE  606

Query  2012  VCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMK  2191
             VC+ K+K I  YS   WH  G L+EA+   +EAL AF  +L +DP +VPS++STA VL +
Sbjct  607   VCLSKSKAISPYSASRWHAAGLLYEAKGSHQEALRAFRAALDVDPTHVPSLISTASVLRQ  666

Query  2192  MGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSK  2296
              GSQ++PI RS L +ALR++   H AW++LG L K
Sbjct  667   FGSQSIPIIRSFLTDALRLDKMNHSAWYNLGLLYK  701



>dbj|BAK03445.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=726

 Score =   481 bits (1237),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 294/703 (42%), Positives = 421/703 (60%), Gaps = 21/703 (3%)
 Frame = +2

Query  224   RAHCRRRKMLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEA  403
             R   RR  M C CSGEQ K  +            T+DFSASG SS R G    E   +  
Sbjct  11    RNFVRRMAMECLCSGEQLKGADDTIRSSDSTF--TKDFSASGYSS-RNGEV--EQYLDNG  65

Query  404   QVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAIter  583
              ++E E +L+E + LNYEEARALLGRLEYQRG+ +AAL+VF GIDI +L P+M  +I  +
Sbjct  66    NIEEAELSLREGVCLNYEEARALLGRLEYQRGHVEAALRVFDGIDISSLVPKMKISIARK  125

Query  584   trprkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDS  763
                RK R        +  M LH+VSLL+EAI LK+++L  LG+ +DAA+EC+ ILDIV++
Sbjct  126   AHRRKTRSQWD----APPMPLHAVSLLMEAIYLKARALHDLGKFKDAAQECRMILDIVEA  181

Query  764   AFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLA  943
             A P G+  G G+ CKL E+  KA+EFLP+LW   G   EA++ YRR+L+  WNLD + +A
Sbjct  182   AVPEGLPAGFGKGCKLNEIICKAVEFLPELWKLAGFSLEAISEYRRSLLNNWNLDGETIA  241

Query  944   SMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDS  1117
              +QK+ A+ LL++G E   SP    ++  S  P+NNMEEA LLL +L+ K     VE D 
Sbjct  242   KIQKEFAVFLLYSGCEAR-SPNLHSQLDGSFVPRNNMEEATLLLMILLRKFNLRRVERDP  300

Query  1118  EVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKV  1297
              VM HLTFAL++ G+ + LA   E++LPG+  + E  Y +ALCY +   + TALNLL+++
Sbjct  301   TVMHHLTFALSMSGQLKPLAIQFEELLPGLLDKREWSYNVALCYLAEKDDSTALNLLKRI  360

Query  1298  SGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGV  1477
                   +    +  LLL +K+C +    + EG ++AR A+ +     K   + A   LGV
Sbjct  361   --LKFGQDSDSLKELLLASKVCVEKGDHA-EGAAYARRAISNIQGGCKQFAAVADFLLGV  417

Query  1478  CYGNAAKISFSDSERNSYQTQSLNSLTQAAM-LCKEDAETVFSLGLEYATQRNLTPAFDN  1654
                N A+ + SD+ER S+Q ++L  L  A   +  +D   +++L LE A QR L  A   
Sbjct  418   SLSNQARYAISDTERASWQCEALEVLGSAQKNMHGQDCRIMYNLSLENAEQRKLDAAVFY  477

Query  1655  ALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqI  1834
             A +  ++ AGS  + W LLA I+SA++ F+DAE +VD ALD+TG+ +Q   L+ KA +Q 
Sbjct  478   AKKLVKLEAGSELRSWLLLARILSAQKLFADAETVVDAALDQTGKWNQGDLLRTKARIQA  537

Query  1835  ARQHPNQAMETYRILLAMIQAQRQSGMDHEVLS-----DRKLEVEAWLDLARIYIDQDSW  1999
             A+     A+ TY  LLA+IQ + +S      L+     D+ LE   W DLA +Y+    W
Sbjct  538   AQGQLRDAVGTYTQLLALIQLRTKSFGAGISLAKGGEDDKSLETVTWYDLALLYLGMSQW  597

Query  2000  PDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAE  2179
              DA+VC+ K +    YS  +WH TG L EA++  KEAL A+  +L  D  +VPS++STA 
Sbjct  598   RDAEVCVSKIRATSCYSALAWHATGKLCEAKDLPKEALGAYFRALDFDGKHVPSLISTAT  657

Query  2180  VLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGS  2308
             +L ++G   +P  R  L +AL+++ T H AWF+LG L K EG 
Sbjct  658   ILRQLGETPLPFVRCFLTDALQLDRTNHMAWFNLGLLYKEEGG  700



>ref|XP_002453569.1| hypothetical protein SORBIDRAFT_04g008250 [Sorghum bicolor]
 gb|EES06545.1| hypothetical protein SORBIDRAFT_04g008250 [Sorghum bicolor]
Length=708

 Score =   479 bits (1233),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 282/660 (43%), Positives = 408/660 (62%), Gaps = 14/660 (2%)
 Frame = +2

Query  419   ESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprk  598
             ES+  E LSLNYEEARALLGRLE+Q+GN + AL+VF GID++    +   ++++    + 
Sbjct  52    ESSHPEGLSLNYEEARALLGRLEFQKGNVEVALRVFDGIDLQAAIQQFQPSLSKTPSKKG  111

Query  599   prggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNG  778
                 +    V+     +  SL+LEAI LKS SL  LG+  +AA +CK++LD V+S F NG
Sbjct  112   RTKSELPSSVTQNNQNNPASLVLEAIYLKSLSLQKLGKSTEAANQCKSVLDSVESIFQNG  171

Query  779   MSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKD  958
               +    + KLQE  +K++E LP+ W   G   EA+ SYRRAL+ PWNLD +    +QK 
Sbjct  172   TPDI---EQKLQETINKSVELLPEAWKHAGSYQEALASYRRALLSPWNLDDESRTRIQKR  228

Query  959   LAIALLFAGVEVDLSPRF---KIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMD  1129
              A  LL++ +  D SP     ++  S  PKNN EEA+LLL V++    QG+  WD  VM+
Sbjct  229   YASFLLYSNI--DWSPPSMAQQVEGSFVPKNNFEEALLLLMVVLRNWYQGKTHWDPSVME  286

Query  1130  HLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSS  1309
             HLT+AL++ GE   LA  +E++LPG+  R ERW  LALCY  AGQ + ALN LRK     
Sbjct  287   HLTYALSLCGEPLLLAKQLEEVLPGIYPRTERWATLALCYYVAGQKDIALNFLRKSLNKL  346

Query  1310  EAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGN  1489
             E  ++ H  +LLL AK+CS+D   S EG+ +AR  +    + + HL S    FLG C GN
Sbjct  347   ENPNDIH--ALLLAAKICSKDHHLSSEGVEYARRVIALAGSSDSHLKSVGLHFLGSCLGN  404

Query  1490  AAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYS  1669
              +K+  SD +R+  QT++L SLT++  L + + + +F +G+EYA QRN+  A   A ++ 
Sbjct  405   KSKVVSSDYQRSLLQTETLKSLTESISLNRYNVDLIFDMGVEYAEQRNMNAALRCAKEFI  464

Query  1670  EMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHP  1849
             E T GS +KGW+LLAL++SA+QRF++AE   D ALDET ++DQ   L++KA L++A+  P
Sbjct  465   EATGGSISKGWRLLALVLSAQQRFTEAEVATDAALDETAKLDQGSLLRVKAKLKVAQSSP  524

Query  1850  NQAMETYRILLAMIQAQRQSGMD-HEVLSDRK---LEVEAWLDLARIYIDQDSWPDAQVC  2017
              +A+E YR LLA++QAQ+ S       + D      E E W  LA +Y     W DA++C
Sbjct  525   MEAVEAYRALLALVQAQKNSSASCKNAIEDTDGSVTEFEIWQGLANLYSSLSYWRDAEIC  584

Query  2018  IDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMG  2197
             + KAK +  YS  + H  G + +A+++ K+AL A+  + S + ++VPS V+   +L K G
Sbjct  585   LKKAKALKSYSAATLHAEGYMHQARDQTKDALAAYVNAFSTELEHVPSKVAIGAMLSKQG  644

Query  2198  SQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
              + +P AR  L +ALR+EPT   AW  LGK+ + +G    AAD FQAA  L+ S PV+SF
Sbjct  645   PRFLPAARCFLSDALRVEPTNRMAWLYLGKVHRSDGRISDAADCFQAAVMLEESDPVESF  704



>ref|XP_009358011.1| PREDICTED: uncharacterized protein LOC103948685 [Pyrus x bretschneideri]
 ref|XP_009358012.1| PREDICTED: uncharacterized protein LOC103948685 [Pyrus x bretschneideri]
Length=734

 Score =   480 bits (1235),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 294/701 (42%), Positives = 439/701 (63%), Gaps = 21/701 (3%)
 Frame = +2

Query  236   RRRKML-CACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVD  412
             R  KML C  S EQ + +E   +  S   LATRD+SASG +   + T + E++ + + ++
Sbjct  17    RLEKMLKCIRSAEQLRVDEVPHSSDS---LATRDYSASGGTGYSSRTGEVETKVDNSNIE  73

Query  413   EVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrp  592
             E ES+L+E+  LNYEEARALLGRLEYQ+GN +AAL VF+GIDI  + P+M  +I+ R   
Sbjct  74    EAESSLRESGYLNYEEARALLGRLEYQKGNTEAALHVFEGIDIAGVIPKMKVSISRRCET  133

Query  593   rkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFP  772
              + R     +     MS+H+VSLLLEAI LK+KSL GLGR  +AA+ CK ILD V+SA P
Sbjct  134   NRRRSQSDSV---PPMSMHAVSLLLEAIFLKAKSLQGLGRFGEAAQSCKLILDTVESALP  190

Query  773   NGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQ  952
             +G+ E    DCKLQE   KA+E LP+LW+  G   EA+ SYR+AL+  WNLD +  + M+
Sbjct  191   DGLPENFASDCKLQETVGKAVELLPELWILAGAPQEAILSYRQALLYRWNLDIELASKME  250

Query  953   KDLAIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEV  1123
             K+ A+ LL++G   D +P   R ++  S  P+NN+EEAILLL VL+GK   G +EWD  +
Sbjct  251   KEFAVFLLYSG--CDANPPNLRSQMESSFVPRNNIEEAILLLLVLLGKFGAGTIEWDPSI  308

Query  1124  MDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSG  1303
             +DHL+FAL+V G+  +LA  VE+++PG+  R ER+  LALCY   G+ E  + L    + 
Sbjct  309   LDHLSFALSVSGKVRALAHQVEELIPGIMGRQERFCTLALCY--YGEGEDLVALNLLKNI  366

Query  1304  SSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCY  1483
              +  E+   I  LLL +K+C ++     +G  +A  A+     +   + + A   LG+  
Sbjct  367   LNNRENTDCILELLLASKICCENLVCIEDGTKYAYKALSDLDGKCSQMSTIANCLLGLSL  426

Query  1484  GNAAKISFSDSERNSYQTQSLNSLTQAAMLCKE-DAETVFSLGLEYATQRNLTPAFDNAL  1660
                ++   SDSER   Q++++ +L  A  + K+ +   +F L LE A QR L  A   A 
Sbjct  427   SAKSRSVTSDSERILKQSEAIQALQTADKITKDRNPYILFHLCLELAEQRKLDIALYYAN  486

Query  1661  QYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIAR  1840
             Q  ++ AGS+ K + LLA I+SA++RF DAE +++ ALD+TG+ DQ + L+ KA L IA+
Sbjct  487   QLLKLEAGSSVKSYALLARILSAQKRFIDAETVINAALDQTGKWDQGELLRTKAKLHIAQ  546

Query  1841  QHPNQAMETYRILLAMIQAQRQS-GMDHEVLSDRK-----LEVEAWLDLARIYIDQDSWP  2002
                  A+ETY  LLA++Q + ++ G+D  +L  R+     LE+E W DLA +Y     W 
Sbjct  547   GQLKNAIETYTHLLAVLQVRTKNLGVDKRLLKSRRNHNRSLEMETWHDLANLYTSLSQWR  606

Query  2003  DAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEV  2182
             DA+VC+ K+++I+ +S   WH+TG L+EA+   +EAL +F  +L  +P +VPS++S A +
Sbjct  607   DAEVCLSKSQSINPHSASRWHSTGLLYEAKGLQQEALESFRKALDFEPTHVPSLISAACI  666

Query  2183  LMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEG  2305
             L + G Q++P+ARS LM+ALR++     AW++LG L K + 
Sbjct  667   LRQFGGQSLPVARSFLMDALRLDRGNPCAWYNLGLLYKADA  707



>ref|XP_009348291.1| PREDICTED: uncharacterized protein LOC103939918 [Pyrus x bretschneideri]
Length=734

 Score =   479 bits (1234),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 294/701 (42%), Positives = 439/701 (63%), Gaps = 21/701 (3%)
 Frame = +2

Query  236   RRRKML-CACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVD  412
             R  KML C  S EQ + +E   +  S   LATRD+SASG +   + T + E++ + + ++
Sbjct  17    RLEKMLKCIRSAEQLRVDEVPHSSDS---LATRDYSASGGTGYSSRTGEVETKVDNSNIE  73

Query  413   EVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrp  592
             E ES+L+E+  LNYEEARALLGRLEYQ+GN +AAL VF+GIDI  + P+M  +I+ R   
Sbjct  74    EAESSLRESGYLNYEEARALLGRLEYQKGNTEAALHVFEGIDIAGVIPKMKVSISRRCET  133

Query  593   rkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFP  772
              + R     +     MS+H+VSLLLEAI LK+KSL GLGR  +AA+ CK ILD V+SA P
Sbjct  134   NRRRSQSDSV---PPMSMHAVSLLLEAIFLKAKSLQGLGRFGEAAQSCKLILDTVESALP  190

Query  773   NGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQ  952
             +G+ E    DCKLQE   KA+E LP+LW+  G   EA+ SYR+AL+  WNLD +  + M+
Sbjct  191   DGLPENFASDCKLQETVGKAVELLPELWILAGAPQEAILSYRQALLYRWNLDIELASKME  250

Query  953   KDLAIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEV  1123
             K+ A+ LL++G   D +P   R ++  S  P+NN+EEAILLL VL+GK   G +EWD  +
Sbjct  251   KEFAVFLLYSG--CDANPPNLRSQMESSFVPRNNIEEAILLLLVLLGKFGAGTIEWDPSI  308

Query  1124  MDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSG  1303
             +DHL+FAL+V G+  +LA  VE+++PG+  R ER+  LALCY   G+ E  + L    + 
Sbjct  309   LDHLSFALSVSGKVRALAHQVEELIPGIMGRQERFCTLALCYY--GEGEDLVALNLLKNI  366

Query  1304  SSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCY  1483
              +  E+   I  LLL +K+C ++     +G  +A  A+     +   + + A   LG+  
Sbjct  367   LNNRENTDCILELLLASKICCENLVCIEDGTKYAYKALSDLDGKCSQMSTIANCLLGLSL  426

Query  1484  GNAAKISFSDSERNSYQTQSLNSLTQAAMLCKE-DAETVFSLGLEYATQRNLTPAFDNAL  1660
                ++   SDSER   Q++++ +L  A  + K+ +   +F L LE A QR L  A   A 
Sbjct  427   SAKSRSVTSDSERILKQSEAIQALQTADKITKDRNPYILFHLCLELAEQRKLDIALYYAN  486

Query  1661  QYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIAR  1840
             Q  ++ AGS+ K + LLA I+SA++RF DAE +++ ALD+TG+ DQ + L+ KA L IA+
Sbjct  487   QLLKLEAGSSVKSYALLARILSAQKRFIDAETVINAALDQTGKWDQGELLRTKAKLHIAQ  546

Query  1841  QHPNQAMETYRILLAMIQAQRQS-GMDHEVLSDRK-----LEVEAWLDLARIYIDQDSWP  2002
                  A+ETY  LLA++Q + ++ G+D  +L  R+     LE+E W DLA +Y     W 
Sbjct  547   GQLKNAIETYTHLLAVLQVRTKNLGVDKRLLKSRRNHNRSLEMETWHDLANLYTSLSQWR  606

Query  2003  DAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEV  2182
             DA+VC+ K+++I+ +S   WH+TG L+EA+   +EAL +F  +L  +P +VPS++S A +
Sbjct  607   DAEVCLSKSQSINPHSASRWHSTGLLYEAKGLQQEALESFRKALDFEPTHVPSLISAACI  666

Query  2183  LMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEG  2305
             L + G Q++P+ARS LM+ALR++     AW++LG L K + 
Sbjct  667   LRQFGGQSLPVARSFLMDALRLDRGNPCAWYNLGLLYKADA  707



>gb|EMT02991.1| Tetratricopeptide repeat protein 7A [Aegilops tauschii]
Length=716

 Score =   479 bits (1232),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 290/669 (43%), Positives = 425/669 (64%), Gaps = 12/669 (2%)
 Frame = +2

Query  389   RFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSK  568
             R ++  + E ES+L+E LSLNYEEARALLGRLEYQRGN +AAL+VF GID++    R   
Sbjct  51    RVDDGNIQEAESSLREGLSLNYEEARALLGRLEYQRGNVEAALRVFDGIDLQAAIQRFQP  110

Query  569   AItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAIL  748
             +++E+   ++    + +   SG  S H+ SL+LEAI LK+ SL  LG+  +AA++CK++L
Sbjct  111   SLSEKPSSKRNNKLRSDSSNSG--SQHAASLVLEAIYLKAMSLQKLGKAIEAAQQCKSVL  168

Query  749   DIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLD  928
             D V+S F  G+ + + E  KLQE   K++E LP+LW Q G   EA+ SYRRAL+  WNLD
Sbjct  169   DAVESIFQRGIPDVMVEQ-KLQETVSKSVELLPELWKQAGAYQEALASYRRALLSQWNLD  227

Query  929   AKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPKNNMEEAILLLFVLMGKIQQGE  1102
              +    +QK  ++ LL+ GVE    P    +   S  PKNN+EEAILLL +L+ K   G+
Sbjct  228   DECCTRIQKRFSVFLLYGGVEAS-PPSLASQTEGSFVPKNNLEEAILLLMILLKKWYLGK  286

Query  1103  VEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALN  1282
               WD  VM+HLTFAL++ G+   LA + E++LPG+  R ERWY LALCYS+A  +E ALN
Sbjct  287   THWDPSVMEHLTFALSLCGQTSVLAKHFEEVLPGIYPRTERWYSLALCYSAASDDEAALN  346

Query  1283  LLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQAR  1462
             LL+K    +E+ ++  I +LLL AK+CS D   + EG+ +A+ A+      + HL S   
Sbjct  347   LLKKSLNKNESPND--INALLLAAKICSSDYYLASEGVEYAKRAIGDDELLDGHLRSVGL  404

Query  1463  KFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTP  1642
               LG C  N +KI+ SD +R+  Q ++L SL +A  L + + + +F +G+EYA QRN+  
Sbjct  405   HLLGSCLANESKIASSDHQRSLLQAEALKSLGEAFSLDRHNPDLIFDMGVEYAEQRNMQA  464

Query  1643  AFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklka  1822
             A   A Q+ + T GS +KGW+LL+L++SA+QR+S+AE + D AL+ET + +Q   L+++A
Sbjct  465   ALKCAKQFIDTTGGSVSKGWRLLSLVLSAQQRYSEAEVVTDAALEETTKWEQGPLLRIRA  524

Query  1823  alqIARQHPNQAMETYRILLAMIQAQRQS----GMDHEVLSDRKLEVEAWLDLARIYIDQ  1990
              L+ A+  P +A+E YR LLA++QAQR++        E   ++  E E W  LA +Y   
Sbjct  525   KLKAAQSLPMEAVEAYRALLALVQAQRKAYGSLKNGTEERDNKVSEFEVWQGLANLYASL  584

Query  1991  DSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVS  2170
                 DA++C+ KAK +  YS  + H  G +   +E+ + AL A+  +LS + D+VPS VS
Sbjct  585   SYCRDAEICLQKAKALKTYSATTLHAEGDMHGVREQTQHALAAYLNALSTEVDHVPSKVS  644

Query  2171  TAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHEL  2350
                +L K G + +P+ARS L +ALR+EPT   AWF LG++ K +G   +AAD FQAA  L
Sbjct  645   IGALLSKQGPKYLPVARSFLSDALRLEPTNRMAWFYLGQVHKHDGRLAEAADCFQAASML  704

Query  2351  KLSTPVQSF  2377
             + S PV+S 
Sbjct  705   EESDPVESL  713



>ref|XP_008645918.1| PREDICTED: uncharacterized protein LOC100384077 isoform X1 [Zea 
mays]
 ref|XP_008645926.1| PREDICTED: uncharacterized protein LOC100384077 isoform X1 [Zea 
mays]
 ref|XP_008645933.1| PREDICTED: uncharacterized protein LOC100384077 isoform X1 [Zea 
mays]
 ref|XP_008645938.1| PREDICTED: uncharacterized protein LOC100384077 isoform X1 [Zea 
mays]
 ref|XP_008645946.1| PREDICTED: uncharacterized protein LOC100384077 isoform X1 [Zea 
mays]
 tpg|DAA49671.1| TPA: hypothetical protein ZEAMMB73_204972 [Zea mays]
Length=726

 Score =   479 bits (1232),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 299/702 (43%), Positives = 428/702 (61%), Gaps = 21/702 (3%)
 Frame = +2

Query  224   RAHCRRRKMLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEA  403
             R   RR  M C CSGEQ K    +   +S +S  T+DFSASG SS R G  + E   +  
Sbjct  11    RNSLRRMAMECLCSGEQLK--ASDETMRSSDSTITKDFSASGYSS-RNG--EIEQYLDNG  65

Query  404   QVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAIter  583
              ++E E +L+E + LNYEEARALLGRLEYQRG+ +AAL+VF GIDI  L P+M  +I  +
Sbjct  66    NIEEAELSLREGICLNYEEARALLGRLEYQRGHVEAALRVFDGIDISALVPKMKISIARK  125

Query  584   trprkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDS  763
             T  RK          S  M LH+VSLL+EAI LK+++L  LG+ ++AA+EC+ ILDIV++
Sbjct  126   TDRRKTHSQWD----SPPMPLHAVSLLMEAIYLKARALHDLGKDKEAAQECRMILDIVEA  181

Query  764   AFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLA  943
             A P G+  G G+ CKL E+  KA+E LP+LW   G   E ++SYRR+L+  WNLD + +A
Sbjct  182   AVPEGLPAGFGKGCKLNEIICKAVELLPELWKSGGFSLETISSYRRSLLNNWNLDGETIA  241

Query  944   SMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDS  1117
              +QK  A+ LL++G E    P    ++  S  P+NN+EEAILLL +L+ K     +E D 
Sbjct  242   RIQKKFAVFLLYSGCEAR-PPNLHSQLDGSFVPRNNIEEAILLLMILLRKSNLKRIEQDP  300

