BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c28613_g1_i1 len=907 path=[885:0-906]

Length=907
                                                                      Score     E

ref|XP_007024240.1|  NDH-dependent cyclic electron flow 1 isoform 1     207   2e-62   
ref|XP_006465658.1|  PREDICTED: uncharacterized protein LOC102626...    204   3e-61   
ref|XP_006426910.1|  hypothetical protein CICLE_v10026544mg             201   9e-60   
ref|XP_004486767.1|  PREDICTED: uncharacterized protein LOC101490201    195   1e-57   
gb|AFK42515.1|  unknown                                                 193   6e-57   
gb|KFK38978.1|  hypothetical protein AALP_AA3G184200                    193   1e-56   
ref|XP_009599175.1|  PREDICTED: uncharacterized protein LOC104094...    192   2e-56   
ref|XP_009758905.1|  PREDICTED: uncharacterized protein LOC104211534    191   4e-56   
ref|XP_009599174.1|  PREDICTED: uncharacterized protein LOC104094...    192   4e-56   
ref|XP_009114819.1|  PREDICTED: uncharacterized protein LOC103840092    192   4e-56   
ref|XP_008462178.1|  PREDICTED: uncharacterized protein LOC103500602    191   5e-56   
ref|XP_002885131.1|  hypothetical protein ARALYDRAFT_897928             191   1e-55   
emb|CDX97734.1|  BnaA05g23450D                                          191   1e-55   
ref|XP_011004924.1|  PREDICTED: uncharacterized protein LOC105111310    190   2e-55   
ref|XP_002299725.1|  hypothetical protein POPTR_0001s18740g             189   2e-55   Populus trichocarpa [western balsam poplar]
emb|CDY20191.1|  BnaA01g28110D                                          190   2e-55   
ref|XP_009599173.1|  PREDICTED: uncharacterized protein LOC104094...    191   2e-55   
ref|XP_011072397.1|  PREDICTED: uncharacterized protein LOC105157664    189   4e-55   
ref|XP_006298569.1|  hypothetical protein CARUB_v10014651mg             189   4e-55   
ref|XP_006406856.1|  hypothetical protein EUTSA_v10021523mg             189   4e-55   
ref|XP_004245440.1|  PREDICTED: uncharacterized protein LOC101258885    188   5e-55   
gb|EYU21482.1|  hypothetical protein MIMGU_mgv1a014196mg                188   6e-55   
ref|XP_004141758.1|  PREDICTED: uncharacterized protein LOC101218377    188   6e-55   
ref|XP_009146157.1|  PREDICTED: uncharacterized protein LOC103869841    188   9e-55   
ref|XP_010098112.1|  hypothetical protein L484_026246                   187   1e-54   
ref|XP_010691367.1|  PREDICTED: uncharacterized protein LOC104904707    187   1e-54   
ref|XP_010545683.1|  PREDICTED: uncharacterized protein LOC104817971    187   1e-54   
ref|XP_002284206.1|  PREDICTED: uncharacterized protein LOC100241139    186   3e-54   Vitis vinifera
ref|XP_010487477.1|  PREDICTED: uncharacterized protein LOC104765461    186   4e-54   
ref|XP_010504019.1|  PREDICTED: uncharacterized protein LOC104781121    186   5e-54   
ref|XP_004302880.1|  PREDICTED: uncharacterized protein LOC101311105    186   6e-54   
ref|NP_188246.1|  NDH-dependent cyclic electron flow 1                  186   6e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010465639.1|  PREDICTED: uncharacterized protein LOC104745954    186   7e-54   
ref|XP_003597703.1|  Electron carrier/ electron transporter/ iron...    182   2e-52   
ref|XP_009377887.1|  PREDICTED: uncharacterized protein LOC103966441    182   2e-52   
ref|XP_008228470.1|  PREDICTED: uncharacterized protein LOC103327880    182   2e-52   
ref|XP_007215986.1|  hypothetical protein PRUPE_ppa011732mg             181   3e-52   
ref|XP_008342650.1|  PREDICTED: uncharacterized protein LOC103405430    182   4e-52   
ref|XP_006343759.1|  PREDICTED: uncharacterized protein LOC102582039    181   4e-52   
ref|XP_008380902.1|  PREDICTED: uncharacterized protein LOC103443783    180   2e-51   
ref|XP_009353576.1|  PREDICTED: uncharacterized protein LOC103944839    179   5e-51   
ref|XP_002515998.1|  electron carrier, putative                         175   1e-49   Ricinus communis
ref|XP_003546527.1|  PREDICTED: uncharacterized protein LOC100820264    174   2e-49   
gb|KDP37269.1|  hypothetical protein JCGZ_06325                         174   2e-49   
ref|XP_010249610.1|  PREDICTED: uncharacterized protein LOC104592109    173   3e-49   
ref|XP_010062509.1|  PREDICTED: uncharacterized protein LOC104449901    167   8e-47   
ref|NP_001147712.1|  electron carrier/ electron transporter/ iron...    167   8e-47   Zea mays [maize]
ref|XP_003563100.1|  PREDICTED: uncharacterized protein LOC100845974    163   2e-45   
ref|XP_004957722.1|  PREDICTED: uncharacterized protein LOC101772218    163   3e-45   
ref|NP_001235859.1|  uncharacterized protein LOC100500287               162   6e-45   
ref|XP_006465662.1|  PREDICTED: uncharacterized protein LOC102626...    161   7e-45   
ref|NP_001141368.1|  electron carrier/ electron transporter/ iron...    162   8e-45   Zea mays [maize]
ref|XP_006657710.1|  PREDICTED: uncharacterized protein LOC102712646    161   2e-44   
ref|XP_006426911.1|  hypothetical protein CICLE_v10026544mg             160   3e-44   
ref|NP_001059669.1|  Os07g0489800                                       160   4e-44   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002460712.1|  hypothetical protein SORBIDRAFT_02g033590          160   4e-44   Sorghum bicolor [broomcorn]
dbj|BAJ93050.1|  predicted protein                                      159   1e-43   
gb|EMS65658.1|  hypothetical protein TRIUR3_25345                       157   1e-43   
gb|EAZ03907.1|  hypothetical protein OsI_26041                          159   1e-43   Oryza sativa Indica Group [Indian rice]
ref|XP_006833432.1|  hypothetical protein AMTR_s00109p00146830          157   5e-43   
ref|XP_007150650.1|  hypothetical protein PHAVU_005G170200g             155   3e-42   
gb|EMT22593.1|  hypothetical protein F775_06167                         152   1e-41   
ref|XP_008803832.1|  PREDICTED: uncharacterized protein LOC103717288    153   2e-41   
ref|XP_010919663.1|  PREDICTED: uncharacterized protein LOC105043701    152   6e-41   
ref|XP_009382446.1|  PREDICTED: uncharacterized protein LOC103970406    150   3e-40   
emb|CDY63822.1|  BnaC01g44590D                                          135   2e-35   
ref|XP_007024241.1|  NDH-dependent cyclic electron flow 1 isoform 2     136   2e-35   
ref|XP_007024242.1|  NDH-dependent cyclic electron flow 1 isoform 3     136   2e-35   
emb|CAN70335.1|  hypothetical protein VITISV_011434                     135   8e-35   Vitis vinifera
gb|KCW69651.1|  hypothetical protein EUGRSUZ_F03055                     135   2e-34   
ref|XP_006465663.1|  PREDICTED: uncharacterized protein LOC102626...    122   5e-30   
ref|XP_006406855.1|  hypothetical protein EUTSA_v10021523mg             122   6e-30   
gb|KDO56979.1|  hypothetical protein CISIN_1g0293331mg                  114   5e-28   
emb|CDO98002.1|  unnamed protein product                                110   2e-26   
emb|CDY30147.1|  BnaC05g37150D                                        97.4    1e-21   
emb|CDO98001.1|  unnamed protein product                              98.2    2e-21   
ref|XP_010049032.1|  PREDICTED: uncharacterized protein LOC104437723  99.0    3e-21   
emb|CBI20927.3|  unnamed protein product                              96.7    6e-21   
gb|KCW81494.1|  hypothetical protein EUGRSUZ_C02856                   98.6    9e-21   
ref|XP_002281853.1|  PREDICTED: uncharacterized protein LOC100250753  97.1    1e-20   Vitis vinifera
gb|KDO56977.1|  hypothetical protein CISIN_1g0293332mg                94.0    3e-20   
ref|XP_006830417.1|  hypothetical protein AMTR_s00118p00075510        94.0    7e-20   
dbj|BAJ88549.1|  predicted protein                                    94.0    2e-19   
ref|XP_007013752.1|  2Fe-2S ferredoxin-like superfamily protein       94.0    2e-19   
ref|XP_010041387.1|  PREDICTED: uncharacterized protein LOC104430345  94.0    2e-19   
ref|XP_006450558.1|  hypothetical protein CICLE_v10009578mg           93.2    3e-19   
gb|ACG47194.1|  electron carrier/ electron transporter/ iron ion ...  93.2    3e-19   Zea mays [maize]
ref|NP_001056273.1|  Os05g0555300                                     93.2    3e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006654759.1|  PREDICTED: uncharacterized protein LOC102713363  93.2    3e-19   
tpg|DAA40854.1|  TPA: hypothetical protein ZEAMMB73_132806            92.4    4e-19   
emb|CDY30148.1|  BnaC05g37140D                                        91.7    5e-19   
gb|EEC79669.1|  hypothetical protein OsI_20921                        92.0    9e-19   Oryza sativa Indica Group [Indian rice]
gb|KDP32290.1|  hypothetical protein JCGZ_13215                       91.3    1e-18   
ref|XP_009401825.1|  PREDICTED: uncharacterized protein LOC103985740  91.7    1e-18   
ref|NP_001147484.1|  electron carrier/ electron transporter/ iron...  91.3    2e-18   Zea mays [maize]
ref|XP_003565942.1|  PREDICTED: uncharacterized protein LOC100844664  90.9    2e-18   
ref|XP_008445132.1|  PREDICTED: uncharacterized protein LOC103488...  90.9    2e-18   
gb|AFW79079.1|  electron carrier/ electron transporter/ iron ion ...  90.5    2e-18   
ref|NP_001150870.1|  electron carrier/ electron transporter/ iron...  90.5    3e-18   Zea mays [maize]
ref|XP_004138751.1|  PREDICTED: uncharacterized protein LOC101202...  90.1    3e-18   
ref|XP_010526190.1|  PREDICTED: uncharacterized protein LOC104803819  90.1    3e-18   
emb|CDP19031.1|  unnamed protein product                              89.7    4e-18   
ref|XP_010447367.1|  PREDICTED: uncharacterized protein LOC104730014  89.4    4e-18   
gb|KFK29869.1|  hypothetical protein AALP_AA7G189600                  88.6    6e-18   
ref|XP_004961285.1|  PREDICTED: uncharacterized protein LOC101765231  89.4    6e-18   
ref|XP_010049028.1|  PREDICTED: uncharacterized protein LOC104437718  89.0    7e-18   
ref|XP_010432692.1|  PREDICTED: uncharacterized protein LOC104716917  88.6    8e-18   
ref|XP_010051201.1|  PREDICTED: uncharacterized protein LOC104439895  90.9    9e-18   
ref|XP_007225952.1|  hypothetical protein PRUPE_ppa012418mg           88.6    1e-17   
ref|XP_008219857.1|  PREDICTED: uncharacterized protein LOC103320026  88.6    1e-17   
ref|XP_010249906.1|  PREDICTED: uncharacterized protein LOC104592303  88.6    1e-17   
ref|XP_008394020.1|  PREDICTED: uncharacterized protein LOC103456149  88.6    1e-17   
ref|NP_567899.1|  2Fe-2S iron-sulfur cluster binding domain-conta...  88.6    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009377507.1|  PREDICTED: uncharacterized protein LOC103966093  88.2    2e-17   
ref|XP_008811590.1|  PREDICTED: uncharacterized protein LOC103722...  88.2    2e-17   
gb|KCW81491.1|  hypothetical protein EUGRSUZ_C02852                   89.0    3e-17   
ref|XP_002869262.1|  hypothetical protein ARALYDRAFT_913185           87.0    3e-17   
ref|XP_007161258.1|  hypothetical protein PHAVU_001G055300g           86.7    3e-17   
ref|XP_010913958.1|  PREDICTED: uncharacterized protein LOC105039...  87.0    4e-17   
ref|XP_003550159.1|  PREDICTED: uncharacterized protein LOC100807...  86.3    5e-17   
ref|XP_010437886.1|  PREDICTED: uncharacterized protein LOC104721570  86.3    6e-17   
gb|AFK39613.1|  unknown                                               85.5    9e-17   
ref|XP_010670755.1|  PREDICTED: uncharacterized protein LOC104887730  85.5    1e-16   
ref|XP_006412452.1|  hypothetical protein EUTSA_v10026415mg           84.3    2e-16   
ref|XP_009125813.1|  PREDICTED: uncharacterized protein LOC103850777  84.7    2e-16   
ref|XP_006412454.1|  hypothetical protein EUTSA_v10026415mg           84.3    3e-16   
ref|XP_004138752.1|  PREDICTED: uncharacterized protein LOC101202...  84.0    3e-16   
gb|AFK34507.1|  unknown                                               84.0    3e-16   
gb|AFW60528.1|  hypothetical protein ZEAMMB73_761500                  83.2    4e-16   
ref|XP_004291420.1|  PREDICTED: uncharacterized protein LOC101300021  83.2    5e-16   
ref|XP_003588686.1|  Electron carrier/ electron transporter/ iron...  83.6    6e-16   
gb|KCW81482.1|  hypothetical protein EUGRSUZ_C02841                   82.4    6e-16   
ref|XP_009606094.1|  PREDICTED: uncharacterized protein LOC104100546  83.2    7e-16   
ref|XP_009758600.1|  PREDICTED: uncharacterized protein LOC104211266  82.8    1e-15   
ref|XP_011086930.1|  PREDICTED: uncharacterized protein LOC105168487  82.0    2e-15   
ref|XP_008665839.1|  PREDICTED: uncharacterized protein LOC103644408  83.2    2e-15   
gb|KDO56980.1|  hypothetical protein CISIN_1g0293331mg                79.0    3e-15   
ref|XP_008811593.1|  PREDICTED: uncharacterized protein LOC103722...  81.3    4e-15   
ref|XP_008680127.1|  PREDICTED: uncharacterized protein LOC103655098  83.6    5e-15   
ref|XP_010914163.1|  PREDICTED: uncharacterized protein LOC105039...  80.1    7e-15   
ref|XP_004498633.1|  PREDICTED: uncharacterized protein LOC101502...  79.7    9e-15   
emb|CDX68864.1|  BnaC01g05890D                                        79.7    1e-14   
ref|XP_002973178.1|  hypothetical protein SELMODRAFT_59158            78.2    1e-14   
gb|EYU29247.1|  hypothetical protein MIMGU_mgv1a015108mg              79.7    1e-14   
ref|XP_002976675.1|  hypothetical protein SELMODRAFT_59157            77.8    1e-14   
ref|XP_011019734.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  79.7    1e-14   
ref|XP_002516617.1|  electron carrier, putative                       79.3    1e-14   Ricinus communis
ref|XP_006450556.1|  hypothetical protein CICLE_v10009578mg           79.7    2e-14   
ref|XP_002441489.1|  hypothetical protein SORBIDRAFT_09g027890        79.7    2e-14   Sorghum bicolor [broomcorn]
ref|XP_002309590.1|  ferredoxin-related family protein                79.3    2e-14   Populus trichocarpa [western balsam poplar]
emb|CDX75257.1|  BnaA01g04450D                                        79.3    2e-14   
ref|XP_006412453.1|  hypothetical protein EUTSA_v10026415mg           79.0    2e-14   
gb|KHN10388.1|  hypothetical protein glysoja_047000                   78.6    4e-14   
gb|AAT58739.1|  unknown protein                                       79.0    4e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006450555.1|  hypothetical protein CICLE_v10009578mg           78.2    6e-14   
gb|KHM99988.1|  hypothetical protein glysoja_043981                   75.5    7e-14   
gb|KDO79621.1|  hypothetical protein CISIN_1g029369mg                 78.2    7e-14   
ref|XP_006476193.1|  PREDICTED: uncharacterized protein LOC102630...  77.8    1e-13   
gb|AFK41293.1|  unknown                                               73.6    4e-13   
ref|XP_008445133.1|  PREDICTED: uncharacterized protein LOC103488...  75.1    5e-13   
ref|NP_974664.1|  2Fe-2S iron-sulfur cluster binding domain-conta...  73.2    3e-12   Arabidopsis thaliana [mouse-ear cress]
gb|EMT11473.1|  hypothetical protein F775_25882                       73.2    3e-12   
emb|CCI55389.1|  NDH subunit PnsB3                                    71.6    1e-11   
ref|XP_010109036.1|  hypothetical protein L484_007370                 68.9    2e-11   
gb|EPS60932.1|  hypothetical protein M569_13870                       68.6    5e-11   
ref|XP_006450557.1|  hypothetical protein CICLE_v10009578mg           67.0    3e-10   
gb|KCW81487.1|  hypothetical protein EUGRSUZ_C02845                   65.5    4e-10   
ref|XP_001759250.1|  predicted protein                                69.3    4e-10   
ref|XP_004498634.1|  PREDICTED: uncharacterized protein LOC101502...  64.7    2e-09   
ref|WP_015177761.1|  ferredoxin                                       62.8    4e-09   
ref|WP_015202669.1|  ferredoxin                                       61.6    1e-08   
ref|WP_017653826.1|  iron ABC transporter substrate-binding protein   60.5    3e-08   
ref|WP_017746280.1|  iron ABC transporter substrate-binding protein   60.5    3e-08   
gb|EMS67753.1|  hypothetical protein TRIUR3_01768                     62.0    4e-08   
ref|XP_003057235.1|  predicted protein                                61.2    5e-08   
ref|WP_015157484.1|  ferredoxin                                       60.5    5e-08   
ref|WP_015113623.1|  ferredoxin                                       59.7    6e-08   
ref|WP_038082692.1|  iron ABC transporter substrate-binding protein   59.7    6e-08   
ref|WP_039714396.1|  iron ABC transporter substrate-binding protein   59.3    7e-08   
ref|WP_007354414.1|  MULTISPECIES: iron ABC transporter substrate...  59.3    7e-08   
ref|WP_015126804.1|  ferredoxin                                       59.3    9e-08   
ref|WP_015209426.1|  ferredoxin                                       58.9    1e-07   
ref|WP_011431947.1|  iron ABC transporter substrate-binding protein   58.5    2e-07   
ref|WP_011429540.1|  iron ABC transporter substrate-binding protein   58.2    2e-07   
ref|WP_006195023.1|  iron ABC transporter substrate-binding protein   58.2    2e-07   
ref|WP_015218419.1|  ferredoxin                                       58.2    3e-07   
ref|WP_008191595.1|  iron ABC transporter substrate-binding protein   58.2    3e-07   
ref|WP_011613812.1|  iron ABC transporter substrate-binding protein   58.2    3e-07   
ref|XP_002953816.1|  hypothetical protein VOLCADRAFT_64100            58.2    3e-07   
ref|WP_016952452.1|  iron ABC transporter substrate-binding protein   57.8    3e-07   
ref|WP_013190041.1|  iron ABC transporter substrate-binding protein   57.4    4e-07   
ref|WP_012162533.1|  iron ABC transporter substrate-binding protein   57.4    5e-07   
ref|WP_037219685.1|  iron ABC transporter substrate-binding protein   57.0    6e-07   
ref|WP_010474496.1|  iron ABC transporter substrate-binding protein   57.0    7e-07   
ref|WP_015190116.1|  ferredoxin                                       56.6    7e-07   
ref|WP_015132906.1|  ferredoxin                                       57.0    7e-07   
ref|WP_015216294.1|  ferredoxin                                       56.6    7e-07   
ref|WP_006631487.1|  iron ABC transporter substrate-binding protein   56.6    7e-07   
ref|XP_001695531.1|  2Fe-2S ferredoxin                                57.0    8e-07   Chlamydomonas reinhardtii
ref|WP_009628823.1|  ferredoxin                                       56.6    9e-07   
ref|WP_013322272.1|  iron ABC transporter substrate-binding protein   56.2    1e-06   
ref|WP_009455493.1|  MULTISPECIES: iron ABC transporter substrate...  56.2    1e-06   
ref|WP_012407088.1|  iron ABC transporter substrate-binding protein   55.8    1e-06   
ref|WP_036008260.1|  iron ABC transporter substrate-binding protein   55.8    2e-06   
ref|WP_006101464.1|  iron ABC transporter substrate-binding protein   55.8    2e-06   
ref|WP_016874262.1|  iron ABC transporter substrate-binding protein   55.5    2e-06   
ref|WP_027403249.1|  iron ABC transporter substrate-binding protein   55.5    2e-06   
ref|WP_026721485.1|  iron ABC transporter substrate-binding protein   55.5    2e-06   
ref|WP_039200258.1|  iron ABC transporter substrate-binding protein   55.5    2e-06   
ref|WP_017311897.1|  iron ABC transporter substrate-binding protein   55.5    2e-06   
ref|WP_015147815.1|  ferredoxin                                       55.1    2e-06   
ref|WP_023076016.1|  ferredoxin                                       55.5    2e-06   
ref|WP_016864736.1|  iron ABC transporter substrate-binding protein   55.1    2e-06   
ref|WP_017719765.1|  iron ABC transporter substrate-binding protein   55.1    3e-06   
ref|WP_039743855.1|  iron ABC transporter substrate-binding protein   55.1    3e-06   
ref|WP_015166068.1|  ferredoxin                                       54.7    4e-06   
ref|WP_011057369.1|  iron ABC transporter substrate-binding protein   55.1    4e-06   
ref|WP_026101278.1|  iron ABC transporter substrate-binding protein   54.7    4e-06   
ref|WP_019492324.1|  iron ABC transporter substrate-binding protein   54.7    4e-06   
ref|WP_016863374.1|  iron ABC transporter substrate-binding protein   54.3    5e-06   
ref|WP_027845148.1|  iron ABC transporter substrate-binding protein   54.3    6e-06   
ref|WP_017323135.1|  iron ABC transporter substrate-binding protein   54.3    6e-06   
ref|WP_026731793.1|  iron ABC transporter substrate-binding protein   54.3    6e-06   
ref|WP_015955483.1|  iron ABC transporter substrate-binding protein   54.3    6e-06   
ref|WP_024124589.1|  ferredoxin (2Fe-2S)                              54.3    6e-06   
ref|WP_025781684.1|  hypothetical protein                             54.7    6e-06   
ref|WP_023066838.1|  2Fe-2S iron-sulfur cluster binding domain pr...  53.5    8e-06   
ref|WP_015186075.1|  ferredoxin                                       53.9    8e-06   
ref|WP_015160171.1|  ferredoxin                                       53.5    9e-06   
ref|WP_028082439.1|  iron ABC transporter substrate-binding protein   53.5    9e-06   
ref|WP_035149126.1|  iron ABC transporter substrate-binding protein   53.5    1e-05   
ref|WP_011243144.1|  ferredoxin                                       54.3    1e-05   
ref|WP_009782902.1|  iron ABC transporter substrate-binding protein   53.5    1e-05   
ref|WP_036477598.1|  iron ABC transporter substrate-binding protein   53.5    1e-05   
ref|WP_007100551.1|  ferredoxin                                       53.9    1e-05   
ref|WP_006512418.1|  ferredoxin                                       53.1    1e-05   
ref|WP_019502206.1|  iron ABC transporter substrate-binding protein   53.1    1e-05   
gb|EAZ92725.1|  hydrogenase component                                 52.8    2e-05   Cyanothece sp. CCY0110
ref|WP_029637864.1|  iron ABC transporter substrate-binding prote...  52.8    2e-05   
ref|WP_026786683.1|  MULTISPECIES: iron ABC transporter substrate...  52.8    2e-05   
tpg|DAA55519.1|  TPA: hypothetical protein ZEAMMB73_916473            55.8    2e-05   
ref|WP_035798607.1|  iron ABC transporter substrate-binding protein   52.8    2e-05   
ref|WP_009768006.1|  ferredoxin                                       52.4    2e-05   
gb|AIE74406.1|  Ferredoxin                                            52.4    2e-05   
ref|WP_038023870.1|  ferredoxin                                       53.5    2e-05   
gb|KDO79620.1|  hypothetical protein CISIN_1g029369mg                 53.1    2e-05   
ref|WP_017662478.1|  iron ABC transporter substrate-binding protein   52.0    3e-05   
gb|EAU72934.1|  possible ferredoxin (2Fe-2S)                          53.5    3e-05   Synechococcus sp. RS9916
ref|WP_012626344.1|  iron ABC transporter substrate-binding protein   52.0    3e-05   
ref|WP_026080057.1|  iron ABC transporter substrate-binding protein   52.0    3e-05   
gb|KEI65819.1|  hypothetical protein A19Y_0644                        52.0    3e-05   
ref|WP_026797768.1|  iron ABC transporter substrate-binding protein   52.0    4e-05   
ref|WP_015120289.1|  ferredoxin                                       52.0    4e-05   
ref|WP_017712749.1|  hypothetical protein                             52.0    4e-05   
ref|WP_036536305.1|  iron ABC transporter substrate-binding protein   51.6    5e-05   
ref|WP_012596125.1|  MULTISPECIES: iron ABC transporter substrate...  51.6    5e-05   
ref|WP_015079947.1|  ferredoxin                                       51.6    5e-05   
ref|WP_036486592.1|  iron ABC transporter substrate-binding protein   51.6    5e-05   
ref|WP_012361495.1|  iron ABC transporter substrate-binding protein   51.6    5e-05   
ref|WP_010995058.1|  iron ABC transporter substrate-binding protein   51.6    5e-05   
ref|WP_015169926.1|  ferredoxin                                       51.6    5e-05   
gb|AAL05047.1|AF410434_1  putative [2Fe-2S] ferredoxin                51.6    5e-05   Anabaena variabilis
ref|WP_009546126.1|  iron ABC transporter substrate-binding protein   51.6    5e-05   
ref|WP_006516451.1|  ferredoxin                                       51.2    5e-05   
ref|WP_017300175.1|  hypothetical protein                             51.6    6e-05   
ref|WP_017316271.1|  iron ABC transporter substrate-binding protein   51.2    6e-05   
ref|WP_011321157.1|  iron ABC transporter substrate-binding protein   51.2    6e-05   
ref|WP_015199279.1|  ferredoxin                                       51.2    6e-05   
ref|WP_006620154.1|  MULTISPECIES: iron ABC transporter substrate...  51.2    6e-05   
ref|WP_035985902.1|  iron ABC transporter substrate-binding protein   51.2    7e-05   
ref|WP_015125663.1|  ferredoxin                                       51.2    7e-05   
ref|WP_015145091.1|  ferredoxin                                       50.8    8e-05   
ref|WP_011826815.1|  ferredoxin                                       51.2    8e-05   
ref|WP_011131031.1|  ferredoxin                                       51.2    8e-05   
ref|WP_010872997.1|  iron ABC transporter substrate-binding protein   50.8    9e-05   
gb|KDO79622.1|  hypothetical protein CISIN_1g029369mg                 51.6    9e-05   
ref|WP_009632365.1|  ferredoxin                                       50.8    1e-04   
ref|WP_015194077.1|  ferredoxin                                       50.4    1e-04   
ref|WP_012307752.1|  MULTISPECIES: iron ABC transporter substrate...  50.4    1e-04   
ref|WP_017293744.1|  iron ABC transporter substrate-binding protein   50.4    1e-04   
ref|WP_015136747.1|  ferredoxin                                       50.4    1e-04   
ref|WP_002736984.1|  iron ABC transporter substrate-binding protein   50.4    1e-04   
ref|WP_032517434.1|  ferredoxin                                       50.4    1e-04   
ref|WP_015225897.1|  ferredoxin                                       50.4    1e-04   
ref|WP_015221410.1|  ferredoxin                                       50.1    1e-04   
ref|WP_036911276.1|  MULTISPECIES: ferredoxin                         50.4    1e-04   
ref|WP_021829075.1|  Ferredoxin                                       50.1    1e-04   
ref|WP_007309986.1|  iron ABC transporter substrate-binding protein   50.1    2e-04   
ref|WP_002801057.1|  iron ABC transporter substrate-binding protein   50.1    2e-04   
ref|XP_006476194.1|  PREDICTED: uncharacterized protein LOC102630...  51.2    2e-04   
gb|KGG28772.1|  Ferredoxin                                            50.4    2e-04   
ref|WP_026148445.1|  hypothetical protein                             49.7    2e-04   
ref|WP_024545606.1|  iron ABC transporter substrate-binding protein   49.7    2e-04   
ref|WP_039727861.1|  iron ABC transporter substrate-binding protein   49.7    2e-04   
ref|WP_012194906.1|  ferredoxin                                       49.7    2e-04   
ref|WP_015228303.1|  ferredoxin                                       49.3    3e-04   
ref|WP_026735926.1|  iron ABC transporter substrate-binding protein   49.3    3e-04   
ref|WP_019507799.1|  iron ABC transporter substrate-binding protein   49.3    3e-04   
gb|ABE10842.1|  putative ferredoxin                                   49.7    3e-04   
ref|WP_029982015.1|  ferredoxin                                       49.3    3e-04   
ref|WP_002761301.1|  iron ABC transporter substrate-binding protein   49.3    3e-04   
ref|WP_025900322.1|  ferredoxin                                       48.9    3e-04   
ref|WP_029960933.1|  ferredoxin                                       48.9    3e-04   
ref|WP_029953095.1|  ferredoxin                                       48.9    4e-04   
ref|WP_025937381.1|  ferredoxin                                       49.3    4e-04   
ref|WP_029982626.1|  ferredoxin                                       48.9    4e-04   
ref|WP_032527599.1|  ferredoxin                                       49.3    4e-04   
ref|WP_024968598.1|  iron ABC transporter substrate-binding protein   48.9    4e-04   
ref|WP_025961791.1|  ferredoxin                                       48.9    4e-04   
gb|AIQ94384.1|  Ferredoxin                                            49.3    4e-04   
ref|WP_032558233.1|  ferredoxin                                       48.9    4e-04   
ref|WP_008230932.1|  Ferredoxin                                       48.9    4e-04   
ref|WP_025951822.1|  ferredoxin                                       48.9    5e-04   
gb|ELS47510.1|  putative ferredoxin                                   48.5    5e-04   
ref|WP_011817803.1|  ferredoxin                                       48.9    5e-04   
ref|WP_025965338.1|  ferredoxin                                       48.9    5e-04   
ref|WP_002790976.1|  iron ABC transporter substrate-binding protein   48.5    5e-04   
ref|WP_025927978.1|  ferredoxin                                       48.9    5e-04   
ref|WP_011375883.1|  ferredoxin                                       48.9    5e-04   
ref|WP_008199024.1|  iron ABC transporter substrate-binding protein   48.5    5e-04   
ref|WP_025893996.1|  MULTISPECIES: ferredoxin                         48.9    5e-04   
ref|WP_025890419.1|  MULTISPECIES: ferredoxin                         48.9    5e-04   
gb|ABE11481.1|  putative ferredoxin                                   48.5    6e-04   
ref|XP_005781002.1|  hypothetical protein EMIHUDRAFT_59853            48.1    6e-04   
ref|WP_002795594.1|  iron ABC transporter substrate-binding protein   48.5    6e-04   
ref|WP_025922899.1|  ferredoxin                                       48.5    6e-04   
ref|WP_011862352.1|  ferredoxin                                       48.5    6e-04   
ref|XP_002182418.1|  predicted protein                                50.8    6e-04   
ref|WP_011124511.1|  ferredoxin                                       48.5    7e-04   
ref|WP_002766752.1|  iron ABC transporter substrate-binding protein   48.1    7e-04   
ref|WP_025914165.1|  ferredoxin                                       48.5    7e-04   
ref|WP_007307975.1|  iron ABC transporter substrate-binding protein   48.1    7e-04   
ref|WP_025929158.1|  ferredoxin                                       48.5    7e-04   
ref|WP_025925982.1|  ferredoxin                                       48.5    7e-04   
ref|WP_015171180.1|  ferredoxin                                       48.1    7e-04   
ref|WP_036891667.1|  MULTISPECIES: ferredoxin                         48.1    8e-04   
ref|WP_002782874.1|  Ferredoxin                                       48.1    8e-04   
ref|WP_032524065.1|  ferredoxin                                       48.1    9e-04   



