BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c28806_g1_i1 len=1360 path=[1338:0-1359]

Length=1360
                                                                      Score     E

ref|XP_006364285.1|  PREDICTED: bark storage protein A-like             532   0.0      
ref|XP_006364286.1|  PREDICTED: bark storage protein A-like isofo...    529   0.0      
ref|XP_010325109.1|  PREDICTED: bark storage protein A                  529   0.0      
emb|CDP16182.1|  unnamed protein product                                523   0.0      
ref|XP_009596122.1|  PREDICTED: bark storage protein A                  517   4e-179   
ref|XP_002283985.1|  PREDICTED: bark storage protein A                  496   9e-171   Vitis vinifera
emb|CBI20868.3|  unnamed protein product                                490   8e-169   
gb|KDP34190.1|  hypothetical protein JCGZ_07761                         486   8e-167   
gb|EYU20446.1|  hypothetical protein MIMGU_mgv1a009063mg                473   6e-162   
ref|XP_010049098.1|  PREDICTED: bark storage protein A-like             471   4e-161   
gb|KCW81555.1|  hypothetical protein EUGRSUZ_C02911                     471   3e-160   
ref|XP_008393885.1|  PREDICTED: bark storage protein A-like             466   4e-159   
ref|XP_009367890.1|  PREDICTED: bark storage protein A-like isofo...    462   1e-157   
ref|XP_009367887.1|  PREDICTED: bark storage protein A-like isofo...    462   3e-157   
ref|XP_010049097.1|  PREDICTED: bark storage protein A-like             461   5e-157   
ref|XP_008220066.1|  PREDICTED: bark storage protein A-like             459   5e-156   
ref|XP_008367689.1|  PREDICTED: bark storage protein A-like isofo...    457   2e-155   
ref|XP_004292852.1|  PREDICTED: uncharacterized protein LOC101304070    468   4e-155   
ref|XP_002516547.1|  mta/sah nucleosidase, putative                     454   2e-154   Ricinus communis
ref|XP_008393883.1|  PREDICTED: bark storage protein A-like             454   3e-154   
ref|XP_008367691.1|  PREDICTED: bark storage protein A-like isofo...    451   7e-154   
ref|XP_008352016.1|  PREDICTED: bark storage protein A-like isofo...    451   3e-153   
ref|XP_008352018.1|  PREDICTED: bark storage protein A-like isofo...    451   3e-153   
ref|XP_009367888.1|  PREDICTED: bark storage protein A-like isofo...    449   2e-152   
ref|XP_010049099.1|  PREDICTED: bark storage protein A-like             447   6e-152   
ref|XP_006833372.1|  hypothetical protein AMTR_s00109p00105850          446   4e-151   
ref|XP_009367891.1|  PREDICTED: bark storage protein A-like isofo...    444   8e-151   
gb|KHN18182.1|  Bark storage protein A                                  443   5e-150   
ref|XP_010668210.1|  PREDICTED: bark storage protein B-like             441   4e-149   
ref|NP_001276232.1|  bark storage protein A-like                        438   6e-148   
ref|XP_010668205.1|  PREDICTED: bark storage protein B-like             437   1e-147   
ref|XP_007012101.1|  Phosphorylase superfamily protein isoform 1        437   1e-147   
gb|KEH36049.1|  bark storage-like protein                               434   3e-146   
gb|KEH36051.1|  bark storage-like protein                               433   3e-146   
ref|XP_010668197.1|  PREDICTED: bark storage protein A-like             431   1e-145   
ref|XP_008220062.1|  PREDICTED: bark storage protein A-like             431   4e-145   
ref|XP_007224794.1|  hypothetical protein PRUPE_ppa023740mg             426   3e-144   
ref|XP_007137203.1|  hypothetical protein PHAVU_009G108300g             424   5e-142   
ref|XP_003636438.1|  5'-methylthioadenosine/S-adenosylhomocystein...    435   1e-141   
gb|ABR16427.1|  unknown                                                 420   5e-141   Picea sitchensis
ref|XP_010254051.1|  PREDICTED: bark storage protein A                  416   3e-139   
gb|KCW81554.1|  hypothetical protein EUGRSUZ_C029101                    411   1e-138   
emb|CBI28039.3|  unnamed protein product                                412   2e-138   
ref|XP_002280745.2|  PREDICTED: bark storage protein A                  412   4e-138   Vitis vinifera
gb|KDP33702.1|  hypothetical protein JCGZ_07273                         407   6e-136   
ref|XP_010100640.1|  Bark storage protein A                             407   7e-136   
ref|XP_006381729.1|  nucleosidase-related family protein                402   4e-134   
ref|XP_007013111.1|  Phosphorylase superfamily protein                  402   5e-134   
ref|XP_011012465.1|  PREDICTED: bark storage protein A isoform X1       400   5e-133   
ref|XP_007204522.1|  hypothetical protein PRUPE_ppa018203mg             399   7e-133   
ref|XP_009352502.1|  PREDICTED: bark storage protein A                  399   8e-133   
ref|XP_010438369.1|  PREDICTED: bark storage protein A-like             399   8e-133   
ref|XP_006284040.1|  hypothetical protein CARUB_v10005161mg             398   2e-132   
ref|XP_008242572.1|  PREDICTED: bark storage protein A                  398   2e-132   
ref|NP_194623.2|  phosphorylase superfamily protein                     398   2e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008352307.1|  PREDICTED: bark storage protein A-like             397   4e-132   
ref|XP_004142512.1|  PREDICTED: bark storage protein A-like             397   5e-132   
ref|XP_002869463.1|  hypothetical protein ARALYDRAFT_491863             397   5e-132   
ref|NP_001148584.1|  LOC100282200                                       397   1e-131   Zea mays [maize]
ref|XP_010447907.1|  PREDICTED: bark storage protein A-like             396   2e-131   
ref|XP_010049662.1|  PREDICTED: bark storage protein A-like             392   3e-130   
dbj|BAJ86281.1|  predicted protein                                      391   2e-129   
ref|XP_002454890.1|  hypothetical protein SORBIDRAFT_03g000850          391   2e-129   Sorghum bicolor [broomcorn]
ref|XP_002454891.1|  hypothetical protein SORBIDRAFT_03g000860          390   3e-129   Sorghum bicolor [broomcorn]
ref|XP_004299992.1|  PREDICTED: bark storage protein A-like             389   5e-129   
ref|XP_006412896.1|  hypothetical protein EUTSA_v10025609mg             389   8e-129   
ref|XP_010433154.1|  PREDICTED: bark storage protein A-like             389   2e-128   
gb|EAY73139.1|  hypothetical protein OsI_01011                          387   7e-128   Oryza sativa Indica Group [Indian rice]
emb|CDY06856.1|  BnaC01g09550D                                          385   2e-127   
gb|EMT26191.1|  Bark storage protein A                                  385   2e-127   
gb|KEH36050.1|  bark storage-like protein                               382   2e-127   
gb|KHG16526.1|  Bark storage A                                          384   6e-127   
ref|XP_010915872.1|  PREDICTED: bark storage protein A                  384   7e-127   
ref|XP_002440824.1|  hypothetical protein SORBIDRAFT_09g007440          384   8e-127   Sorghum bicolor [broomcorn]
ref|XP_010047915.1|  PREDICTED: bark storage protein A-like             384   9e-127   
gb|KCW79940.1|  hypothetical protein EUGRSUZ_C01272                     383   1e-126   
ref|XP_003528930.1|  PREDICTED: bark storage protein A                  382   3e-126   
emb|CDX92904.1|  BnaC07g41620D                                          382   4e-126   
ref|XP_009129133.1|  PREDICTED: bark storage protein A                  382   4e-126   
ref|XP_008462741.1|  PREDICTED: bark storage protein A                  380   1e-125   
emb|CDY35234.1|  BnaA01g07970D                                          380   2e-125   
gb|KHN20661.1|  Bark storage protein A                                  380   2e-125   
emb|CDP03301.1|  unnamed protein product                                379   3e-125   
ref|XP_004960653.1|  PREDICTED: bark storage protein A-like             375   2e-123   
ref|XP_006645676.1|  PREDICTED: bark storage protein A-like             372   4e-123   
ref|XP_010540964.1|  PREDICTED: bark storage protein A                  374   5e-123   
ref|XP_011093615.1|  PREDICTED: bark storage protein A                  372   4e-122   
emb|CDX92905.1|  BnaC07g41630D                                          369   6e-121   
ref|NP_001042490.1|  Os01g0229800                                       362   4e-119   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003565983.1|  PREDICTED: bark storage protein A                  364   5e-119   
gb|KCW79941.1|  hypothetical protein EUGRSUZ_C01273                     363   7e-119   
ref|XP_010047917.1|  PREDICTED: bark storage protein A-like             363   7e-119   
gb|KEH27138.1|  bark storage-like protein                               362   2e-118   
gb|AFK47296.1|  unknown                                                 361   4e-118   
emb|CCJ09766.1|  hypothetical protein                                   357   2e-117   
ref|XP_003528928.1|  PREDICTED: bark storage protein A-like             358   5e-117   
ref|XP_009785044.1|  PREDICTED: bark storage protein A isoform X3       354   6e-117   
ref|XP_009785043.1|  PREDICTED: bark storage protein A isoform X2       354   6e-117   
ref|XP_009785042.1|  PREDICTED: bark storage protein A isoform X1       355   6e-117   
ref|XP_008783246.1|  PREDICTED: bark storage protein A                  358   9e-117   
ref|XP_011012466.1|  PREDICTED: bark storage protein A isoform X2       344   8e-112   
gb|KEH27142.1|  bark storage-like protein                               344   2e-111   
ref|XP_004513011.1|  PREDICTED: bark storage protein A-like             343   5e-111   
ref|NP_001054970.1|  Os05g0228000                                       343   1e-110   Oryza sativa Japonica Group [Japonica rice]
gb|AFK33817.1|  unknown                                                 338   2e-110   
ref|XP_007012102.1|  Phosphorylase superfamily protein isoform 2        337   2e-109   
ref|XP_003637886.1|  5'-methylthioadenosine/S-adenosylhomocystein...    336   3e-108   
gb|KEH27141.1|  bark storage-like protein                               331   2e-106   
gb|EEE54169.1|  hypothetical protein OsJ_00983                          320   2e-103   Oryza sativa Japonica Group [Japonica rice]
emb|CAN83797.1|  hypothetical protein VITISV_002973                     346   1e-102   Vitis vinifera
dbj|BAA94780.1|  putative bark storage protein                          318   2e-101   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002972420.1|  hypothetical protein SELMODRAFT_441751             312   5e-97    
ref|XP_006655113.1|  PREDICTED: bark storage protein A-like             304   2e-96    
ref|XP_002993814.1|  hypothetical protein SELMODRAFT_431848             302   5e-95    
gb|KEH27139.1|  bark storage-like protein                               298   1e-94    
ref|XP_002993974.1|  hypothetical protein SELMODRAFT_449264             299   6e-94    
ref|XP_002514270.1|  conserved hypothetical protein                     293   3e-92    Ricinus communis
ref|XP_007137204.1|  hypothetical protein PHAVU_009G108300g             289   7e-91    
ref|XP_010041628.1|  PREDICTED: uncharacterized protein LOC104430580    285   1e-90    
ref|XP_002984250.1|  hypothetical protein SELMODRAFT_445786             288   6e-88    
gb|EEC78746.1|  hypothetical protein OsI_18961                          274   3e-85    Oryza sativa Indica Group [Indian rice]
gb|AFX97761.1|  mta/sah nucleosidase                                    265   9e-83    
emb|CCJ09769.1|  hypothetical protein                                   263   8e-82    
gb|ACU19785.1|  unknown                                                 264   1e-81    Glycine max [soybeans]
emb|CCJ09767.1|  hypothetical protein                                   257   1e-79    
tpg|DAA52767.1|  TPA: vegetative storage protein PNI288                 255   1e-78    
ref|XP_006379491.1|  hypothetical protein POPTR_0008s02870g             238   3e-70    
ref|XP_011031567.1|  PREDICTED: bark storage protein A-like isofo...    233   2e-68    
ref|XP_006379490.1|  hypothetical protein POPTR_0008s02860g             231   8e-68    
ref|XP_009137991.1|  PREDICTED: bark storage protein A-like             230   5e-67    
ref|XP_011031566.1|  PREDICTED: bark storage protein A-like isofo...    228   3e-66    
ref|XP_002262699.1|  PREDICTED: bark storage protein A                  224   4e-65    Vitis vinifera
ref|XP_011031565.1|  PREDICTED: bark storage protein A-like             223   1e-64    
emb|CDY34283.1|  BnaA01g13860D                                          223   1e-64    
emb|CDY03453.1|  BnaC01g16290D                                          223   2e-64    
gb|AAM66964.1|  unknown                                                 223   2e-64    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009137982.1|  PREDICTED: bark storage protein A-like             223   2e-64    
emb|CDY34282.1|  BnaA01g13850D                                          222   3e-64    
ref|NP_567699.1|  phosphorylase family protein                          222   3e-64    Arabidopsis thaliana [mouse-ear cress]
emb|CDY03454.1|  BnaC01g16280D                                          221   7e-64    
ref|XP_007010129.1|  Phosphorylase superfamily protein                  220   1e-63    
ref|XP_011101664.1|  PREDICTED: LOW QUALITY PROTEIN: bark storage...    220   2e-63    
ref|XP_010439047.1|  PREDICTED: bark storage protein A                  220   2e-63    
dbj|BAD44476.1|  putative protein                                       219   3e-63    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007220735.1|  hypothetical protein PRUPE_ppa023149mg             219   4e-63    
ref|XP_011031569.1|  PREDICTED: bark storage protein A-like isofo...    216   5e-63    
ref|XP_006413442.1|  hypothetical protein EUTSA_v10025575mg             219   6e-63    
ref|XP_010433781.1|  PREDICTED: bark storage protein A-like             218   8e-63    
ref|NP_194166.2|  phosphorylase family protein                          218   9e-63    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006286134.1|  hypothetical protein CARUB_v10007687mg             218   1e-62    
ref|XP_010448574.1|  PREDICTED: bark storage protein A-like isofo...    217   2e-62    
ref|XP_008233427.1|  PREDICTED: bark storage protein A-like             217   2e-62    
gb|AAM65580.1|  unknown                                                 216   3e-62    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006846768.1|  hypothetical protein AMTR_s00148p00020960          214   3e-61    
ref|XP_008233237.1|  PREDICTED: bark storage protein A-like isofo...    213   6e-61    
ref|XP_002869722.1|  hypothetical protein ARALYDRAFT_492412             213   7e-61    
emb|CDO99840.1|  unnamed protein product                                213   9e-61    
ref|XP_007010127.1|  Phosphorylase family protein isoform 1             213   1e-60    
ref|XP_007010128.1|  Phosphorylase superfamily protein isoform 2        210   1e-59    
ref|XP_010940791.1|  PREDICTED: bark storage protein A-like             209   3e-59    
ref|XP_010110204.1|  Bark storage protein A                             208   4e-59    
ref|XP_010448572.1|  PREDICTED: bark storage protein A-like             208   5e-59    
ref|XP_010520775.1|  PREDICTED: bark storage protein A-like isofo...    207   9e-59    
gb|KFK30973.1|  hypothetical protein AALP_AA6G051900                    207   1e-58    
gb|KDO47238.1|  hypothetical protein CISIN_1g019168mg                   207   2e-58    
ref|XP_006286102.1|  hypothetical protein CARUB_v10007645mg             206   2e-58    
dbj|BAJ97171.1|  predicted protein                                      206   3e-58    
ref|XP_004964322.1|  PREDICTED: bark storage protein B-like             205   7e-58    
emb|CAB45069.1|  putative protein                                       204   1e-57    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006478936.1|  PREDICTED: bark storage protein A-like             206   1e-57    
ref|XP_010433778.1|  PREDICTED: bark storage protein A-like             204   1e-57    
gb|EYU38056.1|  hypothetical protein MIMGU_mgv1a009527mg                204   1e-57    
emb|CDO99837.1|  unnamed protein product                                204   2e-57    
ref|XP_010439052.1|  PREDICTED: bark storage protein A                  203   4e-57    
ref|XP_006655706.1|  PREDICTED: bark storage protein A-like             202   6e-57    
ref|XP_002533940.1|  mta/sah nucleosidase, putative                     201   1e-56    Ricinus communis
ref|NP_001056591.1|  Os06g0112100                                       201   2e-56    Oryza sativa Japonica Group [Japonica rice]
emb|CDP19654.1|  unnamed protein product                                199   4e-56    
ref|XP_002520035.1|  mta/sah nucleosidase, putative                     201   1e-55    Ricinus communis
gb|ACN25261.1|  unknown                                                 199   1e-55    Zea mays [maize]
ref|XP_011031568.1|  PREDICTED: bark storage protein A-like isofo...    197   3e-55    
ref|XP_003557245.2|  PREDICTED: bark storage protein A-like             197   5e-55    
emb|CDO99838.1|  unnamed protein product                                195   7e-55    
ref|XP_009630340.1|  PREDICTED: bark storage protein A-like             196   3e-54    
ref|XP_007029595.1|  Phosphorylase superfamily protein                  196   8e-54    
ref|XP_004250013.1|  PREDICTED: bark storage protein A-like             194   9e-54    
ref|XP_003637891.1|  5'-methylthioadenosine/S-adenosylhomocystein...    189   1e-53    
ref|XP_009787066.1|  PREDICTED: bark storage protein A-like             194   1e-53    
ref|XP_006360498.1|  PREDICTED: bark storage protein A-like             194   1e-53    
ref|XP_010448575.1|  PREDICTED: bark storage protein A-like isofo...    193   2e-53    
emb|CDI41123.1|  putative bark storage protein                          179   1e-50    
ref|XP_010054874.1|  PREDICTED: uncharacterized protein LOC104443237    180   1e-50    
ref|XP_008367694.1|  PREDICTED: uncharacterized protein LOC103431323    179   2e-50    
ref|XP_008367687.1|  PREDICTED: uncharacterized protein LOC103431319    179   3e-50    
gb|KCW78221.1|  hypothetical protein EUGRSUZ_D02406                     179   3e-50    
gb|AFP49328.1|  hypothetical protein                                    179   6e-50    
ref|XP_002272967.3|  PREDICTED: bark storage protein A-like             185   7e-50    Vitis vinifera
emb|CBI26508.3|  unnamed protein product                                186   9e-50    
emb|CDP19657.1|  unnamed protein product                                181   1e-49    
gb|AFK43228.1|  unknown                                                 176   2e-49    
ref|XP_006379492.1|  hypothetical protein POPTR_0008s02880g             179   4e-49    
ref|XP_010671111.1|  PREDICTED: bark storage protein A-like             179   4e-48    
gb|EMS45486.1|  Bark storage protein A                                  178   8e-48    
ref|NP_001119043.1|  phosphorylase family protein                       172   1e-46    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008233238.1|  PREDICTED: bark storage protein A-like isofo...    172   3e-46    
ref|XP_009138096.1|  PREDICTED: uncharacterized protein LOC103862140    171   6e-46    
ref|XP_008802263.1|  PREDICTED: bark storage protein A-like             168   3e-45    
ref|XP_011010765.1|  PREDICTED: bark storage protein A-like             169   1e-44    
ref|XP_006443231.1|  hypothetical protein CICLE_v10023782mg             172   1e-44    
gb|EMS52187.1|  5'-methylthioadenosine/S-adenosylhomocysteine nuc...    170   1e-44    
ref|XP_010520777.1|  PREDICTED: bark storage protein A-like isofo...    165   4e-44    
gb|EMT22529.1|  Bark storage protein A                                  169   4e-44    
ref|XP_002325384.1|  hypothetical protein POPTR_0019s07690g             168   5e-44    Populus trichocarpa [western balsam poplar]
emb|CDP19658.1|  unnamed protein product                                167   1e-43    
emb|CDP19655.1|  unnamed protein product                                165   2e-43    
ref|XP_009791547.1|  PREDICTED: uncharacterized protein LOC104238775    159   3e-43    
emb|CDO99839.1|  unnamed protein product                                161   6e-42    
gb|AAK01124.1|AF330050_1  vegetative storage protein PNI288             159   2e-41    Populus trichocarpa x Populus deltoides
ref|XP_011014172.1|  PREDICTED: bark storage protein B-like             160   3e-41    
gb|ADO32585.1|  trypsin inhibitor                                       157   1e-40    
gb|AAV65286.1|  bark protein-like protein                               159   2e-40    Thuja occidentalis
gb|AGO28167.1|  PNP_UDP_1 superfamily protein                           157   2e-40    
gb|AGO28168.1|  PNP_UDP_1 superfamily protein                           154   8e-40    
ref|WP_013742281.1|  phosphorylase                                      155   2e-39    
ref|XP_010087472.1|  Bark storage protein A                             158   4e-39    
gb|AGO28166.1|  PNP_UDP_1 superfamily protein                           152   7e-39    
ref|XP_011013318.1|  PREDICTED: bark storage protein A-like             154   7e-39    
gb|KDP45052.1|  hypothetical protein JCGZ_01552                         153   7e-39    
ref|XP_003637890.1|  5'-methylthioadenosine/S-adenosylhomocystein...    146   6e-38    
dbj|BAH56816.1|  AT4G24350                                              144   1e-36    Arabidopsis thaliana [mouse-ear cress]
ref|WP_037281825.1|  phosphorylase                                      147   1e-36    
ref|XP_006579063.1|  PREDICTED: bark storage protein B-like             142   2e-36    
gb|ADB92666.1|  wound-inducible 4                                       146   2e-36    
ref|WP_036839600.1|  phosphorylase                                      146   3e-36    
ref|XP_009351241.1|  PREDICTED: LOW QUALITY PROTEIN: bark storage...    144   4e-36    
ref|WP_015014285.1|  phosphorylase                                      145   4e-36    
gb|EJL81266.1|  nucleoside phosphorylase                                145   5e-36    
ref|WP_035044210.1|  phosphorylase                                      145   5e-36    
ref|WP_013541663.1|  phosphorylase                                      145   5e-36    
ref|WP_004617524.1|  nucleoside phosphorylase                           144   2e-35    
gb|KDP21761.1|  hypothetical protein JCGZ_00548                         142   3e-35    
ref|WP_007838860.1|  phosphorylase                                      143   3e-35    
ref|WP_020949682.1|  S-adenosylhomocysteine/5'-methylthioadenosin...    142   5e-35    
ref|WP_029413035.1|  phosphorylase                                      142   7e-35    
gb|AAA16342.1|  vegetative storage protein                              142   8e-35    Populus trichocarpa x Populus deltoides
ref|WP_023461730.1|  phosphorylase                                      142   8e-35    
ref|WP_037165967.1|  MULTISPECIES: phosphorylase                        142   1e-34    
ref|WP_026346164.1|  phosphorylase                                      142   1e-34    
ref|WP_026848837.1|  hypothetical protein                               142   1e-34    
ref|XP_006375994.1|  hypothetical protein POPTR_0013s07800g             142   1e-34    
ref|XP_011009687.1|  PREDICTED: bark storage protein A-like             141   2e-34    
dbj|GAM10274.1|  5'-methylthioadenosine/S-adenosylhomocysteine nu...    140   3e-34    
ref|WP_029618198.1|  phosphorylase                                      140   3e-34    
ref|XP_005975014.1|  PREDICTED: bark storage protein B-like             140   4e-34    
ref|WP_035096809.1|  phosphorylase                                      140   4e-34    
ref|WP_021007472.1|  putative nucleoside phosphorylase                  139   9e-34    
ref|XP_002520036.1|  mta/sah nucleosidase, putative                     138   9e-34    Ricinus communis
ref|XP_006375995.1|  hypothetical protein POPTR_0013s078102g            138   1e-33    
ref|WP_035205716.1|  phosphorylase                                      138   2e-33    
gb|ADB92672.1|  bark storage protein 1+2                                138   2e-33    
gb|KDP36631.1|  hypothetical protein JCGZ_08884                         139   2e-33    
gb|KDP36640.1|  hypothetical protein JCGZ_08893                         137   2e-33    
gb|EJE49949.1|  nucleoside phosphorylase                                138   2e-33    
ref|WP_024574361.1|  MULTISPECIES: phosphorylase                        137   3e-33    
ref|WP_009734216.1|  phosphorylase                                      137   3e-33    
ref|XP_006375999.1|  hypothetical protein POPTR_0013s07840g             137   4e-33    
ref|WP_002713293.1|  hypothetical protein                               137   5e-33    
ref|WP_036180872.1|  phosphorylase                                      136   9e-33    
ref|WP_011812114.1|  phosphorylase                                      136   1e-32    
ref|WP_012747766.1|  MULTISPECIES: phosphorylase                        136   1e-32    
ref|WP_006022085.1|  hypothetical protein                               135   1e-32    
ref|WP_013080014.1|  phosphorylase                                      135   1e-32    
ref|WP_010920127.1|  phosphorylase                                      135   1e-32    
ref|WP_026067551.1|  phosphorylase                                      135   2e-32    
ref|XP_011044485.1|  PREDICTED: bark storage protein A-like isofo...    135   2e-32    
ref|WP_037448612.1|  phosphorylase                                      134   3e-32    
gb|EWY41579.1|  phosphorylase                                           135   3e-32    
ref|WP_023273314.1|  MTA/SAH nucleosidase                               134   5e-32    
ref|WP_007676693.1|  phosphorylase                                      133   7e-32    
ref|WP_019054108.1|  hypothetical protein                               133   8e-32    
ref|XP_006376161.1|  hypothetical protein POPTR_0013s10370g             134   9e-32    
sp|Q07469.1|BSPA_POPDE  RecName: Full=Bark storage protein A; Fla...    133   9e-32    
pir||S31580  storage protein, bark - cottonwood                         133   1e-31 
ref|WP_017181636.1|  hypothetical protein                               132   2e-31    
ref|WP_035091950.1|  phosphorylase                                      132   2e-31    
ref|WP_006273460.1|  phosphorylase                                      132   2e-31    
ref|WP_013479435.1|  phosphorylase                                      132   2e-31    
ref|XP_010671478.1|  PREDICTED: bark storage protein A-like             132   3e-31    
ref|XP_006376163.1|  hypothetical protein POPTR_0013s10380g             132   3e-31    
gb|KDP45050.1|  hypothetical protein JCGZ_01550                         129   4e-31    
ref|WP_034658720.1|  phosphorylase                                      130   5e-31    
ref|XP_011010435.1|  PREDICTED: bark storage protein A                  131   6e-31    
ref|WP_018061704.1|  MULTISPECIES: phosphorylase                        130   7e-31    
ref|WP_035705462.1|  hypothetical protein                               130   1e-30    
ref|WP_023454318.1|  phosphorylase                                      130   1e-30    
gb|AAB20113.2|  major storage protein                                   130   1e-30    
ref|WP_038277562.1|  hypothetical protein                               130   2e-30    
ref|WP_028040453.1|  phosphorylase                                      129   2e-30    
ref|WP_024924835.1|  MULTISPECIES: phosphorylase                        130   2e-30    
ref|WP_028640354.1|  phosphorylase                                      129   4e-30    
gb|ESQ74346.1|  phosphorylase                                           128   4e-30    
ref|WP_035077875.1|  phosphorylase                                      128   4e-30    
gb|ACN25722.1|  unknown                                                 125   7e-30    
gb|KCZ46085.1|  hypothetical protein HY17_10020                         127   1e-29    
sp|Q09117.1|BSPB_POPDE  RecName: Full=Bark storage protein B; Fla...    127   2e-29    
ref|WP_036505387.1|  phosphorylase                                      127   2e-29    
gb|EJL20799.1|  nucleoside phosphorylase                                127   2e-29    
ref|XP_006376159.1|  hypothetical protein POPTR_0013s10350g             127   3e-29    
ref|WP_006950964.1|  5'-methylthioadenosine nucleosidase / S-aden...    126   3e-29    
ref|XP_008233239.1|  PREDICTED: bark storage protein A-like isofo...    124   3e-29    
ref|WP_034768462.1|  hypothetical protein                               125   3e-29    
gb|ABK96415.1|  unknown                                                 126   3e-29    
ref|WP_007705495.1|  phosphorylase                                      126   3e-29    
gb|KCZ89874.1|  methylthioadenosine nucleosidase                        126   4e-29    
emb|CAB45070.1|  putative protein                                       123   6e-29    
gb|KDP36628.1|  hypothetical protein JCGZ_08881                         125   8e-29    
ref|XP_011044486.1|  PREDICTED: bark storage protein A-like isofo...    124   1e-28    
ref|WP_031255360.1|  phosphorylase                                      124   2e-28    
ref|XP_006376162.1|  hypothetical protein POPTR_0013s10380g             123   3e-28    
ref|WP_027474416.1|  phosphorylase                                      122   4e-28    
ref|WP_010339366.1|  phosphorylase                                      122   6e-28    
ref|WP_004212589.1|  hypothetical protein                               122   7e-28    
gb|KHN10208.1|  5'-methylthioadenosine/S-adenosylhomocysteine nuc...    116   8e-28    
ref|WP_037506889.1|  phosphorylase                                      122   8e-28    
ref|XP_002869723.1|  hypothetical protein ARALYDRAFT_354336             120   9e-28    
ref|WP_017502114.1|  phosphorylase                                      121   9e-28    
emb|CDM23008.1|  5'-methylthioadenosine nucleosidase / S-adenosyl...    122   1e-27    
ref|WP_037519754.1|  phosphorylase                                      121   1e-27    
gb|ADB92673.1|  bark storage protein 3                                  121   2e-27    
ref|WP_007883983.1|  nucleoside phosphorylase                           121   3e-27    
ref|WP_018607403.1|  hypothetical protein                               120   3e-27    
gb|KDP45048.1|  hypothetical protein JCGZ_01548                         119   3e-27    
ref|WP_036523236.1|  phosphorylase                                      120   3e-27    
ref|WP_008832252.1|  adenosylhomocysteine nucleosidase                  119   6e-27    
gb|ADB92667.1|  nitrogen-inducible protein 288                          117   7e-27    
ref|WP_016835115.1|  nucleoside phosphorylase                           120   7e-27    
ref|WP_035579856.1|  hypothetical protein                               119   8e-27    
gb|AHE55159.1|  hypothetical protein NX02_17420                         119   8e-27    
gb|ESQ92612.1|  hypothetical protein ABENE_07280                        118   9e-27    
ref|XP_010100247.1|  5'-methylthioadenosine/S-adenosylhomocystein...    115   1e-26    
ref|WP_017668908.1|  hypothetical protein                               118   2e-26    
ref|WP_035690052.1|  phosphorylase                                      118   2e-26    
ref|XP_011016340.1|  PREDICTED: bark storage protein B-like             118   2e-26    
ref|WP_028658121.1|  phosphorylase                                      118   2e-26    
ref|WP_025095778.1|  hypothetical protein                               118   2e-26    
ref|WP_039279173.1|  phosphorylase                                      117   3e-26    
ref|WP_008993390.1|  adenosylhomocysteine nucleosidase                  117   3e-26    
emb|CDY50933.1|  BnaA03g59110D                                          114   4e-26    
ref|WP_004940679.1|  hypothetical protein                               117   4e-26    
ref|WP_004945255.1|  hypothetical protein                               117   4e-26    
dbj|BAG15856.1|  vegetative storage protein                             116   9e-26    
ref|WP_038494002.1|  menaquinone via futalosine step 2                  116   1e-25    
gb|AIY43960.1|  5'-methylthioadenosine nucleosidase                     116   1e-25    
ref|WP_026605458.1|  hypothetical protein                               115   1e-25    
gb|KDP27547.1|  hypothetical protein JCGZ_20132                         112   1e-25    
ref|WP_021320158.1|  hypothetical protein                               115   2e-25    
ref|WP_039390683.1|  phosphorylase                                      114   3e-25    
ref|WP_014008188.1|  menaquinone via futalosine step 2                  114   5e-25    
ref|WP_034294788.1|  menaquinone via futalosine step 2                  114   6e-25    
ref|WP_007601067.1|  purine or other phosphorylase family 1             112   1e-24    
ref|XP_010671479.1|  PREDICTED: bark storage protein A-like             113   1e-24    
gb|AIA57954.1|  vegetative storage protein 1                            111   3e-24    
ref|XP_002520043.1|  mta/sah nucleosidase, putative                     112   3e-24    
ref|WP_004924288.1|  MULTISPECIES: hypothetical protein                 112   3e-24    
gb|AIA57955.1|  vegetative storage protein 2                            111   3e-24    
emb|CDY67605.1|  BnaAnng24770D                                          108   5e-24    
ref|WP_017928326.1|  hypothetical protein                               109   1e-23    
ref|WP_014107114.1|  purine phosphorylase                               108   2e-23    
ref|WP_008067005.1|  adenosylhomocysteine nucleosidase                  108   5e-23    
gb|AHF90609.1|  phosphorylase                                           107   9e-23    
ref|XP_002520037.1|  mta/sah nucleosidase, putative                     107   1e-22    
ref|WP_007361591.1|  5'-nucleosidase                                    107   1e-22    
ref|WP_006008059.1|  purine phosphorylases family protein 1             105   5e-22    
emb|CAB45071.1|  putative protein                                     97.8    6e-21    
gb|AFW86165.1|  hypothetical protein ZEAMMB73_090894                  98.6    9e-21    
ref|XP_009375403.1|  PREDICTED: bark storage protein A-like isofo...  97.4    1e-20    
ref|XP_006413443.1|  hypothetical protein EUTSA_v10027599mg           97.4    1e-20    
ref|XP_006833371.1|  hypothetical protein AMTR_s00109p00104440        96.3    2e-20    
gb|AIA57956.1|  storage protein                                       99.8    2e-20    
ref|XP_002520044.1|  mta/sah nucleosidase, putative                     100   3e-20    
emb|CAB43908.1|  putative protein                                     94.7    6e-20    
ref|WP_031235817.1|  phosphorylase                                    99.0    8e-20    
emb|CCJ09768.1|  hypothetical protein                                 92.0    2e-19    
ref|XP_002519987.1|  mta/sah nucleosidase, putative                   97.8    3e-19    
ref|WP_020745375.1|  phosphorylase family protein                     97.4    3e-19    
ref|WP_039219783.1|  purine phosphorylase                             97.4    5e-19    
ref|WP_020742908.1|  phosphorylase family protein                     97.1    5e-19    
ref|WP_008303600.1|  MULTISPECIES: purine phosphorylase               97.4    6e-19    
ref|WP_014980633.1|  purine phosphorylase                             97.1    7e-19    
ref|WP_007622691.1|  S-adenosylhomocysteine                           96.3    8e-19    
ref|WP_012517289.1|  purine phosphorylase                             96.7    9e-19    
ref|WP_015066243.1|  phosphorylase family protein                     96.3    9e-19    
ref|WP_025256515.1|  purine phosphorylase                             95.9    1e-18    
ref|WP_011573458.1|  purine phosphorylase                             95.9    2e-18    
ref|XP_002520039.1|  mta/sah nucleosidase, putative                   95.5    2e-18    
ref|WP_007990214.1|  S-adenosylhomocysteine/5'-methylthioadenosin...  95.9    2e-18    
ref|XP_009375408.1|  PREDICTED: uncharacterized protein LOC103964...  90.9    2e-18    
ref|WP_039233732.1|  purine phosphorylase                             95.1    2e-18    
ref|WP_014951196.1|  purine phosphorylase                             94.7    3e-18    
gb|KDP36638.1|  hypothetical protein JCGZ_08891                       94.0    3e-18    
ref|WP_032097659.1|  MULTISPECIES: purine phosphorylase               94.7    3e-18    
ref|WP_033186553.1|  purine phosphorylase                             95.1    4e-18    
ref|XP_007220000.1|  hypothetical protein PRUPE_ppb023416mg           90.9    4e-18    
gb|AIG00425.1|  purine phosphorylase                                  94.7    4e-18    
ref|WP_007641380.1|  S-adenosylhomocysteine/5'-methylthioadenosin...  94.0    6e-18    
ref|WP_008843706.1|  S-adenosylhomocysteine/5'-methylthioadenosin...  93.6    9e-18    
ref|WP_006992754.1|  S-adenosylhomocysteine/5'-methylthioadenosin...  93.6    1e-17    
ref|WP_021692563.1|  5'-methylthioadenosine nucleosidase / S-aden...  92.8    1e-17    
ref|WP_014999934.1|  purine phosphorylase                             92.4    1e-17    
ref|WP_013786483.1|  purine phosphorylase                             93.2    1e-17    
gb|AFG62646.1|  hypothetical protein 0_5855_01                        88.6    1e-17    
gb|AFG62642.1|  hypothetical protein 0_5855_01                        88.6    2e-17    
ref|WP_015190628.1|  purine or other phosphorylase family 1           92.8    4e-17    
ref|WP_006009137.1|  S-adenosylhomocysteine/5'-methylthioadenosin...  87.8    9e-16    
ref|XP_010247613.1|  PREDICTED: uncharacterized protein LOC104590596  86.7    5e-15    
ref|XP_006387990.1|  hypothetical protein POPTR_0423s00200g           83.2    5e-15    
ref|XP_011010436.1|  PREDICTED: bark storage protein A-like           82.0    1e-14    
ref|WP_022505237.1|  5'-methylthioadenosine/S-adenosylhomocystein...  82.8    2e-14    
ref|WP_020598111.1|  adenosylhomocysteine nucleosidase                82.4    3e-14    
ref|WP_012924840.1|  adenosylhomocysteine nucleosidase                82.0    4e-14    
gb|KDP39514.1|  hypothetical protein JCGZ_02534                       80.1    5e-14    
ref|WP_035115258.1|  phosphorylase                                    83.2    6e-14    
ref|XP_009340200.1|  PREDICTED: uncharacterized protein LOC103932353  78.6    1e-13    
gb|AAT07460.1|  phosphorylase domain-containing protein               80.1    1e-13    
gb|AAQ54550.1|  phosphorylase                                         75.9    2e-13    
tpg|DAA52768.1|  TPA: hypothetical protein ZEAMMB73_395391            76.6    3e-13    
ref|WP_020607270.1|  hypothetical protein                             79.3    3e-13    
ref|XP_006376000.1|  hypothetical protein POPTR_0013s07850g           78.2    3e-13    
ref|WP_035270343.1|  S-adenosylhomocysteine nucleosidase              77.0    1e-12    
emb|CEG27961.1|  5'-methylthioadenosine/S-adenosylhomocysteine nu...  76.6    1e-12    
ref|WP_039835346.1|  MTA/SAH nucleosidase                             75.9    3e-12    
ref|WP_039714128.1|  phosphorylase                                    78.2    3e-12    
ref|WP_019636087.1|  hypothetical protein                             75.5    4e-12    
ref|WP_022272120.1|  methylthioadenosine nucleosidase                 75.5    4e-12    
ref|WP_035275174.1|  S-adenosylhomocysteine nucleosidase              75.1    6e-12    
ref|WP_027134238.1|  MTA/SAH nucleosidase                             74.3    1e-11    
ref|WP_010269913.1|  MTA/SAH nucleosidase                             73.9    1e-11    
ref|XP_007043699.1|  Uncharacterized protein TCM_008225               70.5    1e-11    
ref|WP_028539933.1|  MTA/SAH nucleosidase                             73.6    2e-11    
ref|WP_003802070.1|  S-adenosylhomocysteine nucleosidase              72.8    3e-11    
ref|WP_038590467.1|  MTA/SAH nucleosidase                             72.8    4e-11    
ref|WP_022983637.1|  S-adenosylhomocysteine nucleosidase              72.4    4e-11    
ref|WP_022461363.1|  putative uncharacterized protein                 72.4    4e-11    
ref|WP_022213992.1|  methylthioadenosine nucleosidase                 72.0    6e-11    
ref|WP_020606628.1|  adenosylhomocysteine nucleosidase                72.0    9e-11    
ref|WP_016311584.1|  MTA/SAH nucleosidase                             71.2    1e-10    
ref|WP_008507221.1|  adenosylhomocysteine nucleosidase                71.6    1e-10    
ref|WP_036621532.1|  MTA/SAH nucleosidase                             70.9    1e-10    
ref|WP_005425936.1|  S-adenosylhomocysteine nucleosidase [            70.9    2e-10    
ref|XP_006436590.1|  hypothetical protein CICLE_v10033407mg           70.1    2e-10    
dbj|GAK39764.1|  adenosylhomocysteine nucleosidase                    70.9    2e-10    
ref|WP_009225205.1|  MTA/SAH nucleosidase                             70.9    2e-10    
ref|WP_008706966.1|  MULTISPECIES: S-adenosylhomocysteine nucleos...  70.5    2e-10    
ref|WP_034308609.1|  5'-methylthioadenosine nucleosidase              70.5    2e-10    
emb|CEG33771.1|  5'-methylthioadenosine/S-adenosylhomocysteine nu...  70.5    2e-10    
ref|WP_022388541.1|  mTA/SAH nucleosidase                             70.1    2e-10    
ref|WP_015525635.1|  MULTISPECIES: methylthioadenosine nucleosidase   70.1    2e-10    
ref|WP_026639003.1|  S-adenosylhomocysteine nucleosidase              70.1    3e-10    
ref|WP_013166700.1|  MTA/SAH nucleosidase                             69.3    5e-10    
ref|WP_038695489.1|  MTA/SAH nucleosidase                             68.9    6e-10    
ref|WP_015540780.1|  methylthioadenosine nucleosidase [               68.9    6e-10    
ref|WP_008374185.1|  MULTISPECIES: S-adenosylhomocysteine nucleos...  68.6    8e-10    
gb|AIQ46760.1|  MTA/SAH nucleosidase                                  68.2    1e-09    
ref|WP_021262591.1|  adenosylhomocysteine nucleosidase                68.2    1e-09    
ref|WP_036428261.1|  MTA/SAH nucleosidase                             67.8    2e-09    
ref|WP_031526576.1|  adenosylhomocysteine nucleosidase                67.8    2e-09    
ref|WP_002566354.1|  S-adenosylhomocysteine nucleosidase [            67.0    2e-09    
gb|KDP36634.1|  hypothetical protein JCGZ_08887                       65.1    4e-09    
ref|WP_022183307.1|  methylthioadenosine nucleosidase                 66.6    4e-09    
ref|WP_028531251.1|  MTA/SAH nucleosidase                             66.6    4e-09    
ref|WP_002589258.1|  MTA/SAH nucleosidase [                           66.2    4e-09    
ref|WP_021256692.1|  adenosylhomocysteine nucleosidase                66.6    4e-09    
ref|WP_022250670.1|  putative uncharacterized protein                 66.2    5e-09    
ref|WP_021005170.1|  putative MTA/SAH nucleosidase                    66.2    7e-09    
ref|WP_004613069.1|  S-adenosylhomocysteine nucleosidase              65.5    7e-09    
ref|WP_008400590.1|  S-adenosylhomocysteine nucleosidase              65.9    7e-09    
ref|WP_002577200.1|  MTA/SAH nucleosidase [                           65.5    9e-09    
ref|WP_028595763.1|  MTA/SAH nucleosidase                             65.5    9e-09    
ref|WP_011727877.1|  MTA/SAH nucleosidase                             65.5    1e-08    
ref|WP_005548179.1|  MTA/SAH nucleosidase                             65.5    1e-08    
ref|WP_035154429.1|  MTA/SAH nucleosidase                             65.1    1e-08    
ref|WP_007171013.1|  hypothetical protein                             66.2    1e-08    
ref|WP_036686141.1|  MTA/SAH nucleosidase                             65.1    1e-08    
ref|WP_003893136.1|  MTA/SAH nucleosidase                             65.1    1e-08    
ref|WP_001033368.1|  HAD family hydrolase                             66.6    1e-08    
ref|WP_016998534.1|  hypothetical protein                             64.7    1e-08    
ref|WP_026676611.1|  MTA/SAH nucleosidase                             64.7    2e-08    
ref|WP_038267769.1|  S-adenosylhomocysteine nucleosidase [            64.7    2e-08    
ref|WP_022117960.1|  mTA/SAH nucleosidase                             64.7    2e-08    
ref|WP_034235763.1|  S-adenosylhomocysteine nucleosidase              64.3    2e-08    
gb|AIQ41125.1|  MTA/SAH nucleosidase                                  64.7    2e-08    
ref|WP_015492505.1|  methylthioadenosine nucleosidase                 64.7    2e-08    
ref|WP_031471092.1|  S-adenosylhomocysteine nucleosidase [            63.9    2e-08    
ref|WP_036695016.1|  MTA/SAH nucleosidase                             63.9    2e-08    
gb|KDP36636.1|  hypothetical protein JCGZ_08889                       61.6    2e-08    
ref|WP_019160543.1|  S-adenosylhomocysteine nucleosidase              63.9    3e-08    
ref|WP_007129619.1|  MULTISPECIES: MTA/SAH nucleosidase               63.9    3e-08    
ref|WP_034927243.1|  S-adenosylhomocysteine nucleosidase              63.9    3e-08    
ref|WP_028549408.1|  MTA/SAH nucleosidase                             63.9    3e-08    
ref|WP_037447077.1|  MTA/SAH nucleosidase                             63.9    4e-08    



>ref|XP_006364285.1| PREDICTED: bark storage protein A-like [Solanum tuberosum]
Length=354

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/328 (78%), Positives = 298/328 (91%), Gaps = 2/328 (1%)
 Frame = -1

Query  1240  EGANGSLLDDGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRF  1061
             E ANG++   GKTR LI+ ANKKGPYLG+VIPN+FEMNPLL+H SYKPS L IDYAGRRF
Sbjct  23    EEANGTI--SGKTRKLIDMANKKGPYLGLVIPNLFEMNPLLQHPSYKPSDLTIDYAGRRF  80

Query  1060  RFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQ  881
             RFG I+ +PV+LVMTGLAMLNAGITTQLLL++FDV GVVHYGIAGNANPSLNIGDVAIPQ
Sbjct  81    RFGHIDNQPVVLVMTGLAMLNAGITTQLLLALFDVKGVVHYGIAGNANPSLNIGDVAIPQ  140

Query  880   YWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWY  701
             YW+HTALWNWQRYGDG ENELPLEVNGDYTR+IG++K ++Y+ NV  CNS +NLLNN+WY
Sbjct  141   YWAHTALWNWQRYGDGAENELPLEVNGDYTRDIGYLKISEYSVNVTNCNSHNNLLNNIWY  200

Query  700   QPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVER  521
             QPEE+FPV  TPE+RQHIFWVPVD  Y+ IA+ LEGL+LEGC+NATTCL+H PKVTRV R
Sbjct  201   QPEEVFPVFGTPEDRQHIFWVPVDPRYYAIAKKLEGLKLEGCLNATTCLSHPPKVTRVHR  260

Query  520   GTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsae  341
             GTSASIYLDNAAYRSFIY+KF+VSPVEMESAAVAL+C+QQKVPYI+IRALSD+AGGG++E
Sbjct  261   GTSASIYLDNAAYRSFIYNKFDVSPVEMESAAVALICYQQKVPYIVIRALSDMAGGGTSE  320

Query  340   sneaATFIDLAADNSVKVAVEFIKKVPS  257
             SNEA+TFI LAA NSV+V V+FIK++ +
Sbjct  321   SNEASTFITLAATNSVEVTVQFIKQLST  348



>ref|XP_006364286.1| PREDICTED: bark storage protein A-like isoform X1 [Solanum tuberosum]
Length=353

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/328 (78%), Positives = 296/328 (90%), Gaps = 2/328 (1%)
 Frame = -1

Query  1240  EGANGSLLDDGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRF  1061
             E ANG++   GKTR LI+ ANK GPYLG+VIPN+FEMNPLL+H SYKP  L IDYAGRRF
Sbjct  22    EEANGAI--SGKTRKLIDMANKNGPYLGLVIPNLFEMNPLLQHPSYKPGDLTIDYAGRRF  79

Query  1060  RFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQ  881
             RFG I+ +PV+LVMTGLAMLNAGITTQLLL++F+V GVVHYGIAGNANPSLNIGDVAIPQ
Sbjct  80    RFGHIDNQPVVLVMTGLAMLNAGITTQLLLALFNVKGVVHYGIAGNANPSLNIGDVAIPQ  139

Query  880   YWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWY  701
             YW+HTALWNWQRYGDGPENELPLEVNGDYTR+IG++K ++Y+ NV  CNS +NLLNN+WY
Sbjct  140   YWAHTALWNWQRYGDGPENELPLEVNGDYTRDIGYLKISEYSVNVTNCNSHNNLLNNIWY  199

Query  700   QPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVER  521
             QPEE+FPV  TPEERQHIFWVPVD  Y+ IA+ LEGL+LEGC+NATTCL+H PKVTRV R
Sbjct  200   QPEEVFPVFGTPEERQHIFWVPVDPRYYAIAKKLEGLKLEGCLNATTCLSHPPKVTRVHR  259

Query  520   GTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsae  341
             GTSASIYLDNAAYRSFIY+KF+VSPVEMESAAVAL+C+QQ VPYI+IRALSD+AGGG++E
Sbjct  260   GTSASIYLDNAAYRSFIYNKFDVSPVEMESAAVALICYQQNVPYIVIRALSDMAGGGTSE  319

Query  340   sneaATFIDLAADNSVKVAVEFIKKVPS  257
             SNEA+TFI LAA NSV+V V+FIK++ S
Sbjct  320   SNEASTFITLAATNSVEVTVQFIKQLSS  347



>ref|XP_010325109.1| PREDICTED: bark storage protein A [Solanum lycopersicum]
Length=355

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/326 (78%), Positives = 295/326 (90%), Gaps = 2/326 (1%)
 Frame = -1

Query  1234  ANGSLLDDGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRF  1055
             ANG++   GKTR LI+ ANKKGPYLG+VIPN+FEMNPLL+H SYKPS L IDYAGRRFRF
Sbjct  25    ANGAI--SGKTRKLIDMANKKGPYLGLVIPNLFEMNPLLQHPSYKPSDLTIDYAGRRFRF  82

Query  1054  GTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYW  875
             G I+ +PV+LVMTGLAMLNAGITTQLLL++FDV GVVHYGIAGNANPSLNIGDVAIPQYW
Sbjct  83    GRIDNQPVVLVMTGLAMLNAGITTQLLLALFDVKGVVHYGIAGNANPSLNIGDVAIPQYW  142

Query  874   SHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQP  695
             +HTALWNWQRYGDGPENELPLEVNGDYTR+IG++K A+Y  NV  CNS +NLLNNVWYQP
Sbjct  143   AHTALWNWQRYGDGPENELPLEVNGDYTRDIGYLKIAEYTVNVTNCNSHNNLLNNVWYQP  202

Query  694   EEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGT  515
             EE+FPV  TPE+RQHIFWVPVD  Y+ IA+ LEGL+L GC+NATTCL+H PKVTRV RG+
Sbjct  203   EEVFPVFGTPEDRQHIFWVPVDPRYYAIAKKLEGLKLVGCLNATTCLSHPPKVTRVARGS  262

Query  514   SASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesn  335
             SASIYLDNAAYRSF+Y+KF+VSPVEMESAAVAL+C+QQKVPYI+IRALSD+AGGG++ESN
Sbjct  263   SASIYLDNAAYRSFMYNKFDVSPVEMESAAVALICYQQKVPYIVIRALSDMAGGGTSESN  322

Query  334   eaATFIDLAADNSVKVAVEFIKKVPS  257
             EA+TFI LAA NSV+V V+FI ++ +
Sbjct  323   EASTFITLAATNSVEVTVQFINQLAT  348



>emb|CDP16182.1| unnamed protein product [Coffea canephora]
Length=356

 Score =   523 bits (1347),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/326 (80%), Positives = 292/326 (90%), Gaps = 4/326 (1%)
 Frame = -1

Query  1240  EGANGSLLDDGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRF  1061
             E  NG+L   GKT+ LI  ANK GPYLG+VIPN+FEMNPLL+H S+ PS L+ID+AGRRF
Sbjct  19    EATNGAL--HGKTQALINRANKFGPYLGLVIPNLFEMNPLLQHPSFVPSELVIDFAGRRF  76

Query  1060  RFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQ  881
             RFGTIE KPVILVMTGL MLNAG+TTQLLLS+F++ GVVHYGIAGNANPSL+IGDV IPQ
Sbjct  77    RFGTIEKKPVILVMTGLGMLNAGVTTQLLLSLFEIEGVVHYGIAGNANPSLHIGDVTIPQ  136

Query  880   YWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYAT-NVDECNSQ-DNLLNNV  707
             +WSH+ALWNWQRYGDGP NELPLE NGDYTR+IG+I+FA Y T NV  C+S  DNLLNNV
Sbjct  137   FWSHSALWNWQRYGDGPSNELPLEENGDYTRDIGYIRFADYTTSNVTSCSSPFDNLLNNV  196

Query  706   WYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRV  527
             WYQPEE+FP+D  PEERQH FWVPVDSHYF+I++ LEGLELEGC+N+TTCL  TPKVTRV
Sbjct  197   WYQPEEVFPIDGDPEERQHAFWVPVDSHYFKISRLLEGLELEGCVNSTTCLDTTPKVTRV  256

Query  526   ERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggs  347
             ERGTSASIYLDNAAYRSFIY+KFNVSPVEMESAAVALVCHQQ+VP+I+IRALSDLAGGG+
Sbjct  257   ERGTSASIYLDNAAYRSFIYNKFNVSPVEMESAAVALVCHQQRVPFIVIRALSDLAGGGT  316

Query  346   aesneaATFIDLAADNSVKVAVEFIK  269
             AESNEAATF  LAADNSVKV VEFIK
Sbjct  317   AESNEAATFTALAADNSVKVVVEFIK  342



>ref|XP_009596122.1| PREDICTED: bark storage protein A [Nicotiana tomentosiformis]
Length=350

 Score =   517 bits (1332),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 249/326 (76%), Positives = 288/326 (88%), Gaps = 3/326 (1%)
 Frame = -1

Query  1240  EGANGSLLDDGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRF  1061
             E ANG+    GKT+ LI+ AN++GPYLG+VIPN+FEMNPLL+H SYKP+ L IDYAGRRF
Sbjct  20    EEANGA--ATGKTKKLIDMANRRGPYLGLVIPNLFEMNPLLQHPSYKPTNLTIDYAGRRF  77

Query  1060  RFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQ  881
             RFG I+ +PV+LVMTGLAMLNAGITTQLLL++F V GVVHYGIAGNANPSL+IGDVAIPQ
Sbjct  78    RFGYIDNQPVVLVMTGLAMLNAGITTQLLLALFKVKGVVHYGIAGNANPSLHIGDVAIPQ  137

Query  880   YWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWY  701
             YW+HTALWNWQ+YGDGP+NELPLEVNGDYTR+IG++K +KY+ NV  CNS +NLLNNVWY
Sbjct  138   YWAHTALWNWQKYGDGPQNELPLEVNGDYTRDIGYLKISKYSVNVTNCNSHNNLLNNVWY  197

Query  700   QPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVER  521
             QPEE+FPV  TPEERQHIFWVPVD  YF IA+ LEGL+LE CI+A TCL+HTPKV RV R
Sbjct  198   QPEEVFPVFGTPEERQHIFWVPVDPQYFAIAKKLEGLKLEECIDAKTCLSHTPKVARVHR  257

Query  520   GTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsae  341
             GTSASIYLDNAAYRSFIY+KF+VSPVEMESAAVAL+C+QQK PYI+IRALSDL  GG   
Sbjct  258   GTSASIYLDNAAYRSFIYNKFDVSPVEMESAAVALICYQQKTPYIVIRALSDL-AGGGDA  316

Query  340   sneaATFIDLAADNSVKVAVEFIKKV  263
              NEAATFI LAA+NSV+V V+FIK++
Sbjct  317   DNEAATFITLAANNSVEVVVQFIKQL  342



>ref|XP_002283985.1| PREDICTED: bark storage protein A [Vitis vinifera]
Length=355

 Score =   496 bits (1277),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 245/338 (72%), Positives = 287/338 (85%), Gaps = 2/338 (1%)
 Frame = -1

Query  1243  KEGANGSLLDDGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRR  1064
             +EG NG+L+ + +T+ +I+ AN+ GPYLG+VIPN+FEMNPLL+  +Y  S L ID+AGRR
Sbjct  20    QEG-NGALIRE-ETQEMIDEANRNGPYLGLVIPNLFEMNPLLQSPNYTASNLTIDFAGRR  77

Query  1063  FRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIP  884
             FRFGTI  K VILVMTGL+M+NAGITTQLLLS FD+ GVVHYGIAGNANPSLNIGDV IP
Sbjct  78    FRFGTIADKKVILVMTGLSMINAGITTQLLLSTFDIEGVVHYGIAGNANPSLNIGDVTIP  137

Query  883   QYWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVW  704
             QYW+HTALWNWQRYGDGPE+E+ LE NGDYTREIG++KFA Y  NV   +S DNLLNNVW
Sbjct  138   QYWAHTALWNWQRYGDGPEDEIALEENGDYTREIGYLKFANYTVNVSSSSSYDNLLNNVW  197

Query  703   YQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVE  524
             YQPEE+FPVD TPEER+H FWVPVDS YFQ++Q+L  LELEGC+N+TTCLT TPKV  V 
Sbjct  198   YQPEEVFPVDGTPEEREHAFWVPVDSLYFQLSQNLLALELEGCVNSTTCLTETPKVVSVL  257

Query  523   RGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsa  344
             RGTSASIYLDNAAYR+FIYDKF VSPV+MESAAVAL+C QQ+V +I  RALSDLAGGGSA
Sbjct  258   RGTSASIYLDNAAYRAFIYDKFQVSPVDMESAAVALICLQQRVAFIAFRALSDLAGGGSA  317

Query  343   esneaATFIDLAADNSVKVAVEFIKKVPSPNRSAGLIS  230
             +SNEAATF  LAA+NSV V VEFIK++ + +  A  +S
Sbjct  318   QSNEAATFTSLAANNSVTVVVEFIKQLSAASFHASFVS  355



>emb|CBI20868.3| unnamed protein product [Vitis vinifera]
Length=322

 Score =   490 bits (1261),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 239/322 (74%), Positives = 275/322 (85%), Gaps = 0/322 (0%)
 Frame = -1

Query  1195  LIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFGTIEGKPVILVMT  1016
             +I+ AN+ GPYLG+VIPN+FEMNPLL+  +Y  S L ID+AGRRFRFGTI  K VILVMT
Sbjct  1     MIDEANRNGPYLGLVIPNLFEMNPLLQSPNYTASNLTIDFAGRRFRFGTIADKKVILVMT  60

Query  1015  GLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGD  836
             GL+M+NAGITTQLLLS FD+ GVVHYGIAGNANPSLNIGDV IPQYW+HTALWNWQRYGD
Sbjct  61    GLSMINAGITTQLLLSTFDIEGVVHYGIAGNANPSLNIGDVTIPQYWAHTALWNWQRYGD  120

Query  835   GPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEER  656
             GPE+E+ LE NGDYTREIG++KFA Y  NV   +S DNLLNNVWYQPEE+FPVD TPEER
Sbjct  121   GPEDEIALEENGDYTREIGYLKFANYTVNVSSSSSYDNLLNNVWYQPEEVFPVDGTPEER  180

Query  655   QHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRS  476
             +H FWVPVDS YFQ++Q+L  LELEGC+N+TTCLT TPKV  V RGTSASIYLDNAAYR+
Sbjct  181   EHAFWVPVDSLYFQLSQNLLALELEGCVNSTTCLTETPKVVSVLRGTSASIYLDNAAYRA  240

Query  475   FIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNS  296
             FIYDKF VSPV+MESAAVAL+C QQ+V +I  RALSDLAGGGSA+SNEAATF  LAA+NS
Sbjct  241   FIYDKFQVSPVDMESAAVALICLQQRVAFIAFRALSDLAGGGSAQSNEAATFTSLAANNS  300

Query  295   VKVAVEFIKKVPSPNRSAGLIS  230
             V V VEFIK++ + +  A  +S
Sbjct  301   VTVVVEFIKQLSAASFHASFVS  322



>gb|KDP34190.1| hypothetical protein JCGZ_07761 [Jatropha curcas]
Length=353

 Score =   486 bits (1251),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 233/318 (73%), Positives = 275/318 (86%), Gaps = 0/318 (0%)
 Frame = -1

Query  1201  RMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFGTIEGKPVILV  1022
             R LI+ ANK GPYLG+VIPN+FEMNPLL+  ++  + LIID++GRRFRFGTI  K VILV
Sbjct  34    RKLIDQANKDGPYLGLVIPNLFEMNPLLQSPNFTATDLIIDFSGRRFRFGTIAEKKVILV  93

Query  1021  MTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRY  842
             MTGL+++NAG+TTQLLLS F+V GVVHYGIAGNANPSLNIGDV IPQYW+H  LW+WQRY
Sbjct  94    MTGLSLINAGVTTQLLLSFFNVNGVVHYGIAGNANPSLNIGDVTIPQYWAHLGLWSWQRY  153

Query  841   GDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPE  662
             G GP++ELPLE NGDYTR+IG+IKFA Y+TNV EC S DNLLNNVWYQPEE+F VDATPE
Sbjct  154   GKGPKDELPLESNGDYTRKIGYIKFANYSTNVSECGSHDNLLNNVWYQPEEVFLVDATPE  213

Query  661   ERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAY  482
              R H FWVPVDS+YFQI+++LE ++L+GC+N+TTCL+ TP+V  VERG SASIYLDNAAY
Sbjct  214   NRGHAFWVPVDSNYFQISKALESMKLQGCLNSTTCLSETPRVVTVERGGSASIYLDNAAY  273

Query  481   RSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAAD  302
             RSFIY KFNVSPVEME+AAVAL+CHQQK+P+I IRALSDLAGGGSA SNEA TF  LAA+
Sbjct  274   RSFIYKKFNVSPVEMETAAVALICHQQKIPFIAIRALSDLAGGGSAHSNEADTFTSLAAN  333

Query  301   NSVKVAVEFIKKVPSPNR  248
             +SV V +E IK++P   R
Sbjct  334   HSVAVVLELIKRLPLTKR  351



>gb|EYU20446.1| hypothetical protein MIMGU_mgv1a009063mg [Erythranthe guttata]
Length=354

 Score =   473 bits (1218),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 234/331 (71%), Positives = 280/331 (85%), Gaps = 4/331 (1%)
 Frame = -1

Query  1234  ANGSLLDDGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRF  1055
             ANG +++ GKT+ +I  ANK+GPYLG+VIPN+FEMNPLL H S++P+ L ID+AGRRFRF
Sbjct  26    ANGDVIN-GKTQRMIYKANKEGPYLGLVIPNLFEMNPLLHHPSFQPTNLTIDFAGRRFRF  84

Query  1054  GTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYW  875
             GTI  + VILVMTGLAMLNAG+TTQLLLS+F++ GV+HYGIAGNANPSLNIGDV IP+YW
Sbjct  85    GTIYEEKVILVMTGLAMLNAGVTTQLLLSLFNIKGVLHYGIAGNANPSLNIGDVTIPEYW  144

Query  874   SHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQP  695
             SHTALWNWQRYGDGPENEL LE NGDYTREIG ++FA Y TN       DNLLN VWYQP
Sbjct  145   SHTALWNWQRYGDGPENELALEGNGDYTREIGHLRFANYTTN---NVVSDNLLNRVWYQP  201

Query  694   EEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGT  515
             EEIF +D TPE+RQH FWVPVDS+YF++++ LEG+ELE CIN+TTCL+ TP V RV RGT
Sbjct  202   EEIFEIDGTPEQRQHAFWVPVDSNYFELSKKLEGMELEKCINSTTCLSDTPIVRRVSRGT  261

Query  514   SASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesn  335
             S SI+LDN+AYRSF++DKF+VSPV+MESAAVAL+CHQQKVP+I  R+LSDLAGGGSA+SN
Sbjct  262   SGSIFLDNSAYRSFLHDKFHVSPVDMESAAVALICHQQKVPFITFRSLSDLAGGGSAQSN  321

