BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c28625_g1_i1 len=814 path=[792:0-813]

Length=814
                                                                      Score     E

dbj|BAA21921.1|  ZPT2-12                                                166   8e-47   Petunia x hybrida [garden petunia]
ref|XP_009628782.1|  PREDICTED: zinc finger protein ZAT12-like          160   1e-44   
dbj|BAA21922.1|  ZPT2-13                                                159   4e-44   Petunia x hybrida [garden petunia]
ref|XP_009608410.1|  PREDICTED: zinc finger protein ZAT12-like          159   4e-44   
ref|XP_009622960.1|  PREDICTED: zinc finger protein ZAT12-like          157   2e-43   
ref|XP_009773332.1|  PREDICTED: zinc finger protein ZAT12-like          155   6e-43   
ref|XP_006350750.1|  PREDICTED: zinc finger protein ZAT11-like          155   7e-43   
ref|XP_009782299.1|  PREDICTED: zinc finger protein ZAT12-like          152   8e-42   
emb|CDP16476.1|  unnamed protein product                                150   6e-41   
emb|CDP09000.1|  unnamed protein product                                150   6e-41   
ref|XP_002533000.1|  zinc finger protein, putative                      148   5e-40   Ricinus communis
ref|XP_010253292.1|  PREDICTED: zinc finger protein ZAT12-like          147   1e-39   
ref|XP_009622961.1|  PREDICTED: zinc finger protein ZAT8-like           147   1e-39   
ref|XP_009628781.1|  PREDICTED: zinc finger protein ZAT12-like          145   3e-39   
ref|XP_006363363.1|  PREDICTED: zinc finger protein ZAT11-like          144   8e-39   
ref|XP_002533110.1|  nucleic acid binding protein, putative             144   1e-38   Ricinus communis
ref|XP_006429010.1|  hypothetical protein CICLE_v10013311mg             144   1e-38   
ref|XP_010260064.1|  PREDICTED: zinc finger protein ZAT12               144   1e-38   
ref|XP_009779269.1|  PREDICTED: zinc finger protein ZAT11-like          143   2e-38   
ref|XP_002284384.1|  PREDICTED: zinc finger protein ZAT11               143   2e-38   Vitis vinifera
ref|XP_006363362.1|  PREDICTED: zinc finger protein ZAT11-like          143   3e-38   
gb|KDP35585.1|  hypothetical protein JCGZ_09023                         143   3e-38   
ref|XP_006363361.1|  PREDICTED: zinc finger protein ZAT11-like          142   5e-38   
gb|ACB20696.1|  putative cold-inducible protein                         142   6e-38   Camellia sinensis [black tea]
gb|KCW88902.1|  hypothetical protein EUGRSUZ_A01230                     142   7e-38   
ref|XP_010043586.1|  PREDICTED: zinc finger protein ZAT12-like          140   3e-37   
ref|XP_010313549.1|  PREDICTED: zinc finger protein ZAT11-like          140   3e-37   
ref|XP_009604641.1|  PREDICTED: zinc finger protein ZAT12-like          140   3e-37   
ref|XP_004251306.1|  PREDICTED: zinc finger protein ZAT11-like          139   6e-37   
ref|XP_003547427.1|  PREDICTED: zinc finger protein ZAT11               139   8e-37   
ref|XP_010043584.1|  PREDICTED: zinc finger protein ZAT11-like          139   1e-36   
ref|XP_002284111.1|  PREDICTED: zinc finger protein ZAT12               138   2e-36   Vitis vinifera
emb|CAN64128.1|  hypothetical protein VITISV_022422                     146   3e-36   Vitis vinifera
ref|XP_007139263.1|  hypothetical protein PHAVU_008G014600g             137   5e-36   
ref|XP_010043587.1|  PREDICTED: zinc finger protein ZAT12-like          137   5e-36   
ref|XP_003552680.1|  PREDICTED: zinc finger protein ZAT11-like          137   8e-36   
ref|XP_010068234.1|  PREDICTED: zinc finger protein 433-like            142   1e-35   
gb|KDO72957.1|  hypothetical protein CISIN_1g031430mg                   136   1e-35   
ref|XP_010047364.1|  PREDICTED: zinc finger protein ZAT11-like          136   1e-35   
ref|XP_010041405.1|  PREDICTED: zinc finger protein ZAT12-like          136   1e-35   
ref|XP_006363365.1|  PREDICTED: zinc finger protein ZAT11-like          136   2e-35   
ref|XP_011027131.1|  PREDICTED: zinc finger protein ZAT11-like          136   2e-35   
ref|XP_009594751.1|  PREDICTED: zinc finger protein ZAT11-like          136   2e-35   
gb|KCW88903.1|  hypothetical protein EUGRSUZ_A01231                     135   2e-35   
gb|KHN09436.1|  Zinc finger protein ZAT11                               135   2e-35   
ref|XP_007016517.1|  C2H2 and C2HC zinc fingers superfamily prote...    135   3e-35   
ref|XP_008371383.1|  PREDICTED: zinc finger protein ZAT12-like          136   3e-35   
ref|XP_010043588.1|  PREDICTED: zinc finger protein ZAT8-like           135   4e-35   
ref|XP_008233585.1|  PREDICTED: zinc finger protein ZAT12-like          135   5e-35   
gb|KCW85606.1|  hypothetical protein EUGRSUZ_B02393                     139   5e-35   
gb|KHN02412.1|  Zinc finger protein ZAT11-like protein                  134   6e-35   
gb|KCW85608.1|  hypothetical protein EUGRSUZ_B02395                     135   6e-35   
ref|XP_010043582.1|  PREDICTED: zinc finger protein ZAT8-like           134   9e-35   
ref|XP_010043581.1|  PREDICTED: zinc finger protein ZAT8-like           134   1e-34   
gb|KCW85603.1|  hypothetical protein EUGRSUZ_B02390                     134   1e-34   
ref|XP_007142720.1|  hypothetical protein PHAVU_007G011300g             134   1e-34   
gb|KDO44126.1|  hypothetical protein CISIN_1g031966mg                   133   1e-34   
ref|XP_007218449.1|  hypothetical protein PRUPE_ppa011762mg             134   1e-34   
ref|NP_001235638.1|  uncharacterized protein LOC100527151               134   1e-34   
gb|KDP29859.1|  hypothetical protein JCGZ_18434                         134   1e-34   
gb|AGY36840.1|  Cys2/His2-type zinc finger protein                      133   1e-34   
dbj|BAA21923.1|  ZPT2-14                                                133   1e-34   Petunia x hybrida [garden petunia]
ref|XP_003521347.1|  PREDICTED: zinc finger protein ZAT11-like          133   2e-34   
gb|ACU20152.1|  unknown                                                 133   2e-34   Glycine max [soybeans]
ref|XP_010043590.1|  PREDICTED: zinc finger protein ZAT8-like           133   2e-34   
ref|XP_009628790.1|  PREDICTED: zinc finger protein ZAT12-like          133   2e-34   
gb|KDO67723.1|  hypothetical protein CISIN_1g040287mg                   133   2e-34   
ref|XP_003625524.1|  Zinc finger protein                                133   2e-34   
ref|XP_006363360.1|  PREDICTED: zinc finger protein ZAT11-like          132   3e-34   
ref|XP_004492093.1|  PREDICTED: zinc finger protein ZAT11-like          133   3e-34   
ref|XP_002311150.1|  zinc finger family protein                         132   4e-34   Populus trichocarpa [western balsam poplar]
gb|AFK36078.1|  unknown                                                 132   4e-34   
ref|XP_010043583.1|  PREDICTED: zinc finger protein ZAT8-like           132   4e-34   
ref|XP_010043589.1|  PREDICTED: zinc finger protein ZAT8-like           132   4e-34   
ref|XP_007150296.1|  hypothetical protein PHAVU_005G141500g             132   5e-34   
ref|XP_004294603.1|  PREDICTED: zinc finger protein ZAT11-like          132   5e-34   
ref|XP_004241247.1|  PREDICTED: zinc finger protein ZAT12-like          132   5e-34   
ref|XP_011077219.1|  PREDICTED: zinc finger protein ZAT11-like          132   5e-34   
gb|AES12473.1|  C2H2-type zinc finger protein 1                         132   6e-34   
ref|XP_006363364.1|  PREDICTED: zinc finger protein ZAT11-like          132   6e-34   
gb|KDP44196.1|  hypothetical protein JCGZ_05663                         132   6e-34   
ref|XP_011000297.1|  PREDICTED: zinc finger protein ZAT11               132   6e-34   
ref|XP_002316305.2|  hypothetical protein POPTR_0010s21650g             132   7e-34   Populus trichocarpa [western balsam poplar]
ref|NP_001237020.1|  uncharacterized protein LOC100500371               132   8e-34   
gb|KCW85605.1|  hypothetical protein EUGRSUZ_B02391                     133   9e-34   
ref|XP_002528469.1|  nucleic acid binding protein, putative             132   1e-33   Ricinus communis
gb|KHN13875.1|  Zinc finger protein ZAT11                               130   1e-33   
ref|XP_006436055.1|  hypothetical protein CICLE_v10032899mg             131   1e-33   
emb|CAQ64474.1|  putative Cys2/His2 zinc finger protein                 131   2e-33   Populus tremula x Populus alba [gray poplar]
ref|XP_011023518.1|  PREDICTED: zinc finger protein ZAT11-like          130   3e-33   
ref|XP_008357752.1|  PREDICTED: zinc finger protein ZAT12               130   3e-33   
ref|XP_008807730.1|  PREDICTED: zinc finger protein ZAT12-like          129   4e-33   
gb|AEY76110.1|  Cys2/His2-type zinc finger protein                      130   4e-33   
ref|XP_010922390.1|  PREDICTED: zinc finger protein ZAT11               129   5e-33   
ref|XP_004294604.1|  PREDICTED: zinc finger protein ZAT12-like          129   6e-33   
ref|XP_009347446.1|  PREDICTED: zinc finger protein ZAT12-like          130   6e-33   
ref|XP_009357691.1|  PREDICTED: zinc finger protein ZAT12-like          129   8e-33   
emb|CAF74933.1|  zinc finger DNA-binding protein                        129   1e-32   Catharanthus roseus [chatas]
ref|XP_010067376.1|  PREDICTED: zinc finger protein ZAT12-like          129   1e-32   
ref|XP_006436056.1|  hypothetical protein CICLE_v10032889mg             128   2e-32   
emb|CDP00044.1|  unnamed protein product                                129   2e-32   
emb|CDX93380.1|  BnaC04g45160D                                          128   2e-32   
ref|XP_003625522.1|  Zinc finger protein                                128   2e-32   
ref|XP_006350904.1|  PREDICTED: zinc finger protein ZAT11-like          127   3e-32   
ref|XP_010937700.1|  PREDICTED: zinc finger protein ZAT12-like          127   3e-32   
gb|AFK41279.1|  unknown                                                 127   3e-32   
gb|AFK39144.1|  unknown                                                 127   4e-32   
ref|XP_003621801.1|  Zinc finger protein                                127   4e-32   
ref|XP_002314198.2|  RESPONSIVE TO HIGH LIGHT 41 family protein         127   4e-32   Populus trichocarpa [western balsam poplar]
gb|KHN27209.1|  Zinc finger protein ZAT11                               127   5e-32   
ref|XP_009358331.1|  PREDICTED: zinc finger protein ZAT12-like          127   6e-32   
ref|XP_009593204.1|  PREDICTED: zinc finger protein ZAT11-like          126   7e-32   
ref|XP_004493901.1|  PREDICTED: zinc finger protein ZAT11-like          126   8e-32   
ref|XP_010096626.1|  Zinc finger protein ZAT11                          127   8e-32   
ref|XP_006410928.1|  hypothetical protein EUTSA_v10017303mg             126   9e-32   
ref|XP_008241560.1|  PREDICTED: zinc finger protein ZAT11               126   9e-32   
gb|KDO67725.1|  hypothetical protein CISIN_1g041414mg                   125   9e-32   
gb|AGW47690.1|  trifoliate orange Cys2/His2-type zinc finger protein    126   1e-31   
ref|XP_006436057.1|  hypothetical protein CICLE_v10032922mg             125   1e-31   
ref|XP_009762518.1|  PREDICTED: zinc finger protein ZAT11-like          125   1e-31   
ref|XP_006345939.1|  PREDICTED: zinc finger protein ZAT11-like          125   2e-31   
gb|AFK34837.1|  unknown                                                 125   2e-31   
ref|XP_002299891.2|  zinc finger family protein                         126   2e-31   Populus trichocarpa [western balsam poplar]
ref|XP_009757271.1|  PREDICTED: zinc finger protein ZAT11-like          125   2e-31   
ref|XP_011091501.1|  PREDICTED: zinc finger protein ZAT12-like          125   2e-31   
gb|EYU19898.1|  hypothetical protein MIMGU_mgv1a014646mg                125   2e-31   
ref|XP_003536960.1|  PREDICTED: zinc finger protein ZAT11-like          124   3e-31   
ref|XP_004494993.1|  PREDICTED: zinc finger protein ZAT11-like          124   3e-31   
gb|KHN49000.1|  Zinc finger protein ZAT11                               125   4e-31   
ref|XP_009141657.1|  PREDICTED: zinc finger protein ZAT11-like          125   4e-31   
emb|CAF74934.1|  zinc finger DNA-binding protein                        125   4e-31   Catharanthus roseus [chatas]
ref|XP_004239776.1|  PREDICTED: zinc finger protein ZAT11-like          124   5e-31   
ref|XP_007206686.1|  hypothetical protein PRUPE_ppa022066mg             124   5e-31   
ref|XP_009337587.1|  PREDICTED: zinc finger protein ZAT12-like          125   5e-31   
ref|XP_008370922.1|  PREDICTED: zinc finger protein ZAT12-like          125   5e-31   
gb|KEH42343.1|  C2H2 type zinc finger transcription factor family...    124   6e-31   
gb|KHN33407.1|  Zinc finger protein ZAT12                               124   6e-31   
ref|XP_008788081.1|  PREDICTED: zinc finger protein ZAT11               124   7e-31   
gb|KEH42342.1|  C2H2 type zinc finger transcription factor family...    124   7e-31   
gb|ACJ48970.1|  putative Cys2-His2 type zinc finger protein             123   1e-30   Glycine soja [wild soybean]
ref|XP_007149157.1|  hypothetical protein PHAVU_005G046200g             123   1e-30   
ref|XP_003543503.1|  PREDICTED: zinc finger protein ZAT11-like          123   1e-30   
gb|AGK28202.1|  C2H2-type zinc finger protein 4                         122   2e-30   
ref|XP_006387108.1|  hypothetical protein POPTR_1833s00200g             122   2e-30   
ref|XP_007205995.1|  hypothetical protein PRUPE_ppa012242mg             123   2e-30   
ref|XP_008222989.1|  PREDICTED: zinc finger protein ZAT12               123   2e-30   
emb|CAI77630.1|  putative Cys2-His2 zinc finger transcription factor    123   2e-30   Juglans regia
ref|XP_004294605.1|  PREDICTED: zinc finger protein ZAT11-like          122   3e-30   
ref|XP_011042666.1|  PREDICTED: zinc finger protein ZAT12-like          122   4e-30   
ref|NP_001241413.1|  uncharacterized protein LOC100816598               122   4e-30   
emb|CDX91362.1|  BnaC04g07880D                                          122   5e-30   
ref|XP_004493902.1|  PREDICTED: zinc finger protein ZAT11-like          121   5e-30   
ref|XP_004307547.1|  PREDICTED: zinc finger protein ZAT11-like          123   6e-30   
dbj|BAA19110.1|  PEThy;ZPT2-5                                           121   7e-30   Petunia x hybrida [garden petunia]
gb|ADL36628.1|  C2H2L domain class transcription factor                 121   7e-30   
ref|XP_009599326.1|  PREDICTED: zinc finger protein ZAT11-like          121   7e-30   
ref|XP_006403670.1|  hypothetical protein EUTSA_v10010956mg             121   7e-30   
gb|KHN05931.1|  Zinc finger protein ZAT11                               120   8e-30   
ref|NP_001235351.1|  uncharacterized protein LOC100526874               121   8e-30   
ref|XP_010553303.1|  PREDICTED: zinc finger protein ZAT11-like          121   9e-30   
ref|XP_008385163.1|  PREDICTED: zinc finger protein ZAT12-like          120   1e-29   
gb|AFK48956.1|  unknown                                                 119   1e-29   
ref|NP_001236265.1|  uncharacterized protein LOC100500316               120   2e-29   
ref|XP_008795640.1|  PREDICTED: zinc finger protein ZAT12-like          120   2e-29   
ref|XP_008385161.1|  PREDICTED: zinc finger protein ZAT12-like          120   2e-29   
ref|XP_010505329.1|  PREDICTED: zinc finger protein ZAT11-like          120   2e-29   
ref|XP_004302781.1|  PREDICTED: zinc finger protein ZAT11-like          120   3e-29   
ref|XP_008359103.1|  PREDICTED: zinc finger protein ZAT12-like          119   3e-29   
gb|AFK46502.1|  unknown                                                 119   3e-29   
ref|XP_006424755.1|  hypothetical protein CICLE_v10029464mg             119   3e-29   
ref|XP_007027111.1|  C2H2 and C2HC zinc fingers superfamily prote...    120   4e-29   
gb|KHN30196.1|  Zinc finger protein ZAT11                               119   4e-29   
ref|XP_010517014.1|  PREDICTED: zinc finger protein ZAT11-like          119   5e-29   
ref|XP_009143499.1|  PREDICTED: zinc finger protein ZAT11               119   5e-29   
ref|XP_009420085.1|  PREDICTED: zinc finger protein ZAT12-like          119   6e-29   
ref|XP_006345938.1|  PREDICTED: zinc finger protein ZAT11-like          118   6e-29   
emb|CAA67230.1|  zinc finger protein                                    119   7e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_181279.1|  zinc finger protein ZAT11                             119   8e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010905716.1|  PREDICTED: zinc finger protein ZAT12-like          117   1e-28   
ref|XP_004306355.1|  PREDICTED: zinc finger protein ZAT11-like          117   1e-28   
emb|CDY65670.1|  BnaCnng48130D                                          118   1e-28   
ref|XP_009139386.1|  PREDICTED: zinc finger protein ZAT11-like          118   1e-28   
ref|XP_004142087.1|  PREDICTED: zinc finger protein ZAT11-like          117   2e-28   
ref|XP_004495268.1|  PREDICTED: zinc finger protein ZAT11-like          117   2e-28   
ref|XP_007144473.1|  hypothetical protein PHAVU_007G159000g             116   2e-28   
ref|XP_009771157.1|  PREDICTED: zinc finger protein ZAT11-like          117   3e-28   
gb|KHN37328.1|  Zinc finger protein ZAT11                               117   3e-28   
ref|XP_010504128.1|  PREDICTED: zinc finger protein ZAT11-like          117   4e-28   
ref|XP_008369844.1|  PREDICTED: zinc finger protein ZAT11-like          117   5e-28   
ref|XP_010669838.1|  PREDICTED: zinc finger protein ZAT12-like          117   5e-28   
ref|XP_007144472.1|  hypothetical protein PHAVU_007G158900g             116   5e-28   
ref|XP_008448374.1|  PREDICTED: zinc finger protein ZAT11-like          115   5e-28   
ref|XP_010509338.1|  PREDICTED: zinc finger protein ZAT11               116   5e-28   
ref|XP_008447526.1|  PREDICTED: zinc finger protein ZAT11               116   5e-28   
gb|KHN02411.1|  Zinc finger protein ZAT11-like protein                  115   6e-28   
ref|XP_002879670.1|  zinc finger family protein                         116   6e-28   
ref|XP_004147699.1|  PREDICTED: zinc finger protein ZAT11-like          116   9e-28   
ref|XP_009402337.1|  PREDICTED: zinc finger protein ZAT12-like          115   9e-28   
ref|XP_010431330.1|  PREDICTED: zinc finger protein ZAT11-like          116   9e-28   
ref|XP_010515858.1|  PREDICTED: zinc finger protein ZAT11-like          115   9e-28   
ref|NP_001236732.1|  uncharacterized protein LOC100500607               114   1e-27   
ref|XP_008461644.1|  PREDICTED: zinc finger protein ZAT12-like          115   2e-27   
ref|XP_009338354.1|  PREDICTED: zinc finger protein ZAT12-like          116   2e-27   
emb|CDP09001.1|  unnamed protein product                                114   2e-27   
gb|KHN21982.1|  Zinc finger protein ZAT8                                114   2e-27   
emb|CDY30857.1|  BnaC04g27120D                                          114   3e-27   
ref|XP_006295072.1|  hypothetical protein CARUB_v10024141mg             114   3e-27   
ref|NP_190928.1|  C2H2-type zinc finger protein                         114   4e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004497300.1|  PREDICTED: zinc finger protein ZAT11-like          114   4e-27   
ref|XP_004148235.1|  PREDICTED: zinc finger protein ZAT11-like          112   5e-27   
ref|XP_009416690.1|  PREDICTED: zinc finger protein ZAT11-like          113   5e-27   
ref|XP_008457541.1|  PREDICTED: zinc finger protein ZAT12-like          113   7e-27   
gb|KHN23143.1|  Zinc finger protein ZAT11                               113   7e-27   
ref|XP_003520631.1|  PREDICTED: zinc finger protein ZAT11-like          113   7e-27   
ref|XP_010541384.1|  PREDICTED: zinc finger protein ZAT12-like          112   9e-27   
ref|XP_010097386.1|  Zinc finger protein ZAT11                          113   1e-26   
ref|XP_003537203.1|  PREDICTED: zinc finger protein ZAT11-like          113   1e-26   
ref|XP_006590993.1|  PREDICTED: zinc finger protein ZAT11-like          112   1e-26   
ref|XP_002876215.1|  zinc finger family protein                         113   1e-26   
gb|KHN32102.1|  Zinc finger protein ZAT12                               112   1e-26   
gb|KGN65670.1|  hypothetical protein Csa_1G481720                       112   1e-26   
gb|KHN05934.1|  Zinc finger protein ZAT11                               112   1e-26   
ref|XP_009117667.1|  PREDICTED: zinc finger protein ZAT11-like          112   1e-26   
ref|XP_009377110.1|  PREDICTED: zinc finger protein ZAT11-like          112   2e-26   
ref|XP_008776431.1|  PREDICTED: zinc finger protein ZAT11-like          112   2e-26   
ref|XP_010920692.1|  PREDICTED: zinc finger protein ZAT12-like          112   2e-26   
ref|XP_003597339.1|  Zinc finger protein                                111   2e-26   
ref|XP_010542618.1|  PREDICTED: zinc finger protein ZAT12-like          112   2e-26   
ref|XP_004241248.2|  PREDICTED: zinc finger protein ZAT11-like          110   3e-26   
ref|XP_010228788.1|  PREDICTED: zinc finger protein ZAT11-like          112   3e-26   
ref|XP_009594752.1|  PREDICTED: zinc finger protein ZAT11-like          111   4e-26   
ref|XP_007162678.1|  hypothetical protein PHAVU_001G170800g             112   5e-26   
ref|XP_004305218.1|  PREDICTED: zinc finger protein ZAT11-like          111   5e-26   
ref|XP_007132100.1|  hypothetical protein PHAVU_011G066800g             109   8e-26   
gb|KHN09437.1|  Zinc finger protein ZAT11                               109   8e-26   
ref|NP_001235663.1|  uncharacterized protein LOC100526897               110   1e-25   
ref|NP_001049734.1|  Os03g0279700                                       110   1e-25   Oryza sativa Japonica Group [Japonica rice]
gb|KFK32262.1|  hypothetical protein AALP_AA6G219400                    109   1e-25   
gb|EEE58806.1|  hypothetical protein OsJ_10357                          110   1e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004165931.1|  PREDICTED: zinc finger protein ZAT12-like          109   1e-25   
ref|XP_004149058.1|  PREDICTED: zinc finger protein ZAT12-like          109   1e-25   
ref|XP_002465455.1|  hypothetical protein SORBIDRAFT_01g039190          110   2e-25   Sorghum bicolor [broomcorn]
ref|XP_006291929.1|  hypothetical protein CARUB_v10018114mg             109   2e-25   
dbj|BAA21925.1|  ZPT2-8                                                 108   2e-25   Petunia x hybrida [garden petunia]
ref|XP_010047376.1|  PREDICTED: zinc finger protein ZAT11-like          108   3e-25   
ref|XP_010521816.1|  PREDICTED: zinc finger protein ZAT12-like          108   3e-25   
gb|AGK28205.1|  C2H2-type zinc finger protein 7                         108   4e-25   
gb|KEH42344.1|  Cys2-His2 zinc finger transcription factor              108   4e-25   
ref|XP_009421348.1|  PREDICTED: zinc finger protein ZAT12-like          108   4e-25   
ref|XP_008654280.1|  PREDICTED: zinc finger protein ZAT12-like          108   4e-25   
ref|XP_009404616.1|  PREDICTED: zinc finger protein ZAT12-like          107   5e-25   
ref|NP_200790.1|  high light responsive zinc finger protein ZAT12       107   6e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004984762.1|  PREDICTED: zinc finger protein ZAT11-like          108   6e-25   
ref|XP_010520301.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    107   7e-25   
ref|XP_009604696.1|  PREDICTED: zinc finger protein ZAT12-like          108   7e-25   
ref|XP_003540733.1|  PREDICTED: zinc finger protein ZAT12-like          107   8e-25   
ref|XP_006409904.1|  hypothetical protein EUTSA_v10017375mg             107   8e-25   
ref|XP_009341517.1|  PREDICTED: zinc finger protein ZAT11-like          108   8e-25   
ref|XP_010529859.1|  PREDICTED: zinc finger protein ZAT11-like          108   9e-25   
ref|XP_002864652.1|  hypothetical protein ARALYDRAFT_919218             107   1e-24   
ref|XP_010920697.1|  PREDICTED: zinc finger protein ZAT11-like          106   1e-24   
ref|XP_008807698.1|  PREDICTED: zinc finger protein ZAT5                109   1e-24   
ref|XP_003541392.1|  PREDICTED: zinc finger protein ZAT11-like          108   1e-24   
ref|XP_002879181.1|  zinc finger family protein                         106   2e-24   
ref|NP_180439.1|  C2H2-type zinc finger-containing protein              106   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010414490.1|  PREDICTED: zinc finger protein ZAT12-like          106   2e-24   
ref|XP_010510589.1|  PREDICTED: zinc finger protein ZAT12-like          105   3e-24   
ref|XP_008794835.1|  PREDICTED: zinc finger protein ZAT11-like          105   3e-24   
ref|XP_010470052.1|  PREDICTED: zinc finger protein ZAT12-like          105   3e-24   
emb|CDX77198.1|  BnaC04g39930D                                          105   3e-24   
ref|XP_009103876.1|  PREDICTED: zinc finger protein ZAT11-like          106   3e-24   
dbj|BAA21924.1|  ZPT2-7                                                 105   3e-24   Petunia x hybrida [garden petunia]
ref|XP_006295104.1|  hypothetical protein CARUB_v10024179mg             106   3e-24   
ref|XP_010483627.1|  PREDICTED: zinc finger protein ZAT12-like          105   4e-24   
ref|XP_010112909.1|  Zinc finger protein ZAT8                           106   4e-24   
gb|KEH44476.1|  C2H2-type zinc finger protein                           107   4e-24   
ref|XP_009140933.1|  PREDICTED: zinc finger protein ZAT12-like          105   4e-24   
ref|XP_004960500.1|  PREDICTED: zinc finger protein ZAT12-like          106   4e-24   
ref|XP_009131969.1|  PREDICTED: zinc finger protein ZAT12-like          105   4e-24   
emb|CDY07578.1|  BnaC06g14860D                                          105   5e-24   
ref|XP_007009441.1|  Uncharacterized protein TCM_042836                 105   6e-24   
gb|AAM65582.1|  zinc finger protein Zat12                               105   6e-24   
ref|XP_006281040.1|  hypothetical protein CARUB_v10027055mg             107   6e-24   
gb|AFW74905.1|  ZFP16-1                                                 106   6e-24   
ref|XP_008660288.1|  PREDICTED: zinc finger protein ZAT8-like           106   7e-24   
ref|XP_009384889.1|  PREDICTED: zinc finger protein ZAT11-like          104   7e-24   
ref|XP_009759207.1|  PREDICTED: zinc finger protein ZAT8-like           105   7e-24   
ref|XP_009396915.1|  PREDICTED: zinc finger protein ZAT5-like           106   1e-23   
ref|XP_006400912.1|  hypothetical protein EUTSA_v10014884mg             104   1e-23   
ref|NP_001054460.1|  Os05g0114400                                       105   1e-23   
ref|XP_009779270.1|  PREDICTED: zinc finger protein ZAT11-like          104   1e-23   
ref|XP_010455559.1|  PREDICTED: zinc finger protein ZAT12-like          104   1e-23   
ref|XP_009402256.1|  PREDICTED: zinc finger protein ZAT12-like          104   1e-23   
gb|ABA25899.1|  HvZFP16-1                                               104   2e-23   
gb|ABA25898.1|  ZFP16-1                                                 104   2e-23   
gb|ACD02025.1|  Q-type C2H2 zinc finger protein                         104   2e-23   
gb|AAP74357.1|  C2H2 type zinc finger transcription factor ZFP16        104   2e-23   
gb|EMT21733.1|  hypothetical protein F775_52535                         104   2e-23   
ref|XP_009103709.1|  PREDICTED: zinc finger protein ZAT12-like          103   2e-23   
emb|CDY15775.1|  BnaC04g15490D                                          103   2e-23   
emb|CDY04582.1|  BnaA07g14080D                                          103   2e-23   
emb|CBI31394.3|  unnamed protein product                                106   3e-23   
ref|XP_010910785.1|  PREDICTED: zinc finger protein ZAT5-like           105   4e-23   
emb|CDX80226.1|  BnaC09g35160D                                          103   4e-23   
emb|CDX71073.1|  BnaC03g11570D                                          103   4e-23   
ref|XP_010443762.1|  PREDICTED: zinc finger protein ZAT12               102   6e-23   
gb|ABA25903.1|  ZFP16-2                                                 102   7e-23   
ref|XP_003569008.1|  PREDICTED: zinc finger protein ZAT12-like          103   7e-23   
gb|ABA25901.1|  ZFP16-2                                                 102   8e-23   
ref|XP_006381377.1|  hypothetical protein POPTR_0006s12340g             105   8e-23   
ref|XP_010558885.1|  PREDICTED: zinc finger protein ZAT5-like           105   1e-22   
ref|XP_002440475.1|  hypothetical protein SORBIDRAFT_09g001560          102   1e-22   
gb|AFK41453.1|  unknown                                                 102   1e-22   
ref|NP_001150802.1|  ZFP16-1                                            102   1e-22   
dbj|BAA21926.1|  ZPT2-9                                                 101   1e-22   
dbj|BAJ98547.1|  predicted protein                                      102   2e-22   
ref|XP_006354388.1|  PREDICTED: zinc finger protein ZAT5-like           103   2e-22   
gb|ABB55254.1|  C2H2 zinc finger protein 1                              100   3e-22   
ref|XP_010933179.1|  PREDICTED: zinc finger protein ZAT5-like           103   3e-22   
ref|XP_004294532.1|  PREDICTED: zinc finger protein ZAT5-like           103   4e-22   
ref|XP_008801217.1|  PREDICTED: zinc finger protein ZAT5-like           102   4e-22   
gb|EPS70731.1|  hypothetical protein M569_04032                       99.0    4e-22   
ref|XP_010050475.1|  PREDICTED: zinc finger protein ZAT5-like           102   4e-22   
emb|CDY00945.1|  BnaC05g42550D                                          103   5e-22   
ref|XP_010685828.1|  PREDICTED: zinc finger protein ZAT12               102   5e-22   
emb|CDY65692.1|  BnaA02g06790D                                          100   5e-22   
ref|XP_003541393.1|  PREDICTED: zinc finger protein ZAT11-like          100   5e-22   
ref|XP_011077299.1|  PREDICTED: zinc finger protein ZAT5                102   6e-22   
ref|XP_010098815.1|  Zinc finger protein ZAT5                           102   6e-22   
ref|XP_010905714.1|  PREDICTED: zinc finger protein ZAT11-like        99.4    7e-22   
emb|CBI17130.3|  unnamed protein product                                100   8e-22   
ref|NP_190195.1|  zinc finger protein ZAT7                            99.8    8e-22   
ref|XP_008795823.1|  PREDICTED: zinc finger protein ZAT11-like        99.8    1e-21   
ref|XP_009608411.1|  PREDICTED: zinc finger protein ZAT12-like        99.8    1e-21   
gb|EMS52089.1|  hypothetical protein TRIUR3_04728                       100   1e-21   
gb|ABB52061.1|  C2H2-type zinc finger protein                         99.0    1e-21   
ref|XP_006837964.1|  hypothetical protein AMTR_s00102p00073930          100   1e-21   
ref|NP_001288817.1|  zinc finger protein ZAT12                        99.0    1e-21   
ref|NP_190194.1|  zinc finger protein ZAT8                            98.2    2e-21   
emb|CDY08602.1|  BnaA05g28380D                                          101   2e-21   
ref|XP_009801628.1|  PREDICTED: zinc finger protein ZAT12-like        98.2    3e-21   
emb|CDY11027.1|  BnaA03g46860D                                        99.8    3e-21   
ref|XP_009120502.1|  PREDICTED: zinc finger protein ZAT12-like        97.8    3e-21   
ref|XP_010229432.1|  PREDICTED: zinc finger protein ZAT12-like        97.1    3e-21   
gb|KFK27524.1|  c2h2-type zinc finger protein                         97.8    3e-21   
ref|NP_001151309.1|  zinc finger, C2H2 type family protein            98.6    4e-21   
ref|XP_009126657.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  97.4    4e-21   
tpg|DAA56924.1|  TPA: zinc finger, C2H2 type family protein           99.0    4e-21   
ref|XP_010910911.1|  PREDICTED: zinc finger protein ZAT8-like         98.2    4e-21   
ref|XP_009394662.1|  PREDICTED: zinc finger protein ZAT5-like         99.8    4e-21   
ref|XP_009776555.1|  PREDICTED: zinc finger protein ZAT5-like           100   4e-21   
emb|CDY30924.1|  BnaA06g19890D                                        97.4    4e-21   
ref|XP_011094585.1|  PREDICTED: zinc finger protein ZAT5-like         99.8    5e-21   
ref|XP_009386213.1|  PREDICTED: zinc finger protein ZAT5-like         99.8    5e-21   
ref|XP_010552999.1|  PREDICTED: zinc finger protein ZAT5              99.8    5e-21   
ref|XP_008666945.1|  PREDICTED: zinc finger protein ZAT12-like        96.7    6e-21   
ref|XP_010542577.1|  PREDICTED: zinc finger protein ZAT5-like         99.4    7e-21   
ref|XP_009150251.1|  PREDICTED: zinc finger protein ZAT8-like         97.1    8e-21   
ref|XP_002880944.1|  hypothetical protein ARALYDRAFT_481690           99.0    8e-21   
emb|CDY41350.1|  BnaA01g31690D                                        98.6    8e-21   
gb|KDP43958.1|  hypothetical protein JCGZ_05425                       99.4    8e-21   
ref|XP_009390198.1|  PREDICTED: zinc finger protein ZAT5-like         99.0    9e-21   
ref|XP_006649865.1|  PREDICTED: zinc finger protein 1-like            97.1    1e-20   
emb|CDY30501.1|  BnaA04g16320D                                        98.2    1e-20   
gb|EPS68966.1|  hypothetical protein M569_05802                       95.9    1e-20   
emb|CDM84884.1|  unnamed protein product                              97.1    1e-20   
ref|XP_009416689.1|  PREDICTED: zinc finger protein ZAT11-like        95.5    1e-20   
ref|XP_003536961.1|  PREDICTED: zinc finger protein ZAT11-like        96.3    2e-20   
ref|XP_009384823.1|  PREDICTED: zinc finger protein ZAT11-like        95.1    2e-20   
ref|XP_008226652.1|  PREDICTED: zinc finger protein ZAT5              98.2    2e-20   
ref|XP_010510676.1|  PREDICTED: zinc finger protein ZAT5              97.8    2e-20   
gb|EYU37028.1|  hypothetical protein MIMGU_mgv1a021331mg              97.4    2e-20   
ref|XP_004246607.1|  PREDICTED: zinc finger protein ZAT5              98.2    2e-20   
ref|XP_007205449.1|  hypothetical protein PRUPE_ppa007860mg           98.2    2e-20   
emb|CDX68366.1|  BnaC01g24440D                                        95.9    2e-20   
ref|XP_011089966.1|  PREDICTED: zinc finger protein ZAT5-like         97.8    2e-20   
emb|CDY44852.1|  BnaC09g50520D                                        98.2    2e-20   
ref|XP_002458732.1|  hypothetical protein SORBIDRAFT_03g039250        97.1    3e-20   
ref|XP_008779116.1|  PREDICTED: zinc finger protein ZAT5-like         97.8    3e-20   
ref|XP_010414581.1|  PREDICTED: zinc finger protein ZAT5-like         97.8    3e-20   
ref|XP_010503221.1|  PREDICTED: zinc finger protein ZAT8-like         95.5    3e-20   
emb|CDX80870.1|  BnaC03g01240D                                        97.1    3e-20   
ref|XP_010935821.1|  PREDICTED: zinc finger protein ZAT5-like         97.4    3e-20   
emb|CAA43111.1|  DNA-binding protein                                  97.4    3e-20   
emb|CDY11255.1|  BnaA03g00910D                                        97.1    3e-20   
emb|CDY70037.1|  BnaCnng66450D                                        96.7    4e-20   
ref|XP_010109936.1|  Zinc finger protein ZAT5                         97.4    4e-20   
dbj|BAA21920.1|  ZPT2-11                                              97.1    4e-20   
emb|CDX70228.1|  BnaA10g25770D                                        97.4    4e-20   
ref|XP_011018810.1|  PREDICTED: zinc finger protein ZAT5-like         97.4    4e-20   
emb|CDY30925.1|  BnaA06g19880D                                        94.7    4e-20   
ref|XP_002267645.1|  PREDICTED: zinc finger protein ZAT5              96.7    5e-20   
ref|NP_190193.1|  C2H2-type zinc finger family protein                94.4    6e-20   
gb|ABK28589.1|  unknown                                               94.4    6e-20   
ref|XP_008466979.1|  PREDICTED: zinc finger protein ZAT5-like         96.7    6e-20   
ref|XP_010940535.1|  PREDICTED: zinc finger protein ZAT5-like         96.7    6e-20   
gb|KFK32333.1|  hypothetical protein AALP_AA6G228200                  96.3    7e-20   
emb|CDY04544.1|  BnaA07g13700D                                        96.3    7e-20   
ref|XP_004240199.2|  PREDICTED: zinc finger protein ZAT5-like         93.2    8e-20   
ref|XP_008776407.1|  PREDICTED: zinc finger protein ZAT11-like        93.6    8e-20   
ref|XP_006418969.1|  hypothetical protein EUTSA_v10002839mg           94.7    8e-20   
ref|XP_010922394.1|  PREDICTED: zinc finger protein ZAT11-like        94.0    8e-20   
emb|CDY11288.1|  BnaA03g01240D                                        96.3    1e-19   
ref|XP_009420453.1|  PREDICTED: zinc finger protein ZAT5-like         95.5    1e-19   
emb|CDX71375.1|  BnaC04g16100D                                        95.5    1e-19   
ref|XP_010470129.1|  PREDICTED: zinc finger protein ZAT5-like         95.9    1e-19   
ref|XP_008788150.1|  PREDICTED: zinc finger protein ZAT11-like        92.8    1e-19   
ref|XP_007132339.1|  hypothetical protein PHAVU_011G086400g           95.9    1e-19   
emb|CBI30164.3|  unnamed protein product                              94.7    1e-19   
gb|KFK33964.1|  hypothetical protein AALP_AA5G084600                  93.2    1e-19   
ref|XP_006347206.1|  PREDICTED: zinc finger protein ZAT5-like         95.9    1e-19   
ref|XP_003567257.1|  PREDICTED: zinc finger protein ZAT12-like        94.0    2e-19   
gb|EAY76430.1|  hypothetical protein OsI_04363                        94.4    2e-19   
gb|AAP31023.1|  zinc finger transcription factor ZFP19                94.4    2e-19   
ref|XP_009150252.1|  PREDICTED: zinc finger protein ZAT8-like         93.2    2e-19   
ref|XP_006398801.1|  hypothetical protein EUTSA_v10014348mg           95.1    2e-19   
ref|XP_004167789.1|  PREDICTED: zinc finger protein ZAT5-like         93.6    2e-19   
ref|XP_002323497.1|  hypothetical protein POPTR_0016s10790g           95.5    2e-19   
gb|EPS70723.1|  hypothetical protein M569_04037                       92.8    2e-19   
ref|NP_001044747.2|  Os01g0838600                                     94.4    2e-19   
ref|XP_002877452.1|  zinc finger family protein                       92.8    2e-19   
ref|XP_009382162.1|  PREDICTED: zinc finger protein ZAT5-like         95.1    2e-19   
ref|XP_004970514.1|  PREDICTED: zinc finger protein ZAT11-like        94.0    2e-19   
ref|XP_010426037.1|  PREDICTED: zinc finger protein ZAT8-like iso...  93.2    2e-19   
gb|KHN05932.1|  Zinc finger protein ZAT11                             92.4    2e-19   
ref|XP_004145820.1|  PREDICTED: zinc finger protein ZAT5-like         94.0    3e-19   
ref|XP_009407475.1|  PREDICTED: zinc finger protein ZAT8-like         92.0    3e-19   
ref|XP_008657926.1|  PREDICTED: zinc finger protein ZAT8-like         92.8    3e-19   
ref|XP_010426036.1|  PREDICTED: zinc finger protein ZAT8-like iso...  92.8    3e-19   
ref|XP_003538193.1|  PREDICTED: zinc finger protein ZAT5-like         94.7    3e-19   
gb|KGN46888.1|  hypothetical protein Csa_6G148300                     94.7    3e-19   
emb|CDX86044.1|  BnaC03g55590D                                        93.2    3e-19   
ref|XP_010503222.1|  PREDICTED: zinc finger protein ZAT8-like         92.4    3e-19   
ref|XP_004306266.1|  PREDICTED: zinc finger protein ZAT5-like         94.4    3e-19   
ref|XP_002265877.1|  PREDICTED: zinc finger protein ZAT5              94.7    3e-19   
ref|XP_010514932.1|  PREDICTED: zinc finger protein ZAT8-like         92.4    3e-19   
ref|XP_010426035.1|  PREDICTED: zinc finger protein ZAT8-like         92.4    4e-19   
emb|CDY58436.1|  BnaC03g71210D                                        94.4    4e-19   
gb|AAY40247.1|  Cys2/His2 zinc-finger transcription factor            94.0    5e-19   
ref|XP_010243202.1|  PREDICTED: zinc finger protein ZAT5              94.0    5e-19   
ref|XP_006606310.1|  PREDICTED: zinc finger protein ZAT5-like         94.4    5e-19   
ref|XP_002456606.1|  hypothetical protein SORBIDRAFT_03g039270        92.4    5e-19   
gb|KDO47574.1|  hypothetical protein CISIN_1g045639mg                 94.4    6e-19   
gb|KHN00957.1|  Zinc finger protein ZAT5                              94.0    6e-19   
ref|XP_009149989.1|  PREDICTED: zinc finger protein ZAT8-like         92.0    6e-19   
gb|EPS71955.1|  hypothetical protein M569_02805                       88.6    7e-19   
gb|AAD29833.1|  putative zinc-finger protein                          93.6    7e-19   
ref|XP_006349125.1|  PREDICTED: zinc finger protein ZAT5-like         93.6    7e-19   
ref|NP_180387.2|  zinc finger protein ZAT5                            93.6    7e-19   
ref|XP_002315335.2|  putative zinc finger family protein              93.6    8e-19   
emb|CAA67233.1|  zinc finger protein                                  93.2    8e-19   
ref|XP_006592720.1|  PREDICTED: zinc finger protein ZAT5-like iso...  93.6    8e-19   
gb|AHN52234.1|  C2H2-type zinc finger protein 3                       93.6    9e-19   
ref|XP_007027469.1|  Nucleic acid binding protein, putative           93.2    9e-19   
ref|XP_002877453.1|  hypothetical protein ARALYDRAFT_484989           90.9    1e-18   
emb|CDY10376.1|  BnaCnng02770D                                        92.8    1e-18   
ref|XP_010267264.1|  PREDICTED: zinc finger protein ZAT5              92.8    1e-18   
emb|CDX70302.1|  BnaA10g26510D                                        92.4    1e-18   
gb|EAY92363.1|  hypothetical protein OsI_14092                        90.9    2e-18   
ref|XP_010514933.1|  PREDICTED: zinc finger protein ZAT8-like         90.5    2e-18   
ref|XP_009384553.1|  PREDICTED: zinc finger protein ZAT5-like         92.4    2e-18   
ref|XP_006409841.1|  hypothetical protein EUTSA_v10016842mg           92.8    2e-18   
ref|XP_008674848.1|  PREDICTED: zinc finger protein ZAT9-like         90.5    2e-18   
gb|AAO65873.1|  putative Cys2/His2 zinc-finger protein                90.5    2e-18   
ref|XP_008657927.1|  PREDICTED: zinc finger protein ZAT12-like        90.9    2e-18   
gb|AFW84646.1|  hypothetical protein ZEAMMB73_002439                  90.9    2e-18   
ref|XP_009122694.1|  PREDICTED: zinc finger protein ZAT5-like         91.7    3e-18   
ref|XP_002439925.1|  hypothetical protein SORBIDRAFT_09g022660        90.5    3e-18   
ref|XP_004235433.2|  PREDICTED: zinc finger protein ZAT11-like        89.7    3e-18   
ref|XP_008650662.1|  PREDICTED: zinc finger protein ZAT12-like        90.1    3e-18   
ref|XP_009613500.1|  PREDICTED: zinc finger protein ZAT5-like         91.3    4e-18   
ref|XP_009140851.1|  PREDICTED: zinc finger protein ZAT5-like         91.3    5e-18   
gb|AAL76091.1|  C2H2 zinc finger protein                              89.0    5e-18   
ref|XP_011024338.1|  PREDICTED: zinc finger protein ZAT5              90.9    5e-18   
ref|XP_009103654.1|  PREDICTED: zinc finger protein ZAT5              90.9    6e-18   
gb|EAZ14093.1|  hypothetical protein OsJ_04016                        88.6    6e-18   
gb|EAY76434.1|  hypothetical protein OsI_04367                        88.6    6e-18   
ref|XP_010067204.1|  PREDICTED: zinc finger protein ZAT5              90.1    7e-18   
emb|CDM84910.1|  unnamed protein product                              89.4    7e-18   
ref|XP_010412551.1|  PREDICTED: zinc finger protein ZAT7-like         87.8    8e-18   
gb|EMS49105.1|  Zinc finger protein 1                                 87.4    8e-18   
emb|CDY04886.1|  BnaAnng00680D                                        90.1    8e-18   
ref|XP_010050234.1|  PREDICTED: zinc finger protein ZAT5-like         90.1    8e-18   
gb|KGN52233.1|  hypothetical protein Csa_5G622500                     90.5    9e-18   
ref|XP_007144383.1|  hypothetical protein PHAVU_007G151700g           90.1    9e-18   
ref|XP_011031622.1|  PREDICTED: zinc finger protein ZAT5-like         90.1    1e-17   
ref|XP_007016063.1|  C2H2-type zinc finger family protein, putative   90.1    1e-17   
ref|XP_006294403.1|  hypothetical protein CARUB_v10023420mg           90.9    1e-17   
ref|XP_009125507.1|  PREDICTED: zinc finger protein ZAT5-like         89.7    1e-17   
gb|KCW65288.1|  hypothetical protein EUGRSUZ_G02745                   89.7    1e-17   
ref|XP_010507193.1|  PREDICTED: zinc finger protein ZAT8-like         87.0    1e-17   
dbj|BAA19111.1|  PEThy;ZPT2-6                                         90.1    1e-17   
ref|NP_195971.1|  C2H2-type zinc finger protein                       89.4    2e-17   
ref|XP_009406954.1|  PREDICTED: zinc finger protein ZAT12-like        86.7    2e-17   
ref|XP_004986152.1|  PREDICTED: zinc finger protein ZAT12-like        87.0    2e-17   
ref|XP_002871040.1|  zinc finger family protein                       89.4    2e-17   
ref|XP_010523126.1|  PREDICTED: zinc finger protein ZAT5-like         89.0    2e-17   
gb|KHN21482.1|  Zinc finger protein ZAT5                              89.0    2e-17   
ref|XP_009146836.1|  PREDICTED: zinc finger protein ZAT5-like         90.1    2e-17   
ref|XP_009130761.1|  PREDICTED: zinc finger protein ZAT5              89.0    2e-17   