>ref|XP_007024240.1| NDH-dependent cyclic electron flow 1 isoform 1 [Theobroma cacao]
 gb|EOY26862.1| NDH-dependent cyclic electron flow 1 isoform 1 [Theobroma cacao]
Length=194

 Score =   207 bits (528),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 144/199 (72%), Gaps = 14/199 (7%)
 Frame = +1

Query  100  LKMNSYGLLPSFSSPSYKYNFNNPKYLTTIIHPKRFTASPNLSRNISGGKIRASGSTVTP  279
            L++N++GL  + S P YK+NF +  +       K    S +LS  IS G+IRA  + +  
Sbjct  4    LQLNTHGL-ATLSVP-YKFNFTSSSH-------KALGLSRHLS--ISRGRIRAVRTVLES  52

Query  280  DEAE---EEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAl  450
            +      EE   V  AFVHSVL PDG+PDVH+R A GGQKLRDIMLD N+ELYGPY+R L
Sbjct  53   ESLAREPEEPPAVDFAFVHSVLLPDGTPDVHFRSACGGQKLRDIMLDNNIELYGPYARPL  112

Query  451  cncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVI  630
             NC G GTCGTCMVEVVEGKELL+PRT+KE EKLKRKP+NWRLACQTTVG P+S+G LVI
Sbjct  113  LNCAGGGTCGTCMVEVVEGKELLTPRTDKEKEKLKRKPKNWRLACQTTVGKPDSRGLLVI  172

Query  631  QQLPEWKGHEWNYKELKSS  687
            QQLPEWK HEW Y+ +  S
Sbjct  173  QQLPEWKAHEWTYETIAPS  191



>ref|XP_006465658.1| PREDICTED: uncharacterized protein LOC102626236 isoform X1 [Citrus 
sinensis]
 ref|XP_006465659.1| PREDICTED: uncharacterized protein LOC102626236 isoform X2 [Citrus 
sinensis]
 ref|XP_006465660.1| PREDICTED: uncharacterized protein LOC102626236 isoform X3 [Citrus 
sinensis]
 ref|XP_006465661.1| PREDICTED: uncharacterized protein LOC102626236 isoform X4 [Citrus 
sinensis]
Length=195

 Score =   204 bits (520),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 145/200 (73%), Gaps = 16/200 (8%)
 Frame = +1

Query  100  LKMNSYGLLPSFSSPSYKYNFNNPKYLTTIIHPK-RFTASPNLSRNISGGKIRASGSTVT  276
            L++NSY  L S+S P   YNFN     TT  H   +F    + SR+    +IRA+ +   
Sbjct  4    LQLNSY-RLASYSLP---YNFN----CTTNSHKSLKFYKRVSFSRS----RIRATATISE  51

Query  277  PDE---AEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRA  447
             D    A EE  +V  AFVHSVL PDG+PD+H+R A GGQKLRDIML+ N++LYGPY+R 
Sbjct  52   NDSQANAAEEPPVVNFAFVHSVLLPDGTPDIHFRTACGGQKLRDIMLNSNIDLYGPYARP  111

Query  448  lcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLV  627
            L NC G GTCGTCMVEV+EGKELL  RT+KE EKLKRKP+NWRLACQTTVGTP+S G +V
Sbjct  112  LSNCAGGGTCGTCMVEVIEGKELLGSRTDKEKEKLKRKPKNWRLACQTTVGTPDSTGLVV  171

Query  628  IQQLPEWKGHEWNYKELKSS  687
            IQQLPEWKGHEW YK++ +S
Sbjct  172  IQQLPEWKGHEWKYKKIPTS  191



>ref|XP_006426910.1| hypothetical protein CICLE_v10026544mg [Citrus clementina]
 gb|ESR40150.1| hypothetical protein CICLE_v10026544mg [Citrus clementina]
Length=195

 Score =   201 bits (510),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 143/200 (72%), Gaps = 16/200 (8%)
 Frame = +1

Query  100  LKMNSYGLLPSFSSPSYKYNFNNPKYLTTIIHPK-RFTASPNLSRNISGGKIRASGSTVT  276
            L++NSY L    +S S  YNFN     TT  H   +F    + SR+    +IRA+ +   
Sbjct  4    LQLNSYRL----ASHSLPYNFN----CTTNSHKSLKFYNRVSFSRS----RIRATATIPK  51

Query  277  PDE---AEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRA  447
             D    A EE  +V  AFVHSVL PDG+PD+H+R A GGQKLRDIML+ N++LYGPY+R 
Sbjct  52   SDSQANAAEEPPVVNFAFVHSVLLPDGTPDIHFRTACGGQKLRDIMLNSNIDLYGPYARP  111

Query  448  lcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLV  627
            L NC G GTCGTCMVEV+EG ELL  RT+KE EKLKRKP+NWRLACQTTVGTP+S G +V
Sbjct  112  LSNCAGGGTCGTCMVEVIEGNELLGSRTDKEKEKLKRKPKNWRLACQTTVGTPDSTGLVV  171

Query  628  IQQLPEWKGHEWNYKELKSS  687
            IQQLPEWKGHEW Y+++ +S
Sbjct  172  IQQLPEWKGHEWKYEKIPTS  191



>ref|XP_004486767.1| PREDICTED: uncharacterized protein LOC101490201 [Cicer arietinum]
Length=191

 Score =   195 bits (496),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 131/197 (66%), Gaps = 21/197 (11%)
 Frame = +1

Query  97   ELKMNSYGLLPSFSSPSYKYNFNNPKYLTTIIHPKRFTASPNLSRNISGGKIRASGSTVT  276
            +LK+  Y  L S S  S+K+  NN   L              L+R     K+RA G+   
Sbjct  5    QLKLTPYHALTSLSHSSHKFRPNNRTLL--------------LART----KVRAIGTVPE  46

Query  277  PDEAEEEE---AMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRA  447
             D    +      V  AFV SVL PDG+PDVHYR A GGQKLR+IMLD N+ELYGPY R 
Sbjct  47   RDSQTTDSNDPPSVGFAFVSSVLLPDGTPDVHYRSASGGQKLRNIMLDSNIELYGPYGRI  106

Query  448  lcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLV  627
            L NC G GTC TCMVEV+EGKELLSPRT+KE EKLKRKP+NWRLACQTTVG P+S G +V
Sbjct  107  LLNCAGGGTCATCMVEVLEGKELLSPRTDKEKEKLKRKPKNWRLACQTTVGEPDSTGVVV  166

Query  628  IQQLPEWKGHEWNYKEL  678
            IQQLPEWKGHEW Y++ 
Sbjct  167  IQQLPEWKGHEWKYEKF  183



>gb|AFK42515.1| unknown [Lotus japonicus]
Length=195

 Score =   193 bits (491),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 137/203 (67%), Gaps = 21/203 (10%)
 Frame = +1

Query  97   ELKMNSYGL--LPSFSSPSYKYNFNNPKYLTTIIHPKRFTASPNLSRNISGGKIRASGST  270
            +L++ S+ L  LPSFS+ S++ N             + F  S  L  N +   IRA G+ 
Sbjct  5    QLQLTSHALCSLPSFSN-SFRPN-------------RTFHCSKRL--NFATTNIRAVGTV  48

Query  271  VTPD---EAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYS  441
               D    A +E   V  AFV SVL PDG+PD+HYR A GGQKLRDIMLD N+ELYGPY 
Sbjct  49   PERDLETTATDEPPSVGFAFVSSVLLPDGTPDIHYRSATGGQKLRDIMLDSNIELYGPYG  108

Query  442  RAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGT  621
            +   NC G GTC TCMVEV+EG ELL+PRT+KE EKLKRKP+NWRLACQTTVG P+S G 
Sbjct  109  KLFSNCAGGGTCATCMVEVLEGTELLNPRTDKEKEKLKRKPKNWRLACQTTVGEPDSTGV  168

Query  622  LVIQQLPEWKGHEWNYKELKSSG  690
            +VIQQLPEWKGHEW Y++ + S 
Sbjct  169  VVIQQLPEWKGHEWKYEKPEESA  191



>gb|KFK38978.1| hypothetical protein AALP_AA3G184200 [Arabis alpina]
Length=208

 Score =   193 bits (490),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 134/197 (68%), Gaps = 14/197 (7%)
 Frame = +1

Query  100  LKMNSYGLLPSFSSPSYKYNFNNPKYLTTIIHPKR--FTASPNLSRNISGGKIRASGSTV  273
            +++N  GL+ S S     +NF    + T  I+ K     +  N +R      IRA  +T 
Sbjct  4    VQLNGSGLVASLSP---NHNFT---HKTKFIYAKSSLLLSKHNATRLSRAKTIRAVSTTA  57

Query  274  ------TPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGP  435
                    DE ++E   V  AFVHSVL PDG+PDVH+R+A GGQKLRDIMLD N+ELYGP
Sbjct  58   PASQPQVADEPDDEPPAVDFAFVHSVLLPDGTPDVHWRRACGGQKLRDIMLDSNIELYGP  117

Query  436  YSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSK  615
            YS+ L NC G+GTC TCMVE+V GKELL+PRT+ E EKLKRKP+NWRLACQT VG P+S 
Sbjct  118  YSKPLSNCAGVGTCATCMVEIVNGKELLNPRTDIEKEKLKRKPKNWRLACQTNVGNPDST  177

Query  616  GTLVIQQLPEWKGHEWN  666
            G +VIQQLPEWK HEWN
Sbjct  178  GLVVIQQLPEWKAHEWN  194



>ref|XP_009599175.1| PREDICTED: uncharacterized protein LOC104094862 isoform X3 [Nicotiana 
tomentosiformis]
Length=195

 Score =   192 bits (488),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 136/184 (74%), Gaps = 14/184 (8%)
 Frame = +1

Query  154  YNFNNPKYLTTIIHPKRFTASPNLSRNISGGKIRASGSTVTPDEA-------EEEEAMVK  312
            YN +     ++I   K+  ASP+LS      KIRA G  + P++A       +EEEA VK
Sbjct  7    YNVSTSVSRSSIFKNKK-VASPSLS--FGRTKIRAVG--IVPEKASIGVLQEDEEEASVK  61

Query  313  IAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMV  492
             AFV SVL PDG+PDV  RKA GGQKLRDIMLD NVELYGPY+R L NCGG GTCGTC+V
Sbjct  62   FAFVSSVLLPDGTPDVQLRKACGGQKLRDIMLDANVELYGPYARPLLNCGGGGTCGTCLV  121

Query  493  EVVEGKELLSPRTEKEN--EKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWKGHEWN  666
            EVVEGKELL+PRT+KEN  ++LKR P+NWRLACQ  VG P+S+G +VIQQLPEWK HEWN
Sbjct  122  EVVEGKELLNPRTDKENNHDELKRHPKNWRLACQAIVGKPDSRGMMVIQQLPEWKAHEWN  181

Query  667  YKEL  678
            Y+ L
Sbjct  182  YRGL  185



>ref|XP_009758905.1| PREDICTED: uncharacterized protein LOC104211534 [Nicotiana sylvestris]
Length=197

 Score =   191 bits (486),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 127/171 (74%), Gaps = 11/171 (6%)
 Frame = +1

Query  190  IHPKRFTASPNLSRNISGGKIRASG------STVTPDEAEEEEAMVKIAFVHSVLFPDGS  351
            I   +  ASP+LS      KIRA G      S V P E +EE A VK AFV SVL PDG+
Sbjct  20   IFKNKKIASPSLS--FGRTKIRAVGTVPEKTSVVAPQE-DEEAASVKFAFVSSVLLPDGT  76

Query  352  PDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRT  531
            PDV  RKA GGQKLRDIMLD NVELYGPY+R L NCGG GTCGTC+VEVVEGKELL+PRT
Sbjct  77   PDVQLRKACGGQKLRDIMLDANVELYGPYARPLLNCGGGGTCGTCLVEVVEGKELLNPRT  136

Query  532  EKEN--EKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWKGHEWNYKEL  678
            +KEN  E LKR P+NWRLACQT VG P+S G +VIQQLPEWK HEWNY+ L
Sbjct  137  DKENNHEDLKRHPKNWRLACQTIVGKPDSIGMMVIQQLPEWKAHEWNYRGL  187



>ref|XP_009599174.1| PREDICTED: uncharacterized protein LOC104094862 isoform X2 [Nicotiana 
tomentosiformis]
Length=215

 Score =   192 bits (488),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 143/202 (71%), Gaps = 16/202 (8%)
 Frame = +1

Query  109  NSYGLLPSFSSPSYKYNFNNPKYLTTIIHPKRFTASPNLSRNIS----------GGKIRA  258
            N+ G L S  SPS++    + ++L T  H K   + P+  R ++          GGK + 
Sbjct  8    NNSGKLSSSFSPSFQRV--SVQFLQT--HNKHTCSLPSTPRPLTVISMAPPKPGGGKAKK  63

Query  259  SGSTVTPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPY  438
              +++   + +EEEA VK AFV SVL PDG+PDV  RKA GGQKLRDIMLD NVELYGPY
Sbjct  64   EKASIGVLQEDEEEASVKFAFVSSVLLPDGTPDVQLRKACGGQKLRDIMLDANVELYGPY  123

Query  439  SRAlcncgglgtcgtcMVEVVEGKELLSPRTEKEN--EKLKRKPRNWRLACQTTVGTPNS  612
            +R L NCGG GTCGTC+VEVVEGKELL+PRT+KEN  ++LKR P+NWRLACQ  VG P+S
Sbjct  124  ARPLLNCGGGGTCGTCLVEVVEGKELLNPRTDKENNHDELKRHPKNWRLACQAIVGKPDS  183

Query  613  KGTLVIQQLPEWKGHEWNYKEL  678
            +G +VIQQLPEWK HEWNY+ L
Sbjct  184  RGMMVIQQLPEWKAHEWNYRGL  205



>ref|XP_009114819.1| PREDICTED: uncharacterized protein LOC103840092 [Brassica rapa]
Length=204

 Score =   192 bits (487),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 134/192 (70%), Gaps = 8/192 (4%)
 Frame = +1

Query  100  LKMNSYGLLPSFSSP---SYKYNFNNPKYLTTIIHPKRFTASPNLSRNISGGKIRASGST  270
            +++N  GL+ S S     S+K   +NP+  ++ +  K   +     R IS     AS   
Sbjct  4    VQLNGSGLVASLSQNHIFSHKTKLSNPE--SSFLRSKHNASRAKTIRAISTAP--ASQPP  59

Query  271  VTPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAl  450
            V  DE  +E   V  AFVHSVL PDG+PDVH+R+A GGQKLRDIMLD N+ELYGPYS+ L
Sbjct  60   VA-DEPNDEPPAVDFAFVHSVLLPDGTPDVHWRRACGGQKLRDIMLDSNIELYGPYSKPL  118

Query  451  cncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVI  630
             NC G+GTC TCMVE+V GKELL+PRT+ E EKLKRKP+NWRLACQT VG P+S G +VI
Sbjct  119  SNCAGVGTCATCMVEIVNGKELLNPRTDIEKEKLKRKPKNWRLACQTNVGNPDSTGLVVI  178

Query  631  QQLPEWKGHEWN  666
            QQLPEWK HEWN
Sbjct  179  QQLPEWKAHEWN  190



>ref|XP_008462178.1| PREDICTED: uncharacterized protein LOC103500602 [Cucumis melo]
Length=197

 Score =   191 bits (485),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 125/151 (83%), Gaps = 5/151 (3%)
 Frame = +1

Query  247  KIRASGSTVTPDEAE----EEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDG  414
            ++RA G TV+  ++E    EE  +V +AFV+SVL PDG+PDVH+R+A GGQKLR+IMLD 
Sbjct  42   QVRAVG-TVSQSQSEATDPEEPPIVDLAFVNSVLLPDGTPDVHFRRACGGQKLRNIMLDS  100

Query  415  NVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTT  594
            N++LYGPYSR L NC G GTCGTCMVE+VEGKELL+PRT+ E +KLKRKP+NWRLACQTT
Sbjct  101  NIDLYGPYSRFLLNCAGGGTCGTCMVEIVEGKELLNPRTDIEKDKLKRKPKNWRLACQTT  160

Query  595  VGTPNSKGTLVIQQLPEWKGHEWNYKELKSS  687
            VG P+S+G LV+QQLPEWK HEW Y+E+  S
Sbjct  161  VGKPDSRGMLVVQQLPEWKAHEWGYEEVDLS  191



>ref|XP_002885131.1| hypothetical protein ARALYDRAFT_897928 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61390.1| hypothetical protein ARALYDRAFT_897928 [Arabidopsis lyrata subsp. 
lyrata]
Length=204

 Score =   191 bits (484),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 130/192 (68%), Gaps = 9/192 (5%)
 Frame = +1

Query  100  LKMNSYGL---LPSFSSPSYKYNFNNPKYLTTIIHPKRFTASPNLSRNISGGKIRASGST  270
            +++N  GL   LP   S S+K   +NPK  +  +  K   A     R IS        + 
Sbjct  4    VQLNGSGLVASLPPNHSFSHKTKLSNPK--SYFLRSKHNAAGTKTVRAISTAPASQPPAA  61

Query  271  VTPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAl  450
              PDE       V  AFVHSVL PDG+PDVH+R+A GGQKLRDIMLD N+ELYGPYS+ L
Sbjct  62   DEPDEP----PAVDFAFVHSVLLPDGTPDVHWRRACGGQKLRDIMLDSNIELYGPYSKPL  117

Query  451  cncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVI  630
             NC G+GTC TCMVE+V GKELL+PRT+ E EKLKRKP+NWRLACQT VG P+S G +VI
Sbjct  118  SNCAGVGTCATCMVEIVNGKELLNPRTDIEKEKLKRKPKNWRLACQTNVGNPDSTGLVVI  177

Query  631  QQLPEWKGHEWN  666
            QQLPEWK HEWN
Sbjct  178  QQLPEWKAHEWN  189



>emb|CDX97734.1| BnaA05g23450D [Brassica napus]
Length=204

 Score =   191 bits (484),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 130/192 (68%), Gaps = 8/192 (4%)
 Frame = +1

Query  100  LKMNSYGLLPSFSSP---SYKYNFNNPKYLTTIIHPKRFTASPNLSRNISGGKIRASGST  270
            +++N  GL+ S S     S+K   +NPK  ++ +  K         R IS          
Sbjct  4    VQLNGSGLVASLSPTHIFSHKTKLSNPK--SSFLRSKDNATRTKTIRAISTAPASQPPVA  61

Query  271  VTPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAl  450
              PD+   E   V  AFVHSVL PDG+PDVH+R+A GGQKLRDIMLD N+ELYGPYS+ L
Sbjct  62   AEPDD---EPPAVDFAFVHSVLLPDGTPDVHWRRACGGQKLRDIMLDTNIELYGPYSKPL  118

Query  451  cncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVI  630
             NC G+GTC TCMVE+V GKELL+PRT+ E EKLKRKP+NWRLACQT VG P+S G +VI
Sbjct  119  SNCAGVGTCATCMVEIVNGKELLNPRTDIEKEKLKRKPKNWRLACQTNVGNPDSTGLVVI  178

Query  631  QQLPEWKGHEWN  666
            QQLPEWK HEWN
Sbjct  179  QQLPEWKAHEWN  190



>ref|XP_011004924.1| PREDICTED: uncharacterized protein LOC105111310 [Populus euphratica]
Length=195

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 143/197 (73%), Gaps = 21/197 (11%)
 Frame = +1

Query  100  LKMNSYGLLPSFSSPSYKYNFNNPKYLTTIIHPKRFTASPNLSRNISGGKIRASGSTVTP  279
            L++NSYGL P F  P+ K            + P R T S + SR     KIRA  STV  
Sbjct  4    LQLNSYGLAP-FQVPTNKS-----------LKPSRHTISFSPSRL----KIRAV-STVPE  46

Query  280  DEAE----EEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRA  447
              +E    EE   V +AFVHSVL PDG+PDVH+R A GGQKLRDIM+D N+ELYGPYSRA
Sbjct  47   SSSEAKEPEEPPCVHLAFVHSVLLPDGTPDVHFRNAPGGQKLRDIMMDTNIELYGPYSRA  106

Query  448  lcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLV  627
            L NCGG GTC TCMVEV+EGKELLSPRT+ E EKLK+KP+NWRLACQTTVG P+S+G +V
Sbjct  107  LLNCGGGGTCATCMVEVIEGKELLSPRTDNEKEKLKKKPKNWRLACQTTVGNPDSRGLVV  166

Query  628  IQQLPEWKGHEWNYKEL  678
            IQQLPEWK HEWNY++L
Sbjct  167  IQQLPEWKAHEWNYEKL  183



>ref|XP_002299725.1| hypothetical protein POPTR_0001s18740g [Populus trichocarpa]
 gb|ABK95098.1| unknown [Populus trichocarpa]
 gb|EEE84530.1| hypothetical protein POPTR_0001s18740g [Populus trichocarpa]
Length=195

 Score =   189 bits (481),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 143/197 (73%), Gaps = 21/197 (11%)
 Frame = +1

Query  100  LKMNSYGLLPSFSSPSYKYNFNNPKYLTTIIHPKRFTASPNLSRNISGGKIRASGSTVTP  279
            L++NSYGL P F  P+ K            + P R T S + SR     KIRA  STV  
Sbjct  4    LQLNSYGLAP-FQVPTNKS-----------LKPSRHTISFSPSRL----KIRAV-STVPE  46

Query  280  DEAE----EEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRA  447
              +E    EE   V +AFVHSVL PDG+PDVH+R A GGQKLRDIM+D N+ELYGPYSRA
Sbjct  47   SSSEAKEPEEPPCVHLAFVHSVLLPDGTPDVHFRNAPGGQKLRDIMMDTNIELYGPYSRA  106

Query  448  lcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLV  627
            L NCGG GTC TCMVEV+EGKELLSPRT+ E EKLK+KP+NWRLACQTTVG P+S+G +V
Sbjct  107  LLNCGGGGTCATCMVEVIEGKELLSPRTDNEKEKLKKKPKNWRLACQTTVGNPDSRGLVV  166

Query  628  IQQLPEWKGHEWNYKEL  678
            IQQLPEWK HEWNY++L
Sbjct  167  IQQLPEWKAHEWNYEKL  183



>emb|CDY20191.1| BnaA01g28110D [Brassica napus]
Length=204

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 134/192 (70%), Gaps = 8/192 (4%)
 Frame = +1

Query  100  LKMNSYGLLPSFSSP---SYKYNFNNPKYLTTIIHPKRFTASPNLSRNISGGKIRASGST  270
            +++N  GL+ S S     S+K   +NP+  ++ +  K   +     R IS     AS   
Sbjct  4    VQLNGSGLVASLSQNHIFSHKTKLSNPE--SSFLRSKHNASRAKTIRAISTAP--ASQPP  59

Query  271  VTPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAl  450
            V  DE  +E   +  AFVHSVL PDG+PDVH+R+A GGQKLRDIMLD N+ELYGPYS+ L
Sbjct  60   VA-DEPNDEPPAMDFAFVHSVLLPDGTPDVHWRRACGGQKLRDIMLDSNIELYGPYSKPL  118

Query  451  cncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVI  630
             NC G+GTC TCMVE+V GKELL+PRT+ E EKLKRKP+NWRLACQT VG P+S G +VI
Sbjct  119  SNCAGVGTCATCMVEIVNGKELLNPRTDIEKEKLKRKPKNWRLACQTNVGYPDSTGLVVI  178

Query  631  QQLPEWKGHEWN  666
            QQLPEWK HEWN
Sbjct  179  QQLPEWKAHEWN  190



>ref|XP_009599173.1| PREDICTED: uncharacterized protein LOC104094862 isoform X1 [Nicotiana 
tomentosiformis]
Length=248

 Score =   191 bits (485),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 128/166 (77%), Gaps = 13/166 (8%)
 Frame = +1

Query  208  TASPNLSRNISGGKIRASGSTVTPDEA-------EEEEAMVKIAFVHSVLFPDGSPDVHY  366
             ASP+LS      KIRA G  + P++A       +EEEA VK AFV SVL PDG+PDV  
Sbjct  77   VASPSLS--FGRTKIRAVG--IVPEKASIGVLQEDEEEASVKFAFVSSVLLPDGTPDVQL  132

Query  367  RKAKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKEN-  543
            RKA GGQKLRDIMLD NVELYGPY+R L NCGG GTCGTC+VEVVEGKELL+PRT+KEN 
Sbjct  133  RKACGGQKLRDIMLDANVELYGPYARPLLNCGGGGTCGTCLVEVVEGKELLNPRTDKENN  192