Query  334   eaATFIDLAADNSVKVAVEFIKKVPSPNRSA  242
             EA  F  LAA+NSV V V F++ + S N  +
Sbjct  322   EAEIFAPLAANNSVAVVVGFVEILASLNSKS  352



>ref|XP_010049098.1| PREDICTED: bark storage protein A-like [Eucalyptus grandis]
Length=348

 Score =   471 bits (1213),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 231/328 (70%), Positives = 273/328 (83%), Gaps = 3/328 (1%)
 Frame = -1

Query  1234  ANGSLLDDGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRF  1055
             ANG+L     T   I  AN  GPY+G+VIPN+FEM PLL  SSY  +  II+++GRRFRF
Sbjct  22    ANGAL--SATTLEAIAKANVNGPYIGIVIPNLFEMGPLLNSSSYSAAE-IINFSGRRFRF  78

Query  1054  GTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYW  875
             GT+E + VILVMTGL+++NA ITTQLLLS FDV GV+HYGIAGNANP L+IGDVAIPQYW
Sbjct  79    GTVEERKVILVMTGLSVINAAITTQLLLSFFDVEGVIHYGIAGNANPDLHIGDVAIPQYW  138

Query  874   SHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQP  695
             +HT LWNWQRYG GPE+EL LE NGDYTR +G+++FA Y TNV  C S DNLLNN+WYQP
Sbjct  139   AHTGLWNWQRYGQGPEDELALESNGDYTRTLGYLRFANYTTNVTGCASHDNLLNNIWYQP  198

Query  694   EEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGT  515
             EE+FPV  TPEERQH FWVPV S YF++A+ LEGL+LE C+NATTCL +TP V+ VERG 
Sbjct  199   EEVFPVTGTPEERQHEFWVPVGSTYFEVAKKLEGLKLESCVNATTCLNYTPSVSTVERGV  258

Query  514   SASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesn  335
             SASIYLDN+AYRSFIYDKFNVSPV+MESA+VAL+C+QQ  P+I IRALSDLAGGGSAESN
Sbjct  259   SASIYLDNSAYRSFIYDKFNVSPVDMESASVALICYQQNTPFIAIRALSDLAGGGSAESN  318

Query  334   eaATFIDLAADNSVKVAVEFIKKVPSPN  251
             EA TF+DLA++N+V V VEFIK++ S N
Sbjct  319   EADTFVDLASNNAVTVMVEFIKQLSSRN  346



>gb|KCW81555.1| hypothetical protein EUGRSUZ_C02911 [Eucalyptus grandis]
Length=388

 Score =   471 bits (1211),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 231/328 (70%), Positives = 273/328 (83%), Gaps = 3/328 (1%)
 Frame = -1

Query  1234  ANGSLLDDGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRF  1055
             ANG+L     T   I  AN  GPY+G+VIPN+FEM PLL  SSY  +  II+++GRRFRF
Sbjct  62    ANGAL--SATTLEAIAKANVNGPYIGIVIPNLFEMGPLLNSSSYSAAE-IINFSGRRFRF  118

Query  1054  GTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYW  875
             GT+E + VILVMTGL+++NA ITTQLLLS FDV GV+HYGIAGNANP L+IGDVAIPQYW
Sbjct  119   GTVEERKVILVMTGLSVINAAITTQLLLSFFDVEGVIHYGIAGNANPDLHIGDVAIPQYW  178

Query  874   SHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQP  695
             +HT LWNWQRYG GPE+EL LE NGDYTR +G+++FA Y TNV  C S DNLLNN+WYQP
Sbjct  179   AHTGLWNWQRYGQGPEDELALESNGDYTRTLGYLRFANYTTNVTGCASHDNLLNNIWYQP  238

Query  694   EEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGT  515
             EE+FPV  TPEERQH FWVPV S YF++A+ LEGL+LE C+NATTCL +TP V+ VERG 
Sbjct  239   EEVFPVTGTPEERQHEFWVPVGSTYFEVAKKLEGLKLESCVNATTCLNYTPSVSTVERGV  298

Query  514   SASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesn  335
             SASIYLDN+AYRSFIYDKFNVSPV+MESA+VAL+C+QQ  P+I IRALSDLAGGGSAESN
Sbjct  299   SASIYLDNSAYRSFIYDKFNVSPVDMESASVALICYQQNTPFIAIRALSDLAGGGSAESN  358

Query  334   eaATFIDLAADNSVKVAVEFIKKVPSPN  251
             EA TF+DLA++N+V V VEFIK++ S N
Sbjct  359   EADTFVDLASNNAVTVMVEFIKQLSSRN  386



>ref|XP_008393885.1| PREDICTED: bark storage protein A-like [Malus domestica]
 ref|XP_008367693.1| PREDICTED: bark storage protein A-like [Malus domestica]
Length=358

 Score =   466 bits (1200),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 221/319 (69%), Positives = 266/319 (83%), Gaps = 1/319 (0%)
 Frame = -1

Query  1213  DGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFGTIEGKP  1034
               +T   I+ AN+ GPYLGVVIPN FEMNPLL+  ++  + L ID +GRRFRFGTI  K 
Sbjct  29    SAETYKSIDEANQSGPYLGVVIPNAFEMNPLLQSPNFTSTNLTIDVSGRRFRFGTIANKK  88

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             VILVMTGL+M+NAGITTQLLLS+F++ GVVHYGIAGNANPS+NI DV IPQYW+H ALWN
Sbjct  89    VILVMTGLSMINAGITTQLLLSLFBIEGVVHYGIAGNANPSINIADVVIPQYWAHXALWN  148

Query  853   WQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVD  674
             WQRYG GPE ELPLE +GDYTREIG++KFA Y  N    +  DNLLNN+WYQPEE+FP+D
Sbjct  149   WQRYGQGPEXELPLEASGDYTREIGYLKFANYTVNAS-SSXYDNLLNNIWYQPEEVFPID  207

Query  673   ATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLD  494
              TPEERQH FWVPVD  Y+ I++ LE L+LEGC+N+TTCL+HTPKV RV+RGTSASIYLD
Sbjct  208   GTPEERQHAFWVPVDPLYYNISKKLEDLKLEGCLNSTTCLSHTPKVARVDRGTSASIYLD  267

Query  493   NAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFID  314
             NAAYR FIY+KFNVSPVEMESA+VAL+C QQ+VP+I+IRA+SDLAGGG A+SNEA  F+ 
Sbjct  268   NAAYRGFIYNKFNVSPVEMESASVALICLQQRVPFIVIRAISDLAGGGGADSNEADAFLT  327

Query  313   LAADNSVKVAVEFIKKVPS  257
             LA+ NSV   +EF+K++ +
Sbjct  328   LASKNSVTAVLEFVKQLSA  346



>ref|XP_009367890.1| PREDICTED: bark storage protein A-like isoform X3 [Pyrus x bretschneideri]
Length=348

 Score =   462 bits (1189),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 222/319 (70%), Positives = 265/319 (83%), Gaps = 1/319 (0%)
 Frame = -1

Query  1213  DGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFGTIEGKP  1034
               +T   I+ AN+ GPYLG+VIPN FEMNPLL+  ++  +   ID +GRRFRFGTI  K 
Sbjct  29    SAETHKSIDEANQSGPYLGLVIPNTFEMNPLLQSPNFTSTNFTIDVSGRRFRFGTIANKK  88

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             VILVMTGL+++NAGITTQLLLS+F++ GVVHYGIAGNANPS+NI DV IP+YW+HT LWN
Sbjct  89    VILVMTGLSLINAGITTQLLLSLFNIEGVVHYGIAGNANPSINIADVVIPRYWAHTTLWN  148

Query  853   WQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVD  674
             WQRYG GPENELPLE NGDYTREIG++K A Y  N    +S DNLLNN+WYQPEE+FP+D
Sbjct  149   WQRYGQGPENELPLEANGDYTREIGYLKVANYTVNASS-SSYDNLLNNIWYQPEEVFPID  207

Query  673   ATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLD  494
              TPEERQH FWVPVD  Y+ I++ LE L+LEGC+N+TTCL+HTPKV RV+RGTSASIYLD
Sbjct  208   GTPEERQHAFWVPVDPLYYNISKKLEDLKLEGCLNSTTCLSHTPKVARVDRGTSASIYLD  267

Query  493   NAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFID  314
             NAAYR FIY+KFNVSPV MESA+VAL+C QQ VP+I IRALSDLAGGGSA+SNEA TFI 
Sbjct  268   NAAYRGFIYNKFNVSPVGMESASVALICLQQGVPFIAIRALSDLAGGGSADSNEADTFIT  327

Query  313   LAADNSVKVAVEFIKKVPS  257
             LA+ NSV   +EF+K++ +
Sbjct  328   LASKNSVTAVLEFVKQLSA  346



>ref|XP_009367887.1| PREDICTED: bark storage protein A-like isoform X1 [Pyrus x bretschneideri]
Length=363

 Score =   462 bits (1189),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 222/319 (70%), Positives = 265/319 (83%), Gaps = 1/319 (0%)
 Frame = -1

Query  1213  DGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFGTIEGKP  1034
               +T   I+ AN+ GPYLG+VIPN FEMNPLL+  ++  +   ID +GRRFRFGTI  K 
Sbjct  29    SAETHKSIDEANQSGPYLGLVIPNTFEMNPLLQSPNFTSTNFTIDVSGRRFRFGTIANKK  88

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             VILVMTGL+++NAGITTQLLLS+F++ GVVHYGIAGNANPS+NI DV IP+YW+HT LWN
Sbjct  89    VILVMTGLSLINAGITTQLLLSLFNIEGVVHYGIAGNANPSINIADVVIPRYWAHTTLWN  148

Query  853   WQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVD  674
             WQRYG GPENELPLE NGDYTREIG++K A Y  N    +S DNLLNN+WYQPEE+FP+D
Sbjct  149   WQRYGQGPENELPLEANGDYTREIGYLKVANYTVNASS-SSYDNLLNNIWYQPEEVFPID  207

Query  673   ATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLD  494
              TPEERQH FWVPVD  Y+ I++ LE L+LEGC+N+TTCL+HTPKV RV+RGTSASIYLD
Sbjct  208   GTPEERQHAFWVPVDPLYYNISKKLEDLKLEGCLNSTTCLSHTPKVARVDRGTSASIYLD  267

Query  493   NAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFID  314
             NAAYR FIY+KFNVSPV MESA+VAL+C QQ VP+I IRALSDLAGGGSA+SNEA TFI 
Sbjct  268   NAAYRGFIYNKFNVSPVGMESASVALICLQQGVPFIAIRALSDLAGGGSADSNEADTFIT  327

Query  313   LAADNSVKVAVEFIKKVPS  257
             LA+ NSV   +EF+K++ +
Sbjct  328   LASKNSVTAVLEFVKQLSA  346



>ref|XP_010049097.1| PREDICTED: bark storage protein A-like [Eucalyptus grandis]
Length=347

 Score =   461 bits (1185),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 226/325 (70%), Positives = 268/325 (82%), Gaps = 3/325 (1%)
 Frame = -1

Query  1231  NGSLLDDGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFG  1052
             NG+L     T   I  AN  GPY+G+VIPN+FEM PLL  SSY  +  IID++GRRFRFG
Sbjct  23    NGAL--PAATLEAIAKANANGPYIGIVIPNLFEMGPLLNSSSYSAAE-IIDFSGRRFRFG  79

Query  1051  TIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWS  872
             T+E + VILVMTGL+++NA ITTQLLLS F+V GV+HYGIAGNANP L+IGDVAIPQYW+
Sbjct  80    TVEERKVILVMTGLSVINAAITTQLLLSFFNVEGVIHYGIAGNANPDLHIGDVAIPQYWA  139

Query  871   HTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPE  692
             HT LWNWQRYG G E+EL LE +GDYTR +G+++FA Y TNV  C S DNLLNN+WYQPE
Sbjct  140   HTGLWNWQRYGQGTEDELALESSGDYTRTLGYLRFANYTTNVTGCASHDNLLNNIWYQPE  199

Query  691   EIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTS  512
             E+FPV  TPEERQH FWVPV S YF +A+ LEGL+LE C+NATTCL +TP V+ VERG S
Sbjct  200   EVFPVTGTPEERQHEFWVPVGSTYFAVAKKLEGLKLESCVNATTCLNYTPSVSTVERGVS  259

Query  511   ASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesne  332
             ASIYLDN+AYRSFIYDKFNVSPV+MESA+VAL+C+QQ   +I IRALSDLAGGGSAESNE
Sbjct  260   ASIYLDNSAYRSFIYDKFNVSPVDMESASVALICYQQNTSFIAIRALSDLAGGGSAESNE  319

Query  331   aATFIDLAADNSVKVAVEFIKKVPS  257
             A TF++LA+DN+V V VEFIK++ S
Sbjct  320   ADTFVNLASDNAVTVVVEFIKQLSS  344



>ref|XP_008220066.1| PREDICTED: bark storage protein A-like [Prunus mume]
Length=357

 Score =   459 bits (1180),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 217/318 (68%), Positives = 270/318 (85%), Gaps = 0/318 (0%)
 Frame = -1

Query  1210  GKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFGTIEGKPV  1031
               T+ LI+ AN+ GPYLG+VIPN FEM PLL+  ++  + LII+++GRRFRFGTI  K V
Sbjct  34    ANTQKLIDEANEGGPYLGLVIPNSFEMKPLLQSPNFTSTDLIINFSGRRFRFGTIANKKV  93

Query  1030  ILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNW  851
             ILVMTGL+++NAGITTQLLL++F++ GVVHYGIAG ANPSLNIGDVAIP YW+HTALWNW
Sbjct  94    ILVMTGLSLINAGITTQLLLTLFNIEGVVHYGIAGTANPSLNIGDVAIPHYWAHTALWNW  153

Query  850   QRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDA  671
             QRYG GPE+ELPLE NGDYTRE G++  A Y  NV + +S DNLLNN+W+QPEE+FP+D 
Sbjct  154   QRYGKGPEDELPLEANGDYTREFGYLNVANYTVNVTDGSSYDNLLNNIWFQPEEVFPIDG  213

Query  670   TPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDN  491
             TPEERQH FWV VD HY++I+Q +E ++LEGC+N+TTCL++ PKV RV+RG SASIYLDN
Sbjct  214   TPEERQHAFWVAVDPHYYEISQKVEDVKLEGCLNSTTCLSNIPKVARVQRGASASIYLDN  273

Query  490   AAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDL  311
             AAYR F+Y+KFN+SP++ME+A+VAL+C QQ+VP+I IRALSDLAGGGSA+SNEA TF  L
Sbjct  274   AAYRGFLYNKFNISPMDMETASVALICLQQRVPFIAIRALSDLAGGGSAKSNEADTFSPL  333

Query  310   AADNSVKVAVEFIKKVPS  257
             AA NSV V VEFIK++ +
Sbjct  334   AAKNSVTVVVEFIKQLSA  351



>ref|XP_008367689.1| PREDICTED: bark storage protein A-like isoform X1 [Malus domestica]
 ref|XP_008367690.1| PREDICTED: bark storage protein A-like isoform X1 [Malus domestica]
Length=349

 Score =   457 bits (1175),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 213/315 (68%), Positives = 265/315 (84%), Gaps = 1/315 (0%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFGTIEGKPVI  1028
             +T+MLIE AN  GPYLG+VIPN +EM+PLL+  ++  S L ID++GRRFRFGTI  KPVI
Sbjct  29    ETQMLIEEANMSGPYLGLVIPNSYEMDPLLQSPNFTSSNLFIDFSGRRFRFGTIANKPVI  88

Query  1027  LVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQ  848
             LVMTGL+M+NA ITTQLLLS FD+ GVVHYGIAG+ANPSL++ DV IPQYWSH+ALW+WQ
Sbjct  89    LVMTGLSMINAAITTQLLLSQFDIEGVVHYGIAGHANPSLSLADVVIPQYWSHSALWSWQ  148

Query  847   RYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDAT  668
             RYG+GPE+ELPLE +GDYTREIG++  A Y TNV + +S DNLLNN+W+QPEE+FP+D T
Sbjct  149   RYGNGPEDELPLEKDGDYTREIGYLNVANYTTNVTDGSSYDNLLNNIWFQPEEVFPIDGT  208

Query  667   PEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNA  488
             PEERQH FWV VD  Y++I+Q LE LELE C+N+TTCL HTPKV RVERGTSA I+L NA
Sbjct  209   PEERQHAFWVAVDPLYYEISQKLEDLELERCLNSTTCLPHTPKVXRVERGTSAGIFLSNA  268

Query  487   AYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLA  308
             AYRSF++DKFN+SP++MESA+VALVC QQ+VP+I+I+ALS  +  G++E  EAA FI LA
Sbjct  269   AYRSFLFDKFNISPLDMESASVALVCLQQRVPFIVIKALSS-SLSGTSEPXEAANFISLA  327

Query  307   ADNSVKVAVEFIKKV  263
             + NSV   VEFI+++
Sbjct  328   SKNSVMAVVEFIRRL  342



>ref|XP_004292852.1| PREDICTED: uncharacterized protein LOC101304070 [Fragaria vesca 
subsp. vesca]
Length=700

 Score =   468 bits (1205),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 224/321 (70%), Positives = 273/321 (85%), Gaps = 0/321 (0%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFGTIEGKPVI  1028
             +T  LI  AN  GPYLG+VIPN FEM+PLL+  ++  S LIID++GRRFRFGTI GK V+
Sbjct  35    ETLKLIAEANANGPYLGLVIPNSFEMDPLLQSPNFTSSNLIIDFSGRRFRFGTIAGKQVV  94

Query  1027  LVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQ  848
             LVMTGLAM+NAGITTQLLLS+FD+ GVVHYGIAGNANP L++ DV IPQ+ +HTALWNWQ
Sbjct  95    LVMTGLAMINAGITTQLLLSLFDIEGVVHYGIAGNANPDLHLADVVIPQFSAHTALWNWQ  154

Query  847   RYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDAT  668
             RYG+GPE+ELPLE  GDYTR+IG++KFA +  NV +  S DNLLNN+WYQPEEIFPVD T
Sbjct  155   RYGNGPEDELPLESQGDYTRDIGYLKFANFTVNVTDGTSYDNLLNNIWYQPEEIFPVDGT  214

Query  667   PEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNA  488
             PE+R+H FWV VD  Y++I+Q LE +ELEGC+N TTCL+HTP+V RV+RGTSASIYLDNA
Sbjct  215   PEQREHAFWVEVDPFYYEISQKLEDMELEGCLNTTTCLSHTPRVARVQRGTSASIYLDNA  274

Query  487   AYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLA  308
             AYR FIYDKFN++PV+MESA+VAL+C QQKVP+I+IR+LSDLAGGGSA+SNEA TFI LA
Sbjct  275   AYRDFIYDKFNITPVDMESASVALICLQQKVPFIVIRSLSDLAGGGSADSNEADTFITLA  334

Query  307   ADNSVKVAVEFIKKVPSPNRS  245
             ++NSV V +EF+K + +   S
Sbjct  335   SNNSVTVLLEFVKHLSAATIS  355


 Score =   456 bits (1174),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 219/326 (67%), Positives = 267/326 (82%), Gaps = 0/326 (0%)
 Frame = -1

Query  1210  GKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFGTIEGKPV  1031
              KT+ LI  ANKKGPYLG+VIPN FEMNPLLE S++  + L ID++GRRFRFG I  K V
Sbjct  372   AKTQKLINKANKKGPYLGLVIPNTFEMNPLLESSNFTSTNLTIDFSGRRFRFGMIAEKKV  431

Query  1030  ILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNW  851
             +LVMTG+ M+NAGITTQLLLSVF++ GVVHYGIAGNANP  NI DV IPQ+WSH+ LWNW
Sbjct  432   LLVMTGMGMINAGITTQLLLSVFNIEGVVHYGIAGNANPDFNIADVVIPQFWSHSGLWNW  491

Query  850   QRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDA  671
             Q+YGDGPE+ELPLE  GD+TR+IG+++FA Y  NV   +S DNLLN +W+Q EEIFPV+ 
Sbjct  492   QKYGDGPEDELPLESIGDFTRDIGYLRFANYTVNVTGGSSYDNLLNYIWFQEEEIFPVNG  551

Query  670   TPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDN  491
             TPEER+  FWV VD  Y++IA+ LEGL LE CIN+TTCL+ TPKV RV+RGTSASIYL N
Sbjct  552   TPEERERAFWVEVDPTYYEIAKKLEGLTLESCINSTTCLSETPKVARVQRGTSASIYLYN  611

Query  490   AAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDL  311
             AAYR+FIYDKFNV+PV+MESA++AL+C QQ VP+I IRALSDLAGGGS+ +++A TF DL
Sbjct  612   AAYRNFIYDKFNVTPVDMESASIALICLQQNVPFITIRALSDLAGGGSSVTDDADTFFDL  671

Query  310   AADNSVKVAVEFIKKVPSPNRSAGLI  233
             AA+NSV V +EFIK++ +   S   I
Sbjct  672   AANNSVIVLLEFIKELSASTLSKSTI  697



>ref|XP_002516547.1| mta/sah nucleosidase, putative [Ricinus communis]
 gb|EEF45888.1| mta/sah nucleosidase, putative [Ricinus communis]
Length=349

 Score =   454 bits (1168),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 210/315 (67%), Positives = 256/315 (81%), Gaps = 0/315 (0%)
 Frame = -1

Query  1204  TRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFGTIEGKPVIL  1025
             T  LI   N  GPYLG+VIPN +EMNPLL+  ++  + L ID++GRRFRFGTI  + VIL
Sbjct  31    TLKLISEVNDDGPYLGLVIPNPYEMNPLLQSPNFTATNLTIDFSGRRFRFGTIGERKVIL  90

Query  1024  VMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQR  845
             VMTGL+++NAGITTQLL+S F++ GVVHYGIAGNANPSLNIGDV IP+YW+HT LWNWQR
Sbjct  91    VMTGLSLINAGITTQLLISFFNIEGVVHYGIAGNANPSLNIGDVTIPRYWAHTGLWNWQR  150

Query  844   YGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATP  665
             YG GPE+EL LE NGDYTRE G+IKFA Y  NV  C+S DNLLNNVWYQPEE+FPVD TP
Sbjct  151   YGKGPEDELRLEANGDYTREFGYIKFANYTVNVTGCSSYDNLLNNVWYQPEEVFPVDGTP  210

Query  664   EERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAA  485
             EER+H+FWV VD +YFQ++ SL  ++LEGC+N+TTCL+ TPKV  VERGTSASI+LDN+A
Sbjct  211   EEREHVFWVSVDPYYFQVSLSLLDMKLEGCLNSTTCLSSTPKVVTVERGTSASIFLDNSA  270

Query  484   YRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAA  305
             YRSF+YDK N+S V+ME+AAVAL+C QQK+P+I IRALS      +  ++EA  F  L A
Sbjct  271   YRSFLYDKLNISTVDMETAAVALICLQQKMPFIAIRALSGGRNSAAQSNSEADIFTSLVA  330

Query  304   DNSVKVAVEFIKKVP  260
             DNSV V +EFIK++P
Sbjct  331   DNSVAVVLEFIKRLP  345



>ref|XP_008393883.1| PREDICTED: bark storage protein A-like [Malus domestica]
 ref|XP_008393884.1| PREDICTED: bark storage protein A-like [Malus domestica]
Length=349

 Score =   454 bits (1167),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 212/315 (67%), Positives = 264/315 (84%), Gaps = 1/315 (0%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFGTIEGKPVI  1028
             +T+MLIE AN  GPYLG+VIPN +EM+PLL+  ++  S L ID++GRRFRFGTI  KPVI
Sbjct  29    ETQMLIEEANMSGPYLGLVIPNSYEMDPLLQSPNFTSSNLFIDFSGRRFRFGTIANKPVI  88

Query  1027  LVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQ  848
             LVMTGL+M+NA ITTQLLLS FD+  VVHYGIAG+ANPSL++ DV IPQYWSH+ALW+WQ
Sbjct  89    LVMTGLSMINAAITTQLLLSQFDIEXVVHYGIAGHANPSLSLADVVIPQYWSHSALWSWQ  148

Query  847   RYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDAT  668
             RYG+GPE+ELPLE +GDYTREIG++  A Y TNV + +S DNLLNN+W+QPEE+FP+D T
Sbjct  149   RYGNGPEDELPLEKDGDYTREIGYLNVANYTTNVTDGSSYDNLLNNIWFQPEEVFPIDGT  208

Query  667   PEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNA  488
             PEERQH FWV VD  Y++I+Q LE LELE C+N+TTCL HTPKV RVERGTSA I+L NA
Sbjct  209   PEERQHAFWVAVDPLYYEISQKLEDLELERCLNSTTCLPHTPKVXRVERGTSAGIFLSNA  268

Query  487   AYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLA  308
             AYRSF++DKFN+SP++MESA+VALVC QQ+VP+I+I+ALS  +  G++E  EAA FI LA
Sbjct  269   AYRSFLFDKFNISPLDMESASVALVCLQQRVPFIVIKALSS-SLSGTSEPXEAANFISLA  327

Query  307   ADNSVKVAVEFIKKV  263
             + NSV   VEFI+++
Sbjct  328   SKNSVMAVVEFIRRL  342



>ref|XP_008367691.1| PREDICTED: bark storage protein A-like isoform X2 [Malus domestica]
Length=318

 Score =   451 bits (1161),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 212/312 (68%), Positives = 262/312 (84%), Gaps = 1/312 (0%)
 Frame = -1

Query  1198  MLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFGTIEGKPVILVM  1019
             MLIE AN  GPYLG+VIPN +EM+PLL+  ++  S L ID++GRRFRFGTI  KPVILVM
Sbjct  1     MLIEEANMSGPYLGLVIPNSYEMDPLLQSPNFTSSNLFIDFSGRRFRFGTIANKPVILVM  60

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             TGL+M+NA ITTQLLLS FD+ GVVHYGIAG+ANPSL++ DV IPQYWSH+ALW+WQRYG
Sbjct  61    TGLSMINAAITTQLLLSQFDIEGVVHYGIAGHANPSLSLADVVIPQYWSHSALWSWQRYG  120

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
             +GPE+ELPLE +GDYTREIG++  A Y TNV + +S DNLLNN+W+QPEE+FP+D TPEE
Sbjct  121   NGPEDELPLEKDGDYTREIGYLNVANYTTNVTDGSSYDNLLNNIWFQPEEVFPIDGTPEE  180

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
             RQH FWV VD  Y++I+Q LE LELE C+N+TTCL HTPKV RVERGTSA I+L NAAYR
Sbjct  181   RQHAFWVAVDPLYYEISQKLEDLELERCLNSTTCLPHTPKVXRVERGTSAGIFLSNAAYR  240

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
             SF++DKFN+SP++MESA+VALVC QQ+VP+I+I+ALS  +  G++E  EAA FI LA+ N
Sbjct  241   SFLFDKFNISPLDMESASVALVCLQQRVPFIVIKALSS-SLSGTSEPXEAANFISLASKN  299

Query  298   SVKVAVEFIKKV  263
             SV   VEFI+++
Sbjct  300   SVMAVVEFIRRL  311



>ref|XP_008352016.1| PREDICTED: bark storage protein A-like isoform X1 [Malus domestica]
 ref|XP_008352017.1| PREDICTED: bark storage protein A-like isoform X1 [Malus domestica]
Length=349

 Score =   451 bits (1161),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 211/315 (67%), Positives = 263/315 (83%), Gaps = 1/315 (0%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFGTIEGKPVI  1028
             +T+MLIE AN  GPYLG+ IPN +EM+ LL+  ++  S L ID++GRRFRFGTI  KPVI
Sbjct  29    ETQMLIEEANMSGPYLGLXIPNXYEMDXLLQSPNFTSSNLFIDFSGRRFRFGTIANKPVI  88

Query  1027  LVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQ  848
             LVMTGL+M+NA ITTQLLLS FD+ GVVHYGIAG+ANPSL++ DV IPQYWSH+ALW+WQ
Sbjct  89    LVMTGLSMINAAITTQLLLSQFDIEGVVHYGIAGHANPSLSLADVVIPQYWSHSALWSWQ  148

Query  847   RYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDAT  668
             RYG+GPE+ELPLE +GDYTREIG++  A Y TNV + +S DNLLNN+W+QPEE+FP+D T
Sbjct  149   RYGNGPEDELPLEKDGDYTREIGYLNVANYTTNVTDGSSYDNLLNNIWFQPEEVFPIDGT  208

Query  667   PEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNA  488
             PEERQH FWV VD  Y++I+Q LE LELE C+N+TTCL HTPKV RVERGTSA I+L NA
Sbjct  209   PEERQHAFWVAVDPLYYEISQKLEDLELERCLNSTTCLPHTPKVXRVERGTSAGIFLSNA  268

Query  487   AYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLA  308
             AYRSF++DKFN+SP++MESA+VALVC QQ+VP+I+I+ALS  +  G++E  EAA FI LA
Sbjct  269   AYRSFLFDKFNISPLDMESASVALVCLQQRVPFIVIKALSS-SLSGTSEPXEAANFISLA  327

Query  307   ADNSVKVAVEFIKKV  263
             + NSV   VEFI+++
Sbjct  328   SKNSVMAVVEFIRRL  342



>ref|XP_008352018.1| PREDICTED: bark storage protein A-like isoform X2 [Malus domestica]
Length=329

 Score =   451 bits (1159),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 211/315 (67%), Positives = 263/315 (83%), Gaps = 1/315 (0%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFGTIEGKPVI  1028
             +T+MLIE AN  GPYLG+ IPN +EM+ LL+  ++  S L ID++GRRFRFGTI  KPVI
Sbjct  9     ETQMLIEEANMSGPYLGLXIPNXYEMDXLLQSPNFTSSNLFIDFSGRRFRFGTIANKPVI  68

Query  1027  LVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQ  848
             LVMTGL+M+NA ITTQLLLS FD+ GVVHYGIAG+ANPSL++ DV IPQYWSH+ALW+WQ
Sbjct  69    LVMTGLSMINAAITTQLLLSQFDIEGVVHYGIAGHANPSLSLADVVIPQYWSHSALWSWQ  128

Query  847   RYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDAT  668
             RYG+GPE+ELPLE +GDYTREIG++  A Y TNV + +S DNLLNN+W+QPEE+FP+D T
Sbjct  129   RYGNGPEDELPLEKDGDYTREIGYLNVANYTTNVTDGSSYDNLLNNIWFQPEEVFPIDGT  188

Query  667   PEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNA  488
             PEERQH FWV VD  Y++I+Q LE LELE C+N+TTCL HTPKV RVERGTSA I+L NA
Sbjct  189   PEERQHAFWVAVDPLYYEISQKLEDLELERCLNSTTCLPHTPKVXRVERGTSAGIFLSNA  248

Query  487   AYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLA  308
             AYRSF++DKFN+SP++MESA+VALVC QQ+VP+I+I+ALS  +  G++E  EAA FI LA
Sbjct  249   AYRSFLFDKFNISPLDMESASVALVCLQQRVPFIVIKALSS-SLSGTSEPXEAANFISLA  307

Query  307   ADNSVKVAVEFIKKV  263
             + NSV   VEFI+++
Sbjct  308   SKNSVMAVVEFIRRL  322



>ref|XP_009367888.1| PREDICTED: bark storage protein A-like isoform X2 [Pyrus x bretschneideri]
 ref|XP_009367889.1| PREDICTED: bark storage protein A-like isoform X2 [Pyrus x bretschneideri]
Length=353

 Score =   449 bits (1155),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 211/316 (67%), Positives = 264/316 (84%), Gaps = 1/316 (0%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFGTIEGKPVI  1028
             +T+MLIE AN  GPYLG+VIPN +EM+PLL+  ++  S L ID++GRRFRFGTI  KPVI
Sbjct  29    ETQMLIEEANMSGPYLGLVIPNSYEMDPLLQSPNFTSSNLFIDFSGRRFRFGTIANKPVI  88

Query  1027  LVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQ  848
             LVMTGL+M+NA ITTQLLLS FD+ GVVHYG+A +ANPSLN+ DV IPQYWSH+ALW+WQ
Sbjct  89    LVMTGLSMINAAITTQLLLSQFDIEGVVHYGVARHANPSLNLADVVIPQYWSHSALWSWQ  148

Query  847   RYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDAT  668
             RYG+GPE+ELPLE +GDYTREIG++  A Y TNV + ++ DNLLNN+W+QPEE+FP+D T
Sbjct  149   RYGNGPEDELPLEKDGDYTREIGYLNVANYTTNVTDGSTYDNLLNNLWFQPEEVFPIDGT  208

Query  667   PEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNA  488
             PEERQH FWV VD  Y++I+Q LE L+LE C+N+TTCL H PKV+RVERGTSASI+L NA
Sbjct  209   PEERQHSFWVAVDPLYYEISQKLEDLQLERCLNSTTCLPHIPKVSRVERGTSASIFLSNA  268

Query  487   AYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaes-neaATFIDL  311
             AYRSF++DKFN+SP++MESA+VALVC QQ+VP+I+IRALS  + G  +   NEAA FI L
Sbjct  269   AYRSFLFDKFNISPLDMESASVALVCLQQRVPFIVIRALSSSSSGSGSSDPNEAAKFISL  328

Query  310   AADNSVKVAVEFIKKV  263
             A+ NSV   VEFI+++
Sbjct  329   ASKNSVMAVVEFIRQL  344



>ref|XP_010049099.1| PREDICTED: bark storage protein A-like [Eucalyptus grandis]
 gb|KCW81556.1| hypothetical protein EUGRSUZ_C02912 [Eucalyptus grandis]
Length=346

 Score =   447 bits (1151),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 226/327 (69%), Positives = 265/327 (81%), Gaps = 5/327 (2%)
 Frame = -1

Query  1231  NGSLLDDGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFG  1052
             NG+LL    T   I  AN  GPY+G+VIPN+FEM PLL  S+Y  +  IID++GRRFRFG
Sbjct  23    NGALL--AATLEAITKANVNGPYIGIVIPNLFEMGPLLNSSNYSAAE-IIDFSGRRFRFG  79

Query  1051  TIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWS  872
             T+E + VILVMTGL ++NA ITTQLLLS F+V GV+HYGIA NANP L+IGDVAIPQYW+
Sbjct  80    TVEERKVILVMTGLGVINAAITTQLLLSFFNVEGVIHYGIARNANPDLHIGDVAIPQYWA  139

Query  871   HTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPE  692
             HT LWNWQRYG GPE+EL LE NGDYTR +G ++FA Y TNV  C S DNLLNN+WYQ E
Sbjct  140   HTGLWNWQRYGQGPEDELTLESNGDYTRTLGHLRFANYTTNVTGCASHDNLLNNIWYQQE  199

Query  691   EIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTS  512
             E+FPV  TPEERQH FWVPV S YF +A+ LEGL+L+ C+  TTCL +TP V+ VERG S
Sbjct  200   EVFPVTGTPEERQHEFWVPVGSTYFAVAKKLEGLKLKPCV--TTCLNYTPSVSTVERGIS  257

Query  511   ASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesne  332
             ASIYLDN+AYRSFIYDKFNVSPV+MESA+VAL+C+QQ  P+I IRALSDLAGGGSAESNE
Sbjct  258   ASIYLDNSAYRSFIYDKFNVSPVDMESASVALICYQQNTPFIAIRALSDLAGGGSAESNE  317

Query  331   aATFIDLAADNSVKVAVEFIKKVPSPN  251
             A TF DLA+DN+V V VEFIK++ S N
Sbjct  318   ADTFADLASDNAVMVVVEFIKQLSSRN  344



>ref|XP_006833372.1| hypothetical protein AMTR_s00109p00105850 [Amborella trichopoda]
 gb|ERM98650.1| hypothetical protein AMTR_s00109p00105850 [Amborella trichopoda]
Length=355

 Score =   446 bits (1147),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 215/322 (67%), Positives = 265/322 (82%), Gaps = 4/322 (1%)
 Frame = -1

Query  1210  GKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGK  1037
             GKT   I   N+ GPY+G+VIPN FEMNPLL+  S++P+  +  +D+AGRRFR GTIEG+
Sbjct  29    GKTLKRIAKLNRNGPYMGLVIPNSFEMNPLLQSPSFQPNESLPYVDFAGRRFRLGTIEGE  88

Query  1036  PVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALW  857
              VILVMTGLAMLNAG+TTQLLL++F V GVVHYGIAGNANP LNIGDV IPQ+W+HT LW
Sbjct  89    KVILVMTGLAMLNAGVTTQLLLALFKVKGVVHYGIAGNANPDLNIGDVTIPQFWAHTGLW  148

Query  856   NWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATN--VDECNSQDNLLNNVWYQPEEIF  683
             NWQRYGDGPE+ELPLE NGDYTR+IG++ FA Y+ +      N+ +NLLNNVWYQPEE+F
Sbjct  149   NWQRYGDGPEDELPLESNGDYTRKIGYLHFADYSIDDGNKTLNTSENLLNNVWYQPEEVF  208

Query  682   PVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASI  503
             P++  PE R H FWVPV+SHYF ++  LE L+L+ CIN+TTCL+  P V RV RG+S+SI
Sbjct  209   PINGIPETRGHAFWVPVNSHYFALSNRLENLKLKNCINSTTCLSSPPVVKRVARGSSSSI  268

Query  502   YLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaAT  323
             ++DNAAYRSFIY+KFN+SP++MESAAVALVCHQQK P+I+ RALSDLAGGG A+SNEA+ 
Sbjct  269   FVDNAAYRSFIYNKFNISPIDMESAAVALVCHQQKTPFIVFRALSDLAGGGEAQSNEASI  328

Query  322   FIDLAADNSVKVAVEFIKKVPS  257
             F  LAA+NSV V V+F+K + S
Sbjct  329   FASLAANNSVTVVVQFLKHLHS  350



>ref|XP_009367891.1| PREDICTED: bark storage protein A-like isoform X4 [Pyrus x bretschneideri]
Length=322

 Score =   444 bits (1142),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 210/313 (67%), Positives = 261/313 (83%), Gaps = 1/313 (0%)
 Frame = -1

Query  1198  MLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFGTIEGKPVILVM  1019
             MLIE AN  GPYLG+VIPN +EM+PLL+  ++  S L ID++GRRFRFGTI  KPVILVM
Sbjct  1     MLIEEANMSGPYLGLVIPNSYEMDPLLQSPNFTSSNLFIDFSGRRFRFGTIANKPVILVM  60

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             TGL+M+NA ITTQLLLS FD+ GVVHYG+A +ANPSLN+ DV IPQYWSH+ALW+WQRYG
Sbjct  61    TGLSMINAAITTQLLLSQFDIEGVVHYGVARHANPSLNLADVVIPQYWSHSALWSWQRYG  120

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
             +GPE+ELPLE +GDYTREIG++  A Y TNV + ++ DNLLNN+W+QPEE+FP+D TPEE
Sbjct  121   NGPEDELPLEKDGDYTREIGYLNVANYTTNVTDGSTYDNLLNNLWFQPEEVFPIDGTPEE  180

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
             RQH FWV VD  Y++I+Q LE L+LE C+N+TTCL H PKV+RVERGTSASI+L NAAYR
Sbjct  181   RQHSFWVAVDPLYYEISQKLEDLQLERCLNSTTCLPHIPKVSRVERGTSASIFLSNAAYR  240

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaes-neaATFIDLAAD  302
             SF++DKFN+SP++MESA+VALVC QQ+VP+I+IRALS  + G  +   NEAA FI LA+ 
Sbjct  241   SFLFDKFNISPLDMESASVALVCLQQRVPFIVIRALSSSSSGSGSSDPNEAAKFISLASK  300

Query  301   NSVKVAVEFIKKV  263
             NSV   VEFI+++
Sbjct  301   NSVMAVVEFIRQL  313



>gb|KHN18182.1| Bark storage protein A [Glycine soja]
Length=355

 Score =   443 bits (1140),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 218/308 (71%), Positives = 258/308 (84%), Gaps = 0/308 (0%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFGTIEGKPVILVMTG  1013
             I  AN++GPYLG++IPN FE++PLL++  Y  S  IID+AGRRFRFG I  KPVILVMTG
Sbjct  37    IAKANQEGPYLGLIIPNSFELDPLLQNPGYTASDTIIDFAGRRFRFGAIGDKPVILVMTG  96

Query  1012  LAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDG  833
             L+++NA ITTQLLLS+F V GVVHYGIAGNANPSL+IGDVAIPQYW+H ALW+WQRYG G
Sbjct  97    LSVINAAITTQLLLSLFTVEGVVHYGIAGNANPSLHIGDVAIPQYWAHLALWSWQRYGLG  156

Query  832   PENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQ  653
             P++ LPLE NGDYTRE+G + FA + +NV   +  DN LNN+WYQPEEIFP+D  PE RQ
Sbjct  157   PDDTLPLEDNGDYTRELGHLNFANFTSNVTADSPFDNQLNNIWYQPEEIFPIDGVPEVRQ  216

Query  652   HIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSF  473
             H+FWVPVDS Y+ IA+ L+ LELE CIN+TTCLT TPKV  V RG S SIYLDNAAYRSF
Sbjct  217   HVFWVPVDSKYYHIAKKLKDLELESCINSTTCLTTTPKVELVNRGISQSIYLDNAAYRSF  276

Query  472   IYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSV  293
             IY+KF VSPV+MESA+VAL+CHQQ+VP+I IRALSDLAGGGSAESNEA TF+ +AA NSV
Sbjct  277   IYNKFEVSPVDMESASVALICHQQRVPFIAIRALSDLAGGGSAESNEADTFLSIAATNSV  336

Query  292   KVAVEFIK  269
              V +EF+K
Sbjct  337   TVVIEFVK  344



>ref|XP_010668210.1| PREDICTED: bark storage protein B-like [Beta vulgaris subsp. 
vulgaris]
Length=348

 Score =   441 bits (1133),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 216/325 (66%), Positives = 262/325 (81%), Gaps = 2/325 (1%)
 Frame = -1

Query  1243  KEGANGSLLDDGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRR  1064
             + GA G +    +T  LI  AN KGPY+GVVIPN+FE+NPLL+  S+  S   ID++GRR
Sbjct  17    QHGAQGEI--SIRTMHLINLANNKGPYIGVVIPNLFELNPLLQSPSFTASDFTIDFSGRR  74

Query  1063  FRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIP  884
             FRFGTI GK VILVMTGL M+NAGITTQLLLS+F + GVVHYGIAGNA+PSL+IGDVAIP
Sbjct  75    FRFGTIAGKKVILVMTGLGMVNAGITTQLLLSLFRIEGVVHYGIAGNADPSLHIGDVAIP  134

Query  883   QYWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVW  704
             QYW H  L NWQR G GP++EL LE  GDY+RE G ++FA Y +N+ + ++ DNLLN +W
Sbjct  135   QYWGHLGLLNWQRDGHGPDDELALEAAGDYSREYGNLRFADYTSNISDNSAPDNLLNRIW  194

Query  703   YQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVE  524
             YQ EE+FP+D TPE+RQH+FWVPVD HYF +A+ L+ L L GC+NATTCL+ TPKV  V 
Sbjct  195   YQAEEVFPIDGTPEQRQHVFWVPVDPHYFNLAKKLQSLNLVGCVNATTCLSTTPKVATVL  254

Query  523   RGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsa  344
             RG SASIY+DNAAYR+FIY++F +SPVEMESA VAL+CHQQ+VPYI +RALSDLAGGGSA
Sbjct  255   RGASASIYVDNAAYRNFIYEQFKLSPVEMESAGVALICHQQRVPYITLRALSDLAGGGSA  314

Query  343   esneaATFIDLAADNSVKVAVEFIK  269
             +SNEA TF+ +AA NSV   VEFIK
Sbjct  315   QSNEADTFLPVAATNSVIAVVEFIK  339



>ref|NP_001276232.1| bark storage protein A-like [Glycine max]
 gb|ACU23193.1| unknown [Glycine max]
Length=366

 Score =   438 bits (1127),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 216/308 (70%), Positives = 256/308 (83%), Gaps = 0/308 (0%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFGTIEGKPVILVMTG  1013
             I  AN++GPYLG++IPN FE++PLL++  Y  S  IID+AGRRFRFG I  KPVILVMTG
Sbjct  48    IAKANQEGPYLGLIIPNSFELDPLLQNPGYTASDTIIDFAGRRFRFGAIGDKPVILVMTG  107

Query  1012  LAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDG  833
             L+++NA ITTQLLLS+F V GVVHYGIAGNANPSL+IGDVAIPQYW+H ALW+WQRYG G
Sbjct  108   LSVINAAITTQLLLSLFTVEGVVHYGIAGNANPSLHIGDVAIPQYWAHLALWSWQRYGLG  167

Query  832   PENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQ  653
             P++ LPLE NGDYTRE+G +  A + +NV   +  DN LNN+WYQPEEIFP+D  PE RQ
Sbjct  168   PDDTLPLEDNGDYTRELGHLNSANFTSNVTADSPFDNQLNNIWYQPEEIFPIDGVPEVRQ  227

Query  652   HIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSF  473
             H+FWVPVDS Y+ IA+ L+ LELE CIN+TTCLT TPKV  V RG S SIYLDNAAYRSF
Sbjct  228   HVFWVPVDSKYYHIAKKLKDLELESCINSTTCLTTTPKVELVNRGISQSIYLDNAAYRSF  287

Query  472   IYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSV  293
             IY+KF VSPV+MESA+VAL+CHQQ+VP+I IRALSDLAGGGSAESNEA TF+ +A  NSV
Sbjct  288   IYNKFEVSPVDMESASVALICHQQRVPFIAIRALSDLAGGGSAESNEADTFLSIATTNSV  347

Query  292   KVAVEFIK  269
              V +EF+K
Sbjct  348   TVVIEFVK  355



>ref|XP_010668205.1| PREDICTED: bark storage protein B-like [Beta vulgaris subsp. 
vulgaris]
Length=341

 Score =   437 bits (1123),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 213/325 (66%), Positives = 264/325 (81%), Gaps = 2/325 (1%)
 Frame = -1

Query  1243  KEGANGSLLDDGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRR  1064
             + GA G +    +T  LI +AN KGPY+GVVIPN+FE+NPLL+  S+  S L ID+AGRR
Sbjct  17    QHGAQGEI--PKRTMHLINSANYKGPYIGVVIPNLFELNPLLQSPSFTSSRLTIDFAGRR  74

Query  1063  FRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIP  884
             FRFGTI GK VILVMTGL M+NAG+TTQ+LLS+F V GVVHYGIAGN +PSL++GDVAIP
Sbjct  75    FRFGTIAGKKVILVMTGLGMVNAGLTTQMLLSLFRVEGVVHYGIAGNTDPSLHVGDVAIP  134

Query  883   QYWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVW  704
             QYW+H  L NWQR GDGPE+EL LE  GDY+R+ G ++F  Y +N+ + +  +NLLN +W
Sbjct  135   QYWAHLGLLNWQRNGDGPEDELALEAAGDYSRDYGNLRFGDYTSNISDNSVPNNLLNRIW  194

Query  703   YQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVE  524
             YQ EE+FPVD TPEERQHIFWVPVD HYF +A+ L+ L+LE C+NATTCL+ TPKV+ V 
Sbjct  195   YQAEEVFPVDGTPEERQHIFWVPVDPHYFNLAKRLKSLKLERCVNATTCLSTTPKVSTVL  254

Query  523   RGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsa  344
             RG SASI++DNAAYR+FIY++F +SPVEMESA VAL+CHQQ+VP+I +RALSDLAGGGS 
Sbjct  255   RGGSASIFVDNAAYRNFIYEQFKLSPVEMESAGVALICHQQRVPFITLRALSDLAGGGSV  314

Query  343   esneaATFIDLAADNSVKVAVEFIK  269
             +SNEA TF+ +AA NSV   VEFI+
Sbjct  315   QSNEADTFLPVAATNSVIAVVEFIE  339



>ref|XP_007012101.1| Phosphorylase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY29720.1| Phosphorylase superfamily protein isoform 1 [Theobroma cacao]
Length=347

 Score =   437 bits (1123),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 214/326 (66%), Positives = 265/326 (81%), Gaps = 2/326 (1%)
 Frame = -1

Query  1234  ANGSLLDDGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRF  1055
             A+G++    + + LI  A   GPY+GVVIPN+FE++PLL + ++  +   I ++GRRFRF
Sbjct  24    ADGAV--SAEVQKLIHEAKLNGPYVGVVIPNLFELSPLLHNPNFTSANFTIPFSGRRFRF  81

Query  1054  GTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYW  875
             G I  K VILVMTGL+++NAGITTQLLL++F + GVVHYGIA NANPSLNIGDV IP+YW
Sbjct  82    GAIGEKRVILVMTGLSLINAGITTQLLLTLFKIEGVVHYGIAVNANPSLNIGDVTIPKYW  141

Query  874   SHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQP  695
             S T+LW WQRYGDGP +EL LE NGDYTRE+GF+KFA + TNV    S DNLLNNVWYQP
Sbjct  142   SQTSLWYWQRYGDGPSDELTLESNGDYTRELGFLKFANFTTNVTASPSHDNLLNNVWYQP  201

Query  694   EEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGT  515
             EE+F +D TPE+RQH FWVPVDS Y +IA++L  L+LEGC+N+TTCL   P+V  V+RGT
Sbjct  202   EEVFFIDGTPEQRQHAFWVPVDSKYLRIAKTLADLKLEGCLNSTTCLDEQPRVVTVQRGT  261

Query  514   SASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesn  335
             S S++LDNAAYRSFIY KFNVSPV+MESA+VAL+C QQ+VP+IIIRALSDLAGGGSAESN
Sbjct  262   SGSVFLDNAAYRSFIYSKFNVSPVDMESASVALICLQQRVPFIIIRALSDLAGGGSAESN  321

Query  334   eaATFIDLAADNSVKVAVEFIKKVPS  257
             EA  F  LAA+N+V V +EFIK++ +
Sbjct  322   EADIFTSLAANNAVTVVMEFIKQLSA  347



>gb|KEH36049.1| bark storage-like protein [Medicago truncatula]
Length=357

 Score =   434 bits (1115),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 211/314 (67%), Positives = 260/314 (83%), Gaps = 2/314 (1%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFGTIEGKPVILVMTG  1013
             I   N++GPYLG++IPN FE+NPLL++  Y PS  IID+AGRRFRFG+I  KPVILVMTG
Sbjct  39    IAKINEEGPYLGLIIPNSFELNPLLQNPGYTPSDSIIDFAGRRFRFGSIGEKPVILVMTG  98

Query  1012  LAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDG  833
             L+++NA ITTQLLLS F V GVVHYGIAGNANPSL+IGDVAIP YW+H ALW+WQRYG  
Sbjct  99    LSVINAAITTQLLLSFFKVDGVVHYGIAGNANPSLHIGDVAIPHYWAHLALWSWQRYGQD  158

Query  832   PENELPLEVNGDYTREIGFIKFAKYATNVDECNS--QDNLLNNVWYQPEEIFPVDATPEE  659
              ++ LPLE+NGDYTR++GF+KF+ + +N+   +S   DN LNN+WYQPEEIFPVD  PE+
Sbjct  159   ADDTLPLEINGDYTRDVGFLKFSDFTSNISAADSVTVDNHLNNLWYQPEEIFPVDGIPEQ  218

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
             RQH  WVPVDS Y++IA+ LE ++L+ CI++ TCLT TPKV  VERGTSA  YLDNAAYR
Sbjct  219   RQHALWVPVDSEYYRIAKKLEQMKLDACIDSDTCLTTTPKVVLVERGTSAGFYLDNAAYR  278

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
             +FI++KFNVSPV+MESA+VAL+C QQ++P+I IRALSDLAGGG+AESNEA TF  LAA N
Sbjct  279   TFIFNKFNVSPVDMESASVALICLQQRIPFIAIRALSDLAGGGTAESNEADTFSPLAATN  338

Query  298   SVKVAVEFIKKVPS  257
             SV V +EF+K + S
Sbjct  339   SVAVVIEFVKLLSS  352



>gb|KEH36051.1| bark storage-like protein [Medicago truncatula]
Length=355

 Score =   433 bits (1114),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 211/310 (68%), Positives = 258/310 (83%), Gaps = 2/310 (1%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFGTIEGKPVILVMTG  1013
             I   N++GPYLG++IPN FE+NPLL++  Y PS  IID+AGRRFRFG+I  KPVILVMTG
Sbjct  39    IAKINEEGPYLGLIIPNSFELNPLLQNPGYTPSDSIIDFAGRRFRFGSIGEKPVILVMTG  98

Query  1012  LAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDG  833
             L+++NA ITTQLLLS F V GVVHYGIAGNANPSL+IGDVAIP YW+H ALW+WQRYG  
Sbjct  99    LSVINAAITTQLLLSFFKVDGVVHYGIAGNANPSLHIGDVAIPHYWAHLALWSWQRYGQD  158

Query  832   PENELPLEVNGDYTREIGFIKFAKYATNVDECNS--QDNLLNNVWYQPEEIFPVDATPEE  659
              ++ LPLE+NGDYTR++GF+KF+ + +N+   NS   +N LNN+WYQPEEIFPVD  PE+
Sbjct  159   ADDTLPLEINGDYTRDVGFLKFSDFTSNISAANSFTVNNHLNNLWYQPEEIFPVDGIPEQ  218

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
             RQH  WVPVDS Y++IA+ LE ++LE CI++ TCLT TPKV  VERGTSA  YLDNAAYR
Sbjct  219   RQHALWVPVDSKYYRIAKKLEQMKLEACIDSDTCLTTTPKVVLVERGTSAGFYLDNAAYR  278

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
             +FI++KFNVSPV+MESA+VAL+C QQ++P+I IRALSDLAGGG+AESNEA TF  LAA N
Sbjct  279   TFIFNKFNVSPVDMESASVALICLQQRIPFIAIRALSDLAGGGTAESNEADTFSPLAATN  338

Query  298   SVKVAVEFIK  269
             SV V +EF+K
Sbjct  339   SVAVVIEFVK  348



>ref|XP_010668197.1| PREDICTED: bark storage protein A-like [Beta vulgaris subsp. 
vulgaris]
Length=342

 Score =   431 bits (1109),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 215/325 (66%), Positives = 257/325 (79%), Gaps = 2/325 (1%)
 Frame = -1

Query  1243  KEGANGSLLDDGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRR  1064
             + GA G +    KT  +I  AN KGPY+GVVIPN+FE+NPLL+  SYK S   ID++GRR
Sbjct  17    QHGAKGEI--PRKTMHMINVANMKGPYIGVVIPNLFELNPLLQSPSYKSSNFNIDFSGRR  74

Query  1063  FRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIP  884
             FRFGTI  K VILVMTGL M+NAG+TTQLLL++F V GVVHYGIAGNA+PSL+IGDVAIP
Sbjct  75    FRFGTIANKKVILVMTGLGMVNAGVTTQLLLNLFRVSGVVHYGIAGNADPSLHIGDVAIP  134

Query  883   QYWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVW  704
             QYW+H  L NWQR G GP  EL LE  GDY+R+ G ++FA Y TN+      DN LN  W
Sbjct  135   QYWAHLGLLNWQRNGHGPNEELALEAAGDYSRKYGNLRFADYTTNIKHNKKVDNQLNRFW  194

Query  703   YQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVE  524
             YQ EE+FPVD TPEERQH+FW+PVD+HYF++A+ L+ ++LE C+NATTCL   PK++ V 
Sbjct  195   YQAEEVFPVDGTPEERQHVFWIPVDAHYFKLAKKLQNIKLEQCVNATTCLPTRPKMSTVL  254

Query  523   RGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsa  344
             RG SASIY+DNAAYRS IYDKF +SPVEMESA VAL+CHQQ+VP+I +RALSDLAGGGSA
Sbjct  255   RGASASIYVDNAAYRSSIYDKFKLSPVEMESAGVALICHQQRVPHITLRALSDLAGGGSA  314

Query  343   esneaATFIDLAADNSVKVAVEFIK  269
             ESNEA TF+ +AA NSV   VEFIK
Sbjct  315   ESNEADTFLPVAAKNSVIAVVEFIK  339



>ref|XP_008220062.1| PREDICTED: bark storage protein A-like [Prunus mume]
 ref|XP_008220063.1| PREDICTED: bark storage protein A-like [Prunus mume]
 ref|XP_008220064.1| PREDICTED: bark storage protein A-like [Prunus mume]
Length=353

 Score =   431 bits (1107),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 210/327 (64%), Positives = 262/327 (80%), Gaps = 3/327 (1%)
 Frame = -1

Query  1240  EGANGSLLDDGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRF  1061
             + +NG+L    +T+MLIE AN  GPYLG+VIPN FEM+PLL+  ++  S L ID++GRRF
Sbjct  20    QQSNGAL--SAETQMLIEEANMSGPYLGLVIPNSFEMDPLLQSPNFTSSNLFIDFSGRRF  77

Query  1060  RFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQ  881
             RFGTI  K VILVMTGL+M+NA ITTQLLLSVF++ GVVHYGIAG+ANPS N+ DV IPQ
Sbjct  78    RFGTIANKQVILVMTGLSMINAAITTQLLLSVFNIEGVVHYGIAGHANPSFNLADVVIPQ  137

Query  880   YWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWY  701
             YWSH+ALW+WQRYG GP++ELPLE NGDYTRE G++  A Y  N  + +S DNLLNN+W+
Sbjct  138   YWSHSALWSWQRYGKGPQDELPLEANGDYTREFGYLNVANYTVNATDGSSYDNLLNNIWF  197

Query  700   QPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVER  521
             QPEE+FP+D TPEERQH FWV VD  Y++I+Q LE LELE C+NATTCL HTPKV RV+R
Sbjct  198   QPEEVFPIDGTPEERQHAFWVAVDPLYYEISQKLEELELERCLNATTCLPHTPKVARVQR  257

Query  520   GTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsae  341
             GTSASI+L NAAYRSF+YDKFN++P++MESA+V L+C QQ+VP+I IR+LS    GG + 
Sbjct  258   GTSASIFLSNAAYRSFLYDKFNITPLDMESASVGLICLQQRVPFIAIRSLSSSLTGGGSG  317

Query  340   sneaAT-FIDLAADNSVKVAVEFIKKV  263
                 A+ FI LA+ NSV   VEFI+++
Sbjct  318   DPNEASKFITLASKNSVTAVVEFIEQL  344



>ref|XP_007224794.1| hypothetical protein PRUPE_ppa023740mg, partial [Prunus persica]
 gb|EMJ25993.1| hypothetical protein PRUPE_ppa023740mg, partial [Prunus persica]
Length=298

 Score =   426 bits (1096),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 197/281 (70%), Positives = 240/281 (85%), Gaps = 0/281 (0%)
 Frame = -1

Query  1210  GKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFGTIEGKPV  1031
               T+ LI+ ANK+GPYLG+VIPN FEMNPLL+   +  + LIID++GRRFRFGTI  K V
Sbjct  7     ANTQKLIDEANKRGPYLGLVIPNSFEMNPLLQSPHFTSTDLIIDFSGRRFRFGTIANKKV  66

Query  1030  ILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNW  851
             ILVMTGL+++NAGITTQLLL++F++ GVVHYGIAGNANPSLNI DVAIP YW+HTALWNW
Sbjct  67    ILVMTGLSLINAGITTQLLLTLFNIEGVVHYGIAGNANPSLNIADVAIPHYWAHTALWNW  126

Query  850   QRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDA  671
             QRYG GP++ELPLE NGDYTRE G++  A Y  NV + +S DNLLNN+W+QPEE+FP+D 
Sbjct  127   QRYGKGPQDELPLEANGDYTREFGYLNVANYTVNVTDGSSYDNLLNNIWFQPEEVFPIDG  186

Query  670   TPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDN  491
             TPEERQH FWV VD  Y++I+Q LE LELE C+NATTCL HTPKV RV+RGTSASI+L N
Sbjct  187   TPEERQHAFWVAVDPLYYEISQKLEELELERCLNATTCLPHTPKVARVQRGTSASIFLSN  246

Query  490   AAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALS  368
             AAYRSF+YDKFN++P++MESA+VAL+C QQ+VP+I IR+LS
Sbjct  247   AAYRSFLYDKFNITPLDMESASVALICLQQRVPFIAIRSLS  287



>ref|XP_007137203.1| hypothetical protein PHAVU_009G108300g [Phaseolus vulgaris]
 gb|ESW09197.1| hypothetical protein PHAVU_009G108300g [Phaseolus vulgaris]
Length=381

 Score =   424 bits (1089),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 203/308 (66%), Positives = 253/308 (82%), Gaps = 0/308 (0%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFGTIEGKPVILVMTG  1013
             I  AN++GPYLG+VIP  FE++PLL++ +Y  S  IID AGRRFRFG I  KPVILVMTG
Sbjct  68    IAEANQEGPYLGLVIPITFELHPLLQNPAYTASDTIIDLAGRRFRFGAIGEKPVILVMTG  127

Query  1012  LAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDG  833
             L+++NA ITTQLLLS F + GVVHYGIAGNANPSL++GDV IPQ+W+H  LW+WQRYG G
Sbjct  128   LSIINAAITTQLLLSFFAIEGVVHYGIAGNANPSLHVGDVTIPQHWAHLGLWSWQRYGLG  187

Query  832   PENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQ  653
             P+++LPLE NGDYTR IGF+ FA + +NV    S DN LNN+W+QPEEIFPVD  PEERQ
Sbjct  188   PDDKLPLENNGDYTRNIGFLNFADFTSNVSADISADNQLNNIWFQPEEIFPVDGIPEERQ  247

Query  652   HIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSF  473
             H FWVP+D +Y+ IA+ L+ LELE CIN+TTCLT  PKV  V+RG S SIY+DN+AYR+F
Sbjct  248   HAFWVPIDPNYYHIAKKLQDLELERCINSTTCLTSIPKVEFVKRGISQSIYVDNSAYRTF  307

Query  472   IYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSV  293
             +Y+KF  SPV+ME+A+VALVCHQQ++P+I IRA+SDLAGGGSA +NEA TF+ +AA N+V
Sbjct  308   MYNKFEASPVDMETASVALVCHQQRLPFIAIRAVSDLAGGGSAGANEADTFLSIAATNAV  367

Query  292   KVAVEFIK  269
              V +EF+K
Sbjct  368   SVVIEFVK  375



>ref|XP_003636438.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Medicago 
truncatula]
Length=734

 Score =   435 bits (1118),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 213/323 (66%), Positives = 263/323 (81%), Gaps = 2/323 (1%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFGTIEGKPVILVMTG  1013
             I   N++GPYLG++IPN FE+NPLL++  Y PS  IID+AGRRFRFG+I  KPVILVMTG
Sbjct  39    IAKINEEGPYLGLIIPNSFELNPLLQNPGYTPSDSIIDFAGRRFRFGSIGEKPVILVMTG  98

Query  1012  LAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDG  833
             L+++NA ITTQLLLS F V GVVHYGIAGNANPSL+IGDVAIP YW+H ALW+WQRYG  
Sbjct  99    LSVINAAITTQLLLSFFKVDGVVHYGIAGNANPSLHIGDVAIPHYWAHLALWSWQRYGQD  158

Query  832   PENELPLEVNGDYTREIGFIKFAKYATNVDECNS--QDNLLNNVWYQPEEIFPVDATPEE  659
              ++ LPLE+NGDYTR++GF+KF+ + +N+   +S   DN LNN+WYQPEEIFPVD  PE+
Sbjct  159   ADDTLPLEINGDYTRDVGFLKFSDFTSNISAADSVTVDNHLNNLWYQPEEIFPVDGIPEQ  218