Query  1118  EVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKV  1297
              VM HLTFAL++ G+   LA   E++LPG+  + E  Y +ALCY +   + +ALNLL+ +
Sbjct  301   SVMHHLTFALSMSGQLIPLAGQFEELLPGVLDKKEWLYSVALCYLAEEDDLSALNLLKII  360

Query  1298  SGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGV  1477
               S   E    +  LLL +K C +    + EG  +AR A+ +     K +   A   LGV
Sbjct  361   LKS--GEDSVQLIELLLASKACIEMSIHT-EGAFYARRAIANMQGGCKPMAGLANLLLGV  417

Query  1478  CYGNAAKISFSDSERNSYQTQSLNSLTQAAM-LCKEDAETVFSLGLEYATQRNLTPAFDN  1654
                N A+ + SD++R S+Q ++L +L  A   +  +D+  ++SL LE A QR L  A   
Sbjct  418   ALSNQARSAISDTDRASWQCEALEALGNAEKNIHGKDSRALYSLSLENAVQRKLELAAFY  477

Query  1655  ALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqI  1834
             A +  ++ AGS  + W LLA I+SA++ F+DAE +VD ALD+TG+  Q   L+ KA +Q 
Sbjct  478   AKRLVKLEAGSELRSWLLLARILSAQKLFADAETVVDAALDQTGKWCQGDLLRTKARIQA  537

Query  1835  ARQHPNQAMETYRILLAMIQAQRQSGMDHEVL-----SDRKLEVEAWLDLARIYIDQDSW  1999
             A+    +A+ETY  LLA+IQ + +S      L      D+ LE E W DLA +Y+    W
Sbjct  538   AQGQFREAVETYTQLLAIIQLRTKSLTAGVCLPKGNKDDKGLETETWYDLALLYLGMAQW  597

Query  2000  PDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAE  2179
              DA+VC+ K ++I  YS  +WH TG ++EA+   KEAL AF  +L +DP +VPS++STA 
Sbjct  598   RDAEVCVLKIRSISPYSALAWHATGKIYEAKGLRKEALGAFFRALDLDPKHVPSLISTAT  657

Query  2180  VLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEG  2305
             VL ++G + +P  R  L +AL+++ T H AWF+LG L K EG
Sbjct  658   VLQQLGDRPLPSIRCFLTDALQLDRTNHVAWFNLGLLYKEEG  699



>ref|XP_009597512.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009597513.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X2 
[Nicotiana tomentosiformis]
 ref|XP_009597514.1| PREDICTED: tetratricopeptide repeat protein 7B-like isoform X1 
[Nicotiana tomentosiformis]
Length=730

 Score =   479 bits (1232),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 314/727 (43%), Positives = 457/727 (63%), Gaps = 27/727 (4%)
 Frame = +2

Query  236   RRRKML-CACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVD  412
             R RKM+ C CSGEQ + E+  P+ +S   LATRD+SASG SS R G    +++ + + ++
Sbjct  17    RLRKMMKCICSGEQLRIEDIIPSSES---LATRDYSASGYSS-RAGD---DAKADTSNIE  69

Query  413   EVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrp  592
             E ES+L+E+  LNYEEARALLGRLEYQ+GN +AAL VF+GIDI  + P++  +I  R   
Sbjct  70    EAESSLRESGILNYEEARALLGRLEYQKGNIEAALHVFEGIDIAAVVPKIKLSIARRCEI  129

Query  593   rkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFP  772
              +       I     MS+H+VSLL EAILLK+ SL  LGR  +AA+ C  ILD V+SA P
Sbjct  130   PRRNSLSDAI---PPMSMHAVSLLFEAILLKATSLQALGRFTEAAQSCTVILDTVESALP  186

Query  773   NGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQ  952
             +G+ E    DCKL E  +KA+E LP+LW       EA+ SYRRAL+  WNLD +  + ++
Sbjct  187   DGLHENFSADCKLLETLNKAVELLPELWKLACAPQEAILSYRRALLYRWNLDVETRSKIE  246

Query  953   KDLAIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEV  1123
             K  AI LL++G   D +P   R +   S  P+NN+EEAILLL VL+ +    ++ WD  +
Sbjct  247   KQYAIFLLYSG--TDATPPNLRAQAEGSFIPRNNIEEAILLLLVLLRRYIVNKIVWDPSI  304

Query  1124  MDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSG  1303
             +DHL FAL++ GEF +LA  VE++LPG+  R +++  LALCY + G +   ++L    + 
Sbjct  305   LDHLCFALSIAGEFRALAHQVEELLPGIVVRRQKYTTLALCYYAEGDD--MVSLNLLRNL  362

Query  1304  SSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCY  1483
              +  ++E  I  LLL AK+C++ P  S EG+ +AR  +     +   + S A+  LG+  
Sbjct  363   MNNRDNENGIFELLLAAKICAEYPNLSEEGMGYARKVLPKIDGKCNQMASVAKCLLGLLL  422

Query  1484  GNAAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAETV-FSLGLEYATQRNLTPAFDNAL  1660
                ++   SDSER S  +++L SL  A  + +    TV F L LE A QR L  A   A 
Sbjct  423   SGRSRALVSDSERTSRLSEALESLESAQKITEGRNPTVLFYLSLENAEQRKLDIALYYAK  482

Query  1661  QYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIAR  1840
             Q  ++  GST +GW LLA I+SA++R+ DAE I++ ALDETG+ +Q + L+ KA LQIA+
Sbjct  483   QLLKLEGGSTVRGWLLLARILSAQKRYIDAENIINAALDETGKWNQGELLRTKAKLQIAQ  542

Query  1841  QHPNQAMETYRILLAMIQAQRQS-GMDHEVLSD-----RKLEVEAWLDLARIYIDQDSWP  2002
             +H   A+ETY  LLA++Q QR+S G+  ++L +     R LE+E W DLA +Y     W 
Sbjct  543   EHLRDAVETYTHLLAVLQVQRKSFGVQKKLLKNMRNNTRSLEMETWHDLANVYTSLSQWR  602

Query  2003  DAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEV  2182
             DA+VC+ K++ I+ +S    H+ G L++A+   KEAL +F  +L I+P++VPS+VSTA V
Sbjct  603   DAEVCLIKSEAINPHSASRCHSAGLLYQARGLHKEALQSFQKALDIEPNHVPSLVSTAIV  662

Query  2183  LMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKME--GSaqqaadffqaaHELKL  2356
             L ++  Q +P+ +S L +ALR++ T   AW++LG L K E   SA +AA+ F+AA  L+ 
Sbjct  663   LRQLSGQTLPVVKSFLTDALRLDRTNSSAWYNLGLLYKSENGASALEAAECFEAAALLQE  722

Query  2357  STPVQSF  2377
             S PV+ F
Sbjct  723   SAPVEPF  729



>ref|XP_009376912.1| PREDICTED: uncharacterized protein LOC103965566 [Pyrus x bretschneideri]
 ref|XP_009376922.1| PREDICTED: uncharacterized protein LOC103965566 [Pyrus x bretschneideri]
Length=694

 Score =   477 bits (1228),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 296/688 (43%), Positives = 433/688 (63%), Gaps = 16/688 (2%)
 Frame = +2

Query  332   DFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDA  511
             +FSA+G S   T   + +++ +E  + E ES+L+E LSLN+EEARALLG+LEYQRGN + 
Sbjct  13    EFSANGNSMKAT---EVQAKLDEGNIQEAESSLREGLSLNFEEARALLGKLEYQRGNLEG  69

Query  512   ALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKSK  691
             AL+VF GID++    R+   + E+T  +K R           +S H+ +L+L+AI LK+K
Sbjct  70    ALRVFDGIDLQDAIGRLQPNLAEKTASKKGRTRSDS---QHTVSQHAATLILDAIYLKAK  126

Query  692   SLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGL  871
             SL  LGR+++AA EC  +LD V+  F  G+ +    D +LQE   +A+E LP+LW Q G 
Sbjct  127   SLQKLGRLKEAANECNNVLDAVEKIFHQGIPDA-QVDGRLQETVSQAVELLPELWKQSGH  185

Query  872   IDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPKNN  1045
               EA+++YRRAL+  WNLD  R A +QK  A+ LL++GVE    P    ++  S  PKNN
Sbjct  186   PQEAISAYRRALLSQWNLDNDRCARIQKGFAVFLLYSGVEAG-PPSLGAQVEGSYVPKNN  244

Query  1046  MEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAER  1225
             +EEAILLL +L+ K+   + +WD  +++HLTFAL++  +   LA  +E+I+PG+  R +R
Sbjct  245   LEEAILLLMILLRKLSLDKTKWDPSLVEHLTFALSLCNQTFVLAKRLEEIMPGVYHRVDR  304

Query  1226  WYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFA  1405
             W  LALCYS AGQNE ALNLLRK     E   E  + +LLL AK+CS+D   + EG+ +A
Sbjct  305   WNSLALCYSGAGQNEEALNLLRKSLHKHERPDE--LMALLLAAKICSEDSHVAAEGVGYA  362

Query  1406  RGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKED  1585
             + A+ +    ++HL     + LG+  G  AK+S SD ER+  Q+++L SL +A  L   +
Sbjct  363   QRAISNAQGLDEHLRGVGLRLLGLSLGKQAKVSSSDFERSRLQSEALKSLHEAITLEPNN  422

Query  1586  AETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVD  1765
             ++  F LG+ YA  RNL  A   A Q+ + T GS  KGW+LLAL++SA+QRF +A  + D
Sbjct  423   SDLAFELGVHYAEHRNLNTALRYAKQFIDQTGGSLIKGWRLLALVLSAQQRFLEAHVVTD  482

Query  1766  LALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQS----GMDHEVLS  1933
              ALDET + +Q   L+LKA L+I++  P  A+ETYR LLA++QAQR+S     M  +   
Sbjct  483   AALDETTKWEQGPLLRLKAKLRISQSLPMDAIETYRNLLALVQAQRKSFGPLRMSPQAED  542

Query  1934  DRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEAL  2113
             D+  E E W  L+ +Y     W DA++C+ KA+ +  +S ++ H  G +FE Q + +EAL
Sbjct  543   DKVSEFEVWHGLSDLYSSLSYWKDAEICLSKARELKQHSAETLHIEGVIFEGQGQIQEAL  602

Query  2114  VAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLS  2293
               +   L ++P YVP  +  A +L KMGS A+P+ARSLL +ALRI+P+   AW+ LG + 
Sbjct  603   ATYIDGLLVEPCYVPCKILIAALLSKMGSTALPVARSLLSDALRIDPSNRKAWYYLGMIH  662

Query  2294  KMEGSaqqaadffqaaHELKLSTPVQSF  2377
             + +G    A D FQAA  L+ S PV+ F
Sbjct  663   RDDGRIGDAIDCFQAASMLEESDPVEGF  690



>gb|KHG30674.1| Tetratricopeptide repeat 7A [Gossypium arboreum]
Length=700

 Score =   477 bits (1228),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 292/711 (41%), Positives = 419/711 (59%), Gaps = 57/711 (8%)
 Frame = +2

Query  326   TRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNF  505
              R+FSA+G S S   T D E++ ++  ++E ES+L+E LSLN EEAR LLGRLEYQRGN 
Sbjct  16    AREFSANGTSMS---TTDVEAKLDKGNIEEAESSLRERLSLNSEEARTLLGRLEYQRGNV  72

Query  506   DAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLK  685
             +AAL+V  GID++    ++  +                       S  +  L+LE + LK
Sbjct  73    EAALRVLDGIDLQAAIQKLQPS-----------------------SQQAARLVLEGVYLK  109

Query  686   SKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQE  865
              KSL  LG+  +AA++C  ILD V   FP G+ +   E  KLQEM  KA+E LP+L  Q 
Sbjct  110   VKSLQKLGKFAEAAQDCTNILDAVGRIFPQGIPDAQVE-SKLQEMISKAVELLPELLKQA  168

Query  866   GLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRFKIWCSTP--PK  1039
             G   EA+ +YRR L+ PWNLD      +QK  A+ LL +G+E    P           PK
Sbjct  169   GKYQEAMAAYRRVLLNPWNLDNDCCGRIQKAFAVFLLHSGLEAG-PPSLGAQADGAYVPK  227

Query  1040  NNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRA  1219
             NN+EEAILLL VLM KI  G+++WD  V+DHL +AL++  +   L+  +E++ PG+  R 
Sbjct  228   NNLEEAILLLLVLMRKIHHGDIQWDPSVLDHLMYALSLCSQTPVLSKQLEELKPGVFHRT  287

Query  1220  ERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGIS  1399
             ERW  LALC S  GQN+ A+NLLRK    +E  ++  + +LLL AK+CS+D   + EG+ 
Sbjct  288   ERWNLLALCCSGVGQNKAAMNLLRKSLHINERPND--LTALLLAAKICSEDSQLAAEGVG  345

Query  1400  FARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCK  1579
             +A+ A+D+    ++HL     + LG+C G  AK+S SD ER+  Q ++L SL  A    +
Sbjct  346   YAQRAVDNAKGVDEHLKGVGLRMLGLCLGKQAKVSSSDFERSCLQNEALKSLDSALSFEQ  405

Query  1580  EDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAI  1759
             ++ + +F LG  YA QRNL  A   A +Y ++T GS  KGW+LLALI+SA+QRF++AE +
Sbjct  406   DNPDIIFELGAHYAEQRNLNAALRFAKKYIDITGGSVMKGWRLLALILSAQQRFAEAEVV  465

Query  1760  VDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQS----GMDHEV  1927
             +D ALDETG+ +Q   L+LKA L++++  P +A+ETYR LLA++QAQR+S     +D +V
Sbjct  466   IDAALDETGKWEQGPLLRLKAKLKVSQSRPMEAIETYRYLLALVQAQRKSFGPMKIDSQV  525

Query  1928  LSDRKLEVEAWLDLARIYIDQDSWPDAQVC----IDKAKTID---------------IYS  2050
               D+  E E W  LA +Y     W D +V     ++ A  +D               +Y 
Sbjct  526   EDDKVKEFEVWYGLAALYSSLSHWKDVEVSLYIQVNLAVLMDYLLIDLVDIIYALAMMYE  585

Query  2051  PQSWHTTGALFEAQER--CKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARS  2224
              +        F  QER   +EAL ++  +  +DP YVPS V    +L K+GS ++P+AR+
Sbjct  586   AEMLEHLDIGFMHQERGEIQEALASYINASLLDPFYVPSKVWIGALLSKLGSNSLPVART  645

Query  2225  LLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             LL +ALRIEPT   AW+ LG + K +G    A D  QAA  L+ S PV++F
Sbjct  646   LLSDALRIEPTNRKAWYHLGMVHKDDGRLADAIDCLQAASMLEESDPVENF  696



>ref|XP_009763162.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Nicotiana 
sylvestris]
 ref|XP_009763163.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Nicotiana 
sylvestris]
Length=730

 Score =   478 bits (1229),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 316/727 (43%), Positives = 456/727 (63%), Gaps = 27/727 (4%)
 Frame = +2

Query  236   RRRKML-CACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVD  412
             R RKM+ C CSGEQ + E+  P+ +S   LATRD+SASG SS R G    +++ + + ++
Sbjct  17    RLRKMMKCICSGEQLRIEDIIPSSES---LATRDYSASGYSS-RAGD---DAKADTSNIE  69

Query  413   EVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrp  592
             E ES+L+E+  LNYEEARALLGRLEYQ+GN +AAL VF GIDI  + P++  +I  R   
Sbjct  70    EAESSLRESGILNYEEARALLGRLEYQKGNIEAALHVFDGIDIAAVVPKIKLSIARRCEI  129

Query  593   rkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFP  772
              +       I     MS+H+VSLL EAILLK+ SL  LGR  +AA+ C  ILD V+SA P
Sbjct  130   PRRNSLSDAI---PPMSMHAVSLLFEAILLKAISLQALGRFTEAAQSCTVILDTVESALP  186

Query  773   NGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQ  952
             +G+ E    DCKL E  +KA+E LP+LW       EA+ SYRRAL+  WNLD +  + ++
Sbjct  187   DGLHENFSADCKLLETLNKAMELLPELWKLACAPQEAILSYRRALLYRWNLDVETRSKIE  246

Query  953   KDLAIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEV  1123
             K  AI LL++G   D +P   R +   S  P+NN+EEAILLL VL+ +    ++ WD  +
Sbjct  247   KQYAIFLLYSG--TDAAPPNLRAQAEGSFIPRNNIEEAILLLLVLLRRYIVNKIVWDPSI  304

Query  1124  MDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSG  1303
             +DHL FAL++ GEF +LA  VE++LPG+  R +++  LALCY + G +   ++L    + 
Sbjct  305   LDHLCFALSIAGEFRALAHQVEELLPGIVVRRQKYTTLALCYYAEGDD--MVSLNLLRNL  362

Query  1304  SSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCY  1483
              +  ++E  I  LLL AK+C++ P  S EG+ +AR  +     +   + S A+  LG+  
Sbjct  363   MNNRDNENGIFELLLAAKICAEYPNLSEEGMGYARKVLPKIDGKCNQMASVAKCLLGLLL  422

Query  1484  GNAAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAETV-FSLGLEYATQRNLTPAFDNAL  1660
                ++   SDSER S  +++L SL  A  + +    TV F L LE A QR L  A   A 
Sbjct  423   SGRSRALVSDSERTSRLSEALESLESAQKITEGRNPTVLFYLSLENAEQRKLDIALYYAK  482

Query  1661  QYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIAR  1840
             Q  ++  GS  KGW LLA I+SA++R+ DAE IV+ ALDETG+ +Q + L+ KA LQIA+
Sbjct  483   QLLKLEGGSIVKGWLLLARILSAQKRYIDAENIVNAALDETGKWNQGELLRTKAKLQIAQ  542

Query  1841  QHPNQAMETYRILLAMIQAQRQS-GMDHEVLSD-----RKLEVEAWLDLARIYIDQDSWP  2002
             +H   A+ETY  LLA++Q QR+S G+  ++L +     R LE+E W DLA +Y     W 
Sbjct  543   EHLRDAVETYTHLLAVLQVQRKSFGVQKKLLKNMRNNTRSLEMETWHDLANVYTSLSQWR  602

Query  2003  DAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEV  2182
             DA+VC+ K++ I+ +S    H+ G L++A+   KEAL +F  +L I+P++VPS+VSTA V
Sbjct  603   DAEVCLIKSEAINPHSASRCHSAGLLYQARGLHKEALQSFQKALDIEPNHVPSLVSTAIV  662

Query  2183  LMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKME--GSaqqaadffqaaHELKL  2356
             L ++  Q++P+ +S L +ALRI+ T   AW++LG L K E   SA +AA+ F+AA  L+ 
Sbjct  663   LRQLSGQSLPVVKSFLTDALRIDRTNSSAWYNLGLLYKSENGASALEAAECFEAAALLQE  722

Query  2357  STPVQSF  2377
             S PV+ F
Sbjct  723   SAPVEPF  729



>ref|XP_008375903.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Malus domestica]
Length=737

 Score =   478 bits (1229),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 291/703 (41%), Positives = 441/703 (63%), Gaps = 22/703 (3%)
 Frame = +2

Query  236   RRRKML-CACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVD  412
             R  K+L C  SGEQ + +E   +  S   LATRD+SASG +   T T + E++ + + ++
Sbjct  17    RLEKILKCIRSGEQLRVDEVPHSSDS---LATRDYSASGGTGCSTRTGEVETKVDNSNIE  73

Query  413   EVESTLKEALSLNYE---EARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAIter  583
             E ES+L+E+  LNYE   + RALLGRLEYQ+GN +AAL VF+GIDI  + P+M  +I+ R
Sbjct  74    EAESSLRESGYLNYEVGXKXRALLGRLEYQKGNTEAALHVFEGIDIAGVIPKMKVSISRR  133

Query  584   trprkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDS  763
                 + R     +     MS+H+VSLLLEAI LK+KSL GLGR+ +AA+ CK ILD V+S
Sbjct  134   CETNRRRSQSDSV---PPMSMHAVSLLLEAIFLKAKSLQGLGRLGEAAQSCKLILDTVES  190

Query  764   AFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLA  943
             A P+G+ E    DCKLQE   KA+E LP+LW+  G   EA+ SYR+AL+  WNLD +  +
Sbjct  191   ALPDGLPENFASDCKLQETVGKAVELLPELWILAGAPQEAILSYRQALLYRWNLDIELAS  250

Query  944   SMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDS  1117
              M+K+ A+ LL++G + +  P    ++  S  P+NN+EEAILLL VL+GK   G +EWD 
Sbjct  251   KMEKEFAVFLLYSGCDAN-PPNLCSQMESSFVPRNNIEEAILLLLVLLGKFVAGTIEWDP  309

Query  1118  EVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKV  1297
              ++DHL+FAL++ G+  +LA  VE+++PG+  R ER+  LALCY   G+ E  + L    
Sbjct  310   SILDHLSFALSISGKVRALAHQVEELIPGIMGRQERYCTLALCY--YGEGEDLVALNLLK  367

Query  1298  SGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGV  1477
             +  +  E+   I  LLL +K+CS++     +G  +A  A+     +   + + A   LG+
Sbjct  368   NILNNRENMDCILELLLASKICSENLVCIEDGTKYAYKALSDLDGKCSQMSTIANCLLGL  427

Query  1478  CYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCK-EDAETVFSLGLEYATQRNLTPAFDN  1654
                  ++   SDSER   Q++++ +L  A  + K  +   +F L LE+A QR L  A   
Sbjct  428   SLSVKSRSVTSDSERILKQSEAIQALQTANKITKXRNPYILFHLCLEHAEQRKLDIALYY  487

Query  1655  ALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqI  1834
             A Q  ++ AGS+ K + LLA I+SA++RF DAE +++ ALD+TG+ DQ + L+ KA L I
Sbjct  488   AKQLLKLEAGSSXKSYALLAXILSAQKRFIDAETVINAALDQTGKWDQGELLRTKAKLHI  547

Query  1835  ARQHPNQAMETYRILLAMIQAQRQS-GMDHEVLSDRK-----LEVEAWLDLARIYIDQDS  1996
             A+     A+ETY  LLA++Q + ++ G+D  +L  R+     LE+E W DLA +Y     
Sbjct  548   AQGQLKNAIETYTXLLAVLQVRTKNLGVDKRLLKSRRNHNRSLEMETWHDLANLYTSLSQ  607

Query  1997  WPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTA  2176
             W DA+VC+ K+++I+ +S   WH+TG L+EA+   +EAL +F  +L ++P +VPS++S A
Sbjct  608   WRDAEVCLSKSQSINPHSASRWHSTGLLYEAKGLQQEALESFRKALDVEPTHVPSLISAA  667

Query  2177  EVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEG  2305
              +L + G Q++P+ARS LM+ALR++     AW++LG L K + 
Sbjct  668   CILRQFGGQSLPVARSFLMDALRLDRGNPCAWYNLGLLYKADA  710



>ref|XP_009412836.1| PREDICTED: ATP-dependent RNA helicase DHX36 [Musa acuminata subsp. 
malaccensis]
Length=1744