Query  544  -EKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWKGHEWNYKEL  678
             ++LKR P+NWRLACQ  VG P+S+G +VIQQLPEWK HEWNY+ L
Sbjct  193  HDELKRHPKNWRLACQAIVGKPDSRGMMVIQQLPEWKAHEWNYRGL  238



>ref|XP_011072397.1| PREDICTED: uncharacterized protein LOC105157664 [Sesamum indicum]
Length=193

 Score =   189 bits (479),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 116/143 (81%), Gaps = 2/143 (1%)
 Frame = +1

Query  247  KIRA--SGSTVTPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNV  420
            KIRA  + +   P   +EE A V  AFV  VL PDG+PDVHYR+A GGQKLRD+MLD +V
Sbjct  37   KIRAVQTSNDAQPAPPQEEPAAVNFAFVSPVLLPDGTPDVHYRRACGGQKLRDVMLDNDV  96

Query  421  ELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVG  600
            ELYGPY+R L NCGG GTCGTC+VEVVEGKELLSPRT+KE EKLKR P+NWRLACQTTVG
Sbjct  97   ELYGPYARPLLNCGGGGTCGTCIVEVVEGKELLSPRTDKEKEKLKRNPKNWRLACQTTVG  156

Query  601  TPNSKGTLVIQQLPEWKGHEWNY  669
             P+S+G +VIQQLPEWK H+W Y
Sbjct  157  RPDSRGVVVIQQLPEWKAHQWTY  179



>ref|XP_006298569.1| hypothetical protein CARUB_v10014651mg [Capsella rubella]
 gb|EOA31467.1| hypothetical protein CARUB_v10014651mg [Capsella rubella]
Length=205

 Score =   189 bits (480),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 134/195 (69%), Gaps = 14/195 (7%)
 Frame = +1

Query  100  LKMNSYGLLPSFS---SPSYKYNFNNPK-YLTTIIHPKRFTASPNLSRNISGGKIRASGS  267
            +++N  GL+ S S   S S+K   +N K Y     H        N +R  +   I  + +
Sbjct  4    VQLNGSGLVASLSPNHSFSHKIKLSNAKSYFLRSKH--------NATRAKTIRAISTAPT  55

Query  268  TVTP--DEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYS  441
            +  P  DE  +E   V  AFVHSVL PDG+PDVH+R+A GGQKLRDIMLD N+ELYGPYS
Sbjct  56   SQPPAADEPNDEPPSVDFAFVHSVLLPDGTPDVHWRRACGGQKLRDIMLDSNIELYGPYS  115

Query  442  RAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGT  621
            + L NC G+GTC TCMVE+V GKELL+PRT+ E EKLKRKP+NWRLACQT VG P+S G 
Sbjct  116  KPLSNCAGVGTCATCMVEIVNGKELLNPRTDIEKEKLKRKPKNWRLACQTNVGNPDSTGL  175

Query  622  LVIQQLPEWKGHEWN  666
            +VIQQLPEWK HEWN
Sbjct  176  VVIQQLPEWKAHEWN  190



>ref|XP_006406856.1| hypothetical protein EUTSA_v10021523mg [Eutrema salsugineum]
 gb|ESQ48309.1| hypothetical protein EUTSA_v10021523mg [Eutrema salsugineum]
Length=208

 Score =   189 bits (480),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 136/194 (70%), Gaps = 9/194 (5%)
 Frame = +1

Query  100  LKMNSYGLLPSFS---SPSYKYNFNN--PKYLTTIIHPKRFTASPNLSRNISGGKIRASG  264
            +++N   L+ S S   S S+K    N  P +L +  +  R + +  + R IS     AS 
Sbjct  4    VQLNGSSLVASLSPNHSFSHKTKLCNLKPSFLRSRHNATRLSRAKTI-RAISTAP--ASQ  60

Query  265  STVTPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSR  444
             +V  DE  +E   V  AFVHSVL PDG+PDVH+R+A GGQKLRDIMLD N+ELYGPYS+
Sbjct  61   PSVA-DEPVDEPPAVDFAFVHSVLLPDGTPDVHWRRACGGQKLRDIMLDSNIELYGPYSK  119

Query  445  AlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTL  624
             L NC G+GTC TCMVE+V GKELL+PRT+ E EKLKRKP+NWRLACQT VG P+S G +
Sbjct  120  PLSNCAGVGTCATCMVEIVNGKELLNPRTDIEKEKLKRKPKNWRLACQTKVGNPDSTGLV  179

Query  625  VIQQLPEWKGHEWN  666
            VIQQLPEWK HEWN
Sbjct  180  VIQQLPEWKAHEWN  193



>ref|XP_004245440.1| PREDICTED: uncharacterized protein LOC101258885 [Solanum lycopersicum]
Length=192

 Score =   188 bits (478),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 114/144 (79%), Gaps = 5/144 (3%)
 Frame = +1

Query  247  KIRASGSTVTPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVEL  426
            KI+A  S+      E+EEA VK AFV SVL PDG+PDV  RKA GGQKLRDIMLD NVEL
Sbjct  36   KIKAVASS-----HEKEEACVKFAFVSSVLLPDGTPDVQLRKACGGQKLRDIMLDANVEL  90

Query  427  YGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTP  606
            YGPY+R L NCGG GTC TC+VEVVEGKELL+PRT+KENE LKR P NWRLACQ  VG P
Sbjct  91   YGPYARPLLNCGGGGTCATCLVEVVEGKELLNPRTDKENENLKRHPNNWRLACQAIVGKP  150

Query  607  NSKGTLVIQQLPEWKGHEWNYKEL  678
            +S+G + IQQLPEWK HEWNY+ L
Sbjct  151  DSRGMMTIQQLPEWKAHEWNYRGL  174



>gb|EYU21482.1| hypothetical protein MIMGU_mgv1a014196mg [Erythranthe guttata]
Length=198

 Score =   188 bits (478),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 130/191 (68%), Gaps = 9/191 (5%)
 Frame = +1

Query  100  LKMNSYGLLPSFS-SPSYKYNFNNPKYLTTIIHPKRFTASPNLSRNISGGKIRASGSTVT  276
            +++NS+ L   FS S ++K +   P     I   K           +SG +  A+ + V 
Sbjct  4    IQLNSHNLTSLFSKSNNFKNSLKTPHNNNHISFSK--VKKIRAVETVSGAESEAAPAAV-  60

Query  277  PDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAlcn  456
                 EE   V  AFV SVL PDG+PDVHYR A GGQKLRDIMLD N+ELYGPYSR L N
Sbjct  61   -----EENPAVNFAFVSSVLLPDGTPDVHYRTASGGQKLRDIMLDNNIELYGPYSRPLLN  115

Query  457  cgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQ  636
            CGG GTC TC+VEVV+G+ELLSPRT+KE EKLKR P+NWRLACQ TVG P+SKG +VIQQ
Sbjct  116  CGGGGTCATCIVEVVDGRELLSPRTDKEKEKLKRNPKNWRLACQATVGRPDSKGLVVIQQ  175

Query  637  LPEWKGHEWNY  669
            LPEWK HEW Y
Sbjct  176  LPEWKAHEWTY  186



>ref|XP_004141758.1| PREDICTED: uncharacterized protein LOC101218377 [Cucumis sativus]
 ref|XP_004158999.1| PREDICTED: uncharacterized protein LOC101228255 [Cucumis sativus]
 gb|KGN45396.1| hypothetical protein Csa_7G447110 [Cucumis sativus]
Length=197

 Score =   188 bits (478),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 124/151 (82%), Gaps = 5/151 (3%)
 Frame = +1

Query  247  KIRASGSTVTPDEAE----EEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDG  414
            ++RA G TV   ++E    EE  +V +AFV+SVL PDG+PDVH R+A GGQKLR+IMLD 
Sbjct  42   QVRAVG-TVPQSQSEATDPEEPPIVDLAFVNSVLLPDGTPDVHLRRACGGQKLRNIMLDS  100

Query  415  NVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTT  594
            N++LYGPYSR L NC G GTCGTCMVE+VEGKELL+PRT+ E +KLKRKP+NWRLACQTT
Sbjct  101  NIDLYGPYSRFLLNCAGGGTCGTCMVEIVEGKELLNPRTDIEKDKLKRKPKNWRLACQTT  160

Query  595  VGTPNSKGTLVIQQLPEWKGHEWNYKELKSS  687
            VG P+S+G LV+QQLPEWK HEW Y+E++ S
Sbjct  161  VGKPDSRGMLVVQQLPEWKAHEWGYEEVELS  191



>ref|XP_009146157.1| PREDICTED: uncharacterized protein LOC103869841 [Brassica rapa]
Length=204

 Score =   188 bits (477),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 130/192 (68%), Gaps = 8/192 (4%)
 Frame = +1

Query  100  LKMNSYGLLPSFSSP---SYKYNFNNPKYLTTIIHPKRFTASPNLSRNISGGKIRASGST  270
            ++++  GL+ S S     S+K   +NPK  ++ +  K         R IS          
Sbjct  4    VQLSGSGLVASLSPTHIFSHKTKLSNPK--SSFLRSKDNAPRTKTIRAISTAPTSQPPVA  61

Query  271  VTPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAl  450
              PD+   E   V  AFVHSVL PDG+PDVH+R+A GGQKLRDIMLD N+ELYGPYS+ L
Sbjct  62   AEPDD---EPPAVDFAFVHSVLLPDGTPDVHWRRACGGQKLRDIMLDTNIELYGPYSKPL  118

Query  451  cncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVI  630
             NC G+GTC TCMVE+V GKELL+PRT+ E EKLKRKP+NWRLACQT VG P+S G +VI
Sbjct  119  SNCAGVGTCATCMVEIVNGKELLNPRTDIEKEKLKRKPKNWRLACQTNVGNPDSTGLVVI  178

Query  631  QQLPEWKGHEWN  666
            QQLPEWK HEWN
Sbjct  179  QQLPEWKAHEWN  190



>ref|XP_010098112.1| hypothetical protein L484_026246 [Morus notabilis]
 gb|EXB74549.1| hypothetical protein L484_026246 [Morus notabilis]
Length=199

 Score =   187 bits (476),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 132/182 (73%), Gaps = 9/182 (5%)
 Frame = +1

Query  157  NFNNPKYLT-TIIHPKRFTASPNLSRNISGGKIRASGSTVTPDEAEEEEA----MVKIAF  321
            NFN   Y+T T   PK+    P       GGKIRA  +T+   E+E+ EA     V  AF
Sbjct  19   NFN---YITNTQKTPKKTYYKPLSFSRTRGGKIRAI-TTIPDSESEDIEADGPPSVDFAF  74

Query  322  VHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVV  501
              S L PDG+PDV  R+A GGQKLRDIML+ N++LYGPYSR L NC G GTCGTCMVEV+
Sbjct  75   FSSSLLPDGTPDVLLRRACGGQKLRDIMLEANIDLYGPYSRPLLNCAGGGTCGTCMVEVI  134

Query  502  EGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWKGHEWNYKELK  681
            EGKELLSPRT+KE EKLKRKP+NWRLACQT VG P+S+G +V+QQLPEWK HEW+Y+E+ 
Sbjct  135  EGKELLSPRTDKEKEKLKRKPKNWRLACQTKVGEPDSRGLVVVQQLPEWKSHEWSYEEID  194

Query  682  SS  687
             S
Sbjct  195  PS  196



>ref|XP_010691367.1| PREDICTED: uncharacterized protein LOC104904707 [Beta vulgaris 
subsp. vulgaris]
Length=205

 Score =   187 bits (476),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 138/201 (69%), Gaps = 16/201 (8%)
 Frame = +1

Query  100  LKMNS-YGLLPSFSSPSYKYNFNNPKYLTTIIHPKRFTASPNLSRNISGGKIRASGSTVT  276
            L MN  Y L  +FS+ +   NF N  Y+T   H  R T+S N+    +  KIRA G+   
Sbjct  5    LHMNPPYSLSSNFSTSN---NFKN--YITK--HIIRTTSSRNVINFNNYRKIRAIGTVPE  57

Query  277  PDEAEE--------EEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYG  432
             D+A E        E   V  AFV SVL PDG+PD+H R A GGQKLRDIMLD ++ELYG
Sbjct  58   RDQANEASQSEEELEPPYVGFAFVSSVLLPDGTPDMHLRSATGGQKLRDIMLDNDIELYG  117

Query  433  PYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNS  612
            PY+R L NC G GTCG+CMVEV+EGKELL+PRTE E E LK+KP+NWRLACQ TVGTP S
Sbjct  118  PYARPLLNCAGGGTCGSCMVEVIEGKELLNPRTETEKEHLKKKPKNWRLACQITVGTPES  177

Query  613  KGTLVIQQLPEWKGHEWNYKE  675
            +G +VIQQLPEWK HEW Y++
Sbjct  178  RGMVVIQQLPEWKAHEWKYEK  198



>ref|XP_010545683.1| PREDICTED: uncharacterized protein LOC104817971 [Tarenaya hassleriana]
Length=200

 Score =   187 bits (476),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 134/188 (71%), Gaps = 5/188 (3%)
 Frame = +1

Query  103  KMNSYGLLPSFSSPSYKYNFNNPKY-LTTIIHPKRFTASPNLSRNISGGKIRASGSTVTP  279
            +MN+ GL+ +   P++K+        L+   +  RF  + N  R +  G + A+ S  T 
Sbjct  5    QMNASGLVAASLPPNHKFAHKTKSLRLSKHNNAVRFCRADNAIRAV--GTVPANQSPATV  62

Query  280  DEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAlcnc  459
            D+  +E   V  AFVHSVL PDG+PDVH R+A GGQKLRDIMLD NVELYGPY++ L NC
Sbjct  63   DD--DEPPSVDFAFVHSVLLPDGTPDVHMRRACGGQKLRDIMLDSNVELYGPYAKPLSNC  120

Query  460  gglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQL  639
            GG+GTCGTCMVEVV+GKELLSPRT+ E EKLKRKP+ WRLACQT VG  +S G +VIQQL
Sbjct  121  GGVGTCGTCMVEVVDGKELLSPRTDIEKEKLKRKPKTWRLACQTAVGESDSNGLVVIQQL  180

Query  640  PEWKGHEW  663
            PEWK HEW
Sbjct  181  PEWKAHEW  188



>ref|XP_002284206.1| PREDICTED: uncharacterized protein LOC100241139 [Vitis vinifera]
 emb|CBI36102.3| unnamed protein product [Vitis vinifera]
Length=191

 Score =   186 bits (473),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 137/196 (70%), Gaps = 11/196 (6%)
 Frame = +1

Query  100  LKMNSYGLLPSFSSPSYKYNFNNPKYLTTIIHPKRFTASPNLSRNISGGKIRASGSTVTP  279
            L++NSYGL    SS S   NF +  + T        ++ P +    + G I  S S  TP
Sbjct  4    LQLNSYGL----SSFSLTQNFTSKTHKTLKPFNPPSSSRPKIK---AIGTIPESQSQATP  56

Query  280  DEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAlcnc  459
                +E   V  AFV+SVL PDG+PDVH+R A GGQKLRDIMLD N++LYGPY+R L NC
Sbjct  57   ---SDEPPSVNFAFVNSVLLPDGTPDVHFRSACGGQKLRDIMLDSNIDLYGPYARPLLNC  113

Query  460  gglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQL  639
            GG GTCGTC+VEV+EGK+LL+PRT+KE EKLKR P+ WRLACQTTVG  +S+G +VIQQL
Sbjct  114  GGGGTCGTCIVEVIEGKDLLTPRTDKEKEKLKRNPKTWRLACQTTVGKADSRGLVVIQQL  173

Query  640  PEWKGHEWNY-KELKS  684
            PEWK HEW Y KEL S
Sbjct  174  PEWKAHEWTYEKELPS  189



>ref|XP_010487477.1| PREDICTED: uncharacterized protein LOC104765461 [Camelina sativa]
Length=205

 Score =   186 bits (473),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = +1

Query  280  DEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAlcnc  459
            DE + E   V  AFVHSVL PDG+PDVH+R+A GGQKLRDIMLD N+ELYGPYS+ L NC
Sbjct  62   DEPDYEPPAVDFAFVHSVLLPDGTPDVHWRRACGGQKLRDIMLDSNIELYGPYSKPLSNC  121

Query  460  gglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQL  639
             G+GTC TCMVE+V GKELL+PRT+ E EKLKRKP+NWRLACQT VG P+S G +VIQQL
Sbjct  122  AGVGTCATCMVEIVNGKELLNPRTDIEKEKLKRKPKNWRLACQTNVGNPDSTGLVVIQQL  181

Query  640  PEWKGHEWN  666
            PEWK HEWN
Sbjct  182  PEWKAHEWN  190



>ref|XP_010504019.1| PREDICTED: uncharacterized protein LOC104781121 [Camelina sativa]
Length=206

 Score =   186 bits (472),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = +1

Query  280  DEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAlcnc  459
            +E ++E   V  AFVHSVL PDG+PDVH+R+A GGQKLRDIMLD N+ELYGPYS+ L NC
Sbjct  63   NEPDDEPPAVDFAFVHSVLLPDGTPDVHWRRACGGQKLRDIMLDSNIELYGPYSKPLSNC  122

Query  460  gglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQL  639
             G+GTC TCMVE+V GKELL+PRT+ E EKLKRKP+NWRLACQT VG P+S G +VIQQL
Sbjct  123  AGVGTCATCMVEIVNGKELLNPRTDIEKEKLKRKPKNWRLACQTNVGNPDSTGLVVIQQL  182

Query  640  PEWKGHEWN  666
            PEWK HEWN
Sbjct  183  PEWKAHEWN  191



>ref|XP_004302880.1| PREDICTED: uncharacterized protein LOC101311105 [Fragaria vesca 
subsp. vesca]
Length=199

 Score =   186 bits (472),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 130/186 (70%), Gaps = 10/186 (5%)
 Frame = +1

Query  145  SYKYNFNNPKYLTTIIHPKRFTASPNLSRNISGGKIRASGSTVTPD--------EAEEEE  300
            S   +F +P     I H    + S   S   S GKIRA   T  P+        E E+E 
Sbjct  8    SCGSSFCSPIPSNLISHNITTSHSTPSSLTFSRGKIRAV--TTVPNSSEPAQAIEPEQEP  65

Query  301  AMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcg  480
             +V  AFV SVL PD +PDVH R+A GGQKLR+IMLDGN+ELYGPY+R L NC G GTCG
Sbjct  66   PLVDFAFVSSVLLPDQTPDVHLRQACGGQKLRNIMLDGNIELYGPYARPLLNCAGGGTCG  125

Query  481  tcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWKGHE  660
            TCMVEV++GKELL+PRT+KE E L++KP+NWRLACQTTVG P+S+G +V+QQLPEWK HE
Sbjct  126  TCMVEVIKGKELLTPRTDKEKEHLQKKPKNWRLACQTTVGKPDSRGLVVVQQLPEWKAHE  185

Query  661  WNYKEL  678
            W Y+ +
Sbjct  186  WKYENV  191



>ref|NP_188246.1| NDH-dependent cyclic electron flow 1 [Arabidopsis thaliana]
 dbj|BAB01265.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK68807.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP13368.1| At3g16240 [Arabidopsis thaliana]
 gb|AEE75790.1| NDH-dependent cyclic electron flow 1 [Arabidopsis thaliana]
Length=204

 Score =   186 bits (472),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 133/194 (69%), Gaps = 13/194 (7%)
 Frame = +1

Query  100  LKMNSYGL---LPSFSSPSYKYNFNNPKYLTTIIHPKRFTASPNLSRNISGGKIRASGST  270
            ++++  GL   LP   S S+K   N P           F +  N +R  +   I  + ++
Sbjct  4    VQLSGSGLVASLPPNHSFSHKTKLNKPNSYF-------FRSKHNAARTKTVRAISTAPAS  56

Query  271  VTP--DEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSR  444
              P  DE +E  A V  AFVHSVL PDG+PDVH+R+A GGQKLRDIMLD N+ELYGPYS+
Sbjct  57   QPPAADEPDEPPA-VDFAFVHSVLLPDGTPDVHWRRANGGQKLRDIMLDSNIELYGPYSK  115

Query  445  AlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTL  624
             L NC G+GTC TCMVE+V GKELL+PRT+ E EKLKRKP+NWRLACQT VG P+S G +
Sbjct  116  PLSNCAGVGTCATCMVEIVNGKELLNPRTDIEKEKLKRKPKNWRLACQTNVGNPDSTGLV  175

Query  625  VIQQLPEWKGHEWN  666
            VIQQLPEWK HEWN
Sbjct  176  VIQQLPEWKAHEWN  189



>ref|XP_010465639.1| PREDICTED: uncharacterized protein LOC104745954 [Camelina sativa]
Length=205

 Score =   186 bits (472),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = +1

Query  280  DEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAlcnc  459
            +E ++E   V  AFVHSVL PDG+PDVH+R+A GGQKLRDIMLD N+ELYGPYS+ L NC
Sbjct  62   NEPDDEPPAVDFAFVHSVLLPDGTPDVHWRRACGGQKLRDIMLDSNIELYGPYSKPLSNC  121

Query  460  gglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQL  639
             G+GTC TCMVE+V GKELL+PRT+ E EKLKRKP+NWRLACQT VG P+S G +VIQQL
Sbjct  122  AGVGTCATCMVEIVNGKELLNPRTDIEKEKLKRKPKNWRLACQTNVGNPDSTGLVVIQQL  181

Query  640  PEWKGHEWN  666
            PEWK HEWN
Sbjct  182  PEWKAHEWN  190



>ref|XP_003597703.1| Electron carrier/ electron transporter/ iron ion binding protein 
[Medicago truncatula]
 gb|AES67954.1| 2Fe-2S iron-sulfur cluster-binding domain protein [Medicago truncatula]
Length=191

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 115/150 (77%), Gaps = 9/150 (6%)
 Frame = +1

Query  247  KIRASGSTVTPDEAEEEEAM-------VKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIM  405
            KIRA G+   P++ + E          +  AFV SVL PDG+PDVHYR A GGQKLR+IM
Sbjct  35   KIRAVGTV--PEKKDSETTTDSNDPPSIGFAFVSSVLLPDGTPDVHYRTACGGQKLRNIM  92

Query  406  LDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLAC  585
            LD N+ELYGPY R L NCGG GTC TCMVEV+EGKELLSP T+KE EKLKRKP+NWRLAC
Sbjct  93   LDSNIELYGPYGRILLNCGGGGTCATCMVEVLEGKELLSPCTDKEKEKLKRKPKNWRLAC  152

Query  586  QTTVGTPNSKGTLVIQQLPEWKGHEWNYKE  675
            QTTVG  +S G +VIQQLPEWKGHEW Y++
Sbjct  153  QTTVGEADSTGVVVIQQLPEWKGHEWKYEK  182



>ref|XP_009377887.1| PREDICTED: uncharacterized protein LOC103966441 [Pyrus x bretschneideri]
Length=199

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 119/152 (78%), Gaps = 3/152 (2%)
 Frame = +1

Query  232  NISGGKIRA-SGSTVTPDEA--EEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDI  402
            + S  KIRA S S  +  EA   E+   V  AFV SVL PD +PDVH R+A GGQKLR+I
Sbjct  40   SFSRAKIRAVSASQESQSEAIQPEQPPSVDFAFVSSVLLPDQTPDVHLRQACGGQKLRNI  99

Query  403  MLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLA  582
            MLD N++LYGPYSR L NC G GTCGTCMVE+V+GKELL+PRT+KE E LK+KP+NWRLA
Sbjct  100  MLDSNIDLYGPYSRVLLNCAGGGTCGTCMVEIVQGKELLTPRTDKEKEHLKKKPKNWRLA  159

Query  583  CQTTVGTPNSKGTLVIQQLPEWKGHEWNYKEL  678
            CQTTVG P+S+G +V+QQLPEWK HEW Y+E+
Sbjct  160  CQTTVGKPDSRGLVVVQQLPEWKAHEWKYEEV  191



>ref|XP_008228470.1| PREDICTED: uncharacterized protein LOC103327880 [Prunus mume]
Length=199

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 120/151 (79%), Gaps = 3/151 (2%)
 Frame = +1

Query  235  ISGGKIRA-SGSTVTPDEAEEEEA--MVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIM  405
             S GKIRA S S   P  A E E   +V  AFV SVL PD +PDVH R+A GGQKLR+IM
Sbjct  41   FSRGKIRAVSTSQENPSGAIEPEQPPLVDFAFVSSVLLPDQTPDVHLRQACGGQKLRNIM  100

Query  406  LDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLAC  585
            LD N++LYGPY+R L NCGG+GTCGTCMVEVV+GKELL+PRT KE E LK+KP+NWRLAC
Sbjct  101  LDSNIDLYGPYARTLLNCGGVGTCGTCMVEVVQGKELLNPRTGKEKEHLKKKPKNWRLAC  160

Query  586  QTTVGTPNSKGTLVIQQLPEWKGHEWNYKEL  678
            QTTVG P+S+G +V+QQLPEWK HEW Y+E+
Sbjct  161  QTTVGKPDSRGLVVVQQLPEWKAHEWRYEEI  191



>ref|XP_007215986.1| hypothetical protein PRUPE_ppa011732mg [Prunus persica]
 gb|EMJ17185.1| hypothetical protein PRUPE_ppa011732mg [Prunus persica]
Length=199

 Score =   181 bits (460),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 120/151 (79%), Gaps = 3/151 (2%)
 Frame = +1

Query  235  ISGGKIRA-SGSTVTPDEA--EEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIM  405
             S GKIRA S S   P  A   E+  +V  AFV SVL PD +PDVH R+A GGQKLR+IM
Sbjct  41   FSRGKIRAVSTSQENPSGAIDPEQPPLVDFAFVSSVLLPDQTPDVHLRQACGGQKLRNIM  100

Query  406  LDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLAC  585
            LD N++LYGPY+R L NCGG+GTCGTCMVEVV+GKELL+PRT KE E LK+KP+NWRLAC
Sbjct  101  LDSNIDLYGPYARTLLNCGGVGTCGTCMVEVVQGKELLNPRTGKEKEHLKKKPKNWRLAC  160

Query  586  QTTVGTPNSKGTLVIQQLPEWKGHEWNYKEL  678
            QTTVG P+S+G +V+QQLPEWK HEW Y+E+
Sbjct  161  QTTVGKPDSRGLVVVQQLPEWKAHEWRYEEI  191



>ref|XP_008342650.1| PREDICTED: uncharacterized protein LOC103405430 [Malus domestica]
Length=222

 Score =   182 bits (461),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 119/152 (78%), Gaps = 3/152 (2%)
 Frame = +1

Query  232  NISGGKIRA-SGSTVTPDEA--EEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDI  402
            + S  KIRA S S  +  EA   E+   V  AFV SVL PD +PDVH R+A GGQKLR+I
Sbjct  63   SFSRAKIRAVSTSQESQSEAIQPEQPPSVDFAFVSSVLLPDQTPDVHLRQACGGQKLRNI  122

Query  403  MLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLA  582
            MLD N++LYGPYSR L NC G GTCGTCMVE+V+GKELL+PRT+KE E LK+KP+NWRLA
Sbjct  123  MLDSNIDLYGPYSRVLLNCAGGGTCGTCMVEIVQGKELLTPRTDKEKEHLKKKPKNWRLA  182

Query  583  CQTTVGTPNSKGTLVIQQLPEWKGHEWNYKEL  678
            CQTTVG P+S+G +V+QQLPEWK HEW Y+E+
Sbjct  183  CQTTVGKPDSRGLVVVQQLPEWKAHEWKYEEV  214



>ref|XP_006343759.1| PREDICTED: uncharacterized protein LOC102582039 [Solanum tuberosum]
Length=201

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = +1

Query  304  MVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgt  483
             VK AFV SV  PDG+PDV  RKA GGQKLRDIMLD NVELYGPY+R L NCGG GTC T
Sbjct  60   CVKFAFVSSVFLPDGTPDVQLRKACGGQKLRDIMLDANVELYGPYARPLLNCGGGGTCAT  119

Query  484  cMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWKGHEW  663
            C+VEVVEGKELL+PRT+KENE LKR P+NWRLACQ  VG P+S+G + IQQLPEWK HEW
Sbjct  120  CLVEVVEGKELLNPRTDKENENLKRHPKNWRLACQAIVGKPDSRGMMTIQQLPEWKAHEW  179

Query  664  NYKEL  678
            NY+ L
Sbjct  180  NYRGL  184



>ref|XP_008380902.1| PREDICTED: uncharacterized protein LOC103443783 [Malus domestica]
Length=225

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 119/152 (78%), Gaps = 3/152 (2%)
 Frame = +1