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
             RQH  WVPVDS Y++IA+ LE ++L+ CI++ TCLT TPKV  VERGTSA  YLDNAAYR
Sbjct  219   RQHALWVPVDSEYYRIAKKLEQMKLDACIDSDTCLTTTPKVVLVERGTSAGFYLDNAAYR  278

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
             +FI++KFNVSPV+MESA+VAL+C QQ++P+I IRALSDLAGGG+AESNEA TF  LAA N
Sbjct  279   TFIFNKFNVSPVDMESASVALICLQQRIPFIAIRALSDLAGGGTAESNEADTFSPLAATN  338

Query  298   SVKVAVEFIKKVPSPNRSAGLIS  230
             SV V +EF+K + S +     IS
Sbjct  339   SVAVVIEFVKLLSSHHSKWSFIS  361


 Score =   434 bits (1115),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 211/310 (68%), Positives = 258/310 (83%), Gaps = 2/310 (1%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFGTIEGKPVILVMTG  1013
             I   N++GPYLG++IPN FE+NPLL++  Y PS  IID+AGRRFRFG+I  KPVILVMTG
Sbjct  418   IAKINEEGPYLGLIIPNSFELNPLLQNPGYTPSDSIIDFAGRRFRFGSIGEKPVILVMTG  477

Query  1012  LAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDG  833
             L+++NA ITTQLLLS F V GVVHYGIAGNANPSL+IGDVAIP YW+H ALW+WQRYG  
Sbjct  478   LSVINAAITTQLLLSFFKVDGVVHYGIAGNANPSLHIGDVAIPHYWAHLALWSWQRYGQD  537

Query  832   PENELPLEVNGDYTREIGFIKFAKYATNVDECNS--QDNLLNNVWYQPEEIFPVDATPEE  659
              ++ LPLE+NGDYTR++GF+KF+ + +N+   NS   +N LNN+WYQPEEIFPVD  PE+
Sbjct  538   ADDTLPLEINGDYTRDVGFLKFSDFTSNISAANSFTVNNHLNNLWYQPEEIFPVDGIPEQ  597

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
             RQH  WVPVDS Y++IA+ LE ++LE CI++ TCLT TPKV  VERGTSA  YLDNAAYR
Sbjct  598   RQHALWVPVDSKYYRIAKKLEQMKLEACIDSDTCLTTTPKVVLVERGTSAGFYLDNAAYR  657

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
             +FI++KFNVSPV+MESA+VAL+C QQ++P+I IRALSDLAGGG+AESNEA TF  LAA N
Sbjct  658   TFIFNKFNVSPVDMESASVALICLQQRIPFIAIRALSDLAGGGTAESNEADTFSPLAATN  717

Query  298   SVKVAVEFIK  269
             SV V +EF+K
Sbjct  718   SVAVVIEFVK  727



>gb|ABR16427.1| unknown [Picea sitchensis]
Length=346

 Score =   420 bits (1079),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 204/321 (64%), Positives = 260/321 (81%), Gaps = 3/321 (1%)
 Frame = -1

Query  1225  SLLDDGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFGTI  1046
             +LL   K + +I   N+ GPYLG+V+PN FEM+PLL+ SS+  S   +D AGRRF  G+I
Sbjct  29    ALLPLPKVQRIIRKINRHGPYLGIVVPNAFEMDPLLQSSSFNVSK-TLDVAGRRFHIGSI  87

Query  1045  EGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHT  866
                 VI+VM+GL MLN+GITTQLLLS F+V GVVHYGIAGNAN SL+IGDV IP+YW+HT
Sbjct  88    HKHRVIIVMSGLGMLNSGITTQLLLSFFEVKGVVHYGIAGNANSSLHIGDVTIPRYWAHT  147

Query  865   ALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEI  686
              LWNWQRYGDGP +EL LE NGDYTR+IG++ FA + T  ++  S  NLLNNVWYQPEE+
Sbjct  148   GLWNWQRYGDGPSDELSLESNGDYTRQIGYLDFANFTTPSNQ--SSGNLLNNVWYQPEEV  205

Query  685   FPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSAS  506
             FPV+ TPE RQH FWVPVD HY+QIA+SLE L+LEGC+N+TTCL++TPK   VERG+SA+
Sbjct  206   FPVNGTPEVRQHAFWVPVDEHYYQIAKSLETLKLEGCLNSTTCLSNTPKAVLVERGSSAN  265

Query  505   IYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaA  326
             +++DNAAYR+F+Y KFN+SP++MESAAVALVC +Q +P+I IR+LSDLAGGG++ESN+AA
Sbjct  266   VFVDNAAYRNFLYTKFNISPIDMESAAVALVCLEQGLPFIAIRSLSDLAGGGTSESNQAA  325

Query  325   TFIDLAADNSVKVAVEFIKKV  263
              F  LA+ N+V   ++FIK +
Sbjct  326   VFAGLASQNAVTAVIQFIKDL  346



>ref|XP_010254051.1| PREDICTED: bark storage protein A [Nelumbo nucifera]
Length=349

 Score =   416 bits (1068),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 203/323 (63%), Positives = 254/323 (79%), Gaps = 6/323 (2%)
 Frame = -1

Query  1225  SLLDDGKTRMLIENA---NKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRF  1061
             S +D   T+ +++     NKKGPYLGVV+PN FEMNPLL+  S+        +D++GRRF
Sbjct  23    SRVDGATTKKVMKKITAINKKGPYLGVVVPNSFEMNPLLQSGSFVVDEKFPYLDFSGRRF  82

Query  1060  RFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQ  881
             R G +EG+ VI+VMTGL+MLNAGITTQLLLS+F V GVVH+GIAGNANP L IGDV IPQ
Sbjct  83    RVGKLEGEKVIVVMTGLSMLNAGITTQLLLSLFRVKGVVHFGIAGNANPELQIGDVTIPQ  142

Query  880   YWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWY  701
             YW+HT LWNWQR+GDGP++EL LE +GDYTR+IG++KF+ Y  + ++  S +NLLN+VWY
Sbjct  143   YWAHTGLWNWQRFGDGPDDELALESSGDYTRKIGYLKFSDYNNDTEKGKSSENLLNSVWY  202

Query  700   QPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVER  521
             QPEEIFPVD  PE RQH FWVPV +HYF + + LEG+ELEGCIN +TCL  TP+V RVER
Sbjct  203   QPEEIFPVDGIPEVRQHSFWVPVSNHYFSVVKKLEGMELEGCIN-STCLPRTPRVIRVER  261

Query  520   GTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsae  341
             G SA+ ++DNAAYR F+  KFNV+ ++MESAAVAL+C QQ+ P+I IRALSDLAGGGS+ 
Sbjct  262   GASANTFVDNAAYRQFLNSKFNVTAIDMESAAVALICLQQRTPFIAIRALSDLAGGGSSL  321

Query  340   sneaATFIDLAADNSVKVAVEFI  272
             SNEA  F  LAA N+V V + F+
Sbjct  322   SNEAGMFAPLAAQNAVSVLLRFV  344



>gb|KCW81554.1| hypothetical protein EUGRSUZ_C029101, partial [Eucalyptus grandis]
Length=274

 Score =   411 bits (1056),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 198/271 (73%), Positives = 233/271 (86%), Gaps = 0/271 (0%)
 Frame = -1

Query  1069  RRFRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVA  890
             RRFRFGT+E + VILVMTGL+++NA ITTQLLLS F+V GV+HYGIAGNANP L+IGDVA
Sbjct  1     RRFRFGTVEERKVILVMTGLSVINAAITTQLLLSFFNVEGVIHYGIAGNANPDLHIGDVA  60

Query  889   IPQYWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNN  710
             IPQYW+HT LWNWQRYG G E+EL LE +GDYTR +G+++FA Y TNV  C S DNLLNN
Sbjct  61    IPQYWAHTGLWNWQRYGQGTEDELALESSGDYTRTLGYLRFANYTTNVTGCASHDNLLNN  120

Query  709   VWYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTR  530
             +WYQPEE+FPV  TPEERQH FWVPV S YF +A+ LEGL+LE C+NATTCL +TP V+ 
Sbjct  121   IWYQPEEVFPVTGTPEERQHEFWVPVGSTYFAVAKKLEGLKLESCVNATTCLNYTPSVST  180

Query  529   VERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLaggg  350
             VERG SASIYLDN+AYRSFIYDKFNVSPV+MESA+VAL+C+QQ   +I IRALSDLAGGG
Sbjct  181   VERGVSASIYLDNSAYRSFIYDKFNVSPVDMESASVALICYQQNTSFIAIRALSDLAGGG  240

Query  349   saesneaATFIDLAADNSVKVAVEFIKKVPS  257
             SAESNEA TF++LA+DN+V V VEFIK++ S
Sbjct  241   SAESNEADTFVNLASDNAVTVVVEFIKQLSS  271



>emb|CBI28039.3| unnamed protein product [Vitis vinifera]
Length=329

 Score =   412 bits (1060),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 201/309 (65%), Positives = 244/309 (79%), Gaps = 3/309 (1%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVM  1019
             I   NK+GPYLG+V+PN +EM+PLL+  S+        +D+AGRRFR G +E K VI+VM
Sbjct  17    ITRVNKEGPYLGIVVPNSYEMDPLLQSPSFVADDKFPYLDFAGRRFRIGKLETKNVIIVM  76

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             TGL+MLNAG+TTQLLLS+F V GV+HYGIAGNANP+L IGDV +P+YW+HT LWNWQRYG
Sbjct  77    TGLSMLNAGLTTQLLLSLFKVNGVLHYGIAGNANPNLQIGDVTVPKYWAHTGLWNWQRYG  136

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
             DGP +EL  E +GDYTR+IG++KF+ Y  +    NS DNLLNNVWYQPEE+FPV  TPE 
Sbjct  137   DGPGDELAFESSGDYTRKIGYLKFSDYNNHTKNGNSSDNLLNNVWYQPEEVFPVTGTPEV  196

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
             RQH FWVPVD H++Q+A  L+ L+LEGC+N +TCL   P VTRVERG SA++++DN AYR
Sbjct  197   RQHAFWVPVDKHFYQVAGKLKDLKLEGCVN-STCLPRAPMVTRVERGVSANVFVDNGAYR  255

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
              F+Y KFN +PV+MESAAVALVC QQK P+I IRALSDLAGGGSA SNEA+ F  LAA N
Sbjct  256   EFLYSKFNATPVDMESAAVALVCLQQKTPFIAIRALSDLAGGGSALSNEASVFSSLAAQN  315

Query  298   SVKVAVEFI  272
             SV   V FI
Sbjct  316   SVDALVRFI  324



>ref|XP_002280745.2| PREDICTED: bark storage protein A [Vitis vinifera]
Length=347

 Score =   412 bits (1060),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 201/309 (65%), Positives = 244/309 (79%), Gaps = 3/309 (1%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVM  1019
             I   NK+GPYLG+V+PN +EM+PLL+  S+        +D+AGRRFR G +E K VI+VM
Sbjct  35    ITRVNKEGPYLGIVVPNSYEMDPLLQSPSFVADDKFPYLDFAGRRFRIGKLETKNVIIVM  94

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             TGL+MLNAG+TTQLLLS+F V GV+HYGIAGNANP+L IGDV +P+YW+HT LWNWQRYG
Sbjct  95    TGLSMLNAGLTTQLLLSLFKVNGVLHYGIAGNANPNLQIGDVTVPKYWAHTGLWNWQRYG  154

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
             DGP +EL  E +GDYTR+IG++KF+ Y  +    NS DNLLNNVWYQPEE+FPV  TPE 
Sbjct  155   DGPGDELAFESSGDYTRKIGYLKFSDYNNHTKNGNSSDNLLNNVWYQPEEVFPVTGTPEV  214

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
             RQH FWVPVD H++Q+A  L+ L+LEGC+N +TCL   P VTRVERG SA++++DN AYR
Sbjct  215   RQHAFWVPVDKHFYQVAGKLKDLKLEGCVN-STCLPRAPMVTRVERGVSANVFVDNGAYR  273

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
              F+Y KFN +PV+MESAAVALVC QQK P+I IRALSDLAGGGSA SNEA+ F  LAA N
Sbjct  274   EFLYSKFNATPVDMESAAVALVCLQQKTPFIAIRALSDLAGGGSALSNEASVFSSLAAQN  333

Query  298   SVKVAVEFI  272
             SV   V FI
Sbjct  334   SVDALVRFI  342



>gb|KDP33702.1| hypothetical protein JCGZ_07273 [Jatropha curcas]
Length=346

 Score =   407 bits (1046),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 194/309 (63%), Positives = 250/309 (81%), Gaps = 6/309 (2%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVM  1019
             I+  NK+GPYLG+V+PN FEMNPLL+  S++P+  +  +D++GRRFR G +E   VI+VM
Sbjct  39    IDRVNKEGPYLGIVVPNAFEMNPLLQSPSFEPNLQLPYLDFSGRRFRIGKVENVKVIIVM  98

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             TGL+M+NAG+TTQLLLS+F V GV+HYGIAGNANPSL IGDV IPQYW+HT LW+WQR+G
Sbjct  99    TGLSMINAGVTTQLLLSLFKVNGVLHYGIAGNANPSLQIGDVTIPQYWAHTGLWSWQRFG  158

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
             + P ++LPLE NGDYTREIGF++F+ +    +   S +NLLN VWYQPEEIFPV+  PE 
Sbjct  159   EEPNDQLPLESNGDYTREIGFLEFSHFN---NRSKSVENLLNRVWYQPEEIFPVNGIPEA  215

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
             R+H FWVPVD+HYF++A+ L+GL+L GC+N +TCL  TP V RVERG SAS+++DN+AYR
Sbjct  216   REHAFWVPVDNHYFEVAKKLQGLKLGGCVN-STCLPRTPMVVRVERGISASVFVDNSAYR  274

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
              F+  KFN +P++MESAA+AL+CHQQ++P+I IRALSDLAGGGSA SNEA  F  LAA N
Sbjct  275   EFLNSKFNATPIDMESAAIALICHQQEIPFITIRALSDLAGGGSAVSNEADIFSSLAAQN  334

Query  298   SVKVAVEFI  272
             +V   + FI
Sbjct  335   AVDALLRFI  343



>ref|XP_010100640.1| Bark storage protein A [Morus notabilis]
 gb|EXB83505.1| Bark storage protein A [Morus notabilis]
Length=350

 Score =   407 bits (1045),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 199/328 (61%), Positives = 248/328 (76%), Gaps = 4/328 (1%)
 Frame = -1

Query  1234  ANGSLLDDGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSY--KPSTLIIDYAGRRF  1061
             ANGS+     T   I   N+KGPYLG+VIPN FE++PLL+ SS+   P    +D++GRRF
Sbjct  25    ANGSV--SSFTLKKISGINEKGPYLGIVIPNAFELDPLLQSSSFVADPHHPFVDFSGRRF  82

Query  1060  RFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQ  881
             R G +E + VILVMTGL+MLNAGI TQLL+++F V GVVHYGIAGNANP L IGDV IP+
Sbjct  83    RIGKLERQKVILVMTGLSMLNAGIATQLLVTLFKVKGVVHYGIAGNANPKLQIGDVTIPE  142

Query  880   YWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWY  701
             YW+HT LWNWQR+GDGP++EL LE NGDYTR+IG++ F+ +     E    DNLLNNVWY
Sbjct  143   YWAHTGLWNWQRFGDGPDDELSLESNGDYTRKIGYLDFSDFNNKTAEGKFVDNLLNNVWY  202

Query  700   QPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVER  521
             QPEE+FPV   PE RQH+FWVPV+  YF  AQ LE ++L GC+N TTCL   P VTRV+R
Sbjct  203   QPEEVFPVFGHPETRQHVFWVPVNQQYFAAAQKLESVKLRGCVNTTTCLPRNPVVTRVKR  262

Query  520   GTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsae  341
             G SA++++DN AYR F+  KFN +P++MESAAVALVC QQK P+I IRALSDLAGGGS+ 
Sbjct  263   GVSANVFVDNKAYREFLNSKFNATPIDMESAAVALVCFQQKKPFITIRALSDLAGGGSSL  322

Query  340   sneaATFIDLAADNSVKVAVEFIKKVPS  257
             SNEA+ F  LA+ N+V V + F+  + S
Sbjct  323   SNEASIFASLASQNAVDVVIRFVALLSS  350



>ref|XP_006381729.1| nucleosidase-related family protein [Populus trichocarpa]
 gb|ERP59526.1| nucleosidase-related family protein [Populus trichocarpa]
Length=351

 Score =   402 bits (1034),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 194/313 (62%), Positives = 239/313 (76%), Gaps = 3/313 (1%)
 Frame = -1

Query  1204  TRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPV  1031
             T   I+  N+KGPYLG+V+PN FEMNPLL+  S+     +  +DY GRRFRFG +E + V
Sbjct  35    TMQEIDRVNEKGPYLGIVVPNSFEMNPLLQSPSFVADLEVPYLDYFGRRFRFGKVENEKV  94

Query  1030  ILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNW  851
             I+VMTGL+MLNAGI TQLLL +F V GV+HYGIAGNANP L IGDV IPQYW+HT LWNW
Sbjct  95    IIVMTGLSMLNAGIATQLLLILFKVKGVLHYGIAGNANPQLQIGDVTIPQYWAHTGLWNW  154

Query  850   QRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDA  671
             QRYGDGP  EL LE NGDYTREIG+++FA Y    +     DN LNNVWYQPEE+FP D 
Sbjct  155   QRYGDGPNEELALESNGDYTREIGYLRFANYQNASENGKPVDNFLNNVWYQPEEVFPADG  214

Query  670   TPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDN  491
              PE RQH FWVPV+ HYF++A+ +EG+  + C+N +TCL   PK  RV+ G SA+ ++DN
Sbjct  215   IPEVRQHSFWVPVNKHYFKVAKRIEGMTFQRCVN-STCLPRAPKAVRVKSGASANAFVDN  273

Query  490   AAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDL  311
             +AYR F+  KFN++P++MESAAVALVCHQQ++P+I IRALSDLAGGGSA SNEA  F  L
Sbjct  274   SAYREFLNSKFNITPIDMESAAVALVCHQQQIPFIAIRALSDLAGGGSAVSNEAGIFASL  333

Query  310   AADNSVKVAVEFI  272
             AA N+V  ++ FI
Sbjct  334   AAQNAVDASLRFI  346



>ref|XP_007013111.1| Phosphorylase superfamily protein [Theobroma cacao]
 gb|EOY30730.1| Phosphorylase superfamily protein [Theobroma cacao]
Length=347

 Score =   402 bits (1033),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 193/314 (61%), Positives = 244/314 (78%), Gaps = 3/314 (1%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVM  1019
             I   N++GPYLG+++PN FEMNPL++  S+     +  +D++GRRFR G ++ + VI+VM
Sbjct  35    ISRINEEGPYLGIIVPNSFEMNPLMQSGSFVADLELPYLDFSGRRFRIGRLKNEKVIIVM  94

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             TGL+MLNAGI TQLLLS+F V GV+HYG+AG+ANP L IGDV IPQYW+HT LWNWQRYG
Sbjct  95    TGLSMLNAGIATQLLLSLFKVKGVLHYGVAGSANPQLQIGDVTIPQYWAHTGLWNWQRYG  154

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
             DGPE+EL LE NGDYTR+IG++KF+ Y    +   S +NLLNNVWYQPEEIFPV+  PE+
Sbjct  155   DGPEDELALESNGDYTRKIGYLKFSDYNNGTECSKSSENLLNNVWYQPEEIFPVNGIPEQ  214

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
             RQH FWVPV+ HYF IA+ ++GL L  C+N TTCL   P V RV+RG SA+++ DN AYR
Sbjct  215   RQHAFWVPVNKHYFAIAERVQGLSLGRCVN-TTCLPRNPMVVRVKRGISANVFTDNRAYR  273

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
              F+Y KFN + ++ME+AA+ALVCHQQK+P+I  R+LSDLAGGGSA SNEAA F  LAA N
Sbjct  274   EFLYSKFNATAIDMETAAIALVCHQQKMPFIAFRSLSDLAGGGSALSNEAAVFATLAAQN  333

Query  298   SVKVAVEFIKKVPS  257
             SV V + FI  + S
Sbjct  334   SVSVLLGFISLLSS  347



>ref|XP_011012465.1| PREDICTED: bark storage protein A isoform X1 [Populus euphratica]
Length=351

 Score =   400 bits (1027),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 190/309 (61%), Positives = 239/309 (77%), Gaps = 3/309 (1%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVM  1019
             I+  N+KGPYLG+++PN FEMNPLL+  S+     +  +DY GRRFRFG +E + VI+VM
Sbjct  39    IDRVNEKGPYLGIIVPNSFEMNPLLQSPSFVADLKVPYLDYFGRRFRFGKVENEKVIIVM  98

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             TGL+MLNAGITTQLLL +F V GV+HYGIAGNANP L IGDV IP+YW+HT LWNWQRYG
Sbjct  99    TGLSMLNAGITTQLLLILFKVKGVLHYGIAGNANPQLQIGDVTIPRYWAHTGLWNWQRYG  158

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
             DG   EL LE NGDYTREIG+++FA Y    +     DN LNNVWYQPEE+FP D  PE 
Sbjct  159   DGTSEELALESNGDYTREIGYLRFANYQNASENGKPIDNFLNNVWYQPEEVFPADGIPEV  218

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
             RQH FWVPV+ HYF++A+ +EG+  +GC+ ++TCL   P+  RV+ G SA+ ++DN+AYR
Sbjct  219   RQHSFWVPVNKHYFKVAKRIEGMTFQGCV-SSTCLPRAPRAVRVKNGASANAFVDNSAYR  277

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
              F+  KFN++P++MESAAVALVCHQQ++P+I IRALSDLAGGGSA SNEA  F  LAA N
Sbjct  278   EFLNSKFNITPIDMESAAVALVCHQQQIPFIAIRALSDLAGGGSAVSNEADIFASLAAQN  337

Query  298   SVKVAVEFI  272
             +V  ++ FI
Sbjct  338   AVDASLRFI  346



>ref|XP_007204522.1| hypothetical protein PRUPE_ppa018203mg [Prunus persica]
 gb|EMJ05721.1| hypothetical protein PRUPE_ppa018203mg [Prunus persica]
Length=348

 Score =   399 bits (1025),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 196/314 (62%), Positives = 242/314 (77%), Gaps = 3/314 (1%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVM  1019
             I+  NKKGPYLG+V+PN FE+NPLL+ +S+     +  +D++GRRFR G +E + VI+VM
Sbjct  36    IDMLNKKGPYLGIVVPNFFELNPLLQSTSFVADQKLPYLDFSGRRFRIGRLEDESVIIVM  95

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             TGL+MLNAGI+TQLLLS+F V GVVHYGIAGNA+P L IGDV IPQ+W+HT LWNWQR+G
Sbjct  96    TGLSMLNAGISTQLLLSLFKVKGVVHYGIAGNADPQLQIGDVTIPQFWAHTGLWNWQRFG  155

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
             DGP NEL LE  GDYTR++G IKF+ +        S  NLLNNVWYQPEE+FPV  TPE 
Sbjct  156   DGPGNELSLESFGDYTRKVGHIKFSDFNNETRNGKSVPNLLNNVWYQPEEVFPVHGTPEV  215

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
             RQH FWVPV+  +F +A+ LE L+L GC+N TTCL   P V RV+RG SAS+++DN AYR
Sbjct  216   RQHAFWVPVNPKFFAVAKDLEDLKLGGCVN-TTCLPRAPIVVRVKRGISASVFVDNRAYR  274

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
              F+  KFN + ++MESAAVALVCHQQK P+I+IRALSDLAGGGS+ SNEA TF  LAA N
Sbjct  275   EFLNSKFNATSIDMESAAVALVCHQQKKPFIVIRALSDLAGGGSSLSNEANTFASLAAQN  334

Query  298   SVKVAVEFIKKVPS  257
             +V V + FI  + S
Sbjct  335   AVDVVLRFISLLSS  348



>ref|XP_009352502.1| PREDICTED: bark storage protein A [Pyrus x bretschneideri]
Length=347

 Score =   399 bits (1025),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 194/314 (62%), Positives = 240/314 (76%), Gaps = 3/314 (1%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVM  1019
             I   NK+GPYLG+V+PN FEMNPLL+ +S+     +  +D+AGRRFR G +E K VI+VM
Sbjct  35    IYRINKEGPYLGIVVPNFFEMNPLLQSTSFVADQKLPYLDFAGRRFRIGRLEDKKVIIVM  94

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             TGL+MLNAGI+TQLL  +F V GVVHYGIAGNA+P L IGDV IPQ+W+HT LWNWQR+G
Sbjct  95    TGLSMLNAGISTQLLQILFKVKGVVHYGIAGNADPQLQIGDVTIPQFWAHTGLWNWQRFG  154

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
             DGP +EL LE  GDYTRE+G+IKF+ ++       S  NLLNN WYQPEE FPV  TPE 
Sbjct  155   DGPNDELSLESFGDYTREVGYIKFSDFSNKTKVGTSVPNLLNNAWYQPEETFPVHGTPEV  214

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
             RQH FWVPV+  YF + + LEGL+L  C+N TTCL  TPKV  V+RG SA++++DN+AYR
Sbjct  215   RQHAFWVPVNHKYFSLTKKLEGLKLGSCVN-TTCLPRTPKVVAVQRGISANVFVDNSAYR  273

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
              F+  KFN +P++MESAAVALVCHQQ  P+I+IRALSDLAGGGS+ SNEA TF  LAA N
Sbjct  274   EFLKSKFNATPIDMESAAVALVCHQQNTPFIVIRALSDLAGGGSSLSNEANTFASLAAQN  333

Query  298   SVKVAVEFIKKVPS  257
             +V V + F+  + S
Sbjct  334   AVDVVLRFVALLSS  347



>ref|XP_010438369.1| PREDICTED: bark storage protein A-like [Camelina sativa]
Length=348

 Score =   399 bits (1025),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 193/313 (62%), Positives = 249/313 (80%), Gaps = 9/313 (3%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVM  1019
             IE  N+KGPYLG+V PN +E+NPLL+  S+ PS+ +  ID+AGR+FRFG +EG+PV++VM
Sbjct  34    IEKMNRKGPYLGIVAPNNYELNPLLQSPSFVPSSSLPFIDFAGRKFRFGKLEGQPVVIVM  93

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             +GL M+NAG+TTQLL+SVF + GV+HYGIAGNA+ +L IGDV IPQYW+H+ LWNWQRYG
Sbjct  94    SGLGMVNAGVTTQLLVSVFRLKGVLHYGIAGNADVNLEIGDVTIPQYWAHSGLWNWQRYG  153

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
             D  + EL LE  GDYTRE+G+++F+KY+      N  DNLLN +WYQPEEIFPV  TPEE
Sbjct  154   DEIDKELALESGGDYTREVGYLQFSKYS------NGTDNLLNRIWYQPEEIFPVTGTPEE  207

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
             RQH+FW+PVD +Y  +A+ LE  +L  C+N TTCL   PKVT V+RG SAS+++DNAAYR
Sbjct  208   RQHVFWIPVDKYYLNLARKLEDTKLPQCVN-TTCLPRPPKVTIVDRGMSASVFVDNAAYR  266

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
             +F+  KFNV+ +EMESAAVAL+ HQQ +P+I+IRALSDLAGGGS  SNEA  F  LAA+N
Sbjct  267   TFLNSKFNVTAIEMESAAVALISHQQNLPFIVIRALSDLAGGGSDVSNEANIFSSLAAEN  326

Query  298   SVKVAVEFIKKVP  260
             SV + V+F+  +P
Sbjct  327   SVDILVKFVALLP  339



>ref|XP_006284040.1| hypothetical protein CARUB_v10005161mg [Capsella rubella]
 gb|EOA16938.1| hypothetical protein CARUB_v10005161mg [Capsella rubella]
Length=348

 Score =   398 bits (1023),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 194/313 (62%), Positives = 246/313 (79%), Gaps = 9/313 (3%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKP--STLIIDYAGRRFRFGTIEGKPVILVM  1019
             IE  N+KGPYLG+V PN FE+NPLLE  SY P  S   ID+AGR+FRFG + G+PV++VM
Sbjct  34    IEKMNQKGPYLGIVAPNNFELNPLLESQSYVPFSSLPFIDFAGRKFRFGKLAGQPVVIVM  93

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             +GL M+NAG+TTQLL+S+F + GV+HYGIAGNA+ +L IGDV IPQYW+H+ LWNWQRYG
Sbjct  94    SGLGMVNAGVTTQLLVSLFKLKGVLHYGIAGNADVNLEIGDVTIPQYWAHSGLWNWQRYG  153

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
             DG +NEL LE  GDYTR++G+++F+KY+      N  DNLLN +WYQPEEIFPV   PEE
Sbjct  154   DGIDNELALESGGDYTRDVGYLQFSKYS------NRTDNLLNRIWYQPEEIFPVTGIPEE  207

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
             RQH+FW+PVD +Y  +A+ LE  +L  C+N TTCL   PKVT V+RG SAS+++DNAAYR
Sbjct  208   RQHVFWIPVDKYYLNLARKLEDTKLPQCVN-TTCLPRPPKVTIVDRGMSASVFVDNAAYR  266

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
             +F+  +FN + VEMESAAVALV HQQ +P+I+IRALSDLAGGGS  SNEA  F  LAA+N
Sbjct  267   TFLNSRFNATAVEMESAAVALVSHQQNLPFIVIRALSDLAGGGSDVSNEANIFSSLAAEN  326

Query  298   SVKVAVEFIKKVP  260
             SV + V+F+  +P
Sbjct  327   SVDILVKFVALLP  339



>ref|XP_008242572.1| PREDICTED: bark storage protein A [Prunus mume]
Length=348

 Score =   398 bits (1022),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 195/314 (62%), Positives = 241/314 (77%), Gaps = 3/314 (1%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVM  1019
             I+  NKKGPYLG+V+PN FE+NPLL+ +S+     +  +D++GRRFR G +E + VI+VM
Sbjct  36    IDRLNKKGPYLGIVVPNFFELNPLLQSTSFVADQKLPYLDFSGRRFRIGRLEDESVIIVM  95

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             TGL+MLNAGI+TQLLLS+F V GVVHYGIAGNA+P L IGDV IPQ+W+HT LWNWQR+G
Sbjct  96    TGLSMLNAGISTQLLLSLFKVKGVVHYGIAGNADPQLQIGDVTIPQFWAHTGLWNWQRFG  155

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
             DGP NEL LE  GDYTR++G IKF+ +        S  NLLNNVWYQPEE+FPV  TPE 
Sbjct  156   DGPGNELSLESFGDYTRKVGHIKFSDFNNKTRNGKSVPNLLNNVWYQPEEVFPVHGTPEV  215

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
             RQH FWVPV+  +F +A+ LE L+L GC+N TTCL   P V RV+RG SAS+++DN AYR
Sbjct  216   RQHAFWVPVNPKFFAVAKDLEDLKLGGCVN-TTCLPRAPIVVRVKRGISASVFVDNRAYR  274

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
              F+  KFN + ++MESAAVALVCHQQK P+I+IRALSDLAGGGS+ SNEA  F  LAA N
Sbjct  275   EFLNSKFNATSIDMESAAVALVCHQQKKPFIVIRALSDLAGGGSSVSNEANIFASLAAQN  334

Query  298   SVKVAVEFIKKVPS  257
             +V V + FI  + S
Sbjct  335   AVDVVLRFISLLSS  348



>ref|NP_194623.2| phosphorylase superfamily protein [Arabidopsis thaliana]
 gb|AEE85565.1| phosphorylase superfamily protein [Arabidopsis thaliana]
Length=348

 Score =   398 bits (1022),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 199/329 (60%), Positives = 254/329 (77%), Gaps = 11/329 (3%)
 Frame = -1

Query  1240  EGANGSLLDDGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGR  1067
             E ANG +     T   IE  N+KGPYLG+V PN +E+NPLL   +Y PS+ +  ID+AGR
Sbjct  20    EEANGEI--PRTTLEKIERMNQKGPYLGIVAPNNYELNPLLGSKAYFPSSSLPFIDFAGR  77

Query  1066  RFRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAI  887
             +FRFG +  +PVI+VM+GL M+NAG+TTQLL+S+F + GV+HYGIAGNA+ +L IGDV I
Sbjct  78    KFRFGKLSNQPVIIVMSGLGMVNAGVTTQLLVSLFRLKGVLHYGIAGNADVNLEIGDVTI  137

Query  886   PQYWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNV  707
             PQYW+H+ LWNWQRYGDG +NEL LE  GDYTRE+G+++F+KY+      N  DNLLN V
Sbjct  138   PQYWAHSGLWNWQRYGDGIDNELALESGGDYTREVGYLQFSKYS------NRTDNLLNRV  191

Query  706   WYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRV  527
             WYQPEEIFPV  TPEERQH+FW+PVD  Y ++A+ LE  +L  C+N TTCL   PKVT V
Sbjct  192   WYQPEEIFPVTGTPEERQHVFWIPVDKSYLKLARKLEDTKLPQCVN-TTCLPRPPKVTIV  250

Query  526   ERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggs  347
             +RG SAS+++DNAAYR+F+  KFN + VEMESAAVAL+ HQQ +P+I+IRALSDLAGGGS
Sbjct  251   KRGMSASVFIDNAAYRTFLNSKFNATAVEMESAAVALISHQQNLPFIVIRALSDLAGGGS  310

Query  346   aesneaATFIDLAADNSVKVAVEFIKKVP  260
               SNEA+ F  LAA+NSV + V+F+  +P
Sbjct  311   DVSNEASIFSSLAAENSVDILVKFVALLP  339



>ref|XP_008352307.1| PREDICTED: bark storage protein A-like [Malus domestica]
Length=347

 Score =   397 bits (1020),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 192/314 (61%), Positives = 240/314 (76%), Gaps = 3/314 (1%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVM  1019
             I   NK+GPYLG+V+PN FEMNPLL+ +S+     +  +D+AGRRFR G +E K VI+VM
Sbjct  35    IYRINKEGPYLGIVVPNFFEMNPLLQSTSFVADQKLPYLDFAGRRFRIGRLEDKKVIIVM  94

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             TGL+MLNAGI+TQLL ++F V GVVHYGIAGNA+P L IGDV IPQ+W+HT LWNWQR+G
Sbjct  95    TGLSMLNAGISTQLLQTLFMVKGVVHYGIAGNADPQLQIGDVTIPQFWAHTGLWNWQRFG  154

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
             DGP +EL LE  GDYTRE+G+IKF+ ++       S  NLLN+ WYQPEE FPV  TPE 
Sbjct  155   DGPNDELSLESFGDYTREVGYIKFSDFSNKTKVGTSVPNLLNSAWYQPEETFPVHGTPEV  214

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
             RQH FWVPV+  YF + + LEGL+L  C+N TTCL  TPKV  V+RG SA++++DN+AYR
Sbjct  215   RQHAFWVPVNHKYFSLTKKLEGLKLGSCVN-TTCLPRTPKVVAVQRGISANVFVDNSAYR  273

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
              F+  KFN +P++MESAAVALVCHQQ  P+I+IRALSDLAGGG + SNEA TF  LAA N
Sbjct  274   EFLNSKFNATPIDMESAAVALVCHQQNTPFIVIRALSDLAGGGXSLSNEANTFASLAAQN  333

Query  298   SVKVAVEFIKKVPS  257
             +V V + F+  + S
Sbjct  334   AVDVVLRFVALLSS  347



>ref|XP_004142512.1| PREDICTED: bark storage protein A-like [Cucumis sativus]
 ref|XP_004171263.1| PREDICTED: bark storage protein A-like [Cucumis sativus]
 gb|KGN66819.1| hypothetical protein Csa_1G696520 [Cucumis sativus]
Length=347

 Score =   397 bits (1020),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 194/310 (63%), Positives = 241/310 (78%), Gaps = 3/310 (1%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVM  1019
             I+  NK GPYLG+V+PN FEMNPLL+  S      +  +D++GRRFRFG I+ K VI+VM
Sbjct  35    IDRVNKNGPYLGIVVPNAFEMNPLLQSPSLMADHNLPHLDFSGRRFRFGRIKDKKVIIVM  94

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             TGL+MLNAG TTQLLL++F V GV+H GIAGNA+P L IGDV IPQYW+HT LWNWQR+G
Sbjct  95    TGLSMLNAGTTTQLLLALFRVKGVIHCGIAGNADPQLEIGDVTIPQYWAHTGLWNWQRFG  154

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYAT-NVDECNSQDNLLNNVWYQPEEIFPVDATPE  662
             DGP++EL LE NGDYTR+IGF+KF+ + T +     S DNLLNNVWYQPEEIFPVD TPE
Sbjct  155   DGPDDELALESNGDYTRKIGFLKFSNFNTVDTKTEKSVDNLLNNVWYQPEEIFPVDGTPE  214

Query  661   ERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAY  482
              RQ+ FW+PVD HYF +A+ LEGL+LE C+N+T CL   P   RV+RG SA++++DN AY
Sbjct  215   IRQNAFWIPVDKHYFSLAKKLEGLKLERCLNSTNCLPRAPVAVRVQRGVSANVFVDNKAY  274

Query  481   RSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAAD  302
             R F+   FNV+ ++ME+AAVALVC QQK+P+I  R+LSDLAGGGSA SNEAA F  LA+ 
Sbjct  275   REFLQSTFNVTSIDMETAAVALVCLQQKIPFIAFRSLSDLAGGGSALSNEAAAFAVLASQ  334

Query  301   NSVKVAVEFI  272
             N+    V+FI
Sbjct  335   NAATALVKFI  344



>ref|XP_002869463.1| hypothetical protein ARALYDRAFT_491863 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45722.1| hypothetical protein ARALYDRAFT_491863 [Arabidopsis lyrata subsp. 
lyrata]
Length=348

 Score =   397 bits (1020),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 193/313 (62%), Positives = 248/313 (79%), Gaps = 9/313 (3%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVM  1019
             IE  N+KGPYLG+V PN +E+NPLL   +Y PS+ +  ID+AGR+FRFG +  +PV++VM
Sbjct  34    IERINQKGPYLGIVAPNNYELNPLLGSKAYVPSSSLPFIDFAGRKFRFGKLSKQPVVIVM  93

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             +GL M+NAG+TTQLL+S+F + GV+HYGIAGNA+ +L IGDV IPQYW+H+ LWNWQRYG
Sbjct  94    SGLGMVNAGVTTQLLVSLFRLKGVLHYGIAGNADINLEIGDVTIPQYWAHSGLWNWQRYG  153

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
             DG +NEL LE  GDYTRE+G+++F+KY+      N  DNLLN VWYQPEEIFPV  TPEE
Sbjct  154   DGIDNELALESGGDYTREVGYLQFSKYS------NRTDNLLNRVWYQPEEIFPVTGTPEE  207

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
             RQH+FW+PVD  Y ++A+ LE  +L  C+N TTCL   PKVT V+RG SAS+++DNAAYR
Sbjct  208   RQHVFWIPVDKSYLKLARKLEDTKLPQCVN-TTCLPRPPKVTIVKRGMSASVFIDNAAYR  266

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
             +F+  KFN + VEMESAAVAL+ HQQ +P+I+IRALSDLAGGGS  SNEA+ F  LAA+N
Sbjct  267   TFLNSKFNATAVEMESAAVALISHQQNLPFIVIRALSDLAGGGSDVSNEASIFSSLAAEN  326

Query  298   SVKVAVEFIKKVP  260
             SV + V+F+  +P
Sbjct  327   SVDILVKFVALLP  339



>ref|NP_001148584.1| LOC100282200 [Zea mays]
 gb|ACG32125.1| vegetative storage protein PNI288 [Zea mays]
Length=365

 Score =   397 bits (1019),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 197/316 (62%), Positives = 242/316 (77%), Gaps = 4/316 (1%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPST--LIIDYAGRRFRFGTIEGKP  1034
             KT   I  A++ GP++G+V+PN +EM P+L    +KPS+   I+D  GRRFRFGTI  + 
Sbjct  34    KTWSAIRRADRDGPFVGLVVPNAYEMVPVLNSPDFKPSSNIPILDVQGRRFRFGTIGSQN  93

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             V++VMTGL+MLNAG+TTQLLLS+F V G+VH+GIAGNAN  L IGDV IP+ W+H +LWN
Sbjct  94    VVMVMTGLSMLNAGLTTQLLLSLFRVKGIVHWGIAGNANEDLQIGDVTIPESWAHLSLWN  153

Query  853   WQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQ--DNLLNNVWYQPEEIFP  680
             WQR+GDGPENELPLE  GDYTRE GF+ F+ Y    D  N +   N LN+VWYQPEEIFP
Sbjct  154   WQRHGDGPENELPLENAGDYTREYGFLNFSDYTVGQDAGNPELAANTLNSVWYQPEEIFP  213

Query  679   VDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIY  500
             +  TPEERQH FWVPV+  Y+ +A  LEGLEL  C+NATTCL   P+VTRV RG SA+IY
Sbjct  214   ISGTPEERQHAFWVPVNKRYYALAGKLEGLELPACVNATTCLPRAPRVTRVPRGCSANIY  273

Query  499   LDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATF  320
              DNA+YR FI   F  +PVEMESAAVALV HQ  VP+I IR+LSDLAGGGS+ SNEAATF
Sbjct  274   TDNASYRQFIRSHFGCTPVEMESAAVALVAHQHGVPFITIRSLSDLAGGGSSISNEAATF  333

Query  319   IDLAADNSVKVAVEFI  272
             +D+AA N+V V ++F+
Sbjct  334   LDIAAQNAVDVMLKFV  349



>ref|XP_010447907.1| PREDICTED: bark storage protein A-like [Camelina sativa]
Length=362

 Score =   396 bits (1018),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 192/313 (61%), Positives = 247/313 (79%), Gaps = 9/313 (3%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVM  1019
             IE  N+KGPYLG+V PN +E+NPLL   SY PS+ +  ID+AGR+FRFG + G+PV++VM
Sbjct  34    IEKMNRKGPYLGIVAPNNYELNPLLGSPSYVPSSSLPFIDFAGRKFRFGKLAGQPVVIVM  93

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             +GL M+NAG+TTQLL+S+F + GV+HYGIAGNA+ +L IGDV IPQYW+H+ LWNWQRYG
Sbjct  94    SGLGMVNAGVTTQLLVSLFRLKGVLHYGIAGNADVNLEIGDVTIPQYWAHSGLWNWQRYG  153

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
             DG + EL LE  GDYTRE+G+++F+KY+      N  +NLLN VWYQPEEIFPV  TPEE
Sbjct  154   DGIDKELALESGGDYTREVGYLQFSKYS------NGTENLLNRVWYQPEEIFPVTGTPEE  207

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
             RQH+FW+PVD +Y  +A+ LE  +L  C+N TTCL   PKVT V+RG SAS+++DNAAYR
Sbjct  208   RQHVFWIPVDKYYLNLARKLEDTKLPQCVN-TTCLPRPPKVTIVDRGMSASVFVDNAAYR  266

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
             +F+  KFN + +EMESAAVAL+ HQQ +P+I+IRALSDLAGGGS  SNEA  F  LAA+N
Sbjct  267   TFLNSKFNATAIEMESAAVALISHQQNLPFIVIRALSDLAGGGSDVSNEANIFSSLAAEN  326

Query  298   SVKVAVEFIKKVP  260
             SV + V+F+  +P
Sbjct  327   SVDILVKFVALLP  339



>ref|XP_010049662.1| PREDICTED: bark storage protein A-like [Eucalyptus grandis]
 gb|KCW82403.1| hypothetical protein EUGRSUZ_C03808 [Eucalyptus grandis]
Length=348

 Score =   392 bits (1008),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 183/316 (58%), Positives = 246/316 (78%), Gaps = 3/316 (1%)
 Frame = -1

Query  1213  DGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEG  1040
             D ++  +++  N++GP+ G+V+PN FEMNPLL+  S+ P+  +  +D +GRRFR G +E 
Sbjct  28    DHRSMKMVDGVNREGPFFGIVVPNSFEMNPLLQSPSFVPNETLPYLDISGRRFRIGRLEN  87

Query  1039  KPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTAL  860
             + VI+VMTGL+MLNAGITT+LLL++F+V GV+HYGIAGNANP+L IGDV IPQYW+HT L
Sbjct  88    EKVIIVMTGLSMLNAGITTELLLTLFNVKGVLHYGIAGNANPNLQIGDVTIPQYWAHTGL  147

Query  859   WNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFP  680
             WNWQR+GDGP++EL  E +GDYTR+IG++  A +  +     +  NLLNNVWYQPEEIFP
Sbjct  148   WNWQRFGDGPDSELAFESDGDYTRKIGYLNIASFNNHTGSGKADQNLLNNVWYQPEEIFP  207

Query  679   VDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIY  500
             V+  PE RQH FWVPVD HYF I++ ++ L+L  C+N +TCL   P V RV+RG SA+++
Sbjct  208   VNGVPEVRQHAFWVPVDKHYFTISKKIKDLKLGQCVN-STCLPRAPMVVRVDRGVSANVF  266

Query  499   LDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATF  320
             +DN+AYR F+Y KFN + ++MESA++ALVCHQ K+P+I IR+LSDLAGGGS+ SNEAA F
Sbjct  267   VDNSAYRQFLYSKFNATAIDMESASIALVCHQHKIPFIAIRSLSDLAGGGSSLSNEAAIF  326

Query  319   IDLAADNSVKVAVEFI  272
               LA  N+V V + FI
Sbjct  327   ASLAVQNAVDVLLRFI  342



>dbj|BAJ86281.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=361

 Score =   391 bits (1004),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/314 (60%), Positives = 237/314 (75%), Gaps = 2/314 (1%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKP  1034
             KT   I  AN+ GP++G+V+PN +EM P+LE  S+  S  I  +D  GRRFRFGTIEG+ 
Sbjct  30    KTWAAIRRANRAGPFVGLVVPNTYEMVPVLESPSFVASKSIPNMDIQGRRFRFGTIEGQS  89

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             V++VMTGL+MLNAG+TTQ+LLS+F V G+VH+GIAGNAN  L IGDV IP+YW+H +LWN
Sbjct  90    VVMVMTGLSMLNAGLTTQMLLSLFRVKGIVHWGIAGNANEDLQIGDVTIPEYWAHVSLWN  149

Query  853   WQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVD  674
             WQR+GDG +NELPLE  GDYTRE G + F+ Y           NLLN++WYQPEEIFP  
Sbjct  150   WQRFGDGKDNELPLEAAGDYTREYGALNFSDYTVGQSNPALSANLLNSIWYQPEEIFPKS  209

Query  673   ATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLD  494
               PE RQH FWVP    Y+ +A+ LEG+EL  C+NATTCL   P+VTRV +G SA+++LD
Sbjct  210   GEPEVRQHAFWVPASKRYYALAKKLEGMELPACVNATTCLPRAPRVTRVSKGCSANVFLD  269

Query  493   NAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFID  314
             NA YR F+  +F  +PVEMESAAVALV H Q VP++ IR+LSDLAGGGSA  NEA+TFID
Sbjct  270   NAEYRQFLRKQFGCTPVEMESAAVALVAHTQGVPFLTIRSLSDLAGGGSALGNEASTFID  329

Query  313   LAADNSVKVAVEFI  272
             +AA N+V+V ++F+
Sbjct  330   IAAKNAVQVMLKFV  343



>ref|XP_002454890.1| hypothetical protein SORBIDRAFT_03g000850 [Sorghum bicolor]
 gb|EES00010.1| hypothetical protein SORBIDRAFT_03g000850 [Sorghum bicolor]
Length=362

 Score =   391 bits (1004),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/314 (61%), Positives = 237/314 (75%), Gaps = 2/314 (1%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPST--LIIDYAGRRFRFGTIEGKP  1034
             KT   I  A++ GP++G+V+PN +EM+P+L    +KPS    I+D  GRRFRFGTI  + 
Sbjct  30    KTWSAIRRADRDGPFVGLVVPNTYEMDPVLSSPDFKPSNNIPILDVQGRRFRFGTIGSQN  89

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             V++VMTGL+MLNAG+TTQLLLS+F V G+VH+GIAGNAN  L IGDV IP+ W+H +LWN
Sbjct  90    VVMVMTGLSMLNAGLTTQLLLSLFRVKGIVHWGIAGNANEDLQIGDVTIPESWAHLSLWN  149

Query  853   WQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVD  674
             WQR+GDG ENELPLE  GDYTRE GF+ F+ Y           N LN+VWYQPEEIFP+ 
Sbjct  150   WQRHGDGAENELPLESAGDYTREYGFLNFSDYTVGQANPELSANTLNSVWYQPEEIFPIS  209

Query  673   ATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLD  494
              TPEERQH FWVPV   Y+++A  LEG+EL  C+N TTCL   P+VTRV RG SA+IY D
Sbjct  210   GTPEERQHAFWVPVSKRYYRLAAKLEGMELPACVNETTCLPRAPRVTRVPRGCSANIYTD  269

Query  493   NAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFID  314
             NA+YR FI   F  +PVEMESAAVALV HQ  VP+I IR+LSDLAGGGS+ SNEAATF+D
Sbjct  270   NASYRQFIRAHFGCTPVEMESAAVALVAHQHGVPFITIRSLSDLAGGGSSLSNEAATFLD  329

Query  313   LAADNSVKVAVEFI  272
             +AA N+V V ++F+
Sbjct  330   IAAKNAVDVMLKFV  343



>ref|XP_002454891.1| hypothetical protein SORBIDRAFT_03g000860 [Sorghum bicolor]
 gb|EES00011.1| hypothetical protein SORBIDRAFT_03g000860 [Sorghum bicolor]
Length=360

 Score =   390 bits (1003),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 189/309 (61%), Positives = 236/309 (76%), Gaps = 2/309 (1%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPST--LIIDYAGRRFRFGTIEGKPVILVM  1019
             I   ++ GP++G+V PN +EM P+L+   +KPS    I+D  GRRFRFGTI G+ V++VM
Sbjct  35    IRQVDRDGPFVGLVAPNAYEMKPVLDSPDFKPSNNIPILDVQGRRFRFGTIGGQNVVMVM  94

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             TGL+MLNAG+TTQLLLS+F V G+VH+GIAGNAN  L IGDV IP+ W+H +LWNWQR+G
Sbjct  95    TGLSMLNAGLTTQLLLSLFRVKGIVHWGIAGNANEDLQIGDVTIPESWAHLSLWNWQRHG  154

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
             DG EN +PLE+ GDYTRE GF+ F+ Y   +       N LN+VWYQPEEIFP+ ATPE+
Sbjct  155   DGAENRVPLEIAGDYTREYGFLHFSNYTVGLANPELSANTLNSVWYQPEEIFPISATPEK  214

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
             RQH FWVPV   Y+++A  LEGLEL  C+NATTCL   P+VTRV RG SA+IY DNA+YR
Sbjct  215   RQHAFWVPVSKRYYKLAGKLEGLELPACVNATTCLPRAPRVTRVPRGCSANIYTDNASYR  274

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
              FI   F  +PVEMESAAVALV HQ  VP+I IR+LSDLAGGGS+ SNEA TF+D+AA N
Sbjct  275   QFIRSHFGCTPVEMESAAVALVAHQHGVPFITIRSLSDLAGGGSSLSNEAGTFLDIAAKN  334

Query  298   SVKVAVEFI  272
             +V V ++F+
Sbjct  335   AVDVMLKFV  343



>ref|XP_004299992.1| PREDICTED: bark storage protein A-like [Fragaria vesca subsp. 
vesca]
Length=339

 Score =   389 bits (999),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 192/309 (62%), Positives = 239/309 (77%), Gaps = 8/309 (3%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVM  1019
             I+  NKKGPYLG+V+PN FE+ PLLE +S+     +  +D++GRRFRFG ++ + V++ M
Sbjct  32    IDMMNKKGPYLGIVVPNSFELTPLLESASFVADQKLPTLDFSGRRFRFGRLDNQSVVITM  91

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             TGL+MLNAG+TTQLLLS+F V GVVHYGIAGNA+P L IGDV IPQYW+HT LWNWQR+G
Sbjct  92    TGLSMLNAGVTTQLLLSLFKVKGVVHYGIAGNADPQLQIGDVTIPQYWAHTGLWNWQRFG  151

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
             DGP++ L LE  GDYTR++G+IKF+ Y     E     N LNN WYQPEEIFPV  TPE 
Sbjct  152   DGPDDLLSLEPFGDYTRDVGYIKFSDYNNKTVE-----NSLNNAWYQPEEIFPVFGTPEV  206

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
             RQH FWVPV+  YF +AQ L  L+LE C+N TTCL  TP + RVERG SA++++DN AYR
Sbjct  207   RQHAFWVPVNRKYFALAQQLLDLKLESCVN-TTCLPRTPIIMRVERGISANVFVDNRAYR  265

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
              F+  KFN + ++MESAAVALVC QQK P+I+IRALSDLAGGGS+ SNEA+TF  LAA N
Sbjct  266   QFLNTKFNATAIDMESAAVALVCKQQKKPFIVIRALSDLAGGGSSVSNEASTFASLAAQN  325

Query  298   SVKVAVEFI  272
             +V V ++FI
Sbjct  326   AVTVVLKFI  334



>ref|XP_006412896.1| hypothetical protein EUTSA_v10025609mg [Eutrema salsugineum]
 gb|ESQ54349.1| hypothetical protein EUTSA_v10025609mg [Eutrema salsugineum]
Length=349

 Score =   389 bits (998),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 193/318 (61%), Positives = 243/318 (76%), Gaps = 10/318 (3%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSY--KPSTLIIDYAGRRFRFGTIEGKPVILVM  1019
             IE  NK+GPYLG+V PN FE+NPLL   +Y   PS   ID+AGRRFRFG I  + V++VM
Sbjct  34    IERMNKRGPYLGIVAPNNFELNPLLASQAYVPYPSLPFIDFAGRRFRFGKISNQRVVIVM  93

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             TGL M+NAG+ TQLL+S+F + GV+HYGIAGNA+ +L IGDV IP+ W+HT LWNWQRYG
Sbjct  94    TGLGMVNAGVATQLLVSLFRLKGVLHYGIAGNADVNLEIGDVTIPKSWAHTGLWNWQRYG  153

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
             DG ++EL LE  GDYTR IG+++F+ Y+      N  +NLLN +WYQPEEIFPV  TPE 
Sbjct  154   DGIDDELALEAGGDYTRNIGYLQFSNYS------NQTENLLNRIWYQPEEIFPVTGTPEV  207

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
             R+H+FW+PVD  Y  +A+ LEG +L  C+N TTCL   PKVT V+RG SAS+++DNAAYR
Sbjct  208   REHVFWIPVDKSYLDLARQLEGTKLPQCVN-TTCLPRAPKVTIVDRGVSASVFVDNAAYR  266

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
             +F+  KFN + VEMESAAVAL+CHQQ +P+++IRALSDLAGGGS  SNEA  F  LAA N
Sbjct  267   TFLRSKFNATAVEMESAAVALICHQQSLPFVVIRALSDLAGGGSDVSNEADLFGSLAAQN  326

Query  298   SVKVAVEFIKKVPSPNRS  245
             SV V V+F+  +P P+RS
Sbjct  327   SVDVLVKFVGLLP-PHRS  343



>ref|XP_010433154.1| PREDICTED: bark storage protein A-like [Camelina sativa]
Length=367

 Score =   389 bits (998),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 189/313 (60%), Positives = 244/313 (78%), Gaps = 9/313 (3%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVM  1019
             IE  N+KGPYLG+V PN +E+NPLL   SY PS+ +  ID+AGR+FRFG + G+PV+ VM
Sbjct  34    IEKMNRKGPYLGIVAPNNYELNPLLGSPSYVPSSSLPFIDFAGRKFRFGKLAGQPVVTVM  93

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             +GL M+NAG+TTQLL+S+F + GV+HYGIAGNA+ +L IGDV IPQYW+H+ LWNWQRYG
Sbjct  94    SGLGMVNAGVTTQLLVSLFRLKGVLHYGIAGNADVNLEIGDVTIPQYWAHSGLWNWQRYG  153

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
             DG + EL LE  GDYTR++G+++F+KY+      N  DNLLN +WYQPEEIF V  TPEE
Sbjct  154   DGIDKELALESGGDYTRKVGYLQFSKYS------NGTDNLLNRIWYQPEEIFLVTGTPEE  207

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
             RQ +FW+PVD +Y  +A+ LE  +L  C+N TTCL   PKVT V+RG SAS+++DNAAYR
Sbjct  208   RQQVFWIPVDKYYLNLARKLEDTKLPQCVN-TTCLPRPPKVTIVDRGMSASVFVDNAAYR  266

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
             +F+  KFN + +EMESAAVAL+ HQQ +P+I+IRALSDLAGGGS  SNEA  F  LAA+N
Sbjct  267   TFLNSKFNATAIEMESAAVALISHQQNLPFIVIRALSDLAGGGSDVSNEANIFSSLAAEN  326

Query  298   SVKVAVEFIKKVP  260
             SV + V+F+  +P
Sbjct  327   SVDILVKFVALLP  339



>gb|EAY73139.1| hypothetical protein OsI_01011 [Oryza sativa Indica Group]
Length=354

 Score =   387 bits (993),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 186/316 (59%), Positives = 239/316 (76%), Gaps = 8/316 (3%)
 Frame = -1

Query  1207  KTRMLIENANKKG-PYLGVVIPNMFEMNPLLEHSSYKPSTLI---IDYAGRRFRFGTIEG  1040
             KT   +  AN +G P++G+V+PN +EM+P+L   S+ P+  +   +D  GRRFRFG I G
Sbjct  26    KTWSAVRRANDRGGPFVGLVVPNAYEMDPVLNSPSFTPTPTLPSYLDIQGRRFRFGAIGG  85

Query  1039  KPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTAL  860
             + V++VMTGL+MLNAG+TTQLLLS+F V G+VH+GIAGNA+  L IGDV IP++W+H +L
Sbjct  86    QNVVMVMTGLSMLNAGLTTQLLLSLFRVKGIVHWGIAGNADEGLQIGDVTIPEHWAHLSL  145

Query  859   WNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFP  680
             WNWQRYGDGPENELPLE  GDYTR++GF+ F+ Y           N LN++W+QPEEIFP
Sbjct  146   WNWQRYGDGPENELPLEAAGDYTRDLGFLNFSDYTA----AGPSPNELNSIWFQPEEIFP  201

Query  679   VDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIY  500
             V  TPE+RQH FWVPV S YF +A+ LEG+EL  C+NATTCL   P+VTRV RG SA+++
Sbjct  202   VSGTPEQRQHAFWVPVSSRYFSLAEKLEGMELPACVNATTCLPRAPRVTRVRRGCSANVF  261

Query  499   LDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATF  320
             LDNAAYR F+  KF  +PVEMESAAVALV HQ  VP++ IR+LSDLAGGGS+  NEA  F
Sbjct  262   LDNAAYRQFLRAKFGCTPVEMESAAVALVAHQHAVPFLTIRSLSDLAGGGSSLGNEAGEF  321

Query  319   IDLAADNSVKVAVEFI  272
             + +AA N+V V + F+
Sbjct  322   LAIAAQNAVDVMLNFV  337



>emb|CDY06856.1| BnaC01g09550D [Brassica napus]
Length=347

 Score =   385 bits (989),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 193/330 (58%), Positives = 248/330 (75%), Gaps = 11/330 (3%)
 Frame = -1

Query  1240  EGANGSLLDDGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSY--KPSTLIIDYAGR  1067
             E ANG +    K    I+  NK+GPYLG+V PN FE+NPLL   +Y   PS   ID+AGR
Sbjct  20    EEANGEI--SPKILSNIKMMNKRGPYLGIVAPNNFELNPLLASRAYVPYPSLPFIDFAGR  77

Query  1066  RFRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAI  887
             RFRFG I  + V++VMTGL M+NAG+ TQLL+S+F + GV+HYGIAGNA+ SL+IGDV I
Sbjct  78    RFRFGNISNQRVVIVMTGLGMVNAGVATQLLVSLFRLKGVLHYGIAGNADVSLDIGDVTI  137

Query  886   PQYWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNV  707
             P++W+H+ LWNWQRYGDG ++EL LE  GDYTR+IG+++F+KY       N  DNLLN V
Sbjct  138   PKFWAHSGLWNWQRYGDGIDDELALEAGGDYTRDIGYLQFSKYN------NQSDNLLNRV  191

Query  706   WYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRV  527
             WYQPEEIFPV  TPE R+H+FWVPVD  Y  +++ L+ + L  C+N TTCL   PKVT V
Sbjct  192   WYQPEEIFPVTGTPEVREHVFWVPVDKSYLDLSRQLKDMRLPQCVN-TTCLPRPPKVTIV  250

Query  526   ERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggs  347
             +RG SAS+++DNAAYR+F+  KFN + ++MESAAVAL+CHQQ +P+++IRALSDLAGGGS
Sbjct  251   DRGVSASVFVDNAAYRTFLRSKFNATAIDMESAAVALICHQQALPFVVIRALSDLAGGGS  310

Query  346   aesneaATFIDLAADNSVKVAVEFIKKVPS  257
               SNEA  F  LAA NSV V V+F+  +P+
Sbjct  311   DVSNEADLFGSLAAQNSVDVLVKFVGLLPT  340



>gb|EMT26191.1| Bark storage protein A [Aegilops tauschii]
Length=363

 Score =   385 bits (990),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 186/316 (59%), Positives = 237/316 (75%), Gaps = 4/316 (1%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKP  1034
             KT   I  AN+ GP++G+V+PN +EM P+LE  S+  S  +  +D  GRRFRFGTIEG+ 
Sbjct  30    KTWGAIRRANRAGPFVGLVVPNTYEMVPVLESPSFVASKSVPNMDIQGRRFRFGTIEGQS  89

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             V++VMTGL+MLNAG+TTQ+LLS+F V G+VH+GIAGNAN  L IGDV IP+YW+H +LWN
Sbjct  90    VVMVMTGLSMLNAGLTTQMLLSLFRVKGIVHWGIAGNANEDLQIGDVTIPEYWAHVSLWN  149

Query  853   WQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVD  674
             WQR+GDG +NELPLE  GDYTRE GF+ F+ Y           N LN++WYQPEEIFP  
Sbjct  150   WQRFGDGKDNELPLEAAGDYTREYGFLNFSDYTVGQSNPELSANHLNSIWYQPEEIFPAS  209

Query  673   ATPEERQHIFWVPVD--SHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIY  500
               PEERQH FWVP      Y+ +A+ LEG+EL  C+NATTCL   P+VTRV +G SA+++
Sbjct  210   GEPEERQHAFWVPASKRKRYYALAKKLEGMELPACVNATTCLPRAPRVTRVSKGCSANVF  269

Query  499   LDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATF  320
             LDNA  R F+  +F  +PVEMESAAVALV H Q VP++ IR+LSDLAGGGSA  NEA+TF
Sbjct  270   LDNAESRQFLRKQFGCTPVEMESAAVALVAHTQGVPFLTIRSLSDLAGGGSALGNEASTF  329

Query  319   IDLAADNSVKVAVEFI  272
             ID+AA N+V+V ++F+
Sbjct  330   IDIAAKNAVEVMLKFV  345



>gb|KEH36050.1| bark storage-like protein [Medicago truncatula]
Length=284

 Score =   382 bits (982),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 188/274 (69%), Positives = 229/274 (84%), Gaps = 2/274 (1%)
 Frame = -1

Query  1072  GRRFRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDV  893
             GRRFRFG+I  KPVILVMTGL+++NA ITTQLLLS F V GVVHYGIAGNANPSL+IGDV
Sbjct  6     GRRFRFGSIGEKPVILVMTGLSVINAAITTQLLLSFFKVDGVVHYGIAGNANPSLHIGDV  65