 Score =   501 bits (1290),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 317/700 (45%), Positives = 442/700 (63%), Gaps = 26/700 (4%)
 Frame = +2

Query  239   RRKMLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEV  418
             +  M C CSGEQ + +E   + +S   LAT++ SA   S     T   E R +   ++E 
Sbjct  12    KNTMKCLCSGEQLQVDEMVRSSES---LATKECSAVRYSCQNGET---EQRVDTGNIEEA  65

Query  419   ESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprk  598
             ES+L+E L LNYEEARALLGRLEYQRGN +AAL+VF GID+ ++ P++  AIT+R   RK
Sbjct  66    ESSLREGLCLNYEEARALLGRLEYQRGNVEAALRVFDGIDLASVGPKIRTAITKRIERRK  125

Query  599   prggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNG  778
                       SG MS+H+VSLL+EA+ LK+++L  LGR ++AA+ C  +LD ++SA P+G
Sbjct  126   FHSNWD----SGPMSIHAVSLLVEAVYLKARALQDLGRFKEAAQSCNIVLDTLESALPDG  181

Query  779   MSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKD  958
              S G   D KLQE+  KA+E LP+LW   G   EA++SYRRAL+  WNLDA  +A +QK+
Sbjct  182   -SPGNITDNKLQEIVCKAVELLPELWKLAGFSHEAISSYRRALLGHWNLDADTMAKIQKE  240

Query  959   LAIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMD  1129
              AI LL+ G   D SP   R ++  +  P+NNMEEAILLL +L+ K     +EWD  + D
Sbjct  241   FAIFLLYGGC--DASPPNLRSQMDGAFIPRNNMEEAILLLIILLRKFALKRIEWDPSIAD  298

Query  1130  HLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSS  1309
             HLT+AL V G+  SLA  VE++LPG+  R E++Y LALCY     + TALNLLRK+  +S
Sbjct  299   HLTYALCVSGQLSSLAGQVEELLPGILERKEQYYTLALCYLGEDDDLTALNLLRKLLSAS  358

Query  1310  EAEHEPH-IPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYG  1486
             E   +P  + +LLL +K+C ++   + EG+ FAR A+ +       + S A   LG+   
Sbjct  359   E---DPDCVKALLLASKVCGENSFCAEEGVLFARRALANVHGCCDQIGSVANCLLGISLS  415

Query  1487  NAAKISFSDSERNSYQTQSLNSLTQA-AMLCKEDAETVFSLGLEYATQRNLTPAFDNALQ  1663
               A+ S SDSER S Q+++L  L +A  M+  +D  T+++L L  A QR L  A   A Q
Sbjct  416   VQARSSTSDSERVSRQSEALEVLEKAEKMIPGKDYRTIYNLSLANAEQRKLDAALRYAKQ  475

Query  1664  YSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQ  1843
               ++ AGS   GW LLA I+SA++RF DAE I+D AL++TG+    + L+ KA +QIA+ 
Sbjct  476   LLKLEAGSNEAGWILLARILSAQKRFVDAETIIDAALEQTGKWSHGELLRTKAKIQIAQG  535

Query  1844  HPNQAMETYRILLAMIQAQRQS-GMDHEVL----SDRKLEVEAWLDLARIYIDQDSWPDA  2008
                 A+ETY  LLA+IQ + +S G+    L    +DR LE++ W DLA++YI      DA
Sbjct  536   KLKNAIETYTHLLAIIQLRTKSFGVGLTSLKGDKNDRSLEIQTWHDLAKVYISMSQCRDA  595

Query  2009  QVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLM  2188
             +VC+ K K+I  YS   WH TG L EAQ   KEAL A++ +L+I+P +VPS+VSTA VL 
Sbjct  596   EVCLSKLKSISPYSALGWHATGQLHEAQGLLKEALGAYAKALNIEPAHVPSLVSTAIVLR  655

Query  2189  KMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGS  2308
              +G Q   + RS L +ALR++ T H AWF+LG L K EG+
Sbjct  656   HLGDQPSVVIRSFLTDALRLDRTNHVAWFNLGLLYKAEGA  695



>gb|EMS56256.1| Tetratricopeptide repeat protein 7A [Triticum urartu]
Length=882

 Score =   481 bits (1238),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 282/645 (44%), Positives = 411/645 (64%), Gaps = 12/645 (2%)
 Frame = +2

Query  389   RFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSK  568
             R ++  + E ES+L+E LSLNYEEARALLGRLEYQRGN +AAL+VF GID++    R   
Sbjct  51    RVDDGNIQEAESSLREGLSLNYEEARALLGRLEYQRGNVEAALRVFDGIDLQAAIQRFQP  110

Query  569   AItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAIL  748
             +++E+   ++    + +   SG  S H+ SL+LEAI LK+ SL  LG+  +AA++CK++L
Sbjct  111   SLSEKPSSKRNNKLRSDSSNSG--SQHAASLVLEAIYLKAMSLQKLGKAIEAAQQCKSVL  168

Query  749   DIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLD  928
             D V+S F  G+ + + E  KLQE   K++E LP+LW Q G   EA+ SYRRAL+  WNLD
Sbjct  169   DAVESIFQRGIPDVMVEQ-KLQETVSKSVELLPELWKQAGAYQEALASYRRALLSQWNLD  227

Query  929   AKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPKNNMEEAILLLFVLMGKIQQGE  1102
              +    +QK  ++ LL+ GVE    P    +   S  PKNN+EEAILLL +L+ K   G+
Sbjct  228   DECCTRIQKRFSVFLLYGGVEAS-PPSLASQTEGSFVPKNNLEEAILLLMILLKKWYLGK  286

Query  1103  VEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALN  1282
               WD  VM+HLTFAL++ G+   LA + E++LPG+  R ERWY LALCYS+A  NE ALN
Sbjct  287   THWDPSVMEHLTFALSLCGQTSVLAKHFEEVLPGIYPRTERWYSLALCYSAASDNEAALN  346

Query  1283  LLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQAR  1462
             LL+K    +E+ ++  I +LLL AK+CS D   + EG+ +A+ A+      + HL S A 
Sbjct  347   LLKKSLNKNESPND--INALLLAAKICSSDYYLASEGVEYAKRAITDDELLDGHLRSVAL  404

Query  1463  KFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTP  1642
               LG C  N +KI+ SD +R+  Q ++L SL +A  L + + + +F +G+EYA QRN+  
Sbjct  405   HLLGSCLANKSKIASSDHQRSLLQAEALKSLGEAFSLDRHNPDLIFDMGVEYAEQRNMQA  464

Query  1643  AFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklka  1822
             A   A Q+ + T GS +KGW+LL+L++SA+QR+S+AE + D ALDET + +Q   L+++A
Sbjct  465   ALKCAKQFIDTTGGSVSKGWRLLSLVLSAQQRYSEAEVVTDAALDETAKWEQGPLLRIRA  524

Query  1823  alqIARQHPNQAMETYRILLAMIQAQRQS----GMDHEVLSDRKLEVEAWLDLARIYIDQ  1990
              L+ A+  P +A+E YR LLA++QAQR++        E   ++  E E W  LA +Y   
Sbjct  525   KLKAAQSLPMEAVEAYRALLALVQAQRKAYGSLKNGTEERDNKVSEFEVWQGLANLYASL  584

Query  1991  DSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVS  2170
                 DA++C+ KAK +  YS  + H  G + E  E+ + AL A+  +LS + D+VPS VS
Sbjct  585   SYCRDAEICLQKAKALKTYSATTLHAEGDMHEVGEQTQHALAAYLNALSTEVDHVPSKVS  644

Query  2171  TAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEG  2305
                +L K G + +P+ARS L +ALR+EPT   AWF LG++ K +G
Sbjct  645   IGALLSKQGPKYLPVARSFLSDALRLEPTNRMAWFYLGQVHKHDG  689



>ref|XP_009142902.1| PREDICTED: uncharacterized protein LOC103866688 [Brassica rapa]
 ref|XP_009142903.1| PREDICTED: uncharacterized protein LOC103866688 [Brassica rapa]
 ref|XP_009142904.1| PREDICTED: uncharacterized protein LOC103866688 [Brassica rapa]
Length=708

 Score =   476 bits (1224),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 289/678 (43%), Positives = 419/678 (62%), Gaps = 14/678 (2%)
 Frame = +2

Query  371   TADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTL  550
             T + E++ +E  + + ES+L+E LSLN EEARALLGRLEYQRGN + AL+VF+GID++  
Sbjct  32    TTEVEAKLDEGNIQDAESSLREGLSLNSEEARALLGRLEYQRGNVEGALRVFEGIDLQAA  91

Query  551   SPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAAR  730
               R+  +     +P   +    E       S H+ +L+LEAI LK+KSL  LGR  +AA+
Sbjct  92    IQRLQVSAPPPEKPSTKKKVPREQPQQSA-SQHAANLVLEAIYLKAKSLQKLGRTTEAAQ  150

Query  731   ECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALV  910
             ECK++LD V+  F  G+ +    D +LQE    A+E LP LW + G   EA+++YRRAL+
Sbjct  151   ECKSVLDSVEKIFQQGIPD-AQVDTRLQETVSHAVELLPALWKESGDYQEAISAYRRALL  209

Query  911   KPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPKNNMEEAILLLFVLMG  1084
               W+LD    A +QKD A+ LL +GVE    P    ++  S  P+NN+EEAILLL +L+ 
Sbjct  210   SQWSLDNDSCARVQKDFAVFLLHSGVEAS-PPSLGSQVEGSYVPRNNLEEAILLLMILLK  268

Query  1085  KIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQ  1264
             K  QG+ +WD  V++HLTF L++  +   LA  +E+++PG+ +R ERW  LALCYS+AGQ
Sbjct  269   KFNQGKAKWDPSVIEHLTFGLSLCSQTSVLAKQLEEVMPGVFSRVERWNSLALCYSAAGQ  328

Query  1265  NETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKH  1444
                A+NLLRK     + E    + +LLL +KLCS++P  + EG  +A+ A+++    ++H
Sbjct  329   TSAAVNLLRK--SLHKHEQPDDLVALLLASKLCSEEPSLAGEGAGYAQRAVNNAQGMDEH  386

Query  1445  LLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYAT  1624
             L     + LG+C G  AK+  SD ER+  Q++SL +L  A      + + +F LG++YA 
Sbjct  387   LKGVGFRMLGLCLGKQAKVPTSDFERSRLQSESLKALDGAIAFEHNNPDLIFELGVQYAE  446

Query  1625  QRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlq  1804
             QRNL  A   A ++ + T GS  KGW+ LAL++SA+QRFS+AE + D ALDET + DQ  
Sbjct  447   QRNLKAASRYAKEFIDATGGSVLKGWRFLALVLSAQQRFSEAEVVTDAALDETAKWDQGP  506

Query  1805  flklkaalqIARQHPNQAMETYRILLAMIQAQRQSGMDHEVLS----DRKLEVEAWLDLA  1972
              L+LKA L+I++ +P +A+ETYR LLA++QAQR+S      LS    D+  E E W  LA
Sbjct  507   LLRLKAKLKISQSNPTEAVETYRYLLALVQAQRKSFGPLRTLSQMEEDKVNEFEVWHGLA  566

Query  1973  RIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDY  2152
              +Y     W D +VC+ KA  +  YS    HT G ++E ++  K AL AF   L +D   
Sbjct  567   YLYSSLSHWNDVEVCLKKAGELKQYSASMLHTEGRMWEGRKEFKPALAAFLDGLLLDESS  626

Query  2153  VPSIVSTAEVLMKMGSQ---AVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaa  2323
             VP  V+   +L + G +    +P+ARSLL +ALRI+PT   AW+ LG + K +G    A 
Sbjct  627   VPCKVAVGALLSERGKEHQPTLPVARSLLSDALRIDPTNRKAWYYLGLVHKYDGRIADAT  686

Query  2324  dffqaaHELKLSTPVQSF  2377
             D FQAA  L+ S P++SF
Sbjct  687   DCFQAASMLEESDPIESF  704



>ref|XP_008380157.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Malus domestica]
Length=694

 Score =   475 bits (1222),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 295/688 (43%), Positives = 435/688 (63%), Gaps = 16/688 (2%)
 Frame = +2

Query  332   DFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDA  511
             +FSA+G S   T   + +++ +E  + E ES+L+E LSLN+EEARALLG+LEYQRGN + 
Sbjct  13    EFSANGNSMKAT---EVQAKLDEGNIQEAESSLREGLSLNFEEARALLGKLEYQRGNLEG  69

Query  512   ALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKSK  691
             AL+VF GID++    R+   + E+T  +K R           +  H+ +L+L+AI LK+K
Sbjct  70    ALRVFDGIDLQAAIERLQPNLAEKTPSKKGRSRSDS---QHTVPQHAATLVLDAIYLKAK  126

Query  692   SLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGL  871
             SL  LGR+++AA EC  +LD V+  F  G+ +    D +LQE   +++E LP+LW Q G 
Sbjct  127   SLQKLGRLKEAANECNNVLDAVEKIFHQGIPDA-QVDGRLQETVSQSVELLPELWKQAGY  185

Query  872   IDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPKNN  1045
               EA+++YRRAL+  WNLD    A +QK  A+ LL++GVE    P    ++  S  PKNN
Sbjct  186   PQEAISAYRRALLSQWNLDNDCCARIQKGFAVFLLYSGVEAG-PPSLGAQVEGSYVPKNN  244

Query  1046  MEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAER  1225
             +EEAILLL +L+ K+  G+ +WDS +M+HLTFAL++  +   LA  +E+I+PG+  R +R
Sbjct  245   LEEAILLLMILLRKLSLGKTKWDSSLMEHLTFALSLCNQTFVLAKQLEEIMPGVYHRVDR  304

Query  1226  WYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFA  1405
             W  LALCY  AGQN+ ALNLLRK     E   E  + +LLL AK+CS+D   + EG+ +A
Sbjct  305   WNSLALCYCGAGQNQEALNLLRKSLHKHERPEE--LMALLLAAKICSEDSYVAAEGVGYA  362

Query  1406  RGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKED  1585
             + A+ +    ++HL     + LG+C G  AK+S SD ER+  Q+++L SL +A  L   +
Sbjct  363   QRAISNAQGLDEHLKGVGLRLLGLCLGKQAKVSSSDFERSRLQSEALKSLNEAINLEPNN  422

Query  1586  AETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVD  1765
             ++  F LG+ YA  RNL  A   A ++ + T G   KGW+LLAL++SA+QRFS+A  + D
Sbjct  423   SDLAFELGVHYAEHRNLDTALRYAKKFIDQTGGCLIKGWRLLALVLSAQQRFSEAHVVTD  482

Query  1766  LALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQS----GMDHEVLS  1933
              ALDET + +Q   L+LKA L+I+   P  A+ETYR LLA++QAQR+S     +  +V  
Sbjct  483   AALDETAKWEQGPLLRLKAKLKISESLPMDAIETYRNLLALVQAQRKSFGPLRISLQVED  542

Query  1934  DRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEAL  2113
             D+  E E W  L+ +Y     W DA++C+ KA+ +  +S ++ H  G +FE Q + +EAL
Sbjct  543   DKVNEFEVWHGLSDLYSSLSYWKDAEICLSKARELKQHSAETLHAEGVIFEGQGQIQEAL  602

Query  2114  VAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLS  2293
              A+   L ++P YVP  +  A +L KMGS A+P+ARSLL +ALRI+P+   AW+ LG + 
Sbjct  603   AAYIDCLLLEPCYVPCKILIAALLSKMGSTALPVARSLLSDALRIDPSNRKAWYYLGMIH  662

Query  2294  KMEGSaqqaadffqaaHELKLSTPVQSF  2377
             + +G    A D FQAA  L+ S P++SF
Sbjct  663   RDDGRIGDAIDCFQAASMLEESDPIESF  690



>ref|XP_004982896.1| PREDICTED: tetratricopeptide repeat protein 7A-like isoform X1 
[Setaria italica]
 ref|XP_004982897.1| PREDICTED: tetratricopeptide repeat protein 7A-like isoform X2 
[Setaria italica]
Length=726

 Score =   476 bits (1224),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 291/702 (41%), Positives = 422/702 (60%), Gaps = 21/702 (3%)
 Frame = +2

Query  224   RAHCRRRKMLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEA  403
             R   RR  M C CSGEQ K  +            T+DFSASG SS R G  + E   +  
Sbjct  11    RNSVRRMAMECLCSGEQLKGADETVRSSDSTI--TKDFSASGYSS-RNG--EIEQYLDNG  65

Query  404   QVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAIter  583
              ++E E +L+E + LNYEEARALLGRLEYQRG+ +AAL+VF GIDI  L P+M  +I  +
Sbjct  66    NIEEAELSLREGICLNYEEARALLGRLEYQRGHVEAALRVFDGIDISALVPKMKISIARK  125

Query  584   trprkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDS  763
                RK          S  M LH+VSLL+EAI LK+++L  LG+ ++AA+EC+ ILDIV++
Sbjct  126   ADRRKTHSQWD----SPPMPLHAVSLLMEAIYLKARALHDLGKYKEAAQECRMILDIVEA  181

Query  764   AFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLA  943
             A P G+  G G+ CKL E+  KA+E LP+LW   G   EA++SYRR+L+  WNLD + +A
Sbjct  182   AIPEGLPAGFGKGCKLNEIICKAVELLPELWKSGGFSLEAISSYRRSLLNNWNLDGETVA  241

Query  944   SMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDS  1117
              +QK  A+ LL++G E    P    ++  S  P+NNMEEAILLL +L+ K     +E D 
Sbjct  242   RIQKKFAVFLLYSGCEAR-PPNLHSQLDGSFVPRNNMEEAILLLMILLRKFNLKRIERDP  300

Query  1118  EVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKV  1297
              VM HLTFAL++ G+   LA   E++LP +  + E  Y +ALCY +   + +ALNLL+++
Sbjct  301   SVMHHLTFALSMSGQLIPLAGQFEELLPDVLDKREWLYNVALCYLAEEDDLSALNLLKQI  360

Query  1298  SGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGV  1477
               S   +    +  LLL +K C +    + EG S+AR A+ +     + +   A   LGV
Sbjct  361   LKS--GDDSDCLKELLLASKACVEMSAYT-EGASYARRAIANMQGGCEQMSGVADLLLGV  417

Query  1478  CYGNAAKISFSDSERNSYQTQSLNSLTQA-AMLCKEDAETVFSLGLEYATQRNLTPAFDN  1654
                N A+ + S ++R S+Q ++L  L  A   +  +D+  ++SL LE A QR L  A   
Sbjct  418   TLSNQARSAISATDRASWQCEALEMLGNAEKKIHGKDSRVLYSLSLENAEQRKLESASFY  477

Query  1655  ALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqI  1834
             A +  ++ AGS  + W LLA I+SA+++F+DAE +VD ALD+TG+  Q   L+ KA +Q 
Sbjct  478   AKELVKLEAGSELRSWVLLARILSAQKQFADAETVVDAALDQTGKWSQGDLLRTKARIQA  537

Query  1835  ARQHPNQAMETYRILLAMIQAQRQSGMDHEVLS-----DRKLEVEAWLDLARIYIDQDSW  1999
             A+     A+ETY  LLA+IQ + +S      L+     D  LE+E W D+A +Y+    W
Sbjct  538   AQGQFRDAVETYTQLLAIIQLRTKSVTAGICLAKGKKDDNGLEIEIWYDIALLYLGMAQW  597

Query  2000  PDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAE  2179
              DA++C+ K ++I  YS  +WH TG ++EA+   KE L AF  +L +DP +VPS++S A 
Sbjct  598   RDAEICVLKMRSISPYSALAWHATGKIYEAKGLTKETLGAFFRALDLDPKHVPSLISIAT  657

Query  2180  VLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEG  2305
             VL ++G + +P  R  L +AL+++ T H AWF+LG L K EG
Sbjct  658   VLRQLGDRPLPSVRCFLTDALQLDRTNHVAWFNLGLLYKEEG  699



>ref|XP_011070119.1| PREDICTED: tetratricopeptide repeat protein 7A-like isoform X2 
[Sesamum indicum]
Length=678

 Score =   474 bits (1219),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 278/652 (43%), Positives = 411/652 (63%), Gaps = 13/652 (2%)
 Frame = +2

Query  440   LSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprggkge  619
             L + ++EARALLG+LEYQRGN + AL VF GID++    R+  ++ ++   RK R     
Sbjct  30    LEIYFQEARALLGKLEYQRGNLEGALLVFDGIDLQATVQRVQHSLEDKPPSRKGRTRSE-  88

Query  620   IVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGE  799
                S  +S +S +L+LEAI LK+KSL  LG++ +AA+ECK++LD V+  F  G+ + V  
Sbjct  89    --TSFAVSQNSTNLVLEAIYLKAKSLQKLGKLTEAAQECKSVLDAVEKIFVEGIPD-VLL  145

Query  800   DCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLF  979
             D KLQE    A+E LP+LW + G   EA+++YRRAL+  WN+D +  A +QK  A+ LL+
Sbjct  146   DNKLQETISHAVELLPELWKKAGCYSEAMSAYRRALLSQWNIDNECCARIQKAFAVFLLY  205

Query  980   AGVEVDLSPRFKIWC--STPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTV  1153
             +GV+   +P   +    S  P+NN+EEAILLL +LM K   G+++WD  V+DHLT A+++
Sbjct  206   SGVDF-CAPSLSVQIDGSYIPRNNLEEAILLLMILMRKAYHGKIKWDPSVLDHLTCAISL  264

Query  1154  VGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHI  1333
              G+   LA  +E+++PG   R +RW  +AL +S +GQ  +AL+LL+K     EA ++  I
Sbjct  265   CGQTSVLAKQLEEVMPGAIHRTDRWKTMALSFSGSGQKRSALDLLKKSLNQHEAPND--I  322

Query  1334  PSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSD  1513
              SLLL AK+CS+D   + +G+ +A+ A+ +    N HL     + LG+C G  AK+S SD
Sbjct  323   VSLLLAAKICSEDVLLAADGVKYAQRAIANANELNAHLKGIGLRMLGLCLGKQAKVSSSD  382

Query  1514  SERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTA  1693
              ER+  Q+++L SL  A  L   + + +F LG+ YA  RNL  A   A QY + T GS  
Sbjct  383   FERSLLQSEALKSLDSAVALECHNPDLIFELGILYAEHRNLDAALQCAKQYLDQTGGSMI  442

Query  1694  KGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYR  1873
             +GW+LLAL++SA+QRFS+AE + D ALDET + DQ   L++KA L+I++     A+ETYR
Sbjct  443   RGWRLLALVLSAQQRFSEAEVVTDAALDETSKWDQGPLLRMKAKLKISQSLHMDAVETYR  502

Query  1874  ILLAMIQAQRQS----GMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTID  2041
              LLA++QAQ++S    G   +V  ++  E E W  LA +Y     W DA++C+ KA+ + 
Sbjct  503   YLLALVQAQKKSYGPLGSSPQVEHEKVDEYEVWHGLASLYASLSRWKDAEICLGKARALK  562