>dbj|BAA21921.1| ZPT2-12 [Petunia x hybrida]
Length=174

 Score =   166 bits (419),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 122/178 (69%), Gaps = 12/178 (7%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKRSRE   VEA AMANCLMLL+ +   S+S+  +       F+CKTC+K+F SFQALGG
Sbjct  4    MKRSREDRQVEAAAMANCLMLLSKLNDKSTSTTTTNQDHHNDFECKTCNKRFSSFQALGG  63

Query  531  HRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFE  352
            HRASHK+PKL+  A GE    P   KMH CSICG+EF++GQALGGHMRRHRAA+     +
Sbjct  64   HRASHKRPKLLIGA-GEFLVQPSSKKMHECSICGMEFSLGQALGGHMRRHRAAI-----D  117

Query  351  NppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND-DLKIESTTP-ATPVLR  184
                A   AM IPVLK++ SSKRIF     LDLNLTP   D DLK+  T P ++PVLR
Sbjct  118  EKSKAATKAMMIPVLKKSNSSKRIFC----LDLNLTPRNEDVDLKLWPTAPISSPVLR  171



>ref|XP_009628782.1| PREDICTED: zinc finger protein ZAT12-like [Nicotiana tomentosiformis]
Length=181

 Score =   160 bits (405),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 125/182 (69%), Gaps = 11/182 (6%)
 Frame = -2

Query  711  MKRSREY-AGVEAEAMANC-LMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQAL  538
            +KRSRE    VEAEAMANC LMLL+ +  N+++S      +   F+CKTC+K+FPSFQAL
Sbjct  4    IKRSREDDMQVEAEAMANCALMLLSRLNNNNTTSTDRDYDN--GFECKTCNKRFPSFQAL  61

Query  537  GGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEG  358
            GGHRASHK+PKL+A A GE     +K+KMH CSICG+EF++GQALGGHMRRHR  + K  
Sbjct  62   GGHRASHKRPKLLAGA-GEFLVQSKKNKMHECSICGMEFSLGQALGGHMRRHRDEINKTS  120

Query  357  FE--NppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTP-ATPVL  187
                     +     IPVLK++ SSKRIF     LDLNLTP  + DLK+  T P ++P+L
Sbjct  121  TVAGKTMIPVVGKKIIPVLKKSNSSKRIF---CGLDLNLTPDIDVDLKLWPTAPVSSPIL  177

Query  186  RC  181
            RC
Sbjct  178  RC  179



>dbj|BAA21922.1| ZPT2-13 [Petunia x hybrida]
Length=175

 Score =   159 bits (401),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 117/176 (66%), Gaps = 13/176 (7%)
 Frame = -2

Query  705  RSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGGHR  526
            RS EY  VEAEAMANCLMLL+ +  +++S       +   F+CKTC+K+FPSFQALGGHR
Sbjct  8    RSEEYGQVEAEAMANCLMLLSKLNDHNTSKNQDHHNE---FECKTCNKRFPSFQALGGHR  64

Query  525  ASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFENp  346
            ASHK+ K++  A        +K+KMH CSICG+EF++GQALGGHMRRHR     E  +  
Sbjct  65   ASHKRTKVLTGAGEFLAQQAKKNKMHECSICGMEFSLGQALGGHMRRHR----DENNKTL  120

Query  345  paaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND-DLKIESTTP-ATPVLR  184
              A      IPVLK++ SSKRIF     LDLNLTP   D DLK+  T P ++PVLR
Sbjct  121  KVARKTTTMIPVLKKSNSSKRIFC----LDLNLTPRNEDVDLKLWPTAPISSPVLR  172



>ref|XP_009608410.1| PREDICTED: zinc finger protein ZAT12-like [Nicotiana tomentosiformis]
Length=181

 Score =   159 bits (401),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 128/182 (70%), Gaps = 13/182 (7%)
 Frame = -2

Query  711  MKRSREYA-GVEAEAMANC-LMLLAHVGRNssssppsaSKDL-CSFQCKTCDKKFPSFQA  541
            +KRSRE    VEAEAMANC LMLL+ +  N++++  S  +D    F+CKTC+K+FPSFQA
Sbjct  4    IKRSREEDRQVEAEAMANCALMLLSRL--NNNNNATSTDRDYHNDFECKTCNKRFPSFQA  61

Query  540  LGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKE  361
            LGGHRASHK+PKL+A A GE     +K+KMH CSICG+EF++GQALGGHMRRHR  + K 
Sbjct  62   LGGHRASHKRPKLLAGA-GEFLVQSKKNKMHECSICGMEFSLGQALGGHMRRHRDEINKT  120

Query  360  GFE--NppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTP-ATPV  190
                 N    +     IPVLK++ SSKRIF     LDLNL+P EN DLK+  T P ++PV
Sbjct  121  SVAAGNTMIPVARKKMIPVLKKSNSSKRIFC----LDLNLSPDENVDLKLWPTAPVSSPV  176

Query  189  LR  184
            LR
Sbjct  177  LR  178



>ref|XP_009622960.1| PREDICTED: zinc finger protein ZAT12-like [Nicotiana tomentosiformis]
Length=175

 Score =   157 bits (396),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 122/181 (67%), Gaps = 15/181 (8%)
 Frame = -2

Query  711  MKRSREY-AGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALG  535
            MKRSREY   VEAEA+ANCLM  +H+   +SS+  +       F+CKTC+K FPSFQA G
Sbjct  4    MKRSREYDTKVEAEAIANCLMFFSHLNNKTSSNNHN------EFECKTCNKCFPSFQAHG  57

Query  534  GHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGF  355
            GHRASHK+PKL+A A G+     +K+KMH CSICG+EF++GQALGGHMRRHR  + K   
Sbjct  58   GHRASHKRPKLLAGA-GDFLVQSKKNKMHGCSICGMEFSLGQALGGHMRRHRDEINKTST  116

Query  354  E--NppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTP-ATPVLR  184
                    +     IPVLK++ SSK IF     LDL+L+P EN DLK+  T P ++PVLR
Sbjct  117  AAGKTIIPVVGKRIIPVLKQSNSSKMIFC----LDLSLSPDENVDLKLWPTAPVSSPVLR  172

Query  183  C  181
            C
Sbjct  173  C  173



>ref|XP_009773332.1| PREDICTED: zinc finger protein ZAT12-like [Nicotiana sylvestris]
Length=183

 Score =   155 bits (393),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 124/182 (68%), Gaps = 9/182 (5%)
 Frame = -2

Query  711  MKRSREY-AGVEAEAMANC-LMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQAL  538
            MKRSRE    VEAEAMANC LMLL+ +  N++++          F+CKTC+K+FPSFQAL
Sbjct  4    MKRSREADLQVEAEAMANCALMLLSRLNNNNNTTTSIDRDYHNGFECKTCNKRFPSFQAL  63

Query  537  GGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEG  358
            GGHRASHK+P+L+  A G+     +K+KMH CSICG+EF++GQALGGHMRRHR  + K  
Sbjct  64   GGHRASHKRPRLLTGA-GDFLVQSKKNKMHECSICGMEFSLGQALGGHMRRHRDEINKTS  122

Query  357  FE--NppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTP-ATPVL  187
                    ++     IPVLK++ SSKR+F     LDLNLTP  + DLK+  T P ++P+L
Sbjct  123  TAAGKTIVSVVEKKIIPVLKKSNSSKRVF---CGLDLNLTPDVDVDLKLWPTAPVSSPIL  179

Query  186  RC  181
            RC
Sbjct  180  RC  181



>ref|XP_006350750.1| PREDICTED: zinc finger protein ZAT11-like [Solanum tuberosum]
Length=164

 Score =   155 bits (391),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 113/183 (62%), Gaps = 23/183 (13%)
 Frame = -2

Query  723  MTMLMKRSREYAG-VEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSF  547
            MT LM++SRE  G VEA+AMANCLMLL+ + R+             SF+CKTC ++F SF
Sbjct  1    MTALMRKSREDNGDVEAQAMANCLMLLSSIDRDRRD----------SFECKTCKRRFSSF  50

Query  546  QALGGHRASHKKPK-LVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAM  370
            QALGGHR SHK  K  +           +K K+H C ICG+EF+MGQALGGHMRRHRA +
Sbjct  51   QALGGHRTSHKSMKSTIDIGKFLHGKLSKKRKVHECLICGMEFSMGQALGGHMRRHRAPV  110

Query  369  MKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPATPV  190
                  N          IPVLK++ SSKRIF     +DLNLTP ENDD +   T PA PV
Sbjct  111  ------NEIKDSSSVRRIPVLKKSNSSKRIFC----VDLNLTPDENDDFQFWPTAPA-PV  159

Query  189  LRC  181
            LRC
Sbjct  160  LRC  162



>ref|XP_009782299.1| PREDICTED: zinc finger protein ZAT12-like [Nicotiana sylvestris]
Length=180

 Score =   152 bits (385),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 122/181 (67%), Gaps = 12/181 (7%)
 Frame = -2

Query  711  MKRSREYA-GVEAEAMANC-LMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQAL  538
            MKRSRE    VEAEAMANC LMLL+ +  N+++S      +   F+CKTC+K+F SFQAL
Sbjct  4    MKRSREEERQVEAEAMANCALMLLSRLNNNNTTSTDRDYHN--EFECKTCNKRFQSFQAL  61

Query  537  GGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEG  358
            GGHRASHK+PKL+  A G+     +K+KMH CSICG+EF++GQALGGHMRRHR  + K  
Sbjct  62   GGHRASHKRPKLLTGA-GDFLVQSKKNKMHDCSICGMEFSLGQALGGHMRRHRDEINKTS  120

Query  357  FE--NppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTP-ATPVL  187
                     +     IPVLK++ SSKRIF     LDLNLTP  + DLK+  T P ++PVL
Sbjct  121  TAAGKTIIPVVGKKMIPVLKKSNSSKRIFC----LDLNLTPDVDVDLKLWPTEPVSSPVL  176

Query  186  R  184
            R
Sbjct  177  R  177



>emb|CDP16476.1| unnamed protein product [Coffea canephora]
Length=174

 Score =   150 bits (379),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 112/169 (66%), Gaps = 11/169 (7%)
 Frame = -2

Query  717  MLMKRSREYA----GVEAEAMANCLMLLAHVGRNssssppsaSKDLCS--FQCKTCDKKF  556
            M +KRSRE A     VE  A  N LMLL+ VG  ++S+    +       F+CKTC+KKF
Sbjct  1    MTVKRSREEALAAETVEETAAINLLMLLSRVGEATTSAAADQAATPSGRVFECKTCNKKF  60

Query  555  PSFQALGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRA  376
            P+FQALGGHRASHKK KL+A    +  +SP K K H C  CGLEF +GQALGGHMRRHRA
Sbjct  61   PTFQALGGHRASHKKLKLMAELLTQPSNSPRKPKKHECPFCGLEFPLGQALGGHMRRHRA  120

Query  375  AMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            A++ EG      +    +A+PVLKR+ SSKR+FG    LDLNL+P END
Sbjct  121  AIL-EGRREIDESRGRKVAVPVLKRSNSSKRVFG----LDLNLSPFEND  164



>emb|CDP09000.1| unnamed protein product [Coffea canephora]
Length=174

 Score =   150 bits (379),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 112/169 (66%), Gaps = 11/169 (7%)
 Frame = -2

Query  717  MLMKRSREYA----GVEAEAMANCLMLLAHVGRNssssppsaSKDLCS--FQCKTCDKKF  556
            M +KRSRE A     VE  A  N LMLL+ VG  ++S+    +       F+CKTC+KKF
Sbjct  1    MTVKRSREEALAAETVEETAAINLLMLLSRVGEATTSAAADQAATPSGRVFECKTCNKKF  60

Query  555  PSFQALGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRA  376
            P+FQALGGHRASHKK KL+A    +  +SP K K H C  CGLEF +GQALGGHMRRHRA
Sbjct  61   PTFQALGGHRASHKKLKLMAELLTQPSNSPRKPKKHECPFCGLEFPLGQALGGHMRRHRA  120

Query  375  AMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            A++ EG      +    +A+PVLKR+ SSKR+FG    LDLNL+P END
Sbjct  121  AIL-EGRREIDESRGRKVAVPVLKRSNSSKRVFG----LDLNLSPFEND  164



>ref|XP_002533000.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF29375.1| zinc finger protein, putative [Ricinus communis]
Length=192

 Score =   148 bits (374),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 113/180 (63%), Gaps = 21/180 (12%)
 Frame = -2

Query  717  MLMKRSREYAGVEAEAMANCLMLLAH---VGRNssssppsaSKDLCSFQCKTCDKKFPSF  547
            M MKR R+ A  ++  MA CLMLL+H        ++S    S +   F+CKTC+KKF SF
Sbjct  1    MAMKRVRQDAEFDSLDMAKCLMLLSHNLVENSKPTNSFIRTSSNDNMFECKTCNKKFSSF  60

Query  546  QALGGHRASHKKPKL-VAPAPGEQESSPE----------KSKMHRCSICGLEFAMGQALG  400
            QALGGHRASHK+P+L + PA   + +S +          K KMH CSICG+EFA+GQALG
Sbjct  61   QALGGHRASHKRPRLFMGPAADSKSASSDDQAVHSSGTKKPKMHECSICGVEFALGQALG  120

Query  399  GHMRRHRAAMMKEGFENppaaipm---amaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            GHMRRHRAA M + F +             +PVL+R+ SSKR+FG    LDLNLTP END
Sbjct  121  GHMRRHRAAAMAQTFASSAKVKNTGCVVQKLPVLRRSNSSKRVFG----LDLNLTPLEND  176



>ref|XP_010253292.1| PREDICTED: zinc finger protein ZAT12-like [Nelumbo nucifera]
Length=177

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 118/182 (65%), Gaps = 18/182 (10%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKRSR    ++   MANCLMLL+  G   S +P         F+CKTC++KFPSFQALGG
Sbjct  7    MKRSRVEGEIDNITMANCLMLLSRGGEADSMAPHRV------FECKTCNRKFPSFQALGG  60

Query  531  HRASHKKPKLV-APAPGEQ---ESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMK  364
            HRASHKKP+L+ A  P  Q    +   K K H CSICGLEFA+GQALGGHMRRHR+A + 
Sbjct  61   HRASHKKPRLMGADDPNHQAQLHNLQVKPKTHECSICGLEFAIGQALGGHMRRHRSA-LS  119

Query  363  EGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND-DLKIESTTPATPVL  187
            EG  +PP   P      VLKR++SS+R+    L LDLNLTP END DL++    P  PV+
Sbjct  120  EGLLSPPPPPPAPQVPAVLKRSSSSRRV----LCLDLNLTPLENDLDLQLGRKMP--PVV  173

Query  186  RC  181
             C
Sbjct  174  DC  175



>ref|XP_009622961.1| PREDICTED: zinc finger protein ZAT8-like [Nicotiana tomentosiformis]
Length=177

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 120/181 (66%), Gaps = 15/181 (8%)
 Frame = -2

Query  711  MKRSREYA-GVEAEAMANC-LMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQAL  538
            MKR+RE    VEA+AMANC LMLL+ +         ++S +   F+CKTC+K+FPSFQAL
Sbjct  4    MKRNREEDRQVEAQAMANCALMLLSRLN------DIASSNNHNEFECKTCNKRFPSFQAL  57

Query  537  GGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEG  358
            GGHRASHK+P+L+  A G+     +K+KMH CSICG+EF++GQALGGHMRRHR  + K  
Sbjct  58   GGHRASHKRPRLLIGA-GDFLVQSKKNKMHECSICGMEFSLGQALGGHMRRHRDEINKTS  116

Query  357  FE--NppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPA-TPVL  187
                     +     IPVLK++ SSKRIF     LDLNLTP  + +LK+  T P  +PVL
Sbjct  117  TAAGKTIIPVAGKTMIPVLKKSNSSKRIFCV---LDLNLTPDVDVELKLWPTAPVLSPVL  173

Query  186  R  184
            R
Sbjct  174  R  174



>ref|XP_009628781.1| PREDICTED: zinc finger protein ZAT12-like [Nicotiana tomentosiformis]
Length=172

 Score =   145 bits (367),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 119/178 (67%), Gaps = 14/178 (8%)
 Frame = -2

Query  711  MKRSREYA-GVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALG  535
            +KRSRE    VEAEAMANC ++L     N++++  +       F+C TC+K+FPSFQALG
Sbjct  4    IKRSREEDRQVEAEAMANCALMLLSRLNNNNNTTSTDRDYHNDFECNTCNKRFPSFQALG  63

Query  534  GHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGF  355
            GHRASHK+P+L+A   GE     +K+KMH CSICG+EF++GQALGGHMRRHR  +     
Sbjct  64   GHRASHKRPRLLA---GEFLVQSKKNKMHECSICGMEFSLGQALGGHMRRHRDEI-----  115

Query  354  ENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPA-TPVLR  184
             N  +A      IP+LK++ SSKRIF     LDLNLTP  + +LK+  T P  +PVLR
Sbjct  116  -NNTSAAAGKTMIPMLKKSNSSKRIF---CGLDLNLTPDVDVELKLWPTAPVLSPVLR  169



>ref|XP_006363363.1| PREDICTED: zinc finger protein ZAT11-like [Solanum tuberosum]
Length=166

 Score =   144 bits (364),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 118/181 (65%), Gaps = 26/181 (14%)
 Frame = -2

Query  711  MKRSRE-YAGVEAEAMANC-LMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQAL  538
            MKRSRE    VE EAMANC LMLL+     SSSS      D   F+CKTC+K+FPSFQAL
Sbjct  4    MKRSREDNMQVEVEAMANCTLMLLSRFNNTSSSSDHHHIND---FECKTCNKRFPSFQAL  60

Query  537  GGHRASH-KKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKE  361
            GGHRASH KKP+L+     +   + +K+KMH+CSICG+EF++GQALGGHMRRHR  + K 
Sbjct  61   GGHRASHNKKPRLLGEFLVQ---TNKKNKMHKCSICGVEFSLGQALGGHMRRHRDEINKT  117

Query  360  GFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTP-AENDDLKIESTTP-ATPVL  187
                          IPVL ++ SSKRIF     LDLNLTP  +N D K+  T P A+PVL
Sbjct  118  S-----------RMIPVLTKSNSSKRIFC----LDLNLTPRNDNVDFKLWPTAPIASPVL  162

Query  186  R  184
            R
Sbjct  163  R  163



>ref|XP_002533110.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF29282.1| nucleic acid binding protein, putative [Ricinus communis]
Length=159

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 103/166 (62%), Gaps = 13/166 (8%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKR RE A ++   MANCLMLL+ VG+               F CKTC+++F SFQALGG
Sbjct  1    MKRDREEAVID---MANCLMLLSKVGQTELEDSKPGR----LFACKTCNRRFSSFQALGG  53

Query  531  HRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFE  352
            HRASHKKPKL+     +  SSP K K H CSICGLEFA+GQALGGHMRRHR         
Sbjct  54   HRASHKKPKLIGDDLLKLPSSPPKPKTHECSICGLEFAIGQALGGHMRRHRGNTGGG--G  111

Query  351  NppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIE  214
                     + +PV+K++ SSKR+    L LDLNLTP EN DL ++
Sbjct  112  GDGVVTRALLPVPVMKKSNSSKRV----LCLDLNLTPVENYDLTLQ  153



>ref|XP_006429010.1| hypothetical protein CICLE_v10013311mg [Citrus clementina]
 ref|XP_006480743.1| PREDICTED: zinc finger protein ZAT11-like [Citrus sinensis]
 gb|ESR42250.1| hypothetical protein CICLE_v10013311mg [Citrus clementina]
Length=172

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 106/155 (68%), Gaps = 17/155 (11%)
 Frame = -2

Query  681  EAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGGHRASHKKPKL  502
            E  A+ANCLMLL    R         + D+  F+CKTC+++FPSFQALGGHRASHKKP+L
Sbjct  14   ERLALANCLMLLTRSNRAKLPIKKRLASDV--FECKTCNRQFPSFQALGGHRASHKKPRL  71

Query  501  VAPAPGEQES----SPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFENppaai  334
            +    GE ++    +  K K+H CSICG EFAMGQALGGHMRRHR AM     E+  +A+
Sbjct  72   IN---GETKTLSSTTATKPKLHECSICGQEFAMGQALGGHMRRHRIAMN----ESLNSAV  124

Query  333  pmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
             ++ + PVL+R+ SS+R+FG    LDLNLTP END
Sbjct  125  IVSQSPPVLRRSNSSRRVFG----LDLNLTPLEND  155



>ref|XP_010260064.1| PREDICTED: zinc finger protein ZAT12 [Nelumbo nucifera]
Length=170

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 118/184 (64%), Gaps = 23/184 (13%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKRSR    +++  MANCLMLL+    N S +   +      F+CKTC+++FPSFQALGG
Sbjct  1    MKRSRVEGEIDSITMANCLMLLSRGAENDSMAYFPSR----VFECKTCNRQFPSFQALGG  56

Query  531  HRASHKKPKLV------APAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAM  370
            HRASHKKP+L+      A    + +S   K K H CS+CGLEFA+GQALGGHMRRHRA  
Sbjct  57   HRASHKKPRLMMTGEDTADHQAQLQSLQMKPKTHECSVCGLEFAIGQALGGHMRRHRAG-  115

Query  369  MKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND-DLKIESTTPATP  193
            + EG       +P    +PVLKR++SS+R+    L LDLNLTP END DL++    P  P
Sbjct  116  LSEGLS-----LPPPPPVPVLKRSSSSRRV----LCLDLNLTPLENDLDLQLGRKIP--P  164

Query  192  VLRC  181
            V+ C
Sbjct  165  VVDC  168



>ref|XP_009779269.1| PREDICTED: zinc finger protein ZAT11-like [Nicotiana sylvestris]
Length=151

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 111/179 (62%), Gaps = 35/179 (20%)
 Frame = -2

Query  711  MKRSREY-AGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALG  535
            MKRSRE  + VEA+AMANC MLL+ +  N+S           SF+CKTC+K+F SFQALG
Sbjct  4    MKRSREDDSEVEAQAMANCSMLLSRLNNNTS-----------SFECKTCNKRFSSFQALG  52

Query  534  GHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGF  355
            GHR SHK  +  +      +S   K+ MH+CSICG+EF MGQALGGHMRRHRA +     
Sbjct  53   GHRTSHKSLR-SSSIDARSKSKKPKNNMHQCSICGMEFFMGQALGGHMRRHRAPV-----  106

Query  354  ENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAE-NDDLKIESTTPATPVLRC  181
                        +PVL ++ SSKRI    L LDLNLTP + NDD  +  T PA PVLRC
Sbjct  107  -----------NVPVLNKSNSSKRI----LCLDLNLTPDDQNDDFMLWPTAPA-PVLRC  149



>ref|XP_002284384.1| PREDICTED: zinc finger protein ZAT11 [Vitis vinifera]
Length=159

 Score =   143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 111/168 (66%), Gaps = 23/168 (14%)
 Frame = -2

Query  711  MKRSRE--YAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQAL  538
            MKRSR      VEA AMANCLMLL+ VG++ S++          F+CKTC++KFPSFQAL
Sbjct  1    MKRSRVDGVDEVEALAMANCLMLLSRVGKSESTNQLPGR----VFECKTCNRKFPSFQAL  56

Query  537  GGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEG  358
            GGHRASHKKP+L+     +  +SP K K H CSICGLEFA+GQALGGHMRRHR+ +    
Sbjct  57   GGHRASHKKPRLMGDE-LQLPTSPAKPKTHECSICGLEFAIGQALGGHMRRHRSEIHNP-  114

Query  357  FENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIE  214
                         + V+K+ TS +R+    L+LDLNLTP EN DLKI+
Sbjct  115  -----------TPVSVVKK-TSDERV--LSLDLDLNLTPWEN-DLKIQ  147



>ref|XP_006363362.1| PREDICTED: zinc finger protein ZAT11-like [Solanum tuberosum]
Length=165

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 119/181 (66%), Gaps = 27/181 (15%)
 Frame = -2

Query  711  MKRSR-EYAGVEAEAMANC-LMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQAL  538
            +KRSR E   VEAEAMANC LMLL+    N+SS        +  F+CKTC+K+FPSFQAL
Sbjct  4    LKRSRGEDVLVEAEAMANCALMLLSRFNTNNSSDHHH----INDFECKTCNKRFPSFQAL  59

Query  537  GGHRASH-KKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKE  361
            GGHRASH KKP+L+     +   + +K+KMH+CSICG+EF++GQALGGHMRRHR  + K 
Sbjct  60   GGHRASHNKKPRLLGEFLVQ---TNKKNKMHKCSICGVEFSLGQALGGHMRRHRDEINKT  116

Query  360  GFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTP-AENDDLKIESTTP-ATPVL  187
                          IPVL ++ SSKRIF     LDLNLTP  +N D K+  T P A+PVL
Sbjct  117  S-----------RMIPVLTKSNSSKRIFC----LDLNLTPRDDNVDFKLWPTAPIASPVL  161

Query  186  R  184
            R
Sbjct  162  R  162



>gb|KDP35585.1| hypothetical protein JCGZ_09023 [Jatropha curcas]
Length=169

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 111/167 (66%), Gaps = 20/167 (12%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            M   R++A +E+  MA CLMLL+     +     S  +D+  F+CKTC++KF SFQALGG
Sbjct  1    MAMKRKFAEIESLDMAKCLMLLSQ-SLQTKPIKTSTEQDV--FECKTCNRKFSSFQALGG  57

Query  531  HRASHKKPKLVAPAPGEQESSPE------KSKMHRCSICGLEFAMGQALGGHMRRHRAAM  370
            HRASHKKP+L  P   E ++S +      K KMH CSICG+EFA+GQALGGHMRRHRA  
Sbjct  58   HRASHKKPRL--PIIAEDDNSNKAGSETTKRKMHACSICGVEFALGQALGGHMRRHRAVA  115

Query  369  MKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            M  G+++   +      +PVL+R+ SSKR+FG    LDLNLTP END
Sbjct  116  M--GYDH---SRRGVSELPVLRRSNSSKRVFG----LDLNLTPLEND  153



>ref|XP_006363361.1| PREDICTED: zinc finger protein ZAT11-like [Solanum tuberosum]
Length=171

 Score =   142 bits (359),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 120/181 (66%), Gaps = 19/181 (10%)
 Frame = -2

Query  711  MKRSRE-YAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALG  535
            MKRSRE    +E EAMANC  L+A + R +++S  SA   +  F+CKTC+K+FPSFQALG
Sbjct  4    MKRSREDNMQIEVEAMANC-ALMALLSRFNNTSSLSAHIHINDFECKTCNKRFPSFQALG  62

Query  534  GHRASH-KKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEG  358
            GHRASH K+ +L      +   + +K+KMH+CSICG+EF++GQALGGHMRRHR  + K  
Sbjct  63   GHRASHNKRSRLFGEFLVQ---TNKKNKMHKCSICGMEFSLGQALGGHMRRHRDEINK--  117

Query  357  FENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTP-AENDDLKIESTTP-ATPVLR  184
                         IP+LK++ S KRIF     LDLNLTP  +N D K+  TTP A+PVLR
Sbjct  118  -----TTAHEQTMIPILKKSNSIKRIFC----LDLNLTPRDDNVDFKLWPTTPIASPVLR  168

Query  183  C  181
            C
Sbjct  169  C  169



>gb|ACB20696.1| putative cold-inducible protein [Camellia sinensis]
Length=165

 Score =   142 bits (358),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 108/170 (64%), Gaps = 24/170 (14%)
 Frame = -2

Query  723  MTM-LMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSF  547
            MTM ++KRSRE   VEA AMANCLMLL+ VG  +S+           F CKTC+++F SF
Sbjct  1    MTMAILKRSREDTEVEALAMANCLMLLSRVGETTSTKGRDRV-----FTCKTCNREFSSF  55

Query  546  QALGGHRASHKKPKLVAPAP--GEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAA  373
            QALGGHRASHKK +L+       +  SSP K K H CSICGLEFAMGQALGGHMRRHR  
Sbjct  56   QALGGHRASHKKLRLMGGGDLHVQTPSSPVKGKTHECSICGLEFAMGQALGGHMRRHR--  113

Query  372  MMKEGFENppaaipmamaiPVLKRTTS---SKRIFGFGLNLDLNLTPAEN  232
                   +  +       IPVLK++ S   SKR+    L+LDLNLTP EN
Sbjct  114  -------DSSSPSTAQAVIPVLKKSNSSNGSKRV----LSLDLNLTPYEN  152



>gb|KCW88902.1| hypothetical protein EUGRSUZ_A01230 [Eucalyptus grandis]
Length=177

 Score =   142 bits (359),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 108/166 (65%), Gaps = 10/166 (6%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKR+R+     +  MA CLMLL+H G N+     +  +   +++CKTC+++F SFQALGG
Sbjct  1    MKRTRDDYERMSLDMAKCLMLLSH-GVNAELKRAAVHQTEDNYECKTCNRQFSSFQALGG  59

Query  531  HRASHKKPKLVAPAPGE----QESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMK  364
            HRASHKKPKL+   PG+          ++KMH CS+CGL+FA+GQALGGHMR+HRA +M 
Sbjct  60   HRASHKKPKLLQNKPGDCTKLALGGTAETKMHECSVCGLKFALGQALGGHMRKHRAELMS  119

Query  363  EGFENppaaipmamaiPVLKRT-TSSKRIFGFGLNLDLNLTPAEND  229
                N      +   +PVL R+ +SSKR+ G    LDLNLTP END
Sbjct  120  GNMMNMDEFFGINSTVPVLNRSNSSSKRVMG----LDLNLTPLEND  161



>ref|XP_010043586.1| PREDICTED: zinc finger protein ZAT12-like [Eucalyptus grandis]
 gb|KCW85607.1| hypothetical protein EUGRSUZ_B02394 [Eucalyptus grandis]
Length=172

 Score =   140 bits (354),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 119/183 (65%), Gaps = 23/183 (13%)
 Frame = -2

Query  714  LMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALG  535
            ++KR RE   VEA A+AN LMLL+ +GR++ S+  S   +   F CKTC+++FPSFQALG
Sbjct  1    MVKRDREDTEVEALAVANSLMLLSRIGRSTDSNRKSRPTERM-FTCKTCNREFPSFQALG  59

Query  534  GHRASHKKPKLVAPAPGE-------QESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRA  376
            GHRASHKKPKL++   G+        +SSP K KMH CSICGL+F  GQALGGHMRRHRA
Sbjct  60   GHRASHKKPKLIS---GDLLRLGRTADSSPAKLKMHECSICGLDFPTGQALGGHMRRHRA  116

Query  375  AMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPAT  196
            A+++            A  +PVLK+ ++SKR+ G    LDLN  P E DDL +     A 
Sbjct  117  AILES------LVAAAAKPVPVLKK-SNSKRVRG----LDLNSLPME-DDLTLRLGKVAP  164

Query  195  PVL  187
            P++
Sbjct  165  PLV  167



>ref|XP_010313549.1| PREDICTED: zinc finger protein ZAT11-like [Solanum lycopersicum]
Length=163

 Score =   140 bits (353),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 117/179 (65%), Gaps = 25/179 (14%)
 Frame = -2

Query  711  MKRSR-EYAGVEAEAMANC-LMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQAL  538
            MKRSR E   +E EAMANC LMLL+    N+SSS       +  F+CKTC+K+FPSFQAL
Sbjct  4    MKRSRDENMQIEVEAMANCALMLLSRFNNNTSSSSDHHH--INDFECKTCNKRFPSFQAL  61

Query  537  GGHRASH-KKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKE  361
            GGHRASH KKP+L+     E   + +K+K H+CSICG+EF++GQALGGHMRRHR  + K 
Sbjct  62   GGHRASHNKKPRLMGEFLVE---TNKKNKKHKCSICGVEFSLGQALGGHMRRHRDEINK-  117

Query  360  GFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPATPVLR  184
                          IPVL ++ SSKRIF     LDLNLTP +++ +  + +  A+PVLR
Sbjct  118  ------------TIIPVLTKSNSSKRIFC----LDLNLTPRDDNVVDFKLSPIASPVLR  160



>ref|XP_009604641.1| PREDICTED: zinc finger protein ZAT12-like [Nicotiana tomentosiformis]
Length=172

 Score =   140 bits (354),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 117/178 (66%), Gaps = 14/178 (8%)
 Frame = -2

Query  711  MKRSREYA-GVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALG  535
            MKRSRE    VEAEAMANC ++L     N++++  +       F+CKTC+K+FPSFQALG
Sbjct  4    MKRSREEDRQVEAEAMANCALMLLSRLNNNNNTTSTDRDYHNDFECKTCNKRFPSFQALG  63

Query  534  GHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGF  355
            G RASHK+P+L+A     Q    +K+KMH CSICG+EF++GQALGGHMRRHR  +     
Sbjct  64   GQRASHKRPRLLARDFLVQS---KKNKMHECSICGMEFSLGQALGGHMRRHRDEI-----  115

Query  354  ENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPA-TPVLR  184
             N  +A      IPVLK++ SSKRIF     LDLNLTP  + +LK+  T    +PVLR
Sbjct  116  -NNTSAAAGKTMIPVLKKSNSSKRIF---CGLDLNLTPDVDVELKLWPTALVLSPVLR  169



>ref|XP_004251306.1| PREDICTED: zinc finger protein ZAT11-like [Solanum lycopersicum]
Length=154

 Score =   139 bits (350),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 113/180 (63%), Gaps = 36/180 (20%)
 Frame = -2

Query  711  MKRSREYAG-VEAEAMANC-LMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQAL  538
            MKRSRE  G VEAEAMANC LMLL+ +  N+             F CKTC+K+FPSFQAL
Sbjct  4    MKRSREDNGQVEAEAMANCALMLLSRLNNNN------------DFACKTCNKRFPSFQAL  51

Query  537  GGHRASH-KKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKE  361
            GGHR SH KKPKL+    GE   + +KSK+H+CSICG+EFA+GQALGGHMRRHR  + K 
Sbjct  52   GGHRTSHNKKPKLL----GE---TNQKSKVHKCSICGMEFALGQALGGHMRRHRDEINK-  103

Query  360  GFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPA-TPVLR  184
                       +    ++    SSKRI  FG+N  LN+TP   DDLK+     A +PVLR
Sbjct  104  ---------VTSHEKTIIPILHSSKRISIFGVN--LNITP-NVDDLKLWPIEEAPSPVLR  151



>ref|XP_003547427.1| PREDICTED: zinc finger protein ZAT11 [Glycine max]
 gb|AAZ03389.1| C2H2 transcription factor [Glycine max]
Length=172

 Score =   139 bits (351),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 108/182 (59%), Gaps = 17/182 (9%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKR RE + ++   MANCLMLL  VG + ++ P S   D+  F+CKTC+++F SFQALGG
Sbjct  1    MKRGREESKLD---MANCLMLLTKVGESETNYPISKGSDIGDFKCKTCNRRFSSFQALGG  57

Query  531  HRASHKKPKLVAPAPGEQESSP-----EKSKMHRCSICGLEFAMGQALGGHMRRHRAAMM  367
            HRASHKKPKL+       +  P     ++ +MH C ICGLEFA+GQALGGHMR+HR A+ 
Sbjct  58   HRASHKKPKLMVTDLSCHQELPNPTMKQQPRMHPCPICGLEFAIGQALGGHMRKHRTAI-  116

