BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c28666_g1_i1 len=890 path=[868:0-889]

Length=890
                                                                      Score     E

ref|XP_009800058.1|  PREDICTED: uncharacterized protein LOC104246028  87.0    1e-17   
emb|CDP16524.1|  unnamed protein product                              80.9    3e-15   
ref|XP_011084073.1|  PREDICTED: uncharacterized protein LOC105166427  80.5    5e-15   
ref|XP_004236041.1|  PREDICTED: uncharacterized protein LOC101251369  73.2    1e-12   
ref|XP_006345146.1|  PREDICTED: uncharacterized protein LOC102597...  72.4    2e-12   
ref|XP_006345144.1|  PREDICTED: uncharacterized protein LOC102596...  71.6    5e-12   
gb|EYU43078.1|  hypothetical protein MIMGU_mgv1a016117mg              67.0    2e-10   



>ref|XP_009800058.1| PREDICTED: uncharacterized protein LOC104246028 [Nicotiana sylvestris]
 ref|XP_009800059.1| PREDICTED: uncharacterized protein LOC104246028 [Nicotiana sylvestris]
 ref|XP_009800060.1| PREDICTED: uncharacterized protein LOC104246028 [Nicotiana sylvestris]
Length=130

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 65/110 (59%), Gaps = 5/110 (5%)
 Frame = +2

Query  290  WNRFCDLAMVSRPVEKGLMDKAMEVAERVRIKQVTEEGL-LQGCCPVCSGAILSAPESDV  466
            W R C L M+SRP  K L DKA+ VA RV +K   ++G+ L+  CPVC   I +  +SD+
Sbjct  9    WQRVCRLIMISRPFGKSLRDKAIAVAGRVTVK---KDGVSLKASCPVCLDIISTPLDSDL  65

Query  467  RMLLAAHFCDLHPVDVYSMWDKMADKKEPEVVRRPSFIFAVGMAAGVLAL  616
            +M LA H    HP DV   W+ M +K    +V  PSF F VG AAG+ AL
Sbjct  66   KMTLAVHMSLWHPDDVQLHWEMMQNKGR-SIVHMPSFCFGVGTAAGIGAL  114



>emb|CDP16524.1| unnamed protein product [Coffea canephora]
Length=137

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 72/132 (55%), Gaps = 11/132 (8%)
 Frame = +2

Query  287  LWNRFCDLAMVSRPVEKGLMDKAMEVAERVRIKQVTEEGLLQGCCPVCSGAILSAPESDV  466
            LW R     ++ +PV   L DKA+ VA RV + +V +   +Q CCPVC+ AI S  +SDV
Sbjct  10   LWLR----NLIPQPVRISLRDKAIAVAGRVSVVKVRDS--MQVCCPVCTEAISSPLDSDV  63

Query  467  RMLLAAHFCDLHPVDVYSMWDKMADKKEPEVVRRPSFIFAVGMAAGVLALTGVFVPII*F  646
            +M+LA H    H  DV   WD M  KK+  V+  PS +  VG+AAGV    GV +  +  
Sbjct  64   KMILAVHLSLWHAEDVNLQWDIMQKKKD-SVLHLPSLVVGVGIAAGV----GVLLTFLAK  118

Query  647  PRHACMVSTSER  682
             R   +V  + R
Sbjct  119  NRAQALVGNTVR  130



>ref|XP_011084073.1| PREDICTED: uncharacterized protein LOC105166427 [Sesamum indicum]
Length=164

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 59/112 (53%), Gaps = 3/112 (3%)
 Frame = +2

Query  290  WNRFCDLAMVSRPVEKGLMDKAMEVAERVRIKQVTEEGLLQGCCPVCSGAILSAPESDVR  469
            W RFC+L   S P +  L DKA+ VA RV      E   +   CPVC   + ++  ++V+
Sbjct  42   WLRFCNLMRFSPPTQTSLRDKAIAVAGRVTTVNDKESSSVS--CPVCLNVLRTSGHAEVK  99

Query  470  MLLAAHFCDLHPVDVYSMWDKMADKKEPEVVRRPSFIFAVGMAAGVLALTGV  625
            M LA H    HP DV   WD M + K+  ++  PS I  VGMAAG  AL  +
Sbjct  100  MTLALHLSLWHPDDVMLQWDIMQNNKK-SIIHLPSLIIGVGMAAGFAALLAI  150