Query  2042  IYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIAR  2221
              YS ++ HT G + E       AL A+  +  ++P YVPS +    +L KMG + +P+AR
Sbjct  563   QYSAETLHTEGMMHEKLGDADNALAAYINAHLLEPKYVPSKILIGSLLCKMGGKMLPVAR  622

Query  2222  SLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             +LL +ALRIEPT + AW+ LG++ K EG    A D FQAA  LK S PV+SF
Sbjct  623   TLLSDALRIEPTNYMAWYYLGRIHKDEGRIADAVDCFQAASMLKESDPVESF  674



>ref|XP_010684660.1| PREDICTED: tetratricopeptide repeat protein 7A-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=714

 Score =   475 bits (1222),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 268/648 (41%), Positives = 410/648 (63%), Gaps = 11/648 (2%)
 Frame = +2

Query  377   DWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSP  556
             D + R +   ++E ES+L+E+  LN+EEARALLG+ EYQ+GN +AA++VF+GID+ +++P
Sbjct  46    DVQPRPDTVNIEEAESSLRESGGLNFEEARALLGKYEYQKGNVEAAIRVFEGIDVTSVTP  105

Query  557   RMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAAREC  736
             R+   +       K R        +  MS+H+V+LL EA+LLK+KSL  LGR R+AA+ C
Sbjct  106   RIKLTLDRIRDRPKRRSQGD---ANPPMSVHAVNLLFEAMLLKAKSLQSLGRFREAAQSC  162

Query  737   KAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKP  916
             K ILDIV+S+ P+G+ E +  D KLQE   +A+E LP+LW       +A+  +RRAL+  
Sbjct  163   KVILDIVESSLPDGLPENLSVDSKLQETLIRAVELLPELWKLADCPHDAILCFRRALLYR  222

Query  917   WNLDAKRLASMQKDLAIALLFAGVE-VDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQ  1093
             WNLD++    +Q++ A+ LL++GVE    S R +   S  PKNN+EEA LLL +L  K+ 
Sbjct  223   WNLDSETATRIQREFAVYLLYSGVEATPPSLRSQKDNSYVPKNNLEEATLLLMLLFRKVT  282

Query  1094  QGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNET  1273
             + E+EWD  +++HL+FAL+V  E ++LA  +E + PG+  R E ++ LALCY + G +  
Sbjct  283   RREIEWDPSIVEHLSFALSVSNEPQALAWVIEALPPGIIERKEMFHTLALCYHAHGDSFA  342

Query  1274  ALNLLRKVSGSSEAEHEP-HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLL  1450
             A NLL+K+   SE   EP H   L++ +KLCS++P  + EGI++AR A+    ++  H +
Sbjct  343   AFNLLKKLLHHSE---EPKHSSGLVMASKLCSENPSLAEEGIAYARRALVDKEDRCDHTV  399

Query  1451  SQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCK-EDAETVFSLGLEYATQ  1627
              +    LGV    +A+ + +DSER   Q +++  L  A  L    D+  V+ L L+YA Q
Sbjct  400   GRIHSLLGVSLSTSAESALADSERVVRQLEAIQELESAVNLTNLSDSTAVYHLSLQYALQ  459

Query  1628  RNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqf  1807
             R L PA   + Q  ++  G+  KGW LLA I+S ++ F DAE +VD AL+++G+ DQ   
Sbjct  460   RKLNPALYYSKQLLKLDGGTNIKGWLLLARILSGQKCFVDAETVVDAALEQSGKWDQGDL  519

Query  1808  lklkaalqIARQHPNQAMETYRILLAMIQAQRQSGMDHEVLS--DRKLEVEAWLDLARIY  1981
             L+ KA LQ+A+ +  +A+ETY  LLA++  +R+S    +     DR LE++ W DLA IY
Sbjct  520   LRTKAKLQVAQGYLRKAIETYMQLLAVLHVKRKSSGSGKSFENCDRHLELQTWHDLACIY  579

Query  1982  IDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPS  2161
             I    W DA++C+ KAKTI       WHT G+L EA+    EAL A++ +L+IDP +VPS
Sbjct  580   ISLSRWKDAEICLSKAKTISPDCASRWHTIGSLHEAKGLFNEALDAYNTALNIDPCHVPS  639

Query  2162  IVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEG  2305
             +VS+A +L ++ S+   + +S LMNAL+++ T H AW++LG   K + 
Sbjct  640   LVSSAMILRRLNSKCNSVIKSYLMNALQLDRTNHVAWYNLGLFYKADN  687



>ref|XP_006663113.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Oryza brachyantha]
Length=706

 Score =   474 bits (1219),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 289/657 (44%), Positives = 406/657 (62%), Gaps = 13/657 (2%)
 Frame = +2

Query  422   STLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkp  601
             S+L E LSLNYEEARALLGRLE+Q+GN +AAL VF GID++    R   ++ ++T  +K 
Sbjct  54    SSLPEGLSLNYEEARALLGRLEFQKGNVEAALCVFDGIDLQAAIHRFQPSLADKTPSKKG  113

Query  602   rggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGM  781
             R        SG    +  +L+LEAI LKS SL  LG+  +AA +CK++LD V+S F NG 
Sbjct  114   RPKSES-PRSGTE--NPATLVLEAIYLKSLSLQKLGKSTEAAHQCKSVLDSVESMFQNGP  170

Query  782   SEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDL  961
              +    + KLQE  +K++E LP+ W Q G   EA+ SYRRAL+  WNLD +    +QK  
Sbjct  171   PDI---EQKLQETINKSVELLPEAWKQAGSHQEALASYRRALLSQWNLDDECCTRIQKRF  227

Query  962   AIALLFAGVEVDLSPRFKIW-CSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLT  1138
             A  LL++ VE        +   S  PKNN+EEAILLL V++ K  QG+  WD  VM+HLT
Sbjct  228   AAFLLYSSVEGSPPSSSSLAEGSFVPKNNVEEAILLLMVVLKKWYQGKTHWDPSVMEHLT  287

Query  1139  FALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAE  1318
             +AL++  +   LA N+E++LPG+  R ERWY LALCY + GQ E ALN LRK     E  
Sbjct  288   YALSLCDQPSVLAKNIEEVLPGIYPRTERWYTLALCYYAIGQKEDALNFLRKSLNKHENP  347

Query  1319  HEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAK  1498
             ++  I +LLL AK+CS++   + EG+ +AR A+    + + H+ S A  FLG C    +K
Sbjct  348   ND--IMALLLAAKICSEERHLASEGVEYARRAITHAESSDVHVKSVALHFLGSCLAKKSK  405

Query  1499  ISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMT  1678
                SD +R   QT++L SL ++  L + + + +F +G+EYA QRN+  A   A ++ + T
Sbjct  406   TVSSDHQRLLLQTETLKSLAESIALDRHNPDLIFDMGVEYAEQRNMNAALRCAKEFIDAT  465

Query  1679  AGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQA  1858
              GS +KGW+LLAL++SA+QR+ +AE   D ALDET + DQ   L LKA L++A+  P +A
Sbjct  466   GGSVSKGWRLLALVLSAQQRYPEAEVATDAALDETAKWDQGLLLSLKAKLKVAQSSPMEA  525

Query  1859  METYRILLAMIQAQRQSG----MDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDK  2026
             +E YR LLA++QAQ+ S      D E   D   E E W  LA +Y     W DA++C+ K
Sbjct  526   VEAYRALLALVQAQKNSSGSSKNDAEGQDDSVSEFEIWQGLANLYSSLSIWRDAEICLQK  585

Query  2027  AKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQA  2206
             A+ +  YS  + H  G + EA+E+ KEAL A+  + SI+ ++VPS V+   +L K G + 
Sbjct  586   ARALKSYSAATMHAEGYMLEAREQNKEALAAYVNAFSIELEHVPSKVAIGALLCKQGPKY  645

Query  2207  VPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             +P AR  L +ALRIEPT   AW  LGK+ + +G    AAD FQAA  L+ S PV+SF
Sbjct  646   LPAARCFLSDALRIEPTNRMAWLHLGKVHRNDGRITDAADCFQAAVMLEESDPVESF  702



>ref|XP_010684659.1| PREDICTED: tetratricopeptide repeat protein 7A-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=718

 Score =   474 bits (1219),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 269/652 (41%), Positives = 411/652 (63%), Gaps = 15/652 (2%)
 Frame = +2

Query  377   DWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSP  556
             D + R +   ++E ES+L+E+  LN+EEARALLG+ EYQ+GN +AA++VF+GID+ +++P
Sbjct  46    DVQPRPDTVNIEEAESSLRESGGLNFEEARALLGKYEYQKGNVEAAIRVFEGIDVTSVTP  105

Query  557   RMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAAREC  736
             R+   +       K R        +  MS+H+V+LL EA+LLK+KSL  LGR R+AA+ C
Sbjct  106   RIKLTLDRIRDRPKRRSQGD---ANPPMSVHAVNLLFEAMLLKAKSLQSLGRFREAAQSC  162

Query  737   KAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKP  916
             K ILDIV+S+ P+G+ E +  D KLQE   +A+E LP+LW       +A+  +RRAL+  
Sbjct  163   KVILDIVESSLPDGLPENLSVDSKLQETLIRAVELLPELWKLADCPHDAILCFRRALLYR  222

Query  917   WNLDAKRLASMQKDLAIALLFAGVE-VDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQ  1093
             WNLD++    +Q++ A+ LL++GVE    S R +   S  PKNN+EEA LLL +L  K+ 
Sbjct  223   WNLDSETATRIQREFAVYLLYSGVEATPPSLRSQKDNSYVPKNNLEEATLLLMLLFRKVT  282

Query  1094  QGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNET  1273
             + E+EWD  +++HL+FAL+V  E ++LA  +E + PG+  R E ++ LALCY + G +  
Sbjct  283   RREIEWDPSIVEHLSFALSVSNEPQALAWVIEALPPGIIERKEMFHTLALCYHAHGDSFA  342

Query  1274  ALNLLRKVSGSSEAEHEP-HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLL  1450
             A NLL+K+   SE   EP H   L++ +KLCS++P  + EGI++AR A+    ++  H +
Sbjct  343   AFNLLKKLLHHSE---EPKHSSGLVMASKLCSENPSLAEEGIAYARRALVDKEDRCDHTV  399

Query  1451  SQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCK-EDAETVFSLGLEYATQ  1627
              +    LGV    +A+ + +DSER   Q +++  L  A  L    D+  V+ L L+YA Q
Sbjct  400   GRIHSLLGVSLSTSAESALADSERVVRQLEAIQELESAVNLTNLSDSTAVYHLSLQYALQ  459

Query  1628  RNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqf  1807
             R L PA   + Q  ++  G+  KGW LLA I+S ++ F DAE +VD AL+++G+ DQ   
Sbjct  460   RKLNPALYYSKQLLKLDGGTNIKGWLLLARILSGQKCFVDAETVVDAALEQSGKWDQGDL  519

Query  1808  lklkaalqIARQHPNQAMETYRILLAMIQAQRQSGMDHEVL------SDRKLEVEAWLDL  1969
             L+ KA LQ+A+ +  +A+ETY  LLA++  +R+S    +V        DR LE++ W DL
Sbjct  520   LRTKAKLQVAQGYLRKAIETYMQLLAVLHVKRKSSGSGKVPFKSFENCDRHLELQTWHDL  579

Query  1970  ARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPD  2149
             A IYI    W DA++C+ KAKTI       WHT G+L EA+    EAL A++ +L+IDP 
Sbjct  580   ACIYISLSRWKDAEICLSKAKTISPDCASRWHTIGSLHEAKGLFNEALDAYNTALNIDPC  639

Query  2150  YVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEG  2305
             +VPS+VS+A +L ++ S+   + +S LMNAL+++ T H AW++LG   K + 
Sbjct  640   HVPSLVSSAMILRRLNSKCNSVIKSYLMNALQLDRTNHVAWYNLGLFYKADN  691



>gb|EAY78895.1| hypothetical protein OsI_33999 [Oryza sativa Indica Group]
Length=756

 Score =   475 bits (1222),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 298/731 (41%), Positives = 429/731 (59%), Gaps = 50/731 (7%)
 Frame = +2

Query  224   RAHCRRRKMLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEA  403
             R   RR  M C CSGEQ +  +            T+D SASG SS R G  + E   +  
Sbjct  12    RGFVRRMAMECLCSGEQLRAADEIIRSPESAI--TKDCSASGYSS-RNG--EIEQYLDNG  66

Query  404   QVDEVESTLKEALSLNYE-----------------------------EARALLGRLEYQR  496
              ++E E +L+E + LNYE                             EARALLGRLEYQR
Sbjct  67    NIEEAELSLREGVCLNYEDLISVDLLIAILTNTQTRAKSSHIIKILQEARALLGRLEYQR  126

Query  497   GNFDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAI  676
             G+ +AAL+VF GIDI  L P+M  +I  +   RK R        S  M LH+VSLL+EAI
Sbjct  127   GHVEAALRVFDGIDIPALVPKMKISIARKVDRRKTRSQWD----SPPMPLHAVSLLMEAI  182

Query  677   LLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLW  856
              LKS++L  LG+ ++AA+EC+ ILDIV++A P G+  G G+DCKL E+  KA+E LP+LW
Sbjct  183   YLKSRALHDLGKFKEAAQECRMILDIVEAAVPEGLPAGFGKDCKLNEIICKAVELLPELW  242

Query  857   VQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCST  1030
                G   EA++SYRR+L+  WNLD + +A +QK+ AI LL++G E    P    ++  S 
Sbjct  243   KLGGFSLEAISSYRRSLLNNWNLDGETIARIQKEFAIFLLYSGCEAR-PPNLHSQLDGSF  301

Query  1031  PPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMK  1210
              P+NNMEEAILLL +L+ K     VE D  +M HLTFAL++ G+ + LA   E++LPGM 
Sbjct  302   VPRNNMEEAILLLMILLRKFNLKRVERDPTIMHHLTFALSISGQLKPLAVQFEELLPGML  361

Query  1211  TRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSRE  1390
              + E  Y +ALCY +   + TALNLL+++  S   +   +   LLL +K C++   ++ E
Sbjct  362   DKREWSYNVALCYLAEEDDSTALNLLKRILKS--GDDSDNFKELLLASKACTERSAQT-E  418

Query  1391  GISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQA-A  1567
             G S+A+ A+ +     + +   A   LGV   N A+ + SD+ER S+Q ++L  L  A  
Sbjct  419   GASYAQRAIANMQGGCEQMAGVADLLLGVNLSNQARCATSDTERASWQCEALEVLENAEK  478

Query  1568  MLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSD  1747
              +  +D   ++SL LE A QR L  A   A +  ++ AGS  + W LLA I+SA+++F+D
Sbjct  479   KMHGKDPRAMYSLSLENADQRKLDAAAFYAKKLVKLEAGSELRSWLLLARILSAQKQFAD  538

Query  1748  AEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQS-----G  1912
             AE I+D ALD+TG+  Q   L+ KA +Q A+     A+ETY  LLA+IQ + +S      
Sbjct  539   AETIIDAALDQTGKWSQGDLLRTKARIQAAQGQLRNAVETYTKLLAVIQLRTKSLSAGIF  598

Query  1913  MDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQ  2092
             +      D  LE+E W DLA +Y+    W DA+VC+ K +TI  YS  +WH  G L+EA+
Sbjct  599   LAKGTKDDISLEIETWYDLALLYLRMSQWRDAEVCVSKIRTISPYSALAWHVKGKLYEAK  658

Query  2093  ERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAW  2272
              + KEAL ++  +L +D  +VPS++STA VL ++G++ +P  R  L +AL+++ T H AW
Sbjct  659   GQPKEALGSYFRALDLDRKHVPSLISTASVLREIGNRPLPSVRCFLTDALQLDRTNHAAW  718

Query  2273  FSLGKLSKMEG  2305
             F+LG L K EG
Sbjct  719   FNLGLLYKEEG  729



>gb|KEH23953.1| TPR 7B-like protein [Medicago truncatula]
Length=728

 Score =   473 bits (1216),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 300/718 (42%), Positives = 432/718 (60%), Gaps = 14/718 (2%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             M C CSG+  K EE    P S ESLAT+D+ +S  S         E R +   +++ ES+
Sbjct  16    MKCFCSGDMVK-EEETMVPNSSESLATKDYFSSTASGISGQDGQVERRLDSGNIEQAESS  74

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             L+E+  LNYEEARALLGR EYQ GN +AAL VF+GI+I  L+P++   + + T   K R 
Sbjct  75    LRESGILNYEEARALLGRYEYQEGNIEAALHVFEGINIAALTPKIKVFLAKSTERPKRRS  134

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                    +  MS+H+  LLLEAI LK+K L  L R  ++A+ CK ILD+++S+ P G+  
Sbjct  135   QN---YTTPPMSIHTAGLLLEAIFLKAKCLQVLARFEESAQTCKIILDLIESSLPEGLPG  191

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
               G +CKLQE   KA+E LP+LW       E + SYR AL+  WNLDA   A +QK+ AI
Sbjct  192   NFGSECKLQETLSKAVELLPELWKLADCPREVILSYRNALLHRWNLDAGTTAKIQKEFAI  251

Query  968   ALLFAG-VEVDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFA  1144
              LL++G  E+    R  +  S  P+NN+EEAILLL +L  KI   ++E D  +M+HL+F+
Sbjct  252   FLLYSGGEEIPSDLRSHMDSSFVPRNNIEEAILLLMILQRKIALNKIESDPSIMEHLSFS  311

Query  1145  LTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHE  1324
             L+V G+  +LA+  E++LP    R ER++ LALCY   G N+  + L       S +E  
Sbjct  312   LSVSGDLTALANQWEELLPVTINRRERYHALALCY--YGANKDLVALNLLKKLLSSSEDP  369

Query  1325  PHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKIS  1504
              H+P+LL+ +K+C ++P  +++G+S+A  A ++   +   L S A   LGV     +K +
Sbjct  370   KHVPALLMASKICCENPDLAKDGVSYACRARENLFEKCNQLESLANCLLGVSLSTYSKFA  429

Query  1505  FSDSERNSYQTQSLNSLTQAAMLCK-EDAETVFSLGLEYATQRNLTPAFDNALQYSEMTA  1681
              S+SER   Q+++L+SL  A+ + K ++   ++ L LE A QR L  A   A ++  + A
Sbjct  430   VSNSERFERQSEALHSLETASTMTKMKEPLILYYLSLECAEQRKLDSALCYAERFLSLEA  489

Query  1682  GSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAM  1861
             GS  +GW LLA I+SA+++F DAE IVD ALD TG  DQ   L+ KA LQIA++    A+
Sbjct  490   GSNIRGWLLLARILSAQKQFLDAEGIVDAALDRTGIWDQGDLLRTKAKLQIAQEKLPSAI  549

Query  1862  ETYRILLAMIQAQRQS-GMDHEVLSD-----RKLEVEAWLDLARIYIDQDSWPDAQVCID  2023
             ETY  LL ++  QR++ G   ++  D     R LEVE W DLA IYI    W DA+ C+ 
Sbjct  550   ETYTQLLGILLVQRKTFGSRTKLYKDNRDHARNLEVEIWHDLAYIYIRLSRWHDAEACLS  609

Query  2024  KAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQ  2203
             K+K I ++S    H  G + EA+   KEAL AF  +L +DP ++PS++STA VL + G+Q
Sbjct  610   KSKAIKLHSASRCHVIGTMLEAKGLYKEALKAFRDALDLDPGHIPSLISTAVVLRRDGTQ  669

Query  2204  AVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             + P  RS LM ALR+  +   AW+ LG L K EG   +AA+ FQ A+ L+ S PV+ F
Sbjct  670   SNPAIRSYLMEALRLNSSNASAWYHLGILHKAEGRMSEAAECFQEANSLEESEPVEPF  727



>ref|XP_004241005.1| PREDICTED: uncharacterized protein LOC101248015 [Solanum lycopersicum]
 ref|XP_010322242.1| PREDICTED: uncharacterized protein LOC101248015 [Solanum lycopersicum]
Length=730

 Score =   473 bits (1216),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 312/727 (43%), Positives = 456/727 (63%), Gaps = 27/727 (4%)
 Frame = +2

Query  236   RRRKML-CACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVD  412
             R RKM+ C CSGEQ + E+  P+ +S   LATRD+SASG SS R G    +++ + + ++
Sbjct  17    RLRKMMKCICSGEQLRIEDIIPSSES---LATRDYSASGYSS-RAGD---DAKADTSNIE  69

Query  413   EVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrp  592
             E ES+L+E+  LNYEEARALLGRLEYQ+GN +AAL VF+GIDI  + P++  +I  R   
Sbjct  70    EAESSLRESGILNYEEARALLGRLEYQKGNIEAALHVFEGIDIAAVVPKIKLSIARRGEV  129

Query  593   rkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFP  772
              +       I     MS+H+VSLL EAILLK+ SL  LGR  +AA+ C  ILD V+SA P
Sbjct  130   PRRNSLSDAI---PPMSMHAVSLLFEAILLKATSLQALGRFTEAAQSCAVILDTVESALP  186

Query  773   NGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQ  952
             +G+ E    DCKL E  +KA+E LP+LW       EA+ SYRRAL+  WNLD +  + ++
Sbjct  187   DGLPENFSTDCKLLETLNKAVELLPELWKLACAPQEAILSYRRALLYCWNLDVETRSKIE  246

Query  953   KDLAIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEV  1123
             K+ AI LL++G   D +P   R +   S  P+NN+EEAILLL VL+ +    ++ WD  +
Sbjct  247   KEYAIFLLYSG--TDAAPPNLRAQAEGSFIPRNNIEEAILLLLVLLRRYILNKIVWDPSI  304

Query  1124  MDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSG  1303
             +DHL+FAL++ GEF +LA  VE++LPG+  R +++  LALCY + G +  ALN     + 
Sbjct  305   LDHLSFALSIAGEFRALARQVEELLPGVVVRRQKYTILALCYYAEGDDMAALN--LLRNL  362

Query  1304  SSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCY  1483
              +  +++  I  L+L AK+C++ P    EG+ ++R  +     +   + S A+  LG+  
Sbjct  363   MNNRDNKNGIFELVLAAKICAEYPNLLEEGMGYSRKVLPKIEGKCNQMASVAKCLLGLLL  422

Query  1484  GNAAKISFSDSERNSYQTQSLNSLTQA-AMLCKEDAETVFSLGLEYATQRNLTPAFDNAL  1660
                ++   SDSER S   ++L SL  A  M    +   +F L LE A QR L  A   A 
Sbjct  423   SGRSRTIVSDSERTSRLCEALESLDSAHKMTGGRNPNVLFYLSLENAEQRKLDIALYYAK  482

Query  1661  QYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIAR  1840
             Q  ++  GST KGW LLA I+SA++R+ DAE+I++ ALDETG+ +Q + L+ KA LQIA+
Sbjct  483   QLLKLEGGSTVKGWLLLARILSAQKRYIDAESIINAALDETGKWNQGELLRTKAKLQIAQ  542