Query  366  KEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPATPVL  187
                 N         +   + + +S        L LDLNLTP E DDLK+      TPVL
Sbjct  117  -----NDGLLCGKPSSSLSILKESSKDGDQKLNLRLDLNLTPLEEDDLKLNL---RTPVL  168

Query  186  RC  181
             C
Sbjct  169  NC  170



>ref|XP_010043584.1| PREDICTED: zinc finger protein ZAT11-like [Eucalyptus grandis]
Length=175

 Score =   139 bits (350),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 118/185 (64%), Gaps = 24/185 (13%)
 Frame = -2

Query  714  LMKRSREYAGVEAEAMANCLMLLAHVGR--NssssppsaSKDLCSFQCKTCDKKFPSFQA  541
            ++KR RE AGVEA A ANCLMLL+ VG   NSSS    +      F+CKTC+++F S QA
Sbjct  1    MVKRDREDAGVEALARANCLMLLSQVGESTNSSSPNHKSRPTERMFKCKTCNREFSSSQA  60

Query  540  LGGHRASHKKPKLVAPAPGE-------QESSPEKSKMHRCSICGLEFAMGQALGGHMRRH  382
            LGGHRASHKKPKL++   G+         SSP K K H CSICGLEF +GQALGGH+RRH
Sbjct  61   LGGHRASHKKPKLIS---GDLLHLGHAAYSSPAKPKKHECSICGLEFPIGQALGGHVRRH  117

Query  381  RAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTP  202
            RAAM++        A      +PVLK+ ++SKR+ G    LDLN +P E DDL +     
Sbjct  118  RAAMLES------LAAVATKPVPVLKK-SNSKRVMG----LDLNSSPME-DDLTLRLGKV  165

Query  201  ATPVL  187
            A P++
Sbjct  166  APPLV  170



>ref|XP_002284111.1| PREDICTED: zinc finger protein ZAT12 [Vitis vinifera]
Length=176

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 110/173 (64%), Gaps = 14/173 (8%)
 Frame = -2

Query  717  MLMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQAL  538
            M MKR R+    E+ ++ANCLMLL+  G +  S     S+    F+CKTC+++FPSFQAL
Sbjct  1    MTMKRMRD-GEHESVSIANCLMLLSR-GTDYDSIARVPSR---VFECKTCNRQFPSFQAL  55

Query  537  GGHRASHKKPKLVA---PAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAM-  370
            GGHRASHKKP+L+A     P + +SSP K K H CSICGLEFA+GQALGGHMRRHRAA  
Sbjct  56   GGHRASHKKPRLMALNGDDPAQLQSSPLKPKTHECSICGLEFAIGQALGGHMRRHRAAAS  115

Query  369  -MKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIE  214
               +      ++         L +  +S+R+    L LDLNLTP EN DL+ +
Sbjct  116  GATQALSETTSSSSPPPPQAPLLKKPNSRRV----LCLDLNLTPLENIDLQFQ  164



>emb|CAN64128.1| hypothetical protein VITISV_022422 [Vitis vinifera]
Length=647

 Score =   146 bits (368),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 111/168 (66%), Gaps = 23/168 (14%)
 Frame = -2

Query  711  MKRSRE--YAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQAL  538
            MKRSR      VEA AMANCLMLL+ VG++ S++          F+CKTC++KFPSFQAL
Sbjct  1    MKRSRVDGVDEVEALAMANCLMLLSRVGKSESTNQLPGR----VFECKTCNRKFPSFQAL  56

Query  537  GGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEG  358
            GGHRASHKKP+L+     +  +SP K K H CSICGLEFA+GQALGGHMRRHR+ +    
Sbjct  57   GGHRASHKKPRLMGDEL-QLPTSPAKPKTHECSICGLEFAIGQALGGHMRRHRSEIHN--  113

Query  357  FENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIE  214
                         + V+K+ TS +R+    L+LDLNLTP EN DLKI+
Sbjct  114  ----------PTPVSVVKK-TSDERV--LSLDLDLNLTPWEN-DLKIQ  147



>ref|XP_007139263.1| hypothetical protein PHAVU_008G014600g [Phaseolus vulgaris]
 gb|ESW11257.1| hypothetical protein PHAVU_008G014600g [Phaseolus vulgaris]
Length=165

 Score =   137 bits (345),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 108/174 (62%), Gaps = 13/174 (7%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKR RE   V++ +MANCLMLL+  G   +S   S+S     F+CKTC+++FPSFQALGG
Sbjct  1    MKRERE---VDSVSMANCLMLLSRGGEFEASYSSSSSMSNRVFECKTCNRQFPSFQALGG  57

Query  531  HRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFE  352
            HRASHKKP+L+A        SP K K H CSICGLEFA+GQALGGHMRRHR A +     
Sbjct  58   HRASHKKPRLMASEGELLHDSPAKPKTHECSICGLEFAIGQALGGHMRRHRVANLNN---  114

Query  351  NppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPATPV  190
               +    +    V   + ++KR+    L LDLNLTP END   ++   P T V
Sbjct  115  ---STTSSSGGSSVDSSSKNNKRV----LVLDLNLTPFENDLEFLKIRKPTTLV  161



>ref|XP_010043587.1| PREDICTED: zinc finger protein ZAT12-like [Eucalyptus grandis]
 gb|KCW85609.1| hypothetical protein EUGRSUZ_B02396 [Eucalyptus grandis]
Length=172

 Score =   137 bits (345),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 116/180 (64%), Gaps = 17/180 (9%)
 Frame = -2

Query  714  LMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALG  535
            ++KR RE   VEA A+AN LMLL+ VG+++ S+      +   F CKTC+++F SFQALG
Sbjct  1    MVKRDREDMEVEALAVANSLMLLSRVGQSTDSNRKWQPTERM-FTCKTCNREFSSFQALG  59

Query  534  GHRASHKKPKLVAP----APGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMM  367
            GHRASHKKPKL++        E +SSP K K H C ICGL+F +GQALGGHMRRHRAAM+
Sbjct  60   GHRASHKKPKLISGDLLRLGHEADSSPAKPKTHECPICGLDFPIGQALGGHMRRHRAAML  119

Query  366  KEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPATPVL  187
            +        A      +PVLK+ ++SKR+ G    LDLN +P E DDL +     A P++
Sbjct  120  ES------LAAAATKPVPVLKK-SNSKRVTG----LDLNSSPME-DDLTLRLGKVAPPLV  167



>ref|XP_003552680.1| PREDICTED: zinc finger protein ZAT11-like [Glycine max]
Length=175

 Score =   137 bits (344),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 89/179 (50%), Positives = 108/179 (60%), Gaps = 13/179 (7%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKR RE   V++  MANCLMLL+  G    ++  S S     F+CKTC+++FPSFQALGG
Sbjct  1    MKRERE---VDSLTMANCLMLLSR-GSEFEATYSSTSMSNRVFECKTCNRQFPSFQALGG  56

Query  531  HRASHKKPKLVAPAPGEQ--ESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEG  358
            HRASHKKP+L+A     Q    SP K K H CSICGLEFA+GQALGGHMRRHRAA +   
Sbjct  57   HRASHKKPRLMAGDIEGQLLHDSPPKPKTHECSICGLEFAIGQALGGHMRRHRAANLNGN  116

Query  357  FENppaaipmamaiPVL---KRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPATPV  190
              N  A    +         K+   +KR+    L LDLNLTP END   ++   P T V
Sbjct  117  VHNSTATSSSSGGSSFDSSPKKKADNKRV----LVLDLNLTPFENDLEFLKIGKPTTFV  171



>ref|XP_010068234.1| PREDICTED: zinc finger protein 433-like [Eucalyptus grandis]
Length=392

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 113/179 (63%), Gaps = 14/179 (8%)
 Frame = -2

Query  738  ISSPSMTM----LMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKT  571
            I+ PSMT      +KR+R+     +  MA CLMLL+H G N++    +   D  +F+CKT
Sbjct  202  ITIPSMTFSCAPTLKRTRDDCEGMSLDMAKCLMLLSH-GVNTNPKKAAVHHDEDNFECKT  260

Query  570  CDKKFPSFQALGGHRASHKKPKLVAPAPGEQES-----SPEKSKMHRCSICGLEFAMGQA  406
            C+++F SFQALGGHRASHKKP+L+     E  +     S  K KMH CS+CGL+FA GQA
Sbjct  261  CNRRFSSFQALGGHRASHKKPRLLETTKLEDCTKLALGSMAKPKMHECSMCGLKFASGQA  320

Query  405  LGGHMRRHRAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            LGGHMRRHRA +M          + +   IP+LKR+ SSKR+ G    LDLNL+P END
Sbjct  321  LGGHMRRHRAELMSGDMMKMDEILAVGSMIPLLKRSNSSKRVMG----LDLNLSPLEND  375


 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 101/152 (66%), Gaps = 10/152 (7%)
 Frame = -2

Query  669  MANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGGHRASHKKPKLVAPA  490
            MA CLMLL+H G N+     +  +   +++CKTC+++F SFQALGGHRASHKKPKL+   
Sbjct  5    MAKCLMLLSH-GVNAELKRAAVHQTEDNYECKTCNRQFSSFQALGGHRASHKKPKLLQNK  63

Query  489  PGE----QESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFENppaaipmam  322
            PG+          ++KMH CS+CGL+FA+GQALGGHMR+HRA +M     N      +  
Sbjct  64   PGDCTKLALGGTAETKMHECSVCGLKFALGQALGGHMRKHRAELMSGNMMNMDEFFGINS  123

Query  321  aiPVLKRT-TSSKRIFGFGLNLDLNLTPAEND  229
             +PVL R+ +SSKR+ G    LDLNLTP END
Sbjct  124  TVPVLNRSNSSSKRVMG----LDLNLTPLEND  151



>gb|KDO72957.1| hypothetical protein CISIN_1g031430mg [Citrus sinensis]
 gb|KDO72958.1| hypothetical protein CISIN_1g031430mg [Citrus sinensis]
Length=159

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 104/173 (60%), Gaps = 25/173 (14%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKR RE A ++    ANCLMLL+ VG                F CKTC+K+FPSFQALGG
Sbjct  1    MKRDREMAAIDT---ANCLMLLSKVGETDQGKRV--------FACKTCNKEFPSFQALGG  49

Query  531  HRASHKKPKLVAPAPGEQE--------SSPEKSKMHRCSICGLEFAMGQALGGHMRRHRA  376
            HRASHKKPKL+  A   ++        +SP K K H CSICGLEFA+GQALGGHMRRHRA
Sbjct  50   HRASHKKPKLMTMASSGEDFDQTQMPPASPRKPKTHECSICGLEFAIGQALGGHMRRHRA  109

Query  375  AMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKI  217
            A       +        + +PVLK++ S KR+F     LDLNL P   DDLK+
Sbjct  110  AAAMGAVAD-GLVTRPLLPLPVLKKSNSCKRVF----CLDLNLMPT-GDDLKL  156



>ref|XP_010047364.1| PREDICTED: zinc finger protein ZAT11-like [Eucalyptus grandis]
 gb|AGK28204.1| C2H2-type zinc finger protein 6 [Eucalyptus grandis]
 gb|KCW88904.1| hypothetical protein EUGRSUZ_A01232 [Eucalyptus grandis]
Length=181

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 105/170 (62%), Gaps = 14/170 (8%)
 Frame = -2

Query  714  LMKRSREYAGVEAEAMANCLMLLAH-VGRNssssppsaSKDLCSFQCKTCDKKFPSFQAL  538
            +MKRSR+        MA CLMLL H V  N  ++     +D  +F+CKTC+++FPSFQAL
Sbjct  1    MMKRSRDDYERMNLDMAKCLMLLTHGVNANPKTAAVHHHED--NFKCKTCNRQFPSFQAL  58

Query  537  GGHRASHKKPKLVAPAPGEQESS----PEKSKMHRCSICGLEFAMGQALGGHMRRHRAAM  370
            GGHRASHKKPKL+   P +   S        KMH CSICGL+F++GQALGGHMRRHR  +
Sbjct  59   GGHRASHKKPKLLETKPEDSTKSVLGTTANPKMHECSICGLKFSLGQALGGHMRRHRVQL  118

Query  369  M--KEGFENppaaipmamaiPVLKRTTSS-KRIFGFGLNLDLNLTPAEND  229
            M              +   IPVLKR+ SS KR+ G    LDLNLTP END
Sbjct  119  MSGSGSVMKMDEIFVVGPTIPVLKRSKSSNKRVMG----LDLNLTPLEND  164



>ref|XP_010041405.1| PREDICTED: zinc finger protein ZAT12-like [Eucalyptus grandis]
 gb|KCW44374.1| hypothetical protein EUGRSUZ_L02150 [Eucalyptus grandis]
Length=172

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 116/180 (64%), Gaps = 17/180 (9%)
 Frame = -2

Query  714  LMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALG  535
            ++KR RE   VEA A+AN LMLL+ VG+++ S+      +   F CKTC+++F SFQALG
Sbjct  1    MVKRDREDMEVEALAVANSLMLLSRVGQSTDSNCKWQPTERM-FACKTCNREFSSFQALG  59

Query  534  GHRASHKKPKLVAP----APGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMM  367
            GHRASHKKPKL++        E +SSP K K H C ICGL+F +GQALGGHMRRHRAAM+
Sbjct  60   GHRASHKKPKLISGDLLRLGHEADSSPAKPKTHECPICGLDFPIGQALGGHMRRHRAAML  119

Query  366  KEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPATPVL  187
            +        A      +PVLK+ ++SKR+ G    LDLN +P E DDL +     A P++
Sbjct  120  ES------LAAAATKPVPVLKK-SNSKRVTG----LDLNSSPME-DDLTLRLGKVAPPLV  167



>ref|XP_006363365.1| PREDICTED: zinc finger protein ZAT11-like [Solanum tuberosum]
Length=170

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 114/181 (63%), Gaps = 22/181 (12%)
 Frame = -2

Query  711  MKRSREY-AGVEAEAMANC-LMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQAL  538
            MKRSRE    +E EAMANC LMLL+     SS S      D   F+CKTC+K+FPSFQAL
Sbjct  4    MKRSREDDMQIEEEAMANCALMLLSRFNNTSSLSAHIHIND---FECKTCNKRFPSFQAL  60

Query  537  GGHRASH-KKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKE  361
            GGHRASH K+ +L      +   + +K+KMH+CSICG+EF++GQALGGHMRRHR  + K 
Sbjct  61   GGHRASHNKRSRLFGEFLVQ---TNKKNKMHKCSICGMEFSLGQALGGHMRRHRDEINK-  116

Query  360  GFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTP-AENDDLKIESTTP-ATPVL  187
                          IP+LK++ S KRIF     LDLNLTP  +N D K+    P A+PVL
Sbjct  117  ------TTAHEQTMIPILKKSNSIKRIFC----LDLNLTPRDDNVDFKLWPMAPIASPVL  166

Query  186  R  184
            R
Sbjct  167  R  167



>ref|XP_011027131.1| PREDICTED: zinc finger protein ZAT11-like [Populus euphratica]
Length=179

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 114/183 (62%), Gaps = 12/183 (7%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCS----FQCKTCDKKFPSFQ  544
            MKR      +++  MANCLM L+    + S      +    S    F+CKTC+++FPSFQ
Sbjct  1    MKRGLHEREIDSITMANCLMFLSKGRESYSFPSFDHAMSNISPARVFECKTCNRQFPSFQ  60

Query  543  ALGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMK  364
            ALGGHRASHKKP+L+      +  SP K K H CSICGLEFA+GQALGGHMRRHRAA+  
Sbjct  61   ALGGHRASHKKPRLMGGEGSFETQSPAKPKTHECSICGLEFAIGQALGGHMRRHRAALND  120

Query  363  EGFENppa--aipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPATPV  190
            +   +P    +     A+PV+KR+T S+R+    L+LDLNLTP EN D+++       P+
Sbjct  121  QNQVDPLKPPSTDDQKAVPVMKRST-SRRV----LSLDLNLTPYEN-DMELFKLGTTAPM  174

Query  189  LRC  181
            + C
Sbjct  175  VNC  177



>ref|XP_009594751.1| PREDICTED: zinc finger protein ZAT11-like [Nicotiana tomentosiformis]
Length=191

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 104/179 (58%), Gaps = 30/179 (17%)
 Frame = -2

Query  711  MKRSREY-AGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALG  535
            MKRSRE  + VEA AMANC MLL+ +  N+  +         SF+CKTC+K+F SFQALG
Sbjct  39   MKRSREEDSDVEALAMANCSMLLSRLNNNTIKTS--------SFECKTCNKRFSSFQALG  90

Query  534  GHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGF  355
            GHR SHK  +  +     +    + + MH+C ICG+EF MGQALGGHMR HRA +     
Sbjct  91   GHRTSHKSLRSSSIDARSKSKKTKNNNMHQCCICGMEFFMGQALGGHMRCHRAPINVPVL  150

Query  354  ENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAE-NDDLKIESTTPATPVLRC  181
             N                 +SSKRI    L LDLNLTP + NDD K+  T PA PVLRC
Sbjct  151  NNS---------------NSSSKRI----LCLDLNLTPDDQNDDFKLWPTAPA-PVLRC  189



>gb|KCW88903.1| hypothetical protein EUGRSUZ_A01231 [Eucalyptus grandis]
Length=164

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 100/152 (66%), Gaps = 10/152 (7%)
 Frame = -2

Query  669  MANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGGHRASHKKPKLVAPA  490
            MA CLMLL+H G N++    +   D  +F+CKTC+++F SFQALGGHRASHKKP+L+   
Sbjct  1    MAKCLMLLSH-GVNTNPKKAAVHHDEDNFECKTCNRRFSSFQALGGHRASHKKPRLLETT  59

Query  489  PGEQES-----SPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFENppaaipma  325
              E  +     S  K KMH CS+CGL+FA GQALGGHMRRHRA +M          + + 
Sbjct  60   KLEDCTKLALGSMAKPKMHECSMCGLKFASGQALGGHMRRHRAELMSGDMMKMDEILAVG  119

Query  324  maiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
              IP+LKR+ SSKR+ G    LDLNL+P END
Sbjct  120  SMIPLLKRSNSSKRVMG----LDLNLSPLEND  147



>gb|KHN09436.1| Zinc finger protein ZAT11, partial [Glycine soja]
Length=174

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 101/165 (61%), Gaps = 10/165 (6%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKR R++ G E+  +ANCLM+L+H  +N          +   F+CKTC++KF SFQALGG
Sbjct  1    MKRQRDFEGFESIDLANCLMMLSHPQQNKKLLQTKI--EAVKFECKTCNRKFSSFQALGG  58

Query  531  HRASHKKPKLVAP---APGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKE  361
            HRASHK+ KL      A     S   K KMH CSICG EF++GQALGGHMRRHR  +   
Sbjct  59   HRASHKRSKLEGDELKAHAISLSLGNKPKMHECSICGQEFSLGQALGGHMRRHRTTIN--  116

Query  360  GFENppaaipmamaiPVLKRTTSSKRIFGFG-LNLDLNLTPAEND  229
              E+  +   +   +P LKR+ S++ I     L LDLNLTP END
Sbjct  117  --EDFSSIKQVITQVPDLKRSNSTRVIMCLDVLTLDLNLTPFEND  159



>ref|XP_007016517.1| C2H2 and C2HC zinc fingers superfamily protein, putative [Theobroma 
cacao]
 gb|EOY34136.1| C2H2 and C2HC zinc fingers superfamily protein, putative [Theobroma 
cacao]
Length=163

 Score =   135 bits (340),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 107/181 (59%), Gaps = 22/181 (12%)
 Frame = -2

Query  717  MLMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQAL  538
            M MKR RE   +EA  MANCLMLL+ VG+   S           F CKTC K+F SFQAL
Sbjct  1    MTMKRGRE---IEAMDMANCLMLLSKVGQTDPSKHFQGR----VFACKTCSKRFSSFQAL  53

Query  537  GGHRASHKKPKLVA-PAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKE  361
            GGHRASHKKP+L       E  +SP+K K H CSICGLEFAMGQALGGHMRRHRAA   E
Sbjct  54   GGHRASHKKPRLGGGDNLSEMPASPKKPKTHECSICGLEFAMGQALGGHMRRHRAA-SNE  112

Query  360  GFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND-DLKIESTTPATPVLR  184
            G                +K++  ++      L LDLNLTP  +D +LK+    PA PV+ 
Sbjct  113  GLVTRDLLPE-------MKKSRDAES----DLCLDLNLTPWGSDLELKLGKVAPA-PVVH  160

Query  183  C  181
            C
Sbjct  161  C  161



>ref|XP_008371383.1| PREDICTED: zinc finger protein ZAT12-like [Malus domestica]
Length=195

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 104/179 (58%), Gaps = 23/179 (13%)
 Frame = -2

Query  669  MANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGGHRASHKKPKLVAPA  490
            MANCLMLL+    N+     S+      F+CKTC+++FPSFQALGGHRASHKKP+L  P+
Sbjct  19   MANCLMLLSRGINNNDYQYDSSVSPSRVFECKTCNRQFPSFQALGGHRASHKKPRLTGPS  78

Query  489  -PGEQESS--------PEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFENppaa  337
              G   SS        P K+K H C+ICGLEFA+GQALGGHMRRHRAA+      +    
Sbjct  79   GDGNSNSSDQSLSQGSPPKTKTHECNICGLEFAIGQALGGHMRRHRAALSSSNTTSNIHD  138

Query  336  ipmamai---------PVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPATPVL  187
               +             VLK+T S +R     + LDLNLTP EN DL+I     A P++
Sbjct  139  RYSSSMSLNPQPAQVFQVLKKTNSGRR----AMCLDLNLTPLEN-DLEILQLGKAAPLV  192



>ref|XP_010043588.1| PREDICTED: zinc finger protein ZAT8-like [Eucalyptus grandis]
 gb|AGK28203.1| C2H2-type zinc finger protein 5 [Eucalyptus grandis]
Length=172

 Score =   135 bits (340),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 118/179 (66%), Gaps = 23/179 (13%)
 Frame = -2

Query  714  LMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALG  535
            ++KR RE   VEA A+AN LMLL+ VG++S S+  S   +   F CKTC+++F SFQALG
Sbjct  1    MVKRDREDTEVEALAVANSLMLLSRVGQSSDSNCKSWPTERM-FACKTCNREFSSFQALG  59

Query  534  GHRASHKKPKLVAPAPGE-------QESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRA  376
            GHRASHKKPKL++   G+        +SS  K K H CSICGL+F +GQALGGHMRRHRA
Sbjct  60   GHRASHKKPKLIS---GDLFHLGHAADSSQAKPKKHECSICGLDFPIGQALGGHMRRHRA  116

Query  375  AMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND-DLKIESTTP  202
            AM++        A   A  +PVLK+ ++SKR+ G    LDLN +P E+D  L++   TP
Sbjct  117  AMLER------LATATAKPVPVLKK-SNSKRVMG----LDLNSSPTEDDLTLRLGKVTP  164



>ref|XP_008233585.1| PREDICTED: zinc finger protein ZAT12-like [Prunus mume]
Length=196

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 87/200 (44%), Positives = 114/200 (57%), Gaps = 30/200 (15%)
 Frame = -2

Query  717  MLMKRS----REYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPS  550
            M MKRS    RE     +  MANCLMLL+    +       ++     F+CKTC+++FPS
Sbjct  1    MTMKRSITEMRELD--PSLTMANCLMLLSRGSHDHHHYDTFSASPTRVFECKTCNRQFPS  58

Query  549  FQALGGHRASHKKPKLVAPAPG---------EQESSPEKSKMHRCSICGLEFAMGQALGG  397
            FQALGGHRASHKKP+L+    G         + + SP K K H C+ICGLEFA+GQALGG
Sbjct  59   FQALGGHRASHKKPRLMGSGDGNSSNGSDQSQSQGSPPKPKTHECNICGLEFAIGQALGG  118

Query  396  HMRRHRAAMMKEGFENppaaipmamaiP----------VLKRTTSSKRIFGFGLNLDLNL  247
            HMRRHR+A+      N  +    + ++           VLK+T S +R+    + LDLNL
Sbjct  119  HMRRHRSALSNNNNNNNTSQYSDSNSLSLSPQPAPMFQVLKKTNSGRRV----MCLDLNL  174

Query  246  TPAENDDLKIESTTPATPVL  187
            TP EN DLKI     A P++
Sbjct  175  TPLEN-DLKILQIGKAAPLV  193



>gb|KCW85606.1| hypothetical protein EUGRSUZ_B02393 [Eucalyptus grandis]
Length=327

 Score =   139 bits (349),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 118/185 (64%), Gaps = 24/185 (13%)
 Frame = -2

Query  714  LMKRSREYAGVEAEAMANCLMLLAHVGR--NssssppsaSKDLCSFQCKTCDKKFPSFQA  541
            ++KR RE AGVEA A ANCLMLL+ VG   NSSS    +      F+CKTC+++F S QA
Sbjct  153  MVKRDREDAGVEALARANCLMLLSQVGESTNSSSPNHKSRPTERMFKCKTCNREFSSSQA  212

Query  540  LGGHRASHKKPKLVAPAPGE-------QESSPEKSKMHRCSICGLEFAMGQALGGHMRRH  382
            LGGHRASHKKPKL++   G+         SSP K K H CSICGLEF +GQALGGH+RRH
Sbjct  213  LGGHRASHKKPKLIS---GDLLHLGHAAYSSPAKPKKHECSICGLEFPIGQALGGHVRRH  269

Query  381  RAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTP  202
            RAAM++        A      +PVLK+ ++SKR+ G    LDLN +P E DDL +     
Sbjct  270  RAAMLES------LAAVATKPVPVLKK-SNSKRVMG----LDLNSSPME-DDLTLRLGKV  317

Query  201  ATPVL  187
            A P++
Sbjct  318  APPLV  322



>gb|KHN02412.1| Zinc finger protein ZAT11-like protein [Glycine soja]
Length=171

 Score =   134 bits (338),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 101/165 (61%), Gaps = 14/165 (8%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKR R++ G E+  +ANCLM+L+H  +N          +   F+CKTC++KF SFQALGG
Sbjct  1    MKRQRDFKGFESIDLANCLMMLSHPQQNEKLLQKKI--EAVEFECKTCNRKFSSFQALGG  58

Query  531  HRASHKKPKLVAP----APGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMK  364
            HRASHK+ KL       A     S   K KMH CSICG EF++GQALGGHMRRHR  +  
Sbjct  59   HRASHKRSKLEGDHELKAHAISLSLANKPKMHECSICGQEFSLGQALGGHMRRHRTTI--  116

Query  363  EGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
               E+  +   +   +PVLKR+ S++ +      LDLNLTP END
Sbjct  117  --HEDFSSIKQVITQMPVLKRSNSTRVV----TCLDLNLTPLEND  155



>gb|KCW85608.1| hypothetical protein EUGRSUZ_B02395, partial [Eucalyptus grandis]
Length=194

 Score =   135 bits (340),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 118/179 (66%), Gaps = 23/179 (13%)
 Frame = -2

Query  714  LMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALG  535
            ++KR RE   VEA A+AN LMLL+ VG++S S+  S   +   F CKTC+++F SFQALG
Sbjct  23   MVKRDREDTEVEALAVANSLMLLSRVGQSSDSNCKSWPTERM-FACKTCNREFSSFQALG  81

Query  534  GHRASHKKPKLVAPAPGE-------QESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRA  376
            GHRASHKKPKL++   G+        +SS  K K H CSICGL+F +GQALGGHMRRHRA
Sbjct  82   GHRASHKKPKLIS---GDLFHLGHAADSSQAKPKKHECSICGLDFPIGQALGGHMRRHRA  138

Query  375  AMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND-DLKIESTTP  202
            AM++        A   A  +PVLK+ ++SKR+ G    LDLN +P E+D  L++   TP
Sbjct  139  AMLER------LATATAKPVPVLKK-SNSKRVMG----LDLNSSPTEDDLTLRLGKVTP  186



>ref|XP_010043582.1| PREDICTED: zinc finger protein ZAT8-like [Eucalyptus grandis]
 gb|AGK28199.1| C2H2-type zinc finger protein 1 [Eucalyptus grandis]
 gb|KCW85604.1| hypothetical protein EUGRSUZ_B02392 [Eucalyptus grandis]
Length=175

 Score =   134 bits (337),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 116/185 (63%), Gaps = 24/185 (13%)
 Frame = -2

Query  714  LMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCS--FQCKTCDKKFPSFQA  541
            ++KR RE   VEA A ANCLMLL+ VG ++ S+            F CKTC+++F SFQA
Sbjct  1    MVKRDREDTEVEALARANCLMLLSRVGESTDSASLDRKSHPTERMFACKTCNREFSSFQA  60

Query  540  LGGHRASHKKPKLVAPAPGE-------QESSPEKSKMHRCSICGLEFAMGQALGGHMRRH  382
            LGGH+ASHKKPKL++   G+        +SSP K K H CSICGL+F MGQALGGHMR+H
Sbjct  61   LGGHKASHKKPKLIS---GDLFHLGHAADSSPAKPKTHECSICGLDFPMGQALGGHMRKH  117

Query  381  RAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTP  202
            RAAM++        A   A  +PVLK+ ++SKR+ GF    DLN  P + DDL +     
Sbjct  118  RAAMLES------LAAAAAKPVPVLKK-SNSKRVTGF----DLNSLPMQ-DDLTLRLGKV  165

Query  201  ATPVL  187
            A P++
Sbjct  166  APPLV  170



>ref|XP_010043581.1| PREDICTED: zinc finger protein ZAT8-like [Eucalyptus grandis]
Length=175

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 116/185 (63%), Gaps = 24/185 (13%)
 Frame = -2

Query  714  LMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCS--FQCKTCDKKFPSFQA  541
            ++KR RE   VEA A  NCLMLL+ VG ++ S+ P          F CKTC+++F SFQA
Sbjct  1    MVKRDREDTEVEALARVNCLMLLSRVGESTDSASPDRKSRPTERMFACKTCNREFSSFQA  60

Query  540  LGGHRASHKKPKLVAPAPGE-------QESSPEKSKMHRCSICGLEFAMGQALGGHMRRH  382
            LGGH+ASHKKPKL++   G+        +SSP K K H CSICGL+F MGQALGGHMRRH
Sbjct  61   LGGHKASHKKPKLIS---GDLFHLGHAADSSPAKPKTHECSICGLDFPMGQALGGHMRRH  117

Query  381  RAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTP  202
            RAAM++        A   A  +PVLK+ ++SKR+ G    LDLN  P E DDL +     
Sbjct  118  RAAMLES------LAAAAAKPVPVLKK-SNSKRVTG----LDLNSLPME-DDLTLRLGKV  165

Query  201  ATPVL  187
            A P++
Sbjct  166  APPLV  170



>gb|KCW85603.1| hypothetical protein EUGRSUZ_B02390, partial [Eucalyptus grandis]
Length=178

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 116/185 (63%), Gaps = 24/185 (13%)
 Frame = -2

Query  714  LMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCS--FQCKTCDKKFPSFQA  541
            ++KR RE   VEA A  NCLMLL+ VG ++ S+ P          F CKTC+++F SFQA
Sbjct  4    MVKRDREDTEVEALARVNCLMLLSRVGESTDSASPDRKSRPTERMFACKTCNREFSSFQA  63

Query  540  LGGHRASHKKPKLVAPAPGE-------QESSPEKSKMHRCSICGLEFAMGQALGGHMRRH  382
            LGGH+ASHKKPKL++   G+        +SSP K K H CSICGL+F MGQALGGHMRRH
Sbjct  64   LGGHKASHKKPKLIS---GDLFHLGHAADSSPAKPKTHECSICGLDFPMGQALGGHMRRH  120

Query  381  RAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTP  202
            RAAM++        A   A  +PVLK+ ++SKR+ G    LDLN  P E DDL +     
Sbjct  121  RAAMLES------LAAAAAKPVPVLKK-SNSKRVTG----LDLNSLPME-DDLTLRLGKV  168

Query  201  ATPVL  187
            A P++
Sbjct  169  APPLV  173



>ref|XP_007142720.1| hypothetical protein PHAVU_007G011300g [Phaseolus vulgaris]
 gb|ESW14714.1| hypothetical protein PHAVU_007G011300g [Phaseolus vulgaris]
Length=174

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 105/181 (58%), Gaps = 12/181 (7%)
 Frame = -2

Query  714  LMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALG  535
            +MKR RE   VE+  MAN LMLL+  G   + +    S +   F+CKTC ++FPSFQALG
Sbjct  1    MMKRERE---VESVTMANYLMLLSAGGEFENRNYLKYSSNNRVFECKTCKRQFPSFQALG  57

Query  534  GHRASHKKPKLVAPAPGEQE---SSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMK  364
            GHRASHKKP+L+       +    SP K K H CSICGLEFA+GQALGGHMRRHR +   
Sbjct  58   GHRASHKKPRLMMGESDHNQVLHGSPPKPKTHECSICGLEFAIGQALGGHMRRHRTSSST  117

Query  363  EGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPATPVLR  184
             G  +        +     ++    + +F      DLNLTP+EN DL+I      TP+L 
Sbjct  118  NGSMHSSLVSGRRVHNGSPQKGEKKRVLFP-----DLNLTPSEN-DLEILKIRTPTPLLH  171

Query  183  C  181
            C
Sbjct  172  C  172



>gb|KDO44126.1| hypothetical protein CISIN_1g031966mg [Citrus sinensis]
Length=150

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 92/123 (75%), Gaps = 15/123 (12%)
 Frame = -2

Query  585  FQCKTCDKKFPSFQALGGHRASHKKPKLVAPAPGEQES----SPEKSKMHRCSICGLEFA  418
            F+CKTC+++FPSFQALGGHRASHKKP+L+    GE ++    +  K K+H CSICG EFA
Sbjct  22   FECKTCNRQFPSFQALGGHRASHKKPRLIN---GETKTLSSTTATKPKLHECSICGQEFA  78

Query  417  MGQALGGHMRRHRAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPA  238
            MGQALGGHMRRHR AM     E+  +A+ ++ + PVL+R+ SS+R+FG    LDLNLTP 
Sbjct  79   MGQALGGHMRRHRIAMN----ESLNSAVIVSQSPPVLRRSNSSRRVFG----LDLNLTPL  130

Query  237  END  229
            END
Sbjct  131  END  133



>ref|XP_007218449.1| hypothetical protein PRUPE_ppa011762mg [Prunus persica]
 gb|EMJ19648.1| hypothetical protein PRUPE_ppa011762mg [Prunus persica]
Length=197

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 86/201 (43%), Positives = 111/201 (55%), Gaps = 31/201 (15%)
 Frame = -2

Query  717  MLMKRS----REYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPS  550
            M MKRS    RE     +  MANCLMLL+    +       ++     F+CKTC+++FPS
Sbjct  1    MTMKRSITEMRELD--RSLTMANCLMLLSRGSHDHHQYDTFSASPTRVFECKTCNRQFPS  58

Query  549  FQALGGHRASHKKPKLVAPAPG---------EQESSPEKSKMHRCSICGLEFAMGQALGG  397
            FQALGGHRASHKKP+L+    G         + + SP K K H C+ICGLEFA+GQALGG
Sbjct  59   FQALGGHRASHKKPRLMGSGDGNSSNGSDQSQSQGSPPKPKTHECNICGLEFAIGQALGG  118

Query  396  HMRRHRAAMMKEGFENppaaipmamai-----------PVLKRTTSSKRIFGFGLNLDLN  250
            HMRRHR+A+      +  +                    VLK+T S +R+    + LDLN
Sbjct  119  HMRRHRSALSNNNNTSQYSDSNSNSNSVSLSPQPAPMFQVLKKTNSGRRV----MCLDLN  174

Query  249  LTPAENDDLKIESTTPATPVL  187
            LTP EN DLKI     A P++
Sbjct  175  LTPLEN-DLKILQIGKAAPLV  194



>ref|NP_001235638.1| uncharacterized protein LOC100527151 [Glycine max]
 gb|ACU16201.1| unknown [Glycine max]
Length=183

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 101/165 (61%), Gaps = 14/165 (8%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKR R++ G E+  +ANCLM+L+H  +N          +   F+CKTC++KF SFQALGG
Sbjct  1    MKRQRDFKGFESIDLANCLMMLSHPQQNEKLLQKKI--EAVEFECKTCNRKFSSFQALGG  58

Query  531  HRASHKKPKLVAP----APGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMK  364
            HRASHK+ KL       A     S   K KMH CSICG EF++GQALGGHMRRHR  +  
Sbjct  59   HRASHKRSKLEGDHELKAHAISLSLANKPKMHECSICGQEFSLGQALGGHMRRHRTTI--  116

Query  363  EGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
               E+  +   +   +PVLKR+ S++ +      LDLNLTP END
Sbjct  117  --HEDFSSIKQVITQMPVLKRSNSTRVV----TCLDLNLTPLEND  155



>gb|KDP29859.1| hypothetical protein JCGZ_18434 [Jatropha curcas]
Length=191

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 109/177 (62%), Gaps = 23/177 (13%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLC------SFQCKTCDKKFPS  550
            MKRS     +++  MANCLMLL+  G+ +      A KD         F+CKTC+++FPS
Sbjct  1    MKRSFYNTEIDSITMANCLMLLSQ-GKETRFPSFEAMKDTGLNSPGRVFECKTCNRQFPS  59

Query  549  FQALGGHRASHKKPKLVAPAPGEQESS--------PEKSKMHRCSICGLEFAMGQALGGH  394
            FQALGGHRASHKKP+L+    G  E+         P K K H CSICGLEFA+GQALGGH
Sbjct  60   FQALGGHRASHKKPRLMG-GDGSLENQTSSLSSSSPVKPKTHECSICGLEFAIGQALGGH  118

Query  393  MRRHRAAMMKEGFENppaaipmamai--PVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            MRRHRAA+      N   +    + +  P+LK+ ++SKR+    L LDLNLTP END
Sbjct  119  MRRHRAALSNNNHNNGDDSAEEKVMVPPPILKK-SNSKRV----LCLDLNLTPYEND  170



>gb|AGY36840.1| Cys2/His2-type zinc finger protein [Citrus trifoliata]
Length=159

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 104/173 (60%), Gaps = 25/173 (14%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKR RE A ++    ANCLMLL+ VG                F CKTC+K+FPSFQALGG
Sbjct  1    MKRDREMAAIDT---ANCLMLLSKVGDTDQRKRV--------FACKTCNKEFPSFQALGG  49

Query  531  HRASHKKPKLVAPAPGEQE--------SSPEKSKMHRCSICGLEFAMGQALGGHMRRHRA  376
            HRASHKKPKL+  A   ++        +SP+K K H CSICGLEFA+GQALGGHMRRHRA
Sbjct  50   HRASHKKPKLMTMASSGEDFDQAQMPPASPKKPKTHECSICGLEFAIGQALGGHMRRHRA  109

Query  375  AMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKI  217
            A    G           + +PVLK++ S KR     L LDLNL P   DDLK+
Sbjct  110  AAAMGG-AADGLVTRPLLPLPVLKKSNSCKR----ALCLDLNLMPT-GDDLKL  156



>dbj|BAA21923.1| ZPT2-14 [Petunia x hybrida]
Length=166

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 107/170 (63%), Gaps = 17/170 (10%)
 Frame = -2

Query  723  MTMLMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQ  544
            + + +KR RE        MAN LML +H   + ++   ++   +  F+CKTC+++F SFQ
Sbjct  2    VVLPLKREREAEFKSITTMANYLMLFSHQENHFNTMMDNSPSRV--FECKTCNRQFSSFQ  59

Query  543  ALGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMK  364
            ALGGHRASHKKP+L+     +  +SP K K H CSICGLEF +GQALGGHMRRHRA M +
Sbjct  60   ALGGHRASHKKPRLMGELNFQLPTSPPKPKTHECSICGLEFPIGQALGGHMRRHRAVMNE  119

Query  363  EGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIE  214
               +            PV+K+ ++S+R+    L LDLNLTP END+L+ +
Sbjct  120  NNLQ----------VTPVVKK-SNSRRV----LCLDLNLTPLENDNLEFK  154



>ref|XP_003521347.1| PREDICTED: zinc finger protein ZAT11-like [Glycine max]
Length=173

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 101/164 (62%), Gaps = 13/164 (8%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKR R++ G E+  +ANCLM+L+H  +N          +   F+CKTC++KF SFQALGG
Sbjct  1    MKRQRDFEGFESIDLANCLMMLSHPQQNKKLLQTKI--EAVKFECKTCNRKFSSFQALGG  58

Query  531  HRASHKKPKLVAP---APGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKE  361
            HRASHK+ KL      A     S   K KMH CSICG EF++GQALGGHMRRHR  +   
Sbjct  59   HRASHKRSKLEGDELKAHAISLSLGNKPKMHECSICGQEFSLGQALGGHMRRHRTTIN--  116

Query  360  GFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
              E+  +   +   +P LKR+ S++ I    + LDLNLTP END
Sbjct  117  --EDFSSIKQVITQVPDLKRSNSTRVI----MCLDLNLTPFEND  154



>gb|ACU20152.1| unknown [Glycine max]
Length=173

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 101/164 (62%), Gaps = 13/164 (8%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKR R++ G E+  +ANCLM+L+H  +N          +   F+CKTC++KF SFQALGG
Sbjct  1    MKRQRDFEGFESIDLANCLMMLSHPQQNKKLLQTKI--EAVKFECKTCNRKFSSFQALGG  58

Query  531  HRASHKKPKLVAP---APGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKE  361
            HRASHK+ KL      A     S   K KMH CSICG EF++GQALGGHMRRHR  +   
Sbjct  59   HRASHKRSKLEGDELKAHAISLSLGSKPKMHECSICGQEFSLGQALGGHMRRHRTTIN--  116

Query  360  GFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
              E+  +   +   +P LKR+ S++ I    + LDLNLTP END
Sbjct  117  --EDFSSIKQVITQVPDLKRSNSTRVI----MCLDLNLTPFEND  154



>ref|XP_010043590.1| PREDICTED: zinc finger protein ZAT8-like [Eucalyptus grandis]
 gb|AGK28201.1| C2H2-type zinc finger protein 3 [Eucalyptus grandis]
 gb|KCW85612.1| hypothetical protein EUGRSUZ_B02399 [Eucalyptus grandis]
Length=173