Query  232  NISGGKIRA-SGSTVTPDEA--EEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDI  402
            + S  KIRA S S  +  EA   ++   V  AFV+SVL PD +PDVH R+A GGQKLR+I
Sbjct  66   SFSRAKIRAISTSQESQSEAVQPQQSPSVDFAFVNSVLLPDQTPDVHLRQACGGQKLRNI  125

Query  403  MLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLA  582
            MLD N++LYGPY R L NC G GTCGTCMVE+V+GKELL+PRT+KE E LK+KP+NWRLA
Sbjct  126  MLDSNIDLYGPYGRVLLNCAGGGTCGTCMVEIVQGKELLTPRTDKEKEHLKKKPKNWRLA  185

Query  583  CQTTVGTPNSKGTLVIQQLPEWKGHEWNYKEL  678
            CQTTVG P+S+G +V+QQLPEWK HEW Y+E+
Sbjct  186  CQTTVGKPDSRGLVVVQQLPEWKAHEWKYEEV  217



>ref|XP_009353576.1| PREDICTED: uncharacterized protein LOC103944839 [Pyrus x bretschneideri]
Length=225

 Score =   179 bits (454),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 119/156 (76%), Gaps = 11/156 (7%)
 Frame = +1

Query  232  NISGGKIRASGSTVTPDEAEEEEAM-------VKIAFVHSVLFPDGSPDVHYRKAKGGQK  390
            + S  KIRA    V+  +  + EA+       V   FV+SVL PD +PDVH R+A GGQK
Sbjct  66   SFSRAKIRA----VSTSQESQSEALQPQQPPSVDFVFVNSVLLPDQTPDVHLRQACGGQK  121

Query  391  LRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRN  570
            LR+IMLD N++LYGPYSR L NC G GTCGTC+VE+V+GKELL+PRT+KE E LK+KP+N
Sbjct  122  LRNIMLDSNIDLYGPYSRVLLNCAGGGTCGTCVVEIVQGKELLTPRTDKEKEHLKKKPKN  181

Query  571  WRLACQTTVGTPNSKGTLVIQQLPEWKGHEWNYKEL  678
            WRLACQTTVG P+S+G +V+QQLPEWK HEW Y+E+
Sbjct  182  WRLACQTTVGKPDSRGLVVVQQLPEWKAHEWKYEEV  217



>ref|XP_002515998.1| electron carrier, putative [Ricinus communis]
 gb|EEF46418.1| electron carrier, putative [Ricinus communis]
Length=204

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 133/200 (67%), Gaps = 14/200 (7%)
 Frame = +1

Query  100  LKMNSYGLLPSFSSPSYKYNFNNPKYLTTIIHPKRFTASPNLSRNISGGKIRASGSTVTP  279
            L++NSYGL  S  +    +N  +    +T         S   SR++S  +++       P
Sbjct  5    LQLNSYGLANSLKA---SHNLKHSAATST----NNIHKSLKHSRSVSFSRVKIRAVGTVP  57

Query  280  D-------EAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPY  438
            D       E  EE   VK  FVHSVL PDG+PDVH+R   GGQKLRD MLD N++LYGPY
Sbjct  58   DSKSDAKQEPPEEPPSVKFVFVHSVLLPDGTPDVHFRTTCGGQKLRDTMLDSNIDLYGPY  117

Query  439  SRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKG  618
             R L NC G GTCG+CMVEVV GKELLSPRTEKE + LK+KP+NWRLACQTTVG+P+S G
Sbjct  118  GRPLLNCAGGGTCGSCMVEVVMGKELLSPRTEKEKKILKKKPKNWRLACQTTVGSPDSTG  177

Query  619  TLVIQQLPEWKGHEWNYKEL  678
             +VIQQLPEWK HEW Y+++
Sbjct  178  LVVIQQLPEWKAHEWKYEKI  197



>ref|XP_003546527.1| PREDICTED: uncharacterized protein LOC100820264 [Glycine max]
 gb|KHM98733.1| hypothetical protein glysoja_030786 [Glycine soja]
Length=194

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +1

Query  295  EEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAlcncgglgt  474
            E   V + FV SVL PDG+PD+H+R A GGQ+LR IMLD NVELYGPY+R L NCGG GT
Sbjct  59   EPPYVGLVFVSSVLLPDGTPDMHFRSACGGQRLRKIMLDSNVELYGPYARPLLNCGGGGT  118

Query  475  cgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWKG  654
            CGTCMVEV+EGKELL+PRT+KE E LK+KP+NWRLACQT VG P+S+G +VIQQLPEWKG
Sbjct  119  CGTCMVEVLEGKELLNPRTDKEKEILKKKPKNWRLACQTIVGKPDSRGAVVIQQLPEWKG  178

Query  655  HEWNY  669
            HEW Y
Sbjct  179  HEWKY  183



>gb|KDP37269.1| hypothetical protein JCGZ_06325 [Jatropha curcas]
Length=195

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 138/198 (70%), Gaps = 19/198 (10%)
 Frame = +1

Query  100  LKMNSYGLLPSFSSPSYKYNFNNPKYLTTIIHPKRFTASPNLSRNISGGKIRASGSTVTP  279
            L++NSYG+  S  +P      +  KY TT       T  P    N S  KIRA G+   P
Sbjct  4    LQLNSYGIA-SLKAP------HKSKYTTT-----HKTLRPLSHTNFSRIKIRAIGTV--P  49

Query  280  DEAE-----EEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSR  444
            D        EE   V  AFVHSVL PDG+PDVH+R + GG+KLRDIMLD N+ELYGPY+R
Sbjct  50   DSKSDAKEPEEPPSVNFAFVHSVLLPDGTPDVHFRTSCGGKKLRDIMLDSNIELYGPYAR  109

Query  445  AlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTL  624
             L NCGG GTCGTCMVEV+ GKELL+PRT+KE + LK+KP+NWRLACQTTVG P+S+G +
Sbjct  110  PLLNCGGGGTCGTCMVEVIMGKELLNPRTDKEKKILKKKPKNWRLACQTTVGNPDSRGLV  169

Query  625  VIQQLPEWKGHEWNYKEL  678
            VIQQLPEWK HEW Y+++
Sbjct  170  VIQQLPEWKNHEWKYEKI  187



>ref|XP_010249610.1| PREDICTED: uncharacterized protein LOC104592109 [Nelumbo nucifera]
Length=189

 Score =   173 bits (439),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 113/147 (77%), Gaps = 7/147 (5%)
 Frame = +1

Query  244  GKIRASGS-TVTPDE------AEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDI  402
            GKI+A G+ T++  E      A EE   +  AFV  VL PDG+PD+H R A GGQKLRDI
Sbjct  42   GKIKAVGTGTISGSESAEQVTATEESPSIDFAFVSPVLLPDGTPDIHLRSACGGQKLRDI  101

Query  403  MLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLA  582
            MLD N++LYGP +R L NCGG GTCGTC+VEVVEGKELLSPRT+KE E L++KP+NWRLA
Sbjct  102  MLDNNIDLYGPSARPLLNCGGGGTCGTCLVEVVEGKELLSPRTDKEKEILRKKPKNWRLA  161

Query  583  CQTTVGTPNSKGTLVIQQLPEWKGHEW  663
            CQT VG  NSKG +VIQQLPEWK HEW
Sbjct  162  CQTIVGNGNSKGQVVIQQLPEWKAHEW  188



>ref|XP_010062509.1| PREDICTED: uncharacterized protein LOC104449901 [Eucalyptus grandis]
 gb|KCW69652.1| hypothetical protein EUGRSUZ_F03055 [Eucalyptus grandis]
Length=196

 Score =   167 bits (423),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 132/198 (67%), Gaps = 11/198 (6%)
 Frame = +1

Query  94   NELKMNSYGLLPSFSSPSYKYNFNNPKYLTTIIHPKRFTASPNLSRNISGGKIRASGSTV  273
            N   + S+ L PSFS  S     +        + P R   S   SR  + G +  SGS  
Sbjct  7    NSSHLASFSLTPSFSHRSRTRRAH--------LRPFRSQTSFARSRIRAVGTVPESGSET  58

Query  274  TPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAlc  453
                A EE   V  AFV SVL PDG+PDVH R A GGQKLRDIMLD +VELYGPY+R L 
Sbjct  59   A---APEEPPCVNFAFVSSVLLPDGTPDVHLRTACGGQKLRDIMLDSDVELYGPYARPLL  115

Query  454  ncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQ  633
            NC G GTC TC+VEVV+GKELLSP T+KE EKLK+KP+N+RLACQTTVG P+S+G +VIQ
Sbjct  116  NCAGGGTCATCLVEVVQGKELLSPLTDKEKEKLKKKPKNYRLACQTTVGKPDSRGLVVIQ  175

Query  634  QLPEWKGHEWNYKELKSS  687
            QLPEWK HEW ++++  S
Sbjct  176  QLPEWKAHEWKFEKVSPS  193



>ref|NP_001147712.1| electron carrier/ electron transporter/ iron ion binding protein 
[Zea mays]
 gb|ACG28448.1| electron carrier/ electron transporter/ iron ion binding protein 
[Zea mays]
Length=193

 Score =   167 bits (423),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 108/143 (76%), Gaps = 6/143 (4%)
 Frame = +1

Query  238  SGGKIRASGSTVTPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGN  417
            SGG+  A     TP+E EE  + +  AFV   L PDG+PDVHYR A+GGQKLRD+MLDG 
Sbjct  56   SGGEPSAG----TPEEVEE--STIDFAFVSPRLLPDGTPDVHYRTARGGQKLRDVMLDGY  109

Query  418  VELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTV  597
            ++LYGPY + L NC G G CGTC+VEVVEGKE+LSP+TE E E LKRKP+ WRLACQ TV
Sbjct  110  IDLYGPYDKVLLNCSGGGVCGTCVVEVVEGKEMLSPKTEVEKELLKRKPKTWRLACQATV  169

Query  598  GTPNSKGTLVIQQLPEWKGHEWN  666
            G  +S G ++IQQLPEWK HEW+
Sbjct  170  GNADSTGQMIIQQLPEWKIHEWD  192



>ref|XP_003563100.1| PREDICTED: uncharacterized protein LOC100845974 [Brachypodium 
distachyon]
Length=187

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +1

Query  289  EEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAlcncggl  468
            EEE   V  AFV   L PDG+PDVHYR A GGQKLRDIML G+++LYGPY + L NC G 
Sbjct  60   EEEPPSVDFAFVSPRLLPDGTPDVHYRTACGGQKLRDIMLQGHIDLYGPYDKFLLNCSGG  119

Query  469  gtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEW  648
            G CGTC+VEVVEG E+LSP+ E E EKL+RKP+ WRLACQ TVG P+S+G +VIQQLPEW
Sbjct  120  GECGTCIVEVVEGGEMLSPKNEVEKEKLRRKPKTWRLACQATVGKPDSRGQMVIQQLPEW  179

Query  649  KGHEWN  666
            K HEW+
Sbjct  180  KVHEWD  185



>ref|XP_004957722.1| PREDICTED: uncharacterized protein LOC101772218 [Setaria italica]
Length=195

 Score =   163 bits (412),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = +1

Query  307  VKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtc  486
            V  AFV   L PDG+PDVHYR A+GGQKLRDIML+G ++LYGPY + L NC G G CGTC
Sbjct  73   VDFAFVSPRLLPDGTPDVHYRTARGGQKLRDIMLEGYIDLYGPYDKFLLNCSGGGVCGTC  132

Query  487  MVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWKGHEWN  666
            +VEVVEGKE+LSP+TEKE E LKRKP+ WRLACQ TVG  +S G +VIQQLPEWK HEW+
Sbjct  133  IVEVVEGKEMLSPKTEKEKEMLKRKPKTWRLACQATVGNADSTGQMVIQQLPEWKIHEWD  192



>ref|NP_001235859.1| uncharacterized protein LOC100500287 [Glycine max]
 gb|ACU15323.1| unknown [Glycine max]
 gb|KHN32634.1| hypothetical protein glysoja_022316 [Glycine soja]
Length=194

 Score =   162 bits (410),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 117/150 (78%), Gaps = 11/150 (7%)
 Frame = +1

Query  247  KIRASGSTVTPDEAE---------EEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRD  399
            KIRA G+   PDE +         +E   V + FV SVL PDG+PD+H+R A GGQ+LR 
Sbjct  36   KIRAVGTV--PDEKDSDSDITTDPDEPPYVGLVFVSSVLLPDGTPDMHFRSACGGQRLRK  93

Query  400  IMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRL  579
            IMLD NV+LYGPY+R L NCGG GTCGTCMVEV+EGKELL+PRT+KE + LK+KP+NWRL
Sbjct  94   IMLDSNVDLYGPYARPLLNCGGGGTCGTCMVEVLEGKELLNPRTDKEKKILKKKPKNWRL  153

Query  580  ACQTTVGTPNSKGTLVIQQLPEWKGHEWNY  669
            ACQTTVG P+S+G +VIQQLPEWKGHEW Y
Sbjct  154  ACQTTVGKPDSRGAVVIQQLPEWKGHEWKY  183



>ref|XP_006465662.1| PREDICTED: uncharacterized protein LOC102626236 isoform X5 [Citrus 
sinensis]
Length=174

 Score =   161 bits (408),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 127/200 (64%), Gaps = 37/200 (19%)
 Frame = +1

Query  100  LKMNSYGLLPSFSSPSYKYNFNNPKYLTTIIHPK-RFTASPNLSRNISGGKIRASGSTVT  276
            L++NSY  L S+S P   YNFN     TT  H   +F    + SR+    +IRA+ +   
Sbjct  4    LQLNSY-RLASYSLP---YNFN----CTTNSHKSLKFYKRVSFSRS----RIRATATISE  51

Query  277  PDE---AEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRA  447
             D    A EE  +V  AFVHSVL PDG+PD+H+R A GGQKLRDIML+ N++LYGPY+R 
Sbjct  52   NDSQANAAEEPPVVNFAFVHSVLLPDGTPDIHFRTACGGQKLRDIMLNSNIDLYGPYARP  111

Query  448  lcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLV  627
            L NC G GTCGTCMVE                     KP+NWRLACQTTVGTP+S G +V
Sbjct  112  LSNCAGGGTCGTCMVE---------------------KPKNWRLACQTTVGTPDSTGLVV  150

Query  628  IQQLPEWKGHEWNYKELKSS  687
            IQQLPEWKGHEW YK++ +S
Sbjct  151  IQQLPEWKGHEWKYKKIPTS  170



>ref|NP_001141368.1| electron carrier/ electron transporter/ iron ion binding protein 
[Zea mays]
 gb|ACF86189.1| unknown [Zea mays]
 gb|ACG27776.1| electron carrier/ electron transporter/ iron ion binding protein 
[Zea mays]
 gb|ACG38386.1| electron carrier/ electron transporter/ iron ion binding protein 
[Zea mays]
 tpg|DAA62729.1| TPA: electron carrier/ electron transporter/ iron ion binding 
protein [Zea mays]
Length=191

 Score =   162 bits (409),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +1

Query  307  VKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtc  486
            V  AFV   L PDG+PDVHYR A+GGQKLRDIMLDG ++LYGPY + L NC G G CGTC
Sbjct  71   VDFAFVSPRLLPDGTPDVHYRTARGGQKLRDIMLDGYIDLYGPYDKVLLNCSGGGVCGTC  130

Query  487  MVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWKGHEWN  666
            +VEVVEGKE+LSP+T+ E E LKRKP+ WRLACQ TVG  +S G ++IQQLPEWK HEW+
Sbjct  131  IVEVVEGKEMLSPKTDVEKELLKRKPKTWRLACQATVGNADSTGQMIIQQLPEWKIHEWD  190



>ref|XP_006657710.1| PREDICTED: uncharacterized protein LOC102712646 [Oryza brachyantha]
Length=210

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +1

Query  307  VKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtc  486
            V  AFV   L PDG+PDVHYR A GGQKLRDIMLDG ++LYGPY + L NC G G CGTC
Sbjct  89   VDFAFVAPRLLPDGTPDVHYRTACGGQKLRDIMLDGFIDLYGPYDKLLLNCSGGGVCGTC  148

Query  487  MVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWKGHEWN  666
            +VEVV+G ELLSP+T+ E E LKR+P+ WRLACQ TVG+P+S G +VIQQLPEWK HEW+
Sbjct  149  IVEVVQGSELLSPKTDVEKELLKRQPKTWRLACQATVGSPDSTGQMVIQQLPEWKIHEWD  208



>ref|XP_006426911.1| hypothetical protein CICLE_v10026544mg [Citrus clementina]
 gb|ESR40151.1| hypothetical protein CICLE_v10026544mg [Citrus clementina]
Length=174

 Score =   160 bits (404),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 126/200 (63%), Gaps = 37/200 (19%)
 Frame = +1

Query  100  LKMNSYGLLPSFSSPSYKYNFNNPKYLTTIIHPK-RFTASPNLSRNISGGKIRASGSTVT  276
            L++NSY L    +S S  YNFN     TT  H   +F    + SR+    +IRA+ +   
Sbjct  4    LQLNSYRL----ASHSLPYNFN----CTTNSHKSLKFYNRVSFSRS----RIRATATIPK  51

Query  277  PDE---AEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRA  447
             D    A EE  +V  AFVHSVL PDG+PD+H+R A GGQKLRDIML+ N++LYGPY+R 
Sbjct  52   SDSQANAAEEPPVVNFAFVHSVLLPDGTPDIHFRTACGGQKLRDIMLNSNIDLYGPYARP  111

Query  448  lcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLV  627
            L NC G GTCGTCMVE                     KP+NWRLACQTTVGTP+S G +V
Sbjct  112  LSNCAGGGTCGTCMVE---------------------KPKNWRLACQTTVGTPDSTGLVV  150

Query  628  IQQLPEWKGHEWNYKELKSS  687
            IQQLPEWKGHEW Y+++ +S
Sbjct  151  IQQLPEWKGHEWKYEKIPTS  170



>ref|NP_001059669.1| Os07g0489800 [Oryza sativa Japonica Group]
 dbj|BAC80058.1| 2Fe-2S iron-sulfur cluster protein-like [Oryza sativa Japonica 
Group]
 dbj|BAF21583.1| Os07g0489800 [Oryza sativa Japonica Group]
 gb|EAZ39849.1| hypothetical protein OsJ_24289 [Oryza sativa Japonica Group]
 dbj|BAG90796.1| unnamed protein product [Oryza sativa Japonica Group]
Length=210

 Score =   160 bits (406),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = +1

Query  292  EEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAlcncgglg  471
            EE   V  AFV   L PDG+PDVHYR A GGQKLRDIMLD  ++LYGPY + L NC G G
Sbjct  85   EEPPSVDFAFVAPRLLPDGTPDVHYRTACGGQKLRDIMLDNYIDLYGPYDKLLLNCEGGG  144

Query  472  tcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
             CGTC+VEVVEG ELLSP+T+ E E LKRKP+ WRLACQ TVG P+S G +VIQQLPEWK
Sbjct  145  ECGTCIVEVVEGGELLSPKTDVEKELLKRKPKTWRLACQATVGNPDSTGQMVIQQLPEWK  204

Query  652  GHEWN  666
             HEW+
Sbjct  205  IHEWD  209



>ref|XP_002460712.1| hypothetical protein SORBIDRAFT_02g033590 [Sorghum bicolor]
 gb|EER97233.1| hypothetical protein SORBIDRAFT_02g033590 [Sorghum bicolor]
Length=195

 Score =   160 bits (405),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 99/134 (74%), Gaps = 0/134 (0%)
 Frame = +1

Query  265  STVTPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSR  444
            S   P+  + E   +  AFV   L PDG+PDVHYR A GGQKLRDIMLD  ++LYGPY +
Sbjct  61   SAGAPEPEQVEPPSIDFAFVSPRLLPDGTPDVHYRTACGGQKLRDIMLDAYIDLYGPYDK  120

Query  445  AlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTL  624
             L NC G G CGTC+VEVVEGKE+LSP+T+ E E LKRKP+ WRLACQ TVG  +S G +
Sbjct  121  VLLNCAGGGVCGTCLVEVVEGKEMLSPKTDVEKELLKRKPKTWRLACQATVGNADSTGQM  180

Query  625  VIQQLPEWKGHEWN  666
            +IQQLPEWK HEW+
Sbjct  181  IIQQLPEWKIHEWD  194



>dbj|BAJ93050.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=196

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 97/128 (76%), Gaps = 0/128 (0%)
 Frame = +1

Query  283  EAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAlcncg  462
            E   E   V  AFV   L PDG+PDVHYR A GGQKLRDIMLD  ++LYGPY + L NC 
Sbjct  68   ETTVEPPSVDFAFVSPRLLPDGTPDVHYRTACGGQKLRDIMLDAYIDLYGPYDKLLLNCS  127

Query  463  glgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLP  642
            G G CGTC+VEVVEG E+LSP+ E E EKLKRKP++WRLACQ TVG P+S G +VIQQLP
Sbjct  128  GGGECGTCIVEVVEGGEMLSPKNEVEKEKLKRKPKSWRLACQATVGNPDSTGQMVIQQLP  187

Query  643  EWKGHEWN  666
            EWK H+W+
Sbjct  188  EWKVHKWD  195



>gb|EMS65658.1| hypothetical protein TRIUR3_25345 [Triticum urartu]
Length=128

 Score =   157 bits (396),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = +1

Query  307  VKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtc  486
            V  AFV   L PDG+PDVHYR A GGQKLRDIML+G ++LYGPY + L NC G G CGTC
Sbjct  8    VDFAFVSPRLLPDGTPDVHYRTACGGQKLRDIMLEGYIDLYGPYDKLLLNCSGGGECGTC  67

Query  487  MVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWKGHEW  663
            +VEVVEG E+LSP+ E E EKLKRKP++WRLACQ TVG P+S G +VIQQLPEWK H+W
Sbjct  68   IVEVVEGGEMLSPKNEVEKEKLKRKPKSWRLACQATVGNPDSTGQMVIQQLPEWKVHKW  126



>gb|EAZ03907.1| hypothetical protein OsI_26041 [Oryza sativa Indica Group]
Length=210

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = +1

Query  307  VKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtc  486
            V  AFV   L PDG+PDVHYR A GGQKLRDIMLD  ++LYGPY + L NC G G CGTC
Sbjct  90   VDFAFVAPRLLPDGTPDVHYRTACGGQKLRDIMLDNYIDLYGPYDKLLLNCEGGGECGTC  149

Query  487  MVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWKGHEWN  666
            +VEVVEG ELLSP+T+ E E LKRKP+ WRLACQ TVG P+S G +VIQQLPEWK HEW+
Sbjct  150  IVEVVEGGELLSPKTDVEKELLKRKPKTWRLACQATVGNPDSTGQMVIQQLPEWKIHEWD  209



>ref|XP_006833432.1| hypothetical protein AMTR_s00109p00146830 [Amborella trichopoda]
 gb|ERM98710.1| hypothetical protein AMTR_s00109p00146830 [Amborella trichopoda]
Length=184

 Score =   157 bits (396),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 108/151 (72%), Gaps = 5/151 (3%)
 Frame = +1

Query  229  RNISGGKIRASGSTVTPDEAE-----EEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKL  393
            R +   ++R S     PD  +     EE   V  AFV S L PDG+PDVH R +KGG+KL
Sbjct  34   RRLCNSRVRISAVGTVPDIQQVAVPSEEPPSVDFAFVSSRLLPDGTPDVHIRSSKGGRKL  93

Query  394  RDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNW  573
            R+IM +G+++LYGPY + L NC G GTCGTC+VEVV GKELLSPRT+KE E LK+KP+ W
Sbjct  94   RNIMREGHIDLYGPYDKPLLNCAGSGTCGTCIVEVVSGKELLSPRTDKEKEILKKKPKTW  153

Query  574  RLACQTTVGTPNSKGTLVIQQLPEWKGHEWN  666
            RLACQT VG  +S+G ++IQ LPEWK H+W+
Sbjct  154  RLACQTVVGNGDSRGEVIIQTLPEWKAHDWH  184



>ref|XP_007150650.1| hypothetical protein PHAVU_005G170200g [Phaseolus vulgaris]
 gb|ESW22644.1| hypothetical protein PHAVU_005G170200g [Phaseolus vulgaris]
Length=202

 Score =   155 bits (393),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +1

Query  307  VKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtc  486
            V   FV SVL PDG+PD+H+R A GGQKLR+IM+D N+ELYGPY+RAL NC G GTCGTC
Sbjct  68   VGFVFVSSVLLPDGTPDMHFRSACGGQKLRNIMMDSNIELYGPYARALLNCAGGGTCGTC  127

Query  487  MVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWKGHEWN  666
            MVEV+EG+ELL+PRT+KE + LK+KP+NWRLACQT VG  +++G LVIQQLPEWKGHEW 
Sbjct  128  MVEVLEGQELLNPRTDKEKKLLKKKPKNWRLACQTVVGEADTRGALVIQQLPEWKGHEWG  187

Query  667  Y  669
            Y
Sbjct  188  Y  188



>gb|EMT22593.1| hypothetical protein F775_06167 [Aegilops tauschii]
Length=146

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +1

Query  334  LFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKE  513
            L PDG+PDVHYR A GGQKLRDIML G ++LYGPY + L NC G G CGTC+VEVVEG E
Sbjct  35   LLPDGTPDVHYRTACGGQKLRDIMLQGYIDLYGPYDKLLLNCSGGGECGTCIVEVVEGGE  94

Query  514  LLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWKGHEWN  666
            +LSP+ E E EKLKRKP++WRLACQ TVG P+S G +VIQQLPEWK H+W+
Sbjct  95   MLSPKNEVEKEKLKRKPKSWRLACQATVGNPDSTGQMVIQQLPEWKVHKWD  145



>ref|XP_008803832.1| PREDICTED: uncharacterized protein LOC103717288 [Phoenix dactylifera]
Length=193

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 123/184 (67%), Gaps = 11/184 (6%)
 Frame = +1

Query  127  PSFSSPSYKYNFNNPKYLTTIIHPKRFTASPNLSRNISGGKIRA----SGSTVTPDEAEE  294
            P FSS      FN+       +HP +    P        GK+ A    +G++       +
Sbjct  9    PGFSSVPLAPGFNHNTKSHKFLHPTKQLGLPR-------GKLHAIETATGNSGPEAAMPQ  61

Query  295  EEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAlcncgglgt  474
            E  ++  AFV S L PDG+PD+HYR A GGQKLRDIMLD N++LYGPY + L NCGG+GT
Sbjct  62   EPPLIDFAFVGSRLLPDGTPDIHYRSACGGQKLRDIMLDSNIDLYGPYEKPLLNCGGVGT  121

Query  475  cgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWKG  654
            C TC+VEV+EGKELLSPRTEKE EKL++KP+ WRLACQT VG  +S+G ++IQQLPEWK 
Sbjct  122  CATCIVEVIEGKELLSPRTEKEKEKLRKKPKTWRLACQTVVGKQDSRGQMIIQQLPEWKA  181

Query  655  HEWN  666
            H+W 
Sbjct  182  HDWQ  185



>ref|XP_010919663.1| PREDICTED: uncharacterized protein LOC105043701 [Elaeis guineensis]
Length=193

 Score =   152 bits (383),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 122/183 (67%), Gaps = 11/183 (6%)
 Frame = +1

Query  127  PSFSS----PSYKYNFNNPKYLTTIIHPKRFTASPNLSRNISGGKIRASGSTVTPDEAEE  294
            P FSS    P + +   + K+L         T    L R        A+G++       E
Sbjct  9    PGFSSIPRAPGFNHQTKSHKFLP-------LTNQLGLPRGKLHAIETATGNSGPEAAMPE  61

Query  295  EEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAlcncgglgt  474
            E   + IAFV S L PDG+PDVHYR A GGQKLRDIMLD N++LYGPY + L NCGG+GT
Sbjct  62   EPPQIDIAFVGSRLLPDGTPDVHYRSACGGQKLRDIMLDSNIDLYGPYDKPLLNCGGVGT  121

Query  475  cgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWKG  654
            C TC+VEVVEGKELLSPRTEKE EKL++KP+ WRLACQT VG  +S+G L+IQQLPEWK 
Sbjct  122  CATCIVEVVEGKELLSPRTEKEKEKLRKKPKTWRLACQTVVGKQDSRGQLIIQQLPEWKA  181

Query  655  HEW  663
            H+W
Sbjct  182  HDW  184



>ref|XP_009382446.1| PREDICTED: uncharacterized protein LOC103970406 [Musa acuminata 
subsp. malaccensis]
Length=188