Query  892   AIPQYWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQ--DNL  719
             AIP YW+H ALW+WQRYG   ++ LPLE+NGDYTR++GF+KF+ + +N+   +S   DN 
Sbjct  66    AIPHYWAHLALWSWQRYGQDADDTLPLEINGDYTRDVGFLKFSDFTSNISAADSVTVDNH  125

Query  718   LNNVWYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPK  539
             LNN+WYQPEEIFPVD  PE+RQH  WVPVDS Y++IA+ LE ++L+ CI++ TCLT TPK
Sbjct  126   LNNLWYQPEEIFPVDGIPEQRQHALWVPVDSEYYRIAKKLEQMKLDACIDSDTCLTTTPK  185

Query  538   VTRVERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLa  359
             V  VERGTSA  YLDNAAYR+FI++KFNVSPV+MESA+VAL+C QQ++P+I IRALSDLA
Sbjct  186   VVLVERGTSAGFYLDNAAYRTFIFNKFNVSPVDMESASVALICLQQRIPFIAIRALSDLA  245

Query  358   gggsaesneaATFIDLAADNSVKVAVEFIKKVPS  257
             GGG+AESNEA TF  LAA NSV V +EF+K + S
Sbjct  246   GGGTAESNEADTFSPLAATNSVAVVIEFVKLLSS  279



>gb|KHG16526.1| Bark storage A [Gossypium arboreum]
Length=349

 Score =   384 bits (986),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 199/331 (60%), Positives = 252/331 (76%), Gaps = 6/331 (2%)
 Frame = -1

Query  1237  GANG--SLLDDGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAG  1070
             G NG   LL     R  I+N N +GPYLG+++PN FEMNPLL+  S+     +  +D+AG
Sbjct  21    GINGVYGLLSSSTLRN-IDNINMEGPYLGIIVPNSFEMNPLLQTGSFLEDHKMPYLDFAG  79

Query  1069  RRFRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVA  890
             RRFR G +E + VI+VMTGL+MLNAGI TQLL+++F V G++HYGIAGNAN  L IGDV 
Sbjct  80    RRFRIGRLENERVIIVMTGLSMLNAGIATQLLITLFKVKGILHYGIAGNANSQLQIGDVT  139

Query  889   IPQYWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNN  710
             IPQ+W+HT LWNWQRYGDGPE+EL LE NGDYTREIG+++F+ Y    +  NS DNLLNN
Sbjct  140   IPQFWAHTGLWNWQRYGDGPEDELALESNGDYTREIGYLRFSDYYNGTNCNNSSDNLLNN  199

Query  709   VWYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTR  530
             VWYQPEEIFP++  PE+RQH FWVPV+ HYF IA+ ++GL L GC+N  TCL   P+V R
Sbjct  200   VWYQPEEIFPINGVPEQRQHAFWVPVNKHYFAIAERVQGLRLAGCVNG-TCLPRPPRVVR  258

Query  529   VERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLaggg  350
             V+RG S++I++DN AYR F+  KFN + ++ME+AAVALVCHQQ +P+I  R+LSDLAGGG
Sbjct  259   VQRGISSNIFVDNKAYREFLNSKFNATAIDMETAAVALVCHQQNMPFIAFRSLSDLAGGG  318

Query  349   saesneaATFIDLAADNSVKVAVEFIKKVPS  257
             SA SNEAA+F  LAA N+V V + FI  + S
Sbjct  319   SALSNEAASFATLAAQNAVDVLLRFISLLSS  349



>ref|XP_010915872.1| PREDICTED: bark storage protein A [Elaeis guineensis]
Length=346

 Score =   384 bits (985),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 184/305 (60%), Positives = 238/305 (78%), Gaps = 4/305 (1%)
 Frame = -1

Query  1180  NKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVMTGLA  1007
             N KGP+LG+V+PN FEMNPLL+ S +  S  +  +D+ GRRFRFG +  + VI+VMTGL+
Sbjct  40    NNKGPFLGLVVPNSFEMNPLLQSSQFVQSKELPYLDFGGRRFRFGKVGEQKVIIVMTGLS  99

Query  1006  MLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDGPE  827
             MLNAGITTQLLL++FDV GVVH+GIAGNAN  L IGDV IP+ W+HT LWNWQRYGDGP 
Sbjct  100   MLNAGITTQLLLALFDVKGVVHFGIAGNANSDLQIGDVTIPKRWAHTGLWNWQRYGDGPN  159

Query  826   NELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHI  647
             +EL  E +GDYTR+IG++ F+ +  ++++  +  N LN+VWYQPEE+FPV   PE R+H 
Sbjct  160   DELAFESSGDYTRKIGYLNFSDF--DINKNKNFGNYLNSVWYQPEEVFPVSGVPEVRKHA  217

Query  646   FWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIY  467
             FWV VD HYF +++ LEG+ L  C+N+TTCL  +P V RVE G SASI++DNAAY  F+ 
Sbjct  218   FWVSVDQHYFALSKKLEGMNLTRCVNSTTCLKRSPVVKRVEGGCSASIFIDNAAYSQFLR  277

Query  466   DKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSVKV  287
              KFNV+PV+ME+AAVAL+C +Q+VP+I IRALSDLAG GS++SNEA+ F  LAA N+V V
Sbjct  278   SKFNVTPVDMETAAVALICLEQEVPFIAIRALSDLAGRGSSKSNEASIFGSLAAQNAVSV  337

Query  286   AVEFI  272
               +FI
Sbjct  338   VTKFI  342



>ref|XP_002440824.1| hypothetical protein SORBIDRAFT_09g007440 [Sorghum bicolor]
 gb|EES19254.1| hypothetical protein SORBIDRAFT_09g007440 [Sorghum bicolor]
Length=359

 Score =   384 bits (986),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 189/314 (60%), Positives = 240/314 (76%), Gaps = 6/314 (2%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI---IDYAGRRFRFGTIEGKPVILV  1022
             I+  N+ GP+LGVV+PN FEM PLL+  S+ P+  +   +D AGRRFRFG I  + V++V
Sbjct  44    IQMVNRCGPFLGVVVPNAFEMEPLLQSPSFSPAKGLPPYLDVAGRRFRFGIIREQKVVIV  103

Query  1021  MTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRY  842
             MTGLAMLN+G+TTQLLL++FDV G+VH+GIAGNA+P+  IGDVA+P+YW+HT LWNWQRY
Sbjct  104   MTGLAMLNSGVTTQLLLTLFDVKGIVHFGIAGNADPNRQIGDVAVPRYWAHTGLWNWQRY  163

Query  841   GDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPE  662
             GDGP+ EL LE NGDYTR++G + F  Y+ + +   S  NLLN+VWYQPEE+FPV+ TPE
Sbjct  164   GDGPDKELALESNGDYTRKLGKLNFTDYSVDKNARGSDGNLLNSVWYQPEEVFPVNGTPE  223

Query  661   ERQHIFWVPVDSHYFQIAQSLEGLELEGCINA---TTCLTHTPKVTRVERGTSASIYLDN  491
              R H FWVPVD +Y+ + + LEGL+LEGC+N    TTCL   P V  VE G SAS+++DN
Sbjct  224   VRGHEFWVPVDGYYYDLLRKLEGLKLEGCVNGTNNTTCLPRPPVVAMVEHGCSASVFVDN  283

Query  490   AAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDL  311
             AAYR F+  +  V+ ++ME+AAVALV  QQ  P+I IRALSDLAGGGSA+SNEA  F  L
Sbjct  284   AAYREFLRSRLGVTAIDMETAAVALVALQQGAPFIAIRALSDLAGGGSAQSNEAGVFAPL  343

Query  310   AADNSVKVAVEFIK  269
             AA N+V VAVEFI 
Sbjct  344   AAQNAVTVAVEFIS  357



>ref|XP_010047915.1| PREDICTED: bark storage protein A-like [Eucalyptus grandis]
 ref|XP_010047916.1| PREDICTED: bark storage protein A-like [Eucalyptus grandis]
 ref|XP_010041943.1| PREDICTED: bark storage protein A-like [Eucalyptus grandis]
 ref|XP_010041944.1| PREDICTED: bark storage protein A-like [Eucalyptus grandis]
Length=352

 Score =   384 bits (985),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 185/321 (58%), Positives = 240/321 (75%), Gaps = 9/321 (3%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYK--PSTLIIDYAGRRFRFGTIEGKP  1034
             K RM+    N +GPY+ +V+PN FEMNPLL+  S++  P+   +D  GRRFRFG +E K 
Sbjct  37    KIRMM----NSRGPYIAIVVPNSFEMNPLLQSPSFRADPNFPYLDILGRRFRFGKVENKE  92

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             VI+VMTGL+MLNAG+TT+LLL++F+V GVVHYGIAGNANP L IGDV IPQYW+HT LWN
Sbjct  93    VIVVMTGLSMLNAGVTTELLLALFEVKGVVHYGIAGNANPQLQIGDVTIPQYWAHTGLWN  152

Query  853   WQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQD--NLLNNVWYQPEEIFP  680
             WQR+G+G  +EL LE NGDYTREIG+++FA Y  N  +   ++  NLLN VWYQPEE+FP
Sbjct  153   WQRFGEGSNDELALESNGDYTREIGYLEFANY-NNASQSGEEELGNLLNRVWYQPEEVFP  211

Query  679   VDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIY  500
             +   PE RQH FWVPVD  Y+ ++  +  L+L  C+N++TCL   P+V RVERG SA+++
Sbjct  212   IGGVPEVRQHAFWVPVDRSYYGLSAKITDLKLGACVNSSTCLPRAPRVVRVERGVSANVF  271

Query  499   LDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATF  320
             +DN AYR F+  KFN +P++MES  VALVC Q + P+I  R+LSDLAGGGS+ SNEA+TF
Sbjct  272   VDNKAYREFLSSKFNATPIDMESTGVALVCRQLRTPFIAFRSLSDLAGGGSSLSNEASTF  331

Query  319   IDLAADNSVKVAVEFIKKVPS  257
               LAA N+V   V+FI  + S
Sbjct  332   ASLAAQNAVDAVVKFISLLAS  352



>gb|KCW79940.1| hypothetical protein EUGRSUZ_C01272 [Eucalyptus grandis]
Length=344

 Score =   383 bits (984),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 185/321 (58%), Positives = 240/321 (75%), Gaps = 9/321 (3%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYK--PSTLIIDYAGRRFRFGTIEGKP  1034
             K RM+    N +GPY+ +V+PN FEMNPLL+  S++  P+   +D  GRRFRFG +E K 
Sbjct  29    KIRMM----NSRGPYIAIVVPNSFEMNPLLQSPSFRADPNFPYLDILGRRFRFGKVENKE  84

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             VI+VMTGL+MLNAG+TT+LLL++F+V GVVHYGIAGNANP L IGDV IPQYW+HT LWN
Sbjct  85    VIVVMTGLSMLNAGVTTELLLALFEVKGVVHYGIAGNANPQLQIGDVTIPQYWAHTGLWN  144

Query  853   WQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQD--NLLNNVWYQPEEIFP  680
             WQR+G+G  +EL LE NGDYTREIG+++FA Y  N  +   ++  NLLN VWYQPEE+FP
Sbjct  145   WQRFGEGSNDELALESNGDYTREIGYLEFANY-NNASQSGEEELGNLLNRVWYQPEEVFP  203

Query  679   VDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIY  500
             +   PE RQH FWVPVD  Y+ ++  +  L+L  C+N++TCL   P+V RVERG SA+++
Sbjct  204   IGGVPEVRQHAFWVPVDRSYYGLSAKITDLKLGACVNSSTCLPRAPRVVRVERGVSANVF  263

Query  499   LDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATF  320
             +DN AYR F+  KFN +P++MES  VALVC Q + P+I  R+LSDLAGGGS+ SNEA+TF
Sbjct  264   VDNKAYREFLSSKFNATPIDMESTGVALVCRQLRTPFIAFRSLSDLAGGGSSLSNEASTF  323

Query  319   IDLAADNSVKVAVEFIKKVPS  257
               LAA N+V   V+FI  + S
Sbjct  324   ASLAAQNAVDAVVKFISLLAS  344



>ref|XP_003528930.1| PREDICTED: bark storage protein A [Glycine max]
Length=343

 Score =   382 bits (981),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 181/309 (59%), Positives = 230/309 (74%), Gaps = 3/309 (1%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVM  1019
             I   N++GPY+G+V+PN FE+NPLL   S+ P       D+AG+ FR G +E K VI+VM
Sbjct  31    ISKINREGPYVGIVVPNAFELNPLLRSPSFVPHNKFPYFDFAGKHFRIGVLEKKRVIVVM  90

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             TGL+MLNAGI+TQLLL++FD+ GVVHYGIAGNANP L IGDV IPQYW+HT LWNWQR+G
Sbjct  91    TGLSMLNAGISTQLLLTLFDIEGVVHYGIAGNANPKLQIGDVTIPQYWAHTGLWNWQRFG  150

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
             DGP++ L LE +GDY+R  G++KFA Y  N     S  NLLNNVW+Q EEIFPV+ T E 
Sbjct  151   DGPKDALALEASGDYSRRFGYLKFADYNNNTKHSKSATNLLNNVWFQAEEIFPVNGTAEV  210

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
             RQH FWV VD  YF+IA+ L+ ++L  C+N TTCL   P V RVE+G SA++++DN AYR
Sbjct  211   RQHAFWVSVDKTYFEIARELKNVKLSNCVN-TTCLPRRPIVVRVEKGVSANVFVDNKAYR  269

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
              F++ KF+V+ ++MESAAVAL+C QQK P+I IR+LSDLAG  S  SNE   F  LA+ N
Sbjct  270   EFLHSKFDVTAIDMESAAVALICLQQKKPFIAIRSLSDLAGDSSTLSNEVDVFASLASQN  329

Query  298   SVKVAVEFI  272
             ++ V V FI
Sbjct  330   ALDVVVRFI  338



>emb|CDX92904.1| BnaC07g41620D [Brassica napus]
Length=348

 Score =   382 bits (981),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 191/313 (61%), Positives = 238/313 (76%), Gaps = 9/313 (3%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSY--KPSTLIIDYAGRRFRFGTIEGKPVILVM  1019
             IE  NK+GPYLG+V PN FE+NPLL   +Y   PS   ID+AGRRFRFG I  + V++VM
Sbjct  34    IEWMNKRGPYLGIVAPNNFELNPLLASQAYVPYPSVPFIDFAGRRFRFGKISNQRVVIVM  93

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             TGL M+NAG+ TQLL+S+F + GV+HYGIAGNA+ +L IGDV IP+YW+H+ LWNWQRYG
Sbjct  94    TGLGMVNAGVATQLLVSLFRLKGVLHYGIAGNADVNLEIGDVTIPKYWAHSGLWNWQRYG  153

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
              G ++EL LE  GDYTR+IG+++F+KY+      N  DN+LN VWYQPEEIFPV  TPE 
Sbjct  154   AGIDDELALEAPGDYTRDIGYLQFSKYS------NGSDNVLNRVWYQPEEIFPVTGTPEV  207

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
             R+HIFWVPVD  Y   A+ LE  +L  C+N TTCL   PKVT V+RG SAS+++DNAAYR
Sbjct  208   REHIFWVPVDKSYLNFARQLEDTKLPQCVN-TTCLPRPPKVTIVDRGVSASVFVDNAAYR  266

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
             +F+  KFN + VEMES AVAL+CHQQ +P+++IRALSDLAGGGS  SNEA  F  LAA N
Sbjct  267   TFLRSKFNATAVEMESTAVALICHQQSIPFVVIRALSDLAGGGSDMSNEADIFGSLAAQN  326

Query  298   SVKVAVEFIKKVP  260
             SV V V+F+  +P
Sbjct  327   SVDVLVKFVGLLP  339



>ref|XP_009129133.1| PREDICTED: bark storage protein A [Brassica rapa]
Length=347

 Score =   382 bits (980),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 191/329 (58%), Positives = 246/329 (75%), Gaps = 11/329 (3%)
 Frame = -1

Query  1240  EGANGSLLDDGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSY--KPSTLIIDYAGR  1067
             E ANG +    K    I+  NK+GPYLG+V PN FE+NPLL   +Y   PS   ID+AGR
Sbjct  20    EEANGEI--SPKVLSNIKMMNKRGPYLGIVAPNNFELNPLLASQAYVPYPSLPFIDFAGR  77

Query  1066  RFRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAI  887
             RFRFG I  + V++VMTGL M+N G+ TQLL+S+F + GV+HYGIAGNA+ +L+IGDV I
Sbjct  78    RFRFGNISNQRVVIVMTGLGMVNTGVVTQLLVSLFRLKGVLHYGIAGNADVNLDIGDVTI  137

Query  886   PQYWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNV  707
             P++W+H+ LWNWQRYGDG ++EL LE  GDYTR+IG+++F+KY       N  DNLLN V
Sbjct  138   PKFWAHSGLWNWQRYGDGIDDELALEAGGDYTRDIGYLQFSKYN------NQSDNLLNRV  191

Query  706   WYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRV  527
             WYQPEEIFPV  TPE R+H+FWVPVD  Y  +A+ L+ + L  C+N TTCL   PKVT V
Sbjct  192   WYQPEEIFPVTGTPELREHVFWVPVDKSYLDLARQLQDMRLPQCVN-TTCLPRPPKVTIV  250

Query  526   ERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggs  347
             +RG SAS+++DNAAYR+F+  KFN + ++MESAAVAL+CHQQ +P+++IR+LSDLAGGGS
Sbjct  251   DRGVSASVFVDNAAYRTFLRSKFNATAIDMESAAVALICHQQALPFVVIRSLSDLAGGGS  310

Query  346   aesneaATFIDLAADNSVKVAVEFIKKVP  260
               SNEA  F  LAA NSV V V+F+  +P
Sbjct  311   DVSNEADLFGSLAAQNSVDVLVKFVGLLP  339



>ref|XP_008462741.1| PREDICTED: bark storage protein A [Cucumis melo]
Length=347

 Score =   380 bits (977),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 194/314 (62%), Positives = 242/314 (77%), Gaps = 11/314 (4%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI------IDYAGRRFRFGTIEGKPV  1031
             I   NK GPYLG+V+PN FEM+PLL+     PS ++       D+ GR FRFG I GK V
Sbjct  35    IGRVNKNGPYLGIVVPNAFEMDPLLQ----SPSLVVDHDLPYFDFLGRWFRFGRIRGKKV  90

Query  1030  ILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNW  851
             I+VMTGL+MLNAG TT+LLL++F V GV+HYGIAGNA+P L IGDV IP+YW+HT LWNW
Sbjct  91    IIVMTGLSMLNAGTTTELLLTLFRVKGVIHYGIAGNADPQLEIGDVTIPRYWAHTGLWNW  150

Query  850   QRYGDGPENELPLEVNGDYTREIGFIKFAKYAT-NVDECNSQDNLLNNVWYQPEEIFPVD  674
             QR GDGP++EL LE NGDYTR+IGF+KF+ ++T +     S DNLLNNVWYQPEEIFPVD
Sbjct  151   QRIGDGPDDELALESNGDYTRKIGFLKFSNFSTVDTKTETSVDNLLNNVWYQPEEIFPVD  210

Query  673   ATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLD  494
              TPE RQH+FW+PVD HYF +A+ LEGL+LE C+N+T CL   P   RV+R  SA++++D
Sbjct  211   GTPEIRQHVFWIPVDKHYFSLAKKLEGLKLERCLNSTNCLPRAPIAVRVQRSVSANVFVD  270

Query  493   NAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFID  314
             N AYR F+   FNV+ ++ME+AAVALVC +QK+P+I IR+LSDLAGGGSA SNEAATF  
Sbjct  271   NKAYREFLQSTFNVTSIDMETAAVALVCLRQKIPFIAIRSLSDLAGGGSALSNEAATFAV  330

Query  313   LAADNSVKVAVEFI  272
             LA+ N+    V+FI
Sbjct  331   LASQNAATALVKFI  344



>emb|CDY35234.1| BnaA01g07970D [Brassica napus]
Length=347

 Score =   380 bits (976),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 191/329 (58%), Positives = 245/329 (74%), Gaps = 11/329 (3%)
 Frame = -1

Query  1240  EGANGSLLDDGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSY--KPSTLIIDYAGR  1067
             E ANG +    K    I+  NK+GPYLG V PN FE+NPLL   +Y   PS   ID+AGR
Sbjct  20    EEANGEI--SPKVLSNIKMMNKRGPYLGFVAPNNFELNPLLASQAYVPYPSLPFIDFAGR  77

Query  1066  RFRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAI  887
             RFRFG I  + V++VMTGL M+N G+ TQLL+S+F + GV+HYGIAGNA+ +L+IGDV I
Sbjct  78    RFRFGNISNQRVVIVMTGLGMVNTGVVTQLLVSLFRLKGVLHYGIAGNADVNLDIGDVTI  137

Query  886   PQYWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNV  707
             P++W+H+ LWNWQRYGDG ++EL LE  GDYTR+IG+++F+KY       N  DNLLN V
Sbjct  138   PKFWAHSGLWNWQRYGDGIDDELALEAGGDYTRDIGYLQFSKYN------NQSDNLLNRV  191

Query  706   WYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRV  527
             WYQPEEIFPV  TPE R+H+FWVPVD  Y  +A+ L+ + L  C+N TTCL   PKVT V
Sbjct  192   WYQPEEIFPVTGTPELREHVFWVPVDKSYLDLARQLQDMRLPQCVN-TTCLPRPPKVTIV  250

Query  526   ERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggs  347
             +RG SAS+++DNAAYR+F+  KFN + ++MESAAVAL+CHQQ +P+++IR+LSDLAGGGS
Sbjct  251   DRGVSASVFVDNAAYRTFLRSKFNATAIDMESAAVALICHQQALPFVVIRSLSDLAGGGS  310

Query  346   aesneaATFIDLAADNSVKVAVEFIKKVP  260
               SNEA  F  LAA NSV V V+F+  +P
Sbjct  311   DVSNEADLFGSLAAQNSVDVLVKFVGLLP  339



>gb|KHN20661.1| Bark storage protein A [Glycine soja]
Length=343

 Score =   380 bits (975),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 180/309 (58%), Positives = 229/309 (74%), Gaps = 3/309 (1%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVM  1019
             I   N++GPY+G+V+PN FE+NPLL   S+ P       D+AG+ FR G +E K VI+VM
Sbjct  31    ISKINREGPYVGIVVPNAFELNPLLRSPSFVPHNKFPYFDFAGKHFRIGVLEKKRVIVVM  90

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             TGL+MLNAGI+TQLLL++ D+ GVVHYGIAGNANP L IGDV IPQYW+HT LWNWQR+G
Sbjct  91    TGLSMLNAGISTQLLLTLLDIEGVVHYGIAGNANPKLQIGDVTIPQYWAHTGLWNWQRFG  150

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
             DGP++ L LE +GDY+R  G++KFA Y  N     S  NLLNNVW+Q EEIFPV+ T E 
Sbjct  151   DGPKDALALEASGDYSRRFGYLKFADYNNNTKHSKSATNLLNNVWFQAEEIFPVNGTAEV  210

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
             RQH FWV VD  YF+IA+ L+ ++L  C+N TTCL   P V RVE+G SA++++DN AYR
Sbjct  211   RQHAFWVSVDKTYFEIARELKNVKLSNCVN-TTCLPRRPIVVRVEKGVSANVFVDNKAYR  269

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
              F++ KF+V+ ++MESAAVAL+C QQK P+I IR+LSDLAG  S  SNE   F  LA+ N
Sbjct  270   EFLHSKFDVTAIDMESAAVALICLQQKKPFIAIRSLSDLAGDSSTLSNEVDVFASLASQN  329

Query  298   SVKVAVEFI  272
             ++ V V FI
Sbjct  330   ALDVVVRFI  338



>emb|CDP03301.1| unnamed protein product [Coffea canephora]
Length=339

 Score =   379 bits (974),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 189/310 (61%), Positives = 242/310 (78%), Gaps = 7/310 (2%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVM  1019
             I   N++GPYLG+V+PN FEM+PLL+  S+ P   +  ID AGRRFR G  E K VI+VM
Sbjct  31    IRRVNQEGPYLGIVVPNSFEMSPLLQSPSFVPHDKLPHIDVAGRRFRIGKAENKRVIVVM  90

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             TGL+MLNAG++T+LLLS+F + G++H GIA NANP L IGDV IPQYW+HT LWNWQRYG
Sbjct  91    TGLSMLNAGVSTELLLSLFKIKGILHIGIAENANPQLQIGDVTIPQYWAHTGLWNWQRYG  150

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
             DGPE++L LE NGDYTR +G+++ + + +NV +     NLLNNVWYQPEE+FPVD  PE 
Sbjct  151   DGPEDKLSLESNGDYTRSVGYLELSDFNSNVKD----QNLLNNVWYQPEEVFPVDGYPEI  206

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
             RQH FW+PV+  YF +A+ LEG++LEGC+N +TCL   P VTRVERG SA++++DNAAYR
Sbjct  207   RQHAFWIPVNELYFSLAEKLEGIKLEGCLN-STCLPRRPLVTRVERGISANVFVDNAAYR  265

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
              F+Y KFN + ++MESAA+ALVC QQ+ P++ IRALSDLAGGGS+ SN AA F  LAA N
Sbjct  266   EFVYTKFNATAIDMESAAIALVCLQQRTPFLTIRALSDLAGGGSSTSNAAAIFAPLAAHN  325

Query  298   SVKVAVEFIK  269
             +V V ++FI 
Sbjct  326   AVVVLLKFIS  335



>ref|XP_004960653.1| PREDICTED: bark storage protein A-like [Setaria italica]
Length=350

 Score =   375 bits (963),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 187/314 (60%), Positives = 231/314 (74%), Gaps = 7/314 (2%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI---IDYAGRRFRFGTIEGKPVILV  1022
             I  AN+ GP+LGVV+PN FEM PLL    + P+  +   +D AGRRFRFGTI  + V++V
Sbjct  35    IRRANRLGPFLGVVVPNAFEMEPLLRSPRFSPARSLPPHLDVAGRRFRFGTIGEQKVVIV  94

Query  1021  MTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRY  842
             MTGL MLN+G+TTQLLL++FDV G+VH+GIAGNA+P   IGDVA+P+YW+HT LWNWQRY
Sbjct  95    MTGLGMLNSGVTTQLLLTLFDVKGIVHFGIAGNADPDRQIGDVAVPRYWAHTGLWNWQRY  154

Query  841   GDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFP-VDATP  665
             G GPENEL LE NGDYTRE+G + F  Y        S  NLLN VWYQPEE+FP    TP
Sbjct  155   GHGPENELALESNGDYTRELGSLNFTDYTVG-KNARSDGNLLNGVWYQPEEVFPAASGTP  213

Query  664   EERQHIFWVPVDSHYFQIAQSLEGLELEGCI--NATTCLTHTPKVTRVERGTSASIYLDN  491
             E R H FW PVD+ Y+++++ LEG++LE C+  N TTCL   P V  VERG SAS+++DN
Sbjct  214   EVRGHAFWAPVDARYYELSRKLEGVKLEACVVSNGTTCLPRRPAVAWVERGCSASVFVDN  273

Query  490   AAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDL  311
             AAYR F+  +F V+ V+ME+AAVALV  QQ  P+I +RALSDLAGGG+AESNEA  F  L
Sbjct  274   AAYREFLRSRFGVTAVDMETAAVALVALQQGAPFIAVRALSDLAGGGAAESNEAGVFAPL  333

Query  310   AADNSVKVAVEFIK  269
              A N+V VAVE I 
Sbjct  334   TAQNAVTVAVELIS  347



>ref|XP_006645676.1| PREDICTED: bark storage protein A-like [Oryza brachyantha]
Length=298

 Score =   372 bits (955),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 180/289 (62%), Positives = 224/289 (78%), Gaps = 6/289 (2%)
 Frame = -1

Query  1132  MNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFD  959
             M+P+L   S+ PS  +  +D  GRRFRFGTI G+ V++VMTGL+MLNAG+TTQLLLS+F 
Sbjct  1     MDPVLGSPSFTPSATLPYLDVQGRRFRFGTIGGQNVVMVMTGLSMLNAGLTTQLLLSLFR  60

Query  958   VYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDGPENELPLEVNGDYTREIG  779
             V G+VH+GIAGNA+  L IGDV IP++W+H +LWNWQRYGDGPENELPLE  GDYTRE+G
Sbjct  61    VKGIVHWGIAGNADEGLQIGDVTIPEHWAHLSLWNWQRYGDGPENELPLEAAGDYTRELG  120

Query  778   FIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSL  599
             F+ F+ YA          NLLN++WYQPEEIFPV   PE+RQH FWVPV   YF +A+ L
Sbjct  121   FLNFSDYAA----AGHSPNLLNSIWYQPEEIFPVSGIPEQRQHAFWVPVSKRYFALAEKL  176

Query  598   EGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVA  419
             EGLEL  C+NATTCL   P+VTRV RG SA+++LDNAAYR F+  KF  +PVEMESAAVA
Sbjct  177   EGLELPACVNATTCLPRAPRVTRVSRGCSANLFLDNAAYRQFLRAKFGCTPVEMESAAVA  236

Query  418   LVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSVKVAVEFI  272
             LV HQ  VP++ IR+LSDLAGGGS+  NEA+ F+ +AA N+V V ++F+
Sbjct  237   LVAHQHGVPFLTIRSLSDLAGGGSSLGNEASKFLSIAAQNAVDVMLKFV  285



>ref|XP_010540964.1| PREDICTED: bark storage protein A [Tarenaya hassleriana]
Length=342

 Score =   374 bits (959),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 183/310 (59%), Positives = 230/310 (74%), Gaps = 7/310 (2%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSY--KPSTLIIDYAGRRFRFGTIEGKPVILVM  1019
             IE  N+KGP LG+V PN+FE+NPLL   ++   PS   ID+AGRRFR G +  + V++VM
Sbjct  32    IETINRKGPRLGIVAPNVFELNPLLNSPAFVPDPSLPYIDFAGRRFRIGKLSNESVVIVM  91

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
              GL MLNAG+ TQLL+++F + GV+HYGIAGNAN  L IGDVAIPQYW+H+ LWNWQRYG
Sbjct  92    VGLGMLNAGVGTQLLVNLFRIKGVLHYGIAGNANVDLEIGDVAIPQYWAHSGLWNWQRYG  151

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
             DGPE+EL LE  GDYTR+IG+++F+ Y T   +  S  NLLN VWYQPEEIFP   TPE 
Sbjct  152   DGPEDELSLEAGGDYTRQIGYLQFSDYNT---KNLSDANLLNRVWYQPEEIFPTTGTPEV  208

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
             R+H+FW+PVD  Y ++A  L+G+ L  C+N  TCL   P+V  V  G SASI++DNAAYR
Sbjct  209   REHVFWIPVDPTYLEVAHKLKGMRLGRCVNG-TCLPREPRVAVVRHGMSASIFVDNAAYR  267

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
             SF+  KFNV+ +EMESAAVALV HQQ++P+I+IRALSDL  GG    N A  F  LA+ N
Sbjct  268   SFLNGKFNVTAIEMESAAVALVSHQQRLPFIVIRALSDL-AGGDVTDNGANVFGGLASQN  326

Query  298   SVKVAVEFIK  269
             SV V VEF++
Sbjct  327   SVDVLVEFVR  336



>ref|XP_011093615.1| PREDICTED: bark storage protein A [Sesamum indicum]
Length=354

 Score =   372 bits (954),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 186/312 (60%), Positives = 233/312 (75%), Gaps = 5/312 (2%)
 Frame = -1

Query  1195  LIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILV  1022
             +I   N  GPYLGVV+PN FEM PLL   S+ P   +  +D+AGRRFR G +E + V++V
Sbjct  34    MIGVINSMGPYLGVVVPNTFEMAPLLNSPSFLPHQHLPFLDFAGRRFRIGAVETRKVVVV  93

Query  1021  MTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRY  842
             M+GL+ +NAGI TQLLLS+F + GVVH+GIAGNANP L IGDV IP YW+HT LWNWQR+
Sbjct  94    MSGLSTINAGIATQLLLSLFHIEGVVHFGIAGNANPQLQIGDVTIPHYWAHTGLWNWQRW  153

Query  841   GDGPENELPLEVNGDYTREIGFIKFAKYATNVDECN--SQDNLLNNVWYQPEEIFPVDAT  668
             GD  ++EL LE  GDYTREIG+++F+ Y  N       S DN LN VWYQPEEIF VD  
Sbjct  154   GDDADDELALESAGDYTREIGYLRFSDYNNNNTTYGSVSTDNFLNRVWYQPEEIFSVDGH  213

Query  667   PEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNA  488
             PE RQH FWVPVD+ Y  +A++LEG++LE C+N +TCL   P+V  VERG SA++++DNA
Sbjct  214   PEVRQHAFWVPVDALYLSLAKNLEGMKLERCMN-STCLPRAPEVVMVERGVSANVFVDNA  272

Query  487   AYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLA  308
             AYR F+  KFN +P++MESAAVALVC QQ+ P+I IRALSDLAGGGS+ SNEA  F  LA
Sbjct  273   AYREFLRSKFNATPIDMESAAVALVCLQQRKPFIAIRALSDLAGGGSSVSNEADAFAPLA  332

Query  307   ADNSVKVAVEFI  272
             A N+V V + F+
Sbjct  333   AQNAVSVMLSFV  344



>emb|CDX92905.1| BnaC07g41630D [Brassica napus]
Length=349

 Score =   369 bits (946),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 186/313 (59%), Positives = 237/313 (76%), Gaps = 9/313 (3%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVM  1019
             IE  NK+GP+LG+V PN +E+NPLL+  +Y P   +  ID+AGR+FRFG+I    V++VM
Sbjct  34    IEWINKRGPFLGIVAPNNYELNPLLDSQAYVPYHRLPSIDFAGRKFRFGSILNHRVVIVM  93

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             +GL M+NA ++TQLL+++F + GV+HYGIAGNA+ +L IGDV IP+YW+H+ LWNWQRYG
Sbjct  94    SGLGMVNAAVSTQLLVNLFRLRGVLHYGIAGNADVNLQIGDVTIPRYWAHSGLWNWQRYG  153

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
              G +NEL LE  GDYTREIG+++FAKY       N  DNLLN +WYQPEEIFPV  TPE 
Sbjct  154   AGIDNELALEGGGDYTREIGYLEFAKY------TNGSDNLLNRIWYQPEEIFPVTGTPEV  207

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
             R+H FWVPVD ++  IA  LE  +L  C+N TTCL   PKVT V+ G SAS+++DNAAYR
Sbjct  208   REHAFWVPVDEYFLDIASKLENTKLPQCVN-TTCLPRPPKVTIVDHGVSASVFVDNAAYR  266

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
             +F+  KFN + VEMESAAVAL+ HQQ +P+I+IRALSDLAGGGS  SNEA  F  LAA N
Sbjct  267   TFLRSKFNATAVEMESAAVALISHQQNIPFIVIRALSDLAGGGSEISNEADIFGSLAAVN  326

Query  298   SVKVAVEFIKKVP  260
             SV V V+F+  +P
Sbjct  327   SVDVLVKFVGLLP  339



>ref|NP_001042490.1| Os01g0229800 [Oryza sativa Japonica Group]
 dbj|BAF04404.1| Os01g0229800 [Oryza sativa Japonica Group]
Length=303

 Score =   362 bits (930),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 174/290 (60%), Positives = 220/290 (76%), Gaps = 7/290 (2%)
 Frame = -1

Query  1132  MNPLLEHSSYKPSTLI---IDYAGRRFRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVF  962
             M+P+L   S+ P+  +   +D  GRRFRFG I G+ V++VMTGL+MLNAG+TTQLLLS+F
Sbjct  1     MDPVLNSPSFTPTPTLPSYLDIQGRRFRFGAIGGQNVVMVMTGLSMLNAGLTTQLLLSLF  60

Query  961   DVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDGPENELPLEVNGDYTREI  782
              V G+VH+GIAGNA+  L IGDV IP++W+H +LWNWQRYGDGPENELPLE  GDYTR++
Sbjct  61    RVKGIVHWGIAGNADEGLQIGDVTIPEHWAHLSLWNWQRYGDGPENELPLEAAGDYTRDL  120

Query  781   GFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQS  602
             GF+ F+ Y           N LN++W+QPEEIFPV   PE+RQH FWVPV S YF +A+ 
Sbjct  121   GFLNFSDYTA----AGPSPNELNSIWFQPEEIFPVSGKPEQRQHAFWVPVSSRYFSLAEK  176

Query  601   LEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAV  422
             LEG+EL  C+NATTCL   P+VTRV RG SA+++LDNAAYR F+  KF  +PVEMESAAV
Sbjct  177   LEGMELPACVNATTCLPRAPRVTRVRRGCSANVFLDNAAYRQFLRAKFGCTPVEMESAAV  236

Query  421   ALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSVKVAVEFI  272
             ALV HQ  VP++ IR+LSDLAGGGS+  NEA  F+ +AA N+V V + F+
Sbjct  237   ALVAHQHAVPFLTIRSLSDLAGGGSSLGNEAGEFLAIAAQNAVDVMLNFV  286



>ref|XP_003565983.1| PREDICTED: bark storage protein A [Brachypodium distachyon]
Length=367

 Score =   364 bits (935),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 184/321 (57%), Positives = 233/321 (73%), Gaps = 9/321 (3%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKP  1034
             KT   +  AN+ GP++G+V+PN +EM P+L   S+K S  +  ID  GRRFRFGTI G+ 
Sbjct  32    KTWAAVRRANRDGPFVGLVVPNTYEMVPVLNSPSFKASKGVPNIDVQGRRFRFGTIGGQN  91

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             V++VMTGL+MLNAG+TTQLLLS+F V G+VH+GIAGNAN  L IGDV IP+YW+H +LWN
Sbjct  92    VVMVMTGLSMLNAGLTTQLLLSLFRVKGIVHWGIAGNANEDLQIGDVTIPEYWAHLSLWN  151

Query  853   WQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQ--DNLLNNVWYQPEEIFP  680
             WQR G G +NELPLE  GDYTR++GF+ F+ Y       N +   N LN++WYQPEEIFP
Sbjct  152   WQRAGLGKDNELPLESAGDYTRDLGFLNFSDYTVGQAATNPELSANKLNSIWYQPEEIFP  211

Query  679   VDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCI---NATT--CLTHTPKVTRVERGT  515
                 PEER+H FWVP  + Y+ +A  LEG++L  C+   N TT  CL   P+V RV RG 
Sbjct  212   ASGEPEERRHAFWVPASAPYYALAAKLEGMKLPQCVKNNNGTTDKCLPRAPRVARVARGC  271

Query  514   SASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesn  335
             SA+++LDNAAYR FI  KF  +PVEMESAAVALV +QQ VP++ IR+LSDLAGGGSA  N
Sbjct  272   SANVFLDNAAYRQFIRAKFGCTPVEMESAAVALVAYQQGVPFLTIRSLSDLAGGGSALGN  331

Query  334   eaATFIDLAADNSVKVAVEFI  272
             EA  FI +AA N+V V + F+
Sbjct  332   EAGEFIGIAAQNAVDVMLRFV  352



>gb|KCW79941.1| hypothetical protein EUGRSUZ_C01273 [Eucalyptus grandis]
Length=346

 Score =   363 bits (932),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 178/314 (57%), Positives = 232/314 (74%), Gaps = 2/314 (1%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYK--PSTLIIDYAGRRFRFGTIEGKPVILVM  1019
             I   N +GPY+GV++PN FEM+PLL+  S++  P+   +D  GRRFRFG ++ K V++VM
Sbjct  33    IRRMNSRGPYVGVIVPNSFEMSPLLQSPSFRSDPNFPYLDILGRRFRFGKVKNKKVVIVM  92

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             TGL+MLNAGITT+LLL++FDV GVVHYGIAGNANP L IGDV IPQYW+HT LWNWQR+G
Sbjct  93    TGLSMLNAGITTELLLALFDVKGVVHYGIAGNANPQLQIGDVTIPQYWAHTGLWNWQRFG  152

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
             DGP++EL  E +GD TRE G+++F  Y     +     N LN VW+Q EE+FP+D  PE 
Sbjct  153   DGPDDELAFESSGDDTREFGYLEFDDYNNATRDGEGVGNFLNRVWHQREEVFPIDGVPEV  212

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
             RQ  FWVPVD  Y++++  +  L+LE C+N++TCL  TP+V  V+RG SA++++DN AYR
Sbjct  213   RQLAFWVPVDKSYYKLSTKITDLKLEACVNSSTCLPRTPRVVMVKRGVSANVFVDNRAYR  272

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
              F+  KFN +PV+MESA VALVC Q   P+I  R+LSDLAGGGS+ SNEA TF  LAA N
Sbjct  273   EFLSSKFNATPVDMESAGVALVCRQLGTPFIAFRSLSDLAGGGSSLSNEATTFASLAAQN  332

Query  298   SVKVAVEFIKKVPS  257
             +V   V+FI  + S
Sbjct  333   AVDAVVKFISLLAS  346



>ref|XP_010047917.1| PREDICTED: bark storage protein A-like [Eucalyptus grandis]
Length=352

 Score =   363 bits (933),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 178/314 (57%), Positives = 232/314 (74%), Gaps = 2/314 (1%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYK--PSTLIIDYAGRRFRFGTIEGKPVILVM  1019
             I   N +GPY+GV++PN FEM+PLL+  S++  P+   +D  GRRFRFG ++ K V++VM
Sbjct  39    IRRMNSRGPYVGVIVPNSFEMSPLLQSPSFRSDPNFPYLDILGRRFRFGKVKNKKVVIVM  98

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             TGL+MLNAGITT+LLL++FDV GVVHYGIAGNANP L IGDV IPQYW+HT LWNWQR+G
Sbjct  99    TGLSMLNAGITTELLLALFDVKGVVHYGIAGNANPQLQIGDVTIPQYWAHTGLWNWQRFG  158

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
             DGP++EL  E +GD TRE G+++F  Y     +     N LN VW+Q EE+FP+D  PE 
Sbjct  159   DGPDDELAFESSGDDTREFGYLEFDDYNNATRDGEGVGNFLNRVWHQREEVFPIDGVPEV  218

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
             RQ  FWVPVD  Y++++  +  L+LE C+N++TCL  TP+V  V+RG SA++++DN AYR
Sbjct  219   RQLAFWVPVDKSYYKLSTKITDLKLEACVNSSTCLPRTPRVVMVKRGVSANVFVDNRAYR  278

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
              F+  KFN +PV+MESA VALVC Q   P+I  R+LSDLAGGGS+ SNEA TF  LAA N
Sbjct  279   EFLSSKFNATPVDMESAGVALVCRQLGTPFIAFRSLSDLAGGGSSLSNEATTFASLAAQN  338

Query  298   SVKVAVEFIKKVPS  257
             +V   V+FI  + S
Sbjct  339   AVDAVVKFISLLAS  352



>gb|KEH27138.1| bark storage-like protein [Medicago truncatula]
Length=336

 Score =   362 bits (929),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 177/309 (57%), Positives = 230/309 (74%), Gaps = 7/309 (2%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVM  1019
             I N N KGPY+G+V+PN FE+NPLL+ SS+ P       D+AGR FR G +E K VI+VM
Sbjct  30    ISNINNKGPYIGIVVPNDFELNPLLQSSSFVPHNKFPYFDFAGRHFRIGELEKKKVIVVM  89

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             TGL+MLNAG+ TQLLL++F+V GV+HYGIAGN N    IGDV IPQYW+HT LW+WQR+G
Sbjct  90    TGLSMLNAGLATQLLLTLFNVKGVLHYGIAGNVNSKFQIGDVTIPQYWAHTGLWHWQRFG  149

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
             D PE+    E N D+++E G++KF+ Y        S +NLL+ VWYQPEEIFPVD TPE 
Sbjct  150   DNPED----EENVDFSKEFGYLKFSNYNNYTKHSKSVENLLSKVWYQPEEIFPVDGTPEV  205

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
              QH FWVPVD  YF+IA+ L+ +EL  C+N TTCL   P V RV++G SA++++DN AYR
Sbjct  206   LQHAFWVPVDKTYFEIARKLKNVELSSCVN-TTCLPRKPIVVRVKKGVSANVFVDNKAYR  264

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
              F+  KF+ +PV+MESA+VALVC Q K+P+I IRALSDLAGGGS+ +NE + ++ LA+ N
Sbjct  265   DFLNLKFDATPVDMESASVALVCFQHKIPFIAIRALSDLAGGGSSLTNEYSIYLSLASQN  324

Query  298   SVKVAVEFI  272
             +  V V+FI
Sbjct  325   AFNVLVKFI  333



>gb|AFK47296.1| unknown [Medicago truncatula]
Length=336

 Score =   361 bits (926),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 177/309 (57%), Positives = 229/309 (74%), Gaps = 7/309 (2%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVM  1019
             I N N KGPY+G+V+PN FE+NPLL+ SS+ P       D+AGR FR G +E K VI+VM
Sbjct  30    ISNINNKGPYIGIVVPNDFELNPLLQSSSFVPHNKFPYFDFAGRHFRIGELEKKKVIVVM  89

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             TGL+MLNAG+ TQLLL++F+V GV+HYGIAGN N    IGDV IPQYW HT LW+WQR+G
Sbjct  90    TGLSMLNAGLATQLLLTLFNVKGVLHYGIAGNVNSKFQIGDVTIPQYWVHTGLWHWQRFG  149

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
             D PE+    E N D+++E G++KF+ Y        S +NLL+ VWYQPEEIFPVD TPE 
Sbjct  150   DNPED----EENVDFSKEFGYLKFSNYNNYTKHSKSVENLLSKVWYQPEEIFPVDGTPEV  205

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
              QH FWVPVD  YF+IA+ L+ +EL  C+N TTCL   P V RV++G SA++++DN AYR
Sbjct  206   LQHAFWVPVDKTYFEIARKLKNVELSSCVN-TTCLPRKPIVVRVKKGVSANVFVDNKAYR  264

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
              F+  KF+ +PV+MESA+VALVC Q K+P+I IRALSDLAGGGS+ +NE + ++ LA+ N
Sbjct  265   DFLNLKFDATPVDMESASVALVCFQHKIPFIAIRALSDLAGGGSSLTNEYSIYLSLASQN  324

Query  298   SVKVAVEFI  272
             +  V V+FI
Sbjct  325   AFNVLVKFI  333



>emb|CCJ09766.1| hypothetical protein, partial [Hirudo medicinalis]
Length=272

 Score =   357 bits (916),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 160/268 (60%), Positives = 205/268 (76%), Gaps = 2/268 (1%)
 Frame = -1

Query  1159  GVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVMTGLAMLNAGIT  986
             G+V+PN FEMNPLLE S++ P   I  +D+AGRRFR GT+E + V++VM+GL+MLN+G+ 
Sbjct  2     GIVVPNRFEMNPLLESSNFLPHDTIPHLDHAGRRFRIGTLENRKVVVVMSGLSMLNSGVA  61

Query  985   TQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDGPENELPLEV  806
             TQLLLSVF ++GV+H G AG ANP + IGDV IP YW+HT LWNWQR+GDGPE+EL  E 
Sbjct  62    TQLLLSVFRIHGVLHLGSAGGANPEIQIGDVTIPHYWAHTGLWNWQRFGDGPEDELAFES  121

Query  805   NGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHIFWVPVDS  626
             NGDYTR+ G+++FA Y    +   S DN LN VWYQPEEIF  D  PE R+H FWVP+D 
Sbjct  122   NGDYTRKYGYLRFADYQVRKEGEQSSDNYLNGVWYQPEEIFYGDGEPEIREHAFWVPIDK  181

Query  625   HYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYDKFNVSP  446
             HY+  A++LE + LE C+N++ CL   PKV RV RG SA++++DNAAYR F+  KF  +P
Sbjct  182   HYYSPAKNLENIVLERCVNSSLCLPQPPKVVRVRRGVSANVFVDNAAYREFLNSKFKATP  241

Query  445   VEMESAAVALVCHQQKVPYIIIRALSDL  362
             V+MESAAVALVC QQK P+I IRA+S+L
Sbjct  242   VDMESAAVALVCRQQKTPFIAIRAISNL  269



>ref|XP_003528928.1| PREDICTED: bark storage protein A-like [Glycine max]
 gb|KHN04569.1| Bark storage protein A [Glycine soja]
Length=334

 Score =   358 bits (919),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 178/309 (58%), Positives = 228/309 (74%), Gaps = 10/309 (3%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVM  1019
             I N N +GPYLG+V+PN FE+ PLL  SS+ P       D+AG+ FR G +E K VI+VM
Sbjct  29    ISNINSEGPYLGIVVPNSFELGPLLRSSSFVPHNKFPYFDFAGKHFRIGVLEKKRVIVVM  88

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
              GL MLNAG++TQLLL++F+V GV+HYGIAGNANP L IGDV IPQYW+HT LW+WQR G
Sbjct  89    CGLGMLNAGLSTQLLLTLFNVNGVLHYGIAGNANPKLQIGDVTIPQYWAHTGLWHWQRLG  148

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
             +       + V+GD++R+ G+++FA Y     +  S  NLLN VWYQPEEI+PV+  PE 
Sbjct  149   E-------VNVSGDFSRDFGYLEFANYNNCSKDFKSNTNLLNKVWYQPEEIYPVNGIPEA  201

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
             R  IFWVPVD  YF+IA  L+ ++LE C+N TTCL   P VTRVE+G +A++++DN AYR
Sbjct  202   RHEIFWVPVDKTYFKIASKLKNVKLESCVN-TTCLPRKPIVTRVEKGVTANVFVDNKAYR  260

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
              F+Y KF+ +PVEME+AAVALVC QQK P+I IR+LSDLAGGGSA SNE   F  LA+ N
Sbjct  261   EFLYSKFDATPVEMETAAVALVCLQQKKPFIAIRSLSDLAGGGSALSNEVDVFSSLASQN  320

Query  298   SVKVAVEFI  272
             + +V V+FI
Sbjct  321   AFEVLVKFI  329



>ref|XP_009785044.1| PREDICTED: bark storage protein A isoform X3 [Nicotiana sylvestris]
Length=235

 Score =   354 bits (909),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 161/215 (75%), Positives = 189/215 (88%), Gaps = 2/215 (1%)
 Frame = -1

Query  1240  EGANGSLLDDGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRF  1061
             E ANG+    GKT+ LI+ AN++GPYLG++IPN+FEMNPLL H SYKP+ L IDYAGRRF
Sbjct  20    EEANGA--ATGKTKKLIDMANRRGPYLGLIIPNLFEMNPLLHHPSYKPTNLTIDYAGRRF  77

Query  1060  RFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQ  881
             RFG I+ +PV+LVMTGLAMLNAGITTQLLL++F + GVVHYGIAGNANPSL+IGDVAIPQ
Sbjct  78    RFGYIDNQPVVLVMTGLAMLNAGITTQLLLALFKIKGVVHYGIAGNANPSLHIGDVAIPQ  137

Query  880   YWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWY  701
             YW+HTALWNWQRYGDGP+NELPLEVNGDYTR+IG++K ++Y+ NV  CNS +NLLNNVWY
Sbjct  138   YWAHTALWNWQRYGDGPQNELPLEVNGDYTRDIGYLKISEYSVNVTNCNSHNNLLNNVWY  197

Query  700   QPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLE  596
             QPEE+FPV  TPEERQHIFWVPVD  YF IA+ L+
Sbjct  198   QPEEVFPVFGTPEERQHIFWVPVDPRYFAIAEKLK  232



>ref|XP_009785043.1| PREDICTED: bark storage protein A isoform X2 [Nicotiana sylvestris]
Length=239

 Score =   354 bits (909),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 161/215 (75%), Positives = 189/215 (88%), Gaps = 2/215 (1%)
 Frame = -1

Query  1240  EGANGSLLDDGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRF  1061
             E ANG+    GKT+ LI+ AN++GPYLG++IPN+FEMNPLL H SYKP+ L IDYAGRRF
Sbjct  20    EEANGA--ATGKTKKLIDMANRRGPYLGLIIPNLFEMNPLLHHPSYKPTNLTIDYAGRRF  77

Query  1060  RFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQ  881
             RFG I+ +PV+LVMTGLAMLNAGITTQLLL++F + GVVHYGIAGNANPSL+IGDVAIPQ
Sbjct  78    RFGYIDNQPVVLVMTGLAMLNAGITTQLLLALFKIKGVVHYGIAGNANPSLHIGDVAIPQ  137

Query  880   YWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWY  701
             YW+HTALWNWQRYGDGP+NELPLEVNGDYTR+IG++K ++Y+ NV  CNS +NLLNNVWY
Sbjct  138   YWAHTALWNWQRYGDGPQNELPLEVNGDYTRDIGYLKISEYSVNVTNCNSHNNLLNNVWY  197

Query  700   QPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLE  596
             QPEE+FPV  TPEERQHIFWVPVD  YF IA+ L+
Sbjct  198   QPEEVFPVFGTPEERQHIFWVPVDPRYFAIAEKLK  232



>ref|XP_009785042.1| PREDICTED: bark storage protein A isoform X1 [Nicotiana sylvestris]
Length=275

 Score =   355 bits (912),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 162/218 (74%), Positives = 191/218 (88%), Gaps = 2/218 (1%)
 Frame = -1

Query  1240  EGANGSLLDDGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRF  1061
             E ANG+    GKT+ LI+ AN++GPYLG++IPN+FEMNPLL H SYKP+ L IDYAGRRF
Sbjct  20    EEANGA--ATGKTKKLIDMANRRGPYLGLIIPNLFEMNPLLHHPSYKPTNLTIDYAGRRF  77

Query  1060  RFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQ  881
             RFG I+ +PV+LVMTGLAMLNAGITTQLLL++F + GVVHYGIAGNANPSL+IGDVAIPQ
Sbjct  78    RFGYIDNQPVVLVMTGLAMLNAGITTQLLLALFKIKGVVHYGIAGNANPSLHIGDVAIPQ  137

Query  880   YWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWY  701
             YW+HTALWNWQRYGDGP+NELPLEVNGDYTR+IG++K ++Y+ NV  CNS +NLLNNVWY
Sbjct  138   YWAHTALWNWQRYGDGPQNELPLEVNGDYTRDIGYLKISEYSVNVTNCNSHNNLLNNVWY  197

Query  700   QPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLE  587
             QPEE+FPV  TPEERQHIFWVPVD  YF IA+ L+ L+
Sbjct  198   QPEEVFPVFGTPEERQHIFWVPVDPRYFAIAEKLKDLK  235



>ref|XP_008783246.1| PREDICTED: bark storage protein A [Phoenix dactylifera]
Length=347

 Score =   358 bits (918),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 183/305 (60%), Positives = 236/305 (77%), Gaps = 3/305 (1%)
 Frame = -1

Query  1180  NKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVMTGLA  1007
             NKKGP+LG+V+PN FEM+PLL+ S +  S  +  +D+ GRRFRFG +E + VI+VMTGL+
Sbjct  40    NKKGPFLGLVVPNSFEMSPLLQSSKFVRSKRLPCLDFGGRRFRFGRVEKEKVIIVMTGLS  99

Query  1006  MLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDGPE  827
             MLNAGI+TQLLL++FDV GVVH+G+AGNANP L IGDV IP+YW+HT LWNWQR+GDGP 
Sbjct  100   MLNAGISTQLLLTLFDVKGVVHFGVAGNANPDLQIGDVTIPKYWAHTGLWNWQRFGDGPN  159

Query  826   NELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHI  647
              EL  E +GDYTR IG + F+ +  N ++ N   N LN+VWYQPEE+FPV   PE R+  
Sbjct  160   AELSFESSGDYTRTIGHLNFSDFDINKNDKNF-GNSLNSVWYQPEEVFPVSGVPEVRERA  218

Query  646   FWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIY  467
             FWV VD HYF +++ LEG++L  CIN+TTCL   P V RVE G SA++++DNA Y  F+ 
Sbjct  219   FWVSVDHHYFALSEKLEGMKLTRCINSTTCLKRIPVVKRVEGGCSANVFVDNAEYSQFLR  278

Query  466   DKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSVKV  287
              KFNV+P++MESAAVAL+C QQ+VP+I +RALSDLAGGGS++SNEA+ F  LAA N+V  
Sbjct  279   SKFNVTPIDMESAAVALICLQQQVPFIAVRALSDLAGGGSSKSNEASVFGSLAAQNAVDA  338

Query  286   AVEFI  272
               +FI
Sbjct  339   VTQFI  343



>ref|XP_011012466.1| PREDICTED: bark storage protein A isoform X2 [Populus euphratica]
Length=325

 Score =   344 bits (883),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 172/313 (55%), Positives = 217/313 (69%), Gaps = 29/313 (9%)
 Frame = -1

Query  1204  TRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPV  1031
             T   I+  N+KGPYLG+++PN FEMNPLL+  S+     +  +DY               
Sbjct  35    TMQEIDRVNEKGPYLGIIVPNSFEMNPLLQSPSFVADLKVPYLDY---------------  79

Query  1030  ILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNW  851
                         GITTQLLL +F V GV+HYGIAGNANP L IGDV IP+YW+HT LWNW
Sbjct  80    -----------FGITTQLLLILFKVKGVLHYGIAGNANPQLQIGDVTIPRYWAHTGLWNW  128

Query  850   QRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDA  671
             QRYGDG   EL LE NGDYTREIG+++FA Y    +     DN LNNVWYQPEE+FP D 
Sbjct  129   QRYGDGTSEELALESNGDYTREIGYLRFANYQNASENGKPIDNFLNNVWYQPEEVFPADG  188

Query  670   TPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDN  491
              PE RQH FWVPV+ HYF++A+ +EG+  +GC+ ++TCL   P+  RV+ G SA+ ++DN
Sbjct  189   IPEVRQHSFWVPVNKHYFKVAKRIEGMTFQGCV-SSTCLPRAPRAVRVKNGASANAFVDN  247

Query  490   AAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDL  311
             +AYR F+  KFN++P++MESAAVALVCHQQ++P+I IRALSDLAGGGSA SNEA  F  L
Sbjct  248   SAYREFLNSKFNITPIDMESAAVALVCHQQQIPFIAIRALSDLAGGGSAVSNEADIFASL  307

Query  310   AADNSVKVAVEFI  272
             AA N+V  ++ FI
Sbjct  308   AAQNAVDASLRFI  320



>gb|KEH27142.1| bark storage-like protein [Medicago truncatula]
Length=331

 Score =   344 bits (882),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 173/309 (56%), Positives = 221/309 (72%), Gaps = 12/309 (4%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVM  1019
             I N N +GPY+G+V+PN FE+NPLL+ SS+ P       D+AGR FR G +E K VI+VM
Sbjct  30    ISNINSQGPYIGIVVPNAFELNPLLQSSSFVPHNKFPYFDFAGRHFRIGELEKKKVIVVM  89

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             TG +MLNAG+ TQLLL++F++ GV+HYGIAGN N    IGDV IPQYW+HT LW+WQR+G
Sbjct  90    TGESMLNAGLATQLLLTLFNIEGVLHYGIAGNVNSKFQIGDVTIPQYWAHTGLWHWQRFG  149

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
                      E  GD++ E+G++KFA Y         +DNLLN VWYQPE IFP+D TPE 
Sbjct  150   ---------EDKGDFSTELGYLKFANYNNYTKHYKLEDNLLNKVWYQPERIFPIDGTPEV  200

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
              Q  FWVPVD  YF+IA+ L+ +EL  C+N TTCL   P V RV++G SA++++DN AYR
Sbjct  201   WQPAFWVPVDKTYFEIARKLKNVELSICVN-TTCLPRKPMVVRVKKGVSANMFVDNKAYR  259

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
               +  KF+ +P +MESAAVALVC Q K+P+I IRALSDLAGGGSA SNE + FI LA+ N
Sbjct  260   DHLNSKFDATPTDMESAAVALVCFQHKIPFIAIRALSDLAGGGSALSNEVSIFISLASQN  319

Query  298   SVKVAVEFI  272
             +  V V+FI
Sbjct  320   AFDVLVKFI  328



>ref|XP_004513011.1| PREDICTED: bark storage protein A-like [Cicer arietinum]
Length=338

 Score =   343 bits (879),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 173/311 (56%), Positives = 225/311 (72%), Gaps = 9/311 (3%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVM  1019
             I   N +GP +G+V+PN FE+NPLL+ SS+ P       D+AGR FR G +E K VI+VM
Sbjct  30    ITKINIQGPCIGIVVPNAFELNPLLQSSSFVPHNKFPYFDFAGRHFRIGKLEKKKVIVVM  89

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             +GL+MLNAG+ TQLL S+F+V GV+HYGIAGNAN +  IGDV IPQYW+HT LW+WQR+G
Sbjct  90    SGLSMLNAGLATQLLFSLFNVEGVLHYGIAGNANSNFQIGDVTIPQYWAHTGLWHWQRFG  149

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNS--QDNLLNNVWYQPEEIFPVDATP  665
             D  E+    E +GD++RE G++KF+ Y        S    N+LN VWYQPEEI+PVD TP
Sbjct  150   DSLED----EESGDFSREFGYLKFSNYNNYTKHSKSVENQNVLNKVWYQPEEIYPVDGTP  205

Query  664   EERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAA  485
             E  Q  FWVPVD  YF+IA+  + +EL  C+N  TCL   P V RV++G SA++++DN A
Sbjct  206   EVEQLAFWVPVDKTYFEIARKGKNVELGSCVN-KTCLPRKPIVVRVKKGVSANVFVDNKA  264

Query  484   YRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAA  305
             YR F+  KF+V+P +MESAAVALVC Q K P+I IRALSDLAGGGS+ +NE +TF+ LA+
Sbjct  265   YRDFLNSKFDVTPTDMESAAVALVCLQHKKPFIAIRALSDLAGGGSSLTNEVSTFLTLAS  324

Query  304   DNSVKVAVEFI  272
              N+  V V+FI
Sbjct  325   QNAFDVLVKFI  335



>ref|NP_001054970.1| Os05g0228000 [Oryza sativa Japonica Group]
 gb|AAT77309.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16884.1| Os05g0228000 [Oryza sativa Japonica Group]
 dbj|BAG95167.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62814.1| hypothetical protein OsJ_17617 [Oryza sativa Japonica Group]
Length=360

 Score =   343 bits (879),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 170/286 (59%), Positives = 211/286 (74%), Gaps = 12/286 (4%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVM  1019
             +   N++GPYLGVV+PN FEM PLL   ++ P+  +  +D AGRRFRFG+I  K VI+VM
Sbjct  44    VRQVNRRGPYLGVVVPNGFEMEPLLRSPAFSPAKKLPYLDVAGRRFRFGSIGEKKVIIVM  103

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             TGL MLN+G+TTQLLL++FDV G+VH+GIAGNA+P L+IGDV +P+YW+HT LWNWQRYG
Sbjct  104   TGLGMLNSGVTTQLLLTLFDVEGIVHFGIAGNADPDLHIGDVTVPRYWAHTGLWNWQRYG  163

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
             DGPE EL LE NGDYTR+ G + F+ Y           NLLN VWYQPEE+FP D TPE 
Sbjct  164   DGPEKELALESNGDYTRKYGALNFSDYGVAG---GGGGNLLNGVWYQPEEVFPADGTPES  220

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINAT-------TCLTHTPKVTRVERGTSASIY  500
             R+H FWVPVD  Y+Q+AQ LE + LE C+N T       TCL   P V RVERG SAS++
Sbjct  221   RRHEFWVPVDGRYYQLAQKLEAMPLERCVNRTGTATSPATCLARAPAVARVERGCSASVF  280

Query  499   LDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDL  362
             +DNAAYR F+  +  V+P++MESAAVALV  QQ  P+I IR+LSDL
Sbjct  281   VDNAAYRQFLRSRLGVTPIDMESAAVALVAAQQGAPFIAIRSLSDL  326