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 111/181 (61%), Gaps = 18/181 (10%)
 Frame = -2

Query  714  LMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCS--FQCKTCDKKFPSFQA  541
            ++KR RE   VEA A+ANCLMLL+ VG ++ S   +         F CKTC+++F SFQA
Sbjct  1    MVKRDREDTEVEALALANCLMLLSRVGESTDSPWLNHKSRPTERMFACKTCNREFSSFQA  60

Query  540  LGGHRASHKKPKLVAPA---PGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAM  370
            LGGHRASHKKPKL           +SSP K K H C+ICGLEF +GQALGGHMRRHRAAM
Sbjct  61   LGGHRASHKKPKLSGDLFHLGRTADSSPAKPKTHECAICGLEFPLGQALGGHMRRHRAAM  120

Query  369  MKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPATPV  190
             +               +PVLK+ ++SKR+    + LDLN +P E DDL +     A P+
Sbjct  121  AES-------LATAEKPVPVLKK-SNSKRV----MCLDLNSSPTE-DDLTLRLGKAAPPL  167

Query  189  L  187
            +
Sbjct  168  V  168



>ref|XP_009628790.1| PREDICTED: zinc finger protein ZAT12-like [Nicotiana tomentosiformis]
Length=184

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 108/178 (61%), Gaps = 25/178 (14%)
 Frame = -2

Query  711  MKRSREYA-GVEAEAMANC-LMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQAL  538
            +KRSRE    VEAEAMANC L LL+ +  N++S+      D   F+CKTC+K+FPSFQAL
Sbjct  29   IKRSREEDRQVEAEAMANCALTLLSRLNNNATSTDRDYHND---FECKTCNKRFPSFQAL  85

Query  537  GGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEG  358
            G HRASHK+PKL+A A G+     +K+KMH C ICG+EF +GQALGGHM RH+       
Sbjct  86   GNHRASHKRPKLLAGA-GDFLVQSKKNKMHECYICGMEFYLGQALGGHMIRHQKT-----  139

Query  357  FENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTP-ATPVL  187
                            + R T ++        LDLNLTP EN +LK+  T P ++PVL
Sbjct  140  -------------SSSVARKTKTQVTGIIFCCLDLNLTPDENVELKLWPTAPVSSPVL  184



>gb|KDO67723.1| hypothetical protein CISIN_1g040287mg [Citrus sinensis]
Length=162

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 100/167 (60%), Gaps = 11/167 (7%)
 Frame = -2

Query  669  MANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGGHRASHKKPKLVAPA  490
            MANCLM ++  G   + +    +     F+CKTC+++FPSFQALGGHRASHKKP+L    
Sbjct  1    MANCLMFMSQGGHFDAVNSVDMTAAGRVFECKTCNRQFPSFQALGGHRASHKKPRLTDGT  60

Query  489  PG--EQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFENppaaipmamai  316
             G  + + SP K + H CS+CGLEFA+GQALGGHMRRHRA  +     N   +       
Sbjct  61   GGGADTQQSPAKPRTHECSVCGLEFAIGQALGGHMRRHRAVALH---GNEKVSTLTLSDT  117

Query  315  PVLKRTTSSKRIFGFGLNLDLNLTPAENDDL--KIESTTPATPVLRC  181
              L +  +S+R+    L LDLNLTP END    ++ S   A P++ C
Sbjct  118  APLVKKANSRRV----LCLDLNLTPYENDLECHRLGSNKAAAPIVDC  160



>ref|XP_003625524.1| Zinc finger protein [Medicago truncatula]
 gb|AES81742.1| Cys2-His2 zinc finger transcription factor [Medicago truncatula]
 gb|AFK47111.1| unknown [Medicago truncatula]
Length=165

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 108/183 (59%), Gaps = 30/183 (16%)
 Frame = -2

Query  717  MLMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQAL  538
            M MKR R   G++    ANCLMLL+   + S  +          ++CKTC+KKF SFQAL
Sbjct  1    MAMKRQRSNEGID---YANCLMLLSCPQQKSYENG--------EYECKTCNKKFSSFQAL  49

Query  537  GGHRASHKKPKLVAPAPGEQESSPEKS-------KMHRCSICGLEFAMGQALGGHMRRHR  379
            GGHRASHK+ KL   A GE+     KS       KMH CSICG+ F++GQALGGHMR+HR
Sbjct  50   GGHRASHKRMKL---AEGEELKEQAKSLSLWNKPKMHECSICGMGFSLGQALGGHMRKHR  106

Query  378  AAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPA  199
            A +     E   +   +    PVLKR  +SKRI G    LDLNLTP ENDDL     +P 
Sbjct  107  AVIN----EGVSSINQIIEKFPVLKR-LNSKRIMG----LDLNLTPLENDDLMFGIKSPP  157

Query  198  TPV  190
            TP+
Sbjct  158  TPI  160



>ref|XP_006363360.1| PREDICTED: zinc finger protein ZAT11-like [Solanum tuberosum]
Length=164

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 116/180 (64%), Gaps = 26/180 (14%)
 Frame = -2

Query  711  MKRSREYAG-VEAEAMANC-LMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQAL  538
            MKRSRE  G VEAEAMANC LMLL+ +  N++++          F CKTC+K+FPSFQAL
Sbjct  4    MKRSREDNGQVEAEAMANCALMLLSRLNNNNNNNN--------DFACKTCNKRFPSFQAL  55

Query  537  GGHRASH-KKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKE  361
            GGHR SH KKPKL+     +   + +K+KMH+CSICG EF++GQALGGHMR HR  + K 
Sbjct  56   GGHRTSHNKKPKLLGEFLVQ---TNKKNKMHKCSICGTEFSLGQALGGHMRGHRDEINK-  111

Query  360  GFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPA-TPVLR  184
                          IP+LK++ SSKRI  FG+N   N+ P  +DDLK+     A +PVLR
Sbjct  112  ------ITSHEKTMIPILKKSNSSKRINIFGVN--FNIKP--DDDLKLWPMEEAPSPVLR  161



>ref|XP_004492093.1| PREDICTED: zinc finger protein ZAT11-like [Cicer arietinum]
Length=177

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 106/179 (59%), Gaps = 18/179 (10%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKR RE     +  MANCLMLL+       ++  S S +   F+CKTC+++F SFQALGG
Sbjct  1    MKRERE-----SITMANCLMLLSRGSNQFEATYSSISSNNRVFECKTCNRQFSSFQALGG  55

Query  531  HRASHKKPKLVAP----APGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMK  364
            HRASHKKP+L+        G+  ++P K K H CSICGLEFA+GQALGGHMRRHRA+ + 
Sbjct  56   HRASHKKPRLMQENGENIDGQLLNTPPKPKTHECSICGLEFAIGQALGGHMRRHRASNLN  115

Query  363  EGF---ENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND--DLKIESTTP  202
                   N  +    ++      +   +KR+F     LDLNLTP END    KI  TTP
Sbjct  116  GNMIHNSNTMSCSSGSLDSSQKMKVVGNKRVFV----LDLNLTPFENDLEFFKIGKTTP  170



>ref|XP_002311150.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE88517.1| zinc finger family protein [Populus trichocarpa]
Length=177

 Score =   132 bits (333),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 105/167 (63%), Gaps = 10/167 (6%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCS----FQCKTCDKKFPSFQ  544
            MKRS     +++  MANCL+ L+    + S      + +  S    F+CKTC++KFPSFQ
Sbjct  1    MKRSLYAREIDSITMANCLVFLSKGRESYSFPSFDHAINNNSPSRVFECKTCNRKFPSFQ  60

Query  543  ALGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMK  364
            ALGGHRASHKKPKL+      +  SP K K H CSICGLEFA+GQALGGHMRRHRAA+  
Sbjct  61   ALGGHRASHKKPKLMGGEGSFESQSPAKPKTHECSICGLEFAIGQALGGHMRRHRAALND  120

Query  363  EGFENppaaipmamaiPVLK--RTTSSKRIFGFGLNLDLNLTPAEND  229
            +     P + P +    V+   + ++S+R+    L LDLNLTP END
Sbjct  121  QNQLADPLSPPSSDHKQVVPVVKKSNSRRV----LCLDLNLTPNEND  163



>gb|AFK36078.1| unknown [Medicago truncatula]
Length=165

 Score =   132 bits (332),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 108/183 (59%), Gaps = 30/183 (16%)
 Frame = -2

Query  717  MLMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQAL  538
            M MKR R   G++    ANCLMLL+   + S  +          ++CKTC+KKF SFQAL
Sbjct  1    MAMKRQRSNEGID---YANCLMLLSCPQQKSYENG--------EYECKTCNKKFSSFQAL  49

Query  537  GGHRASHKKPKLVAPAPGEQESSPEKS-------KMHRCSICGLEFAMGQALGGHMRRHR  379
            GGHRASHK+ KL   A GE+     KS       KMH CSICG+ F++GQALGGHMR+HR
Sbjct  50   GGHRASHKRMKL---AEGEELKERAKSLSLWNKPKMHECSICGMGFSLGQALGGHMRKHR  106

Query  378  AAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPA  199
            A +     E   +   +    PVLKR  +SKRI G    LDLNLTP ENDDL     +P 
Sbjct  107  AVIN----EGVSSINQIIEKFPVLKR-LNSKRIMG----LDLNLTPLENDDLMFGIKSPP  157

Query  198  TPV  190
            TP+
Sbjct  158  TPI  160



>ref|XP_010043583.1| PREDICTED: zinc finger protein ZAT8-like [Eucalyptus grandis]
Length=175

 Score =   132 bits (332),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 115/185 (62%), Gaps = 24/185 (13%)
 Frame = -2

Query  714  LMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCS--FQCKTCDKKFPSFQA  541
            ++KR RE   VEA A ANCLMLL+ VG ++ S+ P          F CKTC+++F SFQA
Sbjct  1    MVKRDREDTEVEALARANCLMLLSRVGESTDSASPDRKSHPTERMFACKTCNREFSSFQA  60

Query  540  LGGHRASHKKPKLVAPAPGE-------QESSPEKSKMHRCSICGLEFAMGQALGGHMRRH  382
            LGGH+ASHKK KL++   G+        +SSP K K H CSICGL+F MGQALGGHMR+H
Sbjct  61   LGGHKASHKKQKLIS---GDLFHLGHAADSSPAKPKTHECSICGLDFPMGQALGGHMRKH  117

Query  381  RAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTP  202
            RAAM++        A   A  + VLK+ ++SKR+ G    LDLN  P E DDL +     
Sbjct  118  RAAMLES------LAAAAAKPVLVLKK-SNSKRVTG----LDLNSLPME-DDLTLRLGKV  165

Query  201  ATPVL  187
            A P++
Sbjct  166  APPLV  170



>ref|XP_010043589.1| PREDICTED: zinc finger protein ZAT8-like [Eucalyptus grandis]
 gb|AGK28200.1| C2H2-type zinc finger protein 2 [Eucalyptus grandis]
 gb|KCW85611.1| hypothetical protein EUGRSUZ_B02398 [Eucalyptus grandis]
Length=172

 Score =   132 bits (332),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 116/183 (63%), Gaps = 23/183 (13%)
 Frame = -2

Query  714  LMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALG  535
            ++KR RE A VEA A+ANCLMLL  VG  + S+  S S +   F CKTC+++F SFQALG
Sbjct  1    MVKRDREDAEVEALAVANCLMLLPRVGECADSNRESRSTER-MFACKTCNREFSSFQALG  59

Query  534  GHRASHKKPKLVAPAPG-------EQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRA  376
            GHR SHKK KL+   PG         +SSP K K H CSICGLEF MGQALGGHMRRHRA
Sbjct  60   GHRTSHKKQKLI---PGGLFHLGCTADSSPAKPKRHECSICGLEFPMGQALGGHMRRHRA  116

Query  375  AMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPAT  196
            A M EG      A   A  +PVLKR ++SKR+    + LDLN +  E DDL +     A 
Sbjct  117  A-MAEGL-----AAEAAKPVPVLKR-SNSKRV----MCLDLNSSLME-DDLTLRLGKVAP  164

Query  195  PVL  187
            P++
Sbjct  165  PLV  167



>ref|XP_007150296.1| hypothetical protein PHAVU_005G141500g [Phaseolus vulgaris]
 gb|ESW22290.1| hypothetical protein PHAVU_005G141500g [Phaseolus vulgaris]
Length=177

 Score =   132 bits (333),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 113/192 (59%), Gaps = 32/192 (17%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNsssspps-----aSKDLCSFQCKTCDKKFPSF  547
            MKRSRE    E E M NCLMLL  VG + ++            D+  F+CKTC+++F SF
Sbjct  1    MKRSREEG--ELENMTNCLMLLTKVGVSETNPTSKGCGELRDSDVGDFKCKTCNRRFSSF  58

Query  546  QALGGHRASHKKPKLVA----------PAPGEQESSPEKSKMHRCSICGLEFAMGQALGG  397
            QALGGHRASHKKP+L+           P+P     + ++ +MH C ICGLEFA+GQALGG
Sbjct  59   QALGGHRASHKKPRLMITDLSCHHHTLPSP----VTKQQPRMHPCPICGLEFAIGQALGG  114

Query  396  HMRRHRAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKI  217
            HMR+HR A +  G  N       + ++ +LK++    ++    L LDLNL P E+DDLK+
Sbjct  115  HMRKHRTA-INGGLLN----RRDSDSLSILKKSKDGGKL---NLCLDLNLMPLEDDDLKL  166

Query  216  ESTTPATPVLRC  181
                  TPVL C
Sbjct  167  NL---RTPVLNC  175



>ref|XP_004294603.1| PREDICTED: zinc finger protein ZAT11-like [Fragaria vesca subsp. 
vesca]
Length=158

 Score =   132 bits (331),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 105/159 (66%), Gaps = 11/159 (7%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKR+RE    + + + +CLMLL+ + RN SSS          F CKTC+++F SFQALGG
Sbjct  1    MKRAREDEQ-QTDDLVSCLMLLSKLDRNHSSSIRKQPSSGRLFACKTCNREFSSFQALGG  59

Query  531  HRASHKKPKLVAPAPG--EQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEG  358
            HRASHKKPK  + A    +Q SSPEK K H C+ICG+EFA+GQALGGHMRRH+  M    
Sbjct  60   HRASHKKPKPDSGAADLLQQPSSPEKPKKHECTICGMEFAVGQALGGHMRRHKDVM----  115

Query  357  FENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTP  241
              +  A    A A+PVLK++ SSKR+    LNLDLNL P
Sbjct  116  --SSAAERIRAAAVPVLKKSNSSKRV--SCLNLDLNLAP  150



>ref|XP_004241247.1| PREDICTED: zinc finger protein ZAT12-like [Solanum lycopersicum]
Length=154

 Score =   132 bits (331),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 104/176 (59%), Gaps = 25/176 (14%)
 Frame = -2

Query  711  MKRSREYAG-VEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALG  535
            M + RE  G VEA+AMANCLMLL+ + R+  +          SF+CKTC ++F SFQALG
Sbjct  1    MIKIREDKGEVEAQAMANCLMLLSSIDRDRRN----------SFECKTCKRRFSSFQALG  50

Query  534  GHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGF  355
            GHR SHK    +      + S  +K K+H C ICG+EF+MGQALGGHMRRHRA +     
Sbjct  51   GHRTSHKSTIDIGKFLHGKIS--KKRKVHECLICGMEFSMGQALGGHMRRHRAPV-----  103

Query  354  ENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPATPVL  187
                     A  IPVLK++ S++RIF     +DLNLTP ENDD       P  P L
Sbjct  104  ---NEIEHSAKRIPVLKKSNSNERIFC----VDLNLTPDENDDFHFWPMPPVPPFL  152



>ref|XP_011077219.1| PREDICTED: zinc finger protein ZAT11-like [Sesamum indicum]
Length=179

 Score =   132 bits (332),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 115/180 (64%), Gaps = 12/180 (7%)
 Frame = -2

Query  714  LMKRSRE-YAGVE-AEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQA  541
            +MKR RE  A VE   +MANCLMLL+   R ++++          F+CKTC+++FPSFQA
Sbjct  1    MMKRCREGSADVEDVSSMANCLMLLSG-DRAAAAAAAGGGVFTRVFECKTCNRQFPSFQA  59

Query  540  LGGHRASHKKPKLVAPAPG--EQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMM  367
            LGGHRASHKKP+L A         SSP K K H CSICGLEFA+GQALGGHMRRHRAAM 
Sbjct  60   LGGHRASHKKPRLQAGGDHLLRASSSPPKPKTHECSICGLEFAIGQALGGHMRRHRAAMN  119

Query  366  KEGFENpp---aaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPAT  196
             +  ++      +  ++++ P++ + + S R+    L LDLNLTP+EN  L  +   PA 
Sbjct  120  DQNQQSRSPPLPSSVLSLSPPLIVKKSKSTRV----LCLDLNLTPSENKFLFGKVAAPAV  175



>gb|AES12473.1| C2H2-type zinc finger protein 1 [Populus trichocarpa]
Length=179

 Score =   132 bits (332),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 107/182 (59%), Gaps = 10/182 (5%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCS----FQCKTCDKKFPSFQ  544
            MKR      +++  MANCLM L+    + S      +    S    F+CKTC+++FPSFQ
Sbjct  1    MKRGLHEREIDSITMANCLMFLSKGRESYSFPSFDHAMSNISPARVFECKTCNRQFPSFQ  60

Query  543  ALGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMK  364
            ALGGHRASHKKP+L+      +  SP K K H CSICGLEFA+GQALGGHMRRHRAA+  
Sbjct  61   ALGGHRASHKKPRLMGGEGSFETQSPAKPKTHECSICGLEFAIGQALGGHMRRHRAALND  120

Query  363  EGFENppaaipmamaiPV-LKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPATPVL  187
                +P           V + + ++S+R+    L LDLNLTP EN D+++       P++
Sbjct  121  RNQVDPLNPPSTDDQKAVPVVKRSNSRRV----LCLDLNLTPYEN-DMELFKLGTTAPMV  175

Query  186  RC  181
             C
Sbjct  176  NC  177



>ref|XP_006363364.1| PREDICTED: zinc finger protein ZAT11-like [Solanum tuberosum]
Length=165

 Score =   132 bits (331),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 117/184 (64%), Gaps = 33/184 (18%)
 Frame = -2

Query  711  MKRSREYAG-VEAEAMANC-LMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQAL  538
            MKR RE  G VEAEAMANC LMLL+ + +++             F+CKTC+K+FPSFQAL
Sbjct  4    MKRRREDNGQVEAEAMANCALMLLSRLNKDN------------DFECKTCNKQFPSFQAL  51

Query  537  GGHRASH-KKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKE  361
            GGHRASH K+ +L+     +  +   K+KMH+CSICG+EF++GQALGGHMRRHR  + K 
Sbjct  52   GGHRASHNKRSRLLGEFLVQTNT---KNKMHKCSICGMEFSLGQALGGHMRRHRDKINKI  108

Query  360  GFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTP----AENDDLKIESTTPA-T  196
              E           IP+LK++ SSKRI  FGLN  LN+TP       DDLK+     A +
Sbjct  109  TPE--------KTMIPILKKSNSSKRINIFGLN--LNITPDDDDDNVDDLKLWPMEEAPS  158

Query  195  PVLR  184
            PVLR
Sbjct  159  PVLR  162



>gb|KDP44196.1| hypothetical protein JCGZ_05663 [Jatropha curcas]
Length=188

 Score =   132 bits (333),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 109/201 (54%), Gaps = 39/201 (19%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKR RE    EA  MANCLMLL+ VGR    +          F CKTC++KFPSFQALGG
Sbjct  1    MKRGREE---EAMDMANCLMLLSKVGRTEEETTGRM------FSCKTCNRKFPSFQALGG  51

Query  531  HRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHM-------------  391
            HRASHKKPKL+     +  SSP K K H CSICGLEFA+GQALGGHM             
Sbjct  52   HRASHKKPKLIGGELLKLPSSPPKPKTHECSICGLEFAIGQALGGHMRRHRGVANNNMVG  111

Query  390  ----------RRHRAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTP  241
                      RRHR  +  +             ++P++K++  SKR+    L+LDLNL P
Sbjct  112  EELVTLGGHMRRHR-GVANDNMVGEELVTRSLFSVPIMKKSV-SKRV----LSLDLNLPP  165

Query  240  AEND-DLKIESTTPATPVLRC  181
             END  L++     +  VL C
Sbjct  166  VENDLTLQLGKVVQSPLVLNC  186



>ref|XP_011000297.1| PREDICTED: zinc finger protein ZAT11 [Populus euphratica]
Length=190

 Score =   132 bits (333),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 112/194 (58%), Gaps = 23/194 (12%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLC--------SFQCKTCDKKF  556
            MKR RE A ++   +A CLMLL+ VG+       + +            SF CKTC+K F
Sbjct  1    MKRDREEAELD---LAKCLMLLSKVGKADHEILTNYTSAAATAGAGAGRSFSCKTCNKNF  57

Query  555  PSFQALGGHRASHKKPKLVAPAPG--EQESSPEKSKMHRCSICGLEFAMGQALGGHMRRH  382
            PSFQALGGHRASHKKPKL+       +  +SP K K H+CSICGLEF +GQALGGHMRRH
Sbjct  58   PSFQALGGHRASHKKPKLMESTGNLLKLPNSPSKPKTHQCSICGLEFPLGQALGGHMRRH  117

Query  381  RA-------AMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDL  223
            RA       +   +  E      P   A+PVLKR+ SSKR+    L+L L   P   +D 
Sbjct  118  RAPNNVDTTSTSSKDHELAVTQPPFLPAVPVLKRSNSSKRVLCLDLSLAL---PMYQNDS  174

Query  222  KIESTTPATPVLRC  181
            +++    A P+L+C
Sbjct  175  ELQLEKVARPMLKC  188



>ref|XP_002316305.2| hypothetical protein POPTR_0010s21650g [Populus trichocarpa]
 gb|EEF02476.2| hypothetical protein POPTR_0010s21650g [Populus trichocarpa]
Length=175

 Score =   132 bits (331),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 100/166 (60%), Gaps = 9/166 (5%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCS----FQCKTCDKKFPSFQ  544
            MKR      +++  MANCLM L+    + S      +    S    F+CKTC+++FPSFQ
Sbjct  1    MKRGLHEREIDSITMANCLMFLSKGRESYSFPSFDHAMSNISPARVFECKTCNRQFPSFQ  60

Query  543  ALGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMK  364
            ALGGHRASHKKP+L+      +  SP K K H CSICGLEFA+GQALGGHMRRHRAA+  
Sbjct  61   ALGGHRASHKKPRLMGGEGSFETQSPAKPKTHECSICGLEFAIGQALGGHMRRHRAALND  120

Query  363  EGFENppaaipmamaiPV-LKRTTSSKRIFGFGLNLDLNLTPAEND  229
                +P           V + + ++S+R+    L LDLNLTP END
Sbjct  121  RNQVDPLNPPSTDDQKAVPVVKRSNSRRV----LCLDLNLTPYEND  162



>ref|NP_001237020.1| uncharacterized protein LOC100500371 [Glycine max]
 gb|ACU15428.1| unknown [Glycine max]
Length=180

 Score =   132 bits (331),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 110/183 (60%), Gaps = 16/183 (9%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSK-DLCSFQCKTCDKKFPSFQALG  535
            MKR RE   V++  MANCLMLL+  G    ++  S++  +   F+CKTC+++FPSFQ LG
Sbjct  1    MKRERE---VDSLTMANCLMLLSRGGDQFEATYSSSTSMNNRVFECKTCNRQFPSFQTLG  57

Query  534  GHRASHKKPKLVAPAPGEQE---SSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMK  364
            GHRASHKKP+L+A    E +    SP K K H CSICGLEFA+GQALGGHMRRHRAA + 
Sbjct  58   GHRASHKKPRLMAGDNIEGQLLHDSPPKPKTHECSICGLEFAIGQALGGHMRRHRAANLN  117

Query  363  -EGFENppaaipmamaiPVL----KRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPA  199
                 N   A   +          K+   +KR+    L LDLNLTP END   ++   P 
Sbjct  118  GNNVYNSATATSSSSGGSSFDSSPKKKADNKRV----LVLDLNLTPFENDLEFLKIGKPT  173

Query  198  TPV  190
            T V
Sbjct  174  TFV  176



>gb|KCW85605.1| hypothetical protein EUGRSUZ_B02391 [Eucalyptus grandis]
Length=221

 Score =   133 bits (334),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 115/185 (62%), Gaps = 24/185 (13%)
 Frame = -2

Query  714  LMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCS--FQCKTCDKKFPSFQA  541
            ++KR RE   VEA A ANCLMLL+ VG ++ S+ P          F CKTC+++F SFQA
Sbjct  47   MVKRDREDTEVEALARANCLMLLSRVGESTDSASPDRKSHPTERMFACKTCNREFSSFQA  106

Query  540  LGGHRASHKKPKLVAPAPGE-------QESSPEKSKMHRCSICGLEFAMGQALGGHMRRH  382
            LGGH+ASHKK KL++   G+        +SSP K K H CSICGL+F MGQALGGHMR+H
Sbjct  107  LGGHKASHKKQKLIS---GDLFHLGHAADSSPAKPKTHECSICGLDFPMGQALGGHMRKH  163

Query  381  RAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTP  202
            RAAM++        A   A  + VLK+ ++SKR+ G    LDLN  P E DDL +     
Sbjct  164  RAAMLES------LAAAAAKPVLVLKK-SNSKRVTG----LDLNSLPME-DDLTLRLGKV  211

Query  201  ATPVL  187
            A P++
Sbjct  212  APPLV  216



>ref|XP_002528469.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF33952.1| nucleic acid binding protein, putative [Ricinus communis]
Length=190

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 109/178 (61%), Gaps = 22/178 (12%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssss---ppsaSKDLCS----FQCKTCDKKFP  553
            MKRS   A +++ +MANCLMLL+  GR   S          ++ S    F+CKTC+++FP
Sbjct  1    MKRSFREAEIDSLSMANCLMLLSQ-GREIVSFPSFEAMKGTNINSSNRVFECKTCNRQFP  59

Query  552  SFQALGGHRASHKKPKLVAPAPG--EQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHR  379
            SFQALGGHRASHKKP+L     G  E +SSP K K H CSICGLEFA+GQALGGHMRRHR
Sbjct  60   SFQALGGHRASHKKPRLTNGDVGSLETQSSPAKPKTHECSICGLEFAIGQALGGHMRRHR  119

Query  378  AAMMKEGFENppaaipmamaiPV--------LKRTTSSKRIFGFGLNLDLNLTPAEND  229
            A        + P+    A  + V        + + ++S+R+    L LDLNLTP END
Sbjct  120  AINNDSSSLSTPSPTSSAELMAVKPAGVAPPVMKKSNSRRV----LCLDLNLTPYEND  173



>gb|KHN13875.1| Zinc finger protein ZAT11 [Glycine soja]
Length=164

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 100/165 (61%), Gaps = 10/165 (6%)
 Frame = -2

Query  669  MANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGGHRASHKKPKLVAPA  490
            MANCLMLL+  G    ++  S S     F+CKTC+++FPSFQALGGHRASHKKP+L+A  
Sbjct  1    MANCLMLLSR-GSEFEATYSSTSMSNRVFECKTCNRQFPSFQALGGHRASHKKPRLMAGD  59

Query  489  PGEQ--ESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFENppaaipmamai  316
               Q    SP K K H CSICGLEFA+GQALGGHMRRHRAA +     N  A    +   
Sbjct  60   IEGQLLHDSPPKPKTHECSICGLEFAIGQALGGHMRRHRAANLNGNVHNSTATSSSSGGS  119

Query  315  PVL---KRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPATPV  190
                  K+   +KR+    L LDLNLTP END   ++   P T V
Sbjct  120  SFDSSPKKKADNKRV----LVLDLNLTPFENDLEFLKIGKPTTFV  160



>ref|XP_006436055.1| hypothetical protein CICLE_v10032899mg [Citrus clementina]
 ref|XP_006486058.1| PREDICTED: zinc finger protein ZAT11-like [Citrus sinensis]
 gb|ESR49295.1| hypothetical protein CICLE_v10032899mg [Citrus clementina]
Length=175

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 99/165 (60%), Gaps = 11/165 (7%)
 Frame = -2

Query  669  MANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGGHRASHKKPKLVAPA  490
            MANCLM ++  G   + +    +     F+CKTC+++FPSFQALGGHRASHKKP+L    
Sbjct  14   MANCLMFMSQGGHFDAVNSVDMTAAGRVFECKTCNRQFPSFQALGGHRASHKKPRLTDGT  73

Query  489  PG--EQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFENppaaipmamai  316
             G  + + SP K + H CS+CGLEFA+GQALGGHMRRHRA  +     N   +       
Sbjct  74   GGGADTQQSPAKPRTHECSVCGLEFAIGQALGGHMRRHRAVALH---GNEKVSTLTLSDT  130

Query  315  PVLKRTTSSKRIFGFGLNLDLNLTPAENDDL--KIESTTPATPVL  187
              L +  +S+R+    L LDLNLTP END    ++ S   A PV+
Sbjct  131  APLVKKANSRRV----LCLDLNLTPYENDLECHRLGSNKAAAPVV  171



>emb|CAQ64474.1| putative Cys2/His2 zinc finger protein [Populus tremula x Populus 
alba]
Length=196

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 87/200 (44%), Positives = 106/200 (53%), Gaps = 29/200 (15%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLC------------SFQCKTC  568
            MKR RE   ++   +A CLMLL+ VG        S                  SF CKTC
Sbjct  1    MKRDREQVELD---LAKCLMLLSKVGEADHEILTSYRPAAAAATAGAGAGAGRSFSCKTC  57

Query  567  DKKFPSFQALGGHRASHKKPKLVAPAPG--EQESSPEKSKMHRCSICGLEFAMGQALGGH  394
            DK FPSFQALGGHRASHKKPKL+       +  +SP K K H+CSICGLEF +GQALGGH
Sbjct  58   DKNFPSFQALGGHRASHKKPKLMESTGNLLKLPNSPSKPKTHQCSICGLEFPLGQALGGH  117

Query  393  MRRHRAAMMKEGFENppaaipmamaiP---------VLKRTTSSKRIFGFGLNLDLNLTP  241
            MRRHRA    +   N      +A             VLKR+ SSKR+    L+L L   P
Sbjct  118  MRRHRAPNNVDTTSNSSKDHELAAVTQPPFLPEAVPVLKRSNSSKRVLCLDLSLAL---P  174

Query  240  AENDDLKIESTTPATPVLRC  181
               +D +++    A P+LRC
Sbjct  175  MYQNDSELQLEKVARPMLRC  194



>ref|XP_011023518.1| PREDICTED: zinc finger protein ZAT11-like [Populus euphratica]
Length=177

 Score =   130 bits (327),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 106/168 (63%), Gaps = 12/168 (7%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssss-----ppsaSKDLCSFQCKTCDKKFPSF  547
            MKRS     +++  MANCL+ L+  GR + S        + +     F+CKTC +KFPSF
Sbjct  1    MKRSLCAREIDSINMANCLVFLSK-GREAYSFPSFDHAVNNNSPSRVFECKTCSRKFPSF  59

Query  546  QALGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMM  367
            QALGGHRASHKKPKL+      +  SP K K H CSICGLEFA+GQALGGHMRRHRAA+ 
Sbjct  60   QALGGHRASHKKPKLMGGEGSFESQSPAKPKTHECSICGLEFAIGQALGGHMRRHRAALN  119

Query  366  KEGFENppaaipmamaiPVLK--RTTSSKRIFGFGLNLDLNLTPAEND  229
             +     P ++P +    V+   + ++S+R+    L LDLNLTP END
Sbjct  120  DQNQPADPLSLPSSDHQQVVPVVKKSNSRRV----LCLDLNLTPNEND  163



>ref|XP_008357752.1| PREDICTED: zinc finger protein ZAT12 [Malus domestica]
Length=173

 Score =   130 bits (327),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 102/169 (60%), Gaps = 23/169 (14%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGR-NssssppsaSKDLCSFQCKTCDKKFPSFQALG  535
            MKRSR+    E   M NCLMLL+ VG  +SS      SK+   F CKTCD++FPSFQALG
Sbjct  1    MKRSRQD---ETLDMVNCLMLLSKVGEPDSSPIKYENSKNDRVFVCKTCDREFPSFQALG  57

Query  534  GHRASHKKPKLVAPAPG---------EQESSPEKSKMHRCSICGLEFAMGQALGGHMRRH  382
            GHRASHKKPKL+   PG         E   SP K K H C ICGLEF +GQALGGHMRRH
Sbjct  58   GHRASHKKPKLM---PGGAVDLLHLAEFPGSPVKPKKHECPICGLEFTVGQALGGHMRRH  114

Query  381  RAAMMKEGFENppaaipmamaiPVLKRTTSSKRI--FGFGLNLDLNLTP  241
            R  +     +        +  +PVLK++ SSKR+      LNLDL+L P
Sbjct  115  RDVI-----QAAAVRAQPSPPMPVLKKSNSSKRVSCLNMELNLDLHLAP  158



>ref|XP_008807730.1| PREDICTED: zinc finger protein ZAT12-like [Phoenix dactylifera]
Length=168

 Score =   129 bits (325),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 101/165 (61%), Gaps = 20/165 (12%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKR R    VE+  MAN LMLLA  G         +   +  F+CKTC+++FPSFQALGG
Sbjct  1    MKRLRGGDRVESIDMANVLMLLARGGEEMGHLTRDSPGRV--FECKTCNRQFPSFQALGG  58

Query  531  HRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFE  352
            HRASHKKP+L+    G+ +S+  K ++H CSICGLEFA+GQALGGHMRRHRAA   EGF 
Sbjct  59   HRASHKKPRLMGDGHGQAQSALAKPRVHECSICGLEFAIGQALGGHMRRHRAA--TEGFR  116

Query  351  NppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAE-NDDLK  220
                         + ++    KR+    L LDLNL P E  DD++
Sbjct  117  -----------PGLAEKEPDGKRM----LWLDLNLPPTELLDDME  146



>gb|AEY76110.1| Cys2/His2-type zinc finger protein [Chrysanthemum x morifolium]
Length=178

 Score =   130 bits (326),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 116/182 (64%), Gaps = 24/182 (13%)
 Frame = -2

Query  711  MKRSR-EYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALG  535
            MKRSR +       +MAN LMLL+    N  S    +   +  F+CKTC+++FPSFQALG
Sbjct  6    MKRSRGDEFDTTINSMANYLMLLSRGNTNMDSYQDDSVSRV--FECKTCNRQFPSFQALG  63

Query  534  GHRASHKKPKLVAPAPGEQESSPE------KSKMHRCSICGLEFAMGQALGGHMRRHRAA  373
            GHRASHKKP+LV    G+  S         K K H+CSICG+EFA+GQALGGHMRRHRAA
Sbjct  64   GHRASHKKPRLV---DGDMTSHHHDTALLIKPKTHKCSICGVEFAIGQALGGHMRRHRAA  120

Query  372  MMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND-DLKI--ESTTP  202
               E      A++P+ ++ PV+K+  +S+R+F    +LDLNLTP END + ++  E  TP
Sbjct  121  TTTEN----HASLPLDLSTPVVKK-VNSRRVF----SLDLNLTPLENDFEFRVDDEKVTP  171

Query  201  AT  196
             T
Sbjct  172  IT  173



>ref|XP_010922390.1| PREDICTED: zinc finger protein ZAT11 [Elaeis guineensis]
Length=168

 Score =   129 bits (325),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 103/164 (63%), Gaps = 23/164 (14%)
 Frame = -2

Query  711  MKRSREYAG---VEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQA  541
            MKR R + G   VE+  MAN LMLL+  G    S   + +     F+CKTC+++FPSFQA
Sbjct  1    MKRFR-FGGEEEVESMNMANVLMLLSRGGGGEESEHTAQASPSRVFECKTCNRQFPSFQA  59

Query  540  LGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKE  361
            LGGHRASHKKP+L A   G+ +    K ++H CSICGLEFA+GQALGGHMRRHRAA   E
Sbjct  60   LGGHRASHKKPRLTAE--GQLQGGLAKPRVHECSICGLEFAIGQALGGHMRRHRAAT--E  115

Query  360  GFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            GF +            + ++    +R+    L+LDLNL P+END
Sbjct  116  GFGH-----------GLAEKKPEGRRV----LSLDLNLPPSEND  144



>ref|XP_004294604.1| PREDICTED: zinc finger protein ZAT12-like [Fragaria vesca subsp. 
vesca]
Length=173

 Score =   129 bits (325),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 99/164 (60%), Gaps = 14/164 (9%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKR R++   +   + +CLM L+  G+N S           +F CKTC+++F SFQALGG
Sbjct  1    MKRDRQFEDEQTLDLVSCLMQLSKAGQNDSFPVKKQKTSDRAFVCKTCNREFSSFQALGG  60

Query  531  HRASHKKPKLVAPAPGE-------QESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAA  373
            HRASH KPKL+A    +         SSP K K H C ICGLEFA+GQALGGHMRRHR  
Sbjct  61   HRASHNKPKLMAGGATDLLQLSQSTASSPAKPKTHECPICGLEFALGQALGGHMRRHRDL  120

Query  372  MMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTP  241
            M      +  A    A A+PVLK++ SSKR+    LNLDLNL P
Sbjct  121  M-----SSAAADRVRAAAVPVLKKSNSSKRV--SCLNLDLNLAP  157



>ref|XP_009347446.1| PREDICTED: zinc finger protein ZAT12-like [Pyrus x bretschneideri]
Length=196

 Score =   130 bits (326),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 103/180 (57%), Gaps = 24/180 (13%)
 Frame = -2

Query  669  MANCLMLLAH-VGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGGHRASHKKPKLVAP  493
            +ANCLMLL+  +  N +     +      F+CKTC+++FPSFQALGGHRASHKKP+L  P
Sbjct  19   LANCLMLLSRGINNNDNQYDSFSVSPSRVFECKTCNRQFPSFQALGGHRASHKKPRLTGP  78

Query  492  APGEQESSPEKS---------KMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFENppa  340
            +     +S ++S         + H C+ICGLEFA+GQALGGHMRRHRAA+      +   
Sbjct  79   SGDGNSNSSDQSLSQGSSPKPRTHECNICGLEFAIGQALGGHMRRHRAALSSSNTTSNIH  138

Query  339  aipmamai---------PVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPATPVL  187
                +             VLK+T S +R     + LDLNLTP EN DL+I     A P++
Sbjct  139  DRYSSSMSLNPQPAQVFQVLKKTNSGRR----AMCLDLNLTPLEN-DLEILQLGKAAPLV  193



>ref|XP_009357691.1| PREDICTED: zinc finger protein ZAT12-like [Pyrus x bretschneideri]
Length=196

 Score =   129 bits (325),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 102/180 (57%), Gaps = 24/180 (13%)
 Frame = -2

Query  669  MANCLMLLAH-VGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGGHRASHKKPKLVAP  493
            MANCLMLL+  +  N +     +      F+CKTC+++FPSFQALGGHRASHKKP+L  P
Sbjct  19   MANCLMLLSRGINNNDNQYDSFSVSPSRVFECKTCNRQFPSFQALGGHRASHKKPRLTGP  78

Query  492  APGEQESSPEKS---------KMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFENppa  340
            +     +S ++S         + H C+ICGLEFA+GQALGGHMRRHRAA+      +   
Sbjct  79   SGDGNSNSSDQSLSQGSSPKPRTHECNICGLEFAIGQALGGHMRRHRAALSSSNTTSNIH  138

Query  339  aipmamai---------PVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPATPVL  187
                +             V K+T S +R     + LDLNLTP EN DL+I     A P++
Sbjct  139  DRYSSSMSLNPQPAQVFQVFKKTNSGRR----AMCLDLNLTPLEN-DLEILQLGKAAPLV  193



>emb|CAF74933.1| zinc finger DNA-binding protein [Catharanthus roseus]
Length=178

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 104/169 (62%), Gaps = 12/169 (7%)
 Frame = -2

Query  717  MLMKRSREYAGVEAEAMANCLMLLAHVG-----RNssssppsaSKDLCSFQCKTCDKKFP  553
            M +KR RE      E  ANCLMLL+ VG       S+            ++CKTC K+F 
Sbjct  1    MGVKRFRE------EQSANCLMLLSKVGLLSEMEKSAVPALKPGAGGRIYECKTCKKQFL  54

Query  552  SFQALGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAA  373
            +FQALGGHRASHKK +L+A     Q  +  K K H CSICGLEF +GQALGGHMRRHR A
Sbjct  55   TFQALGGHRASHKKLRLMAADLLHQSLAVTKPKTHACSICGLEFPLGQALGGHMRRHRGA  114

Query  372  MMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLN-LDLNLTPAEND  229
             +        +  P+A A+P L R+ SSKRIFGF ++ LDLNLTP +ND
Sbjct  115  ALDGEKPVVVSDKPVAKAVPFLMRSNSSKRIFGFEVDGLDLNLTPEDND  163



>ref|XP_010067376.1| PREDICTED: zinc finger protein ZAT12-like [Eucalyptus grandis]
 gb|KCW65505.1| hypothetical protein EUGRSUZ_G02910 [Eucalyptus grandis]
Length=196

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 118/205 (58%), Gaps = 40/205 (20%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            M   RE+   E+ AMANCLMLL+      S    S    +  F+CKTC+++F SFQALGG
Sbjct  1    MAMKREF---ESMAMANCLMLLSRGVEFESVVDHSMPSRV--FECKTCNRQFSSFQALGG  55

Query  531  HRASHKKPKLVAPAPGEQES------SPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAM  370
            HRASHKKP+L + A G+  S      SP K K H CSICGLEFA+GQALGGHMRRHRAA 
Sbjct  56   HRASHKKPRL-SSAGGDDSSQSQGSASPAKPKTHECSICGLEFAIGQALGGHMRRHRAA-  113