Query  1841  QHPNQAMETYRILLAMIQAQRQSGMDHEVL------SDRKLEVEAWLDLARIYIDQDSWP  2002
              H   A+ETY  LLA++Q QR+S   H+ L      + R LE+E W DLA +Y +   W 
Sbjct  543   GHLRDAVETYTHLLAVLQVQRKSFGVHKKLLKNTRDNSRSLEMETWHDLANVYTNLSQWR  602

Query  2003  DAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEV  2182
             DA+VC+ K++ I+ +S    H+ G L++A+   KEAL +F  SL I+P++VPS+VSTA V
Sbjct  603   DAEVCLIKSEAINPHSASRCHSAGLLYQARGLYKEALQSFQKSLDIEPNHVPSLVSTAIV  662

Query  2183  LMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEG--SaqqaadffqaaHELKL  2356
             L ++  Q++P+ +S L +ALR++ T   AW++LG + K E   SA +AA+ F+AA  L+ 
Sbjct  663   LRQLDGQSLPVMKSFLTDALRLDRTNPSAWYNLGLVYKSENGVSALEAAECFEAAELLQE  722

Query  2357  STPVQSF  2377
             S PV+ F
Sbjct  723   SAPVEPF  729



>ref|XP_002881885.1| hypothetical protein ARALYDRAFT_483406 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58144.1| hypothetical protein ARALYDRAFT_483406 [Arabidopsis lyrata subsp. 
lyrata]
Length=704

 Score =   471 bits (1213),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 298/692 (43%), Positives = 424/692 (61%), Gaps = 19/692 (3%)
 Frame = +2

Query  329   RDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFD  508
             R   A+G+      T + E++ +E  + E ES+L+E LSLN+EEARALLGRLEYQRGN +
Sbjct  19    RQLCANGIC---MKTTEVEAKLDEGNIQEAESSLREGLSLNFEEARALLGRLEYQRGNLE  75

Query  509   AALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKS  688
              AL+VF+GID++    R+  ++       K    +        +S H+ +L+LEAI LK+
Sbjct  76    GALRVFEGIDLQAAIQRLQASVPPEKPATKKNRPREP---QQSVSQHAANLVLEAIYLKA  132

Query  689   KSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEG  868
             KSL  LGRI +AARECK++LD V+  F  G+ +    D KLQE    A+E LP LW + G
Sbjct  133   KSLQKLGRITEAARECKSVLDSVEKIFQQGIPD-AQVDNKLQETVSHAVELLPALWKESG  191

Query  869   LIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPKN  1042
                EA+++YRRAL+  WNLD    A +QKD A+ LL +GVE    P    +I  S  P+N
Sbjct  192   DYQEAISAYRRALLSQWNLDNDCCARIQKDFAVFLLHSGVEAS-PPSLGSQIEGSYIPRN  250

Query  1043  NMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAE  1222
             N+EEAILLL +L+ K   G+ +WD  V +HLTFAL++  +   LA  +E+++PG+ +R E
Sbjct  251   NLEEAILLLMILLKKFNLGKAKWDPSVFEHLTFALSLCSQTSVLAKQLEEVMPGVFSRIE  310

Query  1223  RWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISF  1402
             RW  LAL YS+AGQN  A+NLLRK     + E    + +LLL AKLCS++P  + EG  +
Sbjct  311   RWNTLALSYSAAGQNSAAVNLLRK--SLHKHEQPDDLVALLLAAKLCSEEPSLAAEGAGY  368

Query  1403  ARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKE  1582
             A+ A+++    ++HL     + LG+C G  AK+  SD ER+  Q++SL +L  A      
Sbjct  369   AQRAINNAQGMDEHLKGVGLRMLGLCLGKQAKVPTSDFERSRLQSESLKALDGAIAFEHN  428

Query  1583  DAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIV  1762
             + + +F LG++YA QRNL  A   A ++ + T GS  KGW+ LAL++SA+QRFS+AE + 
Sbjct  429   NPDLIFELGVQYAEQRNLKAASRYAKEFIDATGGSVLKGWRFLALVLSAQQRFSEAEVVT  488

Query  1763  DLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQSGMDHEVLS---  1933
             D ALDET + DQ   L+LKA L+I++ +P +A+ETYR LLA++QAQR+S      LS   
Sbjct  489   DAALDETAKWDQGPLLRLKAKLKISQSNPTEAVETYRYLLALVQAQRKSFGPLRTLSQME  548

Query  1934  -DRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEA  2110
              D+  E E W  LA +Y     W D +VC+ KA  +  YS    HT G ++E ++  K A
Sbjct  549   EDKVNEFEVWHGLAYLYSSLSHWNDVEVCLKKAGELKQYSASMLHTEGRMWEGRKEFKPA  608

Query  2111  LVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQ---AVPIARSLLMNALRIEPTCHDAWFSL  2281
             L AF   L +D   VP  V+   +L + G      +P+ARSLL +ALRI+PT   AW+ L
Sbjct  609   LAAFLDGLLLDGSSVPCKVAVGALLSERGKDHQPTLPVARSLLSDALRIDPTNRKAWYYL  668

Query  2282  GKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             G + K +G    A D FQAA  L+ S P++SF
Sbjct  669   GMVHKSDGRIADATDCFQAASMLEESDPIESF  700



>ref|XP_009382212.1| PREDICTED: tetratricopeptide repeat protein 7A [Musa acuminata 
subsp. malaccensis]
 ref|XP_009382213.1| PREDICTED: tetratricopeptide repeat protein 7A [Musa acuminata 
subsp. malaccensis]
 ref|XP_009382214.1| PREDICTED: tetratricopeptide repeat protein 7A [Musa acuminata 
subsp. malaccensis]
 ref|XP_009382215.1| PREDICTED: tetratricopeptide repeat protein 7A [Musa acuminata 
subsp. malaccensis]
 ref|XP_009382216.1| PREDICTED: tetratricopeptide repeat protein 7A [Musa acuminata 
subsp. malaccensis]
Length=707

 Score =   470 bits (1210),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 300/722 (42%), Positives = 447/722 (62%), Gaps = 28/722 (4%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEVEST  427
             M C CS +Q + +E   +  S   LAT+D    G  S R G    E R +   ++E ES+
Sbjct  1     MKCLCSDDQLRVDEMVQSSGS---LATKD-CLPGHYSCRNGKV--ERRVDTVNIEEAESS  54

Query  428   LKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprg  607
             L+E L LN EEARALLGR+EYQRGN +AAL VF GID+ +++P++  AI ER    K   
Sbjct  55    LREGLCLNDEEARALLGRIEYQRGNVEAALHVFDGIDLSSVAPKIKAAIAERMERPKCHS  114

Query  608   gkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSE  787
                    +  MS+H++SLL+EA+ LK+++L  LGR ++AA+ C   L+ ++SA  +G+  
Sbjct  115   KWD----ARTMSIHAISLLVEAVYLKARALQDLGRFKEAAQSCSIFLNSIESALHDGLPG  170

Query  788   GVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAI  967
                 D KLQE+  KA+E LP+LW   G   EA+++YRRAL+  WNLD   +A +QK+ AI
Sbjct  171   NFITDNKLQEIVCKAVELLPELWKLAGFPHEAISTYRRALLGHWNLDDVTMAKIQKEFAI  230

Query  968   ALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLT  1138
              LL+ G   D SP     ++  +  P+NNMEEA+LLL +L+ K+    +EWDS ++DHL+
Sbjct  231   FLLYGGC--DASPPNLHSQMDGAFIPRNNMEEAVLLLIILLRKVSLRRIEWDSSIIDHLS  288

Query  1139  FALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAE  1318
             FAL++ G+  SLA  VE +LPG+    E++Y LALCY     + TALNLLRK+  +++ +
Sbjct  289   FALSICGQLSSLAGQVEGLLPGVLGMKEQYYTLALCYLGENDDLTALNLLRKLLNATDPD  348

Query  1319  HEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAK  1498
                 + +L+L AK+C ++   + EG+SFAR A+ +       + S     LG+     A+
Sbjct  349   C---VKALILAAKVCGENTSCAEEGVSFARRALTNLHGCCDQIESVTNCLLGISLSAQAR  405

Query  1499  ISFSDSERNSYQTQSLNSLTQAA-MLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEM  1675
              S SDSER S  +++L  L +    +  +D +T+F+L LE+A QR L  A   A Q  ++
Sbjct  406   SSSSDSERVSRHSEALEVLEKTERTIHGKDCKTIFNLSLEHAEQRKLDAALRYAKQLLKL  465

Query  1676  TAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQ  1855
              AGS    W LLA I++A++RF DAE I++  L++TG+ DQ + L+ KA +QIA+     
Sbjct  466   EAGSNVDAWILLARILTAQKRFVDAETIINAGLEQTGKWDQGELLQTKAKIQIAKGQMKN  525

Query  1856  AMETYRILLAMIQAQRQSGMDHEVLS------DRKLEVEAWLDLARIYIDQDSWPDAQVC  2017
             A+ETY  LLA+IQ + +S  ++ ++S      +R LE++ W DLA +YI    W +A++C
Sbjct  526   AIETYTHLLAIIQLRTKS-FNYGLMSLKGGKSERSLEIQTWHDLANVYISMSLWREAEIC  584

Query  2018  IDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMG  2197
             +   K I  YS   WHTTG L+EA+   +EAL A++ +L I+P +VPS+VS A VL  +G
Sbjct  585   LSNLKAICPYSALRWHTTGQLYEAKGLLQEALGAYAKALDIEPAHVPSLVSRAIVLRHLG  644

Query  2198  SQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEG--SaqqaadffqaaHELKLSTPVQ  2371
               ++ + RSLL +ALR++ T H AWF+LG + K EG  SA +AA+ FQ A  LK + PV+
Sbjct  645   DWSLDVIRSLLTDALRLDRTNHIAWFNLGLIYKAEGARSALEAAECFQTAAFLKETAPVE  704

Query  2372  SF  2377
              F
Sbjct  705   PF  706



>ref|XP_006411579.1| hypothetical protein EUTSA_v10016328mg [Eutrema salsugineum]
 gb|ESQ53032.1| hypothetical protein EUTSA_v10016328mg [Eutrema salsugineum]
Length=704

 Score =   470 bits (1209),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 296/693 (43%), Positives = 424/693 (61%), Gaps = 19/693 (3%)
 Frame = +2

Query  326   TRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNF  505
             +R   A+G+    T     E++ +E  + E ES+L+E LSLN+EEARALLGRLEYQRGN 
Sbjct  18    SRTLCANGICMKTTLV---EAKLDEGNIQEAESSLREGLSLNFEEARALLGRLEYQRGNL  74

Query  506   DAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLK  685
             + AL+VF+GID++    R+  ++       K    +        +S H+ SL+LEAI LK
Sbjct  75    EGALRVFEGIDLQAAIQRLQVSVPPEKPVTKKNRPREP---PQSVSQHAASLVLEAIYLK  131

Query  686   SKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQE  865
             +KSL  LGRI +AARECK++LD V+  F  G+ +    D +LQE    A+E LP LW + 
Sbjct  132   AKSLQKLGRITEAARECKSVLDSVEKIFQQGIPD-AQVDTRLQETVSHAVELLPALWKES  190

Query  866   GLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPK  1039
             G   EA+++YRRAL+  WNLD    A +QKD A+ LL +GVE    P    +I  S  P+
Sbjct  191   GDYQEAISAYRRALLSQWNLDNDSCARIQKDFAVFLLHSGVEAS-PPSLGSQIEGSYIPR  249

Query  1040  NNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRA  1219
             NN+EEAILLL +L+ K   G+ +WD  V++HLTF L++  +   LA  +E+++PG+ +R 
Sbjct  250   NNLEEAILLLMILLKKFNLGKAKWDPSVIEHLTFGLSLCSQTSVLAKQLEEVMPGVFSRV  309

Query  1220  ERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGIS  1399
             ERW  LAL YS+AGQN  ++NLLRK     + E    + +LLL AKLCS++P  + EG  
Sbjct  310   ERWNNLALSYSAAGQNSASVNLLRK--SLHKHEQPDDLVALLLAAKLCSEEPSLAAEGAG  367

Query  1400  FARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCK  1579
             +A+ A+++    ++HL     + LG+C G  AK+  SD ER+  Q++SL +L  A     
Sbjct  368   YAQRAINNAQGMDEHLKGVGLRMLGLCLGKQAKVPTSDFERSRLQSESLKALDGAIAFEH  427

Query  1580  EDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAI  1759
              + + +F LG++YA QRNL  A   A ++ + T GS  KGW+ LAL++SA+QRFS+AE +
Sbjct  428   NNPDLIFELGVQYAEQRNLKAASRYAKEFIDATGGSVLKGWRFLALVLSAQQRFSEAEVV  487

Query  1760  VDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQSGMDHEVLS--  1933
              D ALDET + DQ   L+LKA L+I++ +P +A+ETYR LLA++QAQR+S      LS  
Sbjct  488   TDAALDETAKWDQGPLLRLKAKLKISQSNPTEAVETYRYLLALVQAQRKSFGPLRTLSQM  547

Query  1934  --DRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKE  2107
               D+  E E W  LA +Y     W D +VC+ KA  +  YS    HT G ++E ++  K 
Sbjct  548   EEDKVNEFEVWHGLAYLYSSLSHWNDVEVCLKKAGELKQYSASMLHTEGRMWEGRKEFKP  607

Query  2108  ALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQ---AVPIARSLLMNALRIEPTCHDAWFS  2278
             AL AF   L +D   VP  V+   +L + G      +P+ARSLL +ALRI+PT   AW+ 
Sbjct  608   ALAAFLDGLLLDGSSVPCKVAVGALLSERGKDHQPTLPVARSLLSDALRIDPTNRKAWYY  667

Query  2279  LGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             LG + K +G    A D FQAA  L+ S P++SF
Sbjct  668   LGMVHKYDGRIADATDCFQAASMLEESDPIESF  700



>ref|XP_009129527.1| PREDICTED: tetratricopeptide repeat protein 7A [Brassica rapa]
Length=737

 Score =   471 bits (1211),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 294/712 (41%), Positives = 437/712 (61%), Gaps = 22/712 (3%)
 Frame = +2

Query  203   KLAFLTGRAHCRRRKMLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADW  382
             KL     R   R+ +M C CSGEQ +  E E        L   + S S LS++ +  A  
Sbjct  11    KLRLHRVRQRLRKIRMKCLCSGEQMRLIEEEDKRSE---LGVGNVS-SALSAAESENA--  64

Query  383   ESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRM  562
               + +   ++E E +L+E  SLNYEEARALLGR+EYQ+GN +AAL+VF+GIDI  ++ +M
Sbjct  65    -KKLDNGNIEEAELSLRETSSLNYEEARALLGRIEYQKGNIEAALRVFEGIDINGITIKM  123

Query  563   SKAItertrprkprggkgeIVV--SGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAAREC  736
               A+T R   +  R  KG  V      MS H+VSLL EAI LK+KSL  LGR ++AA+ C
Sbjct  124   KTALTARDEKKHRRRSKGSFVAPPQPPMSKHAVSLLFEAIFLKAKSLQRLGRFQEAAQSC  183

Query  737   KAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKP  916
             + ILDI++++   G SE V  D KLQE   KA+E LP+LW       +A+ SYRRAL+  
Sbjct  184   RVILDIIEASVSEGASENVTGDIKLQETLTKAVELLPQLWKLADSPRDAILSYRRALLNH  243

Query  917   WNLDAKRLASMQKDLAIALLFAGVE-VDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQ  1093
             W LD +  A +QK+ A+ LL++G E V  + R +   S  P+NN+EEAILLL +L+ K+ 
Sbjct  244   WKLDPETTARIQKEYAVFLLYSGEEAVPPNLRSQTEGSFIPRNNVEEAILLLMLLLRKVN  303

Query  1094  QGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNET  1273
             Q  + WD+ ++DHLTFALT+ G+  +LA  +E++ P +  + E ++ L+LCY  AG+   
Sbjct  304   QKRISWDASILDHLTFALTMAGDLTALAKQLEELSPEILDQRELYHTLSLCYHGAGEGLV  363

Query  1274  ALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLS  1453
             AL LLRK+   SE E    I  LL+ +K+C + P  + EG+ +AR A+ S  N+   L  
Sbjct  364   ALGLLRKL--FSEKEDPNRISGLLMASKICGERPSLAEEGLDYARRAIGSLGNECVQLDG  421

Query  1454  QARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRN  1633
              AR  LG+    +++ + +++ER + Q++ + +L  A M    D   +  L LE A QR 
Sbjct  422   AARLVLGIALTESSRKTSTEAERVARQSEGMQALASADMT---DPRVLHRLALENAEQRK  478

Query  1634  LTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflk  1813
             L  A   A Q   + A S  + W LLA ++SA++RFSDAE IVD AL+ETG+ +Q + L+
Sbjct  479   LDSALVYAKQALRLGAESDLEAWLLLARVLSAQKRFSDAETIVDAALNETGKWEQGKLLR  538

Query  1814  lkaalqIARQHPNQAMETYRILLAMIQAQRQSGMDHEVLSD------RKLEVEAWLDLAR  1975
             LKA L++AR    + +++Y  +LA++Q Q +S    + +        R LE+  W DLA 
Sbjct  539   LKAKLRLARGEVKEGIKSYTEVLALLQVQSKSLNSSKKMPKGYVEELRSLELGTWHDLAH  598

Query  1976  IYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYV  2155
             IYID   W DA+ C+ +++ I  YSP  +HT G L++ Q + +EA+ AF+ +L IDP +V
Sbjct  599   IYIDLSQWRDAETCLSRSRLIAPYSPVRYHTEGVLYQRQGQLEEAMEAFTTALDIDPMHV  658

Query  2156  PSIVSTAEVLMKMGSQ-AVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGS  2308
             PS++S AE+L+++G++ +V + RS LM ALRI+   H AW++LGK+ K EGS
Sbjct  659   PSLISKAEILLELGNRSSVAVVRSFLMEALRIDRMNHSAWYNLGKMFKAEGS  710



>ref|XP_007035196.1| No pollen germination related 2 isoform 1 [Theobroma cacao]
 ref|XP_007035197.1| No pollen germination related 2 isoform 1 [Theobroma cacao]
 ref|XP_007035198.1| No pollen germination related 2 isoform 1 [Theobroma cacao]
 gb|EOY06122.1| No pollen germination related 2 isoform 1 [Theobroma cacao]
 gb|EOY06123.1| No pollen germination related 2 isoform 1 [Theobroma cacao]
 gb|EOY06124.1| No pollen germination related 2 isoform 1 [Theobroma cacao]
Length=732

 Score =   470 bits (1210),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 297/696 (43%), Positives = 439/696 (63%), Gaps = 22/696 (3%)
 Frame = +2

Query  239   RRKMLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEV  418
             ++ M C  SG+Q + ++   + +S   LATRD+S SG SS     A  E++ + + ++E 
Sbjct  19    QKMMKCIWSGQQIRVDDTIASSES---LATRDYSVSGYSSRPGEMA--ETKVDNSNIEEA  73

Query  419   ESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprk  598
             ES+L+E+  LNYEEARALLGRLEYQ+GN +AAL VF+GID+  ++ +M  ++  R    +
Sbjct  74    ESSLRESGYLNYEEARALLGRLEYQKGNIEAALHVFEGIDVAAVTSKMKVSLARRCEQNR  133

Query  599   prggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNG  778
              R        +  MS+H+VSLLLEAI LK+KSL  LGR  +AA+ CK ILD V+SA P G
Sbjct  134   RRSQSD---AAPAMSMHAVSLLLEAIFLKAKSLQHLGRFGEAAQSCKVILDNVESALPEG  190

Query  779   MSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKD  958
             +S+    DCKLQE+ +KA+E LP+LW   G   EA+ SYRRAL+  WNLD    + ++K+
Sbjct  191   LSDNYSTDCKLQEILNKAVELLPELWKLAGDPQEAILSYRRALLYYWNLDMGTKSKLEKE  250

Query  959   LAIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMD  1129
              A+ LL++G   D SP   R ++  S  P+NN+EEAILLL VL+ K     + WD  ++D
Sbjct  251   FAVLLLYSG--ADASPPNLRSQMEGSFVPRNNIEEAILLLLVLLRKFFLKRIGWDPSILD  308

Query  1130  HLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSS  1309
             HL FAL+V GE  ++A  VE++ P +  R ER+  LALCY   G++  ALNLLR +  S 
Sbjct  309   HLAFALSVSGELRAIAHQVEELHPEIMNRKERYSTLALCYYGEGEDIVALNLLRNLLNSR  368

Query  1310  EAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGN  1489
               ++   I  LLL +K+C ++     EGIS+AR A+     +   ++S+A   LGV   +
Sbjct  369   --DNPDCILELLLASKICGENMSCIEEGISWARKALSGLNGRCGQMVSKANCLLGVLLSS  426

Query  1490  AAKISFSDSERNSYQTQSLNSL-TQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQY  1666
              +++  SDSER   Q++++  L T   M+ + D   VF L LE A QR L  A   A Q 
Sbjct  427   QSRLVSSDSERILKQSETIEVLETAEKMMTERDPYIVFHLCLENAEQRKLDVALYYAKQL  486

Query  1667  SEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQH  1846
              ++ AGS+ KG+ LLA I+SA+++F DAE +++ ALD++G+ DQ + L+ KA LQIA+  
Sbjct  487   LKLEAGSSVKGYVLLARILSAQKQFVDAETVINAALDQSGKWDQGELLRTKAKLQIAQNQ  546

Query  1847  PNQAMETYRILLAMIQAQ-RQSGMDHEVLS-----DRKLEVEAWLDLARIYIDQDSWPDA  2008
                A+ETY  LLA++Q Q + SG   ++L      DR LE+E W DLA +Y     W DA
Sbjct  547   LKNAVETYTHLLAVLQVQYKSSGAGKKLLKTKGKWDRSLEMETWHDLANVYTSLSQWRDA  606

Query  2009  QVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLM  2188
             +VC+ K+K I  +S   W++TG L EA+   +EAL ++  +L ++P +VPS++STA +L 
Sbjct  607   EVCLSKSKAISPFSASRWYSTGLLNEAKGFHQEALRSYRKALDVEPTHVPSLISTACILR  666

Query  2189  KMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSK  2296
             ++G Q++PI RS L +A+R++ T   AW++LG L K
Sbjct  667   QLGGQSMPIVRSFLTDAVRLDRTNPAAWYNLGLLYK  702



>ref|XP_006489675.1| PREDICTED: tetratricopeptide repeat protein 7A-like isoform X1 
[Citrus sinensis]
 ref|XP_006489676.1| PREDICTED: tetratricopeptide repeat protein 7A-like isoform X2 
[Citrus sinensis]
Length=730

 Score =   470 bits (1209),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 292/696 (42%), Positives = 435/696 (63%), Gaps = 24/696 (3%)
 Frame = +2