 Score =   150 bits (378),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 126/193 (65%), Gaps = 15/193 (8%)
 Frame = +1

Query  100  LKMNSYGL--LPSFSSPSYKYNFNNPKYLTTIIHPKR---FTASPNLSRNISGGKIRASG  264
            L+ NS G+  +P  SS +Y      P +L   +  +R   F  S N +          SG
Sbjct  4    LQFNSPGISSIPITSSFNYNSKSLRPLHLPNQVSLERRKLFAISTNTT----------SG  53

Query  265  STVTPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSR  444
             + + D A EE   +  AFV+S L PDG+PDV YR A GGQKLRDIMLD N++LYGPY  
Sbjct  54   GSESADVASEEPPSIDFAFVNSKLLPDGTPDVQYRSACGGQKLRDIMLDNNIDLYGPYDG  113

Query  445  AlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTL  624
             L NC G GTCGTC+VEVVEGKE+LS RT+KE E LK+KP+ WRLACQT VG  +S+G +
Sbjct  114  PLLNCSGGGTCGTCIVEVVEGKEILSLRTDKEKELLKKKPKTWRLACQTMVGNKDSRGQI  173

Query  625  VIQQLPEWKGHEW  663
            +IQQLPEWK HEW
Sbjct  174  IIQQLPEWKVHEW  186



>emb|CDY63822.1| BnaC01g44590D, partial [Brassica napus]
Length=115

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = +1

Query  328  SVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEG  507
            SVL PDG+PDVH+R+A GGQKLRDIMLD N+ELYGPYS+ L NC G+GTC TCMVE+V G
Sbjct  1    SVLLPDGTPDVHWRRACGGQKLRDIMLDSNIELYGPYSKPLSNCAGVGTCATCMVEIVNG  60

Query  508  KELLSPRTEKENEKLKRKPRNWRLACQTTVGTPN  609
            KELL+PRT+ E EKLKRKP+NWRLACQT VG P+
Sbjct  61   KELLNPRTDIEKEKLKRKPKNWRLACQTNVGNPD  94



>ref|XP_007024241.1| NDH-dependent cyclic electron flow 1 isoform 2 [Theobroma cacao]
 gb|EOY26863.1| NDH-dependent cyclic electron flow 1 isoform 2 [Theobroma cacao]
Length=153

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 108/156 (69%), Gaps = 14/156 (9%)
 Frame = +1

Query  100  LKMNSYGLLPSFSSPSYKYNFNNPKYLTTIIHPKRFTASPNLSRNISGGKIRASGSTVTP  279
            L++N++GL  + S P YK+NF +  +       K    S +LS  IS G+IRA  + +  
Sbjct  4    LQLNTHGL-ATLSVP-YKFNFTSSSH-------KALGLSRHLS--ISRGRIRAVRTVLES  52

Query  280  DEAE---EEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAl  450
            +      EE   V  AFVHSVL PDG+PDVH+R A GGQKLRDIMLD N+ELYGPY+R L
Sbjct  53   ESLAREPEEPPAVDFAFVHSVLLPDGTPDVHFRSACGGQKLRDIMLDNNIELYGPYARPL  112

Query  451  cncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKR  558
             NC G GTCGTCMVEVVEGKELL+PRT+KE EKLKR
Sbjct  113  LNCAGGGTCGTCMVEVVEGKELLTPRTDKEKEKLKR  148



>ref|XP_007024242.1| NDH-dependent cyclic electron flow 1 isoform 3 [Theobroma cacao]
 gb|EOY26864.1| NDH-dependent cyclic electron flow 1 isoform 3 [Theobroma cacao]
Length=156

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 108/156 (69%), Gaps = 14/156 (9%)
 Frame = +1

Query  100  LKMNSYGLLPSFSSPSYKYNFNNPKYLTTIIHPKRFTASPNLSRNISGGKIRASGSTVTP  279
            L++N++GL  + S P YK+NF +  +       K    S +LS  IS G+IRA  + +  
Sbjct  4    LQLNTHGL-ATLSVP-YKFNFTSSSH-------KALGLSRHLS--ISRGRIRAVRTVLES  52

Query  280  DEAE---EEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAl  450
            +      EE   V  AFVHSVL PDG+PDVH+R A GGQKLRDIMLD N+ELYGPY+R L
Sbjct  53   ESLAREPEEPPAVDFAFVHSVLLPDGTPDVHFRSACGGQKLRDIMLDNNIELYGPYARPL  112

Query  451  cncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKR  558
             NC G GTCGTCMVEVVEGKELL+PRT+KE EKLKR
Sbjct  113  LNCAGGGTCGTCMVEVVEGKELLTPRTDKEKEKLKR  148



>emb|CAN70335.1| hypothetical protein VITISV_011434 [Vitis vinifera]
Length=159

 Score =   135 bits (339),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 89/196 (45%), Positives = 108/196 (55%), Gaps = 43/196 (22%)
 Frame = +1

Query  100  LKMNSYGLLPSFSSPSYKYNFNNPKYLTTIIHPKRFTASPNLSRNISGGKIRASGSTVTP  279
            L++NSYGL    SS S   NF +  + T        ++ P +    + G I  S S  TP
Sbjct  4    LQLNSYGL----SSFSLTQNFTSKTHKTLKPFNPPSSSRPKIK---AIGTIPESQSQATP  56

Query  280  DEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAlcnc  459
                +E   V  AFV+SVL PDG+PDVH+R A GGQKLRDIMLD N++LYGPY R L + 
Sbjct  57   ---SDEPPSVNFAFVNSVLLPDGTPDVHFRSACGGQKLRDIMLDSNIDLYGPYVRILDSY  113

Query  460  gglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQL  639
                        V+EGKELL+PRT+KE EKLKR                     +VIQQL
Sbjct  114  T-----------VIEGKELLTPRTDKEKEKLKR---------------------VVIQQL  141

Query  640  PEWKGHEWNY-KELKS  684
            PEWK HEW Y KEL S
Sbjct  142  PEWKAHEWTYEKELPS  157



>gb|KCW69651.1| hypothetical protein EUGRSUZ_F03055 [Eucalyptus grandis]
Length=204

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 124/198 (63%), Gaps = 18/198 (9%)
 Frame = +1

Query  94   NELKMNSYGLLPSFSSPSYKYNFNNPKYLTTIIHPKRFTASPNLSRNISGGKIRASGS--  267
            N   + S+ L PSFS  S           T   H + F +  + +R+    +IRA G+  
Sbjct  7    NSSHLASFSLTPSFSHRSR----------TRRAHLRPFRSQTSFARS----RIRAVGTVP  52

Query  268  -TVTPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSR  444
             + +   A EE   V  AFV SVL PDG+PDVH R A GGQKLRDIMLD +VELYGPY+R
Sbjct  53   ESGSETAAPEEPPCVNFAFVSSVLLPDGTPDVHLRTACGGQKLRDIMLDSDVELYGPYAR  112

Query  445  AlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTL  624
             L NC G GTC TC+VEVV+GKELLSP T+KE EKLK+KP+N+RLACQTTVG P+S+G L
Sbjct  113  PLLNCAGGGTCATCLVEVVQGKELLSPLTDKEKEKLKKKPKNYRLACQTTVGKPDSRG-L  171

Query  625  VIQQLPEWKGHEWNYKEL  678
                 P  +    N ++ 
Sbjct  172  SYNNCPSGRPMNGNLRKC  189



>ref|XP_006465663.1| PREDICTED: uncharacterized protein LOC102626236 isoform X6 [Citrus 
sinensis]
Length=158

 Score =   122 bits (305),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 110/200 (55%), Gaps = 53/200 (27%)
 Frame = +1

Query  100  LKMNSYGLLPSFSSPSYKYNFNNPKYLTTIIHPK-RFTASPNLSRNISGGKIRASGSTVT  276
            L++NSY  L S+S P   YNFN     TT  H   +F    + SR+    +IRA+ +   
Sbjct  4    LQLNSY-RLASYSLP---YNFN----CTTNSHKSLKFYKRVSFSRS----RIRATATISE  51

Query  277  PDE---AEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRA  447
             D    A EE  +V  AFVH+    +         A GG                     
Sbjct  52   NDSQANAAEEPPVVNFAFVHARPLSNC--------AGGG---------------------  82

Query  448  lcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLV  627
                    TCGTCMVEV+EGKELL  RT+KE EKLKRKP+NWRLACQTTVGTP+S G +V
Sbjct  83   --------TCGTCMVEVIEGKELLGSRTDKEKEKLKRKPKNWRLACQTTVGTPDSTGLVV  134

Query  628  IQQLPEWKGHEWNYKELKSS  687
            IQQLPEWKGHEW YK++ +S
Sbjct  135  IQQLPEWKGHEWKYKKIPTS  154



>ref|XP_006406855.1| hypothetical protein EUTSA_v10021523mg [Eutrema salsugineum]
 gb|ESQ48308.1| hypothetical protein EUTSA_v10021523mg [Eutrema salsugineum]
Length=168

 Score =   122 bits (306),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 105/158 (66%), Gaps = 9/158 (6%)
 Frame = +1

Query  100  LKMNSYGLLPSFS---SPSYKYNFNN--PKYLTTIIHPKRFTASPNLSRNISGGKIRASG  264
            +++N   L+ S S   S S+K    N  P +L +  +  R + +  + R IS     AS 
Sbjct  4    VQLNGSSLVASLSPNHSFSHKTKLCNLKPSFLRSRHNATRLSRAKTI-RAISTAP--ASQ  60

Query  265  STVTPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSR  444
             +V  DE  +E   V  AFVHSVL PDG+PDVH+R+A GGQKLRDIMLD N+ELYGPYS+
Sbjct  61   PSVA-DEPVDEPPAVDFAFVHSVLLPDGTPDVHWRRACGGQKLRDIMLDSNIELYGPYSK  119

Query  445  AlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKR  558
             L NC G+GTC TCMVE+V GKELL+PRT+ E EKLKR
Sbjct  120  PLSNCAGVGTCATCMVEIVNGKELLNPRTDIEKEKLKR  157



>gb|KDO56979.1| hypothetical protein CISIN_1g0293331mg, partial [Citrus sinensis]
Length=87

 Score =   114 bits (286),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +1

Query  487  MVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWKGHEWN  666
            MVEV+EGKELL  RT+KE EKLKRKP+NWRLACQTTVGTP+S G +VIQQLPEWKGHEW 
Sbjct  17   MVEVIEGKELLGSRTDKEKEKLKRKPKNWRLACQTTVGTPDSTGLVVIQQLPEWKGHEWK  76

Query  667  YKELKSS  687
            YK++ +S
Sbjct  77   YKKIPTS  83



>emb|CDO98002.1| unnamed protein product [Coffea canephora]
Length=96

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +1

Query  487  MVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWKGHEWN  666
            +VEVVEG+ELLSPRTEKE EKLKR PRNWRLACQTTVG P+S G +VIQQLPEWK HEWN
Sbjct  22   IVEVVEGRELLSPRTEKEKEKLKRNPRNWRLACQTTVGKPDSTGLVVIQQLPEWKMHEWN  81

Query  667  Y  669
            Y
Sbjct  82   Y  82



>emb|CDY30147.1| BnaC05g37150D [Brassica napus]
Length=100

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +1

Query  421  ELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVG  600
            +L+G Y                  ++V GKELL+PRT+ E EKLKRKP+NWRLACQT VG
Sbjct  4    KLWGVYRWWQAERDHGTRLLRRRAQIVNGKELLNPRTDIEKEKLKRKPKNWRLACQTNVG  63

Query  601  TPNSKGTLVIQQLPEWKGHEWN  666
             P+S G +VIQQLPEWK HEWN
Sbjct  64   NPDSTGLVVIQQLPEWKAHEWN  85



>emb|CDO98001.1| unnamed protein product [Coffea canephora]
Length=143

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 58/81 (72%), Gaps = 7/81 (9%)
 Frame = +1

Query  220  NLSRNISGGKIRASGSTV-------TPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAK  378
            +L+ N+S GKIRA GS+        T   ++E  A V  AFV SVL PDG+PDVH+RKA 
Sbjct  48   HLNLNLSKGKIRAVGSSAPDSQSAETSTTSQEPPAAVNFAFVSSVLLPDGTPDVHFRKAC  107

Query  379  GGQKLRDIMLDGNVELYGPYS  441
            GGQKLRDIMLD NVELYGPY+
Sbjct  108  GGQKLRDIMLDSNVELYGPYA  128



>ref|XP_010049032.1| PREDICTED: uncharacterized protein LOC104437723 [Eucalyptus grandis]
Length=176

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 94/171 (55%), Gaps = 14/171 (8%)
 Frame = +1

Query  142  PSYKYNFNNPKYLTTIIHPKRFTASPNLSRNISGGKIRASGSTVTPDEAEEEEAMVKIAF  321
            P    +F N +  +T++  KR   S N           A+GST  P  A  E+  +++ F
Sbjct  18   PDVTSDFGNRQRTSTLVRRKRLALSLN-----------AAGST-EPSSAAPEKPEIELEF  65

Query  322  VHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEV  498
            +      DGS  V   KA  G+KL R+IM +  +ELY  Y +A+   GG       +VE+
Sbjct  66   IGPKPGADGSYPVDKAKAVSGEKLLRNIMNENKIELYATYGKAMNCGGGGSCGTC-IVEI  124

Query  499  VEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
            ++GK+LL+ RT  E   LK+KP +WRLACQT VG   + G +V+Q+LP+WK
Sbjct  125  IDGKDLLNERTNTELRYLKKKPESWRLACQTIVGNKENSGKVVVQRLPQWK  175



>emb|CBI20927.3| unnamed protein product [Vitis vinifera]
Length=137

 Score = 96.7 bits (239),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 82/136 (60%), Gaps = 2/136 (1%)
 Frame = +1

Query  247  KIRASGSTVTPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVE  423
            KI A+ ++V       E+  +++ F+      DGS  V   KA  G+KL R+IMLD  +E
Sbjct  2    KIAAAANSVESSPTVPEKPEIELEFIGEKPGSDGSFPVERAKAVSGEKLLRNIMLDNKIE  61

Query  424  LYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGT  603
            LY PY + +   GG       +VE+++GK+LL+ RT  E   LK+KP +WRLACQT VG 
Sbjct  62   LYAPYGKLMNCGGGGSCGTC-IVEIIDGKDLLNERTNTELRYLKKKPESWRLACQTIVGN  120

Query  604  PNSKGTLVIQQLPEWK  651
              + G +V+Q+LP+WK
Sbjct  121  KENSGKVVVQRLPQWK  136



>gb|KCW81494.1| hypothetical protein EUGRSUZ_C02856 [Eucalyptus grandis]
Length=231

 Score = 98.6 bits (244),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 94/171 (55%), Gaps = 14/171 (8%)
 Frame = +1

Query  142  PSYKYNFNNPKYLTTIIHPKRFTASPNLSRNISGGKIRASGSTVTPDEAEEEEAMVKIAF  321
            P    +F N +  +T++  KR   S N           A+GST  P  A  E+  +++ F
Sbjct  73   PDVTSDFGNRQRTSTLVRRKRLALSLN-----------AAGST-EPSSAAPEKPEIELEF  120

Query  322  VHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEV  498
            +      DGS  V   KA  G+KL R+IM +  +ELY  Y +A+   GG       +VE+
Sbjct  121  IGPKPGADGSYPVDKAKAVSGEKLLRNIMNENKIELYATYGKAMNCGGGGSCGTC-IVEI  179

Query  499  VEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
            ++GK+LL+ RT  E   LK+KP +WRLACQT VG   + G +V+Q+LP+WK
Sbjct  180  IDGKDLLNERTNTELRYLKKKPESWRLACQTIVGNKENSGKVVVQRLPQWK  230



>ref|XP_002281853.1| PREDICTED: uncharacterized protein LOC100250753 [Vitis vinifera]
Length=172

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 90/136 (66%), Gaps = 2/136 (1%)
 Frame = +1

Query  247  KIRASGSTVTPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVE  423
            KI A+ ++V       E+  +++ F+      DGS  V   KA  G+KL R+IMLD  +E
Sbjct  37   KIAAAANSVESSPTVPEKPEIELEFIGEKPGSDGSFPVERAKAVSGEKLLRNIMLDNKIE  96

Query  424  LYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGT  603
            LY PY + L NCGG G+CGTC+VE+++GK+LL+ RT  E   LK+KP +WRLACQT VG 
Sbjct  97   LYAPYGK-LMNCGGGGSCGTCIVEIIDGKDLLNERTNTELRYLKKKPESWRLACQTIVGN  155

Query  604  PNSKGTLVIQQLPEWK  651
              + G +V+Q+LP+WK
Sbjct  156  KENSGKVVVQRLPQWK  171



>gb|KDO56977.1| hypothetical protein CISIN_1g0293332mg, partial [Citrus sinensis]
 gb|KDO56978.1| hypothetical protein CISIN_1g0293332mg, partial [Citrus sinensis]
Length=108

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 72/118 (61%), Gaps = 16/118 (14%)
 Frame = +1

Query  97   ELKMNSYGLLPSFSSPSYKYNFNNPKYLTTIIHPK-RFTASPNLSRNISGGKIRASGSTV  273
             L++NSY L  S+S P   YNFN     TT  H   +F    + SR     +IRA+ +  
Sbjct  3    SLQLNSYRL-ASYSLP---YNFN----CTTNSHKSLKFYKRVSFSR----SRIRATATIS  50

Query  274  TPDE---AEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPY  438
              D    A EE  +V  AFVHSVL PDG+PD+H+R A GGQKLRDIML+ N++LYGPY
Sbjct  51   ENDSQANAAEEPPVVNFAFVHSVLLPDGTPDIHFRTACGGQKLRDIMLNSNIDLYGPY  108



>ref|XP_006830417.1| hypothetical protein AMTR_s00118p00075510 [Amborella trichopoda]
 gb|ERM97833.1| hypothetical protein AMTR_s00118p00075510 [Amborella trichopoda]
Length=136

 Score = 94.0 bits (232),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 71/116 (61%), Gaps = 2/116 (2%)
 Frame = +1

Query  307  VKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgt  483
            +K+ F+     PDG+  V    A  G+KL R+IMLD  +ELY  Y + +   GG      
Sbjct  21   IKLEFMGPKPNPDGTCPVQTASALSGEKLLRNIMLDNKIELYAAYGKVMNCGGGGSCGTC  80

Query  484  cMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
             +VEV+ GKELL+ RT  E   LK+KP +WRLACQT VG   + G +VIQ+LP+WK
Sbjct  81   -IVEVIHGKELLNERTATEQRYLKKKPDSWRLACQTIVGNKENSGKVVIQRLPQWK  135



>dbj|BAJ88549.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=182

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 75/104 (72%), Gaps = 2/104 (2%)
 Frame = +1

Query  343  DGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELL  519
            DGS  V    A  G KL RD+M++  +ELY  Y + L NCGG G+CGTC+VE+++GKELL
Sbjct  79   DGSYPVDRAAAVSGDKLLRDVMVENKIELYAAYGK-LMNCGGGGSCGTCIVEIIDGKELL  137

Query  520  SPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
            SPRT+ EN  LK+KP +WRL CQT VG   + G +V+Q+LP+WK
Sbjct  138  SPRTDAENRYLKKKPESWRLTCQTIVGNKENSGKVVVQRLPQWK  181



>ref|XP_007013752.1| 2Fe-2S ferredoxin-like superfamily protein [Theobroma cacao]
 gb|EOY31371.1| 2Fe-2S ferredoxin-like superfamily protein [Theobroma cacao]
Length=174

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 97/178 (54%), Gaps = 13/178 (7%)
 Frame = +1

Query  124  LPSFSSPSYKYNFNNPKYLT-TIIHPKRFTASPNLSRNISGGKIRASGSTVTPDEAEEEE  300
            L S +     +++NN  Y   TI  P++        R+ S     +S  T +P   E+ E
Sbjct  6    LTSITPQPTGFSWNNNSYRNPTIFIPRK--------RHFSVTLATSSPETNSPTTTEKPE  57

Query  301  AMVKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtc  477
              +++ F+      DGS  V   KA  G+KL R+IMLD  +ELY  Y + +   GG    
Sbjct  58   --IELEFIGPNPGSDGSYPVDKAKAISGEKLLRNIMLDNKIELYAAYGKVMNCGGGGSCG  115

Query  478  gtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
               +VE+V+GK+LL+ RT  E   LK+KP +WRLACQT VG   + G +V+Q+LP+WK
Sbjct  116  TC-IVEIVDGKDLLNERTNTELRYLKKKPESWRLACQTIVGNKENSGKVVVQRLPQWK  172



>ref|XP_010041387.1| PREDICTED: uncharacterized protein LOC104430345 [Eucalyptus grandis]
 gb|KCW44387.1| hypothetical protein EUGRSUZ_L02133 [Eucalyptus grandis]
Length=175

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 91/171 (53%), Gaps = 14/171 (8%)
 Frame = +1

Query  142  PSYKYNFNNPKYLTTIIHPKRFTASPNLSRNISGGKIRASGSTVTPDEAEEEEAMVKIAF  321
            P    NF N +  + ++  KR   S N           A+GST  P  A  E+  +++ F
Sbjct  17   PDVASNFGNRQKPSKLVRGKRLALSLN-----------ATGST-GPSSAAPEKPEIELEF  64

Query  322  VHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEV  498
            +      DGS  V   KA  G+KL R+IM +  +ELY  Y + +   GG       +VE+
Sbjct  65   IGPKPGADGSYPVDKAKAVSGEKLLRNIMNENKIELYATYGKVMNCGGGGSCGTC-IVEI  123

Query  499  VEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
            ++GK+LL+ RT  E   LK+KP +WRLACQT VG   + G + +Q+LP+WK
Sbjct  124  IDGKDLLNERTNTELRYLKKKPESWRLACQTIVGNKENSGKVAVQRLPQWK  174



>ref|XP_006450558.1| hypothetical protein CICLE_v10009578mg [Citrus clementina]
 ref|XP_006476196.1| PREDICTED: uncharacterized protein LOC102630654 isoform X4 [Citrus 
sinensis]
 gb|ESR63798.1| hypothetical protein CICLE_v10009578mg [Citrus clementina]
 gb|KDO79618.1| hypothetical protein CISIN_1g029369mg [Citrus sinensis]
Length=173

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 78/130 (60%), Gaps = 2/130 (2%)
 Frame = +1

Query  265  STVTPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYS  441
            ++  P   E E+  +++ F+      DGS  V   KA  G+KL R+IMLD  +ELY  Y 
Sbjct  44   NSTEPSSPEPEKPEIELEFIAPRAGDDGSYPVERAKAISGEKLLRNIMLDNKIELYATYG  103

Query  442  RAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGT  621
            + +   GG       +VE+++GK+LL+ RT  E   LK+KP +WRLACQT VG   + G 
Sbjct  104  KVMNCGGGGSCGTC-IVEIIDGKDLLNERTNTELRYLKKKPESWRLACQTIVGNKENSGK  162

Query  622  LVIQQLPEWK  651
            +V+Q++P+WK
Sbjct  163  VVVQRIPQWK  172



>gb|ACG47194.1| electron carrier/ electron transporter/ iron ion binding protein 
[Zea mays]
Length=184

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 73/116 (63%), Gaps = 2/116 (2%)
 Frame = +1

Query  307  VKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgt  483
            +++ FV     PDGS  V   +A  G+KL RD+M +  +ELY  Y + +   GG      
Sbjct  69   IELEFVGPKPGPDGSFPVDRAEATSGEKLLRDVMNENKIELYAAYGKVMNCGGGGSCGTC  128

Query  484  cMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
             +VE+++GKELL+ RT  EN  LK+KP +WRLACQT VG   + G +V+Q+LP+WK
Sbjct  129  -IVEIIDGKELLNERTNXENRYLKKKPDSWRLACQTIVGNKXNSGKVVVQRLPQWK  183



>ref|NP_001056273.1| Os05g0555300 [Oryza sativa Japonica Group]
 dbj|BAF18187.1| Os05g0555300 [Oryza sativa Japonica Group]
 dbj|BAG88480.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64636.1| hypothetical protein OsJ_19490 [Oryza sativa Japonica Group]
Length=185

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 71/116 (61%), Gaps = 2/116 (2%)
 Frame = +1

Query  307  VKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgt  483
            + + FV      DGS  V    A  G+KL RD+M++  +ELY  Y + +   GG      
Sbjct  70   IDLEFVGPKADADGSFPVDRAAAGSGEKLLRDVMVENKIELYAAYGKVMNCGGGGSCGTC  129

Query  484  cMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
             +VE+V+GKELL+ RT  EN  LK+KP +WRLACQT VG   + G +V+Q+LP+WK
Sbjct  130  -IVEIVDGKELLNERTNTENRYLKKKPESWRLACQTIVGNKENSGKVVVQRLPQWK  184



>ref|XP_006654759.1| PREDICTED: uncharacterized protein LOC102713363 [Oryza brachyantha]
Length=183

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 86/162 (53%), Gaps = 9/162 (6%)
 Frame = +1

Query  178  LTTIIHPKR---FTASPNLSRNISGGKIRASGSTVTPDEAEEEEAMVKIAFVHSVLFPDG  348
            ++T +H  R   F ASP    N +   +    S      A   +  + + FV      DG
Sbjct  26   VSTRVHHHRKASFRASPVRCSNAASPNV----SPAEAAPAPAPKPQIDLEFVGPKADADG  81

Query  349  SPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSP  525
               V    A  G+KL RD+ML+  +ELY PY + +   GG       +VE+V GKELL+ 
Sbjct  82   LFPVDRAAALSGEKLLRDVMLENKIELYAPYGKVMNCGGGGSCGTC-IVEIVGGKELLNE  140

Query  526  RTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
            RT  EN  LK+KP +WRLACQT VG   + G +V+Q+LP+WK
Sbjct  141  RTNTENRYLKKKPESWRLACQTIVGNKENSGKVVVQRLPQWK  182



>tpg|DAA40854.1| TPA: hypothetical protein ZEAMMB73_132806 [Zea mays]
Length=165

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  496  VVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWKGHEWN  666
            VVEGKE+LSP+TE E E LKRKP+ WRLACQ TVG  +S G ++IQQLPEWK HEW+
Sbjct  108  VVEGKEMLSPKTEVEKELLKRKPKTWRLACQATVGNADSTGQMIIQQLPEWKIHEWD  164



>emb|CDY30148.1| BnaC05g37140D [Brassica napus]
Length=143

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +1

Query  283  EAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAlcncg  462
            E ++E   V  AFVHSVL PDG+PDVH+R+A GGQKLRDIMLD N+ELYGPYS+ L NC 
Sbjct  63   EPDDEPPAVDFAFVHSVLLPDGTPDVHWRRACGGQKLRDIMLDTNIELYGPYSKPLSNCA  122

Query  463  glgtcgtcMVEV  498
            G+GTC TCMVEV
Sbjct  123  GVGTCATCMVEV  134



>gb|EEC79669.1| hypothetical protein OsI_20921 [Oryza sativa Indica Group]
Length=185

 Score = 92.0 bits (227),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 70/116 (60%), Gaps = 2/116 (2%)
 Frame = +1

Query  307  VKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgt  483
            + + FV      DGS  V    A  G+KL RD+M++  +ELY  Y + +   GG      
Sbjct  70   IDLEFVGPKADADGSFPVDRAAAGSGEKLLRDVMVENKIELYAAYGKVMNCGGGGSCGTC  129

Query  484  cMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
             +VE+V+GKE L+ RT  EN  LK+KP +WRLACQT VG   + G +V+Q+LP+WK
Sbjct  130  -IVEIVDGKEFLNERTNTENRYLKKKPESWRLACQTIVGNKENSGKVVVQRLPQWK  184



>gb|KDP32290.1| hypothetical protein JCGZ_13215 [Jatropha curcas]
Length=172

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 79/135 (59%), Gaps = 4/135 (3%)
 Frame = +1

Query  250  IRASGSTVTPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVEL  426
            + AS    +P   E  E  +++ F+      DG   V   KA  G+KL R+IMLD  +EL
Sbjct  40   VSASSPEYSPPVPENPE--IELEFIGPKADGDGRYPVERAKAISGEKLLRNIMLDNKIEL  97

Query  427  YGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTP  606
            Y PY + +   GG       +VE+++GK+LL+ RT  E   LK+KP +WRLACQT VG  
Sbjct  98   YAPYGKVMNCGGGGSCGTC-IVEILDGKDLLNERTNTELRYLKKKPESWRLACQTIVGNK  156