Query  369  MKEG------------------FENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLT  244
            M EG                       +A+  A   PV+K+T S + ++     LDLNLT
Sbjct  114  MSEGARTATATATAAAMAPPPRPLAQISAVSPASQAPVVKKTNSGRVLW-----LDLNLT  168

Query  243  PAEND---DLKIESTTPA-TPVLRC  181
            P EN+   + ++ + TPA  PV+ C
Sbjct  169  PMENESDLEFRLGTKTPAPPPVIDC  193



>ref|XP_006436056.1| hypothetical protein CICLE_v10032889mg [Citrus clementina]
 ref|XP_006486057.1| PREDICTED: zinc finger protein ZAT11-like [Citrus sinensis]
 gb|ESR49296.1| hypothetical protein CICLE_v10032889mg [Citrus clementina]
 gb|KDO67724.1| hypothetical protein CISIN_1g044181mg [Citrus sinensis]
Length=178

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 95/148 (64%), Gaps = 7/148 (5%)
 Frame = -2

Query  669  MANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGGHRASHKKPKLVAPA  490
            MANCLM L+H    ++ +  +      +F+CKTC+++FPSFQALGGHRASHKKP+     
Sbjct  17   MANCLMFLSHGRGFNAVNGVNTMAAGRAFECKTCNRQFPSFQALGGHRASHKKPRFTDGN  76

Query  489  PG-EQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFENppaaipmamaiP  313
             G + +  P K K H CS+CGLEFA+GQALGGHMRRHRAA +  G E       ++   P
Sbjct  77   GGVDMQQLPIKPKTHECSVCGLEFAIGQALGGHMRRHRAAGL-HGNEKLSDLSGLSDKAP  135

Query  312  VLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            ++K+  S       GL LDLNLTP END
Sbjct  136  LVKKANSRG-----GLCLDLNLTPYEND  158



>emb|CDP00044.1| unnamed protein product [Coffea canephora]
Length=210

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 109/193 (56%), Gaps = 34/193 (18%)
 Frame = -2

Query  723  MTMLMKRSREYAGVEA-EAMANCLMLLAHVGR---------NssssppsaSKDLCSFQCK  574
            M +  KR+RE    ++   MANCLMLL+  G          N+SS        +  F+CK
Sbjct  4    MNVGTKRAREPDQFDSITTMANCLMLLSRAGEFEALNIFHHNNSSDNSHNPSRV--FECK  61

Query  573  TCDKKFPSFQALGGHRASHKKPKLVAPAP--GEQESSPEKSKMHRCSICGLEFAMGQALG  400
            TC+++FPSFQALGGHRASHKKPKL A      + ++SP K K H CSICG EFA+GQALG
Sbjct  62   TCNRQFPSFQALGGHRASHKKPKLGADLSLQSQVQTSPPKPKTHECSICGQEFAVGQALG  121

Query  399  GHMRRHRAAMMKE-GFENppaaipmamai---------------PVLKRTTSSKRIFGFG  268
            GHMRRHRAAM +E G+   P +   +                   V K  TSS R+    
Sbjct  122  GHMRRHRAAMNEEIGYHQSPVSSLSSGQQHQSPVSSLSSGQHEPVVQKSNTSSGRV----  177

Query  267  LNLDLNLTPAEND  229
              LDLNLTP END
Sbjct  178  CCLDLNLTPLEND  190



>emb|CDX93380.1| BnaC04g45160D [Brassica napus]
Length=179

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 109/171 (64%), Gaps = 21/171 (12%)
 Frame = -2

Query  711  MKRSR-EYA-GVEAEAMANCLMLLAH-------VGRNssssppsaSKDLCSFQCKTCDKK  559
            MKR R E+   ++   +A CLM+L+        +G N  +   S+++    F+CKTC+K+
Sbjct  1    MKRERSEFEESIKNLDIAKCLMILSQTSSMVKQIGVNQYAESNSSNR----FECKTCNKR  56

Query  558  FPSFQALGGHRASHKKPKL-VAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRH  382
            F SFQALGGHRASHKKPKL V     +Q  + E ++ H C+ICG  F  GQALGGHMRRH
Sbjct  57   FSSFQALGGHRASHKKPKLTVDQKVVKQYLTKEGTQAHECTICGKSFGTGQALGGHMRRH  116

Query  381  RAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            R++MM E  E      P+   +PVLKR +SSKR+    L+LDLNLTP END
Sbjct  117  RSSMMVEPSE---LISPVIHNMPVLKRCSSSKRV----LSLDLNLTPLEND  160



>ref|XP_003625522.1| Zinc finger protein [Medicago truncatula]
Length=172

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 105/167 (63%), Gaps = 17/167 (10%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLA---HVGRNssssppsaSKDLCSFQCKTCDKKFPSFQA  541
            MKR R++ G+E   +ANCLM+L+   H  +N+  +  S +     ++CKTC+KKFPSFQA
Sbjct  1    MKRQRDFEGLENIDLANCLMMLSYPQHQPQNNKPNQKSFAP--VEYECKTCNKKFPSFQA  58

Query  540  LGGHRASHKKPKLVAPAPGEQESS---PEKSKMHRCSICGLEFAMGQALGGHMRRHRAAM  370
            LGGHRASHK+ KL         +S     K KMH CSICG  F++GQALGGHMRRH+A M
Sbjct  59   LGGHRASHKRSKLEGDELLTNSTSLSLGNKPKMHECSICGQNFSLGQALGGHMRRHKAIM  118

Query  369  MKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
             +E      +   + M +PVLKR  S++ +      LDLNLTP END
Sbjct  119  NEE----VSSMEQVVMKLPVLKRLNSARVMC-----LDLNLTPLEND  156



>ref|XP_006350904.1| PREDICTED: zinc finger protein ZAT11-like [Solanum tuberosum]
Length=157

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 101/179 (56%), Gaps = 26/179 (15%)
 Frame = -2

Query  723  MTMLMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQ  544
            MT+  +R  E   VE  AMANC+ +L    +NSS S          F+CKTC K+F SFQ
Sbjct  1    MTIKRRREEEIVTVETLAMANCVNILE---KNSSLSRRF-------FECKTCKKQFESFQ  50

Query  543  ALGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMK  364
            ALGGHRASHKKPKLV P+    +S   K+K H CS CG EF +GQALGGHMR+HR  +M+
Sbjct  51   ALGGHRASHKKPKLVLPS----DSIKSKTKKHECSYCGEEFVLGQALGGHMRKHRDKLME  106

Query  363  EGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPATPVL  187
            +  E               K  T S + F     LDLNLTP END L +    PA  V+
Sbjct  107  KPKEKNTYKSAE-------KMETESGKKFC----LDLNLTPYENDQLTL-GIIPAFTVV  153



>ref|XP_010937700.1| PREDICTED: zinc finger protein ZAT12-like [Elaeis guineensis]
Length=168

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 96/159 (60%), Gaps = 19/159 (12%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKR RE   VE+  MAN LMLLA  G+        +   +  F+CKTC+++FPSFQALGG
Sbjct  1    MKRFREGDQVESIDMANVLMLLARGGQEMGHLTQDSPGRV--FECKTCNRQFPSFQALGG  58

Query  531  HRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFE  352
            HRASHKKP+L+    G+ +++  K K+H CSICGLEFA+GQALGGHMRRHR A   EG  
Sbjct  59   HRASHKKPRLMGDGHGQAQNALAKPKLHECSICGLEFAIGQALGGHMRRHRPA--TEGLR  116

Query  351  NppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAE  235
                         + ++    KR+    L LDLN  P E
Sbjct  117  -----------PGLAEKKPDGKRV----LWLDLNRPPTE  140



>gb|AFK41279.1| unknown [Lotus japonicus]
Length=180

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 111/187 (59%), Gaps = 20/187 (11%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKR RE   +++  MANCLMLL+  G   +++  + S     F+CKTC+++F SFQALGG
Sbjct  1    MKRERE---IDSMTMANCLMLLSQGGEFETTTTSTYSPSRV-FECKTCNRQFSSFQALGG  56

Query  531  HRASHKKPKLVAPAPGEQE-----SSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAA--  373
            HRASHKKP+L+A   G+ E     SSP K K H CSICGLEFA+GQALGGHMRRHRA   
Sbjct  57   HRASHKKPRLMA-GNGDTELLHGSSSPPKPKTHECSICGLEFAIGQALGGHMRRHRAENL  115

Query  372  ---MMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND--DLKIEST  208
               MM+       ++   ++         + K+I    L LDLNLTP END   LKI   
Sbjct  116  SGNMMQSSTTMSCSSGGSSLDSSPKNVMKAYKKIV---LALDLNLTPFENDLEFLKIGKA  172

Query  207  TPATPVL  187
            T     L
Sbjct  173  TGLVDYL  179



>gb|AFK39144.1| unknown [Lotus japonicus]
Length=180

 Score =   127 bits (320),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 111/187 (59%), Gaps = 20/187 (11%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKR RE   +++  MANCLMLL+  G   +++  + S     F+CKTC+++F SFQALGG
Sbjct  1    MKRERE---IDSMTMANCLMLLSQGGEFETTTTSTYSPSRV-FECKTCNRQFSSFQALGG  56

Query  531  HRASHKKPKLVAPAPGEQE-----SSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAA--  373
            HRASHKKP+L+A   G+ E     SSP K K H CSICGLEFA+GQALGGHMRRHRA   
Sbjct  57   HRASHKKPRLMA-GNGDMELLHGSSSPPKPKTHECSICGLEFAIGQALGGHMRRHRAENL  115

Query  372  ---MMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND--DLKIEST  208
               MM+       ++   ++         + K+I    L LDLNLTP END   LKI   
Sbjct  116  SGNMMQSSTTISCSSGGSSLDSSPKNVMKAYKKIV---LALDLNLTPFENDLEFLKIGKA  172

Query  207  TPATPVL  187
            T     L
Sbjct  173  TGLVDYL  179



>ref|XP_003621801.1| Zinc finger protein [Medicago truncatula]
 gb|AES78019.1| C2H2-type zinc finger protein [Medicago truncatula]
Length=184

 Score =   127 bits (320),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 84/116 (72%), Gaps = 4/116 (3%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKR+RE   V++  MANCLMLL+       ++  S + +   F+CKTC+++FPSFQALGG
Sbjct  1    MKRARE---VDSITMANCLMLLSRGSDQFEATYSSTTSNNRVFECKTCNRQFPSFQALGG  57

Query  531  HRASHKKPKLVAP-APGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMM  367
            HRASHKKP+L+     G+   +P K K H CSICGLEFA+GQALGGHMRRHRAA M
Sbjct  58   HRASHKKPRLMGENIDGQLLHTPPKPKTHECSICGLEFAIGQALGGHMRRHRAANM  113



>ref|XP_002314198.2| RESPONSIVE TO HIGH LIGHT 41 family protein [Populus trichocarpa]
 gb|EEE88153.2| RESPONSIVE TO HIGH LIGHT 41 family protein [Populus trichocarpa]
Length=193

 Score =   127 bits (320),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 87/195 (45%), Positives = 113/195 (58%), Gaps = 21/195 (11%)
 Frame = -2

Query  720  TMLMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCS------FQCKTCDKK  559
            ++ MKR RE   ++   MANCLMLL  VG+      P+  K          F CKTC+K 
Sbjct  3    SITMKRGREEGELD---MANCLMLLYKVGKADDHELPTNYKSSSPSGAGRLFSCKTCNKN  59

Query  558  FPSFQALGGHRASHKKPKLVAPAPG---EQESSPEKSKMHRCSICGLEFAMGQALGGHMR  388
            F SFQALGGHRASHKKPKLV        +  +SP K K H+CSICGLEF +GQALGGHMR
Sbjct  60   FSSFQALGGHRASHKKPKLVGSTGNLLMKLPNSPPKPKNHQCSICGLEFPIGQALGGHMR  119

Query  387  RHRAAMMKEGFENppaaipmam-----aiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDL  223
            RHRA  +     +    + +       AIPVLK++ SSKR+    L+L L   P + ++ 
Sbjct  120  RHRAGNIDATSNSADNELAVTYPPFLPAIPVLKKSNSSKRVLCLDLSLAL---PMDQNES  176

Query  222  KIESTTPAT-PVLRC  181
            +++     T PVL+C
Sbjct  177  ELQLRKAGTRPVLKC  191



>gb|KHN27209.1| Zinc finger protein ZAT11 [Glycine soja]
Length=169

 Score =   127 bits (318),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 82/169 (49%), Positives = 103/169 (61%), Gaps = 13/169 (8%)
 Frame = -2

Query  669  MANCLMLLAHVGRNssssppsaSK-DLCSFQCKTCDKKFPSFQALGGHRASHKKPKLVAP  493
            MANCLMLL+  G    ++  S++  +   F+CKTC+++FPSFQALGGHRASHKKP+L+A 
Sbjct  1    MANCLMLLSRGGDQFEATYSSSTSMNNRVFECKTCNRQFPSFQALGGHRASHKKPRLMAG  60

Query  492  APGEQE---SSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMK-EGFENppaaipma  325
               E +    SP K K H CSICGLEFA+GQALGGHMRRHRAA +      N   A   +
Sbjct  61   DNIEGQLLHDSPPKPKTHECSICGLEFAIGQALGGHMRRHRAANLNGNNVYNSATATSSS  120

Query  324  maiPVL----KRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPATPV  190
                      K+   +KR+    L LDLNLTP END   ++   P T V
Sbjct  121  SGGSSFDSSPKKKADNKRV----LVLDLNLTPFENDLEFLKIGKPTTFV  165



>ref|XP_009358331.1| PREDICTED: zinc finger protein ZAT12-like [Pyrus x bretschneideri]
Length=173

 Score =   127 bits (318),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 101/169 (60%), Gaps = 23/169 (14%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGR-NssssppsaSKDLCSFQCKTCDKKFPSFQALG  535
            MKRS +    E   M NCLMLL+ VG  +SS      SK    F CKTCD++FPSFQALG
Sbjct  1    MKRSGQD---ETLDMVNCLMLLSKVGEPDSSPIKYENSKKDRVFVCKTCDREFPSFQALG  57

Query  534  GHRASHKKPKLVAPAPG---------EQESSPEKSKMHRCSICGLEFAMGQALGGHMRRH  382
            GHRASHKKPKL+   PG         E   SP K K H C ICGLEF +GQALGGHMRRH
Sbjct  58   GHRASHKKPKLM---PGGAVDLLHLAEFPGSPVKPKKHECPICGLEFTVGQALGGHMRRH  114

Query  381  RAAMMKEGFENppaaipmamaiPVLKRTTSSKRI--FGFGLNLDLNLTP  241
            R  +     +   A    +  +PVLK++ SSKR+      LNLDL+L P
Sbjct  115  RDVI-----QAAAARAQPSPPMPVLKKSNSSKRVSCLNLELNLDLHLAP  158



>ref|XP_009593204.1| PREDICTED: zinc finger protein ZAT11-like [Nicotiana tomentosiformis]
Length=168

 Score =   126 bits (317),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 106/178 (60%), Gaps = 19/178 (11%)
 Frame = -2

Query  723  MTMLMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQ  544
            + + +KR RE        MAN LMLL+    N  +   S ++    F+CKTC+++F SFQ
Sbjct  4    VVLPIKREREGEFDTITTMANYLMLLSRQANNFDNINKSPNR---VFECKTCNRQFSSFQ  60

Query  543  ALGGHRASHKKPKLVAPAPGEQES-SPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMM  367
            ALGGHRASHKKP+L+      Q S SP K K H CSICG+EF +GQALGGHMRRHRA + 
Sbjct  61   ALGGHRASHKKPRLMGELNFHQLSTSPPKPKTHECSICGVEFPIGQALGGHMRRHRAILN  120

Query  366  KEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND-DLKIESTTPAT  196
            +                 V+K+ ++S+R+    L LDLNLTP END + K+  ++P  
Sbjct  121  ENN---------NIQVPHVVKK-SNSRRV----LCLDLNLTPLENDLEFKLGKSSPVV  164



>ref|XP_004493901.1| PREDICTED: zinc finger protein ZAT11-like [Cicer arietinum]
Length=173

 Score =   126 bits (317),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 107/180 (59%), Gaps = 13/180 (7%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKR R+  G+E   +ANCLM+L++  +  ++ P         F+CKTC++KF SFQALGG
Sbjct  1    MKRQRDIEGLENINLANCLMMLSYPPKQQNNKPKQIKFGPTEFECKTCNRKFSSFQALGG  60

Query  531  HRASHKKPKL----VAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMK  364
            HRASHK+ KL    +  A     S   K KMH CSICG EF++GQALGGHMRRH+A ++ 
Sbjct  61   HRASHKRSKLEGYELIKANAISLSLGNKPKMHECSICGQEFSLGQALGGHMRRHKAMLIN  120

Query  363  EGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND-DLKIESTTPATPVL  187
            +   +      + + IP+LKR  S + +      +DLNLTP END  L   +  P   VL
Sbjct  121  KQLSS---IEKVDVKIPILKRWNSMRVMC-----MDLNLTPLENDLKLLFGNMAPNLDVL  172



>ref|XP_010096626.1| Zinc finger protein ZAT11 [Morus notabilis]
 gb|EXB65294.1| Zinc finger protein ZAT11 [Morus notabilis]
Length=190

 Score =   127 bits (318),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 107/180 (59%), Gaps = 23/180 (13%)
 Frame = -2

Query  711  MKRS-REYAGVEAEAMANCLMLLA---HVGRNssssppsaSKDLCSFQCKTCDKKFPSFQ  544
            MKRS  +   +E   MANCLM L+   H  +   SSP  +S     F+CKTC+++FPSFQ
Sbjct  1    MKRSITDRDHMENLTMANCLMFLSRGDHHHQFEYSSPSPSSSPSRVFECKTCNRQFPSFQ  60

Query  543  ALGGHRASHKKPKLVAPAPGEQESS----PEKSKMHRCSICGLEFAMGQALGGHMRRHRA  376
            ALGGHRASHKKP+++    G    S    P K K H C+ICGLEFA+GQALGGHMRRHRA
Sbjct  61   ALGGHRASHKKPRVMTGDGGSSSDSQGGSPAKPKTHECTICGLEFAIGQALGGHMRRHRA  120

Query  375  AMMKEGFENppa-----------aipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            AM +                   +      +PVLK+T SS+R+    L LDLNLTP END
Sbjct  121  AMTEVNQAQHVVRPHHHPALIMNSATTLQQVPVLKKTNSSRRV----LCLDLNLTPLEND  176



>ref|XP_006410928.1| hypothetical protein EUTSA_v10017303mg [Eutrema salsugineum]
 gb|ESQ52381.1| hypothetical protein EUTSA_v10017303mg [Eutrema salsugineum]
Length=179

 Score =   126 bits (317),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 105/171 (61%), Gaps = 21/171 (12%)
 Frame = -2

Query  711  MKRSR-EYA-GVEAEAMANCLMLLA------HVGRNssssppsaSKDLCSFQCKTCDKKF  556
            MKR R EY   ++   +A CLM+L+      H+G N  +   ++++    F+CKTC+++F
Sbjct  1    MKRERSEYEESIKNLDIAKCLMILSQTSMVKHIGVNHFTESNTSNR----FECKTCNRRF  56

Query  555  PSFQALGGHRASHKKPKLVAPAPGEQESSPEK--SKMHRCSICGLEFAMGQALGGHMRRH  382
             SFQALGGHRASHKKPKL       +  S     + MH CSICG  F  GQALGGHMRRH
Sbjct  57   SSFQALGGHRASHKKPKLTVEQKDVKHLSNNNKGNHMHECSICGQSFGTGQALGGHMRRH  116

Query  381  RAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            R++M     E      P+   +PVLKR +SSKR+    L+LDLNLTP END
Sbjct  117  RSSMT---VEPSQLISPVIPTMPVLKRCSSSKRV----LSLDLNLTPLEND  160



>ref|XP_008241560.1| PREDICTED: zinc finger protein ZAT11 [Prunus mume]
Length=184

 Score =   126 bits (317),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 102/172 (59%), Gaps = 16/172 (9%)
 Frame = -2

Query  711  MKRSREYA---GVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQA  541
            MKR RE     G++   M   LMLL+  G  +     S+  D+  F+CKTC++KFPSFQA
Sbjct  1    MKRMREDEVGLGMKGLDMEKFLMLLS-CGMETKFRKCSSPNDV--FECKTCNRKFPSFQA  57

Query  540  LGGHRASHKKPKLVAPAPGEQES--------SPEKSKMHRCSICGLEFAMGQALGGHMRR  385
            LGGHRASHK+P+       + E+        +  K K H CSICGLEF MGQALGGHMRR
Sbjct  58   LGGHRASHKRPRTSMDHDQQSETRKGSNLMATKNKPKAHECSICGLEFGMGQALGGHMRR  117

Query  384  HRAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            HRA+ M  GF +      +  +   + + +SSKRI    L +DLNLTP END
Sbjct  118  HRASNMNLGFSSKVPDEVVVASKIPVLKRSSSKRI--MCLEMDLNLTPLEND  167



>gb|KDO67725.1| hypothetical protein CISIN_1g041414mg [Citrus sinensis]
Length=152

 Score =   125 bits (315),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 92/149 (62%), Gaps = 8/149 (5%)
 Frame = -2

Query  669  MANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGGHRASHKKPKLVAPA  490
            MANCLM + H G   + +  + +    +F+CKTC+++FPSFQALGGHRASHKK ++   +
Sbjct  1    MANCLMFMPHGGDFDAVNGVNMAVADRAFECKTCNRQFPSFQALGGHRASHKKSRVTEGS  60

Query  489  PG--EQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFENppaaipmamai  316
             G  + + SP K K H CS+CGLEFA+GQALGGHMRRHRA           +A       
Sbjct  61   GGGVDTQQSPVKPKTHECSVCGLEFAIGQALGGHMRRHRAGASHA--NEKLSAFSSLSDT  118

Query  315  PVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
              L    +S+R+    L LDLNLTP END
Sbjct  119  APLVEKANSRRV----LCLDLNLTPYEND  143



>gb|AGW47690.1| trifoliate orange Cys2/His2-type zinc finger protein [Citrus 
trifoliata]
Length=178

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 101/161 (63%), Gaps = 15/161 (9%)
 Frame = -2

Query  669  MANCLMLLAHVGRNssssppsaSKDLC-SFQCKTCDKKFPSFQALGGHRASHKKPKLVAP  493
            +ANCLM L+H GR  ++     +     +F+CKTC+++FPSFQALGGHRASHKKP+    
Sbjct  17   IANCLMFLSH-GRGFNAVNGVNTMAAGRTFECKTCNRQFPSFQALGGHRASHKKPRFTDG  75

Query  492  APG-EQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFENppaaipmamai  316
              G   +  P K K H CS+CGLEFA+GQALGGHMRRHRAA +  G E       ++  +
Sbjct  76   NGGVHMQQLPIKPKTHECSVCGLEFAIGQALGGHMRRHRAAGL-HGNEKLSDMSGLSDKV  134

Query  315  PVLKRTTSSKRIFGFGLNLDLNLTPAEND------DLKIES  211
            P++K+  S       GL LDLNLTP END      D K++S
Sbjct  135  PLVKKANSRG-----GLCLDLNLTPYENDLEMFRLDNKVDS  170



>ref|XP_006436057.1| hypothetical protein CICLE_v10032922mg [Citrus clementina]
 ref|XP_006486056.1| PREDICTED: zinc finger protein ZAT11-like [Citrus sinensis]
 gb|ESR49297.1| hypothetical protein CICLE_v10032922mg [Citrus clementina]
Length=168

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 92/149 (62%), Gaps = 8/149 (5%)
 Frame = -2

Query  669  MANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGGHRASHKKPKLVAPA  490
            MANCLM + H G   + +  + +    +F+CKTC+++FPSFQALGGHRASHKK ++   +
Sbjct  17   MANCLMFMPHGGDFDAVNGVNMAVADRAFECKTCNRQFPSFQALGGHRASHKKSRVTEGS  76

Query  489  PG--EQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFENppaaipmamai  316
             G  + + SP K K H CS+CGLEFA+GQALGGHMRRHRA           +A       
Sbjct  77   GGGADTQQSPVKPKTHECSVCGLEFAIGQALGGHMRRHRAGASHA--NEKLSAFSSLSDT  134

Query  315  PVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
              L    +S+R+    L LDLNLTP END
Sbjct  135  APLVEKANSRRV----LCLDLNLTPYEND  159



>ref|XP_009762518.1| PREDICTED: zinc finger protein ZAT11-like [Nicotiana sylvestris]
Length=168

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 105/178 (59%), Gaps = 19/178 (11%)
 Frame = -2

Query  723  MTMLMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQ  544
            + + +KR RE        MAN LMLL+    +  +   S ++    F+CKTC+++F SFQ
Sbjct  4    VVLPIKREREGDLDTITTMANYLMLLSRQANHFETMNNSPNR---VFECKTCNRQFSSFQ  60

Query  543  ALGGHRASHKKPKLVAPAPGEQES-SPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMM  367
            ALGGHRASHKKP+L+      Q S SP K K H CSICGLEF +GQALGGHMRRHRA + 
Sbjct  61   ALGGHRASHKKPRLMGELNFHQLSTSPPKPKAHECSICGLEFPIGQALGGHMRRHRAILN  120

Query  366  KEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND-DLKIESTTPAT  196
            +   +         +   V+K++ S +      L LDLNLTP END + K+  ++P  
Sbjct  121  ENNIQ---------VPHHVVKKSNSQR-----VLCLDLNLTPLENDLEFKLGKSSPVV  164



>ref|XP_006345939.1| PREDICTED: zinc finger protein ZAT11-like [Solanum tuberosum]
Length=167

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 99/165 (60%), Gaps = 15/165 (9%)
 Frame = -2

Query  723  MTMLMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQ  544
            + + MKR RE    +   +AN LML +    + ++   ++   +  F+CKTC+++FPSFQ
Sbjct  2    VVLPMKRERE-GEFDITTVANYLMLFSRQENHFNTMVNNSPSRV--FECKTCNRQFPSFQ  58

Query  543  ALGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMK  364
            ALGGHRASHKKP+L+         SP K K H CSICGLEF +GQALGGHMRRHR  +  
Sbjct  59   ALGGHRASHKKPRLMGELNFHLPISPPKPKTHECSICGLEFPIGQALGGHMRRHRGMLND  118

Query  363  EGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
               +             V+K+++++ R+    L LDLNLTP END
Sbjct  119  NNIQ--------VPHHDVVKKSSNNPRV----LCLDLNLTPLEND  151



>gb|AFK34837.1| unknown [Lotus japonicus]
Length=186

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 111/186 (60%), Gaps = 31/186 (17%)
 Frame = -2

Query  723  MTMLM---KRSR---EYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDK  562
            MTM+    KR R   + +  E+  +A  LMLL+           + +K    F+CKTC++
Sbjct  1    MTMINNNNKRQRDQTQQSNKESIDLATSLMLLSRT------QTQTQTKPHTEFECKTCNR  54

Query  561  KFPSFQALGGHRASHKKPKLVAPAPGEQE-----SSPEKSKMHRCSICGLEFAMGQALGG  397
            KF SFQALGGHRASHKKPKL     GE+E     + P K KMH CSICG EF++GQALGG
Sbjct  55   KFSSFQALGGHRASHKKPKLT----GEEELKFSAAKPSKPKMHACSICGQEFSLGQALGG  110

Query  396  HMRRHRAAMMKE-GF-----ENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAE  235
            HMRRHR    +E GF     ++         + PVLKR ++SKR+    L +DLNLTP E
Sbjct  111  HMRRHRGDFNEEQGFRFSSIKHSEKISEAVKSTPVLKR-SNSKRV--MCLQMDLNLTPLE  167

Query  234  NDDLKI  217
            N DLKI
Sbjct  168  N-DLKI  172



>ref|XP_002299891.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE84696.2| zinc finger family protein [Populus trichocarpa]
Length=198

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 84/202 (42%), Positives = 105/202 (52%), Gaps = 31/202 (15%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLC---------------SFQC  577
            MKR RE A ++   +A CLMLL+ VG+       +                     SF C
Sbjct  1    MKRDREQAEID---LAKCLMLLSKVGQADHEILTNYRSAAAAAAAATAGAGAGAGRSFSC  57

Query  576  KTCDKKFPSFQALGGHRASHKKPKLVAPAPG--EQESSPEKSKMHRCSICGLEFAMGQAL  403
            KTC+K FPSFQALGGHRASHKKPKL        +  +SP K K H+CSICGLEF +GQAL
Sbjct  58   KTCNKNFPSFQALGGHRASHKKPKLKESTGNLLKLPNSPSKPKTHQCSICGLEFPLGQAL  117

Query  402  GGHMRRHRAAMMKEGFENppaaipmamaiP--------VLKRTTSSKRIFGFGLNLDLNL  247
            GGHMRRHRA    +          +A            VLKR+ SSKR+    L+L L  
Sbjct  118  GGHMRRHRAPHNVDTTSTSSKDHELAAVTQPPFLPAVPVLKRSNSSKRVLCLDLSLAL--  175

Query  246  TPAENDDLKIESTTPATPVLRC  181
             P   +D +++      P+LRC
Sbjct  176  -PMYQNDSELQLEKVDRPMLRC  196



>ref|XP_009757271.1| PREDICTED: zinc finger protein ZAT11-like [Nicotiana sylvestris]
Length=168

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 105/179 (59%), Gaps = 19/179 (11%)
 Frame = -2

Query  723  MTMLMKRSREYAG-VEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSF  547
            + + +KR RE         MAN LML +    +  +   S  +    F+CKTC+++F SF
Sbjct  2    VVLPIKREREEEFRTNITTMANYLMLFSSQENHFDTLNNSPDR---VFECKTCNRQFSSF  58

Query  546  QALGGHRASHKKPKLVAPAPGEQ-ESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAM  370
            QALGGHRASHKKP+L+      Q  +SP K K H CSICGLEF +GQALGGHMRRHRA +
Sbjct  59   QALGGHRASHKKPRLMGELNYHQLPTSPPKPKTHECSICGLEFPIGQALGGHMRRHRAIL  118

Query  369  MKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND-DLKIESTTPAT  196
             +   +         +   V+K++ +S+R+    L LDLNLTP END + K+  + P  
Sbjct  119  NENNIQ---------VPHHVVKKSNNSRRV----LCLDLNLTPLENDLEFKLGKSAPVV  164



>ref|XP_011091501.1| PREDICTED: zinc finger protein ZAT12-like [Sesamum indicum]
Length=174

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 104/167 (62%), Gaps = 13/167 (8%)
 Frame = -2

Query  723  MTMLMKRSRE--YAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPS  550
            MTM MKR+R+         A+ANCLMLL+      +      S  +  F CKTC+++FPS
Sbjct  1    MTM-MKRTRDDQVRDDNITALANCLMLLSSRSGRGAGGGGEFSTRV--FTCKTCNRQFPS  57

Query  549  FQALGGHRASHKKPKLVAPAPGEQES-SPEKSKMHRCSICGLEFAMGQALGGHMRRHRAA  373
            FQALGGHRASHKKP+L+A     Q   SP K K H CSICGLEF +GQALGGHMRRHRA 
Sbjct  58   FQALGGHRASHKKPRLMAGDESLQRPLSPPKPKTHECSICGLEFPIGQALGGHMRRHRAG  117

Query  372  MMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEN  232
             + +  +    A P     P++KR  +S+R+    L +DLNLTP EN
Sbjct  118  AVAD--DQNLRAAPAVSEAPIVKR-ANSRRV----LCMDLNLTPLEN  157



>gb|EYU19898.1| hypothetical protein MIMGU_mgv1a014646mg [Erythranthe guttata]
Length=183

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 112/179 (63%), Gaps = 20/179 (11%)
 Frame = -2

Query  723  MTMLMKRSREYAGVE-AEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSF  547
            M M+MKR RE + V+    +AN L+LL+  G  ++    S+      F+CKTC+++FPSF
Sbjct  1    MMMMMKRQREESDVDDITNLANSLILLSGGGSAAAGGGYSSR----VFECKTCNRQFPSF  56

Query  546  QALGGHRASHKKPKLV--APAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAA  373
            QALGGHRASHKKPKL+  A A  +   SP K K H CSICGLEFA+GQALGGHMRRHR+A
Sbjct  57   QALGGHRASHKKPKLMGGAAAGDDHHRSPPKQKTHECSICGLEFAIGQALGGHMRRHRSA  116

Query  372  MMKEGFENppa---------aipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDL  223
                   +            ++ ++ + P + + ++S+R+    L +DLNLTP+EN  L
Sbjct  117  TTANNDHHQKQRPSPPPPPPSLFLSSSSPPIVKKSNSRRV----LCMDLNLTPSENKFL  171



>ref|XP_003536960.1| PREDICTED: zinc finger protein ZAT11-like [Glycine max]
Length=164

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 101/161 (63%), Gaps = 13/161 (8%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKR R+  GVE+  + NCLMLL+H  R          ++   F+C TC++KF SFQALGG
Sbjct  1    MKRQRD--GVESIDLVNCLMLLSH-HREIKPQKLLGPEE---FECMTCNRKFTSFQALGG  54

Query  531  HRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFE  352
            HRASHKKPKL     G+      K K H C+ICG EF +GQALGGHM++HR A + +GF 
Sbjct  55   HRASHKKPKLHVKEQGKILMLGNKPKKHECTICGREFTLGQALGGHMKKHRIA-VDQGFS  113

Query  351  NppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
                   + + +P LKR+ S + +F   L+L+LNLTP +ND
Sbjct  114  ---LINEVVVKVPFLKRSNSKRVLF---LDLNLNLTPLQND  148



>ref|XP_004494993.1| PREDICTED: zinc finger protein ZAT11-like [Cicer arietinum]
Length=162

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 98/162 (60%), Gaps = 17/162 (10%)
 Frame = -2

Query  714  LMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALG  535
            +MKR RE    E+  +A  LMLL+   +N + S P        F+CKTC++KF SFQALG
Sbjct  1    MMKRQRETEEKESIDLATSLMLLSRTQQNKTFSSP------IEFECKTCNRKFSSFQALG  54

Query  534  GHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGF  355
            GHRASHKK K+       + ++    KMH CSICG EF +GQALGGHMRRHR     E F
Sbjct  55   GHRASHKKLKIEGQQESLKGNNNNVKKMHECSICGQEFKLGQALGGHMRRHRN---NEAF  111

Query  354  ENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
             N         + PVLKR ++SKR+    L LDLNLTP END
Sbjct  112  SN-----CFEKSSPVLKR-SNSKRV--MCLELDLNLTPLEND  145



>gb|KHN49000.1| Zinc finger protein ZAT11 [Glycine soja]
Length=182

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 104/170 (61%), Gaps = 9/170 (5%)
 Frame = -2

Query  723  MTMLMKRSREYAGVEAEA-MANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSF  547
            M  ++KR RE    E+   +A  LM L+ V + S     + S     F+CKTC++KFPSF
Sbjct  1    MVAILKRQRETEAEESIIRLAESLMQLSRVQQKSKPLLKTFSP--TEFECKTCNRKFPSF  58

Query  546  QALGGHRASHKKPKLVAPAPGEQE----SSPEKSKMHRCSICGLEFAMGQALGGHMRRHR  379
            QALGGHRASHKKPK       E+     S   K KMH CSICG+EF++GQALGGHMR+HR
Sbjct  59   QALGGHRASHKKPKFEGEELKEEAKKGLSLGNKPKMHECSICGMEFSLGQALGGHMRKHR  118

Query  378  AAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
             A  +   E   ++I  A++   + + ++SKR+    L +DLNLTP END
Sbjct  119  GATSENNNEAFSSSIKQAISKVPVLKRSNSKRV--MCLEMDLNLTPLEND  166



>ref|XP_009141657.1| PREDICTED: zinc finger protein ZAT11-like [Brassica rapa]
 emb|CDY18446.1| BnaA04g21410D [Brassica napus]
Length=180

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 109/172 (63%), Gaps = 21/172 (12%)
 Frame = -2

Query  714  LMKRSR-EYA-GVEAEAMANCLMLLAH-------VGRNssssppsaSKDLCSFQCKTCDK  562
            +MKR R E+   ++   ++ CLM+L+        +G N  +   ++++    F+CKTC+K
Sbjct  1    MMKRERSEFEESIKNLDISKCLMILSQTSSMVKQIGVNQYTETNTSNR----FECKTCNK  56

Query  561  KFPSFQALGGHRASHKKPKL-VAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRR  385
            +F SFQALGGHRASHKKPKL V     +Q  + + ++ H C+ICG  F  GQALGGHMRR
Sbjct  57   RFSSFQALGGHRASHKKPKLTVDQKVVKQYLTKDGTQAHECTICGQSFGTGQALGGHMRR  116

Query  384  HRAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            HR++M  E  E      P+   +PVLKR +SSKR+    L+LDLNLTP END
Sbjct  117  HRSSMTVEPSE---LISPVIHNMPVLKRCSSSKRV----LSLDLNLTPLEND  161



>emb|CAF74934.1| zinc finger DNA-binding protein [Catharanthus roseus]
Length=190

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 101/174 (58%), Gaps = 14/174 (8%)
 Frame = -2

Query  723  MTMLMKRSREYAGVEA-EAMANCLMLLAHVGRNssssppsaSKDLCS----FQCKTCDKK  559
            + + MKR+RE    ++   MANCLMLL+           +++    +    F+CKTC+++
Sbjct  4    INIPMKRTREANDFDSITTMANCLMLLSQNRSGEFIDSTTSNSSNLNSNRVFECKTCNRQ  63

Query  558  FPSFQALGGHRASHKKPKLVAPAPGEQ-ESSPEKSKMHRCSICGLEFAMGQALGGHMRRH  382
            FPSFQALGGHRASHK+P+L       Q   +  K K H CSICGLEFA+GQALGGHMRRH
Sbjct  64   FPSFQALGGHRASHKRPRLGGDLTLSQIPVAAAKPKTHECSICGLEFAIGQALGGHMRRH  123

Query  381  RAAMMKEGFENppaaipmamaiPVLKRTT----SSKRIFGFGLNLDLNLTPAEN  232
            RAAM      N  +       + V K       + +R++G    LDLNLTP EN
Sbjct  124  RAAMSDSASGNSASPPRDDRTVVVKKSNIVDDDNDRRVWG----LDLNLTPFEN  173



>ref|XP_004239776.1| PREDICTED: zinc finger protein ZAT11-like [Solanum lycopersicum]
Length=170

 Score =   124 bits (311),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 107/182 (59%), Gaps = 16/182 (9%)
 Frame = -2

Query  723  MTMLMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQ  544
            + + MKR RE    +   MAN LML +    + ++   ++   +  F+CKTC+++F SFQ
Sbjct  2    VVLPMKRERE-GEFDITTMANYLMLFSRQENHFNTMVNNSPSRV--FECKTCNRQFSSFQ  58

Query  543  ALGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMK  364
            ALGGHRASHKKP+L+         SP K K H CSICGLEF +GQALGGHMRRHR  + +
Sbjct  59   ALGGHRASHKKPRLMGEMNFHLPISPPKPKTHECSICGLEFPIGQALGGHMRRHRGMLNE  118

Query  363  EGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND-DLKIESTTPATPVL  187
                             V+K+++++ R+    L LDLNLTP END + K++    A P++
Sbjct  119  N-----NNNNNQVPNHDVMKKSSNNPRV----LCLDLNLTPLENDLEFKLKK---ANPIV  166

Query  186  RC  181
             C
Sbjct  167  DC  168



>ref|XP_007206686.1| hypothetical protein PRUPE_ppa022066mg [Prunus persica]
 gb|EMJ07885.1| hypothetical protein PRUPE_ppa022066mg [Prunus persica]
Length=184

 Score =   124 bits (312),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 81/127 (64%), Gaps = 10/127 (8%)
 Frame = -2

Query  585  FQCKTCDKKFPSFQALGGHRASHKKPKLVAPAPGEQES--------SPEKSKMHRCSICG  430
            F+CKTC++KFPSFQALGGHRASH +P+       + E+        +  K K H CSICG
Sbjct  43   FECKTCNRKFPSFQALGGHRASHNRPRTSMDHDQQSETRKRSNLMATKNKPKAHECSICG  102

Query  429  LEFAMGQALGGHMRRHRAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLN  250
            LEF MGQALGGHMRRHRA+ M  GF +      +  +   + R +SSKRI    L +DLN
Sbjct  103  LEFGMGQALGGHMRRHRASNMNLGFSSKVPDEVVVASKIPVLRRSSSKRI--MCLEMDLN  160

Query  249  LTPAEND  229
            LTP END
Sbjct  161  LTPLEND  167



>ref|XP_009337587.1| PREDICTED: zinc finger protein ZAT12-like [Pyrus x bretschneideri]
Length=194

 Score =   125 bits (313),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 98/167 (59%), Gaps = 23/167 (14%)
 Frame = -2

Query  672  AMANCLMLLAH-VGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGGHRASHKKPKLVA  496
             MANCLMLL+  +  N++     +      F+CKTC+++FPSFQALGGHRASHKKP+L  
Sbjct  16   TMANCLMLLSRGINNNANQYDSFSVSPNRVFECKTCNRQFPSFQALGGHRASHKKPRLTG  75

Query  495  PAPGE---------QESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAM--------M  367
             +             + SP K K H C+ICGLEF +GQALGGHMRRHRAA+        +
Sbjct  76   SSGEGNSNSSDQSLSQGSPPKPKTHECNICGLEFPVGQALGGHMRRHRAALSGCNTTSNV  135

Query  366  KEGFENppaai-pmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
             E + +  +     A    VLK+T S +R     + LDLNLTP END
Sbjct  136  HERYSSSNSLNPQPAQVFQVLKKTNSGRR----AMCLDLNLTPLEND  178



>ref|XP_008370922.1| PREDICTED: zinc finger protein ZAT12-like [Malus domestica]
Length=196

 Score =   125 bits (313),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 98/167 (59%), Gaps = 23/167 (14%)
 Frame = -2

Query  672  AMANCLMLLAH-VGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGGHRASHKKPKLVA  496
             MANCLMLL+  +  N++     +      F+CKTC+++FPSFQALGGHRASHKKP+L  
Sbjct  18   TMANCLMLLSRGINYNANQYDSFSVSPNRVFECKTCNRQFPSFQALGGHRASHKKPRLTG  77