Query  242   RKML-CACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRFEEAQVDEV  418
             RKM+ C CS EQ + +E   + +S   LATRD+SASG SS R G  D  ++ + + ++E 
Sbjct  18    RKMIKCICSREQLRVDELISSSES---LATRDYSASGFSS-RAGEMD--AKVDNSNIEEA  71

Query  419   ESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprk  598
             ES+L+E+  LNYEEARALLGRLE+Q+GN +AAL VF+GID+  ++ RM  +++ R    +
Sbjct  72    ESSLRESGYLNYEEARALLGRLEFQKGNIEAALHVFEGIDVAAVTSRMKVSLSRRCDQNR  131

Query  599   prggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNG  778
              R        +  MS+H+VSLL+EAI LK+KSL GLGR  +A + CK ILD V+ A P G
Sbjct  132   RRSQSD---AAPPMSMHAVSLLVEAIFLKTKSLQGLGRFEEACQSCKVILDTVEHALPEG  188

Query  779   MSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKD  958
             +      DCKLQE  +KA+E LP+L+   G  DE + SYRRAL+  WNL  +  A ++K 
Sbjct  189   LPGNHSIDCKLQETLNKAVELLPELYKLAGDPDETILSYRRALLYYWNLAIETTARIEKK  248

Query  959   LAIALLFAGVEVDLSP---RFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMD  1129
              A+ LL++G   D SP   R ++  S  P+NN+EEA+LLL +L+ K   G++EWD  ++D
Sbjct  249   FAVFLLYSG--TDASPPNLRLQMELSFVPRNNIEEAVLLLLILLKKTVLGKIEWDPSIID  306

Query  1130  HLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSS  1309
             HL+FAL+V GE  +LA  VE++LPG+  + ER+  LALCY   G++  ALNL R +    
Sbjct  307   HLSFALSVSGELWTLAHQVEELLPGVMEKKERYCTLALCYLGEGEHMVALNLFRNL--LD  364

Query  1310  EAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGN  1489
               E+      LL+ +K+C+++     EGI++AR A+     + + + S A   LGV    
Sbjct  365   PGENSDCNLELLVASKICAENKVCIEEGITYARKALSMLQGKCRQMASIANCLLGVLLSA  424

Query  1490  AAKISFSDSERNSYQTQSLNSLTQAAMLCKE-DAETVFSLGLEYATQRNLTPAFDNALQY  1666
              ++   SDS+R   Q+++L +L  A    +E D    + L LE A QR L  A   A + 
Sbjct  425   QSRSVVSDSKRILKQSEALVALETAEKTMRERDPYITYHLCLENAEQRKLDVALYYAKKL  484

Query  1667  SEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQH  1846
               + A S  KG+ LLA ++SA+++F+DAE++++ +LD+TG+ DQ + L+ KA LQIA+  
Sbjct  485   LNLEARSNVKGYLLLARVLSAQKQFADAESVINDSLDQTGKWDQGELLRTKAKLQIAQGR  544

Query  1847  PNQAMETYRILLAMIQAQRQSGMDHEVL------SDRKLEVEAWLDLARIYIDQDSWPDA  2008
                A+ETY  LLA++Q +++S    + L       DR LE+E W DLA +Y     W DA
Sbjct  545   LKNAIETYVNLLAVLQFRKKSFSAGKNLVKNRQNHDRSLEMETWHDLANVYSSLSQWRDA  604

Query  2009  QVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLM  2188
             +VC+ K+K I+ YS   WH+TG L+EA+   +EALV+F  +L  +P++VPS+VS A VL 
Sbjct  605   EVCLSKSKAINPYSASGWHSTGLLYEAKGLQQEALVSFRKALDAEPNHVPSLVSIARVLR  664

Query  2189  KMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSK  2296
             ++G +++   R  L +ALR++ T   AW++LG L K
Sbjct  665   QIGGESMATIRCFLTDALRLDRTNTTAWYNLGLLYK  700



>emb|CDY35200.1| BnaA01g08310D [Brassica napus]
Length=737

 Score =   470 bits (1209),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 294/712 (41%), Positives = 438/712 (62%), Gaps = 22/712 (3%)
 Frame = +2

Query  203   KLAFLTGRAHCRRRKMLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADW  382
             KL     R   R+ +M C CSGEQ +  E E        L   + S S LS++ +  A  
Sbjct  11    KLRLHRVRQRLRKIRMKCLCSGEQMRLIEEEDKRSE---LGVGNVS-SALSAAESENA--  64

Query  383   ESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRM  562
               + +   ++E E +L+E  SLNYEEARALLGR+EYQ+GN +AAL+VF+GIDI  ++ +M
Sbjct  65    -KKLDNGNIEEAELSLRETSSLNYEEARALLGRIEYQKGNIEAALRVFEGIDINGITIKM  123

Query  563   SKAItertrprkprggkgeIVV--SGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAAREC  736
               A+T R   +  R  KG  V      MS H+VSLL EAI LK+KSL  LGR ++AA+ C
Sbjct  124   KTALTAREEKKHRRRSKGSFVAPPQPPMSKHAVSLLFEAIYLKAKSLQRLGRFQEAAQSC  183

Query  737   KAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKP  916
             + ILDI++++   G SE V  D KLQE   KA+E LP+LW       +A+ SYRRAL+  
Sbjct  184   RVILDIIEASVSEGASENVTGDIKLQETLTKAVELLPQLWKLADSPRDAILSYRRALLNH  243

Query  917   WNLDAKRLASMQKDLAIALLFAGVE-VDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQ  1093
             W LD +  A +QK+ A+ LL++G E V  + R +   S  P+NN+EEAILLL +L+ K+ 
Sbjct  244   WKLDPETTARIQKEYAVFLLYSGEEAVPPNLRSQTEGSFIPRNNVEEAILLLMLLLRKVN  303

Query  1094  QGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNET  1273
             Q  + WD+ ++DHL+FALT+ G+  +LA  +E++ P +  + E ++ L+LCY  AG+   
Sbjct  304   QKRISWDASILDHLSFALTMAGDLTALAKQLEELSPEILDQRELYHTLSLCYHGAGEGLV  363

Query  1274  ALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLS  1453
             AL LLRK+   SE E    I  LL+ +K+C + P  + EG+ +AR A+ S  N+   L  
Sbjct  364   ALGLLRKL--FSEKEDPNRISGLLMASKICGERPSLAEEGLDYARRAIGSLGNECVQLDG  421

Query  1454  QARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRN  1633
              AR  LGV    +++ + +++ER + Q++ + +L  A M    D   +  L LE A QR 
Sbjct  422   AARLVLGVALTESSRKTSTEAERVAKQSEGMQALASADMT---DPRVLHRLALENAEQRK  478

Query  1634  LTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflk  1813
             L  A   A Q  ++ A S  + W LLA ++SA++RFSDAE IVD AL+ETG+ +Q + L+
Sbjct  479   LDSALVYAKQALKLGAESDLEAWLLLARVLSAQKRFSDAETIVDAALNETGKWEQGKLLR  538

Query  1814  lkaalqIARQHPNQAMETYRILLAMIQAQRQSGMDHEVLSD------RKLEVEAWLDLAR  1975
             LKA L++AR    + +++Y  +LA++Q Q +S    + +        R LE+  W DLA 
Sbjct  539   LKAKLRLARGEVKEGIKSYTEVLALLQVQSKSLNSSKKMPKGYVEELRSLELGTWHDLAH  598

Query  1976  IYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYV  2155
             IYID   W DA+ C+ +++ I  YSP  +HT G L++ Q + +EA+ AF+ +L IDP +V
Sbjct  599   IYIDLSQWRDAETCLSRSRLIAPYSPVRYHTEGVLYQRQGQLEEAMEAFTTALDIDPMHV  658

Query  2156  PSIVSTAEVLMKMGSQ-AVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGS  2308
             PS++S AE+L+++G++ +V + RS LM ALRI+   H AW++LGK+ K EGS
Sbjct  659   PSLISKAEILLELGNRSSVAVVRSFLMEALRIDRMNHSAWYNLGKMFKAEGS  710



>ref|XP_004979219.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Setaria 
italica]
Length=726

 Score =   469 bits (1206),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 287/666 (43%), Positives = 411/666 (62%), Gaps = 26/666 (4%)
 Frame = +2

Query  413   EVESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGID----IKTLSPRMSKAIte  580
             + ES+  E LSLNYEEARALLGRLE+Q+GN + AL+VF GID    I+   P +S     
Sbjct  72    DAESSSPEGLSLNYEEARALLGRLEFQKGNVEVALRVFDGIDLQAAIQQFQPSLSDKTPS  131

Query  581   rtrprkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVD  760
             +    K        + S V   +  SL+LEAI LKS SL  LG+  +AA +C+++LD V+
Sbjct  132   KKGRTKSE------LPSSVPQNNPASLVLEAIYLKSLSLQKLGKSIEAANQCQSVLDSVE  185

Query  761   SAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRL  940
             S F NG  +    + KLQE  +K++E LP+ W   G   EA+ SYRRAL+ PWNLD +  
Sbjct  186   SMFQNGTPDI---EPKLQETVNKSVELLPEAWKYAGSYQEALASYRRALLSPWNLDDECR  242

Query  941   ASMQKDLAIALLFAGVEVDLSPRF---KIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEW  1111
             + +QK     LL+  V VD SP     +I  +  PKNN+EEAILLL +++G   QG+  W
Sbjct  243   SRVQKRFVAFLLY--VNVDWSPPSMAQQIEGTFVPKNNVEEAILLLMIVLGNWYQGKTHW  300

Query  1112  DSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLR  1291
             D  VM+H T+AL++  E   LA  +E++LPG+  R ERW  LALCY +AGQ +TALN LR
Sbjct  301   DPSVMEHFTYALSLCREPLVLAKQLEEVLPGIYPRTERWCTLALCYHAAGQKDTALNFLR  360

Query  1292  KVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFL  1471
             K    ++ E+   I +L L AK+CS++   + EG+ +AR  +   + ++ HL S    FL
Sbjct  361   K--SLNKLENPNDILALSLAAKICSKECHLASEGVEYARRVI--ALAESHHLKSVGLHFL  416

Query  1472  GVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFD  1651
             G C G  +K+  SD +R+  QT++L SLT++  L + +A+ +F +G+EYA QRN+  A  
Sbjct  417   GSCLGKKSKVVSSDYQRSLLQTETLKSLTESITLNRYNADLIFDMGVEYAEQRNMNSALR  476

Query  1652  NALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalq  1831
              A ++ E T GS +KGW+LLAL++SA+QRFS+AE  +D ALDET + DQ   L++KA L+
Sbjct  477   CAKEFIEATGGSVSKGWRLLALVLSAQQRFSEAEVAIDAALDETAKWDQGSLLRVKAKLK  536

Query  1832  IARQHPNQAMETYRILLAMIQAQRQ---SGMDHEVLSDRKL-EVEAWLDLARIYIDQDSW  1999
             +A+  P +A+E YR LL+++QAQ+    S  D   L D  + E E W  LA +Y     W
Sbjct  537   VAQSSPMEAVEAYRTLLSLVQAQKNFSGSTKDTSELIDGSVSEFEIWQGLANLYSSLSYW  596

Query  2000  PDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAE  2179
              DA++C+ KA+T+  YS  + H  G + +A+E  K+AL A+  + S + ++VPS VS   
Sbjct  597   RDAEICLQKARTLKSYSATTLHAEGYMHQAREHTKDALAAYVNAFSTELEHVPSKVSIGA  656

Query  2180  VLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLS  2359
             +L K G + +P AR  L +ALR+EPT   AW  LGK+   +G    AAD FQAA  L+ S
Sbjct  657   LLAKQGPRFLPAARCFLSDALRVEPTNRMAWLYLGKVHWSDGRITDAADCFQAAVMLEES  716

Query  2360  TPVQSF  2377
              PV+S 
Sbjct  717   DPVESL  722



>ref|NP_001068489.1| Os11g0689300 [Oryza sativa Japonica Group]
 gb|ABA95388.1| calmodulin-binding protein MPCBP, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF28852.1| Os11g0689300 [Oryza sativa Japonica Group]
 dbj|BAM28950.1| putative calmodulin-binding protein [Oryza sativa Japonica Group]
Length=697

 Score =   468 bits (1204),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 281/652 (43%), Positives = 409/652 (63%), Gaps = 16/652 (2%)
 Frame = +2

Query  437   ALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprggkg  616
              LSLNYEEARALLGRLE+Q+GN +AAL VF GID++    R   ++T++T  +K +    
Sbjct  53    GLSLNYEEARALLGRLEFQKGNVEAALCVFDGIDLQAAIQRFQPSLTDKTTSKKGQTKSE  112

Query  617   eIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVG  796
                 SG+   +  +L+LEAI LKS SL  LG+  +AA +CK++LD V+S F NG  +   
Sbjct  113   ----SGIE--NPATLVLEAIYLKSLSLQKLGKSTEAANQCKSVLDSVESMFQNGPPDI--  164

Query  797   EDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALL  976
              + KLQE  +K++E LP+ W Q G   EA+ SYRR+L+  WNLD +    +QK  A  LL
Sbjct  165   -EQKLQETINKSVELLPEAWKQAGSHQEALASYRRSLLSQWNLDDECCTRIQKRFAAFLL  223

Query  977   FAGVE-VDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTV  1153
             ++ VE    S   ++  S  PKNN+EEAILLL V++ K  QG+  WD  VM+HLT+AL++
Sbjct  224   YSCVEGSPPSSGSQVEGSFIPKNNVEEAILLLMVVLKKWYQGKTHWDPSVMEHLTYALSL  283

Query  1154  VGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHI  1333
               +   LA N+E++LPG+  R ERW+ L+LCY + GQ E ALN LRK     E  ++  I
Sbjct  284   CDQPSLLAKNLEEVLPGIYPRTERWHTLSLCYYAIGQKEVALNFLRKSLNKHENPND--I  341

Query  1334  PSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSD  1513
              +LLL +K+CS++   + EG+ +AR A+  + + + HL S    FLG C G  +K   SD
Sbjct  342   MALLLASKICSEERHLASEGVEYARRAIKLSESSDVHLKSVGLHFLGNCLGKKSKTVSSD  401

Query  1514  SERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTA  1693
              +R+  Q ++L S +++  L + + + +F +G+EYA QRN+  A   A +Y +   GS +
Sbjct  402   HQRSLLQNETLKSFSESIALDRHNPDLIFDMGVEYAEQRNMNAALRCAKEYIDAIGGSVS  461

Query  1694  KGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYR  1873
             KGW+LLAL++SA+QR+ +AE   + ALDET ++DQ   L LKA L++A+  P +A+E YR
Sbjct  462   KGWRLLALVLSAQQRYPEAEVATNAALDETAKLDQGSLLSLKAKLKVAQSSPMEAVEAYR  521

Query  1874  ILLAMIQAQRQSG----MDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTID  2041
              LLA++QAQ+ S      D E  +D   E E W  LA +Y     W DA++C+ KA+ + 
Sbjct  522   ALLALVQAQKNSSGSSKTDAEGQNDSVSEFEIWQGLANLYSSLSIWRDAEICLRKARALK  581

Query  2042  IYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIAR  2221
              YS  + H  G + EA+++ KEAL A+  + SI+ ++VPS V+   +L K GS+ +P AR
Sbjct  582   SYSAATMHAEGYMLEARDQNKEALAAYVNAFSIELEHVPSKVAIGALLCKQGSRYLPAAR  641

Query  2222  SLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
               L +ALRIEPT   AW  LGK+ + +G    AAD FQAA  L+ S PV+SF
Sbjct  642   CFLSDALRIEPTNRMAWLHLGKVHRNDGRINDAADCFQAAVMLEESDPVESF  693



>gb|EAY84980.1| hypothetical protein OsI_06345 [Oryza sativa Indica Group]
 gb|EAZ41898.1| hypothetical protein OsJ_26446 [Oryza sativa Japonica Group]
Length=697

 Score =   468 bits (1204),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 281/652 (43%), Positives = 409/652 (63%), Gaps = 16/652 (2%)
 Frame = +2

Query  437   ALSLNYEEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprggkg  616
              LSLNYEEARALLGRLE+Q+GN +AAL VF GID++    R   ++T++T  +K +    
Sbjct  53    GLSLNYEEARALLGRLEFQKGNVEAALCVFDGIDLQAAIQRFQPSLTDKTTSKKGQTKSE  112

Query  617   eIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVG  796
                 SG+   +  +L+LEAI LKS SL  LG+  +AA +CK++LD V+S F NG  +   
Sbjct  113   ----SGIE--NPATLVLEAIYLKSLSLQKLGKSTEAANQCKSVLDSVESMFQNGPPDI--  164

Query  797   EDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALL  976
              + KLQE  +K++E LP+ W Q G   EA+ SYRR+L+  WNLD +    +QK  A  LL
Sbjct  165   -EQKLQETINKSVELLPEAWKQAGSHQEALASYRRSLLSQWNLDDECCTRIQKRFAAFLL  223

Query  977   FAGVE-VDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTV  1153
             ++ VE    S   ++  S  PKNN+EEAILLL V++ K  QG+  WD  VM+HLT+AL++
Sbjct  224   YSCVEGSPPSSGSQVEGSFIPKNNVEEAILLLMVVLKKWYQGKTHWDPSVMEHLTYALSL  283

Query  1154  VGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHI  1333
               +   LA N+E++LPG+  R ERW+ L+LCY + GQ E ALN LRK     E  ++  I
Sbjct  284   CDQPSLLAKNLEEVLPGIYPRTERWHTLSLCYYAIGQKEVALNFLRKSLNKHENPND--I  341

Query  1334  PSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSD  1513
              +LLL +K+CS++   + EG+ +AR A+  + + + HL S    FLG C G  +K   SD
Sbjct  342   MALLLASKICSEERHLASEGVEYARRAIKLSESSDVHLKSVGLHFLGNCLGKKSKTVSSD  401

Query  1514  SERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTA  1693
              +R+  Q ++L S +++  L + + + +F +G+EYA QRN+  A   A +Y +   GS +
Sbjct  402   HQRSLLQNETLKSFSESIALDRHNPDLIFDMGVEYAEQRNMNAALRCAKEYIDAIGGSVS  461

Query  1694  KGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYR  1873
             KGW+LLAL++SA+QR+ +AE   + ALDET ++DQ   L LKA L++A+  P +A+E YR
Sbjct  462   KGWRLLALVLSAQQRYPEAEVATNAALDETAKLDQGSLLSLKAKLKVAQSSPMEAVEAYR  521

Query  1874  ILLAMIQAQRQSG----MDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTID  2041
              LLA++QAQ+ S      D E  +D   E E W  LA +Y     W DA++C+ KA+ + 
Sbjct  522   ALLALVQAQKNSSGSSKTDAEGQNDSVSEFEIWQGLANLYSSLSIWRDAEICLRKARALK  581

Query  2042  IYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIAR  2221
              YS  + H  G + EA+++ KEAL A+  + SI+ ++VPS V+   +L K GS+ +P AR
Sbjct  582   SYSAATMHAEGYMLEARDQNKEALAAYVNAFSIELEHVPSKVAIGALLCKQGSRYLPAAR  641

Query  2222  SLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
               L +ALRIEPT   AW  LGK+ + +G    AAD FQAA  L+ S PV+SF
Sbjct  642   CFLSDALRIEPTNRMAWLHLGKVHRNDGRINDAADCFQAAVMLEESDPVESF  693



>ref|NP_850382.1| calmodulin-binding protein NPG1 [Arabidopsis thaliana]
 gb|AAO14644.1|AF474176_1 pollen-specific calmodulin-binding protein [Arabidopsis thaliana]
 gb|ACI49798.1| At2g43040 [Arabidopsis thaliana]
 gb|AEC10202.1| calmodulin-binding protein NPG1 [Arabidopsis thaliana]
Length=704

 Score =   468 bits (1204),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 297/693 (43%), Positives = 423/693 (61%), Gaps = 19/693 (3%)
 Frame = +2

Query  326   TRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNF  505
              R   A+G+      T + E++ +E  + E ES+L+E LSLN+EEARALLGRLEYQRGN 
Sbjct  18    VRQLCANGIC---MKTTEVEAKLDEGNIQEAESSLREGLSLNFEEARALLGRLEYQRGNL  74

Query  506   DAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLK  685
             + AL+VF+GID++    R+  ++       K    +        +S H+ +L+LEAI LK
Sbjct  75    EGALRVFEGIDLQAAIQRLQVSVPLEKPATKKNRPREP---QQSVSQHAANLVLEAIYLK  131

Query  686   SKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQE  865
             +KSL  LGRI +AA ECK++LD V+  F  G+ +    D KLQE    A+E LP LW + 
Sbjct  132   AKSLQKLGRITEAAHECKSVLDSVEKIFQQGIPDA-QVDNKLQETVSHAVELLPALWKES  190

Query  866   GLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPK  1039
             G   EA+++YRRAL+  WNLD    A +QKD A+ LL +GVE    P    +I  S  P+
Sbjct  191   GDYQEAISAYRRALLSQWNLDNDCCARIQKDFAVFLLHSGVEAS-PPSLGSQIEGSYIPR  249

Query  1040  NNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRA  1219
             NN+EEAILLL +L+ K   G+ +WD  V +HLTFAL++  +   LA  +E+++PG+ +R 
Sbjct  250   NNIEEAILLLMILLKKFNLGKAKWDPSVFEHLTFALSLCSQTAVLAKQLEEVMPGVFSRI  309

Query  1220  ERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGIS  1399
             ERW  LAL YS+AGQN  A+NLLRK     + E    + +LLL AKLCS++P  + EG  
Sbjct  310   ERWNTLALSYSAAGQNSAAVNLLRK--SLHKHEQPDDLVALLLAAKLCSEEPSLAAEGTG  367

Query  1400  FARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCK  1579
             +A+ A+++    ++HL     + LG+C G  AK+  SD ER+  Q++SL +L  A     
Sbjct  368   YAQRAINNAQGMDEHLKGVGLRMLGLCLGKQAKVPTSDFERSRLQSESLKALDGAIAFEH  427

Query  1580  EDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAI  1759
              + + +F LG++YA QRNL  A   A ++ + T GS  KGW+ LAL++SA+QRFS+AE +
Sbjct  428   NNPDLIFELGVQYAEQRNLKAASRYAKEFIDATGGSVLKGWRFLALVLSAQQRFSEAEVV  487

Query  1760  VDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQSGMDHEVLS--  1933
              D ALDET + DQ   L+LKA L+I++ +P +A+ETYR LLA++QAQR+S      LS  
Sbjct  488   TDAALDETAKWDQGPLLRLKAKLKISQSNPTEAVETYRYLLALVQAQRKSFGPLRTLSQM  547

Query  1934  --DRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKE  2107
               D+  E E W  LA +Y     W D +VC+ KA  +  YS    HT G ++E ++  K 
Sbjct  548   EEDKVNEFEVWHGLAYLYSSLSHWNDVEVCLKKAGELKQYSASMLHTEGRMWEGRKEFKP  607