Query  607  NSKGTLVIQQLPEWK  651
             + G +V+Q+LP+WK
Sbjct  157  ENSGKVVVQRLPQWK  171



>ref|XP_009401825.1| PREDICTED: uncharacterized protein LOC103985740 [Musa acuminata 
subsp. malaccensis]
Length=180

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 87/156 (56%), Gaps = 4/156 (3%)
 Frame = +1

Query  190  IHPKRFTASPNLSRNISGGKIRASGSTVTPDEAEEE-EAMVKIAFVHSVLFPDGSPDVHY  366
            +HP      P+ S +I       S S  TP  +EE  +  +++ F+      DG+  V  
Sbjct  26   VHPPPSRRKPSFSISIPHAAA-PSSSNPTPTTSEEPPKPQIELEFLGPKAGADGAYPVDK  84

Query  367  RKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKEN  543
              A  G+KL R+IMLD  +ELY  Y + +   GG       +VE+V+GK+LL+ RT+ E 
Sbjct  85   ASAVSGEKLLRNIMLDNKIELYAAYGKVMNCGGGGSCGTC-IVEIVDGKDLLNERTKTEQ  143

Query  544  EKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
              LK+KP +WRLACQT VG   + G +V+Q+ P+WK
Sbjct  144  RYLKKKPESWRLACQTIVGNKENSGKVVVQRTPQWK  179



>ref|NP_001147484.1| electron carrier/ electron transporter/ iron ion binding protein 
[Zea mays]
 gb|ACG27670.1| electron carrier/ electron transporter/ iron ion binding protein 
[Zea mays]
Length=182

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 72/116 (62%), Gaps = 2/116 (2%)
 Frame = +1

Query  307  VKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgt  483
            +++ FV      DGS  V   +A  G+KL RD+M +  +ELY  Y + +   GG      
Sbjct  67   IELEFVGPKPGADGSFPVDRAEAASGEKLLRDVMNENKIELYAAYGKVMNCGGGGSCGTC  126

Query  484  cMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
             +VE+++GKELL+ RT  EN  LK+KP +WRLACQT VG   + G +V+Q+LP+WK
Sbjct  127  -IVEIIDGKELLNERTNTENRYLKKKPDSWRLACQTIVGNKENSGKVVVQRLPQWK  181



>ref|XP_003565942.1| PREDICTED: uncharacterized protein LOC100844664 [Brachypodium 
distachyon]
Length=180

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 79/116 (68%), Gaps = 2/116 (2%)
 Frame = +1

Query  307  VKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgt  483
            +++ F+      DGS  V    A  G+KL RD+ML+  +ELY  Y + L NCGG G+CGT
Sbjct  65   IELEFLGPKAGADGSYPVDRAAAASGEKLLRDVMLENKLELYAAYGK-LMNCGGGGSCGT  123

Query  484  cMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
            C+VE+++GKELLS RT  EN  LK+KP +WRL CQT VG   + G +V+Q+LP+WK
Sbjct  124  CIVEIIDGKELLSERTAAENRYLKKKPDSWRLTCQTIVGNKENSGKVVVQRLPQWK  179



>ref|XP_008445132.1| PREDICTED: uncharacterized protein LOC103488260 isoform X1 [Cucumis 
melo]
Length=176

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 76/127 (60%), Gaps = 6/127 (5%)
 Frame = +1

Query  274  TPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAl  450
            TP E  E    +++ F+      DGS  V   KA  G KL R+IMLD  +ELY PY + +
Sbjct  54   TPAEKPE----IELEFIGPKPGSDGSFPVDTVKAISGDKLLRNIMLDNKIELYAPYGKLM  109

Query  451  cncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVI  630
               GG       +VE+++GK+LL+ RT  E   LK+KP +WRLACQT VG   + G +V+
Sbjct  110  NCGGGGSCGTC-IVEILDGKDLLNERTNTELRYLKKKPESWRLACQTIVGNKENSGKVVV  168

Query  631  QQLPEWK  651
            Q+LP+WK
Sbjct  169  QRLPQWK  175



>gb|AFW79079.1| electron carrier/ electron transporter/ iron ion binding protein 
[Zea mays]
Length=184

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 72/116 (62%), Gaps = 2/116 (2%)
 Frame = +1

Query  307  VKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgt  483
            +++ FV      DGS  V   +A  G+KL RD+M +  +ELY  Y + +   GG      
Sbjct  69   IELEFVGPKPGADGSFPVDRAEAASGEKLLRDVMNENKIELYAAYGKVMNCGGGGSCGTC  128

Query  484  cMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
             +VE+++GKELL+ RT  EN  LK+KP +WRLACQT VG   + G +V+Q+LP+WK
Sbjct  129  -IVEIIDGKELLNERTNTENRYLKKKPDSWRLACQTIVGNKENSGKVVVQRLPQWK  183



>ref|NP_001150870.1| electron carrier/ electron transporter/ iron ion binding protein 
[Zea mays]
 gb|ACG40710.1| electron carrier/ electron transporter/ iron ion binding protein 
[Zea mays]
Length=184

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 72/116 (62%), Gaps = 2/116 (2%)
 Frame = +1

Query  307  VKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgt  483
            +++ FV      DGS  V   +A  G+KL RD+M +  +ELY  Y + +   GG      
Sbjct  69   IELEFVGPKPGADGSFPVDRAEATSGEKLLRDVMNENKIELYAAYGKVMNCGGGGSCGTC  128

Query  484  cMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
             +VE+++GKELL+ RT  EN  LK+KP +WRLACQT VG   + G +V+Q+LP+WK
Sbjct  129  -IVEIIDGKELLNERTNTENRYLKKKPDSWRLACQTIVGNKENSGKVVVQRLPQWK  183



>ref|XP_004138751.1| PREDICTED: uncharacterized protein LOC101202753 isoform 1 [Cucumis 
sativus]
 gb|KGN62897.1| hypothetical protein Csa_2G379280 [Cucumis sativus]
Length=176

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 76/127 (60%), Gaps = 6/127 (5%)
 Frame = +1

Query  274  TPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAl  450
            TP E  E    +++ F+      DGS  V   KA  G KL R+IMLD  +ELY PY + +
Sbjct  54   TPAEKPE----IELEFIGPKPGSDGSFPVDTVKAISGDKLLRNIMLDNKLELYAPYGKLM  109

Query  451  cncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVI  630
               GG       +VE+++GK+LL+ RT  E   LK+KP +WRLACQT VG   + G +V+
Sbjct  110  NCGGGGSCGTC-IVEILDGKDLLNERTNTELRYLKKKPESWRLACQTIVGNKENSGKVVV  168

Query  631  QQLPEWK  651
            Q+LP+WK
Sbjct  169  QRLPQWK  175



>ref|XP_010526190.1| PREDICTED: uncharacterized protein LOC104803819 [Tarenaya hassleriana]
Length=171

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 72/116 (62%), Gaps = 2/116 (2%)
 Frame = +1

Query  307  VKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgt  483
            +++ FV      DGS  V   KA  G+KL R IML+  +ELY  Y + +   GG      
Sbjct  56   IELEFVGPKPGSDGSYPVDKAKAVSGEKLLRSIMLEKKIELYAAYGKVMNCGGGGSCGTC  115

Query  484  cMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
             +VE+++GK+LL+ RT  EN  LK+KP +WRLACQT VG   + G +V+Q+LP+WK
Sbjct  116  -IVEILDGKDLLNERTNTENRYLKKKPESWRLACQTIVGNKENSGKVVVQRLPQWK  170



>emb|CDP19031.1| unnamed protein product [Coffea canephora]
Length=173

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 86/156 (55%), Gaps = 6/156 (4%)
 Frame = +1

Query  181  TTIIHPKRFTASPNLSRNISGGKIRASGSTVTPDEAEEEEAMVKIAFVHSVLFPDGSPDV  360
            TT  HPK  T SP   R  S   +  S    +P+  E+ E  +++ F+      DG   V
Sbjct  20   TTGKHPKFSTFSPR--RKPSSISLATSSPESSPEILEKPE--IELEFIGPKAGADGKFPV  75

Query  361  HYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEK  537
               KA  G KL R+IMLD  +ELY  Y + +   GG       +VE+V+GK+LLS RT  
Sbjct  76   EKAKAISGAKLLRNIMLDNKIELYATYGKLMNCGGGGSCGTC-IVEIVDGKDLLSERTNT  134

Query  538  ENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPE  645
            E   LK+KP +WRLACQT VG   + G +V+Q+LP+
Sbjct  135  EFRYLKKKPESWRLACQTIVGNKENSGKVVVQRLPQ  170



>ref|XP_010447367.1| PREDICTED: uncharacterized protein LOC104730014 [Camelina sativa]
Length=169

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 67/104 (64%), Gaps = 2/104 (2%)
 Frame = +1

Query  343  DGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELL  519
            DGS  V+  KA  G KL R IM D  +ELY  Y + +   GG       +VE++EG++LL
Sbjct  66   DGSYPVNKAKAVSGAKLMRSIMQDNKIELYAAYGKVMNCGGGGSCGTC-IVEILEGRDLL  124

Query  520  SPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
            + RT+ EN  LK+KP +WRLACQT VG   + G +V+Q++P+WK
Sbjct  125  NERTDTENRYLKKKPESWRLACQTIVGNKENSGKVVVQRIPQWK  168



>gb|KFK29869.1| hypothetical protein AALP_AA7G189600 [Arabis alpina]
Length=140

 Score = 88.6 bits (218),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 68/104 (65%), Gaps = 2/104 (2%)
 Frame = +1

Query  343  DGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELL  519
            DGS  V   KA  G+KL R IM D  +ELY  Y + +   GG       +VE+++G++LL
Sbjct  37   DGSYPVDKAKAVSGEKLLRSIMQDNKIELYATYGKVMNCGGGGSCGTC-IVEILDGRDLL  95

Query  520  SPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
            + RT+ EN+ LK+KP +WRLACQT VG   + G +V+Q++P+WK
Sbjct  96   NERTDTENKYLKKKPESWRLACQTIVGNKENSGKVVVQRIPQWK  139



>ref|XP_004961285.1| PREDICTED: uncharacterized protein LOC101765231 [Setaria italica]
Length=185

 Score = 89.4 bits (220),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 82/149 (55%), Gaps = 12/149 (8%)
 Frame = +1

Query  208  TASPNLSRNISGGKIRASGSTVTPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQ  387
            +ASPN+S+          G+          +  + + FV      DG+  V   +A  G+
Sbjct  47   SASPNVSQ----------GAPAPAPAPAPPKPQIDLEFVGPQPGADGTYPVDRAEAASGE  96

Query  388  KL-RDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKP  564
            KL RDIM +  +ELY  Y + +   GG       +VE+++GKELL+ RT  EN  LK+KP
Sbjct  97   KLLRDIMNENKIELYAAYGKVMNCGGGGSCGTC-IVEILDGKELLNERTNTENRYLKKKP  155

Query  565  RNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
             +WRLACQT VG   + G +V+Q+LP+WK
Sbjct  156  ESWRLACQTIVGNKENSGKVVVQRLPQWK  184



>ref|XP_010049028.1| PREDICTED: uncharacterized protein LOC104437718 [Eucalyptus grandis]
Length=175

 Score = 89.0 bits (219),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 89/166 (54%), Gaps = 14/166 (8%)
 Frame = +1

Query  157  NFNNPKYLTTIIHPKRFTASPNLSRNISGGKIRASGSTVTPDEAEEEEAMVKIAFVHSVL  336
            NF   +  + ++  KR   S N           A+GST  P  A  E+  +++ F+    
Sbjct  22   NFGIRQKTSKLVRGKRLALSLN-----------AAGST-EPSSAAPEKPEIELEFIGPKP  69

Query  337  FPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKE  513
              DGS      KA  G+KL R+IM +  +ELY  Y +A+   GG       +VE+++GK+
Sbjct  70   GADGSYPGDKAKAVSGEKLLRNIMNENKIELYATYGKAMNCGGGGSCGTC-IVEIIDGKD  128

Query  514  LLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
            LL+ RT  E   LK+KP +WRLACQT VG   + G + +Q+LP+WK
Sbjct  129  LLNERTNTELRYLKKKPESWRLACQTIVGNKENSGKVAVQRLPQWK  174



>ref|XP_010432692.1| PREDICTED: uncharacterized protein LOC104716917 [Camelina sativa]
Length=162

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 66/104 (63%), Gaps = 2/104 (2%)
 Frame = +1

Query  343  DGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELL  519
            DGS  V   KA  G KL R IM D  +ELY  Y + +   GG       +VE++EG++LL
Sbjct  59   DGSYPVDKAKAVSGAKLMRSIMQDNKIELYAAYGKVMNCGGGGSCGTC-IVEILEGRDLL  117

Query  520  SPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
            + RT+ EN  LK+KP +WRLACQT VG   + G +V+Q++P+WK
Sbjct  118  NERTDTENRYLKKKPESWRLACQTIVGNKENSGKVVVQRIPQWK  161



>ref|XP_010051201.1| PREDICTED: uncharacterized protein LOC104439895 [Eucalyptus grandis]
Length=317

 Score = 90.9 bits (224),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 61/171 (36%), Positives = 92/171 (54%), Gaps = 14/171 (8%)
 Frame = +1

Query  142  PSYKYNFNNPKYLTTIIHPKRFTASPNLSRNISGGKIRASGSTVTPDEAEEEEAMVKIAF  321
            P    NF N +  + ++  K    S N           A+GST  P  A  E+  +++ F
Sbjct  159  PDVASNFGNRQKPSKLVRGKLLALSLN-----------AAGST-EPSSAAPEKPEIELEF  206

Query  322  VHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEV  498
            +      DGS  V   KA  G+KL R+IM +  +ELY  Y + +   GG       +VE+
Sbjct  207  IGPKPGADGSYPVDKAKAVSGEKLLRNIMNENKIELYATYGKVMNCGGGGSCGTC-IVEI  265

Query  499  VEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
            ++GK+LL+ RT  E + LK+KP +WRLACQT VG   + G +V+++LP+WK
Sbjct  266  IDGKDLLNERTNTELQYLKKKPESWRLACQTIVGNKENSGKVVVRRLPQWK  316



>ref|XP_007225952.1| hypothetical protein PRUPE_ppa012418mg [Prunus persica]
 gb|EMJ27151.1| hypothetical protein PRUPE_ppa012418mg [Prunus persica]
Length=170

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 90/143 (63%), Gaps = 7/143 (5%)
 Frame = +1

Query  226  SRNISGGKIRASGSTVTPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDI  402
            S ++S   I A  S   P + E     +++ F+      DGS  V   KA  G+KL RD+
Sbjct  33   SVSVSFAGISAEMSPAQPGKPE-----IELEFIGPKPGNDGSYPVESAKAISGEKLLRDV  87

Query  403  MLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLA  582
            M D  +ELY  Y + L NCGG G+CGTC+VE+++GK+LL+ RT  E + LK+KP +WRLA
Sbjct  88   MSDNKIELYATYGK-LMNCGGGGSCGTCIVEIIDGKDLLNERTNTELKYLKKKPESWRLA  146

Query  583  CQTTVGTPNSKGTLVIQQLPEWK  651
            CQT VG   + G +V+Q++P+WK
Sbjct  147  CQTIVGNKENSGKVVVQRIPQWK  169



>ref|XP_008219857.1| PREDICTED: uncharacterized protein LOC103320026 [Prunus mume]
Length=170

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 90/143 (63%), Gaps = 7/143 (5%)
 Frame = +1

Query  226  SRNISGGKIRASGSTVTPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDI  402
            S ++S   I A  S   P + E     +++ F+      DGS  V   KA  G+KL RD+
Sbjct  33   SVSVSFAGISAEMSPAQPGKPE-----IELEFIGPKPGNDGSYPVESAKAISGEKLLRDV  87

Query  403  MLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLA  582
            M D  +ELY  Y + L NCGG G+CGTC+VE+++GK+LL+ RT  E + LK+KP +WRLA
Sbjct  88   MSDNKIELYATYGK-LMNCGGGGSCGTCIVEIIDGKDLLNERTNTELKYLKKKPESWRLA  146

Query  583  CQTTVGTPNSKGTLVIQQLPEWK  651
            CQT VG   + G +V+Q++P+WK
Sbjct  147  CQTIVGNKENSGKVVVQRIPQWK  169



>ref|XP_010249906.1| PREDICTED: uncharacterized protein LOC104592303 [Nelumbo nucifera]
Length=174

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 81/143 (57%), Gaps = 7/143 (5%)
 Frame = +1

Query  226  SRNISGGKIRASGSTVTPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDI  402
            S ++S   I +  +   P++ E     +++ F+      DG   V    A  G+KL R+I
Sbjct  37   SVSVSCAAIPSESAQAAPEKPE-----IELEFIGPKPGADGPYPVDRATAISGEKLLRNI  91

Query  403  MLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLA  582
            MLD  +ELY  Y + +   GG       +VE+V+GK+LL+ RT  E   LK+KP +WRLA
Sbjct  92   MLDNKIELYAAYGKVMNCGGGGSCGTC-IVEIVDGKDLLNERTNTELRYLKKKPESWRLA  150

Query  583  CQTTVGTPNSKGTLVIQQLPEWK  651
            CQT VG   + G +V+Q+LP+WK
Sbjct  151  CQTIVGNKENSGKVVVQRLPQWK  173



>ref|XP_008394020.1| PREDICTED: uncharacterized protein LOC103456149 [Malus domestica]
Length=174

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 101/182 (55%), Gaps = 17/182 (9%)
 Frame = +1

Query  109  NSYGLLPSFSSPSYKYNFNNPKYLTTIIHPKRFTASPNLSRNISGGKIRASGSTVTPDEA  288
            N+    P+  S +   N+  P    T   P+R   S      +    I A  S   P + 
Sbjct  8    NAASFRPAQVSGAGPRNYQQP----TEFFPRRKCVS------VCFAGISADSSPTQPGKP  57

Query  289  EEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgg  465
            E     +++ F+      DGS  V   KA  G+KL RD+M D  VELY  Y + L NCGG
Sbjct  58   E-----IELEFIGPKPGNDGSYPVESAKAISGEKLLRDVMSDNKVELYATYGK-LMNCGG  111

Query  466  lgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPE  645
             G+CGTC+VE+++GK+LL+ RT  E + LK+KP +WRLACQT VG   + G +V+Q++P+
Sbjct  112  GGSCGTCIVEIIDGKDLLNERTNTELKYLKKKPESWRLACQTIVGNKENSGKVVVQRIPQ  171

Query  646  WK  651
            WK
Sbjct  172  WK  173



>ref|NP_567899.1| 2Fe-2S iron-sulfur cluster binding domain-containing protein 
[Arabidopsis thaliana]
 gb|AAK76639.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91737.1| unknown protein [Arabidopsis thaliana]
 gb|AEE86083.1| 2Fe-2S iron-sulfur cluster binding domain-containing protein 
[Arabidopsis thaliana]
Length=173

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 74/130 (57%), Gaps = 9/130 (7%)
 Frame = +1

Query  265  STVTPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYS  441
            S VTP E E E       F       DGS  V   KA  G KL R IM D  +ELY  Y 
Sbjct  51   SAVTPLEIELE-------FFGPKPGSDGSYPVDKAKAVSGDKLLRSIMQDNKIELYAAYG  103

Query  442  RAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGT  621
            + +   GG       +VE+++G++LL+ RT+ EN  LK+KP +WRLACQT VG   + G 
Sbjct  104  KVMNCGGGGSCGTC-IVEILDGRDLLNERTDTENRYLKKKPESWRLACQTIVGNKENSGK  162

Query  622  LVIQQLPEWK  651
            +V+Q++P+WK
Sbjct  163  VVVQRIPQWK  172



>ref|XP_009377507.1| PREDICTED: uncharacterized protein LOC103966093 [Pyrus x bretschneideri]
Length=174

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 86/135 (64%), Gaps = 7/135 (5%)
 Frame = +1

Query  250  IRASGSTVTPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVEL  426
            I A  S   P + E     +++ F+      DGS  V   KA  G+KL RD+M D  VEL
Sbjct  45   ISADSSPTQPGKPE-----IELEFIGPKPGNDGSYPVESAKAISGEKLLRDVMSDNKVEL  99

Query  427  YGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTP  606
            Y  Y + L NCGG G+CGTC+VE+++GK+LL+ RT  E + LK+KP +WRLACQT VG  
Sbjct  100  YATYGK-LMNCGGGGSCGTCIVEIIDGKDLLNERTNTELKYLKKKPESWRLACQTIVGNK  158

Query  607  NSKGTLVIQQLPEWK  651
             + G +V+Q++P+WK
Sbjct  159  ENSGKVVVQRIPQWK  173



>ref|XP_008811590.1| PREDICTED: uncharacterized protein LOC103722715 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008811591.1| PREDICTED: uncharacterized protein LOC103722715 isoform X1 [Phoenix 
dactylifera]
Length=196

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 70/116 (60%), Gaps = 2/116 (2%)
 Frame = +1

Query  307  VKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgt  483
            +++ FV   +  DGS  V    A  G+KL RDIMLD  +ELY  Y + +   GG      
Sbjct  81   IELEFVGPKVGVDGSYPVDRASAISGEKLLRDIMLDNQIELYAAYGKVMNCGGGGSCGTC  140

Query  484  cMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
             +VE+++G ELL+ +T  E   LK+KP +WRLACQT VG   + G + +Q++P+WK
Sbjct  141  -IVEIIDGMELLNEKTNTEKRYLKKKPESWRLACQTIVGNKENAGKVTVQRMPQWK  195



>gb|KCW81491.1| hypothetical protein EUGRSUZ_C02852 [Eucalyptus grandis]
Length=255

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 89/166 (54%), Gaps = 14/166 (8%)
 Frame = +1

Query  157  NFNNPKYLTTIIHPKRFTASPNLSRNISGGKIRASGSTVTPDEAEEEEAMVKIAFVHSVL  336
            NF   +  + ++  KR   S N           A+GST  P  A  E+  +++ F+    
Sbjct  102  NFGIRQKTSKLVRGKRLALSLN-----------AAGST-EPSSAAPEKPEIELEFIGPKP  149

Query  337  FPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKE  513
              DGS      KA  G+KL R+IM +  +ELY  Y +A+   GG       +VE+++GK+
Sbjct  150  GADGSYPGDKAKAVSGEKLLRNIMNENKIELYATYGKAMNCGGGGSCGTC-IVEIIDGKD  208

Query  514  LLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
            LL+ RT  E   LK+KP +WRLACQT VG   + G + +Q+LP+WK
Sbjct  209  LLNERTNTELRYLKKKPESWRLACQTIVGNKENSGKVAVQRLPQWK  254



>ref|XP_002869262.1| hypothetical protein ARALYDRAFT_913185 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45521.1| hypothetical protein ARALYDRAFT_913185 [Arabidopsis lyrata subsp. 
lyrata]
Length=175

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 67/104 (64%), Gaps = 2/104 (2%)
 Frame = +1

Query  343  DGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELL  519
            DGS  V   KA  G+KL R IM D  +ELY  Y + +   GG       +VE+++G++LL
Sbjct  72   DGSYPVDKAKAVSGEKLLRSIMQDTKIELYAAYGKVMNCGGGGSCGTC-IVEILDGRDLL  130

Query  520  SPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
            + RT+ EN  LK+KP +WRLACQT VG   + G +V+Q++P+WK
Sbjct  131  NERTDTENRYLKKKPESWRLACQTIVGNKENSGKVVVQRIPQWK  174



>ref|XP_007161258.1| hypothetical protein PHAVU_001G055300g [Phaseolus vulgaris]
 gb|ESW33252.1| hypothetical protein PHAVU_001G055300g [Phaseolus vulgaris]
Length=159

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 84/134 (63%), Gaps = 2/134 (1%)
 Frame = +1

Query  253  RASGSTVTPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELY  429
            R + S      ++E    +++ F+      +G   V   KA  G+KL R+IM D  +ELY
Sbjct  26   RRTNSVALAATSQESPPEIELEFIAPKAESEGRYAVEKAKAISGEKLLRNIMSDNKIELY  85

Query  430  GPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPN  609
              Y + L NCGG G+CGTC+VE++EGK+LL+ RT  E   LK+KP +WRLACQT VG   
Sbjct  86   ATYGK-LMNCGGGGSCGTCIVEIIEGKDLLNERTNTELRYLKKKPESWRLACQTIVGNKE  144

Query  610  SKGTLVIQQLPEWK  651
            + G +V+Q++P+WK
Sbjct  145  NSGKVVVQRIPQWK  158



>ref|XP_010913958.1| PREDICTED: uncharacterized protein LOC105039410 isoform X2 [Elaeis 
guineensis]
 ref|XP_010914030.1| PREDICTED: uncharacterized protein LOC105039410 isoform X2 [Elaeis 
guineensis]
Length=188

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 71/116 (61%), Gaps = 2/116 (2%)
 Frame = +1

Query  307  VKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgt  483
            +++ FV      DGS  V    A  G+KL R+IMLD  +ELY  Y + +   GG      
Sbjct  73   IELEFVGPKAGEDGSYPVDRASAISGEKLLRNIMLDNKIELYAAYGKVMNCGGGGSCGTC  132

Query  484  cMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
             +VE+++G ELL+ +T+ E   LK+KP +WRLACQT VG   + G +++Q++P+WK
Sbjct  133  -IVEIIDGMELLNEKTDTEKRYLKKKPESWRLACQTIVGNKENAGKVIVQRMPQWK  187



>ref|XP_003550159.1| PREDICTED: uncharacterized protein LOC100807125 isoform X1 [Glycine 
max]
Length=161

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 77/116 (66%), Gaps = 2/116 (2%)
 Frame = +1

Query  307  VKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgt  483
            +++ F+      DGS  V   KA  G+KL R+IMLD  +ELY  Y + L NC G G+CGT
Sbjct  46   IELEFIGPKPGSDGSYPVERVKAISGEKLLRNIMLDNKIELYATYGK-LMNCAGGGSCGT  104

Query  484  cMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
            C+VE++EGK+LL+ RT  E   L +KP +WRLACQT VG   + G + +Q++P+WK
Sbjct  105  CIVEIIEGKDLLNERTNTELRYLSKKPESWRLACQTIVGNKENSGKVAVQRIPQWK  160



>ref|XP_010437886.1| PREDICTED: uncharacterized protein LOC104721570 [Camelina sativa]
Length=165

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 66/104 (63%), Gaps = 2/104 (2%)
 Frame = +1

Query  343  DGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELL  519
            DGS  V   KA  G KL R IM D  +ELY  Y + +   GG       +VE+++G++LL
Sbjct  62   DGSYPVDKAKAVIGAKLMRSIMQDSRIELYAAYGKVMNCGGGGSCGTC-IVEILDGRDLL  120

Query  520  SPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
            + RT+ EN  LK+KP +WRLACQT VG   + G +V+Q++P+WK
Sbjct  121  NERTDTENRYLKKKPESWRLACQTIVGNKENSGKVVVQRIPQWK  164



>gb|AFK39613.1| unknown [Lotus japonicus]
Length=160

 Score = 85.5 bits (210),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 65/105 (62%), Gaps = 2/105 (2%)
 Frame = +1

Query  340  PDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKEL  516
            P G  D+   KA  G KL R+IMLD  +ELY  Y + +   GG       +VE++EG +L
Sbjct  56   PKGEGDLDKAKAISGAKLLRNIMLDNKIELYATYGKLMNCGGGGSCGTC-IVEIIEGGDL  114

Query  517  LSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
            L+ RT  E   LK+KP +WRLACQT VG   + G +V+Q++P+WK
Sbjct  115  LNERTNTELRYLKKKPESWRLACQTIVGNKENCGKVVVQRIPQWK  159



>ref|XP_010670755.1| PREDICTED: uncharacterized protein LOC104887730 [Beta vulgaris 
subsp. vulgaris]
Length=175

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 72/123 (59%), Gaps = 2/123 (2%)
 Frame = +1

Query  286  AEEEEAMVKIAFVHSVLFPDGS-PDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAlcncg  462
             E E+  +++ FV      DGS P    R   G + LR+IM D  +ELY  Y + +   G
Sbjct  53   TEPEKPEIELEFVGPKAGDDGSYPMDRARVVSGEKLLRNIMADNKIELYATYGKVMNCGG  112

Query  463  glgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLP  642
            G       +VE+++GK+LL+ RT  E   LK+KP +WRLACQT VG   + G +V+Q+LP
Sbjct  113  GGSCGTC-IVEILDGKDLLNERTNAELRYLKKKPESWRLACQTIVGNRENSGKVVVQRLP  171