Query  495  PAPGE---------QESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAM--------M  367
             +             + SP K K H C+ICGLEF +GQALGGHMRRHRAA+        +
Sbjct  78   SSGEGNSNSSDQSLSQGSPPKPKTHECNICGLEFPIGQALGGHMRRHRAALSGSNTTSNV  137

Query  366  KEGFENppaai-pmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
             E + +  +     A    VLK+T S +R     + LDLNLTP END
Sbjct  138  HERYSSSNSLNPQPAQVFQVLKKTNSGRR----AMCLDLNLTPLEND  180



>gb|KEH42343.1| C2H2 type zinc finger transcription factor family protein [Medicago 
truncatula]
Length=171

 Score =   124 bits (311),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 98/163 (60%), Gaps = 10/163 (6%)
 Frame = -2

Query  714  LMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALG  535
            +MKR RE    E+  +A  LMLL+     S  +  + +     F+CKTC++KF SFQALG
Sbjct  1    MMKRQRENEEKESIDLATTLMLLS-----SRITQQNKTYSPVEFECKTCNRKFSSFQALG  55

Query  534  GHRASHKKPKLVAPAPGEQES-SPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEG  358
            GHRASHKK KL+      + +    K KMH+CSICG EF +GQALGGHMRRHR  +  EG
Sbjct  56   GHRASHKKLKLLDSEEAHKVNIHNNKPKMHQCSICGQEFKLGQALGGHMRRHR--INNEG  113

Query  357  FENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            F +      +      + + ++SKR+    + LDLNLTP END
Sbjct  114  FSSSSINYQVIAKSSPVLKRSNSKRV--MIMELDLNLTPLEND  154



>gb|KHN33407.1| Zinc finger protein ZAT12 [Glycine soja]
Length=174

 Score =   124 bits (311),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 113/183 (62%), Gaps = 17/183 (9%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKR RE + ++   MANCLMLL  VG + ++ P S   D+  F+CKTC+++F SFQALGG
Sbjct  1    MKRGREESKLD---MANCLMLLTKVGESETNYPISKGSDIGDFKCKTCNRRFSSFQALGG  57

Query  531  HRASHKKPKLVAPAPGEQESSP-----EKSKMHRCSICGLEFAMGQALGGHMRRHRAAMM  367
            HRASHKKPKL+       +  P     ++ +MH C ICGLEFA+GQALGGHMR+HR A+ 
Sbjct  58   HRASHKKPKLMVTDLSCHQELPNPTMKQQPRMHPCPICGLEFAIGQALGGHMRKHRTAI-  116

Query  366  KEGFENppaaipmamaiPVLKRTT-SSKRIFGFGLNLDLNLTPAENDDLKIESTTPATPV  190
                 +       + ++ +LK ++    +     L+L+LNLTP E DDLK+      TPV
Sbjct  117  ----NDGLLCGKPSSSLSILKESSKDGDQKLNLRLDLNLNLTPLEEDDLKLNL---RTPV  169

Query  189  LRC  181
            L C
Sbjct  170  LNC  172



>ref|XP_008788081.1| PREDICTED: zinc finger protein ZAT11 [Phoenix dactylifera]
Length=172

 Score =   124 bits (310),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 104/169 (62%), Gaps = 28/169 (17%)
 Frame = -2

Query  711  MKRSREYAGVEAEAM--ANCLMLLAHVGRNssssppsaSKDLCS------FQCKTCDKKF  556
            MKR R + G E E+M  AN LMLL+  G          S+          F+CKTC+++F
Sbjct  1    MKRFR-FGGEEVESMNMANVLMLLSRGGGGGGGGSGEESEHSAQTSPGRVFECKTCNRQF  59

Query  555  PSFQALGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRA  376
            PSFQALGGHRASHKKP+L+A   G+ +    K ++H CSICGLEFA+GQALGGHMRRHRA
Sbjct  60   PSFQALGGHRASHKKPRLMAE--GQLQGGLAKPRVHECSICGLEFAIGQALGGHMRRHRA  117

Query  375  AMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            A   EGF +            ++++    +R+    L+LDLNL P+END
Sbjct  118  A--TEGFGH-----------GLVEKKPEGRRV----LSLDLNLPPSEND  149



>gb|KEH42342.1| C2H2 type zinc finger transcription factor family protein [Medicago 
truncatula]
Length=170

 Score =   124 bits (310),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 97/163 (60%), Gaps = 12/163 (7%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKR RE    E+  +A  LMLL+     S  +  + +     F+CKTC++KF SFQALGG
Sbjct  1    MKRQRENEEKESINLATTLMLLS-----SRITQQNKTYSPVEFECKTCNRKFSSFQALGG  55

Query  531  HRASHKKPKLVAPAPGEQES-SPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGF  355
            HRASHKK KL+      + +    K KMH+CSICG EF +GQALGGHMRRHR  +  EGF
Sbjct  56   HRASHKKLKLLDSEEAHKVNIHNNKPKMHQCSICGQEFKLGQALGGHMRRHR--INNEGF  113

Query  354  ENppaaipmamaiP-VLKRTTSSKRIFGFGLNLDLNLTPAEND  229
             +      +      VLKR+ S + +    + LDLNLTP END
Sbjct  114  SSSSINYQVIAKSSPVLKRSNSKRVMI---MELDLNLTPLEND  153



>gb|ACJ48970.1| putative Cys2-His2 type zinc finger protein [Glycine soja]
Length=171

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 109/182 (60%), Gaps = 18/182 (10%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKR RE + ++   MANCLMLL  VG + ++ P S  +D   F+CKTC+++F SFQALGG
Sbjct  1    MKRGREESKLD---MANCLMLLTKVGESETNYPISKGRDDGDFKCKTCNRRFSSFQALGG  57

Query  531  HRASHKKPKLVAPAPGEQESSP-----EKSKMHRCSICGLEFAMGQALGGHMRRHRAAMM  367
            HRASHKKPKL+          P     ++ +MH C ICGLEFA+GQALGGHMR+HR A+ 
Sbjct  58   HRASHKKPKLMVTDLSWHHELPNNPTMKQPRMHPCPICGLEFAIGQALGGHMRKHRTAI-  116

Query  366  KEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPATPVL  187
                 N         ++ +LK ++         L LDLNLTP E DDLK+      TPVL
Sbjct  117  -----NDGLLCGKPSSLSILKNSSKDAHER-LNLRLDLNLTPMEEDDLKLNLR---TPVL  167

Query  186  RC  181
             C
Sbjct  168  NC  169



>ref|XP_007149157.1| hypothetical protein PHAVU_005G046200g [Phaseolus vulgaris]
 gb|ESW21151.1| hypothetical protein PHAVU_005G046200g [Phaseolus vulgaris]
Length=168

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 99/165 (60%), Gaps = 17/165 (10%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKR RE  G+    +ANCLMLL+   +           +   F+CKTC++KF SFQALGG
Sbjct  1    MKRQREMDGLATIDLANCLMLLSCPQQKKLQPKYVEGVE---FECKTCNRKFSSFQALGG  57

Query  531  HRASHKKPKLVAPAPGEQESS----PEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMK  364
            HRASHK+ KL          S      K KMH C+ICG EF++GQALGGHMRRHRA+ +K
Sbjct  58   HRASHKRSKLEGYEHKADAMSLSLGINKPKMHECTICGQEFSLGQALGGHMRRHRAS-IK  116

Query  363  EGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            + F      I     +PVLKR+ SS+     G+ +DLNLTP END
Sbjct  117  DHFS----PINHVAQVPVLKRSNSSR-----GMCMDLNLTPLEND  152



>ref|XP_003543503.1| PREDICTED: zinc finger protein ZAT11-like [Glycine max]
Length=171

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 109/182 (60%), Gaps = 18/182 (10%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKR RE   ++   MANCLMLL  VG + ++ P S  +D   F+CKTC+++F SFQALGG
Sbjct  1    MKRGREEGELD---MANCLMLLTKVGESETNYPISKGRDDGDFKCKTCNRRFSSFQALGG  57

Query  531  HRASHKKPKLVAPAPGEQESSP-----EKSKMHRCSICGLEFAMGQALGGHMRRHRAAMM  367
            HRASHKKPKL+          P     ++ +MH C ICGLEFA+GQALGGHMR+HR+A+ 
Sbjct  58   HRASHKKPKLMVTDLSWHHELPNNPTMKQPRMHPCPICGLEFAIGQALGGHMRKHRSAI-  116

Query  366  KEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPATPVL  187
                 N         ++ +LK ++         L LDLNLTP E DDLK+      TPVL
Sbjct  117  -----NDGLLCGKPSSLSILKNSSKDAHER-LNLRLDLNLTPMEEDDLKLNLR---TPVL  167

Query  186  RC  181
             C
Sbjct  168  NC  169



>gb|AGK28202.1| C2H2-type zinc finger protein 4 [Eucalyptus grandis]
 gb|KCW85610.1| hypothetical protein EUGRSUZ_B02397 [Eucalyptus grandis]
Length=161

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 109/169 (64%), Gaps = 33/169 (20%)
 Frame = -2

Query  714  LMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALG  535
            ++KR RE   VEA A+AN LMLL+ V R               F CKTC+++F SFQALG
Sbjct  1    MVKRDREDTEVEALAVANSLMLLSRVER--------------IFACKTCNREFSSFQALG  46

Query  534  GHRASHKKPKLVAPAPGE-------QESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRA  376
            GHRASHKKPKL++   G+        +SS +K KMH+CSICGLEF +GQALGGHMRRHRA
Sbjct  47   GHRASHKKPKLIS---GDLLHLGHSVDSSLDKPKMHKCSICGLEFPLGQALGGHMRRHRA  103

Query  375  AMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            A++K       AA   A  +PVLK+ ++SK + G    LDLN +P E+D
Sbjct  104  AILK----RLAAAAAAAKPVPVLKK-SNSKIVTG----LDLNSSPMEDD  143



>ref|XP_006387108.1| hypothetical protein POPTR_1833s00200g, partial [Populus trichocarpa]
 gb|ERP46022.1| hypothetical protein POPTR_1833s00200g, partial [Populus trichocarpa]
Length=145

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 90/145 (62%), Gaps = 12/145 (8%)
 Frame = -2

Query  588  SFQCKTCDKKFPSFQALGGHRASHKKPKLVAPAPG--EQESSPEKSKMHRCSICGLEFAM  415
            SF CKTC+K FPSFQALGGHRASHKKPKL        +  +SP K K H+CSICGLEF +
Sbjct  2    SFSCKTCNKNFPSFQALGGHRASHKKPKLKESTGNLLKLPNSPSKPKTHQCSICGLEFPL  61

Query  414  GQALGGHMRRHRA-------AMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLD  256
            GQALGGHMRRHRA       +   +  E      P   A+PVLKR+ SSKR+    L+L 
Sbjct  62   GQALGGHMRRHRAPNNVDTTSTSSKDHELAVTQPPFLPAVPVLKRSNSSKRVLCLDLSLA  121

Query  255  LNLTPAENDDLKIESTTPATPVLRC  181
            L   P   +D +++    A P+LRC
Sbjct  122  L---PMYQNDSELQLEKVARPMLRC  143



>ref|XP_007205995.1| hypothetical protein PRUPE_ppa012242mg [Prunus persica]
 gb|EMJ07194.1| hypothetical protein PRUPE_ppa012242mg [Prunus persica]
Length=178

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 96/158 (61%), Gaps = 20/158 (13%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGR-NssssppsaSKDLCSFQCKTCDKKFPSFQALG  535
            MKR RE    +   + NCLMLL+ + + +SS +     K    F CKTC+++FPSFQALG
Sbjct  1    MKRGREDQDDQTLDLVNCLMLLSKIDQPDSSPTKAEDLKRGRVFTCKTCNREFPSFQALG  60

Query  534  GHRASHKKPKL----------VAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRR  385
            GHRASHKKPKL          +A +PG    SP K K H C +CGLEFA+GQALGGHMRR
Sbjct  61   GHRASHKKPKLMPGGAVDLLQLAQSPG----SPAKPKTHECHVCGLEFAVGQALGGHMRR  116

Query  384  HRAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGF  271
            HR     E  +        + A+PVLK++ SSKR+  F
Sbjct  117  HR-----EEIQGNAVQARSSPAMPVLKKSNSSKRVSSF  149



>ref|XP_008222989.1| PREDICTED: zinc finger protein ZAT12 [Prunus mume]
Length=178

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 96/158 (61%), Gaps = 20/158 (13%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGR-NssssppsaSKDLCSFQCKTCDKKFPSFQALG  535
            MKR RE    +   + NCLMLL+ + + +SS +     K    F CKTC+++FPSFQALG
Sbjct  1    MKRGREDQDDQTLDLVNCLMLLSKIDQPDSSPTKAEDLKPGRVFTCKTCNREFPSFQALG  60

Query  534  GHRASHKKPKL----------VAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRR  385
            GHRASHKKPKL          +A +PG    SP K K H C ICGLEFA+GQALGGHMRR
Sbjct  61   GHRASHKKPKLMPGGAVDLLQLAQSPG----SPAKPKTHECHICGLEFAVGQALGGHMRR  116

Query  384  HRAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGF  271
            HR     E  +        + A+PVLK++ SSKR+  F
Sbjct  117  HR-----EEIQANAVPARSSPAMPVLKKSNSSKRVSSF  149



>emb|CAI77630.1| putative Cys2-His2 zinc finger transcription factor [Juglans 
regia]
Length=183

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 108/176 (61%), Gaps = 22/176 (13%)
 Frame = -2

Query  723  MTMLMKRSREYAGVE--AEAMANCLMLLAHVG-RNssssppsaSKDLCSFQCKTCDKKFP  553
            M M   RS +  G +   + MA CLMLL+H G   + + P +    +  F+CKTC+++F 
Sbjct  1    MAMKRMRSEDIVGDKDSLDDMAKCLMLLSHGGGLTTDTKPKTCPHPVDVFECKTCNRQFS  60

Query  552  SFQALGGHRASHKKPKLVAPAPGEQ--------ESSPEKSKMHRCSICGLEFAMGQALGG  397
            SFQALGGHRASHK+P+L+    GE+        +SS  K KMH CS+CG +F+MGQALGG
Sbjct  61   SFQALGGHRASHKRPRLM----GEEHKVDRTKLQSSGNKPKMHECSLCGQKFSMGQALGG  116

Query  396  HMRRHRAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            HMRRHRA    EG  +    +  A    ++KR+ S++ +     +LDLNLTP END
Sbjct  117  HMRRHRA---NEGLSSIMNPLDHAKVPMLMKRSNSTRVV----CSLDLNLTPLEND  165



>ref|XP_004294605.1| PREDICTED: zinc finger protein ZAT11-like [Fragaria vesca subsp. 
vesca]
Length=176

 Score =   122 bits (306),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 100/166 (60%), Gaps = 17/166 (10%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLA-HVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALG  535
            MKR RE    +   + +CLMLL+  VG+  SS          +F CKTC+++F SFQALG
Sbjct  1    MKRGRE-DDQQTLDLVSCLMLLSKDVGQTGSSPIKKQKTSDRAFACKTCNREFSSFQALG  59

Query  534  GHRASHKKPKLVA--------PAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHR  379
            GHRASH KPKLVA               SSP K K H C ICG+EFA+GQALGGHMRRHR
Sbjct  60   GHRASHNKPKLVAGNGAADLLQLAQSSPSSPAKPKSHECPICGVEFAIGQALGGHMRRHR  119

Query  378  AAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTP  241
              M+     +  A    A A+PVLK++ SSKR+    LNLDLNL P
Sbjct  120  DVMI-----SAAADRGQAAAVPVLKKSNSSKRV--SCLNLDLNLAP  158



>ref|XP_011042666.1| PREDICTED: zinc finger protein ZAT12-like [Populus euphratica]
Length=194

 Score =   122 bits (307),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 113/196 (58%), Gaps = 22/196 (11%)
 Frame = -2

Query  720  TMLMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCS------FQCKTCDKK  559
            ++ MKR RE   ++   M  CLMLL  VG+      P+  K          F CKTC+K 
Sbjct  3    SITMKRGREEGELD---MGKCLMLLYKVGKADDHELPTNYKSSSPSGAGRLFSCKTCNKN  59

Query  558  FPSFQALGGHRASHKKPKLVAPAPG---EQESSPEKSKMHRCSICGLEFAMGQALGGHMR  388
            F SFQALGGHRASHKKPKLV        +  +SP+K K H+CSICGLEF +GQALGGHMR
Sbjct  60   FSSFQALGGHRASHKKPKLVGSTGNLLMKLPNSPQKPKNHQCSICGLEFPIGQALGGHMR  119

Query  387  RHRA----AMMKEGFENppaaip--mamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDD  226
            RHRA    A      +N  A     +  A+PVLKR+ SSKR+    L+L L   P + ++
Sbjct  120  RHRADNIYATSNSTADNELAVTYPPLLPAVPVLKRSNSSKRVLCLDLSLAL---PMDQNE  176

Query  225  LKIESTTPAT-PVLRC  181
             +++    +T  VL+C
Sbjct  177  SELQLRRASTQSVLKC  192



>ref|NP_001241413.1| uncharacterized protein LOC100816598 [Glycine max]
 gb|ACU24131.1| unknown [Glycine max]
Length=185

 Score =   122 bits (306),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 106/196 (54%), Gaps = 32/196 (16%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKR RE   V++  MAN LMLL+    N ++       D   F+CKTC+++F SFQALGG
Sbjct  1    MKRERE---VDSITMANYLMLLSRTTTNLNT------SDNRVFECKTCNRRFTSFQALGG  51

Query  531  HRASHKKPKLVAPAPGEQ--ESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEG  358
            H ASHKKP+L+  + G+     SP K K H CSICGLEFA+GQALGGHMRRHRAA     
Sbjct  52   HCASHKKPRLMGESDGQVLIHGSPPKPKTHECSICGLEFAIGQALGGHMRRHRAAAAAAS  111

Query  357  FENppaaipmamaiPVLK-----------------RTTSSKRIFGFGLNLDLNLTPAEND  229
              N    I   M+                      +   +KRI    L  DLNLTP END
Sbjct  112  NRNMHTTINSLMSSGSSSGGSTVDNTLPPNMNHNHKVNDTKRI----LFPDLNLTPLEND  167

Query  228  DLKIESTTPATPVLRC  181
               ++    ATP++ C
Sbjct  168  LEFLKIGRQATPLVHC  183



>emb|CDX91362.1| BnaC04g07880D [Brassica napus]
Length=180

 Score =   122 bits (305),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 100/168 (60%), Gaps = 14/168 (8%)
 Frame = -2

Query  711  MKRSR---EYAGVEAEAMANCLMLLAHVGR-NssssppsaSKDLCS-FQCKTCDKKFPSF  547
            MKR R   E +   ++ +A CLM+L+               +D  + F+CKTC+K+F SF
Sbjct  1    MKRERSEFEESIKMSDDIARCLMILSQTSMVKQVDVNQYTDRDTSNRFECKTCNKRFSSF  60

Query  546  QALGGHRASHKKPKLVAPAPGEQE--SSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAA  373
            QALGGHRASHKKPKL       +   ++   + MH CSICG  F  GQALGGHMRRHR++
Sbjct  61   QALGGHRASHKKPKLSVDQKEVKHVTNNYNGTHMHECSICGQSFGTGQALGGHMRRHRSS  120

Query  372  MMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            M     E      P+   +PVLKR +SSKR+    L+LDLNLTP END
Sbjct  121  M---KVEPSQLISPVISNVPVLKRCSSSKRV----LSLDLNLTPLEND  161



>ref|XP_004493902.1| PREDICTED: zinc finger protein ZAT11-like [Cicer arietinum]
Length=165

 Score =   121 bits (304),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 108/180 (60%), Gaps = 22/180 (12%)
 Frame = -2

Query  717  MLMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQAL  538
            M MKR R   G E   ++NCLMLL+   + +  +          ++CKTC+KKF  FQAL
Sbjct  1    MAMKRQRNSQGTENINISNCLMLLSCPQQKNYENG--------EYECKTCNKKFSCFQAL  52

Query  537  GGHRASHKKPKLVAPAPGEQE----SSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAM  370
            GGHRASHK+ K++     ++E    S   + KMH CSICG+ F++GQALGGHMR+HRAA 
Sbjct  53   GGHRASHKRMKVIDGEELKEEAKSLSLWNEPKMHECSICGMRFSLGQALGGHMRKHRAA-  111

Query  369  MKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPATPV  190
              EG  +      M   IP+LKR ++SKRI    + LDLNLTP EN DL     +P  P+
Sbjct  112  TNEGLSS---MKQMIAKIPILKR-SNSKRI----MCLDLNLTPLEN-DLAFGMKSPPLPL  162



>ref|XP_004307547.1| PREDICTED: zinc finger protein ZAT11-like [Fragaria vesca subsp. 
vesca]
Length=222

 Score =   123 bits (308),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 108/192 (56%), Gaps = 25/192 (13%)
 Frame = -2

Query  720  TMLMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCS----FQCKTCDKKFP  553
             ++MKRS       +  MANCLMLL+  G +  S   + S    S    F+CKTC+++FP
Sbjct  30   IIIMKRSITELD-HSVTMANCLMLLSR-GNDYDSLISTTSSPTSSPSRVFECKTCNRQFP  87

Query  552  SFQALGGHRASHKKPKLVAPAPGEQESSPEKSKM---HRCSICGLEFAMGQALGGHMRRH  382
            SFQALGGHRASHKKP+L        +S          H C+ICGLEFA+GQALGGHMRRH
Sbjct  88   SFQALGGHRASHKKPRLAGGDGSSSDSQSSSPSKPKTHECNICGLEFAIGQALGGHMRRH  147

Query  381  RAAMMKEGFENppaaipm----------amaiPVLKRTTSSKRIFGFGLNLDLNLTPAEN  232
            RAA+      N   A                +PVLK+T SS+R+    L LDLNLTP EN
Sbjct  148  RAAVTDNDHRNLNGAQSKPMMGLSSNLGQGVVPVLKKTNSSRRV----LCLDLNLTPFEN  203

Query  231  D--DLKIESTTP  202
            D   L I  TTP
Sbjct  204  DMEILGIGKTTP  215



>dbj|BAA19110.1| PEThy;ZPT2-5 [Petunia x hybrida]
Length=176

 Score =   121 bits (304),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 102/175 (58%), Gaps = 17/175 (10%)
 Frame = -2

Query  708  KRSREYAGVEA-EAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            KR RE     +   MAN LMLL+           + S     F+CKTC+++F SFQALGG
Sbjct  7    KREREEDNFYSITTMANYLMLLSRQANEHFDKKMNNSSTSRVFECKTCNRQFSSFQALGG  66

Query  531  HRASHKKPKLVAPAPGEQ--ESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEG  358
            HRASHKKP+L+      Q     P K K H CSICGLEFA+GQALGGHMRRHRA +  + 
Sbjct  67   HRASHKKPRLMGELHNLQLFHELP-KRKTHECSICGLEFAIGQALGGHMRRHRAVINDKN  125

Query  357  FENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND---DLKIESTTP  202
             +      P     PV+K+  + +RI    L+LDLNLTP END   DL+  +T P
Sbjct  126  LQ-----APDDQHAPVVKK-ANGRRI----LSLDLNLTPLENDLEFDLRKSNTAP  170



>gb|ADL36628.1| C2H2L domain class transcription factor [Malus domestica]
Length=171

 Score =   121 bits (303),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 94/154 (61%), Gaps = 23/154 (15%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKRSRE   ++   + NCLMLL+    +S     + +KD   F CKTC+++FPSFQALGG
Sbjct  1    MKRSREDETLD---LVNCLMLLSREPDSSPIKHENTNKDRV-FVCKTCNREFPSFQALGG  56

Query  531  HRASHKKPKL----------VAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRH  382
            HRASHKKPKL          +A +PG    SP K K H C ICGLEFA+GQALGGHMRRH
Sbjct  57   HRASHKKPKLMPGGAADLLHLAQSPG----SPVKPKTHECPICGLEFAIGQALGGHMRRH  112

Query  381  RAAMMKEGFENppaaipmamaiPVLKRTTSSKRI  280
            R  M              +  +PVLK++ SSKR+
Sbjct  113  REVMQAAAVRT-----QASPPMPVLKKSNSSKRV  141



>ref|XP_009599326.1| PREDICTED: zinc finger protein ZAT11-like [Nicotiana tomentosiformis]
Length=168

 Score =   121 bits (303),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 104/179 (58%), Gaps = 19/179 (11%)
 Frame = -2

Query  723  MTMLMKRSRE-YAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSF  547
            + + +KR RE         MAN LML +    +  +   S S+    F+CKTC+++F SF
Sbjct  2    VVLPIKREREGEFRTNITTMANYLMLFSSQENHFDTINNSPSR---VFECKTCNRQFSSF  58

Query  546  QALGGHRASHKKPKLVAPAPGEQ-ESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAM  370
            QALGGHRASHKKP+L+      Q  +SP K K H CSICG+EF +GQALGGHMRRHR   
Sbjct  59   QALGGHRASHKKPRLMGELNFHQLPTSPPKPKTHECSICGVEFPIGQALGGHMRRHRGMT  118

Query  369  MKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND-DLKIESTTPAT  196
             +   +         +   V+K++ +S+R+    L LDLNLTP END + K+  + P  
Sbjct  119  NENSIQ---------VPNHVVKKSNNSRRV----LCLDLNLTPLENDLEFKLGKSAPVV  164



>ref|XP_006403670.1| hypothetical protein EUTSA_v10010956mg [Eutrema salsugineum]
 gb|ESQ45123.1| hypothetical protein EUTSA_v10010956mg [Eutrema salsugineum]
Length=176

 Score =   121 bits (304),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 77/119 (65%), Gaps = 9/119 (8%)
 Frame = -2

Query  585  FQCKTCDKKFPSFQALGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQA  406
            F+CKTC++KF SFQALGGHRASHKKPKL       +  + E  K H+CS CG  F  GQA
Sbjct  48   FECKTCNRKFDSFQALGGHRASHKKPKLSVDHEQMKHPNIENDK-HKCSFCGQMFGTGQA  106

Query  405  LGGHMRRHRAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            LGGHMR+HRA+MM E               PVL R +SSKRIF    +LDLNLTP END
Sbjct  107  LGGHMRKHRASMMTE----QSGISSAVYTRPVLNRCSSSKRIF----SLDLNLTPLEND  157



>gb|KHN05931.1| Zinc finger protein ZAT11 [Glycine soja]
Length=164

 Score =   120 bits (302),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 100/161 (62%), Gaps = 13/161 (8%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKR R+  GVE+  + NCLMLL+H  R          ++   F+  TC++KF SFQALGG
Sbjct  1    MKRHRD--GVESIDLVNCLMLLSH-HREIKPQKLLGPEE---FEYMTCNRKFTSFQALGG  54

Query  531  HRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFE  352
            HRASHKKPKL     G+      K K H C+ICG EF +GQALGGHM++HR A + +GF 
Sbjct  55   HRASHKKPKLHVKEQGKILMLGNKPKKHECTICGREFTLGQALGGHMKKHRIA-VDQGFS  113

Query  351  NppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
                   + + +P LKR+ S + +F   L+L+LNLTP +ND
Sbjct  114  ---LINEVVVKVPFLKRSNSKRVLF---LDLNLNLTPLQND  148



>ref|NP_001235351.1| uncharacterized protein LOC100526874 [Glycine max]
 gb|ACU15884.1| unknown [Glycine max]
Length=182

 Score =   121 bits (304),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 103/170 (61%), Gaps = 9/170 (5%)
 Frame = -2

Query  723  MTMLMKRSREYAGVEAEA-MANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSF  547
            M  ++KR RE    E+   +A  LM L+   + S     + S     F+CKTC++KFPSF
Sbjct  1    MVAILKRQRETEAEESIIRLAESLMQLSRGQQKSKPLLKTFSP--TEFECKTCNRKFPSF  58

Query  546  QALGGHRASHKKPKLVAPAPGEQE----SSPEKSKMHRCSICGLEFAMGQALGGHMRRHR  379
            QALGGHRASHKKPK       E+     S   K KMH CSICG+EF++GQALGGHMR+HR
Sbjct  59   QALGGHRASHKKPKFEGEELKEEAKKGLSLGNKPKMHECSICGMEFSLGQALGGHMRKHR  118

Query  378  AAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
             A  +   E   ++I  A++   + + ++SKR+    L +DLNLTP END
Sbjct  119  GAASENNNEAFSSSIKQAISKVPVLKRSNSKRV--MCLEMDLNLTPLEND  166



>ref|XP_010553303.1| PREDICTED: zinc finger protein ZAT11-like [Tarenaya hassleriana]
Length=175

 Score =   121 bits (303),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 104/176 (59%), Gaps = 12/176 (7%)
 Frame = -2

Query  711  MKRSR-EYAG-VEAEAMANCLMLLAHVGRNs-sssppsaSKDLCSFQCKTCDKKFPSFQA  541
            MKR R +Y   +++  +A  L+LL+    N+   +  S ++D   F+CKTC+K+F SFQA
Sbjct  1    MKRERSDYENSIKSLDIAKYLILLSETFANTPMVTNQSVNEDTNHFECKTCNKRFSSFQA  60

Query  540  LGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKE  361
            LGGHRASHKKPKLV     +  +  +  K H CSIC   F  GQALGGHMRRHRA +  E
Sbjct  61   LGGHRASHKKPKLVGEP--KHNNGADNDKTHECSICRQSFGSGQALGGHMRRHRAVISAE  118

Query  360  GFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPATP  193
                      +   +PVLKR  SSKR+    L+LDLNLTP END   +   T  +P
Sbjct  119  PV---ILCPKLPAVLPVLKRCNSSKRV----LSLDLNLTPLENDLEYVLGNTYLSP  167



>ref|XP_008385163.1| PREDICTED: zinc finger protein ZAT12-like [Malus domestica]
Length=171

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 94/154 (61%), Gaps = 23/154 (15%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKRSR+   ++   + NCLMLL+    +S     + +KD   F CKTC+++FPSFQALGG
Sbjct  1    MKRSRZDETLD---LVNCLMLLSREPDSSPIKHENTNKDRV-FVCKTCNREFPSFQALGG  56

Query  531  HRASHKKPKL----------VAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRH  382
            HRASHKKPKL          +A +PG    SP K K H C ICGLEFA+GQALGGHMRRH
Sbjct  57   HRASHKKPKLMPGGAADLLHLAQSPG----SPVKPKTHECPICGLEFAIGQALGGHMRRH  112

Query  381  RAAMMKEGFENppaaipmamaiPVLKRTTSSKRI  280
            R  M              +  +PVLK++ SSKR+
Sbjct  113  REVMQAAAVRT-----QASPPMPVLKKSNSSKRV  141



>gb|AFK48956.1| unknown [Lotus japonicus]
Length=145

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 97/178 (54%), Gaps = 42/178 (24%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKR R+  G     MANCLMLL+ VG + ++           F CKTC+++F SFQALGG
Sbjct  1    MKRMRDMEG----DMANCLMLLSKVGESCNNGD--------GFVCKTCNREFLSFQALGG  48

Query  531  HRASHKKPKLVAPAPGEQESSP------EKSKMHRCSICGLEFAMGQALGGHMRRHRAAM  370
            HRASHK+ KL+A       S P      +K KMH C ICG+EFA+GQALGGHMR+HRAAM
Sbjct  49   HRASHKRLKLMAAGLSSFSSRPLQGLREKKQKMHSCPICGIEFAIGQALGGHMRKHRAAM  108

Query  369  MKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPAT  196
               G                 KR+          L LDLNLTP END   I  T P +
Sbjct  109  NDGG----------------AKRSDH--------LCLDLNLTPHENDLNLILRTPPLS  142



>ref|NP_001236265.1| uncharacterized protein LOC100500316 [Glycine max]
 gb|ACU15355.1| unknown [Glycine max]
Length=173

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 101/175 (58%), Gaps = 27/175 (15%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKR RE   V++  MAN LMLL+    N ++S          F+CKTC+++F SFQALGG
Sbjct  1    MKRERE---VDSITMANYLMLLSRTTTNLNTSNNRV------FECKTCNRRFASFQALGG  51

Query  531  HRASHKKPKLVAPAPGEQ--ESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEG  358
            HRASHKKP+L+  +  +     SP K K H CSICGLEFA+GQALGGHMRRHRAA    G
Sbjct  52   HRASHKKPRLMGESDSQVLIHGSPPKPKTHECSICGLEFAIGQALGGHMRRHRAAAASNG  111

Query  357  FENppaaipmamaiP------------VLKRTTSSKRIFGFGLNLDLNLTPAEND  229
              +      ++ +              +  +  ++KR+    L  DLNLTP END
Sbjct  112  NMHTTINSWLSSSNSGGSTVDNTLPPNMNNKANNTKRV----LFPDLNLTPLEND  162



>ref|XP_008795640.1| PREDICTED: zinc finger protein ZAT12-like [Phoenix dactylifera]
Length=165

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 94/160 (59%), Gaps = 24/160 (15%)
 Frame = -2

Query  711  MKRSREYAG-VEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALG  535
            MKR RE    VE+  MA  L+ L+  G  +  SP         F+CKTC+++FPSFQALG
Sbjct  1    MKRLREEGDRVESINMARVLIFLSRGGEEARDSPGRV------FECKTCNRQFPSFQALG  54

Query  534  GHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGF  355
            GHRASH KP+LV    G+ +S+  K K+H CSICGLEF +GQALGGHMRRHRAA    G 
Sbjct  55   GHRASHSKPRLVGDGQGQGQSALGKPKVHACSICGLEFPIGQALGGHMRRHRAATESFG-  113

Query  354  ENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAE  235
                          ++++    KR     L LDLNL P+E
Sbjct  114  ------------HGLVEKKPDGKR----ALWLDLNLPPSE  137



>ref|XP_008385161.1| PREDICTED: zinc finger protein ZAT12-like [Malus domestica]
Length=171

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 94/154 (61%), Gaps = 23/154 (15%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKRSR+   ++   + NCLMLL+    +S     + +KD   F CKTC+++FPSFQALGG
Sbjct  1    MKRSRQDETLD---LVNCLMLLSREPDSSPIKHENTNKDRV-FVCKTCNREFPSFQALGG  56

Query  531  HRASHKKPKL----------VAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRH  382
            HRASHKKPKL          +A +PG    SP K K H C ICGLEFA+GQALGGHMRRH
Sbjct  57   HRASHKKPKLMPGGAADLLHLAQSPG----SPVKPKTHECPICGLEFAIGQALGGHMRRH  112

Query  381  RAAMMKEGFENppaaipmamaiPVLKRTTSSKRI  280
            R  M              +  +PVLK++ SSKR+
Sbjct  113  REVMQAAAVRT-----QASPPMPVLKKSNSSKRV  141



>ref|XP_010505329.1| PREDICTED: zinc finger protein ZAT11-like [Camelina sativa]
Length=182

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 105/174 (60%), Gaps = 24/174 (14%)
 Frame = -2

Query  711  MKRSR-EYA-GVEAEAMANCLMLLAH------VGRNssssppsaSKDLCSFQCKTCDKKF  556
            MKR R E+   +++  +A CLM+LA       +G N +    S   +   F+CKTC+++F
Sbjct  1    MKRERSEFEESIKSLDIAKCLMILAQTSMVKQIGLNQNQHTESHMSN--RFECKTCNRRF  58

Query  555  PSFQALGGHRASHKKPKLVAPAPGEQESSPEKSK----MHRCSICGLEFAMGQALGGHMR  388
             SFQALGGHRASHKKPKL      E +      K    +H CSICG  F  GQALGGHMR
Sbjct  59   SSFQALGGHRASHKKPKLTTVEQKEVKHLSNNYKGNNHLHECSICGQSFGTGQALGGHMR  118

Query  387  RHRAAM-MKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            RHR++M ++  F       P+   +PVLKR +SSKR+    L+LDLNLTP END
Sbjct  119  RHRSSMKVQPAF-----ICPVVPTMPVLKRCSSSKRV----LSLDLNLTPLEND  163



>ref|XP_004302781.1| PREDICTED: zinc finger protein ZAT11-like [Fragaria vesca subsp. 
vesca]
Length=175

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 104/167 (62%), Gaps = 14/167 (8%)
 Frame = -2

Query  705  RSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGGHR  526
            R++E  G++   MA CLMLL+           S+   +  ++CKTC+++F SFQALGGHR
Sbjct  5    RNQEVMGLD---MAKCLMLLSCRLETKFKKCSSSPNHV--YECKTCNRQFSSFQALGGHR  59

Query  525  ASHKKPKLVAPAPGEQESSPE----KSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEG  358
            ASHKKP+ +     + +S  +    K K H CSICGLEF++GQALGGHMRRHR  MM  G
Sbjct  60   ASHKKPRTLPGGDDDLKSEAKLAQGKPKKHECSICGLEFSLGQALGGHMRRHR--MMNAG  117

Query  357  FENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKI  217
            F +   +  +  +   +   ++SKR+    L++DLNLTP EN DLK+
Sbjct  118  FSSSAPSAVVVASKIPVLMRSNSKRV--MCLDMDLNLTPLEN-DLKV  161



>ref|XP_008359103.1| PREDICTED: zinc finger protein ZAT12-like [Malus domestica]
Length=171

 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 93/153 (61%), Gaps = 21/153 (14%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKRSR+   ++   + NCLMLL+    +S     + +KD   F CKTC+++FPSFQALGG
Sbjct  1    MKRSRQDETLD---LVNCLMLLSREPDSSPIKHENTNKDRV-FVCKTCNREFPSFQALGG  56

Query  531  HRASHKKPKLVAPAPG---------EQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHR  379
            HRASHKKPKL+   PG         +   SP K K H C ICGLEFA+GQALGGHMRRHR
Sbjct  57   HRASHKKPKLM---PGGAADXLHLAQSTGSPVKPKTHECPICGLEFAIGQALGGHMRRHR  113

Query  378  AAMMKEGFENppaaipmamaiPVLKRTTSSKRI  280
              M              +  +PVLK++ SSKR+
Sbjct  114  EVMQAAAVRT-----QASPPMPVLKKSNSSKRV  141



>gb|AFK46502.1| unknown [Lotus japonicus]
Length=175

 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 101/183 (55%), Gaps = 21/183 (11%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKR R+  G E+  + NCLML+    +   +       +   F+CKTC++KF SFQALGG
Sbjct  1    MKRQRDNEGTESFDLTNCLMLMLSCPKQIRTI-----NESVEFECKTCNRKFSSFQALGG  55

Query  531  HRASH--KKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEG  358
            HRASH  K+ KL   A         K +MH CS+CGL F++GQALGGHMR+HR     EG
Sbjct  56   HRASHNHKRVKLEEQAKTPSLWDNNKPRMHVCSVCGLGFSLGQALGGHMRKHRN---NEG  112

Query  357  F------ENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND---DLKIESTT  205
            F       +  +        PVLKR  SSKR+    L+LDLN  P END    +K+ S  
Sbjct  113  FSSSSSSSSSYSIKEEVAKFPVLKRLNSSKRV--LCLDLDLNFPPMENDFMFGMKLPSPV  170

Query  204  PAT  196
            P +
Sbjct  171  PLS  173



>ref|XP_006424755.1| hypothetical protein CICLE_v10029464mg [Citrus clementina]
 ref|XP_006488262.1| PREDICTED: zinc finger protein ZAT12-like [Citrus sinensis]
 gb|ESR37995.1| hypothetical protein CICLE_v10029464mg [Citrus clementina]
Length=159

 Score =   119 bits (298),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 104/173 (60%), Gaps = 25/173 (14%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKR RE A ++    ANCLMLL+ VG                F CKTC+K+FPSFQALGG
Sbjct  1    MKRDREMAAIDT---ANCLMLLSKVGETDQGKRV--------FACKTCNKEFPSFQALGG  49

Query  531  HRASHKKPKLVAPAPGEQE--------SSPEKSKMHRCSICGLEFAMGQALGGHMRRHRA  376
            HRASHKKPKL+  A   ++        +SP+K K H CSICGLEFA+GQALGGHMRRHRA
Sbjct  50   HRASHKKPKLMTMASSGEDFDQAQMPPASPKKPKTHECSICGLEFAIGQALGGHMRRHRA  109

Query  375  AMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKI  217
            A       +        + +PVLK++ S KR     L LDLNL P   DDLK+
Sbjct  110  AAAMGAAAD-GLVTRPLLQLPVLKKSNSCKR----ALCLDLNLMPT-GDDLKL  156



>ref|XP_007027111.1| C2H2 and C2HC zinc fingers superfamily protein, putative [Theobroma 
cacao]
 gb|EOY07613.1| C2H2 and C2HC zinc fingers superfamily protein, putative [Theobroma 
cacao]
Length=218

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 106/166 (64%), Gaps = 21/166 (13%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MK  RE      E++ANCLMLL+H G  +  +   + +D+  F+CKTC ++FPSFQALGG
Sbjct  52   MKGGRE----SEESVANCLMLLSH-GLETKRTLDHSVEDV--FECKTCHRRFPSFQALGG  104

Query  531  HRASHKKPKLVAPAPGEQES-----SPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMM  367
            HRASHK+P+L+  +     S     +  K K H C+ICG +F +GQALGGHMR+HRA++ 
Sbjct  105  HRASHKRPRLMGESQKADGSKFLSLAITKPKKHECAICGKKFDLGQALGGHMRKHRASI-  163

Query  366  KEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
               +E+      +   +PVL R ++SKRI    + LDLNLTP END
Sbjct  164  ---YESFSPFPVVDPDLPVLSR-SNSKRI----MRLDLNLTPLEND  201



>gb|KHN30196.1| Zinc finger protein ZAT11 [Glycine soja]
Length=160

 Score =   119 bits (297),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 102/168 (61%), Gaps = 15/168 (9%)
 Frame = -2

Query  669  MANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGGHRASHKKPKLVAPA  490
            MANCLMLL  VG + ++ P S  +D   F+CKTC+++F SFQALGGHRASHKKPKL+   
Sbjct  1    MANCLMLLTKVGESETNYPISKGRDDGDFKCKTCNRRFSSFQALGGHRASHKKPKLMVTD  60