Query  2108  ALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQ---AVPIARSLLMNALRIEPTCHDAWFS  2278
             AL AF   L +D   VP  V+   +L + G      +P+ARSLL +ALRI+PT   AW+ 
Sbjct  608   ALAAFLDGLLLDGSSVPCKVAVGALLSERGKDHQPTLPVARSLLSDALRIDPTNRKAWYY  667

Query  2279  LGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             LG + K +G    A D FQAA  L+ S P++SF
Sbjct  668   LGMVHKSDGRIADATDCFQAASMLEESDPIESF  700



>ref|XP_008645613.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Zea mays]
 gb|AFW71225.1| hypothetical protein ZEAMMB73_931534 [Zea mays]
Length=711

 Score =   468 bits (1204),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 283/665 (43%), Positives = 407/665 (61%), Gaps = 24/665 (4%)
 Frame = +2

Query  419   ESTLKEALSLNYEEARALLGRLEYQRGNFDAALQVFQGID----IKTLSPRMSKAItert  586
             ES+  E LSLNYEEARALLGRLE+Q+GN + AL+VF GID    I+   P +S     + 
Sbjct  55    ESSHPEGLSLNYEEARALLGRLEFQKGNVEVALRVFDGIDLQAAIQQFQPSLSDKTPSKK  114

Query  587   rprkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSA  766
                K        + S V   +  SL+LEAI LKS SL  LG+  +AA +CK++LD V+S 
Sbjct  115   GRTKSE------IPSSVPQNNPASLVLEAIYLKSLSLQKLGKSTEAANQCKSVLDSVESI  168

Query  767   FPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLAS  946
             F NG  +    + KLQE  +K++E LP+ W   G   EA+ SYRRAL+ PWNLD +    
Sbjct  169   FQNGAPDI---EQKLQETVNKSVELLPEAWKHAGSNQEALASYRRALLSPWNLDDECRTR  225

Query  947   MQKDLAIALLFAGVEVDLSPRF---KIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDS  1117
             +QK  A  LL+    +D SP     ++     PKN++EEA+LLL V++    QG+  WD 
Sbjct  226   VQKRFASFLLYNN-NIDWSPPSMAQQVEGCFVPKNSVEEAVLLLMVVLRSWYQGKTHWDP  284

Query  1118  EVMDHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKV  1297
              VM+HLT+AL++ GE   LA  +E++LPG+  R ERW  LALCY  AGQ + ALN LRK 
Sbjct  285   SVMEHLTYALSLCGEPLVLAKQLEEVLPGVYPRTERWATLALCYYVAGQKDVALNFLRK-  343

Query  1298  SGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGV  1477
                ++ E+   + +LLL AK+CS++   + EG+ +AR  +    + + HL S    FLG 
Sbjct  344   -SLNKLENPNDVLALLLAAKICSKERHLASEGVEYARRVIACAESSDPHLKSVGLHFLGS  402

Query  1478  CYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNA  1657
             C GN +K+  SD +R+  QT++L S  ++  L + +A+ +F +G+EYA QRN+  A   A
Sbjct  403   CLGNKSKVVSSDYQRSLLQTETLKSFAESIGLNRYNADLIFDMGVEYAEQRNMNAALRCA  462

Query  1658  LQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIA  1837
              ++ E T GS +KGW+LLALI+SA+QRFS+AE   D ALDET ++DQ   L++KA L++A
Sbjct  463   KEFIEATGGSVSKGWRLLALILSAQQRFSEAEVATDAALDETAKLDQGSLLRVKAKLKVA  522

Query  1838  RQHPNQAMETYRILLAMIQAQRQS--GMDHEVLSDRK---LEVEAWLDLARIYIDQDSWP  2002
             +  P +A+E YR LLA++QAQ+ S  G       D      E E W  LA +Y     W 
Sbjct  523   QSSPMEAVEAYRALLALVQAQKNSPGGSCKSATEDADGSVSEFEIWQGLANLYSSLSYWR  582

Query  2003  DAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEV  2182
             DA++C++KA+ + +YS  + H  G + EA+++  +AL A+  + S + ++VPS V+   +
Sbjct  583   DAEICLNKARALKLYSAATLHAEGYMHEARDQTTDALAAYVNAFSTELEHVPSKVAIGAM  642

Query  2183  LMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLST  2362
             L K G + +P AR  L +ALR+EPT   AW  LGK+ + +G    AAD FQAA  L+ S 
Sbjct  643   LSKQGPRFLPAARCFLSDALRVEPTNRMAWLYLGKVHRSDGRISDAADCFQAAVMLEESD  702

Query  2363  PVQSF  2377
             PV+SF
Sbjct  703   PVESF  707



>gb|KHN02486.1| Tetratricopeptide repeat protein 7A [Glycine soja]
Length=716

 Score =   468 bits (1205),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 299/724 (41%), Positives = 442/724 (61%), Gaps = 24/724 (3%)
 Frame = +2

Query  248   MLCACSGEQFKFeepepapqspesLATRDFSASGLSSSRTGTADWESRF---EEAQVDEV  418
             M C C  E  K    +    S +SLA R+F +S  +S R+G  D E          +DE 
Sbjct  2     MKCMCLREPLK--GEDETVPSSDSLAIREFYSST-ASGRSG-PDGEIEMMGSGSGNMDEA  57

Query  419   ESTLKEALSLNY---EEARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertr  589
             E +L+E+  ++    EEARALLG+ EYQ GN +AAL V++ I+I  ++ +M  ++ +   
Sbjct  58    ELSLRESGIMDIMDNEEARALLGKDEYQEGNIEAALHVYERINISAVTSKMKISLAKSRE  117

Query  590   prkprggkgeIVVSGVMSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAF  769
              RK          +  MS+++  LLLEAI LK+K L  LGR ++AA+ CK ILDIV+S+ 
Sbjct  118   HRKKHYH---YYATPPMSIYTAGLLLEAIFLKAKCLQVLGRFKEAAQTCKVILDIVESSL  174

Query  770   PNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASM  949
             P G+ +  G++ KLQE   K +E LP+LW       + + SYRRAL+  WNLDAK +A +
Sbjct  175   PEGLPQNFGDEGKLQETLSKVVELLPELWKLADSPRDVILSYRRALLHQWNLDAKTIAKI  234

Query  950   QKDLAIALLFAGVE-VDLSPRFKIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVM  1126
             QK+  + LL++G E +  + R  +  S  P+NN+EEAILLL +L+ KI   ++EWD  ++
Sbjct  235   QKEFVVFLLYSGGEAIPSNLRSHMDSSFVPRNNLEEAILLLMILLRKISLNKIEWDPSIL  294

Query  1127  DHLTFALTVVGEFESLADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGS  1306
             DHL+FAL+V G+  +LA   E++LPG   R ER++ L+LCY  AG +  ALNLLRK+  S
Sbjct  295   DHLSFALSVSGDLTTLAHQWEELLPGTINRRERYHALSLCYYGAGNDLVALNLLRKLLSS  354

Query  1307  SEAEHEP-HIPSLLLGAKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCY  1483
              E   +P H+PSLL+ +K+CS +P  +++G S A   +++   +   L S +   LGV  
Sbjct  355   RE---DPKHVPSLLMASKICSMNPDLAKDGASLACKVLENLDGRCDQLESLSSCLLGVSL  411

Query  1484  GNAAKISFSDSERNSYQTQSLNSLTQAAMLCK-EDAETVFSLGLEYATQRNLTPAFDNAL  1660
                +KI+ S+SER   Q+++L+SL  A+ + +  +   ++ L LE A QR L  A   A 
Sbjct  412   SAHSKIAISNSERVEKQSEALHSLETASKVTRMRNPPVIYYLSLECAEQRKLDVALHYAK  471

Query  1661  QYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIAR  1840
              +  + AGS  KGW LLA I+SA+++F DAE+IVD AL++TG  DQ + L+ KA LQIA+
Sbjct  472   CFLNLEAGSNIKGWLLLARILSAQKQFLDAESIVDEALNQTGIWDQGELLRTKAKLQIAQ  531

Query  1841  QHPNQAMETYRILLAMIQAQRQSGMDHEVLSD-----RKLEVEAWLDLARIYIDQDSWPD  2005
                  A+ETY  LLA++  QR++    + L       R +EVE W DLA +YI    W D
Sbjct  532   GQLKSAIETYTQLLAILLVQRKTFGSKKKLKTFVDHARNMEVEIWHDLAYVYISLSRWHD  591

Query  2006  AQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVL  2185
             A+VC+ K+K I +YS    H  G ++EA+   KEA+ AF  +LSIDP +VPS++STA VL
Sbjct  592   AEVCLSKSKAIKLYSASRCHAIGTMYEAKGLYKEAIKAFRDALSIDPGHVPSLISTAVVL  651

Query  2186  MKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTP  2365
              +  +Q+ P  RS LM+ALR +     AW++LG  +K EG+  +AAD F+ A+ L+ S P
Sbjct  652   RRCSNQSNPAIRSFLMDALRHDRFNASAWYNLGIFNKDEGTILEAADCFETANFLEESAP  711

Query  2366  VQSF  2377
             V+ F
Sbjct  712   VEPF  715



>gb|EEC69512.1| hypothetical protein OsI_38750 [Oryza sativa Indica Group]
 gb|EEE53440.1| hypothetical protein OsJ_36531 [Oryza sativa Japonica Group]
Length=645

 Score =   466 bits (1198),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 281/646 (43%), Positives = 413/646 (64%), Gaps = 12/646 (2%)
 Frame = +2

Query  458   EARALLGRLEYQRGNFDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGV  637
             EARALLGRLEYQRGN +AAL+VF GID++    R   +++E+   ++    + +   SG 
Sbjct  3     EARALLGRLEYQRGNVEAALRVFDGIDLQAAIQRFQPSLSEKPPSKRSNKLRSDSSNSG-  61

Query  638   MSLHSVSLLLEAILLKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQE  817
              S H+ SL+LEAI LKS SL  LG+  +AA++C+++LD V+S F  G+ + + E  KLQE
Sbjct  62    -SQHAASLVLEAIYLKSMSLQKLGKAVEAAQQCRSVLDAVESIFQRGIPDVMVEQ-KLQE  119

Query  818   MFHKALEFLPKLWVQEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVD  997
                K++E LP+LW Q G   EA+ SYRRAL+  WNLD      +QK  A+ LL+ GVE  
Sbjct  120   TVSKSVELLPELWKQAGAYQEALASYRRALLSQWNLDDDCCTRIQKRFAVFLLYGGVEAS  179

Query  998   LSPRF--KIWCSTPPKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFES  1171
               P    +   S  PKNN+EEAILLL +++ K   G+  WD  VM+HLTFAL++ G+   
Sbjct  180   -PPSLASQTEGSYVPKNNLEEAILLLMIILKKWYLGKTHWDPSVMEHLTFALSLCGQTSV  238

Query  1172  LADNVEQILPGMKTRAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLG  1351
             LA ++E++LPG+  R  RWY LALC  +A  NE ALNLLRK+   +E+  +  I +LLL 
Sbjct  239   LAKHLEEVLPGIYPRTGRWYSLALCNYAASHNEAALNLLRKLLNKNESPGD--IMALLLA  296

Query  1352  AKLCSQDPCKSREGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSY  1531
             AKLCS D   + EG+ +AR A+ +  + + HL S A  FLG C    ++I+ SD +R+  
Sbjct  297   AKLCSSDYSLASEGVEYARRAVTNVDSSDGHLKSAALHFLGSCLAKKSRIATSDHQRSLL  356

Query  1532  QTQSLNSLTQAAMLCKEDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLL  1711
             QT+SL SL++A  L + + + ++ +G+EYA QRN+  A   A ++ + T GS +KGW+LL
Sbjct  357   QTESLKSLSEAISLDRHNPDLIYDMGIEYAEQRNMQAALKCAKEFIDATGGSVSKGWRLL  416

Query  1712  ALIVSAEQRFSDAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMI  1891
             +L++SA+QR+S+AE + D ALDET + +Q   L++KA L++A+  P +A+E YR LLA++
Sbjct  417   SLVLSAQQRYSEAEVVTDAALDETTKWEQGPLLRIKAKLKVAQSLPMEAVEAYRALLALV  476

Query  1892  QAQRQS----GMDHEVLSDRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQS  2059
             QAQR++        E + ++  E E W  LA +Y     W DA++C+ KAK +  +S  +
Sbjct  477   QAQRKAYGTVKNGTEEVDNKVSEFEVWQGLANLYASLSYWRDAEICLQKAKALKSFSAIT  536

Query  2060  WHTTGALFEAQERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNA  2239
              H  G   E +E+ ++AL A+  ++S + ++VPS VS   +L K G + +P+ARS L +A
Sbjct  537   LHAEGYTREVREQTQDALAAYFNAVSTEVEHVPSKVSIGALLSKQGPKYLPVARSFLSDA  596

Query  2240  LRIEPTCHDAWFSLGKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             LR EPT   AWF LGK+ K +G    AAD FQAA  L+ S P++SF
Sbjct  597   LRHEPTNRMAWFYLGKVHKHDGRLADAADCFQAASMLEESDPIESF  642



>ref|XP_006293776.1| hypothetical protein CARUB_v10022752mg [Capsella rubella]
 gb|EOA26674.1| hypothetical protein CARUB_v10022752mg [Capsella rubella]
Length=704

 Score =   467 bits (1201),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 296/692 (43%), Positives = 423/692 (61%), Gaps = 19/692 (3%)
 Frame = +2

Query  329   RDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFD  508
             R   A+G+      T + E++ +E  + E ES+L+E LSLN+EEARALLGRLEYQRGN +
Sbjct  19    RQLCANGIC---MKTTEVEAKLDEGNIQEAESSLREGLSLNFEEARALLGRLEYQRGNLE  75

Query  509   AALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKS  688
              AL+VF+GID++    R+  ++       K    +       ++S H+ +L+LEAI LK+
Sbjct  76    GALRVFEGIDLQAAIQRLQVSVPPEKPATKKNRPREP---QQLVSQHAANLVLEAIYLKA  132

Query  689   KSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEG  868
             KSL  LGRI +AA EC+++LD V+  F  G+ +    D KLQE    A+E LP LW + G
Sbjct  133   KSLQKLGRITEAAHECRSVLDSVEKIFQQGIPD-AQVDNKLQETVSHAVELLPALWKESG  191

Query  869   LIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPKN  1042
                EA+ +YRRAL+  WNLD    A +QKD A+ LL +GVE    P    +I  S  P+N
Sbjct  192   DYQEAIAAYRRALLSQWNLDNDCCARIQKDFAVFLLHSGVEAS-PPSLGSQIEGSYIPRN  250

Query  1043  NMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAE  1222
             N+EEAILLL +L+ K   G+ +WD  V +HLTFAL++  +   LA  +E+++PG+ +R E
Sbjct  251   NLEEAILLLMILLKKFNLGKAKWDPSVFEHLTFALSLCSQTSVLAKQLEEVMPGVFSRIE  310

Query  1223  RWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISF  1402
             RW  LAL YS+AGQN  A+NLLRK     + E    + +LLL AKLCS++P  + EG  +
Sbjct  311   RWNTLALSYSAAGQNSAAVNLLRK--SLHKHEQPDDLVALLLAAKLCSEEPSLAAEGSGY  368

Query  1403  ARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKE  1582
             A+ A+++    ++HL     + LG+C G  AK+  SD ER+  Q++SL +L  A      
Sbjct  369   AQRAINNAQGMDEHLKGVGLRMLGLCLGKQAKVPTSDFERSRLQSESLKALDGAIAFEHN  428

Query  1583  DAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIV  1762
             + + +F LG++YA QRNL  A   A ++ + T GS  KGW+ LAL++SA+QRFS+AE + 
Sbjct  429   NPDLIFELGVQYAEQRNLKAASRYAKEFIDATGGSVLKGWRFLALVLSAQQRFSEAEVVT  488

Query  1763  DLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQSGMDHEVLS---  1933
             D ALDET + DQ   L+LKA L+I++ +P +A+ETYR LLA++QAQR+S      LS   
Sbjct  489   DAALDETAKWDQGPLLRLKAKLKISQSNPTEAVETYRYLLALVQAQRKSFGPLRTLSQME  548

Query  1934  -DRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEA  2110
              D+  E E W  LA +Y     W D +VC+ KA  +  YS    HT G ++E ++  K A
Sbjct  549   EDKVNEFEVWHGLAYLYSSLSHWNDVEVCLKKAGELKQYSASMLHTEGRMWEGRKEFKAA  608

Query  2111  LVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQ---AVPIARSLLMNALRIEPTCHDAWFSL  2281
             L AF   L +D   VP  V+   +L + G      +P+ARSLL +ALRI+PT   AW+ L
Sbjct  609   LAAFLDGLLLDGSSVPCKVAVGALLSERGKDHQPTLPVARSLLSDALRIDPTNRKAWYYL  668

Query  2282  GKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             G + K +G    A D FQAA  L+ S P++SF
Sbjct  669   GMVHKSDGRIADATDCFQAASMLEESDPIESF  700



>ref|XP_010508476.1| PREDICTED: uncharacterized protein LOC104785053 [Camelina sativa]
 ref|XP_010508477.1| PREDICTED: uncharacterized protein LOC104785053 [Camelina sativa]
Length=704

 Score =   466 bits (1200),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 294/692 (42%), Positives = 426/692 (62%), Gaps = 19/692 (3%)
 Frame = +2

Query  329   RDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFD  508
             R   A+G+      T++ E++ +E  + E E++L+E LSLN+EEAR+LLGRLEYQRGN +
Sbjct  19    RQLCANGIC---IKTSEVEAKLDEGNIQEAETSLREGLSLNFEEARSLLGRLEYQRGNLE  75

Query  509   AALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKS  688
              AL+VF+GID++    R+  ++       K    +       ++S H+ +L+LEAI LK+
Sbjct  76    GALRVFEGIDLQAAIQRLQVSVPPEKPATKKNRPREP---QQLVSQHAANLVLEAIYLKA  132

Query  689   KSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEG  868
             KSL  LGRI +AA EC+++LD V+  F  G+ +    D KLQE   +A+E LP LW + G
Sbjct  133   KSLQKLGRITEAAHECRSVLDSVEKIFQQGIPD-AQVDNKLQETVSRAVELLPALWKECG  191

Query  869   LIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPKN  1042
                EA++SYRRAL+  WNLD    A +QKD A+ LL +GVE    P    ++  S  P+N
Sbjct  192   DYQEAISSYRRALLSQWNLDNDCCARIQKDFAVFLLHSGVEAS-PPSLGSQMEGSYIPRN  250

Query  1043  NMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAE  1222
             N+EEAILLL +L+ K   G+ +WD  V +HLTFAL++  +   LA  +E+++PG+ +R E
Sbjct  251   NLEEAILLLMILLKKFNLGKAKWDPSVFEHLTFALSLCSQTSVLAKQLEEVMPGVYSRIE  310

Query  1223  RWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISF  1402
             RW  LAL YS+AGQN  A+NLLRK     + E    + +LLL AKLCS++P  + EG  +
Sbjct  311   RWNTLALSYSAAGQNSAAVNLLRK--SLHKHEQPDDLVALLLAAKLCSEEPSLAAEGSGY  368

Query  1403  ARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKE  1582
             A+ A+++    ++HL     + LG+C G  AK+  SD ER+  Q++SL +L  A      
Sbjct  369   AQRAINNAEGMDEHLKGVGLRMLGLCLGKQAKVPTSDFERSRLQSESLKALDGAIAFEHN  428

Query  1583  DAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIV  1762
             + + +F LG++YA QRNL  A   A ++ + T GS  KGW+ LAL++SA+QRFS+AE + 
Sbjct  429   NPDLIFELGVQYAEQRNLKAASRYAKEFIDATGGSVLKGWRFLALVLSAQQRFSEAEVVT  488

Query  1763  DLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQSGMDHEVLS---  1933
             D ALDET + DQ   L+LKA L+I++ +P +A+ETYR LLA++QAQR+S      LS   
Sbjct  489   DAALDETAKWDQGPLLRLKAKLKISQSNPTEAVETYRYLLALVQAQRKSFGPLRTLSQME  548

Query  1934  -DRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEA  2110
              D+  E E W  LA +Y     W D +VC+ KA  +  YS    HT G ++E ++  K A
Sbjct  549   EDKVNEFEVWHGLAYLYSSLSHWNDVEVCLKKAGELKQYSASMLHTEGRMWEGRKEFKPA  608

Query  2111  LVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQ---AVPIARSLLMNALRIEPTCHDAWFSL  2281
             L AF   L +D   VP  V+   +L + G      +P+ARSLL +ALRI+PT   AW+ L
Sbjct  609   LAAFLDGLLLDGSSVPCKVAVGALLSERGKDHQPTLPVARSLLSDALRIDPTNRKAWYYL  668

Query  2282  GKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             G + K +G    A D FQAA  L+ S P++SF
Sbjct  669   GMVHKSDGRIADATDCFQAASMLEESDPIESF  700



>ref|XP_010506159.1| PREDICTED: uncharacterized protein LOC104782817 [Camelina sativa]
Length=704

 Score =   466 bits (1200),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 295/692 (43%), Positives = 425/692 (61%), Gaps = 19/692 (3%)
 Frame = +2

Query  329   RDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFD  508
             R   A+G+      T++ E++ +E  + E E++L+E LSLN+EEARALLGRLEYQRGN +
Sbjct  19    RQLCANGIC---IKTSEVEAKLDEGNIQEAETSLREGLSLNFEEARALLGRLEYQRGNLE  75

Query  509   AALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKS  688
              AL+VF+GID++    R+  ++       K    +       ++S H+ +L+LEAI LK+
Sbjct  76    GALRVFEGIDLQAAIQRLQVSVPPEKPATKKNRPREP---QQLVSQHAANLVLEAIYLKA  132

Query  689   KSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEG  868
             KSL  LGRI +AA EC+++LD V+  F  G+ +    D KLQE    A+E LP LW + G
Sbjct  133   KSLQKLGRITEAAHECRSVLDSVEKIFQQGIPD-AQVDNKLQETVSHAVELLPALWKECG  191

Query  869   LIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPKN  1042
                EA++SYRRAL+  WNLD    A +QKD A+ LL +GVE    P    ++  S  P+N
Sbjct  192   DYQEAISSYRRALLSQWNLDNDCCARIQKDFAVFLLHSGVEAS-PPSLGSQMEGSYIPRN  250

Query  1043  NMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAE  1222
             N+EEAILLL +L+ K   G+ +WD  V +HLTFAL++  +   LA  +E+++PG+ +R E
Sbjct  251   NLEEAILLLMILLKKFNLGKAKWDPSVFEHLTFALSLCSQTSVLAKQLEEVMPGVYSRIE  310

Query  1223  RWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISF  1402
             RW  LAL YS+AGQN  A+NLLRK     + E    + +LLL AKLCS++P  + EG  +
Sbjct  311   RWNTLALSYSAAGQNSAAINLLRK--SLHKHEQPDDLVALLLAAKLCSEEPSLAAEGSGY  368