>ref|XP_004236041.1| PREDICTED: uncharacterized protein LOC101251369 [Solanum lycopersicum]
 ref|XP_010318845.1| PREDICTED: uncharacterized protein LOC101251369 [Solanum lycopersicum]
 ref|XP_010318846.1| PREDICTED: uncharacterized protein LOC101251369 [Solanum lycopersicum]
Length=130

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 54/99 (55%), Gaps = 5/99 (5%)
 Frame = +2

Query  290  WNRFCDLAMVSRPVEKGLMDKAMEVAERVRIKQVTEEG-LLQGCCPVCSGAILSAPESDV  466
            W R C L M+SRP  K L DKAM VA RV I    EEG  L+  CPVC   + +  +SD+
Sbjct  9    WQRLCRLIMISRPFGKPLRDKAMAVAGRVAI---MEEGTTLKASCPVCLQVLSTPLDSDL  65

Query  467  RMLLAAHFCDLHPVDVYSMWDKMADKKEPEVVRRPSFIF  583
            +M LA H    H  DV   W+ M +K    +V  PSF F
Sbjct  66   KMTLAVHMSLWHADDVQLHWELMQNKGR-SIVHMPSFCF  103



>ref|XP_006345146.1| PREDICTED: uncharacterized protein LOC102597393 isoform X1 [Solanum 
tuberosum]
 ref|XP_006345147.1| PREDICTED: uncharacterized protein LOC102597393 isoform X2 [Solanum 
tuberosum]
 ref|XP_006345148.1| PREDICTED: uncharacterized protein LOC102597393 isoform X3 [Solanum 
tuberosum]
Length=130

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 55/99 (56%), Gaps = 5/99 (5%)
 Frame = +2

Query  290  WNRFCDLAMVSRPVEKGLMDKAMEVAERVRIKQVTEEGL-LQGCCPVCSGAILSAPESDV  466
            W R C L ++SRP  K L DKAM VA RV I    EEG+ L+  CPVC   + +  +SD+
Sbjct  9    WQRLCRLIIISRPFGKPLRDKAMAVAGRVAI---MEEGMTLKASCPVCLQVLSTPLDSDL  65

Query  467  RMLLAAHFCDLHPVDVYSMWDKMADKKEPEVVRRPSFIF  583
            +M LA H    H  DV   W+ M +K    +V  PSF F
Sbjct  66   KMTLAVHMSLWHADDVQLHWELMQNKGR-SIVHMPSFCF  103



>ref|XP_006345144.1| PREDICTED: uncharacterized protein LOC102596864 isoform X1 [Solanum 
tuberosum]
 ref|XP_006345145.1| PREDICTED: uncharacterized protein LOC102596864 isoform X2 [Solanum 
tuberosum]
Length=130

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 54/99 (55%), Gaps = 5/99 (5%)
 Frame = +2

Query  290  WNRFCDLAMVSRPVEKGLMDKAMEVAERVRIKQVTEEG-LLQGCCPVCSGAILSAPESDV  466
            W R C L M+SRP  K L DKAM VA RV I    EEG  L+  CP+C   + +  +SD+
Sbjct  9    WKRLCRLIMISRPFGKPLRDKAMAVAGRVAI---MEEGTTLKASCPMCLQVLSTPLDSDL  65

Query  467  RMLLAAHFCDLHPVDVYSMWDKMADKKEPEVVRRPSFIF  583
            +M LA H    H  DV   W+ M +K    +V  PSF F
Sbjct  66   KMTLAVHMSLWHADDVQLHWELMQNKGR-SIVHMPSFCF  103



>gb|EYU43078.1| hypothetical protein MIMGU_mgv1a016117mg [Erythranthe guttata]
Length=133

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 52/109 (48%), Gaps = 3/109 (3%)
 Frame = +2

Query  290  WNRFCDLAMVSRPVEKGLMDKAMEVAERVRIKQVTEEGLLQGCCPVCSGAILSAPESDVR  469
            W RF +L   S      L DKA+ VA RV    VT     +  CPVC   I +  ++D+R
Sbjct  9    WLRFRNLMTFSPHTPTSLRDKAIAVAGRV--TTVTNGDSSKVSCPVCLNVIETRGDADLR  66

Query  470  MLLAAHFCDLHPVDVYSMWDKMADKKEPEVVRRPSFIFAVGMAAGVLAL  616
            M LA H    HP DV   WD M +K  P  +  PS +  V   AG  AL
Sbjct  67   MTLAVHLSLWHPDDVKLQWDIM-NKTTPSAIHLPSLVVGVAAVAGFGAL  114



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1844883144792