Query  489  PGEQESSP-----EKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFENppaaipma  325
                   P     ++ +MH C ICGLEFA+GQALGGHMR+HR+A+      N        
Sbjct  61   LSWHHELPNNPTMKQPRMHPCPICGLEFAIGQALGGHMRKHRSAI------NDGLLCGKP  114

Query  324  maiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPATPVLRC  181
             ++ +LK ++         L LDLNLTP E DDLK+      TPVL C
Sbjct  115  SSLSILKNSSKDAH-ERLNLRLDLNLTPMEEDDLKLNLR---TPVLNC  158



>ref|XP_010517014.1| PREDICTED: zinc finger protein ZAT11-like [Camelina sativa]
Length=182

 Score =   119 bits (298),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 102/174 (59%), Gaps = 24/174 (14%)
 Frame = -2

Query  711  MKRSRE--YAGVEAEAMANCLMLLAH------VGRNssssppsaSKDLCSFQCKTCDKKF  556
            MKR R      ++   +A CLM+LA       +G N +    S   +   F+CKTC+++F
Sbjct  1    MKRERSDFEESIKNLDIAKCLMILAQTSMVKQIGLNQNQHTDSHMSN--RFECKTCNRRF  58

Query  555  PSFQALGGHRASHKKPKLVAPAPGEQESSPEKSK----MHRCSICGLEFAMGQALGGHMR  388
             SFQALGGHRASHKKPKL      E +      K    +H CSICG  F  GQALGGHMR
Sbjct  59   SSFQALGGHRASHKKPKLTTVEQNEVKHLSNNYKGNNHLHECSICGQRFGTGQALGGHMR  118

Query  387  RHRAAM-MKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            RHR++M ++  F       P+   +PVLKR +SSKR+    L+LDLNLTP END
Sbjct  119  RHRSSMKVQPSF-----ICPVVPTMPVLKRCSSSKRV----LSLDLNLTPLEND  163



>ref|XP_009143499.1| PREDICTED: zinc finger protein ZAT11 [Brassica rapa]
 emb|CDX74961.1| BnaA05g07070D [Brassica napus]
Length=180

 Score =   119 bits (298),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 99/168 (59%), Gaps = 14/168 (8%)
 Frame = -2

Query  711  MKRSR---EYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCS--FQCKTCDKKFPSF  547
            MKR R   E +   ++ +A CLM+L+             ++   S  F+CKTC+K+F SF
Sbjct  1    MKRERSEFEESIKMSDDIARCLMILSQTSMVKQVDVNQYTERDTSNRFECKTCNKRFSSF  60

Query  546  QALGGHRASHKKPKLVAPAPGEQESSPEK--SKMHRCSICGLEFAMGQALGGHMRRHRAA  373
            QALGGHRASHKKPKL       +  +     + +H CSIC   F  GQALGGHMRRHR++
Sbjct  61   QALGGHRASHKKPKLSVDQKEVKHVTNNYNGTHIHECSICSQSFGTGQALGGHMRRHRSS  120

Query  372  MMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            +  E  +      P+   +PVLKR +SSKR+    L+LDLNLTP END
Sbjct  121  VTVEPLQT---ISPVNSTVPVLKRCSSSKRV----LSLDLNLTPLEND  161



>ref|XP_009420085.1| PREDICTED: zinc finger protein ZAT12-like [Musa acuminata subsp. 
malaccensis]
Length=178

 Score =   119 bits (297),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 88/152 (58%), Gaps = 17/152 (11%)
 Frame = -2

Query  684  VEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGGHRASHKKPK  505
            +++  MAN LMLL+  G  S             F+CKTC+++FPSFQALGGHRASHKKP+
Sbjct  24   IDSVNMANVLMLLSQGGGGSGGGAEKRDHSGRVFECKTCNRQFPSFQALGGHRASHKKPR  83

Query  504  LVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFENppaaipma  325
            L     G+ +    K ++H CSICGLEFA+GQALGGHMRRHR     EGF +        
Sbjct  84   LGGDGHGQAQGGAAKPRVHECSICGLEFAIGQALGGHMRRHRTT--AEGFGH--------  133

Query  324  maiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
                + ++    +R    G  LDLNL P E D
Sbjct  134  ---GLTEKPPGDRR----GTLLDLNLPPLETD  158



>ref|XP_006345938.1| PREDICTED: zinc finger protein ZAT11-like [Solanum tuberosum]
Length=157

 Score =   118 bits (296),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 93/164 (57%), Gaps = 14/164 (9%)
 Frame = -2

Query  708  KRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGGH  529
            KR RE        MAN L+L +    +  +   ++   +  F+CKTC+++F SFQALGGH
Sbjct  7    KREREGEFKTITTMANYLLLFSRQENHFDTMVNNSPSRV--FECKTCNRQFSSFQALGGH  64

Query  528  RASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFEN  349
            RASHKKP+L+     +   SP K K H CSICGLEF +GQALGGHMRRHR  + +   +N
Sbjct  65   RASHKKPRLMGELNFQLPISPPKPKTHECSICGLEFPIGQALGGHMRRHRGILNENNNKN  124

Query  348  ppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKI  217
                        V+K+  S +      L LDLNL P END L+ 
Sbjct  125  -------IQVHHVVKKLKSPR-----VLCLDLNLPPLENDHLEF  156



>emb|CAA67230.1| zinc finger protein [Arabidopsis thaliana]
Length=174

 Score =   119 bits (297),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 97/155 (63%), Gaps = 20/155 (13%)
 Frame = -2

Query  669  MANCLMLLAH------VGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGGHRASHKKP  508
            +A CLM+LA       +G N  +   ++++    F+CKTC+K+F SFQALGGHRASHKKP
Sbjct  13   IAKCLMILAQTSMVKQIGLNQHTESHTSNQ----FECKTCNKRFSSFQALGGHRASHKKP  68

Query  507  KLVAPAPGEQESSPEK--SKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFENppaai  334
            KL       +  S +   +  H+CSIC   F  GQALGGHMRRHR++M  E    P    
Sbjct  69   KLTVEQKDVKHLSNDYKGNHFHKCSICSQSFGTGQALGGHMRRHRSSMTVE----PSFIS  124

Query  333  pmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            PM  ++PVLKR  SSKRI    L+LDLNLTP END
Sbjct  125  PMIPSMPVLKRCGSSKRI----LSLDLNLTPLEND  155



>ref|NP_181279.1| zinc finger protein ZAT11 [Arabidopsis thaliana]
 sp|Q9SLD4.1|ZAT11_ARATH RecName: Full=Zinc finger protein ZAT11 [Arabidopsis thaliana]
 gb|AAC98070.1| putative C2H2-type zinc finger protein [Arabidopsis thaliana]
 dbj|BAH30418.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC09397.1| zinc finger protein ZAT11 [Arabidopsis thaliana]
Length=178

 Score =   119 bits (297),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 103/171 (60%), Gaps = 22/171 (13%)
 Frame = -2

Query  711  MKRSRE--YAGVEAEAMANCLMLLAH------VGRNssssppsaSKDLCSFQCKTCDKKF  556
            MKR R      ++   +A CLM+LA       +G N  +   ++++    F+CKTC+K+F
Sbjct  1    MKRERSDFEESLKNIDIAKCLMILAQTSMVKQIGLNQHTESHTSNQ----FECKTCNKRF  56

Query  555  PSFQALGGHRASHKKPKLVAPAPGEQESSPEK--SKMHRCSICGLEFAMGQALGGHMRRH  382
             SFQALGGHRASHKKPKL       +  S +   +  H+CSIC   F  GQALGGHMRRH
Sbjct  57   SSFQALGGHRASHKKPKLTVEQKDVKHLSNDYKGNHFHKCSICSQSFGTGQALGGHMRRH  116

Query  381  RAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            R++M  E    P    PM  ++PVLKR  SSKRI    L+LDLNLTP END
Sbjct  117  RSSMTVE----PSFISPMIPSMPVLKRCGSSKRI----LSLDLNLTPLEND  159



>ref|XP_010905716.1| PREDICTED: zinc finger protein ZAT12-like [Elaeis guineensis]
Length=158

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 96/168 (57%), Gaps = 27/168 (16%)
 Frame = -2

Query  711  MKRSREYAGVEAEA------MANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPS  550
            M+R R + G E EA      MAN LMLL+  G   +      S     F+CKTC+++FPS
Sbjct  1    MERFR-FGGAEGEAAESISNMANLLMLLSRGGVEGTDKLAGTSPGRV-FECKTCNRQFPS  58

Query  549  FQALGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAM  370
            FQALGGHRASHKKP+L+    G+ +    K ++H CSICGLEFA+GQALGGHMRRHR   
Sbjct  59   FQALGGHRASHKKPRLM--TDGQLQGGLAKPRVHECSICGLEFAIGQALGGHMRRHRPVA  116

Query  369  MKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDD  226
               G               +++      R+    + LDLNL P+END+
Sbjct  117  RGAGH-------------GLMEDQGEVGRV----VPLDLNLPPSENDN  147



>ref|XP_004306355.1| PREDICTED: zinc finger protein ZAT11-like [Fragaria vesca subsp. 
vesca]
Length=169

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 98/166 (59%), Gaps = 17/166 (10%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLA-HVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALG  535
            MKRSRE    +   + NCLMLL+  VG+  SS          +F CKTC+ +F SFQALG
Sbjct  1    MKRSRE-DDQQTLDLVNCLMLLSKDVGQKGSSPIKKQKTSDRAFACKTCNHEFSSFQALG  59

Query  534  GHRASHKKPKLVA--------PAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHR  379
            GHRAS  +PKLVA               SSP K K H C ICG+EFA+GQALGGHMRRHR
Sbjct  60   GHRASQHQPKLVARNGASDLLQLAQSSPSSPAKPKSHECPICGVEFAIGQALGGHMRRHR  119

Query  378  AAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTP  241
              M+     +  A    A A+PVLK++ SSK +    LNLDLNL P
Sbjct  120  DVMI-----SAAADRGQAAAVPVLKKSNSSKTV--SCLNLDLNLAP  158



>emb|CDY65670.1| BnaCnng48130D [Brassica napus]
Length=179

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 103/171 (60%), Gaps = 21/171 (12%)
 Frame = -2

Query  711  MKRSR-EYA-GVEAEAMANCLMLLA------HVGRNssssppsaSKDLCSFQCKTCDKKF  556
            MKR R EY   ++   +  CLM+L+       +G N  +   ++++    F+CKTC+++F
Sbjct  1    MKRERSEYEESIKNLDIVKCLMILSRTSIVKQIGVNQFTERNTSNR----FECKTCNRRF  56

Query  555  PSFQALGGHRASHKKPKLVAPAPGEQESSPEK--SKMHRCSICGLEFAMGQALGGHMRRH  382
             SFQALGGHRA+HKKPKL       +  +     + MH+CS CG  F  GQALGGHMRRH
Sbjct  57   SSFQALGGHRATHKKPKLTVDEKDVKHFTKNYKGTHMHKCSRCGQSFGTGQALGGHMRRH  116

Query  381  RAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            R++M     E      P+   +PV+KR +SSKR+    L+LDLNLTP END
Sbjct  117  RSSMT---LEPSQRISPVIPTMPVMKRCSSSKRV----LSLDLNLTPLEND  160



>ref|XP_009139386.1| PREDICTED: zinc finger protein ZAT11-like [Brassica rapa]
 emb|CDX76199.1| BnaA04g04630D [Brassica napus]
Length=174

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 79/123 (64%), Gaps = 8/123 (7%)
 Frame = -2

Query  585  FQCKTCDKKFPSFQALGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQA  406
            F+CKTC++KF SFQALGGHRASHKKPKL++    + +    ++ +H+CSIC   F  GQA
Sbjct  45   FECKTCNRKFDSFQALGGHRASHKKPKLMSVEQEQAKHRNNENDVHKCSICSQMFGTGQA  104

Query  405  LGGHMRRHRAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDD  226
            LGGH+RRHRA+M+ E               PV  +  SSKR+    + LDLNLTP END 
Sbjct  105  LGGHIRRHRASMINE----QSVISSKVYTSPVNDQCQSSKRV----MRLDLNLTPLENDL  156

Query  225  LKI  217
            L I
Sbjct  157  LNI  159



>ref|XP_004142087.1| PREDICTED: zinc finger protein ZAT11-like [Cucumis sativus]
 ref|XP_004161684.1| PREDICTED: zinc finger protein ZAT11-like [Cucumis sativus]
 gb|KGN54223.1| hypothetical protein Csa_4G293330 [Cucumis sativus]
Length=162

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 102/163 (63%), Gaps = 17/163 (10%)
 Frame = -2

Query  717  MLMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQAL  538
            M  KR RE    EA  +A  L LL++ G   SS      ++   F+CKTC+++FPSFQAL
Sbjct  1    MAAKRIREQ--FEASDIAKSLTLLSY-GIQESSDLKFQPQNAAVFECKTCNRQFPSFQAL  57

Query  537  GGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEG  358
            GGHRASHK+P+     P  ++++  K K+H C +CG EF+ GQALGGHMRRHR   +   
Sbjct  58   GGHRASHKRPRTSVEEP--KDTADLKQKIHECGLCGQEFSSGQALGGHMRRHRVPPL---  112

Query  357  FENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
                  A+ +A  IPVLKR+ S++ +    L+LDLNLTP END
Sbjct  113  ------AVAVAEKIPVLKRSGSTRVM---CLDLDLNLTPLEND  146



>ref|XP_004495268.1| PREDICTED: zinc finger protein ZAT11-like [Cicer arietinum]
Length=168

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 94/164 (57%), Gaps = 17/164 (10%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKR R    VE   +ANCL+LL+H   +        ++    F+C TC++KF SFQALGG
Sbjct  1    MKRQRNEE-VENINLANCLILLSHPKESKYKKHFGPTE----FECITCNRKFSSFQALGG  55

Query  531  HRASHKKPKLVAP---APGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKE  361
            HRASHKKPKL         +  S   K KMH C ICG EF++GQALGGHMRRHR A+   
Sbjct  56   HRASHKKPKLDTTELKVQAQTLSLWNKPKMHGCYICGKEFSVGQALGGHMRRHRIALN--  113

Query  360  GFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
              E       +   +P+LKR+ S K +      LDLNLTP  ND
Sbjct  114  --EGVSKKKKIVGEVPILKRSNSKKVMC-----LDLNLTPLHND  150



>ref|XP_007144473.1| hypothetical protein PHAVU_007G159000g [Phaseolus vulgaris]
 gb|ESW16467.1| hypothetical protein PHAVU_007G159000g [Phaseolus vulgaris]
Length=153

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 81/122 (66%), Gaps = 15/122 (12%)
 Frame = -2

Query  585  FQCKTCDKKFPSFQALGGHRASHKKPKLVAPAPGEQE---SSPEKSKMHRCSICGLEFAM  415
            FQCKTC++KF SFQALGGH ASHKKPKL     GE+    S   K K H CSICG EF++
Sbjct  28   FQCKTCNRKFSSFQALGGHLASHKKPKL----DGEEAKDLSLGRKPKAHECSICGQEFSL  83

Query  414  GQALGGHMRRHRAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAE  235
            GQALGGHMR+H+ +M      N   +  +    P+LKR+ SSKR+    L LDLNLTP E
Sbjct  84   GQALGGHMRKHKGSM------NGGLSSSVIPKAPLLKRSNSSKRV--MCLELDLNLTPLE  135

Query  234  ND  229
            ND
Sbjct  136  ND  137



>ref|XP_009771157.1| PREDICTED: zinc finger protein ZAT11-like [Nicotiana sylvestris]
Length=177

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 89/162 (55%), Gaps = 20/162 (12%)
 Frame = -2

Query  678  AEAMANCLMLLAHVGRNssssppsaSKDLCS---FQCKTCDKKFPSFQALGGHRASHKKP  508
               MAN LML ++   +          +  +   F+CKTC++KF SFQALGGHRASHKKP
Sbjct  21   VTTMANFLMLFSNQSNDYHFDNIMKYNNSTTNRVFECKTCNRKFSSFQALGGHRASHKKP  80

Query  507  KLVAPAPGEQESSPE----KSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFENppa  340
            +L+           +    K K H CSICGLEF +GQALGGHMRRHRA M  E  ++   
Sbjct  81   RLINMRELNNMQLFQLPNIKPKTHECSICGLEFGLGQALGGHMRRHRAVMNNEKIQD---  137

Query  339  aipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIE  214
                   + + +    SKR+    L LDLNLTP END L+  
Sbjct  138  ------PLRIPQVVKKSKRV----LCLDLNLTPLENDHLEFN  169



>gb|KHN37328.1| Zinc finger protein ZAT11 [Glycine soja]
Length=172

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 102/180 (57%), Gaps = 27/180 (15%)
 Frame = -2

Query  669  MANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGGHRASHKKPKLVAPA  490
            MAN LMLL+    N ++       D   F+CKTC+++F SFQALGGH ASHKKP+L+  +
Sbjct  1    MANYLMLLSRTTTNLNT------SDNRVFECKTCNRRFTSFQALGGHCASHKKPRLMGES  54

Query  489  PGEQ--ESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRA---------------AMMKE  361
             G+     SP K K H CSICGLEFA+GQALGGHMRRHRA               ++M  
Sbjct  55   DGQVLIHGSPPKPKTHECSICGLEFAIGQALGGHMRRHRAAAAAASNRNMHTTINSLMSS  114

Query  360  GFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPATPVLRC  181
            G  +  + +   +   +  +   +KRI    L  DLNLTP END   ++    ATP++ C
Sbjct  115  GSSSGGSTVDNTLPPNMNHKVNDTKRI----LFPDLNLTPLENDLEFLKIGRQATPLVHC  170



>ref|XP_010504128.1| PREDICTED: zinc finger protein ZAT11-like [Camelina sativa]
Length=176

 Score =   117 bits (292),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 78/119 (66%), Gaps = 10/119 (8%)
 Frame = -2

Query  585  FQCKTCDKKFPSFQALGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQA  406
            F+CKTC++KF SFQALGGHRASHKKPK+       +  + E + MH+CSIC   F  GQA
Sbjct  49   FECKTCNRKFDSFQALGGHRASHKKPKMSVDQEQVKHRNNE-NDMHKCSICDQIFGTGQA  107

Query  405  LGGHMRRHRAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            LGGHMR+HRA+MM    E       +  + PVL R +SSK+I      LDLNLTP END
Sbjct  108  LGGHMRKHRASMMT---EQSVIPSSLVYSRPVLNRCSSSKKI------LDLNLTPLEND  157



>ref|XP_008369844.1| PREDICTED: zinc finger protein ZAT11-like [Malus domestica]
 ref|XP_008345441.1| PREDICTED: zinc finger protein ZAT11-like [Malus domestica]
Length=185

 Score =   117 bits (292),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 102/166 (61%), Gaps = 23/166 (14%)
 Frame = -2

Query  687  GVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGGHRASHKKP  508
            G++   MA CLMLL+       +   + S D+  F+CKTC++KF SFQALGGH+ASHK+ 
Sbjct  13   GLKGLDMAKCLMLLSC---GMETKFKTCSNDV--FECKTCNRKFTSFQALGGHKASHKRS  67

Query  507  KLVAP-----APGEQESSPEKS-------KMHRCSICGLEFAMGQALGGHMRRHRAAMMK  364
            +++          E+E   +KS       K H+CSICGLEF MGQALGGHMRRHRA+ M 
Sbjct  68   RILMSRDDEBCKDEREKGSDKSMVMNKKAKTHKCSICGLEFGMGQALGGHMRRHRASNMD  127

Query  363  -EGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
              GF    A   +   IPVL R +SSKR+    L +DLNLTP END
Sbjct  128  MAGFS--YAPSAVTSKIPVLTR-SSSKRV--MSLEMDLNLTPLEND  168



>ref|XP_010669838.1| PREDICTED: zinc finger protein ZAT12-like [Beta vulgaris subsp. 
vulgaris]
Length=186

 Score =   117 bits (292),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 111/189 (59%), Gaps = 19/189 (10%)
 Frame = -2

Query  717  MLMKRSREYAGVE-AEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQA  541
            M +KRSRE   +E   AMAN L+LL+    +++  P S+S+    ++CKTC+++F SFQA
Sbjct  1    MAIKRSREEIELERTIAMANYLILLSKTSNSTTVEPTSSSR---VYECKTCNRQFASFQA  57

Query  540  LGGHRASHKKPKLVAPA----PGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAA  373
            LGGHRASHKKPK         P E+  S ++SK H CSICGLEF +GQALGGHMRRHRAA
Sbjct  58   LGGHRASHKKPKTHYTNDYNNPSEENVS-KRSKTHGCSICGLEFPIGQALGGHMRRHRAA  116

Query  372  MMKE----------GFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDL  223
            ++              E   ++  ++  +  + ++ S        + LDLNLTP EN  L
Sbjct  117  LIGSQLPCTSRPTLSLELELSSHNVSDELTGVIKSRSYSDDHKSVMCLDLNLTPLENGLL  176

Query  222  KIESTTPAT  196
            ++    P+ 
Sbjct  177  EVRKFAPSV  185



>ref|XP_007144472.1| hypothetical protein PHAVU_007G158900g [Phaseolus vulgaris]
 gb|ESW16466.1| hypothetical protein PHAVU_007G158900g [Phaseolus vulgaris]
Length=160

 Score =   116 bits (290),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 97/164 (59%), Gaps = 23/164 (14%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDL---CSFQCKTCDKKFPSFQA  541
            MKR RE    E   +ANCL+LL+H             ++L     ++C+TC++KF SFQA
Sbjct  1    MKRRRE----ENVDLANCLILLSH-------PREVKPQNLLGPVEYECRTCNRKFSSFQA  49

Query  540  LGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKE  361
            LGGHRASHK PK       +      K K H CSICG EF++GQALGGHM+RHR + + E
Sbjct  50   LGGHRASHKTPKQDLKEEDKIVRLENKPKRHECSICGEEFSLGQALGGHMKRHRIS-LNE  108

Query  360  GFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            GF +      + + +P+LKR+ S K I      LDLNLTP +ND
Sbjct  109  GFSS---INQVVVKVPILKRSNSRKVIC-----LDLNLTPLQND  144



>ref|XP_008448374.1| PREDICTED: zinc finger protein ZAT11-like [Cucumis melo]
Length=147

 Score =   115 bits (289),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 83/131 (63%), Gaps = 5/131 (4%)
 Frame = -2

Query  585  FQCKTCDKKFPSFQALGGHRASHKKPKLVAPAPGEQESSPE-KSKMHRCSICGLEFAMGQ  409
            F CKTC+++F SFQALGGHRASH+KPKL   A G   SS + K+K+H CSICG+EF +GQ
Sbjct  17   FVCKTCNREFSSFQALGGHRASHRKPKLSISADGVFNSSNQVKTKVHECSICGVEFPVGQ  76

Query  408  ALGGHMRRHRAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            ALGGHMRRHR +       N        M  PV+   +      G G++LDLNLTP END
Sbjct  77   ALGGHMRRHRNSSPPPPVVN----DHPQMGQPVVSDESDCDCGVGGGVDLDLNLTPLEND  132

Query  228  DLKIESTTPAT  196
             ++++   P  
Sbjct  133  LVRLQLMAPPV  143



>ref|XP_010509338.1| PREDICTED: zinc finger protein ZAT11 [Camelina sativa]
Length=182

 Score =   116 bits (291),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 102/174 (59%), Gaps = 24/174 (14%)
 Frame = -2

Query  711  MKRSRE--YAGVEAEAMANCLMLLAH------VGRNssssppsaSKDLCSFQCKTCDKKF  556
            MKR R      ++   +A CLM+LA       +G N +    S   +   F+CKTC+++F
Sbjct  1    MKRERSDFEESIKNLDIAKCLMILAQTSMVKQIGLNQNQHTDSHMSN--RFECKTCNRRF  58

Query  555  PSFQALGGHRASHKKPKLVAPAPGEQESSPEKSK----MHRCSICGLEFAMGQALGGHMR  388
             SFQALGGHRASHKKPKL      + +      +    +H CSICG  F  GQALGGHMR
Sbjct  59   SSFQALGGHRASHKKPKLTTVEQKDVKHLSNNYRGNNHLHECSICGQSFGTGQALGGHMR  118

Query  387  RHRAAM-MKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            RHR++M ++  F       P+   +PVLKR +SSKR+    L+LDLNLTP END
Sbjct  119  RHRSSMKVQPSF-----ICPVVPTMPVLKRCSSSKRV----LSLDLNLTPLEND  163



>ref|XP_008447526.1| PREDICTED: zinc finger protein ZAT11 [Cucumis melo]
Length=162

 Score =   116 bits (290),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 103/163 (63%), Gaps = 17/163 (10%)
 Frame = -2

Query  717  MLMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQAL  538
            M  KR RE  G     +A  L LL++ G   SS P    +++  F+CKTC+++FPSFQAL
Sbjct  1    MAAKRIREEFGTSD--IAKSLTLLSY-GIQESSDPKFQPQNVALFECKTCNRQFPSFQAL  57

Query  537  GGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEG  358
            GGHRASHK+P+     P  ++++  K K+H C +CG EF+ GQALGGHMRRHR   +   
Sbjct  58   GGHRASHKRPRTSVEEP--KDTADLKQKIHECGLCGQEFSSGQALGGHMRRHRVPPL---  112

Query  357  FENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
                  A+ +A  IPVLKR+ S++ +    L+LDLNLTP END
Sbjct  113  ------AVAVAEKIPVLKRSGSTRVMC---LDLDLNLTPLEND  146



>gb|KHN02411.1| Zinc finger protein ZAT11-like protein [Glycine soja]
Length=155

 Score =   115 bits (289),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 101/159 (64%), Gaps = 11/159 (7%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLA-HVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALG  535
            MKR R+  G E+  +A CL+L +  +  N +      + +   F+CKTC +KF SFQALG
Sbjct  4    MKRHRDNEGSESLDLAKCLVLFSCPIESNKAQQKGFGAVE---FECKTCSRKFSSFQALG  60

Query  534  GHRASHKKPKLVAPAPGEQE---SSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMK  364
            GHRASHK+ KL      EQ    S   K KMH CSICGLEF++GQALGGHMR+HRAA + 
Sbjct  61   GHRASHKRQKLEGEELKEQAKTLSLWNKPKMHECSICGLEFSLGQALGGHMRKHRAA-LN  119

Query  363  EGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNL  247
            EGF   P+   +   IPVLKR+ S++ +    L+L+L+L
Sbjct  120  EGFPIIPSIDQVIAKIPVLKRSNSTRVMC---LDLELHL  155



>ref|XP_002879670.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55929.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=178

 Score =   116 bits (291),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 98/167 (59%), Gaps = 14/167 (8%)
 Frame = -2

Query  711  MKRSRE--YAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCS--FQCKTCDKKFPSFQ  544
            MKR R      ++   +A CLM+LA             ++   S  F+CKTC+++F SFQ
Sbjct  1    MKRERSDFEESIKNLDIAKCLMILAQTSMVKQIGLSQHTESHTSNRFECKTCNRRFSSFQ  60

Query  543  ALGGHRASHKKPKLVAPAPGEQ--ESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAM  370
            ALGGHRASHKKPKL       +   ++ + +  H CSICG  F  GQALGGHMRRHR++M
Sbjct  61   ALGGHRASHKKPKLTLEQKDVKPLSNNYKGNHTHECSICGQSFGTGQALGGHMRRHRSSM  120

Query  369  MKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
              E    P    P+   +PVLKR +SSKR+    L LDLNLTP END
Sbjct  121  TVE----PSFISPVIPTMPVLKRCSSSKRV----LCLDLNLTPLEND  159



>ref|XP_004147699.1| PREDICTED: zinc finger protein ZAT11-like [Cucumis sativus]
 ref|XP_004173932.1| PREDICTED: zinc finger protein ZAT11-like [Cucumis sativus]
 gb|KGN50533.1| hypothetical protein Csa_5G180920 [Cucumis sativus]
Length=181

 Score =   116 bits (290),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 95/171 (56%), Gaps = 17/171 (10%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCS-----FQCKTCDKKFPSF  547
            MKR RE   +    MANCLMLL+   RN++      S    S     F+CKTC+++F SF
Sbjct  1    MKRERELESITT--MANCLMLLS---RNTAPDHHFESSTSSSSPNRVFECKTCNRQFSSF  55

Query  546  QALGGHRASHKKPKLVAPAPGEQESS-----PEKSKMHRCSICGLEFAMGQALGGHMRRH  382
            QALGGHRASHKKP++V    G  + S     P K K H CSICGLEFA+GQALGGHMRRH
Sbjct  56   QALGGHRASHKKPRIVGGDGGNSDGSSSQGSPTKPKTHECSICGLEFAIGQALGGHMRRH  115

Query  381  RAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            RA  +                        S+    G  L LDLNLTP+END
Sbjct  116  RATTLLNDARLLTNHPRSPPPQQPPVVKKSNGG--GRILCLDLNLTPSEND  164



>ref|XP_009402337.1| PREDICTED: zinc finger protein ZAT12-like [Musa acuminata subsp. 
malaccensis]
Length=171

 Score =   115 bits (289),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 97/178 (54%), Gaps = 31/178 (17%)
 Frame = -2

Query  684  VEAEAMANCLMLLAH--VGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGGHRASHKK  511
            +E+  +AN L+LL+    G        S    +  F CKTC+++FPSFQALGGHRASHKK
Sbjct  13   MESVNVANVLVLLSRGSSGGEEIIDISSRQSPVRVFACKTCNRQFPSFQALGGHRASHKK  72

Query  510  PKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFENppaaip  331
            P+L A   G+  +   K ++H CS+CGLEFA+GQALGGHMRRHRAA  +           
Sbjct  73   PRLAADRQGQVHTELAKPRVHECSVCGLEFAIGQALGGHMRRHRAAAPQ-----------  121

Query  330  mamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND--------DLKIESTTPATPVLRC  181
                  +  +    KR     L LDLN+ P+E D          ++  TTP+  VL C
Sbjct  122  -----ALTGKKPEDKRT----LWLDLNMPPSEGDGDYRKKIFGFELADTTPSM-VLDC  169



>ref|XP_010431330.1| PREDICTED: zinc finger protein ZAT11-like [Camelina sativa]
Length=190

 Score =   116 bits (290),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 79/119 (66%), Gaps = 10/119 (8%)
 Frame = -2

Query  585  FQCKTCDKKFPSFQALGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQA  406
            F+CKTC++KF SFQALGGHRASHKKPKL       +  + E + MH+CSIC   F  GQA
Sbjct  50   FECKTCNRKFDSFQALGGHRASHKKPKLSVDQEQVKHRNNE-NDMHKCSICDQIFGTGQA  108

Query  405  LGGHMRRHRAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            LGGHMR+HRA+MM    E      P+  + PVL R +SSK+I      LDLNLTP END
Sbjct  109  LGGHMRKHRASMMT---EQSVIPSPLVYSRPVLNRCSSSKKI------LDLNLTPLEND  158



>ref|XP_010515858.1| PREDICTED: zinc finger protein ZAT11-like [Camelina sativa]
Length=176

 Score =   115 bits (289),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 79/119 (66%), Gaps = 10/119 (8%)
 Frame = -2

Query  585  FQCKTCDKKFPSFQALGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQA  406
            F+CKTC++KF SFQALGGHRASHKKPK+       +  + E + MH+CSIC   F  GQA
Sbjct  49   FECKTCNRKFDSFQALGGHRASHKKPKMSVDQEQVKHRNNE-NDMHKCSICDQIFGTGQA  107

Query  405  LGGHMRRHRAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            LGGHMR+HRA+MM    E      P+  + PVL R +SSK+I      LDLNLTP END
Sbjct  108  LGGHMRKHRASMMT---EQSVIPSPLVYSRPVLNRCSSSKKI------LDLNLTPLEND  157



>ref|NP_001236732.1| uncharacterized protein LOC100500607 [Glycine max]
 gb|ACU15733.1| unknown [Glycine max]
Length=155

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 101/159 (64%), Gaps = 11/159 (7%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLA-HVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALG  535
            MKR R+  G E+  +A CL+L +  +  N +      + +   F+CKTC +KF SFQALG
Sbjct  4    MKRHRDNEGSESLDLAKCLVLFSCPIESNKAQQKGFGAVE---FECKTCSRKFSSFQALG  60

Query  534  GHRASHKKPKLVAPAPGEQE---SSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMK  364
            GHRASHK+ KL      EQ    S   K +MH CSICGLEF++GQALGGHMR+HRAA + 
Sbjct  61   GHRASHKRQKLEGEELKEQAKTLSLWNKPQMHECSICGLEFSLGQALGGHMRKHRAA-LN  119

Query  363  EGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNL  247
            EGF   P+   +   IPVLKR+ S++ +    L+L+L+L
Sbjct  120  EGFPIIPSIDQVIAKIPVLKRSNSTRVMC---LDLELHL  155



>ref|XP_008461644.1| PREDICTED: zinc finger protein ZAT12-like [Cucumis melo]
Length=184

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 99/174 (57%), Gaps = 20/174 (11%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCS-----FQCKTCDKKFPSF  547
            MKR R+   +    MANCLMLL+   RN+++    +S    S     F+CKTC+++F SF
Sbjct  1    MKRERDLESITT--MANCLMLLS---RNTAADHFESSSTNSSSPNRVFECKTCNRQFSSF  55

Query  546  QALGGHRASHKKPKLVAPAPGEQESS-----PEKSKMHRCSICGLEFAMGQALGGHMRRH  382
            QALGGHRASHKKP++V    G  + S     P K K H CSICGLEFA+GQALGGHMRRH
Sbjct  56   QALGGHRASHKKPRIVGGDGGNSDGSSSQGSPTKPKTHECSICGLEFAIGQALGGHMRRH  115

Query  381  RAAMMKEG---FENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            RA  +        N P                S+    G  L LDLNLTP+END
Sbjct  116  RATTLLNDARLLTNHPRRSLSPPPPKPPVVKKSNGG--GRILCLDLNLTPSEND  167



>ref|XP_009338354.1| PREDICTED: zinc finger protein ZAT12-like [Pyrus x bretschneideri]
Length=238

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 93/154 (60%), Gaps = 23/154 (15%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKRSR+   ++   + NCLMLL+    +S     +  KD   F CKTC+++FPSFQALGG
Sbjct  68   MKRSRQDETLD---LVNCLMLLSREPDSSPIKHENTKKDRV-FVCKTCNREFPSFQALGG  123

Query  531  HRASHKKPKL----------VAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRH  382
            HRASHKKPKL          +A +PG    S  K K H C ICGLEFA+GQALGGHMRRH
Sbjct  124  HRASHKKPKLMPGGAANLLHLAQSPG----SLVKPKTHECPICGLEFAIGQALGGHMRRH  179

Query  381  RAAMMKEGFENppaaipmamaiPVLKRTTSSKRI  280
            R  +              + A+PVLK++ SSKR+
Sbjct  180  RDVIQAAAVRT-----QASPAMPVLKKSNSSKRV  208



>emb|CDP09001.1| unnamed protein product [Coffea canephora]
Length=145

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 91/149 (61%), Gaps = 16/149 (11%)
 Frame = -2

Query  669  MANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGGHRASHKKPKLVAPA  490
            MANCLMLL+++ + +SS P         F CKTC+K+F SFQALGGHRASHK+ +LVA A
Sbjct  1    MANCLMLLSNMAKTTSSPPSLDR----VFTCKTCNKQFSSFQALGGHRASHKRTRLVA-A  55

Query  489  PG--EQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFENppaaipmamai  316
             G  +Q  SP K K H CSICGLEF +GQALGGHMRRHR         N   A   +   
Sbjct  56   DGLHDQNHSPAKPKTHECSICGLEFPLGQALGGHMRRHR---------NDGTAGDKSEET  106

Query  315  PVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
                + +SS       L LDLNLTP EN+
Sbjct  107  QSGSQKSSSHSDSHRALLLDLNLTPRENE  135



>gb|KHN21982.1| Zinc finger protein ZAT8 [Glycine soja]
Length=144

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 92/157 (59%), Gaps = 18/157 (11%)
 Frame = -2

Query  669  MANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGGHRASHKKPKLVAPA  490
            MA+CLMLL  V    + S          F+CKTC++KF SFQALGGHRASHKK KL+A  
Sbjct  1    MASCLMLLTKVSDTETPSRKRVLSG-GDFKCKTCNRKFQSFQALGGHRASHKKLKLMA--  57

Query  489  PGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFENppaaipmamaiPV  310
                  S    KMH+C ICG+EFA+GQALGGHMR+HRA+ + +G               V
Sbjct  58   -SNLSCSTVTQKMHQCPICGIEFAIGQALGGHMRKHRAS-LNDGL---------ITHDHV  106

Query  309  LKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPA  199
            +  ++ +KR+    L LDLNL P EN DL +   TP 
Sbjct  107  VPTSSGTKRL---RLCLDLNLAPYEN-DLNLNLRTPT  139



>emb|CDY30857.1| BnaC04g27120D [Brassica napus]
Length=167

 Score =   114 bits (285),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 82/123 (67%), Gaps = 15/123 (12%)
 Frame = -2

Query  585  FQCKTCDKKFPSFQALGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQA  406
            F+CKTC++KF SFQALGGHRASHKKPKLV+    EQE +  K  +H+CSICG  F  GQA
Sbjct  45   FECKTCNRKFDSFQALGGHRASHKKPKLVSV---EQEQA--KHTVHKCSICGQMFGTGQA  99

Query  405  LGGHMRRHRAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDD  226
            LGGHMR+HR +M+    E    +  +    PV+    SSKR+    + LDLNLTP END 
Sbjct  100  LGGHMRKHRESMIN---EQSVISSMVCSTSPVM---NSSKRV----MRLDLNLTPLENDL  149

Query  225  LKI  217
            + I
Sbjct  150  VYI  152



>ref|XP_006295072.1| hypothetical protein CARUB_v10024141mg [Capsella rubella]
 gb|EOA27970.1| hypothetical protein CARUB_v10024141mg [Capsella rubella]
Length=183

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 103/174 (59%), Gaps = 23/174 (13%)
 Frame = -2

Query  711  MKRSRE--YAGVEAEAMANCLMLLAH------VGRNssssppsaSKDLCSFQCKTCDKKF  556
            MKR R      ++   +A CLM+LA       +  N +    S + +   F+CKTC+K+F
Sbjct  1    MKRVRSDFEESIKNLDIAKCLMILAQTSMANQISLNQNQHTESHTSN--RFECKTCNKRF  58

Query  555  PSFQALGGHRASHKKPKLVAPAPGEQE-----SSPEKSKMHRCSICGLEFAMGQALGGHM  391
             SFQALGGHRASHKKPKL      +++      + + +  H CSICG  F  GQALGGHM
Sbjct  59   SSFQALGGHRASHKKPKLTTVDVEQKDVKHLSYNYKGNHSHECSICGQSFGTGQALGGHM  118

Query  390  RRHRAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            RRHR+++  E    P    P+   +PVLKR +SSKR+    L+LDLNLTP END
Sbjct  119  RRHRSSIKVE----PSFICPVIPTMPVLKRCSSSKRV----LSLDLNLTPLEND  164



>ref|NP_190928.1| C2H2-type zinc finger protein [Arabidopsis thaliana]
 emb|CAB67667.1| zinc finger-like protein [Arabidopsis thaliana]
 gb|ABN04782.1| At3g53600 [Arabidopsis thaliana]
 dbj|BAH30486.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE79115.1| C2H2-type zinc finger protein [Arabidopsis thaliana]
Length=175

 Score =   114 bits (285),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 76/119 (64%), Gaps = 11/119 (9%)
 Frame = -2

Query  585  FQCKTCDKKFPSFQALGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQA  406
            F+CKTC++KF SFQALGGHRASHKKPKL+      +  + E + MH+C+IC   F  GQA
Sbjct  49   FECKTCNRKFDSFQALGGHRASHKKPKLIVDQEQVKHRNKE-NDMHKCTICDQMFGTGQA  107

Query  405  LGGHMRRHRAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            LGGHMR+HR +M+ E          +  + PV  R +SSK I      LDLNLTP END
Sbjct  108  LGGHMRKHRTSMITE----QSIVPSVVYSRPVFNRCSSSKEI------LDLNLTPLEND  156



>ref|XP_004497300.1| PREDICTED: zinc finger protein ZAT11-like [Cicer arietinum]
Length=199

 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 76/196 (39%), Positives = 99/196 (51%), Gaps = 31/196 (16%)
 Frame = -2

Query  714  LMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALG  535
            +MKR RE   +   +MA  LMLL+H          S++ +   F+CKTC ++F SFQALG
Sbjct  1    MMKREREGENINITSMAKYLMLLSHGSEFDHEKNYSSNLNNRVFECKTCKRQFSSFQALG  60

Query  534  GHRASHKKPKLVAPAPGEQESSPEKS---------KMHRCSICGLEFAMGQALGGHMRRH  382
            GHRASHKKP+L+     + +     S         K H CSICGLEFA+GQALGGHMRRH
Sbjct  61   GHRASHKKPRLMEITSSDDQVLHHDSIVATTTTKVKTHECSICGLEFAIGQALGGHMRRH  120

Query  381  RAAMMKEGFENppa---------------aipmamaiPVLKRTTSSKRIFGFGLNLDLNL  247
            R    +    N                  +         +K+  + + +F     LDLNL
Sbjct  121  RRKEQRANNSNENMHTFMTNTSNSSSSGCSTIDNTNSENMKKGNTKRFLF-----LDLNL  175

Query  246  TPAEND--DLKIESTT  205
            TP END   LKI  +T
Sbjct  176  TPLENDLKFLKIGQST  191



>ref|XP_004148235.1| PREDICTED: zinc finger protein ZAT11-like [Cucumis sativus]
 gb|KGN47359.1| hypothetical protein Csa_6G303740 [Cucumis sativus]
Length=139

 Score =   112 bits (281),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 80/128 (63%), Gaps = 8/128 (6%)
 Frame = -2

Query  585  FQCKTCDKKFPSFQALGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQA  406
            F CKTC+++F SFQALGGHRASH+KPKL         S+  K+K H CSICG+EF +GQA
Sbjct  14   FVCKTCNREFSSFQALGGHRASHRKPKLSMSGDALCNSNQNKTKAHECSICGVEFPVGQA  73

Query  405  LGGHMRRHRAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDD  226
            LGGHMRRHR         + P +  M M    +   + S    G G++LDLNLTP END 
Sbjct  74   LGGHMRRHR--------NSSPPSQAMIMTAQPVSDESDSDCGVGGGVDLDLNLTPLENDL  125

Query  225  LKIESTTP  202
            ++++   P
Sbjct  126  VRLQLMAP  133



>ref|XP_009416690.1| PREDICTED: zinc finger protein ZAT11-like [Musa acuminata subsp. 
malaccensis]
Length=163

 Score =   113 bits (283),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 77/119 (65%), Gaps = 16/119 (13%)
 Frame = -2

Query  585  FQCKTCDKKFPSFQALGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQA  406
            F+CKTC+++F SFQALGGHRASHKK +L A   G  E+  +K K+H+CSICG EFA+GQA
Sbjct  54   FECKTCNRQFSSFQALGGHRASHKKSRLAAGDHGRAEAVADKPKVHQCSICGQEFALGQA  113

Query  405  LGGHMRRHRAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            LGGHMRRHR     EGF +            + ++ T   R    G+ LDLNL P EN+
Sbjct  114  LGGHMRRHRTTT--EGFVH-----------SLAEKKTGDDR---GGMFLDLNLPPLENE  156



>ref|XP_008457541.1| PREDICTED: zinc finger protein ZAT12-like [Cucumis melo]
Length=159

 Score =   113 bits (282),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 95/171 (56%), Gaps = 27/171 (16%)
 Frame = -2

Query  714  LMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALG  535
             MKR RE    EA  M +CL  +    R +++    + K    F CKTC+++F SFQALG
Sbjct  10   FMKRERE-GEFEALDMVDCLSKVEEPWRKNTAPAADSGK---VFVCKTCNREFSSFQALG  65

Query  534  GHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGF  355
            GHRASHKKP        +    P K K H C ICGL F MGQALGGHMRRHR +      
Sbjct  66   GHRASHKKPNF-----KDANGPPTKPKAHDCPICGLHFPMGQALGGHMRRHRTS------  114

Query  354  ENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTP  202
                       A  VL+++   ++  GFG  LDLNLTP EN +LK++ +TP
Sbjct  115  --------TTTAAAVLEKSDGGEKR-GFG--LDLNLTPIEN-NLKLQLSTP  153



>gb|KHN23143.1| Zinc finger protein ZAT11 [Glycine soja]
Length=157

 Score =   113 bits (282),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 81/133 (61%), Gaps = 18/133 (14%)
 Frame = -2

Query  585  FQCKTCDKKFPSFQALGGHRASHKKPKLVAPAPGEQ--ESSPEKSKMHRCSICGLEFAMG  412
            F+CKTC+++F SFQALGGHRASHKKP+L+  +  +     SP K K H CSICGLEFA+G
Sbjct  18   FECKTCNRRFASFQALGGHRASHKKPRLMGESDSQVLIHGSPPKPKTHECSICGLEFAIG  77

Query  411  QALGGHMRRHRAAMMKEGFENppaaipmamaiP------------VLKRTTSSKRIFGFG  268
            QALGGHMRRHRAA    G  +      ++ +              +  +  ++KR+    
Sbjct  78   QALGGHMRRHRAAAASNGNMHTTINSWLSSSNSGGSTVDNTLPPNMNNKANNTKRV----  133

Query  267  LNLDLNLTPAEND  229
            L  DLNLTP END
Sbjct  134  LFPDLNLTPLEND  146



>ref|XP_003520631.1| PREDICTED: zinc finger protein ZAT11-like [Glycine max]
Length=159

 Score =   113 bits (282),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 94/172 (55%), Gaps = 22/172 (13%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            MKR  E    E+  M  C+ + + +  + +       +   +F+CKTC++KF SFQALGG
Sbjct  1    MKRRIENEEAESTVMEVCMKMFSELAGDINVQKSPTQE---AFECKTCNRKFSSFQALGG  57

Query  531  HRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMM-KEGF  355
            HRASHK+PKL       ++SS  K K+H CSICGL F++GQALGGHMR+H  ++   E F
Sbjct  58   HRASHKRPKL-------EDSSVGKPKIHECSICGLGFSLGQALGGHMRKHTESINGNESF  110

Query  354  ENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND-DLKIESTTP  202
                    +  +     RT          + LDLNLTP END     E TTP
Sbjct  111  SFSSINQVVVASSSSSART----------MCLDLNLTPLENDLKFLFEITTP  152



>ref|XP_010541384.1| PREDICTED: zinc finger protein ZAT12-like [Tarenaya hassleriana]
Length=161

 Score =   112 bits (281),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 93/168 (55%), Gaps = 15/168 (9%)
 Frame = -2

Query  711  MKRSREYAGVEAE-AMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALG  535
            M+R  E   VE +   ANCLMLL+ VG+N              F C+TC K+F SFQALG
Sbjct  1    MERRSEIQRVEEDDTAANCLMLLSRVGQNDVVERRV-------FTCRTCMKEFTSFQALG  53

Query  534  GHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGF  355
            GHRASHKKP    P   + +S P+ +  H C ICGLEF MGQALGGHMRRHR      G 
Sbjct  54   GHRASHKKP---IPHHHDTKSKPKTASSHSCPICGLEFPMGQALGGHMRRHRH---NNGG  107

Query  354  ENppaaipmamaiPVLKRTTS-SKRIFGFGLNLDLNLTPAENDDLKIE  214
                    +   + +LKR+TS  KR+     N  +    AEN +LK+E
Sbjct  108  GALITRALLPETMVMLKRSTSGGKRVSCLDFNSAMAAAAAENLNLKLE  155



>ref|XP_010097386.1| Zinc finger protein ZAT11 [Morus notabilis]
 gb|EXB67892.1| Zinc finger protein ZAT11 [Morus notabilis]
Length=183

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 85/132 (64%), Gaps = 13/132 (10%)
 Frame = -2

Query  585  FQCKTCDKKFPSFQALGGHRASHKKPKLVAPAPGEQ-ESSPEKS---KMHRCSICGLEFA  418
            F+CKTC+++F SFQALGGHRASH K ++      E  ++SP KS   K H CSICG+ F+
Sbjct  43   FECKTCNRRFSSFQALGGHRASHNKRRMTVDDHHESAKTSPAKSSLPKKHECSICGVVFS  102

Query  417  MGQALGGHMRRHRAAMMKEG-----FENppaaipmamaiPVLKRTTSSKRIFGFGLNLDL  253
            MGQALGGHMRRH+A M  +G       +    + ++    VLKR+ SS ++      LDL
Sbjct  103  MGQALGGHMRRHKAIMEMQGSFADIMPHHHHDVVVSKTPVVLKRSNSSVKV---SWTLDL  159

Query  252  NLTPAENDDLKI  217
            NLTP EN DLKI
Sbjct  160  NLTPLEN-DLKI  170



>ref|XP_003537203.1| PREDICTED: zinc finger protein ZAT11-like [Glycine max]
Length=179

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/168 (46%), Positives = 98/168 (58%), Gaps = 8/168 (5%)
 Frame = -2

Query  723  MTMLMKRSREYAGVEAE-AMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSF  547
            M  ++KR  E    E    +A  LM L+ V + S+            F+CKTC++KF SF
Sbjct  1    MVAILKRQGENESEETIIGLAKSLMQLSRVQQQSNKPLLKTFSP-TEFECKTCNRKFSSF  59

Query  546  QALGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMM  367
            QALGGHRASHKKPK  A    E+     K KMH CSICG+EF++GQALGGHMR+HR A+ 
Sbjct  60   QALGGHRASHKKPKFEAEELKEEAKK-TKPKMHECSICGMEFSLGQALGGHMRKHRGAIS  118

Query  366  KEGFENppaaipmamaiP--VLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            +    N   +          VLKR ++SKR+    L +DLNLTP END
Sbjct  119  ENDNNNEALSSIKQAIAKAPVLKR-SNSKRV--MCLEMDLNLTPLEND  163



>ref|XP_006590993.1| PREDICTED: zinc finger protein ZAT11-like [Glycine max]
Length=144

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 91/157 (58%), Gaps = 18/157 (11%)
 Frame = -2

Query  669  MANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGGHRASHKKPKLVAPA  490
            MA+CLMLL  V    + S          F+CKTC++KF SFQALGGHRASHKK KL+A  
Sbjct  1    MASCLMLLTKVSDTETPSRKRVLSG-GDFKCKTCNRKFQSFQALGGHRASHKKLKLMA--  57

Query  489  PGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFENppaaipmamaiPV  310
                  S    KMH+C ICG+EF +GQALGGHMR+HRA+ + +G               V
Sbjct  58   -SNLSCSTVTQKMHQCPICGIEFGIGQALGGHMRKHRAS-LNDGL---------ITHDHV  106

Query  309  LKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPA  199
            +  ++ +KR+    L LDLNL P EN DL +   TP 
Sbjct  107  VPTSSGTKRL---RLCLDLNLAPYEN-DLNLNLRTPT  139



>ref|XP_002876215.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52474.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=175

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 77/119 (65%), Gaps = 11/119 (9%)
 Frame = -2

Query  585  FQCKTCDKKFPSFQALGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQA  406
            F+CKTC++KF SFQALGGHRASHKKPKL+      +  + E + MH+C+IC   F  GQA
Sbjct  49   FECKTCNRKFDSFQALGGHRASHKKPKLIVDQEQVKHRNNE-NDMHKCTICDQMFGTGQA  107

Query  405  LGGHMRRHRAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            LGGHMR+HR +M+ E          +  + PVL +  S+K+I      LDLNLTP END
Sbjct  108  LGGHMRKHRTSMITE----QSVIPSVVYSRPVLNQCNSNKKI------LDLNLTPLEND  156



>gb|KHN32102.1| Zinc finger protein ZAT12 [Glycine soja]
Length=156

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 96/172 (56%), Gaps = 22/172 (13%)
 Frame = -2

Query  711  MKRSREYAGVEAEA-MANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALG  535
            MKR R+    E+E  MANCLMLL  VG   + S          F+CKTC++KF SFQALG
Sbjct  1    MKRGRDK---ESEVGMANCLMLLTKVGETETPSRERVL-SCGDFRCKTCNRKFHSFQALG  56

Query  534  GHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGF  355
            GHRASHKK KL+A       S     K H+C ICGLEF +GQALGGHMR+HR+A + EG 
Sbjct  57   GHRASHKKLKLMA----SNLSCSMAQKKHQCPICGLEFGIGQALGGHMRKHRSASLNEGL  112

Query  354  ENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPA  199
                           +  +  ++R+    L LD NL P EN DL +   TP 
Sbjct  113  ---------ITHDHAVPTSNGAERLR---LCLDSNLGPYEN-DLNLILRTPV  151



>gb|KGN65670.1| hypothetical protein Csa_1G481720 [Cucumis sativus]
Length=155

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 91/171 (53%), Gaps = 32/171 (19%)
 Frame = -2

Query  714  LMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALG  535
             MKR RE    +   M +C+  +    RN+S+    + K    F CKTC+++F SFQALG
Sbjct  11   FMKRERE-GEFQVLDMVDCMSKVEEPWRNNSAPAGDSGK---VFVCKTCNREFSSFQALG  66

Query  534  GHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGF  355
            GHRASHKKP    P        P K K H C ICGL F +GQALGGHMRRHR +      
Sbjct  67   GHRASHKKPNSKDP--------PTKPKAHECPICGLHFPIGQALGGHMRRHRTS------  112

Query  354  ENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTP  202
                        + V K     KR FG    LDLNLTP EN +LK++ TTP
Sbjct  113  ---------TTTVVVEKSDAGGKRGFG----LDLNLTPIEN-NLKLQLTTP  149



>gb|KHN05934.1| Zinc finger protein ZAT11 [Glycine soja]
Length=180

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 102/169 (60%), Gaps = 9/169 (5%)
 Frame = -2

Query  723  MTMLMKRSREYAGVEAE-AMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSF  547
            M  ++KR  E    E    +A  LM L+ V + S+    +       F+CKTC++KF SF
Sbjct  1    MVAILKRQGENESEETIIGLAKSLMQLSRVQQQSNKPLLNTFSP-TEFECKTCNRKFSSF  59

Query  546  QALGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMM  367
            QALGGHRASHKKPK  A    E+     K KMH CSICG+EF++GQALGGHMR+HR A+ 
Sbjct  60   QALGGHRASHKKPKFEAEELKEEAKK-TKPKMHECSICGMEFSLGQALGGHMRKHRGAIS  118

Query  366  KEGFENppaaipmamaiP---VLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            +    N  A   +  AI    VLKR ++SKR+    L +DLNLTP END
Sbjct  119  ENDNNNNEALSSIKQAIAKAPVLKR-SNSKRV--MCLEMDLNLTPLEND  164



>ref|XP_009117667.1| PREDICTED: zinc finger protein ZAT11-like [Brassica rapa]
 emb|CDY07790.1| BnaA03g17210D [Brassica napus]
Length=181

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 99/169 (59%), Gaps = 15/169 (9%)
 Frame = -2

Query  711  MKRSR-EYA-GVEAEAMANCLMLLAH--VGRNssssppsaSKDLCS--FQCKTCDKKFPS  550
            MKR R EY   ++   +  CLM+L+   + +         ++   S  F+CKTC+++F S
Sbjct  1    MKRERSEYEESIKNLDIVKCLMILSRTSIAKQIGVIHNQFTERNTSNRFECKTCNRRFSS  60

Query  549  FQALGGHRASHKKPKLVAPAPGEQE--SSPEKSKMHRCSICGLEFAMGQALGGHMRRHRA  376
            FQALGGHRASHKKPKL       +    + + + MH+CS C   F  GQALGGHMRRHR+
Sbjct  61   FQALGGHRASHKKPKLAVDEKDVKHLTKNYKGTHMHKCSRCDQSFGTGQALGGHMRRHRS  120

Query  375  AMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
            +M     E      P    +PV+KR +SSKR+    L+LDLNLTP END
Sbjct  121  SMT---LEPSQRISPRIPTMPVMKRCSSSKRV----LSLDLNLTPLEND  162



>ref|XP_009377110.1| PREDICTED: zinc finger protein ZAT11-like [Pyrus x bretschneideri]
Length=185

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 81/131 (62%), Gaps = 16/131 (12%)
 Frame = -2

Query  585  FQCKTCDKKFPSFQALGGHRASHKKPKLVAPAPGEQESSP------------EKSKMHRC  442
            F+CKTC++KF SFQALGGHRASHK+P+ +     E                 +K+K H C
Sbjct  42   FECKTCNRKFTSFQALGGHRASHKRPRTLMSRDDEDRKDEREKGNNKSMVMNKKAKTHEC  101

Query  441  SICGLEFAMGQALGGHMRRHRAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLN  262
            SICGLEF MGQALGGHMR+HRA+ M        A   +   IPVL R +SSKR+    L 
Sbjct  102  SICGLEFGMGQALGGHMRKHRASNMDMA-SFSYAPSAVTSKIPVLTR-SSSKRV--MSLE  157

Query  261  LDLNLTPAEND  229
            +DLNLTP END
Sbjct  158  MDLNLTPLEND  168



>ref|XP_008776431.1| PREDICTED: zinc finger protein ZAT11-like [Phoenix dactylifera]
Length=154

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 88/157 (56%), Gaps = 26/157 (17%)
 Frame = -2

Query  690  AGVEAEA---MANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGGHRAS  520
            AG EAE+   MAN LM+L+  G   ++     S     F+CKTC+++F SFQALGGHRAS
Sbjct  9    AGGEAESISNMANVLMMLSRGGGEGTARLAQTSPGRV-FECKTCNRQFSSFQALGGHRAS  67

Query  519  HKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFENppa  340
            HKKP+L A   G       K + H CSICGLEFA+GQALGGHMRRHR A    G      
Sbjct  68   HKKPRLTAD--GHLRGGLAKPRAHECSICGLEFAIGQALGGHMRRHRPANRGAGH-----  120

Query  339  aipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
                              R+    L+LDLNL P+END
Sbjct  121  -----------GLMEEQARV----LSLDLNLPPSEND  142



>ref|XP_010920692.1| PREDICTED: zinc finger protein ZAT12-like [Elaeis guineensis]
Length=165

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 96/166 (58%), Gaps = 25/166 (15%)
 Frame = -2

Query  711  MKRSREYA-GVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALG  535
            MKR RE    VE+  MA  L+ L+   R       S  +    F+CKTC+++FPSFQALG
Sbjct  1    MKRLREEGHQVESINMAKVLIFLS---RGVEEVRDSPGR---VFECKTCNRQFPSFQALG  54

Query  534  GHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGF  355
            GHRASHKKP+++     + +S+  K ++H CSICGLEF +GQALGGHMRRHR A    G 
Sbjct  55   GHRASHKKPRMMGDGHDQAQSALVKPRVHECSICGLEFPIGQALGGHMRRHRGATESFG-  113

Query  354  ENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEN-DDLK  220
                          ++++    KR     L LDLNL P+E  DD++
Sbjct  114  ------------HGLVEKKPDGKR----ALWLDLNLPPSEALDDVE  143



>ref|XP_003597339.1| Zinc finger protein [Medicago truncatula]
 gb|ABD32282.1| Zinc finger, C2H2-type [Medicago truncatula]
 gb|AES67590.1| C2H2 type zinc finger transcription factor family protein, putative 
[Medicago truncatula]
Length=133

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 87/154 (56%), Gaps = 33/154 (21%)
 Frame = -2

Query  687  GVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGGHRASHKKP  508
            G E ++  NCLMLL+ VG     +        C F+CKTC+K+F SFQALGGHRASHK+P
Sbjct  4    GREDKSELNCLMLLSKVGETKEPNTLKE----CGFKCKTCNKEFSSFQALGGHRASHKRP  59

Query  507  KLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFENppaaipm  328
            KL+   P        K KMH C ICGLEF++GQALGGHMR+H ++               
Sbjct  60   KLMYKLPN------MKPKMHPCPICGLEFSIGQALGGHMRKHNSSF--------------  99

Query  327  amaiPVLKRTTSSKRIFGFGLN--LDLNLTPAEN  232
                 + K+   SK+     LN  LDLNLTP EN
Sbjct  100  ----SIFKK---SKKDHCERLNFCLDLNLTPLEN  126



>ref|XP_010542618.1| PREDICTED: zinc finger protein ZAT12-like [Tarenaya hassleriana]
Length=168

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 92/173 (53%), Gaps = 18/173 (10%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            M+R RE   +    MA+CL+LL++   N +            F CKTC K FPSFQALGG
Sbjct  1    MERGREMEMISN--MASCLILLSNSTSNQNDIGKRV------FTCKTCSKVFPSFQALGG  52

Query  531  HRASHKKPKLVAPAPGEQESSPEKSKM--HRCSICGLEFAMGQALGGHMRRHRAAMMKEG  358
            HRASH++  +V    GE    P + K   H C ICG EFA+GQALGGHMR+H+       
Sbjct  53   HRASHRRSAVV---DGEAPPWPRRLKQAKHDCPICGAEFAVGQALGGHMRKHKGGAHAAD  109

Query  357  FENppaaipmamaiPVLKRTTSSKRIFGFG-----LNLDLNLTPAENDDLKIE  214
                           VL+ +  + +  G G     L LDLNLTP EN+DLK+E
Sbjct  110  AGGGGVGQRSCEEAEVLRASPVTMKKSGGGSGKRVLCLDLNLTPLENEDLKLE  162



>ref|XP_004241248.2| PREDICTED: zinc finger protein ZAT11-like [Solanum lycopersicum]
Length=139

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 92/170 (54%), Gaps = 37/170 (22%)
 Frame = -2

Query  723  MTMLMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQ  544
            MT+  +R  E   VE  AMANC+ +L    +NSS S          F+CKTC K+F SFQ
Sbjct  2    MTIKRRREEEIVTVETFAMANCVSILE---KNSSLSRRF-------FECKTCKKQFESFQ  51

Query  543  ALGGHRASHKKPK-LVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMM  367
            ALGGHRASHKKPK LV P+    +S    +K H CS CG EF +GQALGGHMR+HR    
Sbjct  52   ALGGHRASHKKPKLLVLPS----DSIKSNAKKHECSYCGEEFVLGQALGGHMRKHRDKTK  107

Query  366  KEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKI  217
            ++                      S ++ F     LDLNLTP END L +
Sbjct  108  EKN------------------TYKSPEKKFC----LDLNLTPYENDQLTL  135



>ref|XP_010228788.1| PREDICTED: zinc finger protein ZAT11-like [Brachypodium distachyon]
Length=198

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 63/76 (83%), Gaps = 4/76 (5%)
 Frame = -2

Query  585  FQCKTCDKKFPSFQALGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQA  406
            F+CKTC ++FPSFQALGGHRASHKKP+L   A G Q S P K K+H CS+CGLEFA+GQA
Sbjct  60   FECKTCSRQFPSFQALGGHRASHKKPRL---ADGAQ-SDPPKPKVHGCSVCGLEFAVGQA  115

Query  405  LGGHMRRHRAAMMKEG  358
            LGGHMRRHRAA+  +G
Sbjct  116  LGGHMRRHRAAVAADG  131



>ref|XP_009594752.1| PREDICTED: zinc finger protein ZAT11-like [Nicotiana tomentosiformis]
Length=166

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 97/167 (58%), Gaps = 21/167 (13%)
 Frame = -2

Query  717  MLMKRSRE--YAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQ  544
            M +KRSRE     VE  AMANC+ +L    +NSS +          F+C+TC K+F SFQ
Sbjct  1    MTIKRSREEDQLTVETLAMANCVNILE---KNSSLARRL-------FECRTCKKQFESFQ  50

Query  543  ALGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMK  364
            ALGGHRASHKKPKL + A       P K K H CS CG EF++GQALGGHMR+HR  + +
Sbjct  51   ALGGHRASHKKPKLHSTA---DPIKPNKKK-HECSFCGEEFSLGQALGGHMRKHRYKLGE  106

Query  363  EGFENppaaipmamaiPVLKRTTSSKRIFGF--GLNLDLNLTPAEND  229
               +    +   +    V    T+ K+I G    L LDLN+TP EN+
Sbjct  107  LQKQKQQDSDDNSAGEVV---ETTEKKISGTEKALFLDLNMTPYENE  150



>ref|XP_007162678.1| hypothetical protein PHAVU_001G170800g [Phaseolus vulgaris]
 gb|ESW34672.1| hypothetical protein PHAVU_001G170800g [Phaseolus vulgaris]
Length=217

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 100/165 (61%), Gaps = 9/165 (5%)
 Frame = -2

Query  732  SPSMTMLMKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFP  553
            SP+  + MKR R   G E   +A CL+L +    ++ +   S       F+CKTC++KF 
Sbjct  59   SPTCMLGMKRQRGNEGFENLDLAKCLLLFSCPQESNKAQEKSFGS--AEFECKTCNRKFS  116

Query  552  SFQALGGHRASHKKPKLVAPAPGEQESS---PEKSKMHRCSICGLEFAMGQALGGHMRRH  382
            SFQALGGHRASHKK K+      EQ  S     K KMH CSICG EF++GQALGGHMR+H
Sbjct  117  SFQALGGHRASHKKQKVEGEELKEQGKSLSLWSKPKMHECSICGQEFSLGQALGGHMRKH  176

Query  381  RAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNL  247
            R  +  EGF   P+   +   IPVLKR+ S++ +    L+L+L+L
Sbjct  177  R-GVSNEGFVPIPSIDQVIAKIPVLKRSNSTRVMC---LDLELHL  217



>ref|XP_004305218.1| PREDICTED: zinc finger protein ZAT11-like [Fragaria vesca subsp. 
vesca]
Length=174

 Score =   111 bits (277),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 96/166 (58%), Gaps = 14/166 (8%)
 Frame = -2

Query  711  MKRSRE-YAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALG  535
            MKR+RE   GV+   M   LMLL++          S+  D+  F+CKTC++KFPSFQALG
Sbjct  1    MKRTREEVVGVD---MDKVLMLLSYRLETKFKRCSSSPNDV--FECKTCNRKFPSFQALG  55

Query  534  GHRASHKKPKLVAPAPGEQESSPE----KSKMHRCSICGLEFAMGQALGGHMRRHRAAMM  367
            GHRASHK    V     + +S  +    K K H CSICGL F+ GQALGGHMRRH  +++
Sbjct  56   GHRASHKPRSTVMDTDQDPKSETKLMQSKLKKHECSICGLVFSSGQALGGHMRRH--SIV  113

Query  366  KEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
               F     A   +     +   ++SKR+    L++DLNLTP END
Sbjct  114  NSRFSATIPASSASKMKTPVLMRSNSKRV--MRLDMDLNLTPLEND  157



>ref|XP_007132100.1| hypothetical protein PHAVU_011G066800g [Phaseolus vulgaris]
 gb|ESW04094.1| hypothetical protein PHAVU_011G066800g [Phaseolus vulgaris]
Length=139

 Score =   109 bits (273),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 95/162 (59%), Gaps = 25/162 (15%)
 Frame = -2

Query  669  MANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGGHRASHKKPKLVAPA  490
            M+ CLML+  VG  +S      S +   F+CKTCDK+FPSFQALGGHRASHKK K +A  
Sbjct  1    MSKCLMLVEEVGEGASRERVVKSGE---FKCKTCDKQFPSFQALGGHRASHKKLKRMASN  57

Query  489  PGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFENppaaipmamaiPV  310
                  +P   K+H+CSICGL F +GQALGGHMR+HR + +    ++             
Sbjct  58   LPCSVVTP---KLHQCSICGLVFGIGQALGGHMRKHRVSSIHHHHQD-------------  101

Query  309  LKRTTSSKRI-FGFGLNLDLNLTPAENDDLKIESTTPATPVL  187
            L +++++K + F F    DLNLTP EN  L +   TP + + 
Sbjct  102  LPKSSATKNLRFCF----DLNLTPYEN-HLNLNLRTPVSHLF  138



>gb|KHN09437.1| Zinc finger protein ZAT11 [Glycine soja]
Length=133

 Score =   109 bits (272),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 82/116 (71%), Gaps = 7/116 (6%)
 Frame = -2

Query  585  FQCKTCDKKFPSFQALGGHRASHKKPKLVAPAPGEQESS---PEKSKMHRCSICGLEFAM  415
            F+CKTC++KF SFQALGGHRASHK+ KL      EQ  S     K KMH CSICGLEF++
Sbjct  22   FECKTCNRKFSSFQALGGHRASHKRQKLEGEELKEQAKSLSLWNKPKMHECSICGLEFSL  81

Query  414  GQALGGHMRRHRAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNL  247
            GQALGGHMR+HRA+ + EGF   P+   +   IPVLKR+ S++ +    L+L+L+L
Sbjct  82   GQALGGHMRKHRAS-LNEGFPIIPSIDQVIAKIPVLKRSNSTRVM---CLDLELHL  133



>ref|NP_001235663.1| uncharacterized protein LOC100526897 [Glycine max]
 gb|ACU15918.1| unknown [Glycine max]
Length=158

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 78/114 (68%), Gaps = 5/114 (4%)
 Frame = -2

Query  585  FQCKTCDKKFPSFQALGGHRASHKKPKLVAPAPGEQESS---PEKSKMHRCSICGLEFAM  415
            F+CKTC++KF SFQALGGHRASHK+ KL      EQ  S     K KMH CSICGLEF++
Sbjct  47   FECKTCNRKFSSFQALGGHRASHKRQKLEGEELKEQAKSLSLWNKPKMHECSICGLEFSL  106

Query  414  GQALGGHMRRHRAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDL  253
            GQALGGHMR+HRA+ + EGF   P+   +   IPVLKR+ S+ R+    L L L
Sbjct  107  GQALGGHMRKHRAS-LNEGFPIIPSIDQVIAKIPVLKRSNST-RVMCLDLELHL  158



>ref|NP_001049734.1| Os03g0279700 [Oryza sativa Japonica Group]
 gb|ABF95297.1| zinc finger DNA-binding protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11648.1| Os03g0279700 [Oryza sativa Japonica Group]
 gb|EAY89482.1| hypothetical protein OsI_11011 [Oryza sativa Indica Group]
 dbj|BAG99219.1| unnamed protein product [Oryza sativa Japonica Group]
Length=191

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 60/72 (83%), Gaps = 2/72 (3%)
 Frame = -2

Query  585  FQCKTCDKKFPSFQALGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQA  406
            F+CKTC+++FPSFQALGGHRASHKKP+L    P  +  +P K K+H CSICGLEFA+GQA
Sbjct  51   FECKTCNRQFPSFQALGGHRASHKKPRLADGDPAAE--APAKPKVHGCSICGLEFAVGQA  108

Query  405  LGGHMRRHRAAM  370
            LGGHMRRHRA M
Sbjct  109  LGGHMRRHRAVM  120



>gb|KFK32262.1| hypothetical protein AALP_AA6G219400 [Arabis alpina]
Length=148

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 93/171 (54%), Gaps = 34/171 (20%)
 Frame = -2

Query  711  MKRSREYAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGG  532
            M++ RE   +    MA+CL+LL+   +N + S          F CKTC+K+FPSFQALGG
Sbjct  1    MEKEREMEMINK--MASCLILLSKTHQNDTKSRV--------FACKTCNKEFPSFQALGG  50

Query  531  HRASHKKPKLVAPAPGEQESSPEKSK--MHRCSICGLEFAMGQALGGHMRRHRAAMMKEG  358
            HRASH++    A   G    SP++ K   H C ICG EFA+GQALGGHMR+HR       
Sbjct  51   HRASHRRS---AALEGHAPPSPKRVKPVKHECPICGAEFAVGQALGGHMRKHRG------  101

Query  357  FENppaaipmamaiPVLKRTTSSKRIFGFG---LNLDLNLTPAENDDLKIE  214
                            +   T  K   G+G   L LDLNLTP EN+DLK+E
Sbjct  102  ----------RDRSLAVAPVTMKKSGGGYGKRVLCLDLNLTPLENEDLKLE  142



>gb|EEE58806.1| hypothetical protein OsJ_10357 [Oryza sativa Japonica Group]
Length=191

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 60/72 (83%), Gaps = 2/72 (3%)
 Frame = -2

Query  585  FQCKTCDKKFPSFQALGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQA  406
            F+CKTC+++FPSFQALGGHRASHKKP+L    P  +  +P K K+H CSICGLEFA+GQA
Sbjct  51   FECKTCNRQFPSFQALGGHRASHKKPRLANGDPAAE--APAKPKVHGCSICGLEFAVGQA  108

Query  405  LGGHMRRHRAAM  370
            LGGHMRRHRA M
Sbjct  109  LGGHMRRHRAVM  120



>ref|XP_004165931.1| PREDICTED: zinc finger protein ZAT12-like [Cucumis sativus]
Length=154

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 86/160 (54%), Gaps = 31/160 (19%)
 Frame = -2

Query  669  MANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGGHRASHKKPKLVAPA  490
            M +C+  +    RN+S+    + K    F CKTC+++F SFQALGGHRASHKKP    P 
Sbjct  1    MVDCMSKVEEPWRNNSAPAGDSGK---VFVCKTCNREFSSFQALGGHRASHKKPNSKDP-  56

Query  489  PGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFENppaaipmamaiPV  310
                   P K K H C ICGL F +GQALGGHMRRHR +                  + V
Sbjct  57   -------PTKPKAHECPICGLHFPIGQALGGHMRRHRTS---------------TTTVVV  94

Query  309  LKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPATPV  190
             K     KR FG    LDLNLTP EN +LK++ TTP   V
Sbjct  95   EKSDAGGKRGFG----LDLNLTPIEN-NLKLQLTTPFLDV  129



>ref|XP_004149058.1| PREDICTED: zinc finger protein ZAT12-like [Cucumis sativus]
Length=154

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 86/160 (54%), Gaps = 31/160 (19%)
 Frame = -2

Query  669  MANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGGHRASHKKPKLVAPA  490
            M +C+  +    RN+S+    + K    F CKTC+++F SFQALGGHRASHKKP    P 
Sbjct  1    MVDCMSKVEEPWRNNSAPAGDSGK---VFVCKTCNREFSSFQALGGHRASHKKPNSKDP-  56

Query  489  PGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFENppaaipmamaiPV  310
                   P K K H C ICGL F +GQALGGHMRRHR +                  + V
Sbjct  57   -------PTKPKAHECPICGLHFPIGQALGGHMRRHRTS---------------TTTVVV  94

Query  309  LKRTTSSKRIFGFGLNLDLNLTPAENDDLKIESTTPATPV  190
             K     KR FG    LDLNLTP EN +LK++ TTP   V
Sbjct  95   EKSDAGGKRGFG----LDLNLTPIEN-NLKLQLTTPFLDV  129



>ref|XP_002465455.1| hypothetical protein SORBIDRAFT_01g039190 [Sorghum bicolor]
 gb|EER92453.1| hypothetical protein SORBIDRAFT_01g039190 [Sorghum bicolor]
Length=197

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = -2

Query  585  FQCKTCDKKFPSFQALGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQA  406
            F+CKTC+++FPSFQALGGHRASHKKP+L         + P K K+H CSICGLEFA+GQA
Sbjct  58   FECKTCNRQFPSFQALGGHRASHKKPRLADGGVDAAAAEPPKPKVHGCSICGLEFAIGQA  117

Query  405  LGGHMRRHRAA  373
            LGGHMRRHRAA
Sbjct  118  LGGHMRRHRAA  128



>ref|XP_006291929.1| hypothetical protein CARUB_v10018114mg [Capsella rubella]
 gb|EOA24827.1| hypothetical protein CARUB_v10018114mg [Capsella rubella]
Length=175

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 76/123 (62%), Gaps = 11/123 (9%)
 Frame = -2

Query  585  FQCKTCDKKFPSFQALGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQA  406
            F+CKTC++ F SFQALGGHRASHKKPKL       +    E + MH+CSIC   F  GQA
Sbjct  49   FECKTCNRIFDSFQALGGHRASHKKPKLSVDHEQVKHRKSE-NDMHKCSICDQIFGTGQA  107

Query  405  LGGHMRRHRAAMMKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDD  226
            LGGHMR+HRA M+ E      A   +    PV+ R  SSK+I      LDLNLTP END 
Sbjct  108  LGGHMRKHRAIMLTE----QSAIPSVGFPRPVMNRCNSSKKI------LDLNLTPLENDL  157

Query  225  LKI  217
            + I
Sbjct  158  VTI  160



>dbj|BAA21925.1| ZPT2-8 [Petunia x hybrida]
Length=163

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 94/167 (56%), Gaps = 23/167 (14%)
 Frame = -2

Query  714  LMKRSRE-YAGVEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQAL  538
            + KRSRE  A VE  AMANC+ +L    +N+S +          F+CKTC K+F SFQAL
Sbjct  3    IKKRSREELAKVETLAMANCVNILE---KNTSLARKI-------FECKTCKKQFDSFQAL  52

Query  537  GGHRASHKKPKLVAPAP---GEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMM  367
            GGHRASHKKP+ +  A    G     P  +K+H CS CG +F  GQALGGHMR+HR  + 
Sbjct  53   GGHRASHKKPRFITAADFSIGSPNYKPN-NKVHECSFCGEDFPTGQALGGHMRKHRDKL-  110

Query  366  KEGFENppaaipmamaiPVLKRTTSSKRIFGFG-LNLDLNLTPAEND  229
              G E           I  +++  +S    G G L  DLNLTP END
Sbjct  111  --GHELKKQKQKNCDEIVEIEKKNNS----GTGKLFFDLNLTPYEND  151



>ref|XP_010047376.1| PREDICTED: zinc finger protein ZAT11-like [Eucalyptus grandis]
Length=169

 Score =   108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 103/171 (60%), Gaps = 20/171 (12%)
 Frame = -2

Query  711  MKRSREYAGVEAEAM--ANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQAL  538
            MKR+ +  GV   ++  ANCL+ L+   R+ +  P        +F+CKTC ++FPSFQAL
Sbjct  1    MKRAYD-NGVSTMSLDVANCLIFLS---RSVNIMPRRTDCHGGAFECKTCKRQFPSFQAL  56

Query  537  GGHRASHKKPKLVAPAPGE----QESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAM  370
            GGHR SHK+ +L  P   +       S  K K+H CSICGL+FA GQALGGHMR+HR  +
Sbjct  57   GGHRTSHKRLRLSEPKVEDCTELSLGSMVKPKIHECSICGLKFANGQALGGHMRKHRVEV  116

Query  369  MKEGFENppaaipmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKI  217
            + E   N      M   +PV ++++S  R     ++LDLNL+P EN DLKI
Sbjct  117  LSEVATN------MNSVVPVFRKSSSINRRV---ISLDLNLSPLEN-DLKI  157



>ref|XP_010521816.1| PREDICTED: zinc finger protein ZAT12-like [Tarenaya hassleriana]
Length=156

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 89/154 (58%), Gaps = 18/154 (12%)
 Frame = -2

Query  669  MANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGGHRASHKKPKLVAPA  490
            MA+CL+LL++   N +            F CKTC+K FPSFQALGGHRASH++    A  
Sbjct  13   MASCLILLSNSTSNQNDDVGGGR----VFTCKTCNKAFPSFQALGGHRASHRRS---AGM  65

Query  489  PGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFENppaaipmamaiPV  310
             G    SP K   H C ICG EFA+GQALGGHMR+HR      G         +  +   
Sbjct  66   DGHAPPSPRKPATHDCPICGAEFAVGQALGGHMRKHRV-----GRRTGEDTTALHGSPVT  120

Query  309  LKRT--TSSKRIFGFGLNLDLNLTPAENDDLKIE  214
            +K++   + KR+    L LDLNLTP+EN++LK++
Sbjct  121  MKKSGGGNGKRV----LCLDLNLTPSENENLKLK  150



>gb|AGK28205.1| C2H2-type zinc finger protein 7 [Eucalyptus grandis]
 gb|KCW88905.1| hypothetical protein EUGRSUZ_A01233 [Eucalyptus grandis]
Length=158

 Score =   108 bits (270),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 95/155 (61%), Gaps = 17/155 (11%)
 Frame = -2

Query  669  MANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGGHRASHKKPKLVAPA  490
            +ANCL+ L+   R+ +  P        +F+CKTC ++FPSFQALGGHR SHK+ +L  P 
Sbjct  5    VANCLIFLS---RSVNIMPRRTDCHGGAFECKTCKRQFPSFQALGGHRTSHKRLRLSEPK  61

Query  489  PGE----QESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFENppaaipmam  322
              +       S  K K+H CSICGL+FA GQALGGHMR+HR  ++ E   N      M  
Sbjct  62   VEDCTELSLGSMVKPKIHECSICGLKFANGQALGGHMRKHRVEVLSEVATN------MNS  115

Query  321  aiPVLKRTTSSKRIFGFGLNLDLNLTPAENDDLKI  217
             +PV ++++S  R     ++LDLNL+P EN DLKI
Sbjct  116  VVPVFRKSSSINRRV---ISLDLNLSPLEN-DLKI  146



>gb|KEH42344.1| Cys2-His2 zinc finger transcription factor [Medicago truncatula]
Length=165

 Score =   108 bits (270),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 92/155 (59%), Gaps = 14/155 (9%)
 Frame = -2

Query  684  VEAEAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQALGGHRASHKKPK  505
            VE   +ANCL+LL+H          S  +    F+C TC++KF SFQALGGHRASHK+PK
Sbjct  6    VENIDLANCLILLSHPKETKPKKHFSPVE----FECTTCNRKFSSFQALGGHRASHKRPK  61

Query  504  LVA---PAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRAAMMKEGFENppaai  334
            L         +        KMH C ICG EF++GQALGGHMRRH+ + + EGF +     
Sbjct  62   LDTLKLKLHAQTLGLLNNPKMHGCYICGKEFSLGQALGGHMRRHKIS-VNEGFSS-VKKN  119

Query  333  pmamaiPVLKRTTSSKRIFGFGLNLDLNLTPAEND  229
             +   IP LKR  +SKR+    + LDLNLTP +ND
Sbjct  120  KVVGKIPTLKR-LNSKRV----MCLDLNLTPLQND  149



>ref|XP_009421348.1| PREDICTED: zinc finger protein ZAT12-like [Musa acuminata subsp. 
malaccensis]
Length=152

 Score =   108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 76/115 (66%), Gaps = 6/115 (5%)
 Frame = -2

Query  711  MKRSREYAGVEA---EAMANCLMLLAHVGRNssssppsaSKDLCSFQCKTCDKKFPSFQA  541
            MKR+R     E      MA+ LM L+H G    +   S S     F+CKTC+++FPSFQA
Sbjct  1    MKRTRVAGEGEVGSVHTMAHALMQLSH-GSADDADVSSVSPPARVFECKTCNRQFPSFQA  59

Query  540  LGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQALGGHMRRHRA  376
            LGGHRASHKK KL     G+ E +  K ++H CSICGLEFA+GQALGGHMRRHRA
Sbjct  60   LGGHRASHKKLKLAGDGRGDGEGA--KPRVHECSICGLEFAIGQALGGHMRRHRA  112



>ref|XP_008654280.1| PREDICTED: zinc finger protein ZAT12-like [Zea mays]
 tpg|DAA44719.1| TPA: hypothetical protein ZEAMMB73_389569 [Zea mays]
Length=182

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = -2

Query  585  FQCKTCDKKFPSFQALGGHRASHKKPKLVAPAPGEQESSPEKSKMHRCSICGLEFAMGQA  406
            F+CKTC+++FPSFQALGGHRASHKKP+L +       + P K K+H CSICGLEFA+GQA
Sbjct  50   FECKTCNRQFPSFQALGGHRASHKKPRL-SDGVDAAAAEPPKPKVHGCSICGLEFAIGQA  108

Query  405  LGGHMRRHRAAMMKEG  358
            LGGHMRRHRAA   +G
Sbjct  109  LGGHMRRHRAADQTDG  124



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1536719273000