>gb|AFK33817.1| unknown [Lotus japonicus]
Length=259

 Score =   338 bits (868),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 168/251 (67%), Positives = 206/251 (82%), Gaps = 4/251 (2%)
 Frame = -1

Query  1021  MTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRY  842
             MTG+ M+NAG+TTQLLLS+F V GVVHYG+AGNANPSL+IGDVAIPQYW+H ALW+WQRY
Sbjct  1     MTGMGMINAGVTTQLLLSLFTVEGVVHYGVAGNANPSLHIGDVAIPQYWAHLALWSWQRY  60

Query  841   GDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPE  662
             G GP + LP     D+T+E+G+++FA Y +N       DN LNN+WY+PEE+FPVD  PE
Sbjct  61    GQGPNDSLPF----DFTKEVGYLEFANYTSNSSSSVDSDNQLNNIWYEPEEVFPVDGIPE  116

Query  661   ERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAY  482
             E +H  WVPVDS Y+ IAQ L+GL+L+ CIN+TTCL+  PKV  V+RGTSASIYLDN AY
Sbjct  117   ETKHALWVPVDSKYYHIAQKLKGLKLKACINSTTCLSTIPKVELVDRGTSASIYLDNVAY  176

Query  481   RSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAAD  302
             R+F+Y+KFNVSPV+MESA+VA +C QQ+VP+I+ RALSDLAGGGSA+SNEA TF  LAA 
Sbjct  177   RTFLYNKFNVSPVDMESASVAFICLQQRVPFIVFRALSDLAGGGSAQSNEADTFASLAAT  236

Query  301   NSVKVAVEFIK  269
             NSV V VEF+K
Sbjct  237   NSVTVVVEFVK  247



>ref|XP_007012102.1| Phosphorylase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY29721.1| Phosphorylase superfamily protein isoform 2 [Theobroma cacao]
Length=296

 Score =   337 bits (865),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 178/319 (56%), Positives = 220/319 (69%), Gaps = 51/319 (16%)
 Frame = -1

Query  1213  DGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFGTIEGKP  1034
               + + LI  A   GPY+GVVIPN+FE++PLL + ++  +   I ++GRRFRFG I  K 
Sbjct  29    SAEVQKLIHEAKLNGPYVGVVIPNLFELSPLLHNPNFTSANFTIPFSGRRFRFGAIGEKR  88

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             VILVMTGL+++NAGITTQLLL++F + GVVHYGIA NANPSLNIGDV IP+YWS T+LW 
Sbjct  89    VILVMTGLSLINAGITTQLLLTLFKIEGVVHYGIAVNANPSLNIGDVTIPKYWSQTSLWY  148

Query  853   WQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVD  674
             WQRYGDGP +EL LE NGDYTRE+GF+KFA + TN                         
Sbjct  149   WQRYGDGPSDELTLESNGDYTRELGFLKFANFTTN-------------------------  183

Query  673   ATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLD  494
                                        L+LEGC+N+TTCL   P+V  V+RGTS S++LD
Sbjct  184   --------------------------DLKLEGCLNSTTCLDEQPRVVTVQRGTSGSVFLD  217

Query  493   NAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFID  314
             NAAYRSFIY KFNVSPV+MESA+VAL+C QQ+VP+IIIRALSDLAGGGSAESNEA  F  
Sbjct  218   NAAYRSFIYSKFNVSPVDMESASVALICLQQRVPFIIIRALSDLAGGGSAESNEADIFTS  277

Query  313   LAADNSVKVAVEFIKKVPS  257
             LAA+N+V V +EFIK++ +
Sbjct  278   LAANNAVTVVMEFIKQLSA  296



>ref|XP_003637886.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase, partial 
[Medicago truncatula]
Length=354

 Score =   336 bits (862),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 169/301 (56%), Positives = 216/301 (72%), Gaps = 12/301 (4%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVM  1019
             I N N +GPY+G+V+PN FE+NPLL+ SS+ P       D+AGR FR G +E K VI+VM
Sbjct  30    ISNINSQGPYIGIVVPNAFELNPLLQSSSFVPHNKFPYFDFAGRHFRIGELEKKKVIVVM  89

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             TG +MLNAG+ TQLLL++F++ GV+HYGIAGN N    IGDV IPQYW+HT LW+WQR+G
Sbjct  90    TGESMLNAGLATQLLLTLFNIEGVLHYGIAGNVNSKFQIGDVTIPQYWAHTGLWHWQRFG  149

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
                      E  GD++ E+G++KFA Y         +DNLLN VWYQPE IFP+D TPE 
Sbjct  150   ---------EDKGDFSTELGYLKFANYNNYTKHYKLEDNLLNKVWYQPERIFPIDGTPEV  200

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
              Q  FWVPVD  YF+IA+ L+ +EL  C+N TTCL   P V RV++G SA++++DN AYR
Sbjct  201   WQPAFWVPVDKTYFEIARKLKNVELSICVN-TTCLPRKPMVVRVKKGVSANMFVDNKAYR  259

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
               +  KF+ +P +MESAAVALVC Q K+P+I IRALSDLAGGGSA SNE + FI LA+ N
Sbjct  260   DHLNSKFDATPTDMESAAVALVCFQHKIPFIAIRALSDLAGGGSALSNEVSIFISLASQN  319

Query  298   S  296
             +
Sbjct  320   A  320



>gb|KEH27141.1| bark storage-like protein [Medicago truncatula]
Length=333

 Score =   331 bits (848),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 168/309 (54%), Positives = 219/309 (71%), Gaps = 12/309 (4%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVM  1019
             I N N +GP +G+V+PN +E+NPLL  SS+ P       D+AGR FR G +E K VI+VM
Sbjct  32    ISNINNEGPSIGIVVPNAYELNPLLHSSSFVPHNKFPYFDFAGRHFRIGELEKKKVIVVM  91

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             +G  MLNAG+ TQLLL++F++ GV+HYGIAGN N    IGDV IP+YW+HT LW+WQR+G
Sbjct  92    SGEGMLNAGLATQLLLTLFNIEGVLHYGIAGNLNSRFQIGDVTIPKYWAHTGLWHWQRFG  151

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
                      E  GD+  E+G++KF+ Y        S++NLLN VWYQPE IFPVD TPE 
Sbjct  152   ---------EDIGDFGTELGYLKFSNYNNYTKHSKSEENLLNKVWYQPERIFPVDGTPEV  202

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
              Q +FWVPVD  YF+IA+ L+ +EL  C+N TTCL   P V RV++G +A+I++DN AYR
Sbjct  203   WQPVFWVPVDKTYFEIARKLKNVELSSCVN-TTCLPRKPIVVRVKKGVTANIFVDNKAYR  261

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
               +  KF+ +P +MESAAVALVC Q K+P+I IRALSD AGGGSA SNEA+ F+ LA+ N
Sbjct  262   DHLNCKFDATPTDMESAAVALVCFQHKIPFIAIRALSDFAGGGSALSNEASIFLSLASQN  321

Query  298   SVKVAVEFI  272
             +  V V+FI
Sbjct  322   AFHVLVKFI  330



>gb|EEE54169.1| hypothetical protein OsJ_00983 [Oryza sativa Japonica Group]
Length=258

 Score =   320 bits (820),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/245 (62%), Positives = 189/245 (77%), Gaps = 4/245 (2%)
 Frame = -1

Query  1006  MLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDGPE  827
             MLNAG+TTQLLLS+F V G+VH+GIAGNA+  L IGDV IP++W+H +LWNWQRYGDGPE
Sbjct  1     MLNAGLTTQLLLSLFRVKGIVHWGIAGNADEGLQIGDVTIPEHWAHLSLWNWQRYGDGPE  60

Query  826   NELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHI  647
             NELPLE  GDYTR++GF+ F+ Y           N LN++W+QPEEIFPV   PE+RQH 
Sbjct  61    NELPLEAAGDYTRDLGFLNFSDYTA----AGPSPNELNSIWFQPEEIFPVSGKPEQRQHA  116

Query  646   FWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIY  467
             FWVPV S YF +A+ LEG+EL  C+NATTCL   P+VTRV RG SA+++LDNAAYR F+ 
Sbjct  117   FWVPVSSRYFSLAEKLEGMELPACVNATTCLPRAPRVTRVRRGCSANVFLDNAAYRQFLR  176

Query  466   DKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSVKV  287
              KF  +PVEMESAAVALV HQ  VP++ IR+LSDLAGGGS+  NEA  F+ +AA N+V V
Sbjct  177   AKFGCTPVEMESAAVALVAHQHAVPFLTIRSLSDLAGGGSSLGNEAGEFLAIAAQNAVDV  236

Query  286   AVEFI  272
              + F+
Sbjct  237   MLNFV  241



>emb|CAN83797.1| hypothetical protein VITISV_002973 [Vitis vinifera]
Length=1618

 Score =   346 bits (887),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 158/254 (62%), Positives = 197/254 (78%), Gaps = 10/254 (4%)
 Frame = -1

Query  1132  MNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFD  959
             M+PLL+  S+        +D+AGRRFR G +E K VI+VMTGL+MLNAG+TTQLLLS+F 
Sbjct  1     MDPLLQSPSFVADDKFPYLDFAGRRFRIGKLETKNVIIVMTGLSMLNAGLTTQLLLSLFK  60

Query  958   VYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDGPENELPLEVNGDYTREIG  779
             V GV+HYGIAGNANP+L IGDV +P+YW+HT LWNWQRYGDGP +EL  E +GDYTR+IG
Sbjct  61    VNGVLHYGIAGNANPNLQIGDVTVPKYWAHTGLWNWQRYGDGPGDELAFESSGDYTRKIG  120

Query  778   FIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSL  599
             ++KF+ Y  +    NS DNLLNNVWYQPEE+FPV  TPE RQH FWVPVD H++Q+A  L
Sbjct  121   YLKFSDYNNHTKNGNSSDNLLNNVWYQPEEVFPVTGTPEVRQHAFWVPVDKHFYQVAGKL  180

Query  598   EGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVA  419
             + L+LEGC+N +TCL   P VTRVERG SA++++DN AYR F+Y KFN +PV+MESAAVA
Sbjct  181   KDLKLEGCVN-STCLPRAPMVTRVERGVSANVFVDNGAYREFLYSKFNATPVDMESAAVA  239

Query  418   LVCHQQKVPYIIIR  377
             L       P+I+ R
Sbjct  240   L-------PFILRR  246



>dbj|BAA94780.1| putative bark storage protein [Oryza sativa Japonica Group]
Length=331

 Score =   318 bits (814),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 152/244 (62%), Positives = 188/244 (77%), Gaps = 4/244 (2%)
 Frame = -1

Query  1003  LNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDGPEN  824
             LNAG+TTQLLLS+F V G+VH+GIAGNA+  L IGDV IP++W+H +LWNWQRYGDGPEN
Sbjct  75    LNAGLTTQLLLSLFRVKGIVHWGIAGNADEGLQIGDVTIPEHWAHLSLWNWQRYGDGPEN  134

Query  823   ELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHIF  644
             ELPLE  GDYTR++GF+ F+ Y           N LN++W+QPEEIFPV   PE+RQH F
Sbjct  135   ELPLEAAGDYTRDLGFLNFSDYTA----AGPSPNELNSIWFQPEEIFPVSGKPEQRQHAF  190

Query  643   WVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYD  464
             WVPV S YF +A+ LEG+EL  C+NATTCL   P+VTRV RG SA+++LDNAAYR F+  
Sbjct  191   WVPVSSRYFSLAEKLEGMELPACVNATTCLPRAPRVTRVRRGCSANVFLDNAAYRQFLRA  250

Query  463   KFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSVKVA  284
             KF  +PVEMESAAVALV HQ  VP++ IR+LSDLAGGGS+  NEA  F+ +AA N+V V 
Sbjct  251   KFGCTPVEMESAAVALVAHQHAVPFLTIRSLSDLAGGGSSLGNEAGEFLAIAAQNAVDVM  310

Query  283   VEFI  272
             + F+
Sbjct  311   LNFV  314



>ref|XP_002972420.1| hypothetical protein SELMODRAFT_441751 [Selaginella moellendorffii]
 gb|EFJ26506.1| hypothetical protein SELMODRAFT_441751 [Selaginella moellendorffii]
Length=489

 Score =   312 bits (799),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 153/308 (50%), Positives = 221/308 (72%), Gaps = 5/308 (2%)
 Frame = -1

Query  1177  KKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVMTGLAM  1004
             ++GP+LG+V+P  FEM+ + + + + P   I  +D AGRRF  GTI+G  V+LV +  AM
Sbjct  45    REGPFLGLVVPTSFEMDAIRQQTIFAPHPYIPWLDLAGRRFHIGTIQGHKVVLVQSASAM  104

Query  1003  LNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDGPEN  824
             LNA ITTQ LL  FD+ GV+HYGIAG+AN SL IGD++IP+YW+HTALWNW+++ +G  +
Sbjct  105   LNAAITTQQLLDFFDINGVLHYGIAGSANDSLTIGDISIPKYWAHTALWNWEKFSNGSGH  164

Query  823   ELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHIF  644
              L    NGD+T+++G + F+ +A   +  +SQ NLL +VW QPE++  V  TPE R   F
Sbjct  165   LLSSGPNGDFTQDLGHLHFSDFAYP-NNGHSQ-NLLTSVWSQPEDVLKVSGTPEVRSRAF  222

Query  643   WVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYD  464
             WV VD  +++ A++LEG+EL  C NATTCL+  PKV    RG S++I++DNAAYR F++ 
Sbjct  223   WVRVDKRFYKAAKTLEGMELTSCFNATTCLSIRPKVVVGLRGASSNIFVDNAAYRQFMFQ  282

Query  463   KFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSVKVA  284
              F VS V+MESAAVALVC+  +VP+I+IR++SD + G +  +NE + F +LA+ N+VKV 
Sbjct  283   TFRVSSVDMESAAVALVCYSNEVPFIVIRSISD-SAGNAEGANEVSAFKNLASLNAVKVL  341

Query  283   VEFIKKVP  260
              +F+K +P
Sbjct  342   TQFLKALP  349



>ref|XP_006655113.1| PREDICTED: bark storage protein A-like [Oryza brachyantha]
Length=306

 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 160/310 (52%), Positives = 207/310 (67%), Gaps = 39/310 (13%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLL---EHSSYKPSTLIIDYAGRRFRFGTIEGKPVILV  1022
             +   N++GP++GVV+PN FEM PLL   E SS +     +D AGRRFRFGTI  K VI+V
Sbjct  29    VSRVNRQGPFVGVVVPNGFEMEPLLHSPEFSSARKLPAYLDVAGRRFRFGTIGEKKVIVV  88

Query  1021  MTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRY  842
             MTGL MLN+G+TTQLLL++FDV G+VH+GIAGNA+P+L+IGDV +P+YW+HT LWNWQRY
Sbjct  89    MTGLGMLNSGVTTQLLLTLFDVEGIVHFGIAGNADPALHIGDVTVPRYWAHTGLWNWQRY  148

Query  841   GDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPE  662
             GDGPE EL LE NGDYTR+ G + F+ Y+   D+  +  NLLN+VWYQPEE+F    TPE
Sbjct  149   GDGPEKELALESNGDYTRKYGALNFSDYSVGGDKP-AAGNLLNSVWYQPEEVFRAGGTPE  207

Query  661   ERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAY  482
              R H FWVPVD  Y+Q+++ LE                                   A  
Sbjct  208   SRGHEFWVPVDDRYYQLSRKLE-----------------------------------AMT  232

Query  481   RSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAAD  302
             R F+  +  V+ ++ME+AAVALV  QQ+ P+I IR+LSDLAGGGSA + +A  F  LA+ 
Sbjct  233   RQFLRSRLGVTAIDMETAAVALVALQQRTPFIAIRSLSDLAGGGSARAAQARAFAALASQ  292

Query  301   NSVKVAVEFI  272
             N+V VA+ FI
Sbjct  293   NAVAVAIRFI  302



>ref|XP_002993814.1| hypothetical protein SELMODRAFT_431848 [Selaginella moellendorffii]
 gb|EFJ05106.1| hypothetical protein SELMODRAFT_431848 [Selaginella moellendorffii]
Length=346

 Score =   302 bits (773),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 165/312 (53%), Positives = 220/312 (71%), Gaps = 6/312 (2%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVM  1019
             IE+ +++G ++G+V+PNM+E  PLLE   +     I  ID  GRRF  GTI GK  I+V+
Sbjct  33    IESVSRRGAHVGIVVPNMYEFTPLLEQGRFVADATIPFIDIGGRRFHIGTIHGKRSIVVI  92

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             +GL+MLNAGITTQ LL  F +  V+HYGIAG++NPSL+I DV+I   W HT LW WQRYG
Sbjct  93    SGLSMLNAGITTQQLLDHFRIDVVLHYGIAGSSNPSLHIADVSIASSWIHTGLWYWQRYG  152

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
              GP +EL LE NGDYTR +G + F  Y    +E  + DN L ++++QPEE+FP+  TPE 
Sbjct  153   QGPNDELSLEQNGDYTRLLGNLHFGSYNDPSNE--NSDNKLGHIYFQPEEVFPITGTPEV  210

Query  658   RQHIFWVPVDSHYFQIAQ-SLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAY  482
             RQH F VPV    ++ AQ  L  LEL+ C+N+++CL+  PKV     G+SA+++LDNAAY
Sbjct  211   RQHAFKVPVSRTLYETAQRELMNLELKACLNSSSCLSSEPKVLFGLTGSSANVFLDNAAY  270

Query  481   RSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAAD  302
             R+ +YDKF +S V+MESAAVAL C+ Q  P+II R++SDL  GGS  SNEA  FID+AA+
Sbjct  271   RTLLYDKFGISSVDMESAAVALTCYAQGKPFIIFRSISDL-AGGSDHSNEAIQFIDVAAE  329

Query  301   NSVKVAVEFIKK  266
             N+V   VEFI+ 
Sbjct  330   NAVIAVVEFIRS  341



>gb|KEH27139.1| bark storage-like protein [Medicago truncatula]
Length=248

 Score =   298 bits (762),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/250 (58%), Positives = 189/250 (76%), Gaps = 5/250 (2%)
 Frame = -1

Query  1021  MTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRY  842
             MTGL+MLNAG+ TQLLL++F+V GV+HYGIAGN N    IGDV IPQYW+HT LW+WQR+
Sbjct  1     MTGLSMLNAGLATQLLLTLFNVKGVLHYGIAGNVNSKFQIGDVTIPQYWAHTGLWHWQRF  60

Query  841   GDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPE  662
             GD PE+    E N D+++E G++KF+ Y        S +NLL+ VWYQPEEIFPVD TPE
Sbjct  61    GDNPED----EENVDFSKEFGYLKFSNYNNYTKHSKSVENLLSKVWYQPEEIFPVDGTPE  116

Query  661   ERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAY  482
               QH FWVPVD  YF+IA+ L+ +EL  C+N TTCL   P V RV++G SA++++DN AY
Sbjct  117   VLQHAFWVPVDKTYFEIARKLKNVELSSCVN-TTCLPRKPIVVRVKKGVSANVFVDNKAY  175

Query  481   RSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAAD  302
             R F+  KF+ +PV+MESA+VALVC Q K+P+I IRALSDLAGGGS+ +NE + ++ LA+ 
Sbjct  176   RDFLNLKFDATPVDMESASVALVCFQHKIPFIAIRALSDLAGGGSSLTNEYSIYLSLASQ  235

Query  301   NSVKVAVEFI  272
             N+  V V+FI
Sbjct  236   NAFNVLVKFI  245



>ref|XP_002993974.1| hypothetical protein SELMODRAFT_449264 [Selaginella moellendorffii]
 gb|EFJ04958.1| hypothetical protein SELMODRAFT_449264 [Selaginella moellendorffii]
Length=346

 Score =   299 bits (766),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 164/312 (53%), Positives = 218/312 (70%), Gaps = 6/312 (2%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVM  1019
             IE+ +++G ++G+V+PNM+E  PLLE   +     I  ID  GRRF  GTI GK  I+V+
Sbjct  33    IESVSRRGAHVGIVVPNMYEFTPLLEQGRFVADATIPFIDIGGRRFHIGTIHGKRSIVVI  92

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             +GL+MLNAG TTQ LL  F +  V+HYGIAG++NPSL+I DV+I   W HT LW WQRYG
Sbjct  93    SGLSMLNAGTTTQQLLDHFRIDVVLHYGIAGSSNPSLHIADVSIASSWIHTGLWYWQRYG  152

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
              GP +EL LE NGDYTR +G + F  Y    +E  + DN L ++++QPEE+FP+  TPE 
Sbjct  153   QGPNDELSLEQNGDYTRLLGNLHFGSYNDPSNE--NSDNKLGHIYFQPEEVFPITGTPEV  210

Query  658   RQHIFWVPVDSHYFQIAQ-SLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAY  482
             RQH F VPV    ++ AQ  L  LEL+ C+N+++CL+  PKV     G+SA+++LDNAAY
Sbjct  211   RQHAFKVPVSRTLYETAQRELMNLELKACLNSSSCLSSEPKVLFGLTGSSANVFLDNAAY  270

Query  481   RSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAAD  302
             R+ +YDKF +S V+MESAAVAL C+ Q  P+II R++SDL  GGS  SNEA  F DLAA+
Sbjct  271   RTLLYDKFGISSVDMESAAVALTCYAQGKPFIIFRSISDL-AGGSDHSNEAIQFSDLAAE  329

Query  301   NSVKVAVEFIKK  266
             N+V   VEFI+ 
Sbjct  330   NAVIAVVEFIRS  341



>ref|XP_002514270.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48224.1| conserved hypothetical protein [Ricinus communis]
Length=291

 Score =   293 bits (750),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 156/312 (50%), Positives = 199/312 (64%), Gaps = 58/312 (19%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVM  1019
             IE  N++GPY G+V+PN FEMNPLL+  ++     +  +D++GRRFR G +E   VI+VM
Sbjct  28    IERLNEEGPYFGIVVPNAFEMNPLLQSQNFVAHAQVPYLDFSGRRFRIGKVENVKVIIVM  87

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             TGL+M                                                    RYG
Sbjct  88    TGLSM----------------------------------------------------RYG  95

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDEC---NSQDNLLNNVWYQPEEIFPVDAT  668
             DGP+++LPLE NGDYTR+IGF+ F+ Y    D      S DNLLNNVWYQPEEIFPV+  
Sbjct  96    DGPDDQLPLESNGDYTRKIGFLDFSDYNNKTDTKLGKQSVDNLLNNVWYQPEEIFPVNGV  155

Query  667   PEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNA  488
             PE RQH FWVPVD HYF+IA+ ++GL+LEGC+N +TCL  TP V RV++G SA++++DN+
Sbjct  156   PEVRQHAFWVPVDKHYFKIAKKVQGLKLEGCVN-STCLPRTPVVVRVKKGVSANVFVDNS  214

Query  487   AYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLA  308
             AYR F+  KFN +P++MESAAVAL+C QQ+ P+I IRALSDLAGGGSA SNEA  F  LA
Sbjct  215   AYREFLNSKFNATPIDMESAAVALICQQQRTPFIAIRALSDLAGGGSAVSNEAGIFASLA  274

Query  307   ADNSVKVAVEFI  272
             A NSV   + FI
Sbjct  275   AQNSVAALLRFI  286



>ref|XP_007137204.1| hypothetical protein PHAVU_009G108300g [Phaseolus vulgaris]
 gb|ESW09198.1| hypothetical protein PHAVU_009G108300g [Phaseolus vulgaris]
Length=272

 Score =   289 bits (739),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 161/199 (81%), Gaps = 0/199 (0%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFGTIEGKPVILVMTG  1013
             I  AN++GPYLG+VIP  FE++PLL++ +Y  S  IID AGRRFRFG I  KPVILVMTG
Sbjct  68    IAEANQEGPYLGLVIPITFELHPLLQNPAYTASDTIIDLAGRRFRFGAIGEKPVILVMTG  127

Query  1012  LAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDG  833
             L+++NA ITTQLLLS F + GVVHYGIAGNANPSL++GDV IPQ+W+H  LW+WQRYG G
Sbjct  128   LSIINAAITTQLLLSFFAIEGVVHYGIAGNANPSLHVGDVTIPQHWAHLGLWSWQRYGLG  187

Query  832   PENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQ  653
             P+++LPLE NGDYTR IGF+ FA + +NV    S DN LNN+W+QPEEIFPVD  PEERQ
Sbjct  188   PDDKLPLENNGDYTRNIGFLNFADFTSNVSADISADNQLNNIWFQPEEIFPVDGIPEERQ  247

Query  652   HIFWVPVDSHYFQIAQSLE  596
             H FWVP+D +Y+ IA+ L+
Sbjct  248   HAFWVPIDPNYYHIAKKLQ  266



>ref|XP_010041628.1| PREDICTED: uncharacterized protein LOC104430580 [Eucalyptus grandis]
 gb|KCW44215.1| hypothetical protein EUGRSUZ_L02358 [Eucalyptus grandis]
Length=204

 Score =   285 bits (730),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 166/198 (84%), Gaps = 0/198 (0%)
 Frame = -1

Query  850  QRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDA  671
            QRYG GPE+EL LE +GDYTR +G+++FA Y TNV  C S DNLLNN+WYQPEE+FPV  
Sbjct  4    QRYGQGPEDELALESSGDYTRTLGYLRFANYTTNVTGCASHDNLLNNIWYQPEEVFPVTG  63

Query  670  TPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDN  491
            TPEERQH FWVPV S YF +A+ LEGL+LE C+NAT CL +TP V  VERG SASIYLDN
Sbjct  64   TPEERQHEFWVPVGSTYFAVAKKLEGLKLESCVNATACLNYTPSVCTVERGVSASIYLDN  123

Query  490  AAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDL  311
            +AYRSFIYDKFNVSPV+MESA+VAL+C+QQ   +I IRALSDLAGGGSAESNEA TF++L
Sbjct  124  SAYRSFIYDKFNVSPVDMESASVALICYQQNTSFIAIRALSDLAGGGSAESNEADTFVNL  183

Query  310  AADNSVKVAVEFIKKVPS  257
            A+DN+V V VEFIK++ S
Sbjct  184  ASDNAVTVVVEFIKQLSS  201



>ref|XP_002984250.1| hypothetical protein SELMODRAFT_445786 [Selaginella moellendorffii]
 gb|EFJ14760.1| hypothetical protein SELMODRAFT_445786 [Selaginella moellendorffii]
Length=471

 Score =   288 bits (736),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 145/308 (47%), Positives = 207/308 (67%), Gaps = 20/308 (6%)
 Frame = -1

Query  1177  KKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVMTGLAM  1004
             ++GP+LG+V+P  FEM+ + + + + P   I  +D AGRRF  GTI+G  V+LV +  AM
Sbjct  45    REGPFLGLVVPTSFEMDAIRQQTIFAPHPYIPWLDLAGRRFHIGTIQGHKVVLVQSASAM  104

Query  1003  LNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDGPEN  824
             LNA ITTQ LL  FD+ GV+HYGIAG+AN SL IGD++IP+YW+HTALWNW+++ +G  +
Sbjct  105   LNAAITTQQLLDFFDINGVLHYGIAGSANDSLTIGDISIPKYWAHTALWNWEKFSNGSGH  164

Query  823   ELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHIF  644
              L    NGD+T+++G + F+ +A        + NLL +VW QPE++  V  TPE R   F
Sbjct  165   LLSSGPNGDFTQDLGHLHFSDFA--YPNNGHRQNLLTSVWIQPEDVLKVSGTPEVRSRAF  222

Query  643   WVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYD  464
             W               G+EL  C NATTCL+  PKV    RG S+++++DNAAYR F++ 
Sbjct  223   W---------------GMELTSCFNATTCLSIRPKVVVGLRGASSNVFVDNAAYRQFMFQ  267

Query  463   KFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSVKVA  284
              F VS V+MESAAVALVC+  +VP+I+IR++SD + G S  +NE + F +LA+ N+VKV 
Sbjct  268   TFRVSSVDMESAAVALVCYSNEVPFIVIRSISD-SAGNSEGANEVSAFKNLASLNAVKVL  326

Query  283   VEFIKKVP  260
              +F+K +P
Sbjct  327   TQFLKALP  334



>gb|EEC78746.1| hypothetical protein OsI_18961 [Oryza sativa Indica Group]
Length=258

 Score =   274 bits (700),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/211 (60%), Positives = 158/211 (75%), Gaps = 5/211 (2%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVM  1019
             +   N++GPYLGVV+PN FEM PLL   ++ P+  +  +D AGRRFRFG+I  K VI+VM
Sbjct  44    VRQVNRRGPYLGVVVPNGFEMEPLLRSPAFSPAKKLPYLDVAGRRFRFGSIGEKKVIIVM  103

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             TGL MLN+G+TTQLLL++FDV G+VH+GIAGNA+P L+IGDV +P+YW+HT LWNWQRYG
Sbjct  104   TGLGMLNSGVTTQLLLTLFDVEGIVHFGIAGNADPDLHIGDVTVPRYWAHTGLWNWQRYG  163

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
             DGPE EL LE NGDYTR+ G + F+ Y        +    LN VWYQPEE+FP D TPE 
Sbjct  164   DGPEKELALESNGDYTRKYGALNFSDYGVAGGGGGNL---LNGVWYQPEEVFPADGTPES  220

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINA  566
             R+H FWVPVD  Y+Q+AQ LE + LE C+ A
Sbjct  221   RRHEFWVPVDGRYYQLAQKLEAMPLERCVTA  251



>gb|AFX97761.1| mta/sah nucleosidase, partial [Galium verum var. asiaticum]
Length=210

 Score =   265 bits (678),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 128/207 (62%), Positives = 161/207 (78%), Gaps = 8/207 (4%)
 Frame = -1

Query  889  IPQYWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNN  710
            IP  W H+ LW+WQRYG GPEN LPLE +GDYTRE+G ++FA + TN     + DNLLN 
Sbjct  1    IPHRWIHSGLWSWQRYGLGPENSLPLESSGDYTRELGSLRFADFGTN----KTGDNLLNR  56

Query  709  VWYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTR  530
            VWYQPEE+FPVD TPEERQH+F V VD+ Y+++A++L+ L+LE CIN+T CL +TP+V R
Sbjct  57   VWYQPEEVFPVDGTPEERQHVFQVNVDTDYYRLAKALKNLKLERCINSTKCLQNTPRVNR  116

Query  529  VERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLaggg  350
               GTS SIYLDNAAY SF++DKFNV+ V+MESAAVALVC+QQKVP+I+IR LS+L    
Sbjct  117  ESAGTSTSIYLDNAAYASFLFDKFNVTTVDMESAAVALVCYQQKVPFIVIRGLSNL----  172

Query  349  saesneaATFIDLAADNSVKVAVEFIK  269
            +   +EA  F  L A+N+VKV VEFIK
Sbjct  173  AGRGDEADVFTPLVANNTVKVVVEFIK  199



>emb|CCJ09769.1| hypothetical protein, partial [Hirudo medicinalis]
Length=198

 Score =   263 bits (671),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 146/195 (75%), Gaps = 0/195 (0%)
 Frame = -1

Query  946  VHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKF  767
            +H G AG ANP + IGDV IP YW+HT LWNWQR+GDGP++EL  E NGDYTR+ G+++F
Sbjct  1    LHLGSAGGANPEIQIGDVTIPHYWAHTGLWNWQRFGDGPQDELAFESNGDYTRKYGYLRF  60

Query  766  AKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLE  587
            A Y    +   S DN LN VWYQPEEIF  D  PE R+H FWVP+D HY+ +A++LE + 
Sbjct  61   ADYQVRKEGEKSSDNYLNRVWYQPEEIFYGDGEPEIREHAFWVPIDKHYYSLAKNLENIV  120

Query  586  LEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCH  407
            LE C+N++ CL   PKV RV RG SA++++DNAAYR F+  KF  +PV+MESA VALVC 
Sbjct  121  LERCVNSSLCLPQPPKVVRVRRGVSANVFVDNAAYREFLNSKFKATPVDMESAVVALVCR  180

Query  406  QQKVPYIIIRALSDL  362
            QQK+P+I IRA+S+L
Sbjct  181  QQKMPFIAIRAISNL  195



>gb|ACU19785.1| unknown [Glycine max]
Length=233

 Score =   264 bits (674),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 148/199 (74%), Gaps = 2/199 (1%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVM  1019
             I   N++GPY+G+V+PN FE+NPLL   S+ P       D+AG+ FR G +E K VI+VM
Sbjct  31    ISKINREGPYVGIVVPNAFELNPLLRSPSFVPHNKFPYFDFAGKHFRIGVLEKKRVIVVM  90

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             TGL+MLNAGI+TQLLL++FD+ GVVHYGIAGNANP L IGDV IPQYW+HT LWNWQR+G
Sbjct  91    TGLSMLNAGISTQLLLTLFDIEGVVHYGIAGNANPKLQIGDVTIPQYWAHTGLWNWQRFG  150

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
             DGP++ L LE +GDY+R  G++KFA Y  N     S  NLLNNVW+Q EEIFPV+ T E 
Sbjct  151   DGPKDALALEASGDYSRRFGYLKFADYNNNTKHSKSATNLLNNVWFQAEEIFPVNGTAEV  210

Query  658   RQHIFWVPVDSHYFQIAQS  602
             RQH FWV VD    ++ ++
Sbjct  211   RQHAFWVSVDKLTLRLQRA  229



>emb|CCJ09767.1| hypothetical protein, partial [Hirudo medicinalis]
Length=198

 Score =   257 bits (657),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 144/195 (74%), Gaps = 0/195 (0%)
 Frame = -1

Query  946  VHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKF  767
            +H G AG A+  + IGDV IP YW+HT LWNWQ +GDGPE+EL  E NGDYTR+ G+++F
Sbjct  1    LHLGSAGGASSEIQIGDVTIPHYWAHTGLWNWQGFGDGPEDELAFESNGDYTRKYGYLRF  60

Query  766  AKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLE  587
            A Y    +   S DN LN VWYQPEEIF  D  PE R+H FWVP+D HY+ +A++LE + 
Sbjct  61   ADYQVRKEGEQSSDNYLNRVWYQPEEIFYGDGEPEIREHAFWVPIDKHYYSLAKNLENIV  120

Query  586  LEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCH  407
            LE C+N++ CL   PKV RV RG SA++++DNAAYR F+  KF  +PV+MESAAVALVC 
Sbjct  121  LERCVNSSLCLPQPPKVVRVRRGVSANVFVDNAAYREFLNSKFKATPVDMESAAVALVCR  180

Query  406  QQKVPYIIIRALSDL  362
            QQK P+I IRA+S+L
Sbjct  181  QQKTPFIAIRAISNL  195



>tpg|DAA52767.1| TPA: vegetative storage protein PNI288 [Zea mays]
Length=228

 Score =   255 bits (652),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 147/195 (75%), Gaps = 4/195 (2%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPST--LIIDYAGRRFRFGTIEGKP  1034
             KT   I  A++ GP++G+V+PN +EM P+L    +KPS+   I+D  GRRFRFGTI  + 
Sbjct  34    KTWSAIRRADRDGPFVGLVVPNAYEMVPVLNSPDFKPSSNIPILDVQGRRFRFGTIGSQN  93

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             V++VMTGL+MLNAG+TTQLLLS+F V G+VH+GIAGNAN  L IGDV IP+ W+H +LWN
Sbjct  94    VVMVMTGLSMLNAGLTTQLLLSLFRVKGIVHWGIAGNANEDLQIGDVTIPESWAHLSLWN  153

Query  853   WQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQ--DNLLNNVWYQPEEIFP  680
             WQR+GDGPENELPLE  GDYTRE GF+ F+ Y    D  N +   N LN+VWYQPEEIFP
Sbjct  154   WQRHGDGPENELPLENAGDYTREYGFLNFSDYTVGQDAGNPELAANTLNSVWYQPEEIFP  213

Query  679   VDATPEERQHIFWVP  635
             +  TPEERQH FW P
Sbjct  214   ISGTPEERQHAFWCP  228



>ref|XP_006379491.1| hypothetical protein POPTR_0008s02870g [Populus trichocarpa]
 gb|ERP57288.1| hypothetical protein POPTR_0008s02870g [Populus trichocarpa]
Length=340

 Score =   238 bits (606),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 131/319 (41%), Positives = 192/319 (60%), Gaps = 21/319 (7%)
 Frame = -1

Query  1195  LIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTL--IIDYAGRRFRFGTIEGKPVILV  1022
             LI+  N KGPY+G++     E N  L  + +KP+     ++ +GRR+R GTI GK VI V
Sbjct  37    LIKQVNSKGPYIGLLTVFPPEENAFLGTADFKPNPEHPFVNLSGRRYRVGTIYGKKVIYV  96

Query  1021  MTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNW--Q  848
               G+ M+NA   TQ +L +FDV G+VH+GI+GN N S++IGDV+IP+ +++T LWNW   
Sbjct  97    RCGIGMVNAAAVTQQMLDLFDVAGIVHFGISGNINNSMSIGDVSIPKQFANTGLWNWLNP  156

Query  847   RYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDAT  668
             +    P++   LEV G Y              NV + +   NLL  + Y PE++F V   
Sbjct  157   KGTVDPDDVAQLEV-GKY--------------NVPKGDGV-NLLGKLSYSPEQLFSVSRE  200

Query  667   PEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNA  488
             P +   +FW  V  H+ ++A SLEG+ELE C+N++ CL   PK+    +G++A I++DNA
Sbjct  201   PNDATTLFWAGVSQHWLKLASSLEGMELEKCVNSSLCLPQKPKLVVGLKGSTADIFVDNA  260

Query  487   AYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLA  308
             AYR F+Y  F VS  +MES+AV + C    +P I+IR +SDL  GG +  N   T+  LA
Sbjct  261   AYRDFLYKAFGVSSADMESSAVVMTCLSNGIPVIVIRGMSDL-AGGQSGENAMDTYGSLA  319

Query  307   ADNSVKVAVEFIKKVPSPN  251
             A N+ K  ++FI K+P  N
Sbjct  320   ALNTAKAVLKFISKLPGYN  338



>ref|XP_011031567.1| PREDICTED: bark storage protein A-like isoform X2 [Populus euphratica]
Length=350

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 125/317 (39%), Positives = 182/317 (57%), Gaps = 19/317 (6%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTL--IIDYAGRRFRFGTIEGKPVILVM  1019
             I+  N+KGPY+G++     E        ++KP      +D +GRR+R G I GK V+ V 
Sbjct  43    IKQLNRKGPYIGLITVYSPEEEAFFRTGAFKPDAKHPFVDLSGRRYRVGKINGKKVVFVR  102

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
              G+ + NA   TQ +L +FDV G+VH+GI+GN N S++IGDV IP+ ++HT LWNW    
Sbjct  103   CGVGITNAAAVTQQMLDLFDVTGIVHFGISGNVNDSMSIGDVTIPKQFAHTGLWNW----  158

Query  838   DGPENELPLEVNGDYT-REIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPE  662
                     L  NG     ++ +++   Y  NV E +   NLL  + Y  E++F V   P 
Sbjct  159   --------LNPNGTMDPADVAYLEVGSY--NVPEGDGV-NLLGQIGYSTEQLFSVSREPN  207

Query  661   ERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAY  482
                 ++W+ V   + Q+A+SLEG+ELE C+N++ CL   PK+    +G S++I+LDNAAY
Sbjct  208   TAVSLWWMEVSQQWLQLARSLEGMELEKCVNSSLCLKEKPKLVVGLKGASSNIFLDNAAY  267

Query  481   RSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAAD  302
             R F++  F VS  +MES+AV + C     P I+IR LSDL  G  +  N   TF  LAA 
Sbjct  268   RDFLFQTFEVSSSDMESSAVVMTCLSNGFPVIVIRGLSDL-AGAESGDNAIHTFGSLAAL  326

Query  301   NSVKVAVEFIKKVPSPN  251
             N+ K  +E I K+P  N
Sbjct  327   NAAKAVLELINKLPGYN  343



>ref|XP_006379490.1| hypothetical protein POPTR_0008s02860g [Populus trichocarpa]
 gb|ERP57287.1| hypothetical protein POPTR_0008s02860g [Populus trichocarpa]
Length=332

 Score =   231 bits (589),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 124/314 (39%), Positives = 182/314 (58%), Gaps = 17/314 (5%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTL--IIDYAGRRFRFGTIEGKP  1034
             K+  +I+  N+KGPY+G++     E N      ++KP      +D +GRRFR G ++GK 
Sbjct  30    KSLNIIKEVNRKGPYVGIITVYPPEENAFFASKAFKPDGKHPFVDLSGRRFRVGKVQGKK  89

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             V+ V  G+ M+NA   TQ +L +FD+ G+VH+GIAGN N S++IGDV IP+ ++HT +W+
Sbjct  90    VLYVRCGVGMVNAAAATQQMLDMFDITGIVHFGIAGNVNNSMSIGDVTIPKQFAHTGIWD  149

Query  853   WQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVD  674
             W      P   LP       T +I  + F  Y  NV + +   NLL  + Y  E+ F   
Sbjct  150   WLN----PNGTLP-------TNDIAELDFGSY--NVPKGDGM-NLLGKIGYSYEQFFSES  195

Query  673   ATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLD  494
               P     +FW  +   + Q+A  LEG+ELE C+N++ CL+  PK+    RG++A+I++D
Sbjct  196   GKPNTAIPLFWAQISEQWLQLAAGLEGMELERCVNSSVCLSRKPKLVVGLRGSTANIFVD  255

Query  493   NAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFID  314
             NAAYR F+Y  + VS V+MES+AV +       P I+IR LSDL  GG    N   TF  
Sbjct  256   NAAYRDFLYQTYAVSSVDMESSAVVMTSLSNGYPVIVIRGLSDL-AGGQTGQNAIQTFGP  314

Query  313   LAADNSVKVAVEFI  272
             LAA N+ +  V+FI
Sbjct  315   LAARNAAQAVVKFI  328



>ref|XP_009137991.1| PREDICTED: bark storage protein A-like [Brassica rapa]
Length=361

 Score =   230 bits (586),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 127/330 (38%), Positives = 188/330 (57%), Gaps = 20/330 (6%)
 Frame = -1

Query  1234  ANGSLLDDGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKP--STLIIDYAGRRF  1061
             A+ +  D  KT   I   N+KGPY+G+V     E +  L    ++P  +   ID +GRRF
Sbjct  42    ASATSSDKLKTATTIRKVNRKGPYVGLVTVIETEEDAFLASVEFRPDPNHPFIDLSGRRF  101

Query  1060  RFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQ  881
             R G I GK V+ V  G  M+NA   TQ ++ VFDV G+VH+GIAGN N S++IGDV+IP 
Sbjct  102   RIGKIHGKKVMYVRCGRGMVNAAAATQQMIDVFDVKGIVHFGIAGNINNSMSIGDVSIPN  161

Query  880   YWSHTALWNWQR--YGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNV  707
               ++  LW+W      +G +NE  L++ G+Y              NV + +  +N+L ++
Sbjct  162   QITNAGLWDWLNPDKAEGSDNEAYLDI-GNY--------------NVPQSDGNNNMLGSL  206

Query  706   WYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRV  527
              Y  E+++ V+      Q++FW+     +  +A  LE +EL  C+NA+ CL   PK+   
Sbjct  207   RYGHEQLYSVNGHISSPQNVFWINTTQEWLHLAADLEKMELLQCVNASLCLPEKPKLVVG  266

Query  526   ERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggs  347
              +  +A+I++DNA YR F+YD F VS  +MES+AVA+ C     P I+IR LSDL  G  
Sbjct  267   LKAATANIFVDNAVYRDFLYDTFEVSSSDMESSAVAMTCVSNGYPVIVIRGLSDL-AGAQ  325

Query  346   aesneaATFIDLAADNSVKVAVEFIKKVPS  257
               +N    F  LAA N+ +  +EFIKK+PS
Sbjct  326   TGTNAIRKFGSLAAANTARAVLEFIKKLPS  355



>ref|XP_011031566.1| PREDICTED: bark storage protein A-like isoform X1 [Populus euphratica]
Length=357

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 126/324 (39%), Positives = 181/324 (56%), Gaps = 26/324 (8%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKP---------STLIIDYAGRRFRFGTIEG  1040
             I+  N+KGPY+G++     E        ++KP         S    D  GRR+R G I G
Sbjct  43    IKQLNRKGPYIGLITVYSPEEEAFFRTGAFKPDAKHPFVDLSGSNYDVEGRRYRVGKING  102

Query  1039  KPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTAL  860
             K V+ V  G+ + NA   TQ +L +FDV G+VH+GI+GN N S++IGDV IP+ ++HT L
Sbjct  103   KKVVFVRCGVGITNAAAVTQQMLDLFDVTGIVHFGISGNVNDSMSIGDVTIPKQFAHTGL  162

Query  859   WNWQRYGDGPENELPLEVNGDYT-REIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIF  683
             WNW            L  NG     ++ +++   Y  NV E +   NLL  + Y  E++F
Sbjct  163   WNW------------LNPNGTMDPADVAYLEVGSY--NVPEGDGV-NLLGQIGYSTEQLF  207

Query  682   PVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASI  503
              V   P     ++W+ V   + Q+A+SLEG+ELE C+N++ CL   PK+    +G S++I
Sbjct  208   SVSREPNTAVSLWWMEVSQQWLQLARSLEGMELEKCVNSSLCLKEKPKLVVGLKGASSNI  267

Query  502   YLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaAT  323
             +LDNAAYR F++  F VS  +MES+AV + C     P I+IR LSDL  G  +  N   T
Sbjct  268   FLDNAAYRDFLFQTFEVSSSDMESSAVVMTCLSNGFPVIVIRGLSDL-AGAESGDNAIHT  326

Query  322   FIDLAADNSVKVAVEFIKKVPSPN  251
             F  LAA N+ K  +E I K+P  N
Sbjct  327   FGSLAALNAAKAVLELINKLPGYN  350



>ref|XP_002262699.1| PREDICTED: bark storage protein A [Vitis vinifera]
 emb|CBI40192.3| unnamed protein product [Vitis vinifera]
Length=340

 Score =   224 bits (571),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 122/317 (38%), Positives = 186/317 (59%), Gaps = 18/317 (6%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYK--PSTLIIDYAGRRFRFGTIEGKP  1034
             K+   I+  N+KGPY+G++     E +      +++  P    +D +GRRFR G + G+ 
Sbjct  33    KSLNTIKEVNRKGPYIGLITVFPPEEDAFFTTGAFEINPHHPFVDLSGRRFRIGKVHGRK  92

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             VI V  G+ M+NA   TQ +L +FD+ G+VH+GIAGNAN S++IGDV IP+ ++HT +W+
Sbjct  93    VIYVRCGVGMVNAAAATQQMLDLFDIRGIVHFGIAGNANNSMSIGDVTIPKQFAHTGIWD  152

Query  853   WQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVD  674
             W +    P   LP       + ++  +    Y  NV +     NLL  + Y  E+ F   
Sbjct  153   WLK----PNGILP-------SDDVAHLDIGSY--NVPKGGV--NLLGRIGYSYEQFFSET  197

Query  673   ATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLD  494
               P+  Q + W  +  H+ ++A  LEG+EL+ C+N++ CL   PK+    RG++++I++D
Sbjct  198   GKPDAAQPLVWAKISQHWLRLAAKLEGMELQQCVNSSNCLPQKPKLVVGLRGSTSNIFVD  257

Query  493   NAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFID  314
             NAAYR F++  F+VS V+MESAAVA+       P I+IR LSDL  GG A  N    F  
Sbjct  258   NAAYRDFLFQTFHVSSVDMESAAVAMTTLSNGFPVIVIRGLSDL-AGGQAGQNSIRIFGP  316

Query  313   LAADNSVKVAVEFIKKV  263
             LAA N+ KV V+FI+ +
Sbjct  317   LAALNAAKVVVQFIRTL  333



>ref|XP_011031565.1| PREDICTED: bark storage protein A-like [Populus euphratica]
 ref|XP_011010756.1| PREDICTED: bark storage protein A-like [Populus euphratica]
Length=332

 Score =   223 bits (567),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/284 (40%), Positives = 167/284 (59%), Gaps = 16/284 (6%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTL--IIDYAGRRFRFGTIEGKP  1034
             K+  +I+  N+KGPY+G++     E N      ++KP+     +D +GRRFR G ++GK 
Sbjct  30    KSLNIIKEVNRKGPYVGLITVYPPEENAFFASKAFKPNGKHPFVDLSGRRFRVGKVQGKK  89

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             VI V  G+ M+NA   TQ +L +FD+ G+VH+GIAGN N S++IGDV IP+ ++HT +W+
Sbjct  90    VIYVRCGVGMVNAAAATQQMLDMFDITGIVHFGIAGNVNNSMSIGDVTIPEQFAHTGIWD  149

Query  853   WQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVD  674
             W      P+  LP       T +I  + F  Y  NV + +   NLL  + Y  E+ F   
Sbjct  150   WLN----PKGPLP-------TNDIAELDFGSY--NVPKGDGM-NLLGKIGYSYEQFFSES  195

Query  673   ATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLD  494
               P     +FW  +   + Q+A  LEG+ELE C+N++ CL   PK+    RG++A+I++D
Sbjct  196   GKPNTAIPLFWAQISEQWLQLAAGLEGMELERCVNSSVCLARKPKLVVGLRGSTANIFVD  255

Query  493   NAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDL  362
             NAAYR F+Y  + VS V+MES AV +       P I+IR LSDL
Sbjct  256   NAAYRDFLYQTYAVSSVDMESFAVVMTSLSNGYPVIVIRGLSDL  299



>emb|CDY34283.1| BnaA01g13860D [Brassica napus]
Length=354

 Score =   223 bits (569),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 125/330 (38%), Positives = 186/330 (56%), Gaps = 20/330 (6%)
 Frame = -1

Query  1234  ANGSLLDDGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKP--STLIIDYAGRRF  1061
             A+ +  D  KT   I   N+KGPY+G+V     E +  L    ++P  +   ID +GRRF
Sbjct  35    ASATSSDKLKTATTIRKVNRKGPYVGLVTVIETEEDAFLASVEFRPDPNHPFIDLSGRRF  94

Query  1060  RFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQ  881
             R G I  K V+ V  G  M+NA   TQ ++ VFDV G+VH+GIAGN N S++IGDV+IP 
Sbjct  95    RIGKIHAKKVMYVRCGRGMVNAAAATQQMIDVFDVKGIVHFGIAGNINNSMSIGDVSIPN  154

Query  880   YWSHTALWNWQRYG--DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNV  707
               ++  LW+W      +G ++E  L++ G+Y              NV + +  +N+L ++
Sbjct  155   QITNAGLWDWLNPDKVEGGDDEAYLDI-GNY--------------NVPQIDGNNNMLGSL  199

Query  706   WYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRV  527
              Y  E+++ V       Q++FW+     +  +A  LE +EL  C+NA+ CL   PK+   
Sbjct  200   RYGHEQLYSVTGRINSPQNVFWINTTQEWLHLAADLEKMELLQCVNASLCLPEKPKLVVG  259

Query  526   ERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggs  347
              +  +A+I++DNA YR F+YD F VS  +MES+AVA+ C     P I+IR LSDL  G  
Sbjct  260   LKAATANIFVDNAVYRDFLYDTFEVSSSDMESSAVAMTCVSNGYPVIVIRGLSDL-AGAQ  318

Query  346   aesneaATFIDLAADNSVKVAVEFIKKVPS  257
               +N    F  LAA N+ +  +EFIKK+PS
Sbjct  319   TGTNAIRKFGSLAAANTARAVLEFIKKLPS  348



>emb|CDY03453.1| BnaC01g16290D [Brassica napus]
Length=350

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 125/330 (38%), Positives = 187/330 (57%), Gaps = 20/330 (6%)
 Frame = -1

Query  1234  ANGSLLDDGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKP--STLIIDYAGRRF  1061
             A+ +  D  KT   I   N+KGPY+G+V     E +  L+   ++P  +   ID +GRRF
Sbjct  31    ASATSADKLKTATTIRKVNRKGPYVGLVTVIETEEDAFLDSVEFRPDPNHPFIDLSGRRF  90

Query  1060  RFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQ  881
               G I GK V+ V  G  M+NA   TQ ++ +FDV G+VH+GIAGN N S++IGDV+IP 
Sbjct  91    LIGKIHGKNVMYVRCGRGMVNAAAATQQMIDLFDVKGIVHFGIAGNINNSMSIGDVSIPN  150

Query  880   YWSHTALWNWQR--YGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNV  707
               ++  LW+W      +G ++E  L++ G+Y              NV + +  +N+L ++
Sbjct  151   QITNAGLWDWLNPDKAEGGDDEAYLDI-GNY--------------NVPQRDGNNNMLGSL  195

Query  706   WYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRV  527
              Y  E+++ V       Q++FW+     +  +A  LE +EL  C+NA+ CL   PK+   
Sbjct  196   GYGHEQLYSVTGHINSPQNVFWINTTQEWLHLAADLEKMELLQCVNASLCLPEKPKLVVG  255

Query  526   ERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggs  347
              +  +A+I++DNA YR F+YD F VS  +MES+AVA+ C     P I+IR LSDL  G  
Sbjct  256   LKAATANIFVDNAVYRDFLYDTFEVSSSDMESSAVAMTCVSNGYPVIVIRGLSDL-AGAQ  314

Query  346   aesneaATFIDLAADNSVKVAVEFIKKVPS  257
               +N    F  LAA N+ K  +EFIKK+PS
Sbjct  315   TGTNAIRKFGSLAAANTAKAVLEFIKKLPS  344



>gb|AAM66964.1| unknown [Arabidopsis thaliana]
Length=338

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 121/318 (38%), Positives = 176/318 (55%), Gaps = 21/318 (7%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYK--PSTLIIDYAGRRFRFGTIEGKP  1034
             K+   I   N++GPY+G+V     E +  L    ++  P+   +D +GRRFR G I GK 
Sbjct  38    KSATTIRKINRRGPYIGLVTVFETEEDAFLGSVDFRLDPTHPFLDLSGRRFRIGKIHGKK  97

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             V+ V  G+ M+NA   TQ ++ VF V G+VH+GIAGN N S++IGDV+IP+  ++  LW+
Sbjct  98    VVYVRCGIGMVNAAAATQQMIDVFSVKGIVHFGIAGNINNSMSIGDVSIPKQITNAGLWD  157

Query  853   WQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVD  674
             W   G    NE           ++ ++    Y  NV + N   N L  + Y  EE++ V 
Sbjct  158   WLNPGKAKGNE-----------DVAYLDVGNY--NVPQGN---NKLGTIGYSYEELYSVS  201

Query  673   ATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLD  494
                   + +FW+     +  +A  LE +EL  C+NA+ CL + PKV    +  +A I++D
Sbjct  202   GHINSPKKVFWINTTQEWLHLAADLEKMELLQCVNASLCLPNKPKVVVGLKAATADIFVD  261

Query  493   NAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFID  314
             NAAYR+F+YD F VS  +MES+AVA+ C     P I+IR LSDL        N    F  
Sbjct  262   NAAYRNFLYDTFGVSSSDMESSAVAMTCASNGYPIIVIRGLSDL---AGVGDNTVRKFGS  318

Query  313   LAADNSVKVAVEFIKKVP  260
             LAA N+ K  +EFIKK+P
Sbjct  319   LAATNTAKAVLEFIKKLP  336



>ref|XP_009137982.1| PREDICTED: bark storage protein A-like [Brassica rapa]
Length=345

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 122/322 (38%), Positives = 182/322 (57%), Gaps = 18/322 (6%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTL--IIDYAGRRFRFGTIEGKP  1034
             K  + I   N++GPY+G+V     E N  L    ++P      +D +GRRFR G I GK 
Sbjct  32    KNAITIREVNRRGPYIGLVTVFETEENAFLGSVDFRPDPAHPFLDLSGRRFRIGKIHGKK  91

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             V+ V  G+ M+NA   TQ L+ VF++ G+VH+GIAGN N S++IGDV+IP+  ++  +W+
Sbjct  92    VVYVRCGIGMVNAAAATQQLIDVFNMKGIVHFGIAGNTNNSMSIGDVSIPKQITNAGMWD  151

Query  853   WQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVD  674
             W           P +  G  +    ++ F KY   V + +  D++L ++ Y  EE++ V 
Sbjct  152   WLN---------PDKAEG--SEYAAYLDFGKY--TVPQGDGSDSMLGSIGYSYEELYSVS  198

Query  673   ATPEER-QHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYL  497
                +   + +FW+     + Q+A  LE +EL  C+NAT CL   PK+    +  +A+ ++
Sbjct  199   IGHKNSPKKVFWINTTQEWLQLAAGLEKMELLQCVNATLCLPEKPKLVVGLKAATANTFV  258

Query  496   DNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFI  317
             DNAAYR F+YD F VS  +MES+AVA+ C     P I+IR LSDL  G     N    F 
Sbjct  259   DNAAYRDFLYDTFGVSSSDMESSAVAMTCVSNGYPVIVIRGLSDL-AGAQTGDNAVRKFG  317

Query  316   DLAADNSVKVAVEFIKKVPSPN  251
              LAA N+ +  +EFIKK+P PN
Sbjct  318   SLAATNTARAVLEFIKKLP-PN  338



>emb|CDY34282.1| BnaA01g13850D [Brassica napus]
Length=345

 Score =   222 bits (566),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 121/322 (38%), Positives = 182/322 (57%), Gaps = 18/322 (6%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTL--IIDYAGRRFRFGTIEGKP  1034
             K  + I   N++GPY+G+V     E N  L    ++P      +D +GRRFR G I GK 
Sbjct  32    KNAITIREVNRRGPYIGLVTVFETEENAFLGSVDFRPDPAHPFLDLSGRRFRIGKIHGKK  91

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             V+ V  G+ M+NA   TQ ++ VF++ G+VH+GIAGN N S++IGDV+IP+  ++  +W+
Sbjct  92    VVYVRCGIGMVNAAAATQQMIDVFNMKGIVHFGIAGNTNNSMSIGDVSIPKQITNAGMWD  151

Query  853   WQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVD  674
             W           P +  G  +    ++ F KY   V + +  D++L ++ Y  EE++ V 
Sbjct  152   WLN---------PDKAEG--SEYAAYLDFGKY--TVPQGDGSDSMLGSIGYSYEELYSVS  198

Query  673   ATPEER-QHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYL  497
                +   + +FW+     + Q+A  LE +EL  C+NAT CL   PK+    +  +A+ ++
Sbjct  199   IGHKNSPKKVFWINTTQEWLQLAAGLEKMELLQCVNATLCLPEKPKLVVGLKAATANTFV  258

Query  496   DNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFI  317
             DNAAYR F+YD F VS  +MES+AVA+ C     P I+IR LSDL  G     N    F 
Sbjct  259   DNAAYRDFLYDTFGVSSSDMESSAVAMTCVSNGYPVIVIRGLSDL-AGAQTGDNAVRKFG  317

Query  316   DLAADNSVKVAVEFIKKVPSPN  251
              LAA N+ +  +EFIKK+P PN
Sbjct  318   SLAATNTARAVLEFIKKLP-PN  338



>ref|NP_567699.1| phosphorylase family protein [Arabidopsis thaliana]
 dbj|BAC43650.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63378.1| At4g24340 [Arabidopsis thaliana]
 gb|AEE84891.1| phosphorylase family protein [Arabidopsis thaliana]
Length=338

 Score =   222 bits (565),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 121/318 (38%), Positives = 176/318 (55%), Gaps = 21/318 (7%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYK--PSTLIIDYAGRRFRFGTIEGKP  1034
             K+   I   N++GPY+G+V     E +  L    ++  P+   +D +GRRFR G I GK 
Sbjct  38    KSATTIRKINRRGPYIGLVTVFETEEDAFLGSVDFRLDPTHPFLDLSGRRFRIGKIHGKK  97

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             V+ V  G+ M+NA   TQ ++ VF V G+VH+GIAGN N S++IGDV+IP+  ++  LW+
Sbjct  98    VVYVRCGIGMVNAAAATQQMIDVFSVKGIVHFGIAGNINNSMSIGDVSIPKQITNAGLWD  157

Query  853   WQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVD  674
             W   G    NE           ++ ++    Y  NV + N   N L  + Y  EE++ V 
Sbjct  158   WLNPGKAKGNE-----------DVAYLDVGNY--NVPQGN---NKLGTIGYSYEELYSVS  201

Query  673   ATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLD  494
                   + +FW+     +  +A  LE +EL  C+NA+ CL + PKV    +  +A I++D
Sbjct  202   GHINSPKKVFWINTTQEWLHLAADLEKMELLQCVNASLCLPNKPKVVVGLKAATADIFVD  261

Query  493   NAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFID  314
             NAAYR+F+YD F VS  +MES+AVA+ C     P I+IR LSDL        N    F  
Sbjct  262   NAAYRNFLYDTFGVSSSDMESSAVAMTCVSNGYPLIVIRGLSDL---AGVGDNTVRKFGS  318

Query  313   LAADNSVKVAVEFIKKVP  260
             LAA N+ K  +EFIKK+P
Sbjct  319   LAATNTAKAVLEFIKKLP  336



>emb|CDY03454.1| BnaC01g16280D [Brassica napus]
Length=348

 Score =   221 bits (563),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 125/323 (39%), Positives = 184/323 (57%), Gaps = 20/323 (6%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTL--IIDYAGRRFRFGTIEGKP  1034
             K  + I   N++GPY+G+V     E N  L    ++P      +D +GRRFR G I GK 
Sbjct  35    KNAITIREVNRRGPYIGLVTVFETEENAFLGSVDFRPDPAHPFLDLSGRRFRIGKIHGKK  94

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             V+ V  G+ M+NA   TQ ++ VF++ G+VH+GIAGN N S++IGDV+IP+  ++  LW+
Sbjct  95    VVYVRCGIGMVNAAAATQQMIDVFNMKGIVHFGIAGNINNSMSIGDVSIPKQITNAGLWD  154

Query  853   WQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVD  674
             W    D  E        GDY     ++ F KY   V + +  D++L ++ Y  EE++  D
Sbjct  155   WLN-PDKAEG-------GDYA---AYLDFGKY--TVPQGDGSDSMLGSIGYSYEELYS-D  200

Query  673   ATPEER--QHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIY  500
             +   +   + +FW+     + Q+A  LE +EL  C+NAT CL   PK+    +  +A+ +
Sbjct  201   SIGHKNSPKKVFWINTTQEWLQLAAGLEKMELLQCVNATLCLPEKPKLVVGLKAATANTF  260

Query  499   LDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATF  320
             +DNAAYR F+YD F VS  +MES+AVA+ C     P I+IR LSDL  G     N    F
Sbjct  261   VDNAAYRDFLYDTFGVSSSDMESSAVAMTCVSNGYPVIVIRGLSDL-AGAQTGDNAVRKF  319

Query  319   IDLAADNSVKVAVEFIKKVPSPN  251
               LAA N+ +  +EFIKK+P PN
Sbjct  320   GSLAATNTARAVLEFIKKLP-PN  341



>ref|XP_007010129.1| Phosphorylase superfamily protein [Theobroma cacao]
 gb|EOY18939.1| Phosphorylase superfamily protein [Theobroma cacao]
Length=337

 Score =   220 bits (561),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 116/319 (36%), Positives = 179/319 (56%), Gaps = 19/319 (6%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYK--PSTLIIDYAGRRFRFGTIEGKP  1034
             K+  +I+  N++GPY+G++     E +      S++  P    +D +GRRFR G + G+ 
Sbjct  31    KSLHVIKELNRRGPYIGLITVFSTEEDAFFATGSFRSDPKHPFVDLSGRRFRIGKVRGRK  90