Query  1403  ARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKE  1582
             A+ A+++    ++HL     + LG+C G  AK+  SD ER+  Q++SL +L  A      
Sbjct  369   AQRAINNAQGMDEHLKGVGLRMLGLCLGKQAKVPTSDFERSRLQSESLKALDGAIAFEHN  428

Query  1583  DAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIV  1762
             + + +F LG++YA QRNL  A   A ++ + T GS  KGW+ LAL++SA+QRFS+AE + 
Sbjct  429   NPDLIFELGVQYAEQRNLKAASRYAKEFIDATGGSVLKGWRFLALVLSAQQRFSEAEVVT  488

Query  1763  DLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQSGMDHEVLS---  1933
             D ALDET + DQ   L+LKA L+I++ +P +A+ETYR LLA++QAQR+S      LS   
Sbjct  489   DAALDETAKWDQGPLLRLKAKLKISQSNPTEAVETYRYLLALVQAQRKSFGPLRTLSQME  548

Query  1934  -DRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEA  2110
              D+  E E W  LA +Y     W D +VC+ KA  +  YS    HT G ++E ++  K A
Sbjct  549   EDKVNEFEVWHGLAYLYSSLSHWNDVEVCLKKAGELKQYSASMLHTEGRMWEGRKEFKPA  608

Query  2111  LVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQ---AVPIARSLLMNALRIEPTCHDAWFSL  2281
             L AF   L +D   VP  V+   +L + G      +P+ARSLL +ALRI+PT   AW+ L
Sbjct  609   LAAFLDGLLLDGSSVPCKVAVGALLSERGKDHQPTLPVARSLLSDALRIDPTNRKAWYYL  668

Query  2282  GKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             G + K +G    A D FQAA  L+ S P++SF
Sbjct  669   GMVHKSDGRIADATDCFQAASMLEESDPIESF  700



>ref|XP_010517856.1| PREDICTED: uncharacterized protein LOC104793234 [Camelina sativa]
Length=704

 Score =   466 bits (1199),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 295/692 (43%), Positives = 425/692 (61%), Gaps = 19/692 (3%)
 Frame = +2

Query  329   RDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFD  508
             R   A+G+      T++ E++ +E  + E E++L+E LSLN+EEARALLGRLEYQRGN +
Sbjct  19    RQLCANGIC---IKTSEVEAKLDEGNIQEAETSLREGLSLNFEEARALLGRLEYQRGNLE  75

Query  509   AALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKS  688
              AL+VF+GID++    R+  ++       K    +       ++S H+ +L+LEAI LK+
Sbjct  76    GALRVFEGIDLQAAIQRLQVSVPPEKPATKKNRPREP---QQLVSQHAANLVLEAIYLKA  132

Query  689   KSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEG  868
             KSL  LGRI +AA EC+++LD V+  F  G+ +    D KLQE    A+E LP LW + G
Sbjct  133   KSLQKLGRITEAAHECRSVLDSVEKIFQQGIPD-AQVDNKLQETVSHAVELLPALWKECG  191

Query  869   LIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPKN  1042
                EA++SYRRAL+  WNLD    A +QKD A+ LL +GVE    P    ++  S  P+N
Sbjct  192   DYQEAISSYRRALLSQWNLDNDCCARIQKDFAVFLLHSGVEAS-PPSLGSQMEGSYIPRN  250

Query  1043  NMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAE  1222
             N+EEAILLL +L+ K   G+ +WD  V +HLTFAL++  +   LA  +E+++PG+ +R E
Sbjct  251   NLEEAILLLMILLKKFNLGKAKWDPSVFEHLTFALSLCSQTSVLAKQLEEVMPGVYSRIE  310

Query  1223  RWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGISF  1402
             RW  LAL YS+AGQN  A+NLLRK     + E    + +LLL AKLCS++P  + EG  +
Sbjct  311   RWNTLALSYSAAGQNSAAVNLLRK--SLHKHEQPDDLVALLLAAKLCSEEPSLAAEGSGY  368

Query  1403  ARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCKE  1582
             A+ A+++    ++HL     + LG+C G  AK+  SD ER+  Q++SL +L  A      
Sbjct  369   AQRAINNAQGMDEHLKGVGLRMLGLCLGKQAKVPTSDFERSRLQSESLKALDGAIAFEHN  428

Query  1583  DAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAIV  1762
             + + +F LG++YA QRNL  A   A ++ + T GS  KGW+ LAL++SA+QRFS+AE + 
Sbjct  429   NPDLIFELGVQYAEQRNLKAASRYAKEFIDATGGSVLKGWRFLALVLSAQQRFSEAEVVT  488

Query  1763  DLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQSGMDHEVLS---  1933
             D ALDET + DQ   L+LKA L+I++ +P +A+ETYR LLA++QAQR+S      LS   
Sbjct  489   DAALDETAKWDQGFLLRLKAKLKISQSNPTEAVETYRYLLALVQAQRKSFGPLRTLSQME  548

Query  1934  -DRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKEA  2110
              D+  E E W  LA +Y     W D +VC+ KA  +  YS    HT G ++E ++  K A
Sbjct  549   EDKVNEFEVWHGLAYLYSSLSHWNDVEVCLKKAGELKQYSASMLHTEGRMWEGRKEFKPA  608

Query  2111  LVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQ---AVPIARSLLMNALRIEPTCHDAWFSL  2281
             L AF   L +D   VP  V+   +L + G      +P+ARSLL +ALRI+PT   AW+ L
Sbjct  609   LAAFLDGLLLDGSSVPCKVAVGALLSERGKDHQPTLPVARSLLSDALRIDPTNRKAWYYL  668

Query  2282  GKLSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             G + K +G    A D FQAA  L+ S P++SF
Sbjct  669   GMVHKSDGRIADATDCFQAASMLEESDPIESF  700



>ref|XP_004247514.1| PREDICTED: tetratricopeptide repeat protein 7A isoform X2 [Solanum 
lycopersicum]
Length=709

 Score =   466 bits (1199),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 283/672 (42%), Positives = 416/672 (62%), Gaps = 21/672 (3%)
 Frame = +2

Query  320   LATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRG  499
             LAT+D ++S + S R G +    + +   ++E ES+L+E+  LNYEEARALLGR EYQ+G
Sbjct  22    LATKDHTSS-VHSLRAGESG--QKPDTGNIEEAESSLRESGCLNYEEARALLGRYEYQKG  78

Query  500   NFDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAIL  679
             N ++AL VF+GIDI +++P++  A+ ER + +K R        +  +S+++VSLLLEA+ 
Sbjct  79    NIESALHVFEGIDIASVTPKLKLALAERVQTQKRRSRSFS---TPPLSINAVSLLLEAVF  135

Query  680   LKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWV  859
             LK+KSL  L R ++AA+ C  +LDI++S+ P G+ E    DCKLQ+  +K +E LP+L  
Sbjct  136   LKAKSLQALQRYKEAAQSCTVVLDILESSLPAGLPETFATDCKLQDTLNKTVELLPELCK  195

Query  860   QEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTP  1033
                   EA+ SYRRAL+  WNLD +  A +QK+ AI LL++G E    P    ++  S  
Sbjct  196   LADAPREAIMSYRRALLHQWNLDIQTTAKIQKEFAIFLLYSGGE-SCPPNLQSQMDGSFV  254

Query  1034  PKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKT  1213
             P+NN+EEAILLL +L+ KI    +EWD  ++DHL++A ++ G  ++LA  VE++LP    
Sbjct  255   PRNNIEEAILLLMILLRKISLQRIEWDPSILDHLSYAFSISGGLKTLASKVEELLPRTID  314

Query  1214  RAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHI--PSLLLGAKLCSQDPCKSR  1387
             R E++  LALCY   G + TALNLLRK+  S+    E HI  P LLL +K+C++ P  + 
Sbjct  315   RQEKYLILALCYYGGGDDFTALNLLRKLWRST----EDHICVPGLLLASKVCAESPDCAS  370

Query  1388  EGISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAA  1567
             EGI +A  A++    +  HLL  A   LG+     ++   +DSER    + +L S   A 
Sbjct  371   EGIIYAHRAIERLQERCSHLLGVANCVLGLSLTAHSRTVLTDSERVKIHSDALKSFESAG  430

Query  1568  MLCK-EDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFS  1744
              L K  D   ++ L LE A QR L  A   A  + ++  GST KG  LLA ++SA++RF 
Sbjct  431   KLTKMSDTNVIYHLCLENAEQRKLDVAVHYANWFLKLEGGSTLKGSMLLARVLSAQKRFL  490

Query  1745  DAEAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQS---GM  1915
             DAE I+++AL+++G+ D  + L+ KA LQIA+     A+ETY  +LA++Q QR+S   G 
Sbjct  491   DAETIINVALEQSGKWDHGELLRTKAKLQIAQGQVKNAIETYTQILAILQVQRRSFGLGE  550

Query  1916  DHEVLSD--RKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEA  2089
             D E   D  R LE+E WLDLA IYI    W DA+ C+ K +TI  YS    +T G L ++
Sbjct  551   DLEESGDHCRTLELETWLDLASIYIKLSQWRDAEKCLSKTETISSYSACRLYTAGLLNQS  610

Query  2090  QERCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDA  2269
             +   K AL  +S +L+++P +VPS+VS+A V MK+G Q+  I RSLL  ALR++     A
Sbjct  611   KGLYKAALGDYSNALAVNPSHVPSLVSSAVVFMKIGKQSPAIIRSLLTEALRLDRMNASA  670

Query  2270  WFSLGKLSKMEG  2305
             W++LG L K  G
Sbjct  671   WYNLGLLYKEGG  682



>ref|XP_002300857.1| NO POLLEN GERMINATION 1 family protein [Populus trichocarpa]
 gb|EEE80130.1| NO POLLEN GERMINATION 1 family protein [Populus trichocarpa]
Length=686

 Score =   465 bits (1197),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 292/690 (42%), Positives = 422/690 (61%), Gaps = 31/690 (4%)
 Frame = +2

Query  326   TRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNF  505
             +R+  A+G+      T++ E++ +E  + E ES+L+E LSLN+EEARALLGRLEYQRGN 
Sbjct  18    SREVWANGIC---MKTSEVEAKLDEGNIQEAESSLREGLSLNFEEARALLGRLEYQRGNV  74

Query  506   DAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLK  685
             +AAL VF GID++    R+  + +E+   RK R           +S HS SL+LEAI LK
Sbjct  75    EAALHVFDGIDLQVAIQRLQPSFSEKQPSRKGRSRGDS---QHAVSQHSASLVLEAIYLK  131

Query  686   SKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQE  865
             +KSL  LGR+ DAA ECK +LD V+  F  G+ + V  D +LQ+   +A+E LP+LW Q 
Sbjct  132   AKSLQKLGRLNDAAHECKRVLDAVEKIFHQGIPD-VQVDNRLQDTVRQAVELLPELWKQA  190

Query  866   GLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTPPK  1039
             G   EA+++YRRAL+  WNLD    + +QK  A+ L+ +GVE    P    ++  S  PK
Sbjct  191   GCYHEAMSAYRRALLSQWNLDDDNCSRIQKAFAVFLMHSGVEAG-PPSLAAQVDGSYVPK  249

Query  1040  NNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRA  1219
             +N+EEAILLL +L+ K   G++ WD  V++HLTFAL++ G+   LA  +E+I+PG+  R 
Sbjct  250   HNLEEAILLLMILVRKFYLGKIVWDPSVLEHLTFALSLCGQTFVLAKELEEIMPGVFHRV  309

Query  1220  ERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREGIS  1399
             +RW  LALCYS+ GQN+ ALNLLRK     + E    + +LLL AK+CS+D   + EG+ 
Sbjct  310   DRWNTLALCYSAVGQNKAALNLLRK--SLHKHEQPDDLIALLLAAKICSEDCHLAAEGVG  367

Query  1400  FARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCK  1579
             +A+ A+ +   +N+HL   A + LG+C G  A  S SD ER+  Q+++L  L  A  L K
Sbjct  368   YAQRAITNAQGRNEHLKGVAIRMLGLCSGKQATTSPSDFERSRLQSEALKLLDAAISLEK  427

Query  1580  EDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEAI  1759
              + + +F LG+ YA QRNL  A   A ++ + T GS  KGW+LLA I+SA+QRFS+AE +
Sbjct  428   NNPDLLFELGMLYAEQRNLNTALRYAKRFIDATGGSLLKGWRLLAQILSAQQRFSEAEVV  487

Query  1760  VDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQSGMDHEVLS--  1933
             +D ALDET + +Q   L+LKA L+ ++  P  A+ETYR LLA++QAQR+S      +S  
Sbjct  488   IDAALDETAKWEQGPLLRLKAKLKTSQSLPMDAIETYRYLLALVQAQRKSFGPLRSVSQA  547

Query  1934  --DRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQERCKE  2107
               DR  E E W  LA +Y     W D +VC+ KA+ +  YS            A+  C +
Sbjct  548   GDDRVNEYEVWHGLADLYSRLSHWKDMEVCLGKARELKQYS------------AEVLCSK  595

Query  2108  ALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWFSLGK  2287
              +          P +V   +    +L K  S A+P+ARS+L +AL+IEPT   AW+ LG 
Sbjct  596   DVDKLKKPY---PSFVRCKILIGALLSKRDSNALPVARSILSDALKIEPTNRMAWYYLGI  652

Query  2288  LSKMEGSaqqaadffqaaHELKLSTPVQSF  2377
             + +++G    AAD FQAA  L+ S P+++F
Sbjct  653   IHRVDGRIADAADCFQAASMLEESDPIENF  682



>ref|XP_006367232.1| PREDICTED: tetratricopeptide repeat protein 7A-like isoform X2 
[Solanum tuberosum]
Length=709

 Score =   466 bits (1198),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 282/670 (42%), Positives = 417/670 (62%), Gaps = 17/670 (3%)
 Frame = +2

Query  320   LATRDFSASGLSSSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRG  499
             LAT+D ++S + SSR G A    + +   ++E ES+L+E+  LNYEEARALLGR EYQ+G
Sbjct  22    LATKDHTSS-VRSSRAGEAG--QKPDTGNIEEAESSLRESGCLNYEEARALLGRYEYQKG  78

Query  500   NFDAALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAIL  679
             N +A+L VF+GIDI +++P++  A+ ER + +K R        +  +S+++ SLLLEA+ 
Sbjct  79    NIEASLHVFEGIDIASVTPKLKLALAERVQTQKRRSRSFS---TPPLSINAASLLLEAVF  135

Query  680   LKSKSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWV  859
             LK+KSL  L R ++AA+ C  +LDI++S+ P G+ E    DCKLQ+  +KA+E LP+L  
Sbjct  136   LKAKSLQALQRYKEAAQSCTVLLDILESSLPAGLPETFATDCKLQDTLNKAVELLPELCK  195

Query  860   QEGLIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSPRF--KIWCSTP  1033
                   EA+ +YRRAL+  WNLD +  A +QK+ AI LL++G E    P    ++  S  
Sbjct  196   LADAPQEAIMAYRRALLHQWNLDIQTTAKIQKEFAIFLLYSGGE-SCPPNLQSQMDGSFV  254

Query  1034  PKNNMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKT  1213
             P+NN+EEAILLL +L+ KI    +EWD  ++DHL++AL++ G  ++LA  VE++LP    
Sbjct  255   PRNNIEEAILLLMILLRKISLQRIEWDPSILDHLSYALSISGGLKTLARKVEELLPRTID  314

Query  1214  RAERWYFLALCYSSAGQNETALNLLRKVSGSSEAEHEPHIPSLLLGAKLCSQDPCKSREG  1393
             R E    LALCY   G + TALNLLRK+  S+E +H   +PSLLL +K+C++ P  + EG
Sbjct  315   RQEMSLILALCYYGGGDDFTALNLLRKLLSSTE-DH-TCVPSLLLASKVCAESPDCASEG  372

Query  1394  ISFARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAML  1573
             I +A  A++    +  HLL  A   LG+     ++   +DSER    + +L S   A  L
Sbjct  373   IIYAHKAIERLQERCSHLLGVANCVLGLSLTAHSRTVLTDSERVKIHSDALKSFESAGKL  432

Query  1574  CK-EDAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDA  1750
              K  D   ++ L LE A QR L  A   A  + ++  GST KG  LLA ++SA++RF DA
Sbjct  433   TKMSDTNVIYHLCLENAEQRKLDVAVHYANWFLKLEGGSTLKGSMLLARVLSAQKRFLDA  492

Query  1751  EAIVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQS---GMDH  1921
             E ++++AL+++G+ D  + L+ KA LQIA+     A+ETY  +LA++Q QR+S   G D 
Sbjct  493   ETVINVALEQSGKWDHGELLRTKAKLQIAQGQVKNAIETYTQILAILQVQRKSFRLGEDL  552

Query  1922  EVLSD--RKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQE  2095
             +   D  R LE+E WLDLA IYI    W DA+ C+ K + I  YS    +T G L +++ 
Sbjct  553   KEFGDHCRTLELETWLDLASIYIKLSQWRDAEKCLSKTEAISSYSACRLYTAGLLNQSKG  612

Query  2096  RCKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVPIARSLLMNALRIEPTCHDAWF  2275
               K AL  +S +L+++P +VPS+VS+A VL K+G Q+  I RSLL  ALR++     AW+
Sbjct  613   LYKAALGDYSNALAVNPSHVPSLVSSAVVLRKIGKQSPAIIRSLLTEALRLDRMNASAWY  672

Query  2276  SLGKLSKMEG  2305
             +LG L K  G
Sbjct  673   NLGLLYKEGG  682



>ref|XP_003590809.1| Tetratricopeptide repeat protein 7B [Medicago truncatula]
 gb|AES61060.1| TPR 7B-like protein [Medicago truncatula]
Length=745

 Score =   466 bits (1200),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 300/727 (41%), Positives = 450/727 (62%), Gaps = 31/727 (4%)
 Frame = +2

Query  167   ISWT*V*TENSIKLAFLTGRAH--CRR--RKML-CACSGEQFKFeepepapqspesLATR  331
             IS+  V +E+S++   L  +     RR  RKM+ C CS E+   +E   + +S   LATR
Sbjct  3     ISFCLVGSESSMRAKSLISKKKFSIRRELRKMIKCVCSKEKLSVDELNYSSES---LATR  59

Query  332   DFSASGLS-SSRTGTADWESRFEEAQVDEVESTLKEALSLNYEEARALLGRLEYQRGNFD  508
             D+SA+    SSR G  D  ++ + + ++E ES+L+E+  LNYEEARALLGRLEYQ+GN +
Sbjct  60    DYSATASGYSSRPGEND--TKLDNSNIEEAESSLRESGYLNYEEARALLGRLEYQKGNIE  117

Query  509   AALQVFQGIDIKTLSPRMSKAItertrprkprggkgeIVVSGVMSLHSVSLLLEAILLKS  688
             AAL VF+GIDI  + P+M  +I+ +      R  + + V S  MS+H+VSLLLEA  LK+
Sbjct  118   AALHVFEGIDIAAVIPKMKMSISRKCESNNKRSPQRDSVPS--MSIHAVSLLLEAFFLKA  175

Query  689   KSLAGLGRIRDAARECKAILDIVDSAFPNGMSEGVGEDCKLQEMFHKALEFLPKLWVQEG  868
             KSL  LGR ++AA+ CK ILD V+SA P G  E    DCKLQE+   ++E LP+LW   G
Sbjct  176   KSLQTLGRFQEAAQSCKTILDTVESALPEGWPENFVSDCKLQEIVTNSVELLPELWNLAG  235

Query  869   LIDEAVNSYRRALVKPWNLDAKRLASMQKDLAIALLFAGVEVDLSP--RFKIWCSTPPKN  1042
                + + S+R+AL+  WNLD +  A +QK+ A+ LL++G E D SP  R ++  S  P+N
Sbjct  236   SPQDVILSFRKALLYHWNLDTESTARIQKEFALFLLYSGYEAD-SPSLRSQLNGSFVPRN  294

Query  1043  NMEEAILLLFVLMGKIQQGEVEWDSEVMDHLTFALTVVGEFESLADNVEQILPGMKTRAE  1222
             N+EEA+LLL +L+   +      D  ++ HL+FAL+V GEF +LA  VE++LP    R E
Sbjct  295   NIEEAVLLLLILLRNSK------DRSIIHHLSFALSVCGEFMTLAQQVEELLPETMERRE  348

Query  1223  RWYFLALCYSSAGQNETALNLLRKVSGSSE-AEHEPHIPSLLLGAKLCSQDPCKSREGIS  1399
             R+Y LALCY   G++  AL+LLR +  + E + +   I  LLL +K+C+ +     +GI 
Sbjct  349   RYYTLALCYCGKGEHIVALDLLRNLLKNRENSVYSDCIEELLLASKICADNKVCIEDGIK  408

Query  1400  FARGAMDSTVNQNKHLLSQARKFLGVCYGNAAKISFSDSERNSYQTQSLNSLTQAAMLCK  1579
             F+  A+     +   + + A   LGV     +K   S+SE+   Q+Q+ ++L  +  L K
Sbjct  409   FSSKAISQMHGKCNQIEAIANCLLGVLLSAKSKSVTSESEKVLIQSQAFSALKASEKLMK  468

Query  1580  E-DAETVFSLGLEYATQRNLTPAFDNALQYSEMTAGSTAKGWKLLALIVSAEQRFSDAEA  1756
             E D   V +L LEYA  R L  A+D+A +  ++  GS+  G+ LLA I+SA+++F DAE 
Sbjct  469   ENDPYIVLNLCLEYAEHRKLRIAYDHAKKLIKLEGGSSISGYILLARILSAQKKFVDAEI  528

Query  1757  IVDLALDETGQIDqlqflklkaalqIARQHPNQAMETYRILLAMIQAQRQS-GMDHEVLS  1933
             ++D ALD++G+ DQ + L+ KA +QIA+     A+ETY   LA++Q   ++ G  ++V+ 
Sbjct  529   VIDAALDQSGKWDQGELLRTKAKIQIAQGRLKNAIETYTFFLAILQVHNKNLGTANKVMK  588

Query  1934  -----DRKLEVEAWLDLARIYIDQDSWPDAQVCIDKAKTIDIYSPQSWHTTGALFEAQER  2098
                  DR+LEVE W DLA +Y     W DA++C+ K++ ID YS    H+TG L EA+  
Sbjct  589   CKRNRDRRLEVEVWHDLANVYTALSRWHDAEICLAKSQAIDPYSASRLHSTGLLNEARGL  648

Query  2099  CKEALVAFSFSLSIDPDYVPSIVSTAEVLMKMGSQAVP-IARSLLMNALRIEPTCHDAWF  2275
              +EAL ++  +L I+P++V S++STA VL K+G Q+   I RSLL +AL+++ T   AW+
Sbjct  649   HQEALKSYKKALDIEPNHVASLISTACVLRKLGGQSSSLIVRSLLTDALKLDTTNSSAWY  708

Query  2276  SLGKLSK  2296
             +LG L K
Sbjct  709   NLGLLYK  715



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8119679108800