Query  643  EWK  651
            +WK
Sbjct  172  QWK  174



>ref|XP_006412452.1| hypothetical protein EUTSA_v10026415mg [Eutrema salsugineum]
 gb|ESQ53905.1| hypothetical protein EUTSA_v10026415mg [Eutrema salsugineum]
Length=135

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 67/104 (64%), Gaps = 2/104 (2%)
 Frame = +1

Query  343  DGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELL  519
            DGS      KA  G+KL R+IM +  +ELY  Y + +   GG       +VE+++G++LL
Sbjct  32   DGSYPADKAKAVSGEKLLRNIMQENKIELYATYGKVMNCGGGGSCGTC-IVEILDGRDLL  90

Query  520  SPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
            + RT+ EN  LK+KP +WRLACQT VG   + G +V+Q++P+WK
Sbjct  91   NERTDTENRYLKKKPESWRLACQTIVGNKENSGKVVVQRIPQWK  134



>ref|XP_009125813.1| PREDICTED: uncharacterized protein LOC103850777 [Brassica rapa]
Length=171

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 67/104 (64%), Gaps = 2/104 (2%)
 Frame = +1

Query  343  DGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELL  519
            DG+      KA  G+KL R IM D  +ELY  Y + +   GG       +VE+++G+ELL
Sbjct  68   DGTYPRDKAKAVSGEKLLRSIMQDNKLELYATYGKVMNCGGGGSCGTC-IVEILDGRELL  126

Query  520  SPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
            + RT+ EN+ LK+KP +WRLACQT VG   + G +V+Q++P+WK
Sbjct  127  NERTDTENKYLKKKPESWRLACQTIVGNKENSGKVVVQRIPQWK  170



>ref|XP_006412454.1| hypothetical protein EUTSA_v10026415mg [Eutrema salsugineum]
 gb|ESQ53907.1| hypothetical protein EUTSA_v10026415mg [Eutrema salsugineum]
Length=168

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 74/130 (57%), Gaps = 9/130 (7%)
 Frame = +1

Query  265  STVTPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYS  441
            S  TP E E E       F       DGS      KA  G+KL R+IM +  +ELY  Y 
Sbjct  46   SAATPPEIELE-------FFGPKPGSDGSYPADKAKAVSGEKLLRNIMQENKIELYATYG  98

Query  442  RAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGT  621
            + +   GG       +VE+++G++LL+ RT+ EN  LK+KP +WRLACQT VG   + G 
Sbjct  99   KVMNCGGGGSCGTC-IVEILDGRDLLNERTDTENRYLKKKPESWRLACQTIVGNKENSGK  157

Query  622  LVIQQLPEWK  651
            +V+Q++P+WK
Sbjct  158  VVVQRIPQWK  167



>ref|XP_004138752.1| PREDICTED: uncharacterized protein LOC101202753 isoform 2 [Cucumis 
sativus]
Length=158

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 67/120 (56%), Gaps = 20/120 (17%)
 Frame = +1

Query  295  EEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglg  471
            E+  +++ F+      DGS  V   KA  G KL R+IMLD  +ELY PY           
Sbjct  57   EKPEIELEFIGPKPGSDGSFPVDTVKAISGDKLLRNIMLDNKLELYAPY-----------  105

Query  472  tcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
                    +++GK+LL+ RT  E   LK+KP +WRLACQT VG   + G +V+Q+LP+WK
Sbjct  106  --------ILDGKDLLNERTNTELRYLKKKPESWRLACQTIVGNKENSGKVVVQRLPQWK  157



>gb|AFK34507.1| unknown [Medicago truncatula]
 gb|AES58937.2| 2Fe-2S iron-sulfur cluster-binding domain protein [Medicago truncatula]
Length=163

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 66/104 (63%), Gaps = 2/104 (2%)
 Frame = +1

Query  343  DGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELL  519
            DGS  V   KA  G+KL R IM D  ++LY  Y + +   GG       +VE++EGK+LL
Sbjct  60   DGSFPVDKVKAISGEKLMRSIMSDNKIDLYATYGKLMNCGGGGSCGTC-IVEIIEGKDLL  118

Query  520  SPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
            + RT  E + LK+KP +WRLACQT VG   + G +V+Q++P+WK
Sbjct  119  NERTNTELKYLKKKPESWRLACQTIVGNKENSGKVVVQRIPQWK  162



>gb|AFW60528.1| hypothetical protein ZEAMMB73_761500 [Zea mays]
Length=139

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 67/104 (64%), Gaps = 2/104 (2%)
 Frame = +1

Query  343  DGSPDVHYRKAKGGQKLR-DIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELL  519
            DGS  +   +A  G+KL  D+M +  +ELY  Y + +   GG       +VE+++GKELL
Sbjct  36   DGSFPLDRAEATSGEKLLCDVMNENKIELYVAYGKVMNCGGGGSCGTC-IVEIIDGKELL  94

Query  520  SPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
            + RT  EN+ LK+KP +WRLACQT VG   + G +V+Q+LP+WK
Sbjct  95   NERTSTENQYLKKKPDSWRLACQTIVGNKENSGKVVVQRLPQWK  138



>ref|XP_004291420.1| PREDICTED: uncharacterized protein LOC101300021 [Fragaria vesca 
subsp. vesca]
Length=160

 Score = 83.2 bits (204),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 73/104 (70%), Gaps = 2/104 (2%)
 Frame = +1

Query  343  DGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELL  519
            DGS  V    A  G+KL R IM D  +ELY  Y + L NCGG G+CGTC+VE+++GK+LL
Sbjct  57   DGSYAVEKATAISGEKLLRSIMKDNKIELYATYGK-LMNCGGGGSCGTCIVEIIDGKDLL  115

Query  520  SPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
            + RT  E + LK+KP +WRLACQT VG   + G +V+Q++P+WK
Sbjct  116  NERTNAELKYLKKKPESWRLACQTIVGNKENSGKVVVQRIPQWK  159



>ref|XP_003588686.1| Electron carrier/ electron transporter/ iron ion binding protein 
[Medicago truncatula]
Length=182

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 66/104 (63%), Gaps = 2/104 (2%)
 Frame = +1

Query  343  DGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELL  519
            DGS  V   KA  G+KL R IM D  ++LY  Y + +   GG       +VE++EGK+LL
Sbjct  79   DGSFPVDKVKAISGEKLMRSIMSDNKIDLYATYGKLMNCGGGGSCGTC-IVEIIEGKDLL  137

Query  520  SPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
            + RT  E + LK+KP +WRLACQT VG   + G +V+Q++P+WK
Sbjct  138  NERTNTELKYLKKKPESWRLACQTIVGNKENSGKVVVQRIPQWK  181



>gb|KCW81482.1| hypothetical protein EUGRSUZ_C02841 [Eucalyptus grandis]
 gb|KCW81483.1| hypothetical protein EUGRSUZ_C02841 [Eucalyptus grandis]
Length=135

 Score = 82.4 bits (202),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 67/104 (64%), Gaps = 2/104 (2%)
 Frame = +1

Query  343  DGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELL  519
            DGS  V   KA  G+KL R+IM +  +ELY  Y + +   GG       +VE+++GK+LL
Sbjct  32   DGSYPVDKAKAVSGEKLLRNIMNENKIELYATYGKVMNCGGGGSCGTC-IVEIIDGKDLL  90

Query  520  SPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
            + RT  E + LK+KP +WRLACQT VG   + G +V+++LP+WK
Sbjct  91   NERTNTELQYLKKKPESWRLACQTIVGNKENSGKVVVRRLPQWK  134



>ref|XP_009606094.1| PREDICTED: uncharacterized protein LOC104100546 [Nicotiana tomentosiformis]
Length=175

 Score = 83.2 bits (204),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 71/116 (61%), Gaps = 2/116 (2%)
 Frame = +1

Query  307  VKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgt  483
            +++ FV      +G   +   KA  G+KL R+IM +  +ELY  Y +A+   GG      
Sbjct  60   IELEFVGPKADENGKYPMDKAKAVSGEKLLRNIMSENKIELYAAYGKAMNCGGGGSCGTC  119

Query  484  cMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
             +VE+++GK+LL+ RT  E   LK+KP +WRLACQT VG   + G +V+Q+LP+WK
Sbjct  120  -IVEIIDGKDLLNERTNTELRYLKKKPESWRLACQTIVGNKENSGKVVVQRLPQWK  174



>ref|XP_009758600.1| PREDICTED: uncharacterized protein LOC104211266 [Nicotiana sylvestris]
Length=176

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 72/116 (62%), Gaps = 2/116 (2%)
 Frame = +1

Query  307  VKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgt  483
            +++ FV      +G+  +   KA  G+KL R+IM + N+ELY  Y + +   GG      
Sbjct  61   IELEFVGPKPDENGNFPMDKAKAVSGEKLLRNIMSENNIELYAAYGKVMNCGGGGSCGTC  120

Query  484  cMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
             +VE+++GK+LL+ RT  E   LK+KP +WRLACQT VG   + G +V+Q+LP+WK
Sbjct  121  -IVEIIDGKDLLNERTNTELRYLKKKPESWRLACQTIVGNKENSGKVVVQRLPQWK  175



>ref|XP_011086930.1| PREDICTED: uncharacterized protein LOC105168487 [Sesamum indicum]
Length=165

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 77/135 (57%), Gaps = 4/135 (3%)
 Frame = +1

Query  250  IRASGSTVTPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVEL  426
            +  S ++V+P+ +     + +I      L P     V+   A  G+KL R+IMLD  +EL
Sbjct  33   LSVSFASVSPETSTAPPQIPEIQL--EFLGPKPGDPVNRATAISGEKLLRNIMLDNKIEL  90

Query  427  YGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTP  606
            Y  Y + +   GG       +VE+++GK+LL+ RT  E   LK+ P +WRLACQT VG  
Sbjct  91   YAAYGKVMNCGGGGSCGTC-IVEIIDGKDLLNERTNTELRYLKKNPESWRLACQTIVGNK  149

Query  607  NSKGTLVIQQLPEWK  651
             + G +V+Q+LP+WK
Sbjct  150  ENFGKVVVQRLPQWK  164



>ref|XP_008665839.1| PREDICTED: uncharacterized protein LOC103644408 [Zea mays]
Length=224

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 65/104 (63%), Gaps = 2/104 (2%)
 Frame = +1

Query  343  DGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELL  519
            DGS  V   +A   +KL  D+M +  +ELY  Y + +   GG       +VE+++GKELL
Sbjct  121  DGSFPVDRAEATSDEKLLCDVMNENKIELYAAYGKVMNCDGGGSCGTC-IVEIIDGKELL  179

Query  520  SPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
            + RT  EN  LK+KP +WRLACQT VG   + G +V+Q+LP+WK
Sbjct  180  NERTSTENRYLKKKPDSWRLACQTIVGNKENSGKVVVQRLPQWK  223



>gb|KDO56980.1| hypothetical protein CISIN_1g0293331mg, partial [Citrus sinensis]
Length=66

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +1

Query  550  LKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWKGHEWNYKELKSS  687
            +  KP+NWRLACQTTVGTP+S G +VIQQLPEWKGHEW YK++ +S
Sbjct  17   MVEKPKNWRLACQTTVGTPDSTGLVVIQQLPEWKGHEWKYKKIPTS  62



>ref|XP_008811593.1| PREDICTED: uncharacterized protein LOC103722715 isoform X2 [Phoenix 
dactylifera]
Length=178

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 63/116 (54%), Gaps = 20/116 (17%)
 Frame = +1

Query  307  VKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgt  483
            +++ FV   +  DGS  V    A  G+KL RDIMLD  +ELY  Y               
Sbjct  81   IELEFVGPKVGVDGSYPVDRASAISGEKLLRDIMLDNQIELYAAY---------------  125

Query  484  cMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
                +++G ELL+ +T  E   LK+KP +WRLACQT VG   + G + +Q++P+WK
Sbjct  126  ----IIDGMELLNEKTNTEKRYLKKKPESWRLACQTIVGNKENAGKVTVQRMPQWK  177



>ref|XP_008680127.1| PREDICTED: uncharacterized protein LOC103655098 [Zea mays]
Length=354

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 67/104 (64%), Gaps = 2/104 (2%)
 Frame = +1

Query  343  DGSPDVHYRKAKGGQKLR-DIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELL  519
            DGS  +   +A  G+KL  D+M +  +ELY  Y + +   GG       +VE+++GKELL
Sbjct  251  DGSFPLDRAEATSGEKLLCDVMNENKIELYVAYGKVMNCGGGGSCGTC-IVEIIDGKELL  309

Query  520  SPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
            + RT  EN+ LK+KP +WRLACQT VG   + G +V+Q+LP+WK
Sbjct  310  NERTSTENQYLKKKPDSWRLACQTIVGNKENSGKVVVQRLPQWK  353



>ref|XP_010914163.1| PREDICTED: uncharacterized protein LOC105039410 isoform X4 [Elaeis 
guineensis]
Length=170

 Score = 80.1 bits (196),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 64/116 (55%), Gaps = 20/116 (17%)
 Frame = +1

Query  307  VKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgt  483
            +++ FV      DGS  V    A  G+KL R+IMLD  +ELY  Y               
Sbjct  73   IELEFVGPKAGEDGSYPVDRASAISGEKLLRNIMLDNKIELYAAY---------------  117

Query  484  cMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
                +++G ELL+ +T+ E   LK+KP +WRLACQT VG   + G +++Q++P+WK
Sbjct  118  ----IIDGMELLNEKTDTEKRYLKKKPESWRLACQTIVGNKENAGKVIVQRMPQWK  169



>ref|XP_004498633.1| PREDICTED: uncharacterized protein LOC101502453 isoform X1 [Cicer 
arietinum]
Length=160

 Score = 79.7 bits (195),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 64/106 (60%), Gaps = 4/106 (4%)
 Frame = +1

Query  343  DGSPDVHYRKAK---GGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKE  513
            DG       KAK   G + LR++MLD  +ELY  Y + +   GG       +VE+++G +
Sbjct  55   DGEGSYPVDKAKEISGAKLLRNVMLDNKIELYATYGKLMNCGGGGSCGTC-IVEIIKGND  113

Query  514  LLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
            LL+ RT  E   LK+KP +WRLACQT VG   + G +V+Q++P+WK
Sbjct  114  LLNERTNTELRYLKKKPESWRLACQTIVGNKENSGKVVVQRIPQWK  159



>emb|CDX68864.1| BnaC01g05890D [Brassica napus]
Length=166

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 64/104 (62%), Gaps = 4/104 (4%)
 Frame = +1

Query  343  DGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELL  519
            DG+      KA  G+KL R IM D  +ELY  Y + +   GG          +++G+ELL
Sbjct  65   DGTYPRDKAKAVSGEKLLRSIMQDSKIELYATYGKVMNCGGGGSCGTCI---ILDGRELL  121

Query  520  SPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
            + RT+ EN+ LK+KP +WRLACQT VG   + G +V+Q++P+WK
Sbjct  122  NERTDTENKYLKKKPESWRLACQTIVGNKENSGKVVVQRIPQWK  165



>ref|XP_002973178.1| hypothetical protein SELMODRAFT_59158, partial [Selaginella moellendorffii]
 gb|EFJ25552.1| hypothetical protein SELMODRAFT_59158, partial [Selaginella moellendorffii]
Length=104

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 65/104 (63%), Gaps = 2/104 (2%)
 Frame = +1

Query  343  DGSPDVHYRKAKGGQK-LRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELL  519
            DG  DV     K G+K LR++M +  +ELYG Y + +   GG       +VE++EG+ELL
Sbjct  1    DGKGDVLKTSVKSGEKVLRNVMRENKLELYGLYGKLMNCGGGGSCGTC-IVEILEGQELL  59

Query  520  SPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
            S  T  E + LK+KP  WRLACQT VG  ++ G +V+Q+LP+ K
Sbjct  60   SQPTSAEKKHLKQKPGTWRLACQTIVGDKSNAGKVVVQRLPQKK  103



>gb|EYU29247.1| hypothetical protein MIMGU_mgv1a015108mg [Erythranthe guttata]
Length=168

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 67/91 (74%), Gaps = 1/91 (1%)
 Frame = +1

Query  379  GGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKR  558
            G + LR IM D  +ELY  Y + L NCGG G+CGTC+VE+V+G++LL+ RT  E   LK+
Sbjct  78   GDKLLRTIMSDNKLELYAAYGK-LMNCGGGGSCGTCIVEIVDGQDLLNERTNTELRYLKK  136

Query  559  KPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
            KP +WRLACQT VG  ++ G +V+Q+LP+WK
Sbjct  137  KPESWRLACQTIVGNKDNSGKVVVQRLPQWK  167



>ref|XP_002976675.1| hypothetical protein SELMODRAFT_59157, partial [Selaginella moellendorffii]
 gb|EFJ22344.1| hypothetical protein SELMODRAFT_59157, partial [Selaginella moellendorffii]
Length=104

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 65/104 (63%), Gaps = 2/104 (2%)
 Frame = +1

Query  343  DGSPDVHYRKAKGGQK-LRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELL  519
            DG  DV     K G+K LR++M +  +ELYG Y + +   GG       +VE++EG+ELL
Sbjct  1    DGKGDVLKTSVKSGEKVLRNVMRENKLELYGLYGKLMNCGGGGSCGTC-IVEILEGQELL  59

Query  520  SPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
            S  T  E + LK+KP  WRLACQT VG  ++ G +V+Q+LP+ K
Sbjct  60   SQPTSAEKKHLKQKPGTWRLACQTIVGDKSNAGRVVVQRLPQKK  103



>ref|XP_011019734.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105122357 
[Populus euphratica]
Length=178

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 68/116 (59%), Gaps = 2/116 (2%)
 Frame = +1

Query  307  VKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgt  483
            +++ F+      DG   V   KA  G+KL R+IM D  +ELY  Y + +   GG      
Sbjct  63   IELEFIGPKPEADGKYPVERAKAISGEKLLRNIMSDNKIELYATYGKVMNCGGGGSCGTC  122

Query  484  cMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
             +VE+++G +LL+ RT  E   LK+ P +WRLACQT VG   + G +V+Q++P+WK
Sbjct  123  -IVEILDGNDLLNERTNTELRYLKKNPESWRLACQTIVGNKENSGXVVVQRIPQWK  177



>ref|XP_002516617.1| electron carrier, putative [Ricinus communis]
 gb|EEF45958.1| electron carrier, putative [Ricinus communis]
Length=171

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 76/133 (57%), Gaps = 2/133 (2%)
 Frame = +1

Query  256  ASGSTVTPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYG  432
            A+ S++       E+  +++ F+      DG   V   KA  G+KL R+IM +  +ELY 
Sbjct  39   AAASSLESSPPVMEKPEIELEFIAPKAGSDGKYPVDRVKAISGEKLLRNIMSENKLELYA  98

Query  433  PYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNS  612
             Y + +   GG       +VE+++GK+LL+ +T  E   LK+K  +WRLACQT VG   +
Sbjct  99   AYGKVMNCGGGGSCGTC-IVEILDGKDLLNEKTNTELRYLKKKAESWRLACQTIVGNKEN  157

Query  613  KGTLVIQQLPEWK  651
             G +V+Q+LP+WK
Sbjct  158  SGKVVVQRLPQWK  170



>ref|XP_006450556.1| hypothetical protein CICLE_v10009578mg [Citrus clementina]
 ref|XP_006476195.1| PREDICTED: uncharacterized protein LOC102630654 isoform X3 [Citrus 
sinensis]
 gb|ESR63796.1| hypothetical protein CICLE_v10009578mg [Citrus clementina]
 gb|KDO79619.1| hypothetical protein CISIN_1g029369mg [Citrus sinensis]
Length=186

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 71/126 (56%), Gaps = 2/126 (2%)
 Frame = +1

Query  265  STVTPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYS  441
            ++  P   E E+  +++ F+      DGS  V   KA  G+KL R+IMLD  +ELY  Y 
Sbjct  44   NSTEPSSPEPEKPEIELEFIAPRAGDDGSYPVERAKAISGEKLLRNIMLDNKIELYATYG  103

Query  442  RAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGT  621
            + +   GG       +VE+++GK+LL+ RT  E   LK+KP +WRLACQT VG   + G 
Sbjct  104  KVMNCGGGGSCGTC-IVEIIDGKDLLNERTNTELRYLKKKPESWRLACQTIVGNKENSGK  162

Query  622  LVIQQL  639
              I+ L
Sbjct  163  CRIKYL  168



>ref|XP_002441489.1| hypothetical protein SORBIDRAFT_09g027890 [Sorghum bicolor]
 gb|EES19919.1| hypothetical protein SORBIDRAFT_09g027890 [Sorghum bicolor]
Length=185

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 83/167 (50%), Gaps = 13/167 (8%)
 Frame = +1

Query  178  LTTIIHPKRFTASPNLS-------RNISGGKIRASGSTVTPDEAEEEEAM----VKIAFV  324
            L ++      +ASP +S       R    G +R S ++    +     A+    +++ FV
Sbjct  11   LASLPFAASTSASPRVSGSGHRGPRRFRAGTVRCSSASPNVSQGAPAPALPKPQIELEFV  70

Query  325  HSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVV  501
                  DGS  V   +A  G+KL RDIM +  +ELY  Y + +   GG       +VE++
Sbjct  71   GPKPGADGSFPVDRAEAASGEKLLRDIMNENKIELYAAYGKVMNCGGGGSCGTC-IVEII  129

Query  502  EGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLP  642
            +GKELL+ RT  EN  LK+KP +WRLACQT VG   + G      LP
Sbjct  130  DGKELLNERTNTENRYLKKKPDSWRLACQTIVGNKENSGKACFILLP  176



>ref|XP_002309590.1| ferredoxin-related family protein [Populus trichocarpa]
 gb|EEE93113.1| ferredoxin-related family protein [Populus trichocarpa]
Length=178

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 68/116 (59%), Gaps = 2/116 (2%)
 Frame = +1

Query  307  VKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgt  483
            +++ F+      DG   V   KA  G+KL R+IM D  +ELY  Y + +   GG      
Sbjct  63   IELEFIGPKPEADGKYPVERAKAISGEKLLRNIMSDNKIELYATYGKVMNCGGGGSCGTC  122

Query  484  cMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
             +VE+++G +LL+ RT  E   LK+ P +WRLACQT VG   + G +V+Q++P+WK
Sbjct  123  -IVEILDGNDLLNERTNTELRYLKKNPESWRLACQTIVGNKENSGKVVVQRIPQWK  177



>emb|CDX75257.1| BnaA01g04450D [Brassica napus]
Length=169

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 64/104 (62%), Gaps = 4/104 (4%)
 Frame = +1

Query  343  DGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELL  519
            DG+      KA  G+KL R IM D  +ELY  Y + +   GG          +++G+ELL
Sbjct  68   DGTYPRDKAKAVSGEKLLRSIMQDNKLELYATYGKVMNCGGGGSCGTCI---ILDGRELL  124

Query  520  SPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
            + RT+ EN+ LK+KP +WRLACQT VG   + G +V+Q++P+WK
Sbjct  125  NERTDTENKYLKKKPESWRLACQTIVGNKENSGKVVVQRIPQWK  168



>ref|XP_006412453.1| hypothetical protein EUTSA_v10026415mg [Eutrema salsugineum]
 gb|ESQ53906.1| hypothetical protein EUTSA_v10026415mg [Eutrema salsugineum]
Length=167

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 66/104 (63%), Gaps = 3/104 (3%)
 Frame = +1

Query  343  DGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELL  519
            DGS      KA  G+KL R+IM +  +ELY  Y + +   GG       +VE+++G++LL
Sbjct  65   DGSYPADKAKAVSGEKLLRNIMQENKIELYATYGKVMNCGGGGSCGTC-IVEILDGRDLL  123

Query  520  SPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
            + RT+ EN  LK KP +WRLACQT VG   + G +V+Q++P+WK
Sbjct  124  NERTDTENRYLK-KPESWRLACQTIVGNKENSGKVVVQRIPQWK  166



>gb|KHN10388.1| hypothetical protein glysoja_047000, partial [Glycine soja]
Length=183

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 78/146 (53%), Gaps = 19/146 (13%)
 Frame = +1

Query  256  ASGSTVTPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYG  432
            AS +  +P+   E    +++ F+      DGS  V   KA  G+KL R+IMLD  +ELY 
Sbjct  42   ASMTASSPESPPE----IELEFIGPKPGSDGSYPVERVKAISGEKLLRNIMLDNKIELYA  97

Query  433  PYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKL-------------KRKPRNW  573
             Y + +   GG       +VE++EGK+LL+ RT  E   L             K+KP +W
Sbjct  98   TYGKLMNCAGGGSCGTC-IVEIIEGKDLLNERTNTELRYLILKFYDLLSFRHFKQKPESW  156

Query  574  RLACQTTVGTPNSKGTLVIQQLPEWK  651
            RLACQT VG   + G + +Q++P+WK
Sbjct  157  RLACQTIVGNKENSGKVAVQRIPQWK  182



>gb|AAT58739.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG88513.1| unnamed protein product [Oryza sativa Japonica Group]
Length=210

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 64/114 (56%), Gaps = 2/114 (2%)
 Frame = +1

Query  307  VKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgt  483
            + + FV      DGS  V    A  G+KL RD+M++  +ELY  Y + +   GG      
Sbjct  70   IDLEFVGPKADADGSFPVDRAAAGSGEKLLRDVMVENKIELYAAYGKVMNCGGGGSCGTC  129

Query  484  cMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPE  645
             +VE+V+GKELL+ RT  EN  LK+KP +WRLACQT VG   + G      +P+
Sbjct  130  -IVEIVDGKELLNERTNTENRYLKKKPESWRLACQTIVGNKENSGKYKTTSIPQ  182



>ref|XP_006450555.1| hypothetical protein CICLE_v10009578mg [Citrus clementina]
 gb|ESR63795.1| hypothetical protein CICLE_v10009578mg [Citrus clementina]
Length=193

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 67/118 (57%), Gaps = 2/118 (2%)
 Frame = +1

Query  277  PDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlc  453
            P   E E+  +++ F+      DGS  V   KA  G+KL R+IMLD  +ELY  Y + + 
Sbjct  48   PSSPEPEKPEIELEFIAPRAGDDGSYPVERAKAISGEKLLRNIMLDNKIELYATYGKVMN  107

Query  454  ncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLV  627
              GG       +VE+++GK+LL+ RT  E   LK+KP +WRLACQT VG   + G + 
Sbjct  108  CGGGGSCGTC-IVEIIDGKDLLNERTNTELRYLKKKPESWRLACQTIVGNKENSGKVC  164



>gb|KHM99988.1| hypothetical protein glysoja_043981 [Glycine soja]
Length=83

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 54/83 (65%), Gaps = 1/83 (1%)
 Frame = +1

Query  403  MLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLA  582
            MLD  +ELY  Y + +   GG       +VE++EGK+LL+ RT  E   LK+KP +WRLA
Sbjct  1    MLDNKIELYATYGKLMNCGGGGSCGTC-IVEILEGKDLLNERTNTEFRYLKKKPESWRLA  59

Query  583  CQTTVGTPNSKGTLVIQQLPEWK  651
            CQT VG   + G +V+Q++P+WK
Sbjct  60   CQTIVGNKENSGKVVVQRIPQWK  82



>gb|KDO79621.1| hypothetical protein CISIN_1g029369mg [Citrus sinensis]
Length=194

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 67/118 (57%), Gaps = 2/118 (2%)
 Frame = +1

Query  277  PDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlc  453
            P   E E+  +++ F+      DGS  V   KA  G+KL R+IMLD  +ELY  Y + + 
Sbjct  48   PSSPEPEKPEIELEFIAPRAGDDGSYPVERAKAISGEKLLRNIMLDNKIELYATYGKVMN  107

Query  454  ncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLV  627
              GG       +VE+++GK+LL+ RT  E   LK+KP +WRLACQT VG   + G + 
Sbjct  108  CGGGGSCGTC-IVEIIDGKDLLNERTNTELRYLKKKPESWRLACQTIVGNKENSGKVC  164



>ref|XP_006476193.1| PREDICTED: uncharacterized protein LOC102630654 isoform X1 [Citrus 
sinensis]
Length=210

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 66/115 (57%), Gaps = 2/115 (2%)
 Frame = +1

Query  277  PDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlc  453
            P   E E+  +++ F+      DGS  V   KA  G+KL R+IMLD  +ELY  Y + + 
Sbjct  48   PSSPEPEKPEIELEFIAPRAGDDGSYPVERAKAISGEKLLRNIMLDNKIELYATYGKVMN  107

Query  454  ncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKG  618
              GG       +VE+++GK+LL+ RT  E   LK+KP +WRLACQT VG   + G
Sbjct  108  CGGGGSCGTC-IVEIIDGKDLLNERTNTELRYLKKKPESWRLACQTIVGNKENSG  161



>gb|AFK41293.1| unknown [Lotus japonicus]
Length=83

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 53/83 (64%), Gaps = 1/83 (1%)
 Frame = +1

Query  403  MLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLA  582
            MLD  +ELY  Y + +   GG       +VE++EG +LL+ RT  E   LK+KP +WRLA
Sbjct  1    MLDNKIELYATYGKLMNCGGGGSCGTC-IVEIIEGDDLLNERTNTELRYLKKKPESWRLA  59

Query  583  CQTTVGTPNSKGTLVIQQLPEWK  651
            CQT VG   + G +V+Q++P+WK
Sbjct  60   CQTIVGNKENCGKVVVQRIPQWK  82



>ref|XP_008445133.1| PREDICTED: uncharacterized protein LOC103488260 isoform X2 [Cucumis 
melo]
Length=170

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 66/116 (57%), Gaps = 6/116 (5%)
 Frame = +1

Query  274  TPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAl  450
            TP E  E    +++ F+      DGS  V   KA  G KL R+IMLD  +ELY PY + +
Sbjct  54   TPAEKPE----IELEFIGPKPGSDGSFPVDTVKAISGDKLLRNIMLDNKIELYAPYGKLM  109

Query  451  cncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKG  618
               GG       +VE+++GK+LL+ RT  E   LK+KP +WRLACQT VG   + G
Sbjct  110  NCGGGGSCGTC-IVEILDGKDLLNERTNTELRYLKKKPESWRLACQTIVGNKENSG  164



>ref|NP_974664.1| 2Fe-2S iron-sulfur cluster binding domain-containing protein 
[Arabidopsis thaliana]
 gb|AEE86084.1| 2Fe-2S iron-sulfur cluster binding domain-containing protein 
[Arabidopsis thaliana]
Length=180

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 64/119 (54%), Gaps = 9/119 (8%)
 Frame = +1

Query  265  STVTPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYS  441
            S VTP E E E       F       DGS  V   KA  G KL R IM D  +ELY  Y 
Sbjct  51   SAVTPLEIELE-------FFGPKPGSDGSYPVDKAKAVSGDKLLRSIMQDNKIELYAAYG  103

Query  442  RAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKG  618
            + +   GG       +VE+++G++LL+ RT+ EN  LK+KP +WRLACQT VG   + G
Sbjct  104  KVMNCGGGGSCGTC-IVEILDGRDLLNERTDTENRYLKKKPESWRLACQTIVGNKENSG  161



>gb|EMT11473.1| hypothetical protein F775_25882 [Aegilops tauschii]
Length=182

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 58/111 (52%), Gaps = 7/111 (6%)
 Frame = +1

Query  307  VKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSR------Alcncgg  465
            +++ FV      DGS  V    A  G KL RD+M++  +ELY  Y +             
Sbjct  67   IELEFVGPKPGADGSYPVDRAAAVSGDKLLRDVMVENKIELYAAYGKLMNCGGGGSCGTC  126

Query  466  lgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKG  618
            +        ++++GKELLSPRT+ EN  LK+KP +WRL CQT VG   + G
Sbjct  127  IVESVNLCAQIIDGKELLSPRTDAENRYLKKKPESWRLTCQTIVGNKENSG  177



>emb|CCI55389.1| NDH subunit PnsB3 [Marchantia polymorpha]
Length=184

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 59/91 (65%), Gaps = 1/91 (1%)
 Frame = +1

Query  379  GGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKR  558
            G + +R  M +  +ELY  Y + +   GG       +V+++EG+ELLS RT+ E + LK+
Sbjct  93   GEKNMRKFMTENKLELYALYGKVMNCGGGGSCGTC-LVDILEGQELLSERTDAEYKYLKK  151

Query  559  KPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
            KP +WRLACQT +G  ++ G +V+Q+LP+ K
Sbjct  152  KPESWRLACQTIIGDKSNSGKVVVQRLPQNK  182



>ref|XP_010109036.1| hypothetical protein L484_007370 [Morus notabilis]
 gb|EXC20788.1| hypothetical protein L484_007370 [Morus notabilis]
Length=97

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 63/96 (66%), Gaps = 13/96 (14%)
 Frame = +1

Query  403  MLDGNVELYGPY---------SRAl----cncgglgtcgtcMVEVVEGKELLSPRTEKEN  543
            MLD  +ELY  Y         SR+      NCGG G+CGTC+VE+++G++LL+ RT  E 
Sbjct  1    MLDDKIELYATYVSQSPPNSTSRSSHGKVMNCGGGGSCGTCIVEIIDGRDLLNERTNTEL  60

Query  544  EKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
              LK+KP +WRLACQT VG   + G +V+Q++P+WK
Sbjct  61   RYLKKKPESWRLACQTIVGNKENSGKVVVQRIPQWK  96



>gb|EPS60932.1| hypothetical protein M569_13870, partial [Genlisea aurea]
Length=116

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 55/99 (56%), Gaps = 2/99 (2%)
 Frame = +1

Query  334  LFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGK  510
            L P    +V   K+K G KL R IMLD  +ELY  Y + +   GG       +VE+++GK
Sbjct  19   LGPKPGDEVRIVKSKSGDKLMRTIMLDNKIELYATYGKLMNCGGGGSCGTC-IVEIIQGK  77

Query  511  ELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLV  627
            ELL+ R   E   LK KP  WRLACQT VG   + G ++
Sbjct  78   ELLNERRNTEFRYLKNKPETWRLACQTIVGDKENSGKVI  116



>ref|XP_006450557.1| hypothetical protein CICLE_v10009578mg [Citrus clementina]
 gb|ESR63797.1| hypothetical protein CICLE_v10009578mg [Citrus clementina]
Length=152

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 59/129 (46%), Gaps = 23/129 (18%)
 Frame = +1

Query  268  TVTPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSR  444
            +  P   E E+  +++ F+      DGS  V   KA  G+KL R+IMLD  +ELY  Y  
Sbjct  45   STEPSSPEPEKPEIELEFIAPRAGDDGSYPVERAKAISGEKLLRNIMLDNKIELYATY--  102

Query  445  AlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTL  624
                                GK +           +  KP +WRLACQT VG   + G +
Sbjct  103  --------------------GKVMNCGGGGSCGTCIVEKPESWRLACQTIVGNKENSGKV  142

Query  625  VIQQLPEWK  651
            V+Q++P+WK
Sbjct  143  VVQRIPQWK  151



>gb|KCW81487.1| hypothetical protein EUGRSUZ_C02845 [Eucalyptus grandis]
Length=84

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 52/84 (62%), Gaps = 2/84 (2%)
 Frame = +1

Query  403  MLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLA  582
            M +  +ELY  Y + +   GG       +VE+++GK+LL+ RT  E   LK+KP +WRLA
Sbjct  1    MNENKIELYATYGKVMNCGGGGSCGTC-IVEIIDGKDLLNERTNTELRYLKKKPESWRLA  59

Query  583  CQT-TVGTPNSKGTLVIQQLPEWK  651
            CQT  VG   + G +V+Q LP+WK
Sbjct  60   CQTIIVGNKENSGKVVVQILPQWK  83



>ref|XP_001759250.1| predicted protein [Physcomitrella patens]
 gb|EDQ75934.1| predicted protein [Physcomitrella patens]
Length=340

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 61/97 (63%), Gaps = 2/97 (2%)
 Frame = +1

Query  331  VLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEG  507
            ++ P+   +V       G+KL R+I+L+  +ELYG Y + +   GG       +VE++EG
Sbjct  72   IVGPEAGGEVTTTSVGSGEKLLRNIILENKLELYGLYGKVMNCGGGGSCGTC-VVEILEG  130

Query  508  KELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKG  618
            KELL+ RT+ E + LK+KP +WRL+CQT VG  ++ G
Sbjct  131  KELLNERTDTEYKYLKKKPESWRLSCQTIVGDKSNSG  167



>ref|XP_004498634.1| PREDICTED: uncharacterized protein LOC101502453 isoform X2 [Cicer 
arietinum]
Length=160

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 54/95 (57%), Gaps = 4/95 (4%)
 Frame = +1

Query  343  DGSPDVHYRKAK---GGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKE  513
            DG       KAK   G + LR++MLD  +ELY  Y + +   GG       +VE+++G +
Sbjct  55   DGEGSYPVDKAKEISGAKLLRNVMLDNKIELYATYGKLMNCGGGGSCGTC-IVEIIKGND  113

Query  514  LLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKG  618
            LL+ RT  E   LK+KP +WRLACQT VG   + G
Sbjct  114  LLNERTNTELRYLKKKPESWRLACQTIVGNKENSG  148



>ref|WP_015177761.1| ferredoxin [Oscillatoria nigro-viridis]
 ref|YP_007116933.1| ferredoxin [Oscillatoria nigro-viridis PCC 7112]
 gb|AFZ08517.1| ferredoxin [Oscillatoria nigro-viridis PCC 7112]
Length=98

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 55/80 (69%), Gaps = 1/80 (1%)
 Frame = +1

Query  373  AKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKL  552
            A  G  LR   L+  ++LY  +S  + NCGG G CGTC+VE+VEG E LSPRT+ EN KL
Sbjct  15   AADGANLRLKALENRIDLY-TFSGKMMNCGGYGQCGTCIVEIVEGSENLSPRTDFENRKL  73

Query  553  KRKPRNWRLACQTTVGTPNS  612
            K+KP N+RLACQ TV  P S
Sbjct  74   KKKPENYRLACQATVNGPVS  93



>ref|WP_015202669.1| ferredoxin [Crinalium epipsammum]
 ref|YP_007142059.1| ferredoxin [Crinalium epipsammum PCC 9333]
 gb|AFZ12549.1| ferredoxin [Crinalium epipsammum PCC 9333]
Length=98

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 53/72 (74%), Gaps = 1/72 (1%)
 Frame = +1

Query  382  GQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRK  561
            G  LR+ +L+  ++LY  +   L NCGG G CGTC+VE+VEG E LSPRTE EN KLK+K
Sbjct  18   GANLREKILENGIDLY-TFKGKLMNCGGYGQCGTCVVEIVEGLENLSPRTEFENSKLKKK  76

Query  562  PRNWRLACQTTV  597
            P N+RLACQT V
Sbjct  77   PENYRLACQTIV  88



>ref|WP_017653826.1| iron ABC transporter substrate-binding protein [Microchaete sp. 
PCC 7126]
Length=98

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  487  MVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNS  612
            +VEVVEG E LSPRT+ EN+KLK+KP N+RLACQT V  P S
Sbjct  52   IVEVVEGIENLSPRTDVENKKLKKKPENYRLACQTLVNGPIS  93



>ref|WP_017746280.1| iron ABC transporter substrate-binding protein [Scytonema hofmanni]
Length=98

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  373  AKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKL  552
            A  G  LR+  L  NV++Y  + + + NCGG G CG C+VE+VEG E LSPRT+ EN+ L
Sbjct  15   AANGANLRERALQNNVDVYKLFGK-MMNCGGYGQCGCCVVEIVEGMENLSPRTDAENKLL  73

Query  553  KRKPRNWRLACQTTV  597
            K+KP N RLACQT V
Sbjct  74   KKKPENCRLACQTLV  88



>gb|EMS67753.1| hypothetical protein TRIUR3_01768 [Triticum urartu]
Length=193

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 53/115 (46%), Gaps = 23/115 (20%)
 Frame = +1

Query  343  DGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSR------AlcncgglgtcgtcMVEVV  501
            DGS  V    A  G KL RD+M++  +ELY  Y +             +        +++
Sbjct  77   DGSYPVDRAAAVSGDKLLRDVMVENKIELYAAYGKLMNCGGGGSCGTCIVESVNLCAQII  136

Query  502  EGKELLSPRTEKENEKLKR----------------KPRNWRLACQTTVGTPNSKG  618
            +GKELLSPRT+ EN  LK+                KP +WRL CQT VG   + G
Sbjct  137  DGKELLSPRTDAENRYLKKRSCDLTVHSAPRCLCQKPESWRLTCQTIVGNKENSG  191



>ref|XP_003057235.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58880.1| predicted protein [Micromonas pusilla CCMP1545]
Length=163

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 51/110 (46%), Gaps = 2/110 (2%)
 Frame = +1

Query  274  TPDEAEEEEAMVKIAFVHSVLF-PDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAl  450
            TP       A+V  A V  V F P    DV          LRD+ L   V+LY   ++ L
Sbjct  37   TPSSRSRSAALVARASVVRVEFTPSDGGDVIVTDVTKASVLRDVALGDKVQLYEGMAKLL  96

Query  451  cncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVG  600
               G         V V EG ELLSPRT+ EN KLK    +WRLACQ  VG
Sbjct  97   NCGGMGNCGTCK-VRVTEGMELLSPRTDAENGKLKGLGEDWRLACQCLVG  145



>ref|WP_015157484.1| ferredoxin [Chroococcidiopsis thermalis]
 ref|YP_007094816.1| ferredoxin [Chroococcidiopsis thermalis PCC 7203]
 gb|AFY90947.1| ferredoxin [Chroococcidiopsis thermalis PCC 7203]
Length=114

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 66/107 (62%), Gaps = 4/107 (4%)
 Frame = +1

Query  292  EEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAlcncgglg  471
            E E  VK A + ++ F   + +     A  G  LR   L+  ++LY  + + + NCGG G
Sbjct  6    ETETQVKRAAMANIKFVQENREAI---AADGANLRIKALENGIDLYTTWGK-MMNCGGYG  61

Query  472  tcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNS  612
             CGTC+VE+VEG E LSPRT  EN+KLK+KP N+RLACQT V  P S
Sbjct  62   QCGTCIVEIVEGVENLSPRTPVENKKLKKKPANYRLACQTLVNGPVS  108



>ref|WP_015113623.1| ferredoxin [Nostoc sp. PCC 7107]
 ref|YP_007050561.1| ferredoxin [Nostoc sp. PCC 7107]
 gb|AFY43411.1| ferredoxin [Nostoc sp. PCC 7107]
Length=98

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 45/80 (56%), Gaps = 1/80 (1%)
 Frame = +1

Query  373  AKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKL  552
            A  G  LR   ++  ++LY  + +     G        +VE+VEG E LSPRTE EN K 
Sbjct  15   AANGANLRLKAVENGIDLYTLFGKMTNCGGYGQCGTC-VVEIVEGLENLSPRTEVENRKF  73

Query  553  KRKPRNWRLACQTTVGTPNS  612
            K+KP N+RLACQT V  P S
Sbjct  74   KKKPENYRLACQTVVHGPVS  93



>ref|WP_038082692.1| iron ABC transporter substrate-binding protein [Tolypothrix bouteillei]
 gb|KIE13538.1| iron ABC transporter substrate-binding protein [Tolypothrix bouteillei 
VB521301]
Length=98

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  373  AKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKL  552
            A  G  LR+  L  N+++Y  + + + NCGG G CG C+VE+VEG E LSPRT+ EN+ L
Sbjct  15   AANGANLRERALQNNIDIYKLFGK-MMNCGGYGQCGCCVVEIVEGLENLSPRTDAENKLL  73

Query  553  KRKPRNWRLACQTTV  597
            K+KP N RLACQT V
Sbjct  74   KKKPENCRLACQTLV  88



>ref|WP_039714396.1| iron ABC transporter substrate-binding protein [Scytonema millei]
 gb|KIF22132.1| iron ABC transporter substrate-binding protein [Scytonema millei 
VB511283]
Length=99

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 55/80 (69%), Gaps = 1/80 (1%)
 Frame = +1

Query  373  AKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKL  552
            A  G  LR   L+  ++LY  + + + NCGG G CGTC+VE+VEG E LSPRT  EN+KL
Sbjct  15   AADGANLRIKALENGIDLYTTWGK-MMNCGGYGQCGTCIVEIVEGIENLSPRTPVENKKL  73

Query  553  KRKPRNWRLACQTTVGTPNS  612
            K+KP N+RLACQT V  P S
Sbjct  74   KKKPANYRLACQTLVNGPVS  93



>ref|WP_007354414.1| MULTISPECIES: iron ABC transporter substrate-binding protein 
[Kamptonema]
 emb|CBN55191.1| ferredoxin [ [[Oscillatoria] sp. PCC 6506]
Length=98

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 54/80 (68%), Gaps = 1/80 (1%)
 Frame = +1

Query  373  AKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKL  552
            A  G  LR   L+  V+LY  +S  + NCGG G CGTC+VE+VEG E LSPRT+ EN KL
Sbjct  15   AADGANLRLKALENRVDLY-TFSGKMMNCGGYGQCGTCIVEIVEGMEHLSPRTDVENRKL  73

Query  553  KRKPRNWRLACQTTVGTPNS  612
            K+KP  +RLACQT V  P S
Sbjct  74   KKKPPTYRLACQTLVNGPVS  93



>ref|WP_015126804.1| ferredoxin [Calothrix sp. PCC 7507]
 ref|YP_007063812.1| ferredoxin [Calothrix sp. PCC 7507]
 gb|AFY30978.1| ferredoxin [Calothrix sp. PCC 7507]
Length=98

 Score = 59.3 bits (142),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  487  MVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNS  612
            +VEVVEG + LSPRT+ EN+KLK+KP N+RLACQT V  P S
Sbjct  52   IVEVVEGIDNLSPRTDVENKKLKKKPENYRLACQTLVNGPVS  93



>ref|WP_015209426.1| ferredoxin [Cylindrospermum stagnale]
 ref|YP_007148863.1| ferredoxin [Cylindrospermum stagnale PCC 7417]
 gb|AFZ26183.1| ferredoxin [Cylindrospermum stagnale PCC 7417]
Length=98

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 54/80 (68%), Gaps = 1/80 (1%)
 Frame = +1

Query  373  AKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKL  552
            A  G  LR   ++  +++Y   S+ + NCGG G C TC+VE+VEG E LSPRT+ EN+K 
Sbjct  15   AADGANLRLKAIENGIDIYTFLSK-MTNCGGYGQCATCVVEIVEGLENLSPRTDVENKKF  73

Query  553  KRKPRNWRLACQTTVGTPNS  612
            K+KP N+RLACQT V  P S
Sbjct  74   KKKPENYRLACQTLVNGPVS  93



>ref|WP_011431947.1| iron ABC transporter substrate-binding protein [Synechococcus 
sp. JA-2-3B'a(2-13)]
 ref|YP_476541.1| (Fe-S)-binding protein [Synechococcus sp. JA-2-3B'a(2-13)]
 gb|ABD01278.1| iron-sulfur cluster-binding protein [Synechococcus sp. JA-2-3B'a(2-13)]
Length=98

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  487  MVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTV  597
            +VE+VEG E LSPRTE EN KLKRKP ++RLACQT V
Sbjct  52   VVEIVEGSENLSPRTEAENRKLKRKPDSYRLACQTKV  88



>ref|WP_011429540.1| iron ABC transporter substrate-binding protein [Synechococcus 
sp. JA-3-3Ab]
 ref|YP_474120.1| iron-sulfur cluster-binding protein [Synechococcus sp. JA-3-3Ab]
 gb|ABC98857.1| iron-sulfur cluster-binding protein [Synechococcus sp. JA-3-3Ab]
Length=98

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  487  MVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTV  597
            +VE+VEG E LSPRTE EN KLKRKP  +RLACQT V
Sbjct  52   VVEIVEGAENLSPRTEAENRKLKRKPDTYRLACQTKV  88



>ref|WP_006195023.1| iron ABC transporter substrate-binding protein [Nodularia spumigena]
 gb|EAW46493.1| Ferredoxin [Nodularia spumigena CCY9414]
 gb|AHJ30158.1| Ferredoxin [Nodularia spumigena CCY9414]
Length=98

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +1

Query  487  MVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNS  612
            +VE+VEG E LSPRT  EN+K K+KP N+RLACQT V  P S
Sbjct  52   IVEIVEGMENLSPRTNVENQKFKKKPDNYRLACQTLVNGPVS  93



>ref|WP_015218419.1| ferredoxin [Cyanobacterium aponinum]
 ref|YP_007160732.1| ferredoxin [Cyanobacterium aponinum PCC 10605]
 gb|AFZ52688.1| ferredoxin [Cyanobacterium aponinum PCC 10605]
Length=98

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 54/83 (65%), Gaps = 1/83 (1%)
 Frame = +1

Query  373  AKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKL  552
            A  G  LR+  L  N+++Y  +   L NCGG G C TC+VE+VEG E LSP+T+ E  KL
Sbjct  15   AADGANLREKALQNNIDIY-KWRGKLINCGGYGQCATCVVEIVEGMENLSPKTDFETRKL  73

Query  553  KRKPRNWRLACQTTVGTPNSKGT  621
            K+KP N+RLACQT V  P S  T
Sbjct  74   KKKPENYRLACQTLVNGPISVNT  96



>ref|WP_008191595.1| iron ABC transporter substrate-binding protein [Moorea producens]
 gb|EGJ28434.1| ferredoxin [Moorea producens 3L]
Length=109

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 53/83 (64%), Gaps = 1/83 (1%)
 Frame = +1

Query  373  AKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKL  552
            A  G  LR+ ML   ++LY  +   L NCGG G CGTC+VE+V G E LSPRTE EN KL
Sbjct  15   AANGANLREKMLQNRIDLY-TFRGKLVNCGGYGQCGTCIVEIVAGIENLSPRTEVENRKL  73

Query  553  KRKPRNWRLACQTTVGTPNSKGT  621
            K+KP  +RLACQ  V  P S  T
Sbjct  74   KKKPDTYRLACQVLVNGPVSVKT  96



>ref|WP_011613812.1| iron ABC transporter substrate-binding protein [Trichodesmium 
erythraeum]
 ref|YP_723963.1| ferredoxin [Trichodesmium erythraeum IMS101]
 gb|ABG53490.1| ferredoxin [Trichodesmium erythraeum IMS101]
Length=102

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 53/78 (68%), Gaps = 1/78 (1%)
 Frame = +1

Query  373  AKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKL  552
            A  G  LR   L+  V++Y  ++  L NCGG G CGTC+VE++EG E LSPRTE E +KL
Sbjct  16   AADGANLRLKALENRVDIY-TFTAKLMNCGGYGQCGTCVVEIIEGLENLSPRTEVEEKKL  74

Query  553  KRKPRNWRLACQTTVGTP  606
            K++P NWRLACQ  V  P
Sbjct  75   KKRPENWRLACQVLVNGP  92



>ref|XP_002953816.1| hypothetical protein VOLCADRAFT_64100 [Volvox carteri f. nagariensis]
 gb|EFJ45140.1| hypothetical protein VOLCADRAFT_64100 [Volvox carteri f. nagariensis]
Length=110

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query  382  GQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRK  561
            G  LR +++   V+LY  + +     G        +VEV +G ELLS RT  E +KL  K
Sbjct  23   GDILRTVLMAEKVDLYTTWGKVWQCGGVGNCGTC-IVEVRDGAELLSERTPVEKKKLSGK  81

Query  562  PRNWRLACQTTVGTPNSKGTLVIQQLPE  645
            P  WRLACQT VG   S G + I   P+
Sbjct  82   PATWRLACQTLVGDGESTGVVTIATKPQ  109



>ref|WP_016952452.1| iron ABC transporter substrate-binding protein [Anabaena sp. 
PCC 7108]
Length=98

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +1

Query  487  MVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNS  612
            +VEVVEG E LSPRT+ EN K K+KP N+RLACQT V  P S
Sbjct  52   VVEVVEGLENLSPRTDVENRKFKKKPDNYRLACQTLVNGPVS  93



>ref|WP_013190041.1| iron ABC transporter substrate-binding protein [Trichormus azollae]
 ref|YP_003720145.1| ferredoxin ['Nostoc azollae' 0708]
 gb|ADI63022.1| ferredoxin ['Nostoc azollae' 0708]
Length=98

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +1

Query  487  MVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNS  612
            +VEVVEG E LSPRT+ EN K K KP N+RLACQT V  P S
Sbjct  52   IVEVVEGLENLSPRTDFENRKFKNKPDNYRLACQTMVNGPVS  93



>ref|WP_012162533.1| iron ABC transporter substrate-binding protein [Acaryochloris 
marina]
 ref|YP_001516354.1| 2Fe-2S type ferredoxin [Acaryochloris marina MBIC11017]
 gb|ABW27040.1| ferredoxin, 2Fe-2S type [Acaryochloris marina MBIC11017]
Length=99

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 45/90 (50%), Positives = 58/90 (64%), Gaps = 4/90 (4%)
 Frame = +1

Query  328  SVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEG  507
            S+LF + S ++   +      LR + LD  ++LY  +   L NCGG G CGTC++EVVEG
Sbjct  3    SILFVNESQEIDISEE---DDLRSVALDNKIDLY-TFKGKLMNCGGYGQCGTCLIEVVEG  58

Query  508  KELLSPRTEKENEKLKRKPRNWRLACQTTV  597
             E LSPRT  E+ KLKRKP  +RLACQT V
Sbjct  59   MENLSPRTPVEDAKLKRKPETYRLACQTLV  88



>ref|WP_037219685.1| iron ABC transporter substrate-binding protein [Richelia intracellularis]
 emb|CDN13056.1| Ferredoxin [Richelia intracellularis]
Length=98

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 44/80 (55%), Gaps = 1/80 (1%)
 Frame = +1

Query  373  AKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKL  552
            A  G  LR   ++  +++Y  + + +   G         VEVVEG E LSP TE EN  L
Sbjct  15   AAAGANLRQKAMENGIDIYKMWGKMMNCGGYGQCGTCA-VEVVEGMEYLSPPTEAENRLL  73

Query  553  KRKPRNWRLACQTTVGTPNS  612
            K+KP N+RLACQT V  P S
Sbjct  74   KKKPANFRLACQTLVNGPVS  93



>ref|WP_010474496.1| iron ABC transporter substrate-binding protein [Acaryochloris 
sp. CCMEE 5410]
Length=99

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 45/90 (50%), Positives = 58/90 (64%), Gaps = 4/90 (4%)
 Frame = +1

Query  328  SVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEG  507
            S+LF + S ++   +      LR + LD  ++LY  +   L NCGG G CGTC++EVVEG
Sbjct  3    SILFVNESQEIDVLEE---DDLRSVALDNKIDLY-TFKGKLMNCGGYGQCGTCLIEVVEG  58

Query  508  KELLSPRTEKENEKLKRKPRNWRLACQTTV  597
             E LSPRT  E+ KLKRKP  +RLACQT V
Sbjct  59   MENLSPRTPVEDAKLKRKPETYRLACQTLV  88



>ref|WP_015190116.1| ferredoxin [Gloeocapsa sp. PCC 7428]
 ref|YP_007129408.1| ferredoxin [Gloeocapsa sp. PCC 7428]
 gb|AFZ32248.1| ferredoxin [Gloeocapsa sp. PCC 7428]
Length=98

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 51/93 (55%), Gaps = 7/93 (8%)
 Frame = +1

Query  352  PDVHYRK------AKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKE  513
            P++ + K      A  G  LR   ++  +++Y  Y + +   G        +VE+ +G E
Sbjct  2    PNIKFEKENREVVAADGANLRLKAMENGIDIYKFYGKMMNCGGYGQCGTC-IVEITQGME  60

Query  514  LLSPRTEKENEKLKRKPRNWRLACQTTVGTPNS  612
             LSPRTE E+ KLK+KP+N+RLACQ  V  P S
Sbjct  61   NLSPRTEVEDRKLKKKPKNYRLACQALVNGPVS  93



>ref|WP_015132906.1| ferredoxin [Leptolyngbya sp. PCC 7376]
 ref|YP_007069960.1| ferredoxin [Leptolyngbya sp. PCC 7376]
 gb|AFY37126.1| ferredoxin [Leptolyngbya sp. PCC 7376]
Length=106

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 59/93 (63%), Gaps = 6/93 (6%)
 Frame = +1

Query  373  AKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKL  552
            A  G  LR+  L   V++Y  +   L NCGG+G C TCMVEVVEG E LSPRT+ E  +L
Sbjct  18   ASLGSNLREKALQNGVDIY-TFGAKLMNCGGVGQCATCMVEVVEGMENLSPRTDFEERRL  76

Query  553  KRKPRNWRLACQTTVGTPNSKGTLVIQQLPEWK  651
            K++P N+RLACQ+ V      G +V++  P+ K
Sbjct  