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
              I V  G+ M+NA   TQ +L +FDV G++H+GIAGN N S++IGDV IP+  +HT +W+
Sbjct  91    AIYVRCGIGMINAAAATQQMLDLFDVKGIIHFGIAGNINNSMSIGDVTIPKQVAHTGIWD  150

Query  853   WQRYGDGPENELPLEVNGDY-TREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPV  677
             W            +  NG   + ++  + F  Y  NV + N   NLL ++ Y  E+ F  
Sbjct  151   W------------VNTNGAVDSADVSQLDFGSY--NVPKGNGS-NLLGHIGYSKEQFFSE  195

Query  676   DATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYL  497
                P   + + W  +  H+ Q+A +LEG++LE C+N++ CL   PK+    R ++A+I++
Sbjct  196   SGEPNIAESLVWAKISPHWLQLASNLEGMKLEQCVNSSLCLPEKPKLVVGLRASTANIFV  255

Query  496   DNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFI  317
             DNAAYR F++ KF VS  +ME+AAV +       P I+IR LSDL  G     N    F 
Sbjct  256   DNAAYRDFLFKKFEVSSADMETAAVVMTSLSNGFPVIVIRGLSDL-AGQQQGENAVKKFG  314

Query  316   DLAADNSVKVAVEFIKKVP  260
              LAA N+ K  + FI  +P
Sbjct  315   SLAALNTAKAVLGFIDNLP  333



>ref|XP_011101664.1| PREDICTED: LOW QUALITY PROTEIN: bark storage protein A-like [Sesamum 
indicum]
Length=337

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 123/330 (37%), Positives = 190/330 (58%), Gaps = 18/330 (5%)
 Frame = -1

Query  1240  EGANGSLLDDGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGR  1067
              G  G  ++ GK+  ++   N++GPYLG++     E N      ++K  +    +D +GR
Sbjct  18    SGVLGFPVERGKSLAIVREINRRGPYLGLITVYPPEENAFFASGAFKNHSKYPYVDLSGR  77

Query  1066  RFRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAI  887
             RFR GT+EGK VI V  G+ ++NA   TQ ++  F + G++H+GI+GN N SL+IGDV+I
Sbjct  78    RFRIGTVEGKNVIYVRCGVGLVNAAAATQQMVDHFYIKGLIHFGISGNTNSSLSIGDVSI  137

Query  886   PQYWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNV  707
             P+ +++T LW+W +    P   +P       + ++  + F  Y  NV +    +N L  +
Sbjct  138   PKQFANTGLWDWLK----PNATIP-------SNDVAQLDFENY--NVPK--EGNNSLGRI  182

Query  706   WYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRV  527
              Y PE+ +     P   + + W  V +++ Q+A SLEG+ELE C+NAT CL + P+V   
Sbjct  183   GYSPEQFYSEAGEPNTPRQMLWFQVSNNWLQLATSLEGMELEQCVNATLCLDNKPRVVVG  242

Query  526   ERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggs  347
              R ++A+ +LDNAAYR FI+  F VS  +MES AV +       P I++R LSDLAG   
Sbjct  243   LRXSTANTFLDNAAYRDFIFQTFGVSSADMESTAVVMTSLSNGFPVIVVRGLSDLAGAQD  302

Query  346   aesneaATFIDLAADNSVKVAVEFIKKVPS  257
              E++    F  LAA N   V V+FIKK+ +
Sbjct  303   GENSINL-FGPLAATNVANVVVQFIKKLSA  331



>ref|XP_010439047.1| PREDICTED: bark storage protein A [Camelina sativa]
Length=344

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/323 (37%), Positives = 182/323 (56%), Gaps = 19/323 (6%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTL--IIDYAGRRFRFGTIEGKP  1034
             ++ + I   N++GPY+G+V     E +  L    ++P      +D +GRRFR G I GK 
Sbjct  35    ESAITIRKVNRRGPYIGLVTVFETEEDAFLGSVDFRPDHTHPFMDLSGRRFRIGKIHGKK  94

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             V+ V  G+ M+NA   TQ +L VF+V G+VH+GIAGN N S++IGDV+IP+  ++  LW+
Sbjct  95    VVYVRCGIGMVNAAAATQQMLDVFNVKGIVHFGIAGNINNSMSIGDVSIPKQITNAGLWD  154

Query  853   WQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVD  674
             W           P +  G  + ++ ++    Y  NV   + + N L  + Y  EE++ V+
Sbjct  155   WLN---------PDKAKG--SEDVAYLDVGNY--NVPRGDGK-NELGTIGYSYEELYSVN  200

Query  673   ATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLD  494
                   Q +FW+     +  +A  LE +EL  C+NA+ CL   PK+    +  +A I++D
Sbjct  201   GPINSPQKVFWINTTQEWLHLAAGLEKMELLQCVNASLCLPEKPKLVVGLKAATADIFVD  260

Query  493   NAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFID  314
             NAAYR+F+Y+ F VS  +MES+AVA+ C     P I+IR LSDL        N    F  
Sbjct  261   NAAYRTFLYNSFGVSSSDMESSAVAMTCVSNGYPIIVIRGLSDL---AGVGDNTVRKFGS  317

Query  313   LAADNSVKVAVEFIKKVPSPNRS  245
             LAA N+ K  +EFIKK+PS +++
Sbjct  318   LAATNTAKAVLEFIKKLPSSHKT  340



>dbj|BAD44476.1| putative protein [Arabidopsis thaliana]
Length=313

 Score =   219 bits (557),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 121/318 (38%), Positives = 177/318 (56%), Gaps = 18/318 (6%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTL--IIDYAGRRFRFGTIEGKP  1034
             K+   I   N+ GPY+G+V     E N  L    ++P      +D +GRRFR G I GK 
Sbjct  10    KSATTIRKLNRGGPYIGLVTVIATEENAFLRSVDFRPDPTHPFLDLSGRRFRIGKIHGKK  69

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             V+ V  G  M+N    TQ ++ VF+V G+VH+GIAGN N S++IGDV+IP+  ++  LW+
Sbjct  70    VVYVRCGRGMVNGAAATQQMIDVFNVKGIVHFGIAGNMNNSMSIGDVSIPKQITNAGLWD  129

Query  853   WQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVD  674
             W           P +V G    +I ++    Y  NV + +  DN L ++ Y  E+++ V 
Sbjct  130   WLN---------PDKVKG--VEDIAYLDVGNY--NVPKGDG-DNELGSIGYNYEQLYSVT  175

Query  673   ATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLD  494
                   Q++FW+     +  +A  LE +EL  C+NA+ CL   PK+    +  +A I++D
Sbjct  176   GHINAPQNVFWINTTQEWLHLAADLEKMELSQCVNASLCLPKKPKLVVGLKAATAYIFVD  235

Query  493   NAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFID  314
             NAAYR+F+YD F VS  +MES+AVA+ C     P I+IR LSDL   G    N    F  
Sbjct  236   NAAYRNFLYDTFGVSSSDMESSAVAMTCASNGYPIIVIRGLSDL--AGEGGDNTVHKFGS  293

Query  313   LAADNSVKVAVEFIKKVP  260
             LAA N+ K  +EFI+K+P
Sbjct  294   LAATNTAKAVLEFIRKLP  311



>ref|XP_007220735.1| hypothetical protein PRUPE_ppa023149mg [Prunus persica]
 gb|EMJ21934.1| hypothetical protein PRUPE_ppa023149mg [Prunus persica]
Length=334

 Score =   219 bits (557),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 121/318 (38%), Positives = 182/318 (57%), Gaps = 20/318 (6%)
 Frame = -1

Query  1195  LIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTL--IIDYAGRRFRFGTIEGKPVILV  1022
             LI+  N++GPY+G++     E     +  ++KP+     +D +GRRF  G I  K V+ V
Sbjct  35    LIKKVNREGPYIGLITVFPPEETAFFQIGAFKPNQKHPFVDLSGRRFLVGKIHDKKVVYV  94

Query  1021  MTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRY  842
               G+ M+NA   TQ +L +FD+ G+VH+GIAGNAN SL+IGDV IPQ +SHT +W+W   
Sbjct  95    RCGVGMMNAAAATQQMLDLFDILGIVHFGIAGNANNSLSIGDVTIPQQFSHTGIWDW---  151

Query  841   GDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPE  662
                      L  N     +   + F +Y  NV      DNLL ++ ++ E+ F       
Sbjct  152   ---------LNSNRSLNYDEASLDFKRY--NVPR---GDNLLGHIGFRYEQFFSEYGKAN  197

Query  661   ERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAY  482
               + +FW      + Q+A +L+G++L  C+N++ CL   P++    RG++A+I++DNAAY
Sbjct  198   TARRLFWANTTRQWLQVAANLKGIKLNQCLNSSVCLPQKPQLVVGLRGSTANIFVDNAAY  257

Query  481   RSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAAD  302
             R F++  F VS V+MES+AV +       P I+IR LSDL  GG +  N   TF  LAA 
Sbjct  258   RDFLFQTFRVSSVDMESSAVVMTSLSNGFPVIVIRGLSDL-AGGQSGHNSIDTFGSLAAI  316

Query  301   NSVKVAVEFIKKVPSPNR  248
             N+ KV V+FIK++    R
Sbjct  317   NACKVVVQFIKQLHHDTR  334



>ref|XP_011031569.1| PREDICTED: bark storage protein A-like isoform X4 [Populus euphratica]
Length=277

 Score =   216 bits (551),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 117/283 (41%), Positives = 166/283 (59%), Gaps = 17/283 (6%)
 Frame = -1

Query  1096  STLIIDYAGRRFRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNAN  917
             + L I  AGRR+R G I GK V+ V  G+ + NA   TQ +L +FDV G+VH+GI+GN N
Sbjct  4     TLLWIFQAGRRYRVGKINGKKVVFVRCGVGITNAAAVTQQMLDLFDVTGIVHFGISGNVN  63

Query  916   PSLNIGDVAIPQYWSHTALWNWQRYGDGPENELPLEVNGDYT-REIGFIKFAKYATNVDE  740
              S++IGDV IP+ ++HT LWNW            L  NG     ++ +++   Y  NV E
Sbjct  64    DSMSIGDVTIPKQFAHTGLWNW------------LNPNGTMDPADVAYLEVGSY--NVPE  109

Query  739   CNSQDNLLNNVWYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATT  560
              +   NLL  + Y  E++F V   P     ++W+ V   + Q+A+SLEG+ELE C+N++ 
Sbjct  110   GDGV-NLLGQIGYSTEQLFSVSREPNTAVSLWWMEVSQQWLQLARSLEGMELEKCVNSSL  168

Query  559   CLTHTPKVTRVERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIII  380
             CL   PK+    +G S++I+LDNAAYR F++  F VS  +MES+AV + C     P I+I
Sbjct  169   CLKEKPKLVVGLKGASSNIFLDNAAYRDFLFQTFEVSSSDMESSAVVMTCLSNGFPVIVI  228

Query  379   RALSDLagggsaesneaATFIDLAADNSVKVAVEFIKKVPSPN  251
             R LSDL  G  +  N   TF  LAA N+ K  +E I K+P  N
Sbjct  229   RGLSDL-AGAESGDNAIHTFGSLAALNAAKAVLELINKLPGYN  270



>ref|XP_006413442.1| hypothetical protein EUTSA_v10025575mg [Eutrema salsugineum]
 gb|ESQ54895.1| hypothetical protein EUTSA_v10025575mg [Eutrema salsugineum]
Length=354

 Score =   219 bits (557),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 122/323 (38%), Positives = 184/323 (57%), Gaps = 22/323 (7%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTL--IIDYAGRRFRFGTIEGKP  1034
             K+ + I   N++GPY+G+V     E +  L    ++P      +D +GRRFR G I GK 
Sbjct  36    KSAITIRKVNRRGPYIGLVTVFETEEDAFLATVDFRPDPTHPFLDLSGRRFRIGKIHGKK  95

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             V+ V  G+ M+NA   TQ ++ VF+V G+VH+GIAGN N S++IGDV+IP+  ++  LW+
Sbjct  96    VVYVRCGIGMVNAAAATQQMIDVFNVKGIVHFGIAGNINNSMSIGDVSIPKQITNAGLWD  155

Query  853   WQR--YGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFP  680
             W      DG E+   L+V G+Y              NV + +  +N+L ++ Y  EE++ 
Sbjct  156   WLNPDKADGGEDAAYLDV-GNY--------------NVPQGDG-NNMLGSIGYSYEELYS  199

Query  679   VDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIY  500
             +       Q +FW+     +  +A  LE +EL  C+N++ CL   PK+    +  +A+I+
Sbjct  200   ITGHTNSPQKVFWINTTQEWLHLAADLERMELLQCVNSSLCLPEKPKLVVGLKAATANIF  259

Query  499   LDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATF  320
             +DNAAYR+F+YD F VS  +MES+AVA+ C       I+IR LSD+  G     N    F
Sbjct  260   VDNAAYRNFLYDTFGVSSSDMESSAVAMTCVSNGYTIIVIRGLSDI-AGAQTGHNAVRKF  318

Query  319   IDLAADNSVKVAVEFIKKVPSPN  251
               LAA N+ K  +EFIKK+P PN
Sbjct  319   GSLAATNTAKAVLEFIKKLP-PN  340



>ref|XP_010433781.1| PREDICTED: bark storage protein A-like [Camelina sativa]
Length=344

 Score =   218 bits (556),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 120/325 (37%), Positives = 181/325 (56%), Gaps = 25/325 (8%)
 Frame = -1

Query  1204  TRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTL--IIDYAGRRFRFGTIEGKPV  1031
             + + I   N++GPY+G+V     E +  L    ++P      +D +GRRFR G I GK V
Sbjct  36    SAITIRKVNRRGPYIGLVTVFETEEDAFLGSVDFRPDPTHPFLDLSGRRFRIGKIHGKKV  95

Query  1030  ILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNW  851
             + V  G+ M+NA   TQ +L VF+V G+VH+GIAGN N S++IGDV+IP+  ++  LW+W
Sbjct  96    VYVRCGIGMVNAAAATQQMLDVFNVKGIVHFGIAGNINNSMSIGDVSIPKQITNAGLWDW  155

Query  850   QRYGDGPENELPLEVNGDYTR---EIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFP  680
                           +N D T+   ++ ++    Y  NV   + + N L  + Y  EE++ 
Sbjct  156   --------------LNPDKTKGGEDVAYLDVGNY--NVPRGDGK-NELGTIGYSYEELYS  198

Query  679   VDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIY  500
             V+      Q +FW+     +  +A  LE +EL  C+NA+ CL   PK+    +  +A I+
Sbjct  199   VNGPINSPQKVFWINTTQDWLHLAAGLEKMELLQCVNASLCLPEKPKLVVGLKAATADIF  258

Query  499   LDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATF  320
             +DNAAYR+F+Y+ F VS  +MES+AVA+ C     P I+IR LSDL        N    F
Sbjct  259   VDNAAYRTFLYNSFGVSSSDMESSAVAMTCVSNGYPIIVIRGLSDL---AGVGDNTVRKF  315

Query  319   IDLAADNSVKVAVEFIKKVPSPNRS  245
               LAA N+ K  +EFIKK+PS + +
Sbjct  316   GSLAATNTAKAVLEFIKKLPSSHNT  340



>ref|NP_194166.2| phosphorylase family protein [Arabidopsis thaliana]
 gb|AAK44093.1|AF370278_1 unknown protein [Arabidopsis thaliana]
 gb|AAN13118.1| unknown protein [Arabidopsis thaliana]
 gb|AEE84892.1| phosphorylase family protein [Arabidopsis thaliana]
Length=336

 Score =   218 bits (555),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 121/318 (38%), Positives = 177/318 (56%), Gaps = 18/318 (6%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTL--IIDYAGRRFRFGTIEGKP  1034
             K+   I   N+ GPY+G+V     E N  L    ++P      +D +GRRFR G I GK 
Sbjct  33    KSATTIRKLNRGGPYIGLVTVIATEENAFLRSVDFRPDPTHPFLDLSGRRFRIGKIHGKK  92

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             V+ V  G  M+N    TQ ++ VF+V G+VH+GIAGN N S++IGDV+IP+  ++  LW+
Sbjct  93    VVYVRCGRGMVNGAAATQQMIDVFNVKGIVHFGIAGNMNNSMSIGDVSIPKQITNAGLWD  152

Query  853   WQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVD  674
             W           P +V G    +I ++    Y  NV + +  DN L ++ Y  E+++ V 
Sbjct  153   WLN---------PDKVKG--VEDIAYLDVGNY--NVPKGDG-DNELGSIGYNYEQLYSVT  198

Query  673   ATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLD  494
                   Q++FW+     +  +A  LE +EL  C+NA+ CL   PK+    +  +A I++D
Sbjct  199   GHINAPQNVFWINTTQEWLHLAADLEKMELSQCVNASLCLPKKPKLVVGLKAATAYIFVD  258

Query  493   NAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFID  314
             NAAYR+F+YD F VS  +MES+AVA+ C     P I+IR LSDL   G    N    F  
Sbjct  259   NAAYRNFLYDTFGVSSSDMESSAVAMTCASNGYPIIVIRGLSDL--AGEGGDNTVHKFGS  316

Query  313   LAADNSVKVAVEFIKKVP  260
             LAA N+ K  +EFI+K+P
Sbjct  317   LAATNTAKAVLEFIRKLP  334



>ref|XP_006286134.1| hypothetical protein CARUB_v10007687mg [Capsella rubella]
 gb|EOA19032.1| hypothetical protein CARUB_v10007687mg [Capsella rubella]
Length=346

 Score =   218 bits (555),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 119/315 (38%), Positives = 177/315 (56%), Gaps = 19/315 (6%)
 Frame = -1

Query  1198  MLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKP--STLIIDYAGRRFRFGTIEGKPVIL  1025
             + I   N++GPY+G+V     E +  L    ++P  S   +D +GRRFR G I GK V+ 
Sbjct  40    ITIRKVNRRGPYIGLVTVFETEEDAFLGSVDFRPDPSHPFLDLSGRRFRIGKIHGKKVVY  99

Query  1024  VMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQR  845
             V  G+ M+NA   TQ +L VF+V G+VH+GIAGN N S++IGDV+IP+  ++  LW+W  
Sbjct  100   VRCGIGMVNAAAATQQMLDVFNVKGIVHFGIAGNINNSMSIGDVSIPKQITNAGLWDWLN  159

Query  844   YGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATP  665
                      P +  G    ++ ++    Y  NV + + + N L  + Y  EE++ V+   
Sbjct  160   ---------PDKAKGG--EDVAYLDVGNY--NVPQGDGK-NELGTIGYSSEELYSVNGPI  205

Query  664   EERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAA  485
                Q +FW+     +  +A  LE +EL  C+N+T CL   PK+    +  +A I++DNAA
Sbjct  206   NSPQKVFWINTTQEWLHLAAGLEKIELLQCVNSTLCLPEKPKLVIGLKAATADIFVDNAA  265

Query  484   YRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAA  305
             YR+F+Y+ F VS  +MES+AVA+ C     P I+IR LSDL        N    F  LAA
Sbjct  266   YRNFLYNSFGVSSSDMESSAVAMTCVSNGYPIIVIRGLSDL---AGVGDNTVRKFGSLAA  322

Query  304   DNSVKVAVEFIKKVP  260
              N+ K  +EFIKK+P
Sbjct  323   TNTAKAVLEFIKKLP  337



>ref|XP_010448574.1| PREDICTED: bark storage protein A-like isoform X1 [Camelina sativa]
Length=343

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/319 (37%), Positives = 179/319 (56%), Gaps = 19/319 (6%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKP--STLIIDYAGRRFRFGTIEGKP  1034
             ++ + I   N++GPY+G+V     E +  L    ++P  +   +D +GRRFR G I GK 
Sbjct  34    ESAITIRKVNRRGPYIGLVTVFETEEDAFLGSVDFRPDPTRPFMDLSGRRFRIGKIHGKK  93

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             V+ V  G+ M+NA   TQ ++ VF+V G+VH+GIAGN N S++IGDV+IP+  ++  LW+
Sbjct  94    VVYVRCGIGMVNAAAATQQMIDVFNVKGIVHFGIAGNINNSMSIGDVSIPKQITNAGLWD  153

Query  853   WQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVD  674
             W           P +  G    ++ ++    Y  NV   + + N L  + Y  EE++ V+
Sbjct  154   WLN---------PDKAKGG--EDVAYLDVGNY--NVPRGDGK-NELGTIGYSYEELYSVN  199

Query  673   ATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLD  494
                   Q +FW+     +  +A  LE +EL  C+NA+ CL   PK+    +  +A I++D
Sbjct  200   GPINSPQKVFWINTTQEWLHLAAGLEKMELLQCVNASLCLPEKPKLVVGLKAATADIFVD  259

Query  493   NAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFID  314
             NAAYR+F+Y+ F VS  +MES+AVA+ C     P I+IR LSDL        N    F  
Sbjct  260   NAAYRTFLYNSFGVSSSDMESSAVAMTCVSNGYPIIVIRGLSDL---AGVGDNTVRKFGS  316

Query  313   LAADNSVKVAVEFIKKVPS  257
             LAA N+ K  +EFIKK+PS
Sbjct  317   LAATNTAKAVLEFIKKLPS  335



>ref|XP_008233427.1| PREDICTED: bark storage protein A-like [Prunus mume]
Length=345

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 122/322 (38%), Positives = 183/322 (57%), Gaps = 19/322 (6%)
 Frame = -1

Query  1195  LIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTL--IIDYAGRRFRFGTIEGKPVILV  1022
             LI+  N+KGPY+G++     E     +  ++KP+     +D +GRRF  G I  K V+ V
Sbjct  35    LIKKVNRKGPYIGLITVFPPEETAFFQIGAFKPNQKHPSVDLSGRRFLVGKIHDKKVVYV  94

Query  1021  MTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRY  842
               G+ M+NA   TQ +L +FD+ G+VH+GIAGNAN SL+IGDV IPQ +SHT +W+W   
Sbjct  95    RCGVGMMNAAAATQQMLDLFDILGIVHFGIAGNANNSLSIGDVTIPQQFSHTGIWDW---  151

Query  841   GDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPE  662
                      L  N     +   + F +Y  NV      DNLL ++ ++ E+ F       
Sbjct  152   ---------LNSNRSLNYDEASLDFKRY-INVPR---GDNLLGHIGFRYEQFFSEYGKAN  198

Query  661   ERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAY  482
               + +FW      + Q+A +L+G++L  C++++ CL   P++    RG++A+I++DNAAY
Sbjct  199   TARPLFWANTTRQWLQVAANLKGIKLNQCLSSSVCLPQKPQLVVGLRGSTANIFVDNAAY  258

Query  481   RSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAAD  302
             R F++  F VS V+MES+AV +       P I+IR LSDL  GG +  N   TF  LAA 
Sbjct  259   RDFLFQNFRVSSVDMESSAVVMTSLSNGFPVIVIRGLSDL-AGGQSGHNSIDTFGSLAAM  317

Query  301   NSVKVAVEFIKKVPSPNRSAGL  236
             N+ KV V+FIK++    R  G 
Sbjct  318   NACKVVVQFIKQLHLDTREPGF  339



>gb|AAM65580.1| unknown [Arabidopsis thaliana]
Length=336

 Score =   216 bits (551),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 120/318 (38%), Positives = 176/318 (55%), Gaps = 18/318 (6%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTL--IIDYAGRRFRFGTIEGKP  1034
             K+   I   N+ GPY+G+V     E N  L    ++P      +D +GRRFR G I GK 
Sbjct  33    KSATTIRKLNRGGPYIGLVTVIATEENAFLRSVDFRPDPTHPFLDLSGRRFRIGKIHGKK  92

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             V+ V  G  M+N    TQ ++ VF+V G+VH+GIAGN N S++IGDV+IP+  ++  LW+
Sbjct  93    VVYVRCGRGMVNGAAATQQMIDVFNVKGIVHFGIAGNMNNSMSIGDVSIPKQITNAGLWD  152

Query  853   WQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVD  674
             W           P +  G    +I ++    Y  NV + +  DN L ++ Y  E+++ V 
Sbjct  153   WLN---------PDKAKGG--EDIAYLDVGNY--NVPKGDG-DNELGSIGYNYEQLYSVT  198

Query  673   ATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLD  494
                   Q++FW+     +  +A  LE +EL  C+NA+ CL   PK+    +  +A I++D
Sbjct  199   GHINTPQNVFWINTTQEWLHLAADLEKMELSQCVNASLCLPKKPKLVVGLKAATAYIFVD  258

Query  493   NAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFID  314
             NAAYR+F+YD F VS  +MES+AVA+ C     P I+IR LSDL   G    N    F  
Sbjct  259   NAAYRNFLYDTFGVSSSDMESSAVAMTCASNGYPIIVIRGLSDL--AGEGGDNTVHKFGS  316

Query  313   LAADNSVKVAVEFIKKVP  260
             LAA N+ K  +EFI+K+P
Sbjct  317   LAATNTAKAVLEFIRKLP  334



>ref|XP_006846768.1| hypothetical protein AMTR_s00148p00020960 [Amborella trichopoda]
 gb|ERN08349.1| hypothetical protein AMTR_s00148p00020960 [Amborella trichopoda]
Length=332

 Score =   214 bits (545),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 122/325 (38%), Positives = 180/325 (55%), Gaps = 27/325 (8%)
 Frame = -1

Query  1213  DGKTRMLIENANKKGPYLGVVI------PNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFG  1052
             D ++  LI   N +GPY+GVV          F+ N L  H  Y      +D +GRRFR G
Sbjct  28    DKRSLQLIGELNGEGPYIGVVTVYPPEEKAFFDSNALKPHPKYP----FLDLSGRRFRVG  83

Query  1051  TIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWS  872
              I GK VI V  G+ M+NA   +Q L  +FDV G+VH+GIAGN N S +IGDV IP+Y +
Sbjct  84    KIHGKKVIYVRCGVGMVNAAAASQQLFDLFDVTGIVHFGIAGNVNSSFSIGDVTIPKYVA  143

Query  871   HTALWNWQRYGDGPENELPLEVNGDY-TREIGFIKFAKYATNVDECNSQDNLLNNVWYQP  695
             HT +W W            L ++G+   ++ G +   +Y  N      + N L  + YQP
Sbjct  144   HTGIWEW------------LNIHGEMDKKDFGMLVIGRY--NKPRAKGK-NALGRIGYQP  188

Query  694   EEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGT  515
             EE +  +  P   + + W    S +  +A+SLEG++L+ C+N++ C+ +  K+    R  
Sbjct  189   EEFYSHNGKPNVPEDLIWAQTTSQWQDLAKSLEGMKLDSCLNSSLCVANERKLVVGLRAA  248

Query  514   SASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesn  335
             +A+I++DNAAYR F++  F+VS V+ ESA++ +       P I+IR LSDL  GG    N
Sbjct  249   TANIFVDNAAYRRFLFHNFHVSSVDEESASIVMTSLSNGFPVIVIRGLSDL-AGGQKGQN  307

Query  334   eaATFIDLAADNSVKVAVEFIKKVP  260
               +TF  LAA N+VK  + FI  +P
Sbjct  308   AISTFGPLAARNAVKATLGFIDMLP  332



>ref|XP_008233237.1| PREDICTED: bark storage protein A-like isoform X1 [Prunus mume]
Length=345

 Score =   213 bits (543),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 121/322 (38%), Positives = 183/322 (57%), Gaps = 19/322 (6%)
 Frame = -1

Query  1195  LIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTL--IIDYAGRRFRFGTIEGKPVILV  1022
             LI+  N+KGPY+G++     E     +  ++KP+     +D +GRRF  G I  K V+ V
Sbjct  35    LIKKVNRKGPYIGLITVFPPEETAFFQIGAFKPNQKHPSVDLSGRRFLVGKIHDKKVVYV  94

Query  1021  MTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRY  842
               G+ M+NA   TQ +L +FD+ G+VH+GIAGNAN SL+IGDV IPQ ++HT +W+W   
Sbjct  95    RCGVGMVNAAAATQQMLDLFDILGIVHFGIAGNANSSLSIGDVTIPQQFAHTGIWDWLN-  153

Query  841   GDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPE  662
                P   L  +       ++  + F +Y  NV      DNLL ++ +  E+ F       
Sbjct  154   ---PNRSLNYD-------QVANLDFKRY--NVPR---GDNLLGHIVFSYEQFFAEYGKAN  198

Query  661   ERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAY  482
               + +FW      + Q+A +++G++L  C+N++ CL   P++    RG++A+I++DNAAY
Sbjct  199   TARPLFWANTTRQWLQVAANMKGIKLNQCLNSSVCLPQKPQLVVGLRGSTANIFVDNAAY  258

Query  481   RSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAAD  302
             R F++  F VS V+MES+AV +       P I+IR LSDL  GG A  N    F  LAA 
Sbjct  259   RDFLFQTFQVSSVDMESSAVVMTSLSNGFPVIVIRGLSDL-AGGQAGHNSIDIFGSLAAI  317

Query  301   NSVKVAVEFIKKVPSPNRSAGL  236
             N+ KV V+FIK++    R  G 
Sbjct  318   NACKVVVQFIKQLHLDTREPGF  339



>ref|XP_002869722.1| hypothetical protein ARALYDRAFT_492412 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45981.1| hypothetical protein ARALYDRAFT_492412 [Arabidopsis lyrata subsp. 
lyrata]
Length=339

 Score =   213 bits (542),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 119/320 (37%), Positives = 176/320 (55%), Gaps = 22/320 (7%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTL--IIDYAGRRFRFGTIEGKP  1034
             K+ + I   N +GPY+G+V     E N  L    ++P      +D +GRRFR G + GK 
Sbjct  36    KSAITIRKLNLRGPYIGLVTVIETEENAFLRSVEFRPDPTHPFLDLSGRRFRIGKVHGKK  95

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             V+ V  G  M+N    TQ ++ VF+V G+VH+GIAGN N S++IGDV+IP+  ++  LW+
Sbjct  96    VVYVRCGRGMVNGAAATQQMIDVFNVKGIVHFGIAGNMNNSMSIGDVSIPKQITNAGLWD  155

Query  853   WQR--YGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFP  680
             W       G E+ + L+V G+Y    G                 +N L ++ Y  E+++ 
Sbjct  156   WLNPDKAKGGEDLVYLDV-GNYNVPKG---------------DGNNELGSIGYSYEQLYS  199

Query  679   VDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIY  500
             V       +++FW+     +  +A  LE +EL  C+NA+ CL   PK+    +  +A I+
Sbjct  200   VTGRINIPENVFWINTTQEWLHLAADLEKIELSQCVNASLCLPKKPKLVVGLKAATADIF  259

Query  499   LDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATF  320
             +DNAAYR+F+YD F VS  +MES+AVA+ C     P I+IR LSDL   G    N    F
Sbjct  260   VDNAAYRNFLYDTFGVSSSDMESSAVAMTCASNGYPVIVIRGLSDL--AGVGGDNTVHKF  317

Query  319   IDLAADNSVKVAVEFIKKVP  260
               LAA N+ K  +EFIKK+P
Sbjct  318   GSLAATNTAKAVLEFIKKLP  337



>emb|CDO99840.1| unnamed protein product [Coffea canephora]
Length=339

 Score =   213 bits (542),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 117/308 (38%), Positives = 172/308 (56%), Gaps = 18/308 (6%)
 Frame = -1

Query  1180  NKKGPYLGVVIPNMFEMNPLLEHSSYKPSTL--IIDYAGRRFRFGTIEGKPVILVMTGLA  1007
             N+ GPYLG++     E +      ++KP+     +D +GRRFR G+I G  VI V  G  
Sbjct  39    NRNGPYLGLITVFAPEEDAFFATGAFKPNPKHPYVDLSGRRFRVGSIGGSKVIYVRCGEG  98

Query  1006  MLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDGPE  827
             M+NA   TQ +L VF V G+VH+GIAGNAN S++IGDV IP+ ++ T LW+W ++    +
Sbjct  99    MVNAAAATQQMLDVFRVIGIVHFGIAGNANNSMSIGDVIIPKQFAQTGLWDWVKF----K  154

Query  826   NELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHI  647
               +P       T ++  + F  Y    D  N  DN L ++ Y  E  +     P   +  
Sbjct  155   ATIP-------TNDVAELDFGSY----DVPNGGDNELGSIGYSTEFFYSKSGKPNAPERT  203

Query  646   FWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIY  467
              W     ++ +++ SLEG+ LE C+N++ CL   PKV     G +A+I++DNAAYR F+Y
Sbjct  204   LWFQTSQNWLEVSSSLEGMALEQCVNSSLCLPEKPKVVVGLNGATANIFVDNAAYREFLY  263

Query  466   DKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSVKV  287
               F+VS ++MESAAV + C       I+IR LSDLAG    ++     F  LAA N  K 
Sbjct  264   TTFHVSSLDMESAAVVMTCLSNGFKVIVIRGLSDLAGAQDGDNTIRL-FGPLAASNVAKA  322

Query  286   AVEFIKKV  263
              V+F+K +
Sbjct  323   VVQFVKTL  330



>ref|XP_007010127.1| Phosphorylase family protein isoform 1 [Theobroma cacao]
 gb|EOY18937.1| Phosphorylase family protein isoform 1 [Theobroma cacao]
Length=357

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 117/323 (36%), Positives = 173/323 (54%), Gaps = 19/323 (6%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTL--IIDYAGRRFRFGTIEGKP  1034
             K+  +I+  N++GPY+G++     E N      S++P      +D +GRRFR G + GK 
Sbjct  51    KSLNIIKQLNRRGPYIGLITVIRTEENAFFATGSFRPDPKYPFVDLSGRRFRIGKVHGKK  110

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             VI V  G+ M+NA   TQ +L +FDV G++H+GIAGN N S++IGDV IP   +HT +W+
Sbjct  111   VIFVRCGVGMVNAAAATQQMLDLFDVEGIIHFGIAGNVNNSMSIGDVTIPSQVAHTGIWD  170

Query  853   WQR-YGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPV  677
             W    G   ++++     G Y    G               S  NLL ++ Y+ E+ F  
Sbjct  171   WLNPQGTVDQDDVAQLDIGSYNVPTG---------------SGANLLGHIGYRKEQFFSK  215

Query  676   DATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYL  497
                P   Q + W      + Q+A +   L LE C+N++ CL   PK+    R ++A+I++
Sbjct  216   SGEPNIAQSLVWAKTSPQWLQLASNFGELILEQCVNSSLCLPQKPKLVVGLRASTANIFV  275

Query  496   DNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFI  317
             DNAAYR F++  F++S V+MESAAV +       P I+IR LSDL  G     N    F 
Sbjct  276   DNAAYRDFLFQTFHISSVDMESAAVVMTSLSNGFPLIVIRGLSDL-AGRQRGENAIKAFG  334

Query  316   DLAADNSVKVAVEFIKKVPSPNR  248
              LAA N+ K  + FI K+P   R
Sbjct  335   SLAAVNAAKAVLAFIAKLPGYAR  357



>ref|XP_007010128.1| Phosphorylase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY18938.1| Phosphorylase superfamily protein isoform 2 [Theobroma cacao]
Length=337

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 115/319 (36%), Positives = 171/319 (54%), Gaps = 19/319 (6%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTL--IIDYAGRRFRFGTIEGKP  1034
             K+  +I+  N++GPY+G++     E N      S++P      +D +GRRFR G + GK 
Sbjct  31    KSLNIIKQLNRRGPYIGLITVIRTEENAFFATGSFRPDPKYPFVDLSGRRFRIGKVHGKK  90

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             VI V  G+ M+NA   TQ +L +FDV G++H+GIAGN N S++IGDV IP   +HT +W+
Sbjct  91    VIFVRCGVGMVNAAAATQQMLDLFDVEGIIHFGIAGNVNNSMSIGDVTIPSQVAHTGIWD  150

Query  853   WQR-YGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPV  677
             W    G   ++++     G Y    G               S  NLL ++ Y+ E+ F  
Sbjct  151   WLNPQGTVDQDDVAQLDIGSYNVPTG---------------SGANLLGHIGYRKEQFFSK  195

Query  676   DATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYL  497
                P   Q + W      + Q+A +   L LE C+N++ CL   PK+    R ++A+I++
Sbjct  196   SGEPNIAQSLVWAKTSPQWLQLASNFGELILEQCVNSSLCLPQKPKLVVGLRASTANIFV  255

Query  496   DNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFI  317
             DNAAYR F++  F++S V+MESAAV +       P I+IR LSDL  G     N    F 
Sbjct  256   DNAAYRDFLFQTFHISSVDMESAAVVMTSLSNGFPVIVIRGLSDL-AGQQQGENAVKKFG  314

Query  316   DLAADNSVKVAVEFIKKVP  260
              LAA N+ K  + FI  +P
Sbjct  315   SLAALNTAKAVLGFIDNLP  333



>ref|XP_010940791.1| PREDICTED: bark storage protein A-like [Elaeis guineensis]
Length=339

 Score =   209 bits (531),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 121/319 (38%), Positives = 188/319 (59%), Gaps = 33/319 (10%)
 Frame = -1

Query  1201  RMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVI  1028
             R  ++  N++GP++G+V+    E   +     + P + I  +D  GRRF  GTI    VI
Sbjct  35    RAAVDRVNERGPFIGLVMAYSSEAQAVRSSGEFVPGSDIPSLDLYGRRFHIGTIRDVDVI  94

Query  1027  LVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQ  848
              V +G   LNAGIT Q+LL VFD+ G+VH+GIAG+AN SL+ GDV++P++ + T  W W 
Sbjct  95    WVKSGQRRLNAGITVQILLDVFDIRGLVHFGIAGSANDSLSFGDVSVPKFVAFTGSWTWT  154

Query  847   RY----GDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFP  680
             ++    G  P+                 + F +Y+      +   N L++V Y+ EE+FP
Sbjct  155   KFNSVEGSSPD-----------------LSFGEYSIP----SESKNWLSSVEYKTEELFP  193

Query  679   VDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIY  500
             V    +E Q++FW+ VD  +F +A+ L+ + L+ CIN T CL  TPKV    +G++  I+
Sbjct  194   VG---KEMQYVFWLEVDPEWFYVAEKLQ-VALQRCINETYCLPQTPKVAFGLKGSTDDIF  249

Query  499   LDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATF  320
             ++NAAYR F++++F VS ++ ESAAV +      VP I+ R +SDLAGG  + S+   + 
Sbjct  250   VNNAAYRKFLFNEFGVSTIDEESAAVLMTAVSPGVPTIVFRGVSDLAGGEESWSSTDLS-  308

Query  319   IDLAADNSVKVAVEFIKKV  263
              DLA+ N+ KVA+EFI  +
Sbjct  309   -DLASINAFKVALEFIAAI  326



>ref|XP_010110204.1| Bark storage protein A [Morus notabilis]
 gb|EXC25442.1| Bark storage protein A [Morus notabilis]
Length=336

 Score =   208 bits (530),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 110/321 (34%), Positives = 180/321 (56%), Gaps = 20/321 (6%)
 Frame = -1

Query  1210  GKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKP--STLIIDYAGRRFRFGTIEGK  1037
             G    L++  N+KGPY+G++     E N      ++KP  +   +D++GRRFR G +  K
Sbjct  26    GSRYHLLKKVNRKGPYIGLITVYPTEENAFFSTGAFKPDPNDPFLDFSGRRFRVGKVLDK  85

Query  1036  PVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALW  857
              VI V  G+ ++NA  TTQ +L +F + G+VH+GIAGN N S++IGDV IP+ + +T +W
Sbjct  86    RVIYVKCGVGLINAAATTQQMLDLFRISGIVHFGIAGNINNSMSIGDVTIPKEFVNTGIW  145

Query  856   NWQRYGDGPENELPLEVNGDY-TREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFP  680
             +W            L  NG   T +I  +    Y    +   + DNLL ++ +  E+++ 
Sbjct  146   DW------------LNPNGTVDTADIAGLDVKNY----NSPKAGDNLLGHIGFNFEQLYS  189

Query  679   VDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIY  500
                 P   Q + W  V+  +  +A  LEG+EL+ C+N++ CL   PK+    +G+++ I+
Sbjct  190   NSGEPNTAQTLVWAQVNQDWLHVASKLEGIELQQCVNSSLCLQGKPKLVVGLKGSTSDIF  249

Query  499   LDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATF  320
             +DNAAYR F+++ F VS  +MES+AV +       P I+IR LSD+  G     +   TF
Sbjct  250   VDNAAYRDFLFNTFKVSSTDMESSAVVMTSLSNGFPVIVIRGLSDI-AGKQEGESAIGTF  308

Query  319   IDLAADNSVKVAVEFIKKVPS  257
               LAA N+    ++ +K++P+
Sbjct  309   GSLAALNTANSVIQLLKELPA  329



>ref|XP_010448572.1| PREDICTED: bark storage protein A-like [Camelina sativa]
Length=341

 Score =   208 bits (530),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 117/315 (37%), Positives = 175/315 (56%), Gaps = 22/315 (7%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYK--PSTLIIDYAGRRFRFGTIEGKPVILVM  1019
             I   N++G Y+G+V     E +  L    ++  P+   +D +GRRFR G I  K V+ V 
Sbjct  43    IRKLNRRGTYIGLVTVIETEEDAFLRSVDFRADPTHPYLDLSGRRFRIGKIHEKKVVYVR  102

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNW--QR  845
              G  M+NA   TQ ++ VF+V G+VH+GIAGN N S++IGDV+IP+  ++  LW+W    
Sbjct  103   CGRGMVNAAAVTQQMIDVFNVKGIVHFGIAGNMNNSMSIGDVSIPKQITNAGLWDWLNPN  162

Query  844   YGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATP  665
                G E+   L++ G+Y    G                 +N L ++ Y  E+++ V    
Sbjct  163   NAKGGEDVASLDI-GNYNIPQG---------------DGNNELGSLRYGQEQLYSVTGHI  206

Query  664   EERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAA  485
                Q++FW+     +  +A  LE +EL  C+NA+ CL + PK+    +  +A+I++DNAA
Sbjct  207   NSPQNVFWINTTQEWLHLAADLEKMELSQCVNASLCLPNKPKLVVGLKAATANIFVDNAA  266

Query  484   YRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAA  305
             YR+F+YD F VS  +MES+AVA+ C     P I+IR LSDL   G    N    F  LAA
Sbjct  267   YRNFLYDTFGVSSSDMESSAVAMTCASNGYPIIVIRGLSDL--AGVGGDNTVHKFGSLAA  324

Query  304   DNSVKVAVEFIKKVP  260
              N+ K  +EFIKK+P
Sbjct  325   TNTAKAVLEFIKKLP  339



>ref|XP_010520775.1| PREDICTED: bark storage protein A-like isoform X1 [Tarenaya hassleriana]
Length=341

 Score =   207 bits (528),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 111/310 (36%), Positives = 169/310 (55%), Gaps = 16/310 (5%)
 Frame = -1

Query  1186  NANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTL--IIDYAGRRFRFGTIEGKPVILVMTG  1013
             N    GPY+G+V     E +  L    ++P      +D +GRRFR G I GK V+ V  G
Sbjct  46    NRRGGGPYIGLVTVIETEEDAFLGSVDFRPDPFRPFVDLSGRRFRIGKIHGKNVVYVRCG  105

Query  1012  LAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDG  833
             + ++NA + TQ ++  F V G+VH+GIAGN N S++IGDV IP+  +   LW+W   G  
Sbjct  106   IGLVNAAMATQQMIDAFRVKGIVHFGIAGNLNNSMSIGDVTIPKQIASVGLWDWLNPG--  163

Query  832   PENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQ  653
                        D  +++ F+    Y+  V + +   N L  + Y  EE++         Q
Sbjct  164   ---------KTDGGQDVAFLDIGSYS--VPQGDGSVNELGTIRYNYEELYSKSGKTNTPQ  212

Query  652   HIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSF  473
               FW+  +S +  +A  LEG+EL  C+N++ CL   PK+    +G +A++++DNAAYR+F
Sbjct  213   KKFWINTNSQWLHLASDLEGMELLQCVNSSLCLPQKPKLVVGLKGATANVFVDNAAYRNF  272

Query  472   IYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSV  293
             +Y+ F VS  +MES+AV + C     P I+IR LSDL  G  +  N    F  LAA N+ 
Sbjct  273   LYNTFEVSSSDMESSAVMMTCASNGYPVIVIRGLSDL-AGAQSGDNTVRKFGSLAATNTA  331

Query  292   KVAVEFIKKV  263
             +  + FIKK+
Sbjct  332   RAVLGFIKKL  341



>gb|KFK30973.1| hypothetical protein AALP_AA6G051900 [Arabis alpina]
Length=337

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 118/313 (38%), Positives = 176/313 (56%), Gaps = 18/313 (6%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTL--IIDYAGRRFRFGTIEGKPVILVM  1019
             I   N+KGPY+G+V     E +  L   +++P      +D +GRRF  G I GK V+ V 
Sbjct  39    IRRVNRKGPYIGLVTVFETEEDGFLSTVNFRPDPFHPFLDLSGRRFLIGKIHGKKVVYVR  98

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
              G+ M+NA   TQ ++ VFDV G+VH+GIAGN N S++IGDV+IP+   +  LW+W    
Sbjct  99    CGIGMVNAAAATQQMIDVFDVKGIVHFGIAGNINNSMSIGDVSIPKQIMNAGLWDWLN--  156

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
                    P +  GD   ++ ++    Y     E N   N+L ++ Y  EE++ V+     
Sbjct  157   -------PDKAKGD---DVAYLDIGNYNVPKGEGN---NMLGSLGYSYEELYSVNGHTNS  203

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
              Q +FW+  +  +  +A  LE +EL  C+N++ CL   PK+    +  +A+I++DNAAYR
Sbjct  204   PQKVFWINTNQEWLHLAADLERMELVQCVNSSLCLPEKPKLVVGLKAATANIFVDNAAYR  263

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
              F+Y+ F VS  +MES++VA+ C     P I+IR LSDL  G     N    F  LAA N
Sbjct  264   IFLYNTFGVSSSDMESSSVAMTCVSNGCPIIVIRGLSDL-AGAQKGDNVVQKFGSLAATN  322

Query  298   SVKVAVEFIKKVP  260
             + K  +EFIKK+P
Sbjct  323   AAKAVLEFIKKLP  335



>gb|KDO47238.1| hypothetical protein CISIN_1g019168mg [Citrus sinensis]
Length=345

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 124/309 (40%), Positives = 177/309 (57%), Gaps = 24/309 (8%)
 Frame = -1

Query  1171  GPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVMTGLAMLN  998
             GPY+G+V+    E + L+    +  ++ I  ID AGRRF  G I+   VI VMTG   +N
Sbjct  54    GPYIGLVMAYPPEESALITSRLFVHNSRIPFIDLAGRRFNVGKIKNVDVIYVMTGEQTVN  113

Query  997   AGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDGPENEL  818
             +GIT Q+LL  FD+ GVVHYG AG++N SL+ GDV++ +Y + T  W W+ +      +L
Sbjct  114   SGITVQILLDAFDIRGVVHYGTAGSSNNSLSFGDVSVMKYVAFTGSWKWKAF-KSETGQL  172

Query  817   PLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHIFWV  638
             P         E+ F  F              NLL  V + P +++      EE   +FW+
Sbjct  173   P---------ELDFGAFNFPVRG-------KNLLAKVEFTPSQLYSAGKPMEE---LFWL  213

Query  637   PVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYDKF  458
             PVDS +F IA  L+ LEL  C+N T CL   PKV    RG++A I+LDNAAYR F++ +F
Sbjct  214   PVDSEWFDIATQLQDLELRRCLNDTYCLPERPKVIVGLRGSTADIFLDNAAYREFLFKQF  273

Query  457   NVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSVKVAVE  278
             NVS V+ ESAA+ + C    VP I+ R +SDL  GG ++   + + I LA+ N+++VA E
Sbjct  274   NVSTVDEESAAIVMACLSNAVPSIVFRGVSDL--GGGSDRLLSISRISLASINALRVAAE  331

Query  277   FIKKVPSPN  251
             FI  +   N
Sbjct  332   FIALIDKNN  340



>ref|XP_006286102.1| hypothetical protein CARUB_v10007645mg [Capsella rubella]
 gb|EOA19000.1| hypothetical protein CARUB_v10007645mg [Capsella rubella]
Length=339

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 117/315 (37%), Positives = 173/315 (55%), Gaps = 22/315 (7%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTL--IIDYAGRRFRFGTIEGKPVILVM  1019
             I   N++G Y+G+V     E +  L    ++P      +D +GRRFR G I  K V+ V 
Sbjct  41    IRRLNRRGTYIGLVTVIETEEDAFLRSVDFRPDPTHPFLDLSGRRFRIGKIHEKKVVYVR  100

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
              G  ++NA   TQ ++ VF+V G+VH+GIAGN N S++IGDV+IP+  ++  LW+W   G
Sbjct  101   CGRGLVNAAAVTQQMIDVFNVKGIVHFGIAGNINNSMSIGDVSIPKQITNAGLWDWLNPG  160

Query  838   D--GPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATP  665
                G  + + L++ G+Y    G                 +N L ++ Y  E+++ V    
Sbjct  161   KTKGGADVVDLDM-GNYNIPQG---------------DGNNELGSLRYGKEQLYSVTGHI  204

Query  664   EERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAA  485
                Q++FW+     +  +A  LE +EL  C+NA+ CL   PK+    +  +A I++DNAA
Sbjct  205   NSPQNVFWINTTQEWLHLAADLEKMELSQCVNASLCLPQKPKLVVGLKAATADIFVDNAA  264

Query  484   YRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAA  305
             YR F+YD F VS  +MES+AVA+ C     P I+IR LSDL   G    N    F  LAA
Sbjct  265   YRKFLYDTFGVSSSDMESSAVAMTCVSNGYPIIVIRGLSDL--AGVGGDNTVHKFGSLAA  322

Query  304   DNSVKVAVEFIKKVP  260
              N+VK  +EFIKK+P
Sbjct  323   TNTVKAVLEFIKKLP  337



>dbj|BAJ97171.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=353

 Score =   206 bits (525),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 120/317 (38%), Positives = 186/317 (59%), Gaps = 26/317 (8%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTL--IIDYAGRRFRFGTIEGKP  1034
             + R  ++ AN++GP +G+V+  + E   L     ++P  +   +D  GRRF  G+I G  
Sbjct  47    RVRQQVDRANRRGPSIGLVMSYVAEDTALQASGYFRPWRVQPFVDLYGRRFHIGSIRGVN  106

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             VI  +TG   LNA +T Q LL VF V G+VHYG AG++N S++ GDV++P+  ++T  W 
Sbjct  107   VIYALTGQRRLNAAVTVQTLLDVFTVSGIVHYGTAGSSNDSMSFGDVSVPKLVAYTGAWT  166

Query  853   WQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVD  674
             W++Y    E           + E+ F +F     NV +    +NLL ++ Y+ EE++ V 
Sbjct  167   WKKYKSLKEA----------STELSFGQF-----NVPD--EGENLLGSLKYRNEELYSVG  209

Query  673   ATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLD  494
                EE   +FW+PVDS +F+IA+ L+ + LE C N T CL  TP+V    +G SA ++LD
Sbjct  210   KPMEE---VFWLPVDSAWFKIAEGLK-VTLERC-NDTFCLPKTPQVVHGLKGASADMFLD  264

Query  493   NAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFID  314
             NA YR F++ +F VS ++ ESAAV +      VP I+ R +SDL   G   +  + + ++
Sbjct  265   NAEYRKFLFREFAVSTIDEESAAVVMTTTSPGVPVIVFRGVSDL--AGGEPTWSSTSLMN  322

Query  313   LAADNSVKVAVEFIKKV  263
             LA+ N++KVAVEFI  +
Sbjct  323   LASINALKVAVEFIATI  339



>ref|XP_004964322.1| PREDICTED: bark storage protein B-like [Setaria italica]
Length=337

 Score =   205 bits (521),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 120/317 (38%), Positives = 185/317 (58%), Gaps = 26/317 (8%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTL--IIDYAGRRFRFGTIEGKP  1034
             + R  ++  N++GP LG+V+  + E   L     + P  +   +D  GRRF  G+I G  
Sbjct  31    RVRWQVDRVNRRGPSLGLVMSYVDEATALQASGYFTPWRVQPFLDLYGRRFHIGSIRGVN  90

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             VI  +TG   LNA +T Q L+ VF V G+VHYG AG++N S++ GDV++P+  ++T  W 
Sbjct  91    VIYALTGQRRLNAAVTVQTLIDVFSVSGIVHYGTAGSSNDSMSFGDVSVPKLVAYTGAWT  150

Query  853   WQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVD  674
             W+++    E+   L              F +Y  N+   N  DNLL ++ ++ EE++ V 
Sbjct  151   WKKFRSPKESSAELS-------------FGEY--NIP--NGGDNLLGSLKFRNEELYSVG  193

Query  673   ATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLD  494
                EE   +FW+PVDS +F+IA+ L+ ++LE C N T CL  TP+V    +G+SA ++LD
Sbjct  194   KPMEE---VFWLPVDSAWFKIAEQLK-VKLERC-NDTFCLPTTPQVVYGLKGSSADMFLD  248

Query  493   NAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFID  314
             NA YR F++ +F VS V+ ESAAV +      VP I+ R +SDL   G   +  + + ++
Sbjct  249   NAEYRKFLFREFGVSTVDEESAAVVMTTTSPGVPVIVFRGVSDL--AGGEPTWSSTSLMN  306

Query  313   LAADNSVKVAVEFIKKV  263
             LA+ N++KVAVEFI  V
Sbjct  307   LASINALKVAVEFIATV  323



>emb|CAB45069.1| putative protein [Arabidopsis thaliana]
 emb|CAB79344.1| putative protein [Arabidopsis thaliana]
Length=329

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 116/318 (36%), Positives = 172/318 (54%), Gaps = 27/318 (8%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYK--PSTLIIDYAGRRFRFGTIEGKP  1034
             K+   I   N++GPY+G+V     E +  L    ++  P+   +D +G+      I GK 
Sbjct  35    KSATTIRKINRRGPYIGLVTVFETEEDAFLGSVDFRLDPTHPFLDLSGK------IHGKK  88

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             V+ V  G+ M+NA   TQ ++ VF V G+VH+GIAGN N S++IGDV+IP+  ++  LW+
Sbjct  89    VVYVRCGIGMVNAAAATQQMIDVFSVKGIVHFGIAGNINNSMSIGDVSIPKQITNAGLWD  148

Query  853   WQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVD  674
             W   G    NE           ++ ++    Y  NV + N   N L  + Y  EE++ V 
Sbjct  149   WLNPGKAKGNE-----------DVAYLDVGNY--NVPQGN---NKLGTIGYSYEELYSVS  192

Query  673   ATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLD  494
                   + +FW+     +  +A  LE +EL  C+NA+ CL + PKV    +  +A I++D
Sbjct  193   GHINSPKKVFWINTTQEWLHLAADLEKMELLQCVNASLCLPNKPKVVVGLKAATADIFVD  252

Query  493   NAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFID  314
             NAAYR+F+YD F VS  +MES+AVA+ C     P I+IR LSDL        N    F  
Sbjct  253   NAAYRNFLYDTFGVSSSDMESSAVAMTCVSNGYPLIVIRGLSDL---AGVGDNTVRKFGS  309

Query  313   LAADNSVKVAVEFIKKVP  260
             LAA N+ K  +EFIKK+P
Sbjct  310   LAATNTAKAVLEFIKKLP  327



>ref|XP_006478936.1| PREDICTED: bark storage protein A-like [Citrus sinensis]
Length=378

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 125/309 (40%), Positives = 177/309 (57%), Gaps = 24/309 (8%)
 Frame = -1

Query  1171  GPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVMTGLAMLN  998
             GPY+G+V+    E + L+    +  ++ I  ID AGRRF  G I+   VI VMTG   +N
Sbjct  87    GPYIGLVMAYPPEESALITSRLFVHNSRIPFIDLAGRRFNVGKIKNVDVIYVMTGEQTVN  146

Query  997   AGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDGPENEL  818
             AGIT Q+LL  FD+ GVVHYG AG++N SL+ GDV++ +  + T  W W+ +      +L
Sbjct  147   AGITVQILLDAFDIRGVVHYGTAGSSNNSLSFGDVSVMKNVAFTGSWKWKAF-KSETGQL  205

Query  817   PLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHIFWV  638
             P         E+ F  F              NLL  V + P +++      EE   +FW+
Sbjct  206   P---------ELDFGAFNFPVRG-------KNLLAKVEFTPSQLYSAGKPMEE---LFWL  246

Query  637   PVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYDKF  458
             PVDS +F IA  L+ LEL  C+N T CL  TPKV    RG++A I+LDNAAYR F++ +F
Sbjct  247   PVDSEWFDIATQLQDLELRRCLNDTYCLPETPKVIVGLRGSTADIFLDNAAYREFLFKQF  306

Query  457   NVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSVKVAVE  278
             NVS V+ ESAA+ + C    VP I+ R +SDL  GG ++   + + I LA+ N+++VA E
Sbjct  307   NVSTVDEESAAIVMACLSNAVPSIVFRGVSDL--GGGSDRLLSISRISLASVNALRVAAE  364

Query  277   FIKKVPSPN  251
             FI  +   N
Sbjct  365   FIALIDKNN  373



>ref|XP_010433778.1| PREDICTED: bark storage protein A-like [Camelina sativa]
Length=340

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/314 (36%), Positives = 172/314 (55%), Gaps = 20/314 (6%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKP--STLIIDYAGRRFRFGTIEGKPVILVM  1019
             I   N++G Y+G+V     E +  L    ++P  +   +D +GRRFR G I  K V+ V 
Sbjct  42    IRKLNRRGTYIGLVTVIETEEDAFLRSVDFRPDPTRPFLDLSGRRFRIGKIHEKKVVYVR  101

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
              G  M+NA   TQ ++ VF+V G+VH+GIAGN N S++IGDV+IP+  ++  LW+W    
Sbjct  102   CGRGMVNAAAVTQQMIDVFNVKGIVHFGIAGNMNNSMSIGDVSIPKQITNAGLWDWLNPN  161

Query  838   DGPENELPLEVN-GDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPE  662
                E E    ++ G Y    G                 +N L ++ Y  E+++ V     
Sbjct  162   KAKEGEDAASLDIGSYNIPQG---------------DGNNELGSLKYGNEQLYSVTGHIN  206

Query  661   ERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAY  482
               Q++FW+     +  +A  LE +EL  C+N++ CL   PK+    +  +A+I++DNAAY
Sbjct  207   SPQNVFWINTTQEWLHLAAGLEKMELSQCVNSSLCLPKKPKLVVGLKAATANIFVDNAAY  266

Query  481   RSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAAD  302
             R+F+++ F VS  +MES+AVA+ C     P I+IR LSDL   G   +N    F  LAA 
Sbjct  267   RNFLHETFGVSSSDMESSAVAMTCASNGYPIIVIRGLSDL--AGVGGANTVHKFGSLAAT  324

Query  301   NSVKVAVEFIKKVP  260
             N+ K  +EFIKK+P
Sbjct  325   NTAKAVLEFIKKLP  338



>gb|EYU38056.1| hypothetical protein MIMGU_mgv1a009527mg [Erythranthe guttata]
Length=339

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 117/328 (36%), Positives = 184/328 (56%), Gaps = 28/328 (9%)
 Frame = -1

Query  1219  LDDGKTRMLIENANKKGPYLGV--VIPN----MFEMNPLLEHSSYKPSTLIIDYAGRRFR  1058
             L+  K+  +I   N++GPYL +  V P      F  +P +  S +      +D +GRRFR
Sbjct  27    LEREKSLAIIREINRRGPYLALITVFPTEEYAFFSSDPFINDSKFP----YVDLSGRRFR  82

Query  1057  FGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQY  878
              G +E K VI V  G+ M+NA   TQ ++ +F++ GV+H+GI+GN N SL IGDV IP+ 
Sbjct  83    VGMVEDKKVIYVRCGVGMVNAASATQQMVDIFNIKGVIHFGISGNTNSSLCIGDVTIPKE  142

Query  877   WSHTALWNWQRYGDG-PENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWY  701
             +++T LW+W +  +  PEN++ +                    N +  N   N L  + Y
Sbjct  143   FANTGLWDWLKSNETIPENDVAV----------------LNIENYNVPNGGYNSLGRIGY  186

Query  700   QPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVER  521
             + E+ +     P   Q + W  V +++ Q+A +L+G++LE C+N++ CL   PKV    R
Sbjct  187   RAEQFYSEGGEPNSAQLMLWFHVTNNWLQLATTLQGMKLERCVNSSLCLDTDPKVVIGLR  246

Query  520   GTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsae  341
             G++A+ ++DNA+YR+F++  F VS  +MES+AV +       P II R LSDLAGG +  
Sbjct  247   GSTANTFVDNASYRNFLFLNFGVSSADMESSAVLMTSLSNGYPAIIFRGLSDLAGGQNGH  306

Query  340   sneaATFIDLAADNSVKVAVEFIKKVPS  257
             +     F  LAA N  KV ++FIK +P+
Sbjct  307   NTVRL-FGSLAASNVAKVVLQFIKLLPN  333



>emb|CDO99837.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 118/319 (37%), Positives = 178/319 (56%), Gaps = 21/319 (7%)
 Frame = -1

Query  1210  GKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTL--IIDYAGRRFRFGTIEGK  1037
             G +  +++  N +GPYLG++     E +   +  ++KP      +D +GRRFR G +  K
Sbjct  37    GSSLTILKEVNLRGPYLGLITVYPPEEDAFFDTGAFKPHQKHPYVDLSGRRFRVGKMGKK  96

Query  1036  PVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALW  857
              VI V  G+ M+NA   TQ +L +FDV GVVH+GIAG+ N S++IGDV IP+ ++   LW
Sbjct  97    KVIYVRCGVGMVNAAAATQQMLDMFDVIGVVHFGIAGSINNSMSIGDVTIPKQFAQAGLW  156

Query  856   NWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPV  677
             +W +    P   +P+   GD+T     + F  Y+    E +   N L ++ Y  E+ F  
Sbjct  157   DWLK----PNATIPV---GDFTE----LDFGAYS----EPSGGYNELGSIGYNTEQFFSK  201

Query  676   DATPEERQHIFWVPVDSHYFQIAQS-LEGLELEGCINATTCLTHTPKVTRVERGTSASIY  500
                P   Q   W  V  ++ ++A + LEG+ LE C+N+++CLT  PK+     G +A I+
Sbjct  202   SGKPNTAQRKLWFHVSKNWLELAHTHLEGMVLEQCVNSSSCLTQRPKLVVGLSGATADIF  261

Query  499   LDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATF  320
             LDNAAY  F+Y  F+VS V+MES AV  + +    P I+IR LSD   G     N   +F
Sbjct  262   LDNAAYGEFLYKTFHVSSVDMESVAVTSLSN--GFPVIVIRGLSD-QAGAQEGQNSIYSF  318

Query  319   IDLAADNSVKVAVEFIKKV  263
               LAA N+ K  V+F+K +
Sbjct  319   GPLAASNAAKAVVQFVKAL  337



>ref|XP_010439052.1| PREDICTED: bark storage protein A [Camelina sativa]
Length=340

 Score =   203 bits (516),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 114/315 (36%), Positives = 173/315 (55%), Gaps = 22/315 (7%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKP--STLIIDYAGRRFRFGTIEGKPVILVM  1019
             I   N++G Y+G+V     E +  L    ++P  +   +D +GRRFR G I  K V+ V 
Sbjct  42    IRKLNRRGTYIGLVTVIETEEDAFLRSVDFRPDPTRPFLDLSGRRFRIGKIHEKKVVYVR  101

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNW--QR  845
              G  M+NA   TQ ++ VF+V G+VH+GIAGN N S++IGDV+IP+  ++  LW+W    
Sbjct  102   CGRGMVNAAAVTQQMIDVFNVKGIVHFGIAGNMNNSMSIGDVSIPKQITNAGLWDWLNPN  161

Query  844   YGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATP  665
                G E+   L++ G+Y    G                 +N L ++ Y  E+++ V    
Sbjct  162   NAKGGEDAASLDI-GNYNIPQG---------------DGNNELGSLRYGQEQLYSVTGHI  205

Query  664   EERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAA  485
                Q++ W+     +  +A  LE +EL  C+NA+ CL   PK+    +  +A+I++DNAA
Sbjct  206   NSPQNVLWINTTQEWLHLAADLEKMELSHCVNASLCLPKKPKLVVGLKAATANIFVDNAA  265

Query  484   YRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAA  305
             YR+F+++ F VS  +MES+AVA+ C     P I+IR LSDL   G   +N    F  LAA
Sbjct  266   YRNFLHETFGVSSSDMESSAVAMTCASNGYPIIVIRGLSDL--AGVGGANTVHKFGSLAA  323

Query  304   DNSVKVAVEFIKKVP  260
              N+ K   EFIKK+P
Sbjct  324   TNTAKAVFEFIKKLP  338



>ref|XP_006655706.1| PREDICTED: bark storage protein A-like [Oryza brachyantha]
Length=344

 Score =   202 bits (515),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 118/317 (37%), Positives = 185/317 (58%), Gaps = 26/317 (8%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKP--STLIIDYAGRRFRFGTIEGKP  1034
             + R  ++  N++GP +G+V+  + E   L     ++P  +   +D  GRRF  G+I G  
Sbjct  38    RVRWQVDRVNRRGPSIGLVMSYIDEATALQSSGYFRPWHALPFVDLYGRRFHIGSIRGVN  97

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             VI  +TG   LNA +T Q L+ VF V G+VHYG AG++N S++ GDV++P++ ++T  W 
Sbjct  98    VIYALTGQRRLNAAVTVQTLIDVFSVSGIVHYGTAGSSNDSMSFGDVSVPKFVAYTGAWT  157

Query  853   WQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVD  674
             W+++    E++           E+ F +F     NV   N  +NLL  + ++ EE++ V 
Sbjct  158   WKKFKSFKESD----------SELSFGEF-----NVP--NGGENLLGALKFRNEELYSVG  200

Query  673   ATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLD  494
                +E   +FW+ VDS +F+IAQ L+ + LE C N T CL  TPKV    +G+SA ++LD
Sbjct  201   KPMKE---VFWLSVDSTWFKIAQELK-VTLERC-NNTFCLPTTPKVVYGLKGSSADMFLD  255

Query  493   NAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFID  314
             NA YR F++ +F VS V+ ESAAV +      +P I+ R +SDL   G   +  + + + 
Sbjct  256   NAEYRKFLFREFGVSTVDEESAAVVMTTTSPGIPVIVFRGVSDL--AGGEPTWSSTSLMK  313

Query  313   LAADNSVKVAVEFIKKV  263
             LA+ N++KVAVEFI  V
Sbjct  314   LASINALKVAVEFIGTV  330



>ref|XP_002533940.1| mta/sah nucleosidase, putative [Ricinus communis]
 gb|EEF28447.1| mta/sah nucleosidase, putative [Ricinus communis]
Length=317

 Score =   201 bits (511),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/267 (39%), Positives = 157/267 (59%), Gaps = 16/267 (6%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKP--STLIIDYAGRRFRFGTIEGKP  1034
             K+  +I   N++GPYLG++     E N      ++KP      +D +GRRFR G I  K 
Sbjct  32    KSLSIIREVNRQGPYLGLITVYPPEENSFFATGAFKPYGKHPFVDLSGRRFRIGKIREKK  91

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             VI V  G+ M+NA   TQ ++ +FDV G+VH+GIAGN N S++IGDV IP+ ++HT +W+
Sbjct  92    VIYVRCGVGMVNAAAATQQMVDMFDVKGIVHFGIAGNVNNSMSIGDVTIPKEFAHTGIWD  151

Query  853   WQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVD  674
             W      P+  LP       + +I  ++F  Y  NV E +   NLL ++ Y  E+ +   
Sbjct  152   WLN----PDETLP-------SNDIAQLEFGNY--NVPEKDGM-NLLGHIGYNYEQFYYES  197

Query  673   ATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLD  494
               P     +FW      + Q+A  LEG+ELE C+N+++CL   PK+    +G++A+I++D
Sbjct  198   GKPNSATPLFWAQTSQAWLQVAAGLEGMELEKCVNSSSCLPQKPKLVVGLKGSTANIFVD  257

Query  493   NAAYRSFIYDKFNVSPVEMESAAVALV  413
             NAAYR F+Y  F VS V MESA+V +V
Sbjct  258   NAAYRDFLYQTFAVSSVAMESASVVMV  284



>ref|NP_001056591.1| Os06g0112100 [Oryza sativa Japonica Group]
 dbj|BAD67777.1| putative vegetative storage protein win4.5 [Oryza sativa Japonica 
Group]
 dbj|BAF18505.1| Os06g0112100 [Oryza sativa Japonica Group]
 gb|EAY99380.1| hypothetical protein OsI_21348 [Oryza sativa Indica Group]
 gb|EAZ35583.1| hypothetical protein OsJ_19869 [Oryza sativa Japonica Group]
 dbj|BAG87891.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96668.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96832.1| unnamed protein product [Oryza sativa Japonica Group]
Length=343

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 115/317 (36%), Positives = 186/317 (59%), Gaps = 26/317 (8%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKP  1034
             + R  ++  N++G  +G+V+  + E   L     ++P  ++  +D  GRR+  G+I G  
Sbjct  37    RVRWQVDKVNRRGHSIGLVMSYIDEATALESSGYFRPWHVLPFVDLYGRRYHIGSIRGVN  96

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             VI  +TG   LNA +T Q L+ VF V G+VHYG AG++N S++ GDV++P++ ++T+ W 
Sbjct  97    VIYALTGQRRLNAAVTVQTLIDVFTVSGIVHYGTAGSSNDSMSFGDVSVPKFVAYTSAWT  156

Query  853   WQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVD  674
             W+++    E++  L   GD+T                  N  +NLL  + ++ EE++ V 
Sbjct  157   WKKFKSPKESDTELSF-GDFTVP----------------NGGENLLGALKFRNEELYSVG  199

Query  673   ATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLD  494
                +E   +FW+PVDS +F+IA+ L+ + LE C N T CL  TPKV    +G+SA ++LD
Sbjct  200   KPMKE---VFWLPVDSAWFKIAEGLK-VSLERC-NDTFCLPTTPKVVCGLKGSSADMFLD  254

Query  493   NAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFID  314
             NA YR F++ +F VS V+ ESAAV +      +P I+ R +SDL   G   +  + + ++
Sbjct  255   NAEYRKFLFREFGVSTVDEESAAVVMTTTSPGIPVIVFRGVSDL--AGGEPTWSSTSLMN  312

Query  313   LAADNSVKVAVEFIKKV  263
             LA+ N++KVAVEFI  V
Sbjct  313   LASINALKVAVEFIATV  329



>emb|CDP19654.1| unnamed protein product [Coffea canephora]
Length=298

 Score =   199 bits (506),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 106/274 (39%), Positives = 156/274 (57%), Gaps = 16/274 (6%)
 Frame = -1

Query  1084  IDYAGRRFRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLN  905
             +D +GRRFR G+I G  VI    G+ M+NA   TQ +L VF + G+VH+GIAGNAN S++
Sbjct  32    VDLSGRRFRVGSIGGSKVIYARCGVGMVNAAAATQQMLDVFRMIGIVHFGIAGNANSSMS  91

Query  904   IGDVAIPQYWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQD  725
             IGDV IP+ ++ T LW+W ++    +  +P         ++  + F  Y    D  N  D
Sbjct  92    IGDVIIPKQFAQTGLWDWVKF----KATIP-------ANDVTELDFGSY----DVPNGGD  136

Query  724   NLLNNVWYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHT  545
             N L ++ Y  E  +     P   +   W     ++ +++ SLEG+ LE C+NA+ CL   
Sbjct  137   NELGSIGYSTEFFYSKSGRPNSPERTLWFQTSQNWLEVSSSLEGMALEQCVNASLCLPEK  196

Query  544   PKVTRVERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSD  365
             PKV     G +A+I++DNAAYR F+Y  F+VS ++MESAA+ + C       I+IRALSD
Sbjct  197   PKVVVGLNGATANIFVDNAAYREFLYTTFHVSSLDMESAAIVMTCLSNGFKVIVIRALSD  256

Query  364   LagggsaesneaATFIDLAADNSVKVAVEFIKKV  263
             LAG    ++     F  LAA N  K  V+F+K +
Sbjct  257   LAGAQDGDNTIRL-FGPLAASNVAKAVVQFVKTL  289



>ref|XP_002520035.1| mta/sah nucleosidase, putative [Ricinus communis]
 gb|EEF42359.1| mta/sah nucleosidase, putative [Ricinus communis]
Length=394

 Score =   201 bits (511),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 118/269 (44%), Positives = 165/269 (61%), Gaps = 22/269 (8%)
 Frame = -1

Query  1069  RRFRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVA  890
             RRF  G I G  VI VMTG  +LNAGIT Q+L+  FD+ G+VHYG AG+AN SL+ GDV+
Sbjct  139   RRFHIGKISGIDVIYVMTGEQILNAGITVQILVDAFDIKGIVHYGTAGSANDSLSFGDVS  198

Query  889   IPQYWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNN  710
             +  Y + T+ W W+ +  G   +LP         E+ F  F     N  E    DNLL  
Sbjct  199   VLNYVALTSSWKWKEFKSG-RGQLP---------ELKFGAF-----NFPE--KGDNLLAK  241

Query  709   VWYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTR  530
             + + P +++    T EE   +FW+P+DS++F+IA  L+ L L+ C+N T CL   PKV  
Sbjct  242   IEFTPTQVYSTGKTMEE---MFWLPIDSNWFKIAFQLQDLNLQQCVNDTYCLPKMPKVVY  298

Query  529   VERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLaggg  350
               RG++A I+L NAAYR F+Y +F+VS V+ ESAA+ +      VP I+ R +SDLAGGG
Sbjct  299   GLRGSTADIFLANAAYREFLYKEFSVSTVDEESAAIVMTSLSNGVPCIVFRGVSDLAGGG  358

Query  349   saesneaATFIDLAADNSVKVAVEFIKKV  263
                S+ + +F  LA+ N++ VA+EFIK V
Sbjct  359   GILSDTSLSF--LASVNALNVAIEFIKLV  385



>gb|ACN25261.1| unknown [Zea mays]
 gb|AFW86167.1| hypothetical protein ZEAMMB73_090894 [Zea mays]
Length=333

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 115/324 (35%), Positives = 185/324 (57%), Gaps = 24/324 (7%)
 Frame = -1

Query  1201  RMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVI  1028
             R  I+  N++GP LG+V+  + E   L     ++P   +  +D  GRR+  G+I G  VI
Sbjct  30    RAAIDRVNRRGPSLGLVMSYVDEATALQASGYFQPWRALPFVDLYGRRYHIGSIRGVNVI  89

Query  1027  LVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQ  848
               +TG   LNA +T Q L+ VF V G+VHYG AG+ N S++ GDV++P+  ++T  W W+
Sbjct  90    YALTGQRRLNAAVTVQTLIDVFSVSGIVHYGTAGSCNDSISFGDVSVPRLVAYTGAWTWK  149

Query  847   RYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDAT  668
             ++        P E + +       + F +Y  NV +    +NLL ++ Y+ EE++     
Sbjct  150   KF------RSPRESSAE-------LSFGEY--NVPDGGGGENLLGSLKYRNEELYSAGKP  194

Query  667   PEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNA  488
              EE   +FW+PV S +F+ A+ L  +ELE C N T CL   P++    +G+SA ++LDNA
Sbjct  195   MEE---VFWLPVHSAWFRTAEQLT-VELERC-NDTFCLPTAPRIVYGLKGSSADMFLDNA  249

Query  487   AYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLA  308
              YR F++ +F VS ++ ESAAV +      +P I+ R +SDL   G   +  + + ++LA
Sbjct  250   EYRKFLFQEFGVSTMDEESAAVVMTATSPGIPVIVFRGVSDL--AGGEPTWSSTSLMNLA  307

Query  307   ADNSVKVAVEFIKKVPSPNRSAGL  236
             + N++KVAVEFI  V   + +A +
Sbjct  308   SINALKVAVEFIAAVGKHSSTASV  331



>ref|XP_011031568.1| PREDICTED: bark storage protein A-like isoform X3 [Populus euphratica]
Length=298

 Score =   197 bits (500),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 103/269 (38%), Positives = 153/269 (57%), Gaps = 25/269 (9%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKP---------STLIIDYAGRRFRFGTIEG  1040
             I+  N+KGPY+G++     E        ++KP         S    D  GRR+R G I G
Sbjct  43    IKQLNRKGPYIGLITVYSPEEEAFFRTGAFKPDAKHPFVDLSGSNYDVEGRRYRVGKING  102

Query  1039  KPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTAL  860
             K V+ V  G+ + NA   TQ +L +FDV G+VH+GI+GN N S++IGDV IP+ ++HT L
Sbjct  103   KKVVFVRCGVGITNAAAVTQQMLDLFDVTGIVHFGISGNVNDSMSIGDVTIPKQFAHTGL  162

Query  859   WNWQRYGDGPENELPLEVNGDYT-REIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIF  683
             WNW            L  NG     ++ +++   Y  NV E +   NLL  + Y  E++F
Sbjct  163   WNW------------LNPNGTMDPADVAYLEVGSY--NVPEGDGV-NLLGQIGYSTEQLF  207

Query  682   PVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASI  503
              V   P     ++W+ V   + Q+A+SLEG+ELE C+N++ CL   PK+    +G S++I
Sbjct  208   SVSREPNTAVSLWWMEVSQQWLQLARSLEGMELEKCVNSSLCLKEKPKLVVGLKGASSNI  267

Query  502   YLDNAAYRSFIYDKFNVSPVEMESAAVAL  416
             +LDNAAYR F++  F VS  +MES+AV +
Sbjct  268   FLDNAAYRDFLFQTFEVSSSDMESSAVVM  296



>ref|XP_003557245.2| PREDICTED: bark storage protein A-like [Brachypodium distachyon]
Length=332

 Score =   197 bits (501),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 123/329 (37%), Positives = 193/329 (59%), Gaps = 32/329 (10%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKP  1034
             + R  ++ AN++GP +G+V+  + E   L     + P  ++  +D  GRRF  G+I G  
Sbjct  26    RVRWQVDRANRRGPSIGLVMSYVAEDTALQASGYFTPWHVLPFVDLYGRRFHIGSIRGVN  85

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             VI  +TG   LNA +T Q LL VF V G+VHYG AG++N S++ GDV++P+  ++T  W 
Sbjct  86    VIYALTGQRRLNAAVTVQTLLDVFTVSGIVHYGTAGSSNDSMSFGDVSVPKLVAYTGAWT  145

Query  853   WQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVD  674
             W++           + + + + E+ F +F     NV   N  +NLL ++ Y+ EE++ V 
Sbjct  146   WKK----------FKSSKESSTELSFGQF-----NVP--NGGENLLGSLKYRNEELYSVG  188

Query  673   ATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLD  494
                EE   +FW+PVDS +F+IA+ L+ + LE C N T CL  TP+V    +G+S+ ++LD
Sbjct  189   KPMEE---VFWLPVDSAWFKIAEGLK-VNLERC-NDTFCLPTTPQVVYGLKGSSSDMFLD  243

Query  493   NAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFID  314
             NA YR+F++ +F VS V+ ESAAV +      VP I+ R +SDL   G   +  + + ++
Sbjct  244   NAEYRNFLFREFGVSTVDEESAAVVMTTTSPGVPVIVFRGVSDL--AGGEPTWSSTSLMN  301

Query  313   LAADNSVKVAVEFI------KKVPSPNRS  245
             LA+ N++KVAVEFI      K  PS + S
Sbjct  302   LASINALKVAVEFITTIGRQKSAPSAHSS  330



>emb|CDO99838.1| unnamed protein product [Coffea canephora]
Length=273

 Score =   195 bits (496),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 104/270 (39%), Positives = 152/270 (56%), Gaps = 16/270 (6%)
 Frame = -1

Query  1072  GRRFRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDV  893
             GRRFR G+I G  VI    G+ M+NA   TQ +L VF V G+VH+GIAGNAN S++IGDV
Sbjct  11    GRRFRVGSIGGSKVIYARCGVGMVNAAAATQQMLDVFRVIGIVHFGIAGNANNSMSIGDV  70

Query  892   AIPQYWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLN  713
              IP+ ++ T LW+W ++    +  +P       T ++  + F  Y    D  N  DN L 
Sbjct  71    IIPKQFAQTGLWDWVKF----KATIP-------TNDVAELDFGSY----DVPNGGDNELG  115

Query  712   NVWYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVT  533
             ++ Y  E  +     P   +   W     ++ +++ SLEG+ LE C+N++ CL   PKV 
Sbjct  116   SIGYSTEFFYSKSGKPNAPERTLWFQTSQNWLEVSSSLEGMALEQCVNSSLCLPEKPKVV  175

Query  532   RVERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagg  353
                 G +A+I++DNAAYR F+Y  F+VS ++MESA + + C       I+IR LSDLAG 
Sbjct  176   VGLNGATANIFVDNAAYREFLYTTFHVSSLDMESAVIVMTCLSNGFKVIVIRGLSDLAGA  235

Query  352   gsaesneaATFIDLAADNSVKVAVEFIKKV  263
                ++     F  LAA N  K  V+F+K +
Sbjct  236   QDGDNTIRL-FGPLAASNVAKAVVQFVKTL  264



>ref|XP_009630340.1| PREDICTED: bark storage protein A-like [Nicotiana tomentosiformis]
Length=343

 Score =   196 bits (497),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 109/315 (35%), Positives = 169/315 (54%), Gaps = 20/315 (6%)
 Frame = -1

Query  1195  LIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTL--IIDYAGRRFRFGTIEGKPVILV  1022
             +I++ NK GP+LG+V     E         ++P      +D +GRRF+ G + GK VI V
Sbjct  39    VIKSVNKNGPFLGLVTVYAPEEEAFFSTGVFRPDPRHPFVDLSGRRFQIGKVAGKKVIYV  98

Query  1021  MTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRY  842
               G+ ++NA   TQ +L +FD+ GV+H+GI+GNAN S++IGDV IP   + T LW+W + 
Sbjct  99    KCGVGLVNAAAATQQMLDLFDIKGVIHFGISGNANSSMHIGDVTIPYQVAQTGLWDWLK-  157

Query  841   GDGPENELPLEVNGDYTREIGFIKFAKYA-TNVDECNSQDNLLNNVWYQPEEIFPVDATP  665
                      LE N           FA++   N +     DN L  V Y  E+ +      
Sbjct  158   -----PNATLEPN----------DFAQFDFKNYNAPKGGDNKLGRVGYSTEQFYSTSGEV  202

Query  664   EERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAA  485
                Q   W  +  ++  +A  L+G++LE C N+T CL   PK+    +G +++ ++DNAA
Sbjct  203   NVPQRPVWFNITKNWLHVASHLQGMKLEQCANSTLCLPQKPKLVVGLKGATSNFFIDNAA  262

Query  484   YRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAA  305
             Y  F++  F V+ ++MES+AV + C     P I+IR +SDLAG    ++     F  LAA
Sbjct  263   YTDFLFKTFGVTSLDMESSAVVMTCLSNGYPVIVIRGVSDLAGTQEGDNTIRL-FGPLAA  321

Query  304   DNSVKVAVEFIKKVP  260
              N+ KV + F+K +P
Sbjct  322   LNTAKVVIRFVKSLP  336



>ref|XP_007029595.1| Phosphorylase superfamily protein [Theobroma cacao]
 gb|EOY10097.1| Phosphorylase superfamily protein [Theobroma cacao]
Length=386

 Score =   196 bits (497),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 119/316 (38%), Positives = 179/316 (57%), Gaps = 25/316 (8%)
 Frame = -1

Query  1201  RMLIENANKKG-PYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPV  1031
             R +++  N  G PY+G+V+    E   L +   + P++ I  I  AGRRF  G+I G  V
Sbjct  84    RGVVDKVNDGGGPYVGLVMAYPTEEMALQDSGFFLPNSDIPSIQLAGRRFNIGSINGVDV  143

Query  1030  ILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNW  851
             I VMTG    NA +T Q LL  FD+ G+VHYG AG+ N SL+ GDV++  Y + T+ W W
Sbjct  144   IYVMTGEQTANAALTVQALLDAFDIQGIVHYGTAGSTNDSLSFGDVSVMNYVAFTSSWKW  203

Query  850   QRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDA  671
             + +    + +LP       T   G   F +           +NLL  + + P +++   +
Sbjct  204   KEF-KSEKGQLP-------TLTFGAFNFPEKG---------ENLLAKIEFTPVQLY---S  243

Query  670   TPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDN  491
             T +  + ++W+PVD ++F IA  L+ L L+ C+N T CL  TPKV    +G++A I+LDN
Sbjct  244   TGKPMEEMYWLPVDPNWFTIAAQLQNLTLQQCVNDTYCLPETPKVVYGLKGSTADIFLDN  303

Query  490   AAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDL  311
             AAYR +++ +FNVS V+ ESAA+ L C    VP I+ R +SDLAGG    S  + + +  
Sbjct  304   AAYRKYLFQQFNVSTVDEESAAIVLTCLTNGVPCIVFRGVSDLAGGNGTLSLASLSSLAS  363

Query  310   AADNSVKVAVEFIKKV  263
                N++ VAVEFI  +
Sbjct  364   I--NALTVAVEFISLI  377



>ref|XP_004250013.1| PREDICTED: bark storage protein A-like [Solanum lycopersicum]
Length=343

 Score =   194 bits (494),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 106/314 (34%), Positives = 170/314 (54%), Gaps = 18/314 (6%)
 Frame = -1

Query  1195  LIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTL--IIDYAGRRFRFGTIEGKPVILV  1022
             +++  NK GP+LG++     E     +   ++P      +D +GRRFR G +EGK VI V
Sbjct  39    VVKKVNKNGPFLGLITVYAPEEEAFFKTGVFRPDPRHPFVDLSGRRFRIGKVEGKKVIYV  98

Query  1021  MTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRY  842
               G+ ++NA   TQ +L +FD+ G++H+GI+GNAN S+ IGDV IP   +   LW+W + 
Sbjct  99    KCGVGLVNAAAATQQMLDLFDIKGIIHFGISGNANSSMQIGDVTIPGQLAQAGLWDWLK-  157

Query  841   GDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPE  662
                      +E N D+ +      F  Y    ++    +N L  V Y  E+ + V     
Sbjct  158   -----PNATMEPN-DFAQ----FNFKSY----NDPKGGENQLGKVGYSTEQFYSVAGEVN  203

Query  661   ERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAY  482
               Q   W  + +++  +A  L G+ L+ C N+T CL   PK+    +G +++ ++DNAAY
Sbjct  204   VPQRPVWFNITNNWLHLASHLHGINLDQCANSTLCLPEKPKLVVGLKGATSNFFIDNAAY  263

Query  481   RSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAAD  302
               F+++ F V+ ++MES+AV + C     P I IR LSDLAG    ++     F  LAA 
Sbjct  264   TQFLFNTFGVTSLDMESSAVVMTCLSNGYPVIAIRGLSDLAGTQKGDNTIRL-FGSLAAL  322

Query  301   NSVKVAVEFIKKVP  260
             N+ KV ++F+K +P
Sbjct  323   NTAKVVIDFVKSLP  336



>ref|XP_003637891.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Medicago 
truncatula]
Length=187

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 129/177 (73%), Gaps = 1/177 (1%)
 Frame = -1

Query  802  GDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHIFWVPVDSH  623
            GD+  E+G++KF+ Y        S++NLLN VWYQPE IFPVD TPE  Q +FWVPVD  
Sbjct  9    GDFGTELGYLKFSNYNNYTKHSKSEENLLNKVWYQPERIFPVDGTPEVWQPVFWVPVDKT  68

Query  622  YFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYDKFNVSPV  443
            YF+IA+ L+ +EL  C+N TTCL   P V RV++G +A+I++DN AYR  +  KF+ +P 
Sbjct  69   YFEIARKLKNVELSSCVN-TTCLPRKPIVVRVKKGVTANIFVDNKAYRDHLNCKFDATPT  127

Query  442  EMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSVKVAVEFI  272
            +MESAAVALVC Q K+P+I IRALSD AGGGSA SNEA+ F+ LA+ N+  V V+FI
Sbjct  128  DMESAAVALVCFQHKIPFIAIRALSDFAGGGSALSNEASIFLSLASQNAFHVLVKFI  184



>ref|XP_009787066.1| PREDICTED: bark storage protein A-like [Nicotiana sylvestris]
Length=343

 Score =   194 bits (493),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 109/315 (35%), Positives = 168/315 (53%), Gaps = 20/315 (6%)
 Frame = -1

Query  1195  LIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTL--IIDYAGRRFRFGTIEGKPVILV  1022
             +I++ NK GP+LG++     E         ++P      +D +GRRF+ G + GK  I V
Sbjct  39    VIKSVNKNGPFLGLITVYAPEEEAFFSTGVFRPDPRHPFVDLSGRRFQIGKVAGKKAIYV  98

Query  1021  MTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRY  842
               G+ ++NA   TQ +L +FD+ GV+H+GI+GNAN S++IGDV IP   + T LW+W + 
Sbjct  99    KCGVGLVNAAAATQQMLDLFDIKGVIHFGISGNANSSMHIGDVTIPYQIAQTGLWDWLK-  157

Query  841   GDGPENELPLEVNGDYTREIGFIKFAKYA-TNVDECNSQDNLLNNVWYQPEEIFPVDATP  665
                      LE N           FA++   N +     DN L  V Y  E+ +      
Sbjct  158   -----PNATLEPN----------DFAQFDFKNYNVPKGGDNKLGRVGYSTEQFYSTSGEV  202

Query  664   EERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAA  485
                Q   W  +  ++F +A  L+GL+LE C N+T CL   PK+    +G +++ ++DNAA
Sbjct  203   NVPQRPVWFNITKNWFNVASHLQGLKLEQCANSTLCLPQIPKLVVGLKGATSNFFIDNAA  262

Query  484   YRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAA  305
             Y  F++  F V+ ++MES+AV + C     P I IR +SDLAG    ++     F  LAA
Sbjct  263   YTDFLFKTFGVTSLDMESSAVVMTCLSNGYPVIAIRGVSDLAGTQEGDNTIRL-FGPLAA  321

Query  304   DNSVKVAVEFIKKVP  260
              N+ KV + F+K +P
Sbjct  322   LNTAKVVISFVKSLP  336



>ref|XP_006360498.1| PREDICTED: bark storage protein A-like [Solanum tuberosum]
Length=343

 Score =   194 bits (493),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 106/314 (34%), Positives = 170/314 (54%), Gaps = 18/314 (6%)
 Frame = -1

Query  1195  LIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTL--IIDYAGRRFRFGTIEGKPVILV  1022
             +++  NK GP+LG++     E     +   + P+     +D +GRRFR G +EGK VI V
Sbjct  39    VVKKVNKNGPFLGLITVYAPEEEAFFKTGVFTPNRRHPFVDLSGRRFRIGKVEGKKVIYV  98

Query  1021  MTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRY  842
               G+ ++NA   TQ +L +FD+ G++H+GI+GNAN S+ IGDV IP   + T LW+W + 
Sbjct  99    KCGVGLVNAAAATQQMLDLFDIKGIIHFGISGNANSSMQIGDVTIPGQLAQTGLWDWLK-  157

Query  841   GDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPE  662
                      +E N D+ +      F  Y    ++    +N L  V Y  E+ +       
Sbjct  158   -----PNATMEPN-DFAQ----FDFKSY----NDPKGGENQLGKVGYSTEQFYSAAGEVN  203

Query  661   ERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAY  482
               Q   W  + +++  +A  L+G++L+ C N+T CL   PK+    +G +++ ++DNAAY
Sbjct  204   VPQRPVWFNITNNWLHVASHLQGVKLDQCANSTLCLPEKPKLAVGLKGATSNFFIDNAAY  263

Query  481   RSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAAD  302
               F++  F V+ ++MES+AV + C     P I IR LSDLAG    ++     F  LAA 
Sbjct  264   TQFLFKTFGVTSLDMESSAVVMTCLSNGYPVIAIRGLSDLAGTQKGDNTIRL-FGSLAAL  322

Query  301   NSVKVAVEFIKKVP  260
             N+ KV + F+K +P
Sbjct  323   NTAKVVIGFVKSLP  336



>ref|XP_010448575.1| PREDICTED: bark storage protein A-like isoform X2 [Camelina sativa]
Length=327

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 112/319 (35%), Positives = 168/319 (53%), Gaps = 35/319 (11%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKP--STLIIDYAGRRFRFGTIEGKP  1034
             ++ + I   N++GPY+G+V     E +  L    ++P  +   +D +GRRFR G I GK 
Sbjct  34    ESAITIRKVNRRGPYIGLVTVFETEEDAFLGSVDFRPDPTRPFMDLSGRRFRIGKIHGKK  93

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             V+ V  G+ M+NA   TQ ++ VF+V G+VH+GIAGN N S++IGD             N
Sbjct  94    VVYVRCGIGMVNAAAATQQMIDVFNVKGIVHFGIAGNINNSMSIGD-------------N  140

Query  853   WQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVD  674
               +   G               ++ ++    Y  NV   + + N L  + Y  EE++ V+
Sbjct  141   PDKAKGG--------------EDVAYLDVGNY--NVPRGDGK-NELGTIGYSYEELYSVN  183

Query  673   ATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLD  494
                   Q +FW+     +  +A  LE +EL  C+NA+ CL   PK+    +  +A I++D
Sbjct  184   GPINSPQKVFWINTTQEWLHLAAGLEKMELLQCVNASLCLPEKPKLVVGLKAATADIFVD  243

Query  493   NAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFID  314
             NAAYR+F+Y+ F VS  +MES+AVA+ C     P I+IR LSDL        N    F  
Sbjct  244   NAAYRTFLYNSFGVSSSDMESSAVAMTCVSNGYPIIVIRGLSDL---AGVGDNTVRKFGS  300

Query  313   LAADNSVKVAVEFIKKVPS  257
             LAA N+ K  +EFIKK+PS
Sbjct  301   LAATNTAKAVLEFIKKLPS  319



>emb|CDI41123.1| putative bark storage protein, partial [Olea europaea]
Length=142

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 103/140 (74%), Gaps = 0/140 (0%)
 Frame = -1

Query  781  GFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQS  602
            G+++FA Y    +   S DN LN VWYQPEEIF  D  PE R+H FWVP+D HY+ +A++
Sbjct  1    GYLRFADYQVRKEGEKSSDNYLNRVWYQPEEIFYGDGEPEIREHAFWVPIDKHYYSLAKN  60

Query  601  LEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAV  422
            LE + LE C+N++ CL   PKV RV RG SA++++DNAAYR F+  KF  +PV+MESAAV
Sbjct  61   LENIVLERCVNSSLCLPQPPKVVRVRRGVSANVFVDNAAYREFLNSKFKATPVDMESAAV  120

Query  421  ALVCHQQKVPYIIIRALSDL  362
            ALVC QQK P+I IRA+S+L
Sbjct  121  ALVCRQQKTPFIAIRAISNL  140



>ref|XP_010054874.1| PREDICTED: uncharacterized protein LOC104443237 [Eucalyptus grandis]
Length=164

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 106/141 (75%), Gaps = 3/141 (2%)
 Frame = -1

Query  1231  NGSLLDDGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFG  1052
             NG+L     T   I  AN  GPY+G+VIPN+FEM PL+  SSY  +  IID++GRR+RFG
Sbjct  23    NGTL--PAATLEAIAKANANGPYIGIVIPNLFEMGPLINSSSYSAAE-IIDFSGRRYRFG  79

Query  1051  TIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWS  872
             T+E + VILVMTGL+++NA ITTQLLLS FDV GV+HYGIAGNANP L+IGDVAIPQYW+
Sbjct  80    TVEERKVILVMTGLSVINAAITTQLLLSFFDVEGVIHYGIAGNANPDLHIGDVAIPQYWA  139

Query  871   HTALWNWQRYGDGPENELPLE  809
             HT LWNWQ +      +L + 
Sbjct  140   HTGLWNWQWFSKYTRKKLSMR  160



>ref|XP_008367694.1| PREDICTED: uncharacterized protein LOC103431323 [Malus domestica]
 ref|XP_008367695.1| PREDICTED: uncharacterized protein LOC103431323 [Malus domestica]
Length=152

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFGTIEGKPVI  1028
             +T+MLIE AN  GPYLG+ IPN +EM+ LL+  ++  S L ID++GRR RFGTI  KPVI
Sbjct  29    ETQMLIEEANMSGPYLGLAIPNYYEMDHLLQSPNFTSSNLFIDFSGRRLRFGTIANKPVI  88

Query  1027  LVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQ  848
             LVMTGL+M+NA ITTQLLLS FD+ GVVHYGIAG+ANPSLN+  V IPQYWSH+ALW+WQ
Sbjct  89    LVMTGLSMINAAITTQLLLSPFDIEGVVHYGIAGHANPSLNLAHVVIPQYWSHSALWSWQ  148



>ref|XP_008367687.1| PREDICTED: uncharacterized protein LOC103431319 [Malus domestica]
 ref|XP_008367688.1| PREDICTED: uncharacterized protein LOC103431319 [Malus domestica]
Length=152

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFGTIEGKPVI  1028
             +T+MLIE AN  GPYL   IPN +EM+ LL+  ++  S L ID++GRR RFGTI  KPVI
Sbjct  29    ETQMLIEEANMSGPYLXJXIPNXYEMDXLLQSPNFTSSNLFIDFSGRRLRFGTIANKPVI  88

Query  1027  LVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQ  848
             LVMTGL+M+NA ITTQLLLS FD+ GVVHYGIAG+ANPSLN+  V IPQYWSH+ALW+WQ
Sbjct  89    LVMTGLSMINAAITTQLLLSXFDIEGVVHYGIAGHANPSLNLAHVVIPQYWSHSALWSWQ  148



>gb|KCW78221.1| hypothetical protein EUGRSUZ_D02406 [Eucalyptus grandis]
Length=169

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 103/130 (79%), Gaps = 3/130 (2%)
 Frame = -1

Query  1231  NGSLLDDGKTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFG  1052
             NG+L     T   I  AN  GPY+G+VIPN+FEM PL+  SSY  +  IID++GRR+RFG
Sbjct  23    NGTL--PAATLEAIAKANANGPYIGIVIPNLFEMGPLINSSSYSAAE-IIDFSGRRYRFG  79

Query  1051  TIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWS  872
             T+E + VILVMTGL+++NA ITTQLLLS FDV GV+HYGIAGNANP L+IGDVAIPQYW+
Sbjct  80    TVEERKVILVMTGLSVINAAITTQLLLSFFDVEGVIHYGIAGNANPDLHIGDVAIPQYWA  139

Query  871   HTALWNWQRY  842
             HT LWNWQ +
Sbjct  140   HTGLWNWQVF  149



>gb|AFP49328.1| hypothetical protein, partial [Olea europaea]
Length=189

 Score =   179 bits (455),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 114/168 (68%), Gaps = 2/168 (1%)
 Frame = -1

Query  775  IKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLE  596
            +K   Y    +   S DN LN VWYQPEEIF  D  PE R+H FW+P+D HY+ +A+ LE
Sbjct  4    LKXXXYQVRKEGEQSSDNYLNRVWYQPEEIFYADGEPEIREHAFWIPIDKHYYSLAKKLE  63

Query  595  GLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVAL  416
             + LE C+N++ CL   PKV RV RG SA++++DNAAYR F+  KF  +PV+MESAAVAL
Sbjct  64   NIVLERCVNSSLCLPQPPKVVRVRRGVSANVFVDNAAYREFLNSKFKATPVDMESAAVAL  123

Query  415  VCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSVKVAVEFI  272
            VC QQK+P+I IRA+S+L   G   S + + F  L   N+++VA+ FI
Sbjct  124  VCRQQKMPFIAIRAISNL--AGGTSSIDESAFSSLIVQNTIRVALNFI  169



>ref|XP_002272967.3| PREDICTED: bark storage protein A-like [Vitis vinifera]
Length=394

 Score =   185 bits (470),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 115/311 (37%), Positives = 175/311 (56%), Gaps = 26/311 (8%)
 Frame = -1

Query  1195  LIENANKK-GPYLGVVIPNMFEMNPLLEHSSYKPST--LIIDYAGRRFRFGTIEGKPVIL  1025
             ++E  N++ GP++G+++    E   L     + PS+   ++  AGRRF  G I+G  VI 
Sbjct  95    VVERVNERNGPFVGLLMTYPTEEIALQVSGFFVPSSDFPLVQLAGRRFNIGKIKGVDVIY  154

Query  1024  VMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQR  845
             VM+G   LNAGIT QLL+  FDV G+VHYGIAG+ N SL IGDV++P+Y + T+ W W++
Sbjct  155   VMSGEQTLNAGITVQLLIDTFDVVGIVHYGIAGSTNDSLLIGDVSVPKYVAQTSSWKWKK  214

Query  844   YGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATP  665
             +    +  LP    GDY   I                  +NLL  + +   +++   +T 
Sbjct  215   F-KSKKGALPELKFGDYNLPI----------------KGENLLAEIEFTQVQLY---STG  254

Query  664   EERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAA  485
                Q +FW+  D  +F +A  L+ ++L+ C+N T CL+  PKV    RG+SA I++DNAA
Sbjct  255   RPMQELFWLETDPKWFNLATQLQEVDLQQCLNETYCLSEKPKVAYGLRGSSADIFVDNAA  314

Query  484   YRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAA  305
             Y  F++   N+S V+ ESAAV +      VP ++ R +SD           +++   LAA
Sbjct  315   YNEFLFKTLNISTVDEESAAVVMASMSNGVPSVVFRGISD---TAGDGGTLSSSIFSLAA  371

Query  304   DNSVKVAVEFI  272
              N+V+VAVEFI
Sbjct  372   TNAVRVAVEFI  382



>emb|CBI26508.3| unnamed protein product [Vitis vinifera]
Length=412

 Score =   186 bits (471),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 115/311 (37%), Positives = 175/311 (56%), Gaps = 26/311 (8%)
 Frame = -1

Query  1195  LIENANKK-GPYLGVVIPNMFEMNPLLEHSSYKPST--LIIDYAGRRFRFGTIEGKPVIL  1025
             ++E  N++ GP++G+++    E   L     + PS+   ++  AGRRF  G I+G  VI 
Sbjct  113   VVERVNERNGPFVGLLMTYPTEEIALQVSGFFVPSSDFPLVQLAGRRFNIGKIKGVDVIY  172

Query  1024  VMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQR  845
             VM+G   LNAGIT QLL+  FDV G+VHYGIAG+ N SL IGDV++P+Y + T+ W W++
Sbjct  173   VMSGEQTLNAGITVQLLIDTFDVVGIVHYGIAGSTNDSLLIGDVSVPKYVAQTSSWKWKK  232

Query  844   YGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATP  665
             +    +  LP    GDY   I                  +NLL  + +   +++   +T 
Sbjct  233   FKSK-KGALPELKFGDYNLPI----------------KGENLLAEIEFTQVQLY---STG  272

Query  664   EERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAA  485
                Q +FW+  D  +F +A  L+ ++L+ C+N T CL+  PKV    RG+SA I++DNAA
Sbjct  273   RPMQELFWLETDPKWFNLATQLQEVDLQQCLNETYCLSEKPKVAYGLRGSSADIFVDNAA  332

Query  484   YRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAA  305
             Y  F++   N+S V+ ESAAV +      VP ++ R +SD           +++   LAA
Sbjct  333   YNEFLFKTLNISTVDEESAAVVMASMSNGVPSVVFRGISD---TAGDGGTLSSSIFSLAA  389

Query  304   DNSVKVAVEFI  272
              N+V+VAVEFI
Sbjct  390   TNAVRVAVEFI  400



>emb|CDP19657.1| unnamed protein product [Coffea canephora]
Length=281

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 105/304 (35%), Positives = 163/304 (54%), Gaps = 36/304 (12%)
 Frame = -1

Query  1168  PYLGVVIPNMFEMNPLLEHSSYK--PSTLIIDYAGRRFRFGTIEGKPVILVMTGLAMLNA  995
             PYLG++     E +      ++K  P    ++ +GRRFR G+IEG  VI V  G+ M+NA
Sbjct  3     PYLGLITVYSPEEDAFFATGAFKHNPKHPFVNLSGRRFRVGSIEGSKVIYVRCGVGMVNA  62

Query  994   GITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDGPENELP  815
                TQ +L VF + G+V++GIAGN N S+++GDV IP+ ++ T LW+W ++    +  +P
Sbjct  63    AAATQQMLDVFRMIGIVNFGIAGNVNCSMSMGDVIIPKQFAQTGLWDWVKF----KATIP  118

Query  814   LEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHIFWVP  635
                    T ++  + F     + D  N  DN L ++                     W  
Sbjct  119   -------TNDVAELDFG----SCDVPNGGDNELGSI------------------GTLWFQ  149

Query  634   VDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYDKFN  455
                ++ +++ SLEG+ LE C+N++ CL   PKV     G +A+I++DNAAYR F+Y  F+
Sbjct  150   TSQNWLEVSSSLEGMALEQCVNSSLCLPEKPKVVVGLNGATANIFVDNAAYREFLYTTFH  209

Query  454   VSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSVKVAVEF  275
             VS ++MESA + + C       I+IR LSDLAG    ++     F  LAA N  K  V+F
Sbjct  210   VSSLDMESAVIVMTCLSNGFKVIVIRGLSDLAGAQDGDNTIRL-FGPLAASNVAKAVVQF  268

Query  274   IKKV  263
             +K +
Sbjct  269   VKTL  272



>gb|AFK43228.1| unknown [Medicago truncatula]
Length=152

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFGTIEGKPVILVMTG  1013
             I   N++GPYLG++IPN FE+NPLL++  Y PS  IID+AGRRFRFG+I  KPVILVMTG
Sbjct  39    IAKINEEGPYLGLIIPNSFELNPLLQNPGYTPSDGIIDFAGRRFRFGSIGEKPVILVMTG  98

Query  1012  LAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNW  851
             L+++NA ITTQLLLS F V GVVHYGIAGNANPSL+IGDVAIP YW+H ALW+W
Sbjct  99    LSVINAAITTQLLLSFFKVDGVVHYGIAGNANPSLHIGDVAIPHYWAHLALWSW  152



>ref|XP_006379492.1| hypothetical protein POPTR_0008s02880g [Populus trichocarpa]
 gb|ERP57289.1| hypothetical protein POPTR_0008s02880g [Populus trichocarpa]
Length=233

 Score =   179 bits (453),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 99/243 (41%), Positives = 143/243 (59%), Gaps = 19/243 (8%)
 Frame = -1

Query  976  LLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDGPENELPLEVNGD  797
            +L +FDV G+VH+GI+GN N S++IGDV IP+ ++HT LWNW            L  NG 
Sbjct  1    MLDLFDVTGIVHFGISGNVNDSMSIGDVTIPKQFAHTGLWNW------------LNPNGT  48

Query  796  YT-REIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHIFWVPVDSHY  620
                ++ +++   Y  NV E +   NLL  + Y  E++F V   P     ++W+ V   +
Sbjct  49   MDPADVAYLEVGSY--NVPEGDGV-NLLGQIGYSTEQLFSVSREPNTAVSLWWMEVSQQW  105

Query  619  FQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYDKFNVSPVE  440
             Q+A+SLEG+ELE C+N++ CL   PK+    +G +++I+LDNAAYR F++  F VS  +
Sbjct  106  LQLARSLEGMELEKCVNSSLCLPEKPKLVVGLKGATSNIFLDNAAYRDFLFQTFEVSSSD  165

Query  439  MESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSVKVAVEFIKKVP  260
            MES+AV   C     P I+IR LSDL  G  +  N   TF  LAA N+ K  +EFI K+P
Sbjct  166  MESSAV--TCLSNGFPVIVIRGLSDL-AGAESGDNAIHTFGSLAALNAAKAVLEFISKLP  222

Query  259  SPN  251
              N
Sbjct  223  GYN  225



>ref|XP_010671111.1| PREDICTED: bark storage protein A-like [Beta vulgaris subsp. 
vulgaris]
Length=332

 Score =   179 bits (454),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 108/310 (35%), Positives = 171/310 (55%), Gaps = 25/310 (8%)
 Frame = -1

Query  1195  LIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPST--LIIDYAGRRFRFGTIEGKPVILV  1022
             ++++ N++G YLG+ +    E NPL     + P+    I++ AGR+F  GTI+G  VI V
Sbjct  34    VVDSINRRGSYLGLALAFPAEGNPLHASGLFIPTQNHPIVEIAGRKFNVGTIKGVKVIYV  93

Query  1021  MTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRY  842
             +TG   +NA I    LL  F++ G+V+YG+AG AN S+++GDV IP  ++ T+ W W  +
Sbjct  94    VTGEKGVNAAIGIHTLLQNFNIKGLVYYGMAGCANISMSVGDVGIPYQFAFTSSWRWLEF  153

Query  841   GDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPE  662
             G    +E  L+             F  Y    +      NLL  +  +P E+    +  +
Sbjct  154   GATDTDEKQLD-------------FGAY----NLPRPGKNLLEKLLPEPVELL---SDGK  193

Query  661   ERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAY  482
             E +  +W PVD H++++A  L+G++L+ C+NATTCL + P+V    RG+++ I++ N  Y
Sbjct  194   EVREQYWFPVDPHWYKLASQLQGVKLDRCVNATTCLPYQPQVVYGVRGSTSDIFMSNLEY  253

Query  481   RSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAAD  302
               F+  +  VS V+ ESAAV        VP I+ R +SD+AG         +    LAA 
Sbjct  254   AKFLIKEHGVSTVDEESAAVVHASLTNGVPVIVFRGISDVAGKQHISVAGISA---LAAT  310

Query  301   NSVKVAVEFI  272
             NS KVA++FI
Sbjct  311   NSFKVAMKFI  320



>gb|EMS45486.1| Bark storage protein A [Triticum urartu]
Length=339

 Score =   178 bits (452),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 115/326 (35%), Positives = 177/326 (54%), Gaps = 44/326 (13%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTL--IIDYAGR---------RF  1061
             + R  ++ AN+ GP +G+V+  + E   L     ++P  +   +D  G          RF
Sbjct  33    RVRQQVDRANRHGPSIGLVMSYVAEDTALQASGYFRPWRVQPFVDLYGESPPPVSDPNRF  92

Query  1060  RFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQ  881
             R      K           LNA +T Q LL VF V G+VHYG AG++N S++ GDV++P+
Sbjct  93    RLSCRLSK---------QWLNAAVTVQTLLDVFTVSGIVHYGTAGSSNDSMSFGDVSVPK  143

Query  880   YWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWY  701
               ++T  W W++Y    E           + E+ F +F     NV   N  +NLL ++ Y
Sbjct  144   LVAYTGAWTWKKYKSLKEE----------STELNFGQF-----NVP--NGGENLLGSLKY  186

Query  700   QPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVER  521
             + EE++ V    EE   +FW+PVDS +F+IA+ L+ + LE C N T CL  TP+V    +
Sbjct  187   RNEELYSVGKPMEE---VFWLPVDSAWFKIAEGLK-VNLERC-NDTFCLPKTPQVVHGLK  241

Query  520   GTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsae  341
             G SA ++LDNA YR F++ +F VS ++ ESAAV +      VP I+ R +SDL   G   
Sbjct  242   GASADMFLDNAEYRKFLFREFAVSTIDEESAAVVMTTTSPGVPVIVFRGVSDL--AGGEP  299

Query  340   sneaATFIDLAADNSVKVAVEFIKKV  263
             +  + + ++LA+ N++KVAVEFI  +
Sbjct  300   TWSSTSLMNLASINALKVAVEFIATI  325



>ref|NP_001119043.1| phosphorylase family protein [Arabidopsis thaliana]
 gb|AEE84893.1| phosphorylase family protein [Arabidopsis thaliana]
Length=242

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/248 (38%), Positives = 142/248 (57%), Gaps = 16/248 (6%)
 Frame = -1

Query  1003  LNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDGPEN  824
             +N    TQ ++ VF+V G+VH+GIAGN N S++IGDV+IP+  ++  LW+W         
Sbjct  9     VNGAAATQQMIDVFNVKGIVHFGIAGNMNNSMSIGDVSIPKQITNAGLWDWLN-------  61

Query  823   ELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHIF  644
               P +V G    +I ++    Y  NV + +  DN L ++ Y  E+++ V       Q++F
Sbjct  62    --PDKVKG--VEDIAYLDVGNY--NVPKGDG-DNELGSIGYNYEQLYSVTGHINAPQNVF  114

Query  643   WVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYD  464
             W+     +  +A  LE +EL  C+NA+ CL   PK+    +  +A I++DNAAYR+F+YD
Sbjct  115   WINTTQEWLHLAADLEKMELSQCVNASLCLPKKPKLVVGLKAATAYIFVDNAAYRNFLYD  174

Query  463   KFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSVKVA  284
              F VS  +MES+AVA+ C     P I+IR LSDL   G    N    F  LAA N+ K  
Sbjct  175   TFGVSSSDMESSAVAMTCASNGYPIIVIRGLSDL--AGEGGDNTVHKFGSLAATNTAKAV  232

Query  283   VEFIKKVP  260
             +EFI+K+P
Sbjct  233   LEFIRKLP  240



>ref|XP_008233238.1| PREDICTED: bark storage protein A-like isoform X2 [Prunus mume]
Length=261

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 98/256 (38%), Positives = 147/256 (57%), Gaps = 17/256 (7%)
 Frame = -1

Query  1003  LNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDGPEN  824
             +NA   TQ +L +FD+ G+VH+GIAGNAN SL+IGDV IPQ ++HT +W+W      P  
Sbjct  17    VNAAAATQQMLDLFDILGIVHFGIAGNANSSLSIGDVTIPQQFAHTGIWDWLN----PNR  72

Query  823   ELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHIF  644
              L  +       ++  + F +Y  NV      DNLL ++ +  E+ F         + +F
Sbjct  73    SLNYD-------QVANLDFKRY--NVPR---GDNLLGHIVFSYEQFFAEYGKANTARPLF  120

Query  643   WVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYD  464
             W      + Q+A +++G++L  C+N++ CL   P++    RG++A+I++DNAAYR F++ 
Sbjct  121   WANTTRQWLQVAANMKGIKLNQCLNSSVCLPQKPQLVVGLRGSTANIFVDNAAYRDFLFQ  180

Query  463   KFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSVKVA  284
              F VS V+MES+AV +       P I+IR LSDL  GG A  N    F  LAA N+ KV 
Sbjct  181   TFQVSSVDMESSAVVMTSLSNGFPVIVIRGLSDL-AGGQAGHNSIDIFGSLAAINACKVV  239

Query  283   VEFIKKVPSPNRSAGL  236
             V+FIK++    R  G 
Sbjct  240   VQFIKQLHLDTREPGF  255



>ref|XP_009138096.1| PREDICTED: uncharacterized protein LOC103862140 [Brassica rapa]
Length=277

 Score =   171 bits (434),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 114/151 (75%), Gaps = 1/151 (1%)
 Frame = -1

Query  712  NVWYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVT  533
             +WYQPEEIFPV  TPE R+H FWVPVD ++  IA  LE  +L  C+N TTCL   PKVT
Sbjct  118  RIWYQPEEIFPVTGTPEVREHAFWVPVDEYFLDIASKLENTKLPQCVN-TTCLPRPPKVT  176

Query  532  RVERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagg  353
             V++G SAS+++DNAAYR+F+  KFN + VEMESAA+AL+ H+Q +P+I+IRALSDLAGG
Sbjct  177  IVDKGVSASVFVDNAAYRTFLRSKFNATAVEMESAAIALISHEQNIPFIVIRALSDLAGG  236

Query  352  gsaesneaATFIDLAADNSVKVAVEFIKKVP  260
            GS  SNEA  F  LAA NSV V V+F+  +P
Sbjct  237  GSEISNEADIFGSLAAVNSVDVLVKFVGLLP  267



>ref|XP_008802263.1| PREDICTED: bark storage protein A-like, partial [Phoenix dactylifera]
Length=238

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 101/261 (39%), Positives = 154/261 (59%), Gaps = 31/261 (12%)
 Frame = -1

Query  1012  LAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRY---  842
             L  +NAGIT Q+LL VFD+ GVVH+GIAG+AN SL+ GDV+IP++ + T  W W ++   
Sbjct  3     LLYVNAGITVQILLDVFDIRGVVHFGIAGSANDSLSFGDVSIPKFVAFTGSWTWTKFNSV  62

Query  841   -GDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATP  665
              G  P+                 + F +Y  N+   +   + L++V Y+ EE+F V    
Sbjct  63    KGSSPD-----------------LSFGEY--NIP--SQSKSWLSSVEYKTEELFLVGKGM  101

Query  664   EERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAA  485
             E    +FW+ VD+ +FQ+A+ L+ + L+ C+N T CL  TPKV    +G++  I+++NAA
Sbjct  102   E---LVFWLEVDTEWFQVAEKLQ-VALQKCVNETYCLPETPKVVFGLKGSTDDIFVNNAA  157

Query  484   YRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAA  305
             YR F++ +F VS ++ ESAA+ +      VP I+ R +SDLAGG  + S+   +  DLA+
Sbjct  158   YRKFLFKEFGVSTIDEESAAILMTAMSPGVPVIVFRGVSDLAGGEESWSSTDLS--DLAS  215

Query  304   DNSVKVAVEFIKKVPSPNRSA  242
              N+ +VAVEFI        SA
Sbjct  216   INAFRVAVEFIAATGREKSSA  236



>ref|XP_011010765.1| PREDICTED: bark storage protein A-like [Populus euphratica]
Length=314

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/208 (41%), Positives = 123/208 (59%), Gaps = 14/208 (7%)
 Frame = -1

Query  985  TQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDGPENELPLEV  806
            TQ +L +FD+ G+VH+GIAGN N S++IGDV IP+ ++HT +W+W      P+  LP   
Sbjct  88   TQQMLDMFDITGIVHFGIAGNVNNSMSIGDVTIPEQFAHTGIWDWLN----PKGPLP---  140

Query  805  NGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHIFWVPVDS  626
                T +I  + F  Y  NV + +   NLL  + Y  E+ F     P     +FW  +  
Sbjct  141  ----TNDIAELDFGSY--NVPKGDGM-NLLGKIGYSYEQFFSESGKPNTAIPLFWAQISE  193

Query  625  HYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYDKFNVSP  446
             + Q+A  LEG+ELE C+N++ CL   PK+    RG++A+I++DNAAYR F+Y  + VS 
Sbjct  194  QWLQLAAGLEGMELERCVNSSVCLARKPKLVVGLRGSTANIFVDNAAYRDFLYQTYAVSS  253

Query  445  VEMESAAVALVCHQQKVPYIIIRALSDL  362
            V+MES AV +       P I+IR LSDL
Sbjct  254  VDMESFAVVMTSLSNGHPVIVIRGLSDL  281



>ref|XP_006443231.1| hypothetical protein CICLE_v10023782mg, partial [Citrus clementina]
 gb|ESR56471.1| hypothetical protein CICLE_v10023782mg, partial [Citrus clementina]
Length=406

 Score =   172 bits (435),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 101/249 (41%), Positives = 143/249 (57%), Gaps = 22/249 (9%)
 Frame = -1

Query  997  AGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDGPENEL  818
            AGIT Q+LL  FD+ GVVHYG AG++N SL+ GDV++ +  + T  W W+ +      +L
Sbjct  175  AGITVQILLDAFDIRGVVHYGTAGSSNNSLSFGDVSVMKNVAFTGSWKWKAF-KSETGQL  233

Query  817  PLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHIFWV  638
            P         E+ F  F              NLL  V + P +++      EE   +FW+
Sbjct  234  P---------ELDFGAFNFPVRG-------KNLLAKVEFTPSQLYSAGKPMEE---LFWL  274

Query  637  PVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYDKF  458
            PVDS +F IA  L+ LEL  C+N T CL  TPKV    RG++A I+LDNAAYR F++ +F
Sbjct  275  PVDSEWFDIATQLQDLELRRCLNDTYCLPETPKVIVGLRGSTADIFLDNAAYREFLFKQF  334

Query  457  NVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSVKVAVE  278
            NVS V+ ESAA+ + C    VP I+ R +SDL  GG ++   + + I LA+ N+++VA E
Sbjct  335  NVSTVDEESAAIVMACLSNAVPSIVFRGVSDL--GGGSDRLLSISRISLASVNALRVAAE  392

Query  277  FIKKVPSPN  251
            FI  +   N
Sbjct  393  FIALIDKNN  401



>gb|EMS52187.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Triticum 
urartu]
Length=346

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 118/187 (63%), Gaps = 13/187 (7%)
 Frame = -1

Query  1207  KTRMLIENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKP  1034
             KT   I  AN+ GP++G+V+PN +EM P+LE  S+  S  I  +D  GRRFRFGTIEG+ 
Sbjct  30    KTWGAIRRANRAGPFVGLVVPNTYEMVPVLESPSFVASKSIPNMDIQGRRFRFGTIEGQS  89

Query  1033  VILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWN  854
             V++VMTGL+MLNAG+TTQ+LLS+F V G+VH+GIAGNAN  L IGDV IP+YW+H +LWN
Sbjct  90    VVMVMTGLSMLNAGLTTQMLLSLFRVKGIVHWGIAGNANEDLQIGDVTIPEYWAHVSLWN  149

Query  853   WQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVD  674
             WQ        ELP  VN         +  A   T V +  S +  L+N  Y+       +
Sbjct  150   WQGM------ELPACVNATTC-----LPRAPRVTRVSKGCSANVFLDNAEYRQFLRKQFE  198

Query  673   ATPEERQ  653
              TP E +
Sbjct  199   CTPVEME  205


 Score =   129 bits (324),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 88/109 (81%), Gaps = 0/109 (0%)
 Frame = -1

Query  598  EGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVA  419
            +G+EL  C+NATTCL   P+VTRV +G SA+++LDNA YR F+  +F  +PVEMESAAVA
Sbjct  151  QGMELPACVNATTCLPRAPRVTRVSKGCSANVFLDNAEYRQFLRKQFECTPVEMESAAVA  210

Query  418  LVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSVKVAVEFI  272
            LV H Q VP++ IR+LSDLAGGGSA  NEA+TFID+AA N+V+V ++F+
Sbjct  211  LVAHTQGVPFLTIRSLSDLAGGGSALGNEASTFIDIAAKNAVEVMLKFV  259



>ref|XP_010520777.1| PREDICTED: bark storage protein A-like isoform X2 [Tarenaya hassleriana]
Length=229

 Score =   165 bits (418),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 87/243 (36%), Positives = 134/243 (55%), Gaps = 14/243 (6%)
 Frame = -1

Query  991  ITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDGPENELPL  812
            + TQ ++  F V G+VH+GIAGN N S++IGDV IP+  +   LW+W   G         
Sbjct  1    MATQQMIDAFRVKGIVHFGIAGNLNNSMSIGDVTIPKQIASVGLWDWLNPG---------  51

Query  811  EVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHIFWVPV  632
                D  +++ F+    Y+  V + +   N L  + Y  EE++         Q  FW+  
Sbjct  52   --KTDGGQDVAFLDIGSYS--VPQGDGSVNELGTIRYNYEELYSKSGKTNTPQKKFWINT  107

Query  631  DSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYDKFNV  452
            +S +  +A  LEG+EL  C+N++ CL   PK+    +G +A++++DNAAYR+F+Y+ F V
Sbjct  108  NSQWLHLASDLEGMELLQCVNSSLCLPQKPKLVVGLKGATANVFVDNAAYRNFLYNTFEV  167

Query  451  SPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSVKVAVEFI  272
            S  +MES+AV + C     P I+IR LSDL  G  +  N    F  LAA N+ +  + FI
Sbjct  168  SSSDMESSAVMMTCASNGYPVIVIRGLSDL-AGAQSGDNTVRKFGSLAATNTARAVLGFI  226

Query  271  KKV  263
            KK+
Sbjct  227  KKL  229



>gb|EMT22529.1| Bark storage protein A [Aegilops tauschii]
Length=360

 Score =   169 bits (428),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 99/252 (39%), Positives = 152/252 (60%), Gaps = 24/252 (10%)
 Frame = -1

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYG  839
             +G+  LNA +T Q L+ VF V G+VHYG AG++N S++ GDV++P+  ++T  W W++Y 
Sbjct  119   SGVFELNAAVTVQTLVDVFTVSGIVHYGTAGSSNDSMSFGDVSVPKLVAYTGAWTWKKYK  178

Query  838   DGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEE  659
                E           + E+ F +F     NV   N  +NLL ++ Y+ EE++ V    EE
Sbjct  179   SLKEE----------STELNFGQF-----NVP--NGGENLLGSLKYRNEELYSVGKPMEE  221

Query  658   RQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYR  479
                +FW+PVDS +F+IA+ L+ + LE C N T CL  TP+V    +G SA ++LDNA YR
Sbjct  222   ---VFWLPVDSAWFKIAEGLK-VNLERC-NDTFCLPKTPQVVHGLKGASADMFLDNAEYR  276

Query  478   SFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADN  299
              F++ +F VS ++ ESAAV +      VP I+ R +SDL   G   +  + + ++LA+ N
Sbjct  277   KFLFREFAVSTIDEESAAVVMTTTSPGVPVIVFRGVSDL--AGGEPTWSSTSLMNLASIN  334

Query  298   SVKVAVEFIKKV  263
             ++KVAVEFI  +
Sbjct  335   ALKVAVEFIATI  346



>ref|XP_002325384.1| hypothetical protein POPTR_0019s07690g [Populus trichocarpa]
 gb|ABK95364.1| unknown [Populus trichocarpa]
 gb|EEE99765.1| hypothetical protein POPTR_0019s07690g [Populus trichocarpa]
Length=339

 Score =   168 bits (425),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 107/310 (35%), Positives = 167/310 (54%), Gaps = 32/310 (10%)
 Frame = -1

Query  1165  YLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVMTGLAMLNAG  992
             YLG+V+ +    + LL    + PST +  ID  GRRF  G I+   V++V  G  + N  
Sbjct  52    YLGIVVSSSASEDALLNSGFFVPSTHVPYIDLVGRRFNIGKIKDVHVVVVDVGGEIPNVV  111

Query  991   ITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDGPENELPL  812
             + TQ+L  +  + G++H+G AG+ + SL +GDVA+P+  + T  W W+            
Sbjct  112   LGTQVLFDLLSIRGIIHFGSAGSVSDSLRLGDVAVPESVAFTGNWEWKS-----------  160

Query  811   EVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHIFWVPV  632
               N     ++ F  F      V+   S D       +Q  +++    +    Q++ W+PV
Sbjct  161   --NASTRGKLKFGDFNLPQKGVNSLGSAD-------FQKVKLY---TSGNPSQNLLWLPV  208

Query  631   DSHYFQIAQSLEGLELEGCINA---TTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYDK  461
             DS++  +A  L+GL+L+ C+N    T CL +TP++    RG+SA IYL NAAY  F+ ++
Sbjct  209   DSNWLAVASELQGLKLQECVNEITETNCLENTPEIVFGGRGSSADIYLKNAAYGEFLANR  268

Query  460   FNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSVKVAV  281
             FN + V+  SAAVAL     +VPYI+ RA+S+    G++  N       LA  NSVKVAV
Sbjct  269   FNATFVDTSSAAVALASLTNEVPYILFRAISNSVIQGTSGPNSHY----LATANSVKVAV  324

Query  280   EFIKKVPSPN  251
             +FI+ +  PN
Sbjct  325   KFIELIGKPN  334



>emb|CDP19658.1| unnamed protein product [Coffea canephora]
Length=330

 Score =   167 bits (422),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 105/313 (34%), Positives = 159/313 (51%), Gaps = 28/313 (9%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFGTIEGKPVILVMTG  1013
             I+  + + P+LG           L+   SYK +T   D  GRRF  GTI    VI+V  G
Sbjct  32    IKELSVRPPFLG-----------LISAHSYKQATPFSD-DGRRFHIGTIGSNSVIIVGCG  79

Query  1012  LAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDG  833
               ++NA  TTQLLL  F +  V+H+G AG A+ SL++GDV IP  +S T +W+W +    
Sbjct  80    TGLVNAAATTQLLLDFFPIRAVIHFGTAGGADSSLSVGDVVIPMQFSQTGIWDWLKSEAA  139

Query  832   PENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQ  653
             P+ +     NG     +  ++F +Y   +       NLL  V Y  E  F     P+   
Sbjct  140   PQPD-----NG-----VADLEFRRYHIPI----GGYNLLGRVAYMKEYFFSQTGEPDVPV  185

Query  652   HIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSF  473
               FW        QIA +LEG+EL+ C+N   CL   PK+     GT+A+ +++NAAYR F
Sbjct  186   RKFWFEASEDLLQIASTLEGIELDQCLNG-VCLPKQPKLVLGVNGTTANFFVENAAYRDF  244

Query  472   IYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSV  293
             ++  F+V+ ++MESAAV +         I IR L++ + G     + + ++  + A N  
Sbjct  245   LHSTFHVASIDMESAAVIMTSLSSGQQVIAIRGLAN-SAGAEEGEDSSESYDAIVAANVE  303

Query  292   KVAVEFIKKVPSP  254
             K  V  +  +PSP
Sbjct  304   KTVVALVNNIPSP  316



>emb|CDP19655.1| unnamed protein product [Coffea canephora]
Length=285

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 104/286 (36%), Positives = 153/286 (53%), Gaps = 20/286 (7%)
 Frame = -1

Query  1099  PSTLII---DYAGRRFRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIA  929
             PS+LI     +  RRF  GTI    VI+V  G  ++NA  TTQLLL +F +  V+HYG A
Sbjct  3     PSSLIQISPTWICRRFHIGTIGSNSVIIVGCGTGLVNAAATTQLLLDIFPIRAVIHYGSA  62

Query  928   GNANPSLNIGDVAIPQYWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATN  749
             G A+ SL++GDV IP  +S T LW+W +    P+ +     NG     +  ++F +Y   
Sbjct  63    GGADSSLSLGDVLIPTQFSQTGLWDWLKSERAPQPD-----NG-----VADLEFRRYHIP  112

Query  748   VDECNSQDNLLNNVWYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCIN  569
                 +   NLL  V Y  E  F V   P+  +  FW P   +  QIA +LEG+EL+ C+ 
Sbjct  113   ----SFGFNLLGRVAYMKERFFSVTGEPDVPERKFWFPASENLLQIASTLEGIELDLCL-  167

Query  568   ATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPY  389
             A  CL   PK+     GT+A+ +++NAAY +F++  FNVS ++MESAAV +         
Sbjct  168   AGVCLPKQPKLVLGVNGTTANFFVENAAYSNFLHSTFNVSSIDMESAAVFMTSLSNGNSE  227

Query  388   II-IRALSDLagggsaesneaATFIDLAADNSVKVAVEFIKKVPSP  254
             +I IR L++L  G     + +  +  L A N  K+    +  +PSP
Sbjct  228   VIAIRGLANL-AGAEEGEDSSDRYDALLAVNVEKIVAALVNAIPSP  272



>ref|XP_009791547.1| PREDICTED: uncharacterized protein LOC104238775, partial [Nicotiana 
sylvestris]
Length=118

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 98/111 (88%), Gaps = 1/111 (1%)
 Frame = -1

Query  595  GLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVAL  416
            GL+L+ CI+A TCL+HTPKV RV RGTSASIYLDNAAYRSFIY+KF+VSPVEMESAAVAL
Sbjct  1    GLKLQECIDAKTCLSHTPKVARVHRGTSASIYLDNAAYRSFIYNKFDVSPVEMESAAVAL  60

Query  415  VCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSVKVAVEFIKKV  263
            +C+QQK PYI+IRALSDL  GG    NEAATFI LAA+NSV+V V+FIK++
Sbjct  61   ICYQQKTPYIVIRALSDL-AGGGDSENEAATFITLAANNSVEVVVQFIKQL  110



>emb|CDO99839.1| unnamed protein product [Coffea canephora]
Length=301

 Score =   161 bits (408),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 95/271 (35%), Positives = 138/271 (51%), Gaps = 15/271 (6%)
 Frame = -1

Query  1069  RRFRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVA  890
             RR+  GTI    VI+V  G  ++NA  TTQ+LL  F +  V+H+G AG A+ SL++GDV 
Sbjct  32    RRYHIGTIGSNDVIIVGCGTGLVNAAATTQVLLDFFKISAVIHFGTAGGADSSLSVGDVV  91

Query  889   IPQYWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNN  710
             IP  +S T LW+W          L  E        +  ++F +Y    D      NLL  
Sbjct  92    IPMQFSQTGLWDW----------LKSETAAQPDNGVADLEFRRYHIPADGY----NLLGR  137

Query  709   VWYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTR  530
             V Y  E  F     P+  +  FW        QIA +LEG+EL  C+N   CL   PK+  
Sbjct  138   VAYMKEYFFSPTGEPDVPERKFWFEASEDLLQIASTLEGIELNQCLN-KVCLPQKPKLVL  196

Query  529   VERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLaggg  350
                GT+A+ ++DNAAYR F++  F+V+ ++MESAAV +         I IR L++LAG  
Sbjct  197   GVNGTTANFFVDNAAYRDFLHKTFDVASIDMESAAVIMTSLANGHSVIAIRGLANLAGSE  256

Query  349   saesneaATFIDLAADNSVKVAVEFIKKVPS  257
                 + + ++  + A N  K  V  +  +PS
Sbjct  257   EEGEDSSESYDAIVAANVEKTVVALVNNIPS  287



>gb|AAK01124.1|AF330050_1 vegetative storage protein PNI288 [Populus trichocarpa x Populus 
deltoides]
Length=267

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 156/288 (54%), Gaps = 32/288 (11%)
 Frame = -1

Query  1099  PSTLI--IDYAGRRFRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAG  926
             PST +  ID  GRRF  G I+   V++V  G  + N  + TQ+L  +  + G++H+G AG
Sbjct  2     PSTHVPYIDLVGRRFNIGKIKDVHVVVVNVGGEIPNVVLGTQVLFDLLSIRGIIHFGSAG  61

Query  925   NANPSLNIGDVAIPQYWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNV  746
             + + SL +GDVA+P+  + T  W W+              N     E+ F  F      V
Sbjct  62    SVSDSLRLGDVAVPESVAFTGNWEWKS-------------NASTRGELKFGDFNLPQKGV  108

Query  745   DECNSQDNLLNNVWYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINA  566
             +   S D       +Q  +++    +    Q++ W+PVDS++  +A  L+GL+L+ C+N 
Sbjct  109   NSLGSAD-------FQKVKLY---TSGNPSQNLLWLPVDSNWLAVASELQGLKLQECVNE  158

Query  565   ---TTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKV  395
                T CL +TP++    RG+SA IYL NAAY  F+ ++FN + V+  SAAVAL     +V
Sbjct  159   ITETNCLENTPEIVFGGRGSSADIYLKNAAYGEFLANRFNATFVDTSSAAVALASLTNEV  218

Query  394   PYIIIRALSDLagggsaesneaATFIDLAADNSVKVAVEFIKKVPSPN  251
             PYI+ RA+S+    G++  N       LA  NSVKVAV+FI+ +  PN
Sbjct  219   PYILFRAISNSVIQGTSGPNSHY----LATANSVKVAVKFIELIGKPN  262



>ref|XP_011014172.1| PREDICTED: bark storage protein B-like [Populus euphratica]
Length=339

 Score =   160 bits (406),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 110/314 (35%), Positives = 166/314 (53%), Gaps = 32/314 (10%)
 Frame = -1

Query  1165  YLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVMTGLAMLNAG  992
             YLG+V+ +    + LL  S + PSTL+  ID  GRRF  G I+   V++V  G  + N  
Sbjct  52    YLGIVVTSSASEDALLNSSFFVPSTLVPYIDVVGRRFNIGKIKDVDVVVVNVGGEIPNVV  111

Query  991   ITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDGPENELPL  812
             + TQ+L  +  + G++++G AG+   SL +GDVA+P   + T  W W+            
Sbjct  112   LGTQVLFDLVSIRGIINFGSAGSVRDSLRLGDVAVPASVAFTGNWEWK------------  159

Query  811   EVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHIFWVPV  632
                   T + G +KF  +       NS    L +  +Q  +++     P E  ++ W+PV
Sbjct  160   ----SNTSKRGKLKFGDFNLPQKGANS----LGSADFQKVKLYTA-GNPSE--NLLWLPV  208

Query  631   DSHYFQIAQSLEGLELEGC---INATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYDK  461
             DS +  +A  L+ L L+ C   IN T CL +TP +    RG+SA IYL NAAY  F+ ++
Sbjct  209   DSDWLTVASELQVLTLQECVNEINKTNCLENTPAIVFGGRGSSADIYLKNAAYGEFLANR  268

Query  460   FNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSVKVAV  281
              N + V+  SAAVAL     +VPYI+ RA+S+    G++ SN       LA  NSVKVAV
Sbjct  269   LNATFVDKSSAAVALASLTNEVPYILFRAISNSVIHGTSGSNSRY----LATANSVKVAV  324

Query  280   EFIKKVPSPNRSAG  239
             +FI+ + + N   G
Sbjct  325   KFIELIGTSNSVIG  338



>gb|ADO32585.1| trypsin inhibitor [Drypetes roxburghii]
Length=288

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 105/307 (34%), Positives = 165/307 (54%), Gaps = 31/307 (10%)
 Frame = -1

Query  1165  YLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVMTGLAMLNAG  992
             Y+GVV+ +      L E +++ PS+    ID AGRRF  GTI+   V+ V +G +  N  
Sbjct  5     YIGVVLGSESNEKALNESNAFTPSSTSPHIDLAGRRFHIGTIDNADVVYVKSGGSTPNTV  64

Query  991   ITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDGPENELPL  812
             IT Q+LL+ F++ GVV  G AG  N +L++GDV++P   ++   W W+ +          
Sbjct  65    ITAQILLATFEIRGVVQVGGAGAINDTLSVGDVSVPGKIAYIGDWTWESF----------  114

Query  811   EVNGDYTREI-GFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHIFWVP  635
                  YT+E  G ++F +Y  N+ E  S  N L ++ + P E++   ++ +  + +FW+ 
Sbjct  115   -----YTKETKGPLQFGRY--NLPEPGS--NYLQSIAFNPLELY---SSNDNGKIVFWLR  162

Query  634   VDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYDKFN  455
              D +Y  +A  LEG++LE C +   CLT  PKV    R TSA IY+ N A++ F+  +F 
Sbjct  163   PDDYYLDVASRLEGVKLEKCASKAHCLTENPKVVVGLRATSADIYVVNDAFKGFVNKQFE  222

Query  454   VSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSVKVAVEF  275
              S V+  SAA A       VP+I  R +S+ A G S+ S+   +       N+V  AV+F
Sbjct  223   SSTVDTNSAAFAFTAISNGVPFISFRGVSNSASGSSSGSSYLGSV------NAVNAAVKF  276

Query  274   IKKVPSP  254
             I  +P P
Sbjct  277   IGSLPQP  283



>gb|AAV65286.1| bark protein-like protein [Thuja occidentalis]
Length=355

 Score =   159 bits (402),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 94/254 (37%), Positives = 144/254 (57%), Gaps = 20/254 (8%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSS--YKPSTLI--IDYAGRRFRFGTIEGKPVIL  1025
             IE  NK+G + G+V+    E+  +LE SS  ++P   +  ID +GRRF  G I G+  +L
Sbjct  36    IERVNKRGEHYGLVVSTTAELEVVLEKSSGTFRPDKELPTIDISGRRFHVGDIGGRRTLL  95

Query  1024  VMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANP-SLNIGDVAIPQYWSHTALWNWQ  848
             VM G  M+NA  TTQL++++F V  VV YG   +ANP  LNIGDVAIP+ ++HT L  W+
Sbjct  96    VMCGRGMVNAAQTTQLMVTLFRVRAVVQYGRGSSANPHKLNIGDVAIPRQFAHTGLLYWE  155

Query  847   RYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDAT  668
             ++G          + GD   ++    F  Y     +   Q +    V+ Q EEI+ V   
Sbjct  156   KFGV---------MMGDSIVKLQISHFPDYMLGNRKGKLQMS-FRVVYPQREEIYSVRGK  205

Query  667   PE-ERQHIFWVPVDSHYFQ-IAQSLEGLELEGCINA---TTCLTHTPKVTRVERGTSASI  503
              E  +   FW+ VD+ +   +   LE +ELE C++    + CL   P++ RVERG+S++ 
Sbjct  206   AEGGKAPSFWLNVDNRFLNPLGHQLEKVELEKCMSKEKESACLQEQPRIKRVERGSSSNF  265

Query  502   YLDNAAYRSFIYDK  461
             Y++N AYR+F+ D+
Sbjct  266   YVNNEAYRNFLRDQ  279



>gb|AGO28167.1| PNP_UDP_1 superfamily protein, partial [Euphorbia cotinifolia]
Length=288

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 105/307 (34%), Positives = 164/307 (53%), Gaps = 31/307 (10%)
 Frame = -1

Query  1165  YLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVMTGLAMLNAG  992
             Y+GVV+ +      L E +++ PS+    ID AGRRF  GTI+   V+ V +G +  N  
Sbjct  5     YIGVVLGSESNEKALNESNAFTPSSTSPHIDLAGRRFHIGTIDNADVVYVKSGGSTPNTV  64

Query  991   ITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDGPENELPL  812
             IT Q+LL+ F++ GVV  G AG  N +L++GDV++P   ++   W W  +          
Sbjct  65    ITAQILLATFEIRGVVQVGGAGAINDTLSVGDVSVPGKIAYIGDWTWGSF----------  114

Query  811   EVNGDYTREI-GFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHIFWVP  635
                  YT+E  G ++F +Y  N+ E  S  N L ++ + P E++   ++ +  + +FW+ 
Sbjct  115   -----YTKETKGPLQFGRY--NLPEPGS--NYLQSIAFNPLELY---SSNDNGKIVFWLR  162

Query  634   VDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYDKFN  455
              D +Y  +A  LEG++LE C +   CLT  PKV    R TSA IY+ N A++ F+  +F 
Sbjct  163   PDDYYLDVASRLEGVKLEKCASKAHCLTENPKVVVGLRATSADIYVVNDAFKGFVNKQFE  222

Query  454   VSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSVKVAVEF  275
              S V+  SAA A       VP+I  R +S+ A G S+ S+   +       N+V  AV+F
Sbjct  223   SSAVDTNSAAFAFTAISNGVPFISFRGVSNSASGSSSGSSYLGSV------NAVNAAVKF  276

Query  274   IKKVPSP  254
             I  +P P
Sbjct  277   IGSLPQP  283



>gb|AGO28168.1| PNP_UDP_1 superfamily protein, partial [Euphorbia tithymaloides]
Length=265

 Score =   154 bits (390),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 102/293 (35%), Positives = 159/293 (54%), Gaps = 31/293 (11%)
 Frame = -1

Query  1123  LLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYG  950
             L E +++ PS+    ID AGRRF  GTI+   V+ V +G + LN  IT Q+LL+ F++ G
Sbjct  1     LNESNAFTPSSTSPHIDLAGRRFHIGTIDNADVVYVKSGGSTLNTVITAQILLAAFEIRG  60

Query  949   VVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDGPENELPLEVNGDYTREI-GFI  773
             VV  G AG  N +L++GDV++P   ++   W W+ +               YT+E  G +
Sbjct  61    VVQVGGAGAINDTLSVGDVSVPGKIAYIGDWTWESF---------------YTKETKGPL  105

Query  772   KFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEG  593
             +F +Y  N+ E  S  N L ++ + P E++   ++ +  + +FW+  D +Y  +A  LEG
Sbjct  106   QFGRY--NLPEPGS--NYLQSIAFNPLELY---SSNDNGKIVFWLRPDDYYLDVASRLEG  158

Query  592   LELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALV  413
             ++LE C +   CLT  PKV    R TSA IY+ N A++ F+  +F  S V+  SAA A  
Sbjct  159   VKLEKCASKAHCLTENPKVVVGLRATSADIYVVNDAFKGFVNKQFESSTVDTNSAAFAFT  218

Query  412   CHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSVKVAVEFIKKVPSP  254
                  VP+I  R +S+ A G S+ S+   +       N+V  AV+FI  +P P
Sbjct  219   AISNGVPFISFRGVSNSASGSSSGSSYLGSV------NAVNAAVKFIGSLPQP  265



>ref|WP_013742281.1| phosphorylase [Pusillimonas sp. T7-7]
 ref|YP_004416369.1| methylthioadenosine nucleosidase [Pusillimonas sp. T7-7]
 gb|AEC19745.1| methylthioadenosine nucleosidase [Pusillimonas sp. T7-7]
Length=311

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/268 (35%), Positives = 140/268 (52%), Gaps = 26/268 (10%)
 Frame = -1

Query  1072  GRRFRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDV  893
             G  F  G ++GKPV+L ++G++M NA +TTQL L  F++  +V  GIAG  NP L+IGDV
Sbjct  64    GITFTTGVLQGKPVVLFLSGISMTNAAMTTQLALDRFNISHIVFSGIAGGVNPDLHIGDV  123

Query  892   AIPQYWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLN  713
              +   W         R         P   +     E+GF  +    T             
Sbjct  124   VVAARWGQYLEVLMAR------EVAPGVFDPSAPNELGFANYGMMRT-------------  164

Query  712   NVWYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVT  533
                 +P ++  V A   +    FW  VD     +AQSL G+EL+ C + + CL   P++ 
Sbjct  165   ----RPVKV--VSAGQPQVHKKFWFDVDPDMLAVAQSLNGIELQSCDSGSQCLQRQPRLM  218

Query  532   RVERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagg  353
                 G S + ++DNA YR +++  F  + ++MESAA A+V +   VP+I+ R+LSDL  G
Sbjct  219   VGGNGVSGAAFVDNAEYRKYVFKTFQANVLDMESAACAMVAYTNAVPFIVFRSLSDL-AG  277

Query  352   gsaesneaATFIDLAADNSVKVAVEFIK  269
             G   +NE  TF+D+AADNS KV + F+K
Sbjct  278   GGEGANEMHTFMDIAADNSAKVLLAFLK  305



>ref|XP_010087472.1| Bark storage protein A [Morus notabilis]
 gb|EXB29153.1| Bark storage protein A [Morus notabilis]
Length=513

 Score =   158 bits (399),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 96/277 (35%), Positives = 142/277 (51%), Gaps = 57/277 (21%)
 Frame = -1

Query  1096  STLIIDYAGRRFRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNAN  917
             S  ++   GR F  G I+G  V          NA IT Q+L+  F++ G+VHYG +G+AN
Sbjct  153   SRTVMAILGRTFHIGKIKGGDV----------NAAITVQMLVDKFNIKGIVHYGTSGSAN  202

Query  916   PSLNIGDVAIPQYWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDEC  737
              +LN+G V IP + + T+ W+W+                                     
Sbjct  203   YALNLGSVGIPTHVAFTSSWDWK-------------------------------------  225

Query  736   NSQDNLLNNVWYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCI--NAT  563
                 NLL  V ++P ++F   +  +  Q +FW+P++  +  +A  L+ LEL+ CI  N T
Sbjct  226   ----NLLGKVEFRPHQLF---SNSKPNQDVFWLPIEPKWLTLATQLKNLELQHCITVNKT  278

Query  562   TCLTHTPKVTRVERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYII  383
              CL   PK+    RG++A +YL N AYR F+Y KFNVS V+ ESAAV       +VP I+
Sbjct  279   YCLEEFPKLAYDVRGSTADVYLHNMAYREFLYKKFNVSNVDQESAAVVATSLSNEVPCIV  338

Query  382   IRALSDLagggsaesneaATFIDLAADNSVKVAVEFI  272
              R +SD+  GG+       + +DLAA N++ VAVEFI
Sbjct  339   FRGVSDM-AGGAEPITSTRSILDLAAANALHVAVEFI  374



>gb|AGO28166.1| PNP_UDP_1 superfamily protein, partial [Acalypha wilkesiana]
Length=270

 Score =   152 bits (384),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 89/252 (35%), Positives = 138/252 (55%), Gaps = 25/252 (10%)
 Frame = -1

Query  1123  LLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYG  950
             L E +++ PS+    ID AGRRF  GTI+   V+ V +G + LN  IT Q+LL+ F++ G
Sbjct  10    LNESNAFTPSSTSPHIDLAGRRFHIGTIDNADVVYVKSGGSTLNTVITAQILLAAFEIRG  69

Query  949   VVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDGPENELPLEVNGDYTREI-GFI  773
             VV  G AG  N +L++GDV++P   ++   W W+ +               YT+E  G +
Sbjct  70    VVQVGGAGAINDTLSVGDVSVPGKIAYIGDWTWESF---------------YTKETKGPL  114

Query  772   KFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEG  593
             +F +Y  N+ E  S  N L ++ + P E++   ++ +  + +FW+  D +Y  +A  LEG
Sbjct  115   QFGRY--NLPEPGS--NYLQSIAFNPLELY---SSNDNGKIVFWLRPDDYYLDVASRLEG  167

Query  592   LELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALV  413
             ++LE C +   CLT  PKV    R TSA IY+ N A++ F+  +F  S V+  SAA A  
Sbjct  168   VKLEKCASKAHCLTENPKVVVGLRATSADIYVVNDAFKGFVNKQFESSTVDTNSAAFAFT  227

Query  412   CHQQKVPYIIIR  377
                  VP+I  R
Sbjct  228   AISNGVPFISFR  239



>ref|XP_011013318.1| PREDICTED: bark storage protein A-like [Populus euphratica]
Length=339

 Score =   154 bits (389),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 108/310 (35%), Positives = 162/310 (52%), Gaps = 32/310 (10%)
 Frame = -1

Query  1165  YLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVMTGLAMLNAG  992
             YLG+V+ +    + LL    + PST    ID  GRRF  G I+G  V++V  G  + N  
Sbjct  52    YLGIVVSSSASEDALLASGFFVPSTHTPYIDLIGRRFNIGKIKGVDVVVVNVGGEIPNVV  111

Query  991   ITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDGPENELPL  812
             + TQ+L  +  + G++H+G AG+   SL +GDVA+P   + T  W W+            
Sbjct  112   LGTQVLFDLVGIRGIIHFGNAGSVTDSLCLGDVAVPGSVAFTGNWEWK------------  159

Query  811   EVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHIFWVPV  632
                   T + G +KF  +       NS    L +  +Q  +++         Q++ W+PV
Sbjct  160   ----SNTSKRGKLKFGDFNLPQKGANS----LGSADFQKVKLYTAG---NPSQNLLWLPV  208

Query  631   DSHYFQIAQSLEGLELEGC---INATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYDK  461
             DS +  +A  L+ L L+ C   IN T CL +TP +    RG+SA IYL NAAY  F+ ++
Sbjct  209   DSDWLTVASELQDLTLQECVNEINKTNCLENTPAIVFGGRGSSADIYLKNAAYGEFLANR  268

Query  460   FNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSVKVAV  281
              N + V+  SAAVAL     +VPYI+ RA+S+    G++ SN       LA  NSVKVAV
Sbjct  269   LNATFVDTSSAAVALASLTNEVPYILFRAISNSVIHGTSTSNSRY----LATANSVKVAV  324

Query  280   EFIKKVPSPN  251
             +FI+ + + N
Sbjct  325   KFIELIGTSN  334



>gb|KDP45052.1| hypothetical protein JCGZ_01552 [Jatropha curcas]
Length=296

 Score =   153 bits (386),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 101/313 (32%), Positives = 160/313 (51%), Gaps = 56/313 (18%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFGTIEGKPVILVMTG  1013
             I+  NK  PY+G+V     E N      ++ P+         ++ F              
Sbjct  29    IKEINKIVPYIGLVTEYTPEENAFFATGAFMPNP--------KYPF--------------  66

Query  1012  LAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDG  833
             +  +NA   TQ +L +FD+ G++H+GI+GN N S+ IGD++IP+ +++T LW W      
Sbjct  67    VVQVNAAAATQQMLDLFDMTGIIHFGISGNLNNSMFIGDISIPKKFANTGLWGW------  120

Query  832   PENELPLEVNGDYTR-EIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEER  656
                   L  NG  +  ++  IK   Y  NV + +   N+L  + Y  E+ F V       
Sbjct  121   ------LNPNGTVSSSDVAEIKIGSY--NVPQGDGL-NMLGKIGYSNEQFFSVKEA-NAA  170

Query  655   QHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRS  476
             + +FW  V+ H+  +A SLEG+EL+ C+N++ CLT  PK+    +G++A+I+LDNAA R 
Sbjct  171   EPLFWAEVNQHWLHLAASLEGMELDKCVNSSLCLTQKPKLVVGLKGSTANIFLDNAASRD  230

Query  475   FIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNS  296
             F++  F  S  +MES+A                A+ DL  G  +  N   TF  LAA N+
Sbjct  231   FLFKTFEASTADMESSA----------------AVMDL-AGSQSGDNSIYTFGSLAALNT  273

Query  295   VKVAVEFIKKVPS  257
             VK  ++FIKK+P+
Sbjct  274   VKAVLKFIKKLPA  286



>ref|XP_003637890.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Medicago 
truncatula]
Length=156

 Score =   146 bits (368),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 86/117 (74%), Gaps = 2/117 (2%)
 Frame = -1

Query  1192  IENANKKGPYLGVVIPNMFEMNPLLEHSSYKPSTLI--IDYAGRRFRFGTIEGKPVILVM  1019
             I N N +GP +G+V+PN +E+NPLL  SS+ P       D+AGR FR G +E K VI+VM
Sbjct  32    ISNINNEGPSIGIVVPNAYELNPLLHSSSFVPHNKFPYFDFAGRHFRIGELEKKKVIVVM  91

Query  1018  TGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQ  848
             +G  MLNAG+ TQLLL++F++ GV+HYGIAGN N    IGDV IP+YW+HT LW+WQ
Sbjct  92    SGEGMLNAGLATQLLLTLFNIEGVLHYGIAGNLNSRFQIGDVTIPKYWAHTGLWHWQ  148



>dbj|BAH56816.1| AT4G24350 [Arabidopsis thaliana]
Length=192

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/198 (38%), Positives = 117/198 (59%), Gaps = 14/198 (7%)
 Frame = -1

Query  1006  MLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDGPE  827
             M+N    TQ ++ VF+V G+VH+GIAGN N S++IGDV+IP+  ++  LW+W        
Sbjct  1     MVNGAAATQQMIDVFNVKGIVHFGIAGNMNNSMSIGDVSIPKQITNAGLWDWLN------  54

Query  826   NELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHI  647
                P +V G    +I ++    Y  NV + +  DN L ++ Y  E+++ V       Q++
Sbjct  55    ---PDKVKG--VEDIAYLDVGNY--NVPKGDG-DNELGSIGYNYEQLYSVTGHINAPQNV  106

Query  646   FWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIY  467
             FW+     +  +A  LE +EL  C+NA+ CL   PK+    +  +A I++DNAAYR+F+Y
Sbjct  107   FWINTTQEWLHLAADLEKMELSQCVNASLCLPKKPKLVVGLKAATAYIFVDNAAYRNFLY  166

Query  466   DKFNVSPVEMESAAVALV  413
             D F VS  +MES+AVA+V
Sbjct  167   DTFGVSSSDMESSAVAMV  184



>ref|WP_037281825.1| phosphorylase [Rubellimicrobium mesophilum]
 gb|EYD74971.1| 5'-methylthioadenosine nucleosidase / S-adenosylhomocysteine 
nucleosidase [Rubellimicrobium mesophilum DSM 19309]
Length=301

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 96/272 (35%), Positives = 141/272 (52%), Gaps = 27/272 (10%)
 Frame = -1

Query  1072  GRRFRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDV  893
             G RF  GT+ G+ V+L ++G++M+NA +TTQL L  FD+  +V  GIAG  +PSL+IGDV
Sbjct  54    GNRFISGTLGGQEVVLFLSGISMVNAAMTTQLALDHFDISHIVFSGIAGGVDPSLSIGDV  113

Query  892   AIPQYWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLN  713
              +P+ W       + R       ELP  ++ ++    G +    Y   V+   S  N   
Sbjct  114   VVPEQWGQYLEGVFARETAAGTFELPSWMSSEFP-SYGMM----YTRPVEVVRSGSN---  165

Query  712   NVWYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSL-EGLELEGCINATTCLTHTPKV  536
                            PE R    W PVD    + A+ L + + LE C     CL+  P++
Sbjct  166   --------------EPEARS---WFPVDPGLLETARGLADTIALEDCNAENACLSKAPRI  208

Query  535   TRVERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLag  356
                  G S   ++DNAA+R F++D F    ++MESAAVA V +   VP+I  R+LSDL  
Sbjct  209   VVGGNGVSGMTFVDNAAFREFVFDTFQARVLDMESAAVAHVAYANGVPFIAFRSLSDL-A  267

Query  355   ggsaesneaATFIDLAADNSVKVAVEFIKKVP  260
             GG    N+ ATF+ LA+ NS +V   F+  +P
Sbjct  268   GGGEGENQMATFMSLASRNSAEVVKAFLGAMP  299



>ref|XP_006579063.1| PREDICTED: bark storage protein B-like [Glycine max]
Length=164

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 100/122 (82%), Gaps = 1/122 (1%)
 Frame = -1

Query  634  VDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYDKFN  455
            ++  YF I  ++  LELE CIN+ TCLT TPK+  V RG S SIYLDNAAYRSFIY++F+
Sbjct  33   INGVYFYIT-TINDLELESCINSKTCLTTTPKLELVNRGISQSIYLDNAAYRSFIYNEFD  91

Query  454  VSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSVKVAVEF  275
            VSPV+MESA+VAL+C+QQ+VP+I IRAL DLAGGGSAESNEA TF+ +AA NSV V +EF
Sbjct  92   VSPVDMESASVALICYQQRVPFIAIRALPDLAGGGSAESNEADTFLSIAATNSVTVVIEF  151

Query  274  IK  269
            +K
Sbjct  152  VK  153



>gb|ADB92666.1| wound-inducible 4, partial [Populus tremula x Populus alba]
Length=298

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 98/307 (32%), Positives = 161/307 (52%), Gaps = 32/307 (10%)
 Frame = -1

Query  1162  LGVVIPNMFEMNPLLEHSSYKPS--TLIIDYAGRRFRFGTIEGKPVILVMTGLAMLNAGI  989
             LG+V+ +      L +   + P   T  +D AGRRF  GT+  + ++ V +G   +NA I
Sbjct  15    LGLVLTSDTNEQALQDSGLFTPDAETPYVDIAGRRFHIGTLNARYIVYVKSGGNSVNAAI  74

Query  988   TTQLLLSVFDVYGVVHYGIAGNAN-PSLNIGDVAIPQYWSHTALWNWQRYGDGPENELPL  812
               Q+LL+ F ++G++H+G AG+ +  SL  GDV++P   + T  WNW+++G         
Sbjct  75    AVQILLNRFRIHGIIHFGSAGSLDIKSLVPGDVSVPLAVAFTGAWNWKKFGS--------  126

Query  811   EVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHIFWVPV  632
                     E G + F ++   V+     +NLL +V Y   ++F    +P   Q +FW P 
Sbjct  127   --------EEGKLIFGEFNYPVN----GENLLASVDYDTVKLFSKGQSP---QDVFWFPS  171

Query  631   DSHYFQIA-QSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYDKFN  455
              + ++  A + L+ LEL  C +   CL   PK+    +G+S+  Y+ N AY  F++  FN
Sbjct  172   TTSWYSAATKVLQDLELSQCYDG-VCLPSKPKIVFGTKGSSSDSYIKNKAYGDFLHKAFN  230

Query  454   VSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSVKVAVEF  275
             VS  + ESAAVA      + P+I+IR  S++AG  S  S  +     LA+ N+   A +F
Sbjct  231   VSTADQESAAVAWTSLSNEKPFIVIRGASNVAGAASPGSQASY----LASYNAFLAAAKF  286

Query  274   IKKVPSP  254
             I+ +P+P
Sbjct  287   IESIPTP  293



>ref|WP_036839600.1| phosphorylase [Polaromonas sp. CF318]
Length=306

 Score =   146 bits (368),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 90/267 (34%), Positives = 132/267 (49%), Gaps = 26/267 (10%)
 Frame = -1

Query  1072  GRRFRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDV  893
             G  F  GT++GKPV+L ++G++M+NA + TQL+L  F+V  +V  GIAG  +PSL+IGDV
Sbjct  62    GVEFSTGTLQGKPVVLFLSGISMVNASMNTQLVLDRFNVQAIVFSGIAGGVDPSLHIGDV  121

Query  892   AIPQYWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLN  713
             ++P  W         R        +P  +        G +                    
Sbjct  122   SVPAQWGQYLEVLMARETAPGRYTIPPRMEAQTLAPFGML--------------------  161

Query  712   NVWYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVT  533
                  P  +    A        FW  VD    + A+ L  + LE C  A  CLTH P++ 
Sbjct  162   ----HPRPVETRTAASPAPVRKFWFAVDPRMLETARGLGSIALESC-KAGVCLTHRPQLR  216

Query  532   RVERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagg  353
                 G S   ++DNAA+R + +  F  + ++ME+AAV +V +   VPYI  R+LSDL  G
Sbjct  217   VGGNGVSGQAFVDNAAFREYTFKTFGANVLDMETAAVGMVAYSNNVPYIAFRSLSDL-AG  275

Query  352   gsaesneaATFIDLAADNSVKVAVEFI  272
             G   +NE  TF+ +AADNS KV + F+
Sbjct  276   GGEGANEMVTFMGIAADNSAKVLLAFL  302



>ref|XP_009351241.1| PREDICTED: LOW QUALITY PROTEIN: bark storage protein A-like, 
partial [Pyrus x bretschneideri]
Length=235

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 88/253 (35%), Positives = 137/253 (54%), Gaps = 18/253 (7%)
 Frame = -1

Query  1003  LNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDGPEN  824
             +N    TQ ++ + D+ G+VH+GIAGNAN S++IGD  IPQ ++H  +W+W      P  
Sbjct  1     VNTAAATQQMVDLLDIVGIVHFGIAGNANNSMSIGD-XIPQQFAHAGIWDWLN----PSG  55

Query  823   ELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHIF  644
              +      +Y  ++  + F  Y  NV E    DNLL  + +   E F         + IF
Sbjct  56    TV------NY-NDVAGLDFKGY--NVPE--GGDNLLGQIGFS-YEFFSESGKANTARPIF  103

Query  643   WVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYD  464
             W      +  +A +L+G+ L   +N++ CL   PK+    RG++++I++DNAAYR F++ 
Sbjct  104   WANTTRQWLHVASNLKGINLNQSVNSSVCLPQKPKLVVSLRGSASNIFVDNAAYRDFLFK  163

Query  463   KFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSVKVA  284
              F VS V+MES+AV +         I+IR L D+  GG    N   TF  LAA N+ KV 
Sbjct  164   TFRVSSVDMESSAVVMTSLSNGFLVIVIRGLLDI-AGGQTGHNSVDTFGPLAAINACKVV  222

Query  283   VEFIKKVPSPNRS  245
             ++FI++ P   +S
Sbjct  223   IKFIEEFPKEIKS  235



>ref|WP_015014285.1| phosphorylase [Acidovorax sp. KKS102]
 ref|YP_006854912.1| mta/sah nucleosidase [Acidovorax sp. KKS102]
 gb|AFU46274.1| mta/sah nucleosidase [Acidovorax sp. KKS102]
Length=303

 Score =   145 bits (367),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 93/268 (35%), Positives = 130/268 (49%), Gaps = 27/268 (10%)
 Frame = -1

Query  1072  GRRFRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDV  893
             G  F  GT+EGKPV++ ++G++M NA + TQL+L  F+V  VV  GIAG  NPSL+IGDV
Sbjct  58    GVEFTTGTLEGKPVVVFLSGISMTNAAMNTQLVLDRFNVSHVVFSGIAGGVNPSLHIGDV  117

Query  892   AIPQYWSHTALWNWQRYGDGPENELPLEVNGDYTR-EIGFIKFAKYATNVDECNSQDNLL  716
              +P  W     W   R     +   P  +  + T    G +                   
Sbjct  118   TVPAQWGQYMEWLMAREDQPGQYSAPAWMKSELTMPAFGMM-------------------  158

Query  715   NNVWYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKV  536
                   P  +    A   +    FW   D      A+SL+ + LE C+ A TCL   P++
Sbjct  159   -----HPRPVEVRSAAQPQLSKKFWFEADPKMLATARSLQNVGLEHCL-AATCLKQRPQL  212

Query  535   TRVERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLag  356
                  G S   ++DN A+R + +  F  + ++ME+AA A+V H   VPYI  R+LSDL  
Sbjct  213   VVGGNGVSGQAFVDNKAFREYAFKTFEANVLDMETAATAMVAHSNGVPYIAFRSLSDL-A  271

Query  355   ggsaesneaATFIDLAADNSVKVAVEFI  272
             GG    NE  TF+ LAA NS KV   F+
Sbjct  272   GGGEGENEMGTFMGLAAANSAKVLRAFL  299



>gb|EJL81266.1| nucleoside phosphorylase [Polaromonas sp. CF318]
Length=320

 Score =   145 bits (367),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 90/267 (34%), Positives = 132/267 (49%), Gaps = 26/267 (10%)
 Frame = -1

Query  1072  GRRFRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDV  893
             G  F  GT++GKPV+L ++G++M+NA + TQL+L  F+V  +V  GIAG  +PSL+IGDV
Sbjct  76    GVEFSTGTLQGKPVVLFLSGISMVNASMNTQLVLDRFNVQAIVFSGIAGGVDPSLHIGDV  135

Query  892   AIPQYWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLN  713
             ++P  W         R        +P  +        G +                    
Sbjct  136   SVPAQWGQYLEVLMARETAPGRYTIPPRMEAQTLAPFGML--------------------  175

Query  712   NVWYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVT  533
                  P  +    A        FW  VD    + A+ L  + LE C  A  CLTH P++ 
Sbjct  176   ----HPRPVETRTAASPAPVRKFWFAVDPRMLETARGLGSIALESC-KAGVCLTHRPQLR  230

Query  532   RVERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagg  353
                 G S   ++DNAA+R + +  F  + ++ME+AAV +V +   VPYI  R+LSDL  G
Sbjct  231   VGGNGVSGQAFVDNAAFREYTFKTFGANVLDMETAAVGMVAYSNNVPYIAFRSLSDL-AG  289

Query  352   gsaesneaATFIDLAADNSVKVAVEFI  272
             G   +NE  TF+ +AADNS KV + F+
Sbjct  290   GGEGANEMVTFMGIAADNSAKVLLAFL  316



>ref|WP_035044210.1| phosphorylase [Caulobacter henricii]
Length=300

 Score =   145 bits (366),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 99/276 (36%), Positives = 140/276 (51%), Gaps = 31/276 (11%)
 Frame = -1

Query  1081  DYAGRRFRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNI  902
             D AG  F  GT+EGKP++L ++G++M+NA +TTQ+ L  F+V  +V  GIAG  + SL+I
Sbjct  54    DVAGFTFITGTLEGKPIVLFLSGVSMVNAAMTTQMALDRFNVTRIVFSGIAGGVDESLDI  113

Query  901   GDVAIPQYWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDN  722
             GDV + + W+ +    + R  D                  GF         +      DN
Sbjct  114   GDVLVAEQWTESLETAFARETDK-----------------GF--------ELSNSVRNDN  148

Query  721   LLNNVWYQPEEI-FPVDATPEERQHIFWVPVDSHYFQIAQSLEG-LELEGCINATTCLTH  548
             L N     P  I  P    P E +   W P D     +A+ +    +L  C+ A  CL H
Sbjct  149   LPNYGMMFPRAIMLPRAGGPPETRR--WFPADPAMLSLARQVAADAKLTRCV-ADKCLVH  205

Query  547   TPKVTRVERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALS  368
              PK+     G SA ++LDNAAYR ++   F     +MESAAVA V +    P+I  R+LS
Sbjct  206   APKIVVGGNGVSAPVFLDNAAYRKYLSATFGARVADMESAAVAHVAYVNGAPFIAFRSLS  265

Query  367   DLagggsaesneaATFIDLAADNSVKVAVEFIKKVP  260
             DL  GG A +NE  TF+ LA++NS  V   F+K +P
Sbjct  266   DL-AGGGAGANEMHTFMGLASENSASVVKAFVKALP  300



>ref|WP_013541663.1| phosphorylase [Variovorax paradoxus]
 ref|YP_004155546.1| mta/sah nucleosidase [Variovorax paradoxus EPS]
 gb|ADU37435.1| MTA/SAH nucleosidase [Variovorax paradoxus EPS]
Length=316

 Score =   145 bits (367),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 96/268 (36%), Positives = 139/268 (52%), Gaps = 28/268 (10%)
 Frame = -1

Query  1072  GRRFRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDV  893
             G  F  GT+EGKPV+L ++G++M NA + TQL+L+ F V  +V  GIAG  NPSL++GDV
Sbjct  72    GVEFTTGTLEGKPVVLFLSGISMTNATMNTQLVLNRFRVTSIVFSGIAGGVNPSLHVGDV  131

Query  892   AIPQYWSHTALWNWQRYGDGPENELPLEVN-GDYTREIGFIKFAKYATNVDECNSQDNLL  716
              +P  W           G   E  +  E   G YT    FIK A +              
Sbjct  132   TVPAQW-----------GQYLEVLMARETAPGKYTAPP-FIKDATFP-------------  166

Query  715   NNVWYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKV  536
             N     P  +    A   E +  FW  VD    ++A+S+  ++L  C +A  CL   P++
Sbjct  167   NFGMVHPRPVEVRSAAKPEIERKFWFEVDPKMLEVARSIRTVDLANC-SAGKCLARKPQL  225

Query  535   TRVERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLag  356
                  G S   ++DN A+R + +  F  + ++ME+AAV +V +   VPYI  R+LSDL  
Sbjct  226   VIGGNGVSGQAFMDNKAFREYTFKTFQANVLDMETAAVGMVAYSNGVPYIAFRSLSDL-A  284

Query  355   ggsaesneaATFIDLAADNSVKVAVEFI  272
             GG +  NE  TF+ +AADNS KV + F+
Sbjct  285   GGGSGENEMGTFMGIAADNSAKVMLAFL  312



>ref|WP_004617524.1| nucleoside phosphorylase [Caulobacter vibrioides]
 gb|ENZ82496.1| nucleoside phosphorylase [Caulobacter crescentus OR37]
Length=305

 Score =   144 bits (362),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 97/272 (36%), Positives = 138/272 (51%), Gaps = 29/272 (11%)
 Frame = -1

Query  1072  GRRFRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDV  893
             G RF  GT+EGKPV++ ++G++M+NA +TTQ+ L  F++  +V  GIAG+ +  L+IGDV
Sbjct  61    GVRFTTGTLEGKPVVVFLSGVSMVNAAMTTQMALDRFNITRIVFSGIAGDVDEGLDIGDV  120

Query  892   AIPQYWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLN  713
              +   W+      + R  D                  GF         V       +L N
Sbjct  121   VVADQWAQNLESAFARESDK-----------------GF--------EVSASIRNSDLAN  155

Query  712   NVWYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEG-LELEGCINATTCLTHTPKV  536
                  P  I    A   +   + W P D     IA+ +   + L+ C+ A  CL H PKV
Sbjct  156   FGMIYPRAILLPGADLSKPARV-WFPADPAMLDIARKVAAEVALQRCV-ADKCLAHPPKV  213

Query  535   TRVERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLag  356
                  G SA ++LDNAAYR ++   F    V+MESAAVA V    K P+++ R+LSDL  
Sbjct  214   VVGGNGVSAPVFLDNAAYRKYLRATFQARLVDMESAAVAHVALVNKTPFVVFRSLSDL-A  272

Query  355   ggsaesneaATFIDLAADNSVKVAVEFIKKVP  260
             GG A +NE  TF+ LA+DNS  V   F+K +P
Sbjct  273   GGGAGANEMHTFMALASDNSATVVKAFVKALP  304



>gb|KDP21761.1| hypothetical protein JCGZ_00548 [Jatropha curcas]
Length=265

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 84/247 (34%), Positives = 127/247 (51%), Gaps = 38/247 (15%)
 Frame = -1

Query  1009  AMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDGP  830
             A+L +GIT Q+L   F++ G+VHYG A + N SL I D    ++ S T      ++GD  
Sbjct  41    ALLRSGITVQILAGTFEIEGIVHYGTAESVNASLPIAD----EFKSGTGKLPELKFGD--  94

Query  829   ENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQH  650
                                         D     +NLL  + + P ++F +  + EE   
Sbjct  95    ---------------------------FDFPGKGENLLAKIEFTPTQVFSIGKSMEE---  124

Query  649   IFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFI  470
             +FW+P++S +F IA  L+ + LE C+N T CL   PKV    RG +A I++DNA YR F+
Sbjct  125   MFWLPINSKWFNIASQLQEINLERCVNDTYCLAEAPKVVFGLRGCTADIFVDNAGYRDFL  184

Query  469   YDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSVK  290
             + +F+VS V+ ESAA+ +      VP ++ R +SDL   G        +F  LA+ N++ 
Sbjct  185   FKQFSVSTVDEESAAIVMASLSNGVPCVVFRGVSDL--AGGELKLAETSFSPLASVNALI  242

Query  289   VAVEFIK  269
              AVEFIK
Sbjct  243   AAVEFIK  249



>ref|WP_007838860.1| phosphorylase [Variovorax sp. CF313]
 gb|EJL67945.1| nucleoside phosphorylase [Variovorax sp. CF313]
Length=323

 Score =   143 bits (361),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 93/267 (35%), Positives = 133/267 (50%), Gaps = 26/267 (10%)
 Frame = -1

Query  1072  GRRFRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDV  893
             G  F  GT+EGKPV+L ++G++M NA + TQL+L  F V  +V  GIAG  NPSL++GDV
Sbjct  79    GVEFTTGTLEGKPVVLFLSGISMTNATMNTQLVLDRFRVTNIVFSGIAGGVNPSLHVGDV  138

Query  892   AIPQYWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLN  713
              +P  W                    LEV        G      + T+    N       
Sbjct  139   TVPAQWGQY-----------------LEVLMARETAPGKYTAPPFITDATRPN-----FG  176

Query  712   NVWYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVT  533
              ++ +P E+    A   E Q  FW   D     +A+ +  ++L  C +A  CL   P++ 
Sbjct  177   MMFPRPVEV--RSAARPEIQRKFWFEADPKMLDVARGIRSVDLANC-SAGKCLPRKPQLV  233

Query  532   RVERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagg  353
                 G S   ++DN AYR + Y  F  + ++ME+AAV +V +   VPYI  R+LSDL  G
Sbjct  234   VGGNGVSGQAFMDNKAYREYTYKTFQANVLDMETAAVGMVAYANGVPYIAFRSLSDL-AG  292

Query  352   gsaesneaATFIDLAADNSVKVAVEFI  272
             G    NE  TF+ +AADNS KV + F+
Sbjct  293   GGDGENEMGTFMGIAADNSAKVMLAFL  319



>ref|WP_020949682.1| S-adenosylhomocysteine/5'-methylthioadenosine nucleosidase [Paracoccus 
aminophilus]
 ref|YP_008403802.1| S-adenosylhomocysteine/5'-methylthioadenosine nucleosidase [Paracoccus 
aminophilus JCM 7686]
 gb|AGT08043.1| S-adenosylhomocysteine/5'-methylthioadenosine nucleosidase [Paracoccus 
aminophilus JCM 7686]
Length=310

 Score =   142 bits (359),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 106/308 (34%), Positives = 152/308 (49%), Gaps = 29/308 (9%)
 Frame = -1

Query  1156  VVIPNMFEMNPLLEHSSYKPSTLIIDYAGRRFRFGTIEGKPVILVMTGLAMLNAGITTQL  977
             + I + FE   L      +P+   I + G  F  GT+EGK V+L ++G++M+NA +T QL
Sbjct  30    IAIVSAFEPEWLALKEVVQPTGHSIQH-GTEFVTGTLEGKDVVLYLSGVSMVNAAMTAQL  88

Query  976   LLSVFDVYGVVHYGIAGNANPSLNIGDVAIPQYWSHTALWNWQRYGDGPENELPLEVNGD  797
              L  F++  +   GIAG+A P  +IGDVAIP  W         R  DG    +P     D
Sbjct  89    ALDRFNIQAIAFTGIAGSAEPKYDIGDVAIPLRWGQYFEVVAGRERDGAFT-MPRFFRSD  147

Query  796   YTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHIFWVPVDSHYF  617
             +     F  F     +V    SQ                    PE +   FW  VD   F
Sbjct  148   HKN---FGMFFTRPLDVITAQSQ-------------------KPETK---FWFEVDPKLF  182

Query  616   QIA-QSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYDKFNVSPVE  440
             +IA ++ + ++L  C     CLT  P+V     G S S+++DNA  R++ ++ F    ++
Sbjct  183   RIAAEAAKDVKLSNCSKGNACLTKMPEVRIGGNGVSGSVFVDNAQLRNWAHETFKADVLD  242

Query  439   MESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSVKVAVEFIKKVP  260
             MESAAVA V +   VP+I  R++SDL  GG A  NE  TF+DLAA NSV V   F+  +P
Sbjct  243   MESAAVAQVAYSNDVPFIAFRSVSDL-AGGGAGHNEMGTFMDLAAANSVAVMSRFVAALP  301

Query  259   SPNRSAGL  236
               +   GL
Sbjct  302   PVSEIRGL  309



>ref|WP_029413035.1| phosphorylase [Acidovorax radicis]
Length=311

 Score =   142 bits (358),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 92/267 (34%), Positives = 131/267 (49%), Gaps = 25/267 (9%)
 Frame = -1

Query  1072  GRRFRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDV  893
             G  F  GT+EGKPV++ ++G++M NA + TQL+L  F V  +V  GIAG  NPSL+IGDV
Sbjct  66    GVEFTTGTLEGKPVVVFLSGISMTNAAMNTQLVLDRFHVSHIVFSGIAGGVNPSLHIGDV  125

Query  892   AIPQYWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLN  713
              +P  W     W   R     +   P  +  + T                          
Sbjct  126   TVPAQWGQYMEWLMAREDKPGQYSAPAWMKSELTMPA---------------------FG  164

Query  712   NVWYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVT  533
              +  +P E+         +Q  FW   D      A+SL+ + LE C+ A+TCL   P++ 
Sbjct  165   MMHPRPVEVRSAAKPGITKQ--FWFEADPKMLATARSLQNVGLEHCL-ASTCLKQRPQLV  221

Query  532   RVERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagg  353
                 G S   ++DN A+R + +  F  + ++ME+AA A+V H   VPYI  R+LSDL  G
Sbjct  222   VGGSGVSGQAFVDNKAFREYAFKTFEANVLDMETAATAMVAHSNGVPYIAFRSLSDL-AG  280

Query  352   gsaesneaATFIDLAADNSVKVAVEFI  272
             G    NE  TF+ LAA NS KV   F+
Sbjct  281   GGDGENEMGTFMGLAAANSAKVLQAFL  307



>gb|AAA16342.1| vegetative storage protein [Populus trichocarpa x Populus deltoides]
Length=324

 Score =   142 bits (359),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 96/307 (31%), Positives = 160/307 (52%), Gaps = 31/307 (10%)
 Frame = -1

Query  1162  LGVVIPNMFEMNPLLEHSSYKPS--TLIIDYAGRRFRFGTIEGKPVILVMTGLAMLNAGI  989
             LG+V+ +      L +   + P   T  +D AGRRF  GT+  + ++ V  G   +NA I
Sbjct  40    LGLVLTSDTNEKALQDSGLFTPDAETPYVDIAGRRFHIGTLNARYIVYVKIGGNSVNAAI  99

Query  988   TTQLLLSVFDVYGVVHYGIAGNANP-SLNIGDVAIPQYWSHTALWNWQRYGDGPENELPL  812
               Q+LL+ F + G++H+G AG+ +  S+  GDV++P   + T  WNW+++G         
Sbjct  100   AVQILLNRFRIQGIIHFGSAGSLDKESIVPGDVSVPLAVAFTGAWNWKKFGS--------  151

Query  811   EVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHIFWVPV  632
                     + G + F ++   V+     +NLL +V Y   ++F    +P   Q +FW P 
Sbjct  152   --------DKGTLNFGEFNYPVN----GENLLASVDYDKVKLFSKGHSP---QDVFWFPS  196

Query  631   DSHYFQIA-QSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYDKFN  455
              + ++  A Q L+ LEL  C +   CL+  PK+     G+S+  Y+ N AY  F++  FN
Sbjct  197   TTSWYSAATQVLQDLELRQCYD-RACLSSKPKIVFGTNGSSSDSYIKNKAYGDFLHKVFN  255

Query  454   VSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSVKVAVEF  275
             VS  + ESAAVA      + P+I+IR  S++AG  +   + A+    LA+ N+   A +F
Sbjct  256   VSTADQESAAVAWTSLSNEKPFIVIRGASNVAGEANPGFSPASY---LASYNAFLAAAKF  312

Query  274   IKKVPSP  254
             I+ +P+P
Sbjct  313   IESIPTP  319



>ref|WP_023461730.1| phosphorylase [Asticcacaulis sp. YBE204]
 gb|ESQ79616.1| phosphorylase [Asticcacaulis sp. YBE204]
Length=304

 Score =   142 bits (357),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 92/271 (34%), Positives = 134/271 (49%), Gaps = 25/271 (9%)
 Frame = -1

Query  1072  GRRFRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDV  893
             G  +  GT+EGKPV+L M+G++M+NA +TTQ+L+  F V  +V  GIAG  +P+L IGDV
Sbjct  59    GMSYVTGTLEGKPVVLAMSGMSMVNAAMTTQILIDRFHVEHIVFSGIAGGIDPTLKIGDV  118

Query  892   AIPQYWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLN  713
              +P  W+ +                 LE         GF+K        D       ++ 
Sbjct  119   VVPTRWAQS-----------------LETIMGRKTASGFVKPDWLTWAPDGMAPYGMMI-  160

Query  712   NVWYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVT  533
                  P  +   +A    +  + W   D     +A  LE  EL  C     CL H PK+ 
Sbjct  161   -----PNSVVVGNAAEAAKPKV-WFEADPTMLAVAAGLEQTELAWCTKDGQCLDHRPKLH  214

Query  532   RVERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagg  353
                 G S+S ++DNA YR +++  F     +MESAAV  V +   VP+I+ R+LSDL  G
Sbjct  215   VGGEGVSSSAFVDNADYRDYLHRVFKARVADMESAAVGQVAYANGVPFIVFRSLSDL-AG  273

Query  352   gsaesneaATFIDLAADNSVKVAVEFIKKVP  260
             G   +N+ A F+ LAA+NS  V   FI+ +P
Sbjct  274   GDEHANQMAVFMTLAAENSATVVCRFIRALP  304



>ref|WP_037165967.1| MULTISPECIES: phosphorylase [Rhizobium]
 gb|KEQ05915.1| phosphorylase [Rhizobium sp. R1-200B2]
 gb|KEQ11030.1| phosphorylase [Rhizobium sp. R2-400B4]
Length=304

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 94/272 (35%), Positives = 134/272 (49%), Gaps = 28/272 (10%)
 Frame = -1

Query  1072  GRRFRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDV  893
             GRRF  G++ GK V+L ++G++M+NA +TTQ  L  FD+  +V  GIAG  +PSL++GDV
Sbjct  60    GRRFVTGSMAGKDVVLFLSGVSMVNAAMTTQQALDHFDITSIVFSGIAGGVDPSLSVGDV  119

Query  892   AIPQYWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLN  713
              +   W       + R  +G     P         +  F  F     N            
Sbjct  120   VVSDQWGQYLEAIFARESEGTFAIPPF-------LDTQFPNFGMIYPN------------  160

Query  712   NVWYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEG-LELEGCINATTCLTHTPKV  536
                 + E +    A PE+R   FW PVD    + A+ +   + L  C +   CL+  PKV
Sbjct  161   ----ESEVVRDGSAEPEDR---FWFPVDGKLLETARQVASEVTLAKCASEGRCLSTQPKV  213

Query  535   TRVERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLag  356
                  G S   ++DNAA+R F +D F    ++MESAA A V +   VP+I  R+LSDL  
Sbjct  214   LVGGNGVSGPAFVDNAAFREFTFDTFQAKVLDMESAATAHVAYSNGVPFIAFRSLSDL-A  272

Query  355   ggsaesneaATFIDLAADNSVKVAVEFIKKVP  260
             GG    NE  TF  LA++NS KV   F+  +P
Sbjct  273   GGGEGENEMGTFFALASENSAKVVQAFLAALP  304



>ref|WP_026346164.1| phosphorylase [Variovorax paradoxus]
Length=312

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 92/267 (34%), Positives = 135/267 (51%), Gaps = 26/267 (10%)
 Frame = -1

Query  1072  GRRFRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDV  893
             G  F  GT+EGKPV+L ++G++M NA + TQL L+ F V  +V  GIAG  NPSL++GDV
Sbjct  68    GVEFTTGTLEGKPVVLFLSGISMTNATMNTQLALNRFRVTNIVFSGIAGGVNPSLHVGDV  127

Query  892   AIPQYWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLN  713
              +P  W                    LEV        G      + T+    N       
Sbjct  128   TVPAQWGQY-----------------LEVLMARETSPGKYTAPPFITDATLPN-----FG  165

Query  712   NVWYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEGLELEGCINATTCLTHTPKVT  533
              ++ +P E+    A   E    FW   D+   ++A+S+  ++L  C +A  CL   P++ 
Sbjct  166   MMFPRPVEV--RSAARPEIHRKFWFEADAKMLEVARSIRNVDLANC-SAGKCLPRKPQLV  222

Query  532   RVERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagg  353
                 G S   ++DN AYR + Y  F  + ++ME+AAV +V +   VP+I  R+LSDL  G
Sbjct  223   VGGNGVSGQAFMDNKAYREYTYKTFQANVLDMETAAVGMVAYSNGVPFIAFRSLSDL-AG  281

Query  352   gsaesneaATFIDLAADNSVKVAVEFI  272
             G    NE  TF+ +AADNS KV + F+
Sbjct  282   GGDGENEMGTFMGIAADNSAKVMLAFL  308



>ref|WP_026848837.1| hypothetical protein [Gemmatimonas sp. AP64]
Length=313

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 92/271 (34%), Positives = 134/271 (49%), Gaps = 27/271 (10%)
 Frame = -1

Query  1069  RRFRFGTIEGKPVILVMTGLAMLNAGITTQLLLSVFDVYGVVHYGIAGNANPSLNIGDVA  890
             R + FG + G  V+L+++G +M+NA +TTQ LL    V  +V  GIAG  NP LN+GDV 
Sbjct  59    RTYYFGRLAGHDVVLLLSGFSMVNAAMTTQALLDRIPVKAIVFSGIAGGVNPGLNVGDVT  118

Query  889   IPQYWSHTALWNWQRYGDGPENELPLEVNGDYTREIGFIKFAKYATNVDECNSQDNLLNN  710
             +P  W      N+Q      E     E    +        F  Y                
Sbjct  119   VPAQWG-----NYQ------EQVFARETAQGFEPARRTTDFGGYGM--------------  153

Query  709   VWYQPEEIFPVDATPEERQHIFWVPVDSHYFQIAQSLEG-LELEGCINATTCLTHTPKVT  533
             ++ Q   +    A P+     FW   DS    IA+++   + L  C +  TCL H P++ 
Sbjct  154   MFPQGTSVTVAGAPPDSLVRQFWFQADSTSLAIARTVASQVTLSRCTSGGTCLAHAPRIV  213

Query  532   RVERGTSASIYLDNAAYRSFIYDKFNVSPVEMESAAVALVCHQQKVPYIIIRALSDLagg  353
                 G S   ++DNAAYR +++  F    ++ME++AVALV  +  VPYI  R+LSDL  G
Sbjct  214   VGGNGVSGPTFVDNAAYREWVWKTFRADALDMETSAVALVAQENAVPYIAFRSLSDL-AG  272

Query  352   gsaesneaATFIDLAADNSVKVAVEFIKKVP  260
             G+ + NEA TF  LA+ NS  V + F+K +P
Sbjct  273   GNGDRNEARTFGVLASANSAAVVMAFLKALP  303



>ref|XP_006375994.1| hypothetical protein POPTR_0013s07800g [Populus trichocarpa]
 gb|ERP53791.1| hypothetical protein POPTR_0013s07800g [Populus trichocarpa]
Length=326

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 96/307 (31%), Positives = 160/307 (52%), Gaps = 31/307 (10%)
 Frame = -1

Query  1162  LGVVIPNMFEMNPLLEHSSYKPS--TLIIDYAGRRFRFGTIEGKPVILVMTGLAMLNAGI  989
             LG+V+ +      L +   + P   T  +D AGRRF  GT+  + ++ V  G   +NA I
Sbjct  42    LGLVLTSGNNEKALQDSGLFTPDAETPYVDIAGRRFHIGTLNARYIVYVKIGGNSVNAAI  101

Query  988   TTQLLLSVFDVYGVVHYGIAGNANP-SLNIGDVAIPQYWSHTALWNWQRYGDGPENELPL  812
               Q+LL+ F ++G++H+G AG+ +  S+  GDV++P   + T  WNW+++G         
Sbjct  102   AVQILLNRFRIHGIIHFGSAGSLDKESIVPGDVSVPLAVAFTGAWNWKKFGS--------  153

Query  811   EVNGDYTREIGFIKFAKYATNVDECNSQDNLLNNVWYQPEEIFPVDATPEERQHIFWVPV  632
                     + G + F ++   V+     +NLL +V Y   ++F    +P   Q +FW P 
Sbjct  154   --------DEGTLNFGEFNYPVN----GENLLASVDYDKIKLFSKGQSP---QDVFWFPS  198

Query  631   DSHYFQIA-QSLEGLELEGCINATTCLTHTPKVTRVERGTSASIYLDNAAYRSFIYDKFN  455
              + ++  A Q L+ LEL  C +   CL   PK+     G+S+  Y+ N AY  F++  FN
Sbjct  199   TTSWYSAATQVLQDLELRQCYD-RVCLPSKPKIVFGTNGSSSDSYIKNKAYGDFLHKVFN  257

Query  454   VSPVEMESAAVALVCHQQKVPYIIIRALSDLagggsaesneaATFIDLAADNSVKVAVEF  275
             VS  + ESAAVA      + P+I+IR  S++AG  +   + A+    LA+ N+   A +F
Sbjct  258   VSTADQESAAVAWTSLSNEKPFIVIRGASNVAGEANPGLSPASY---LASYNAFLAAAKF  314

Query  274   IKKVPSP  254
             I+ +P+P
Sbjct  315   IESIPTP  321



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3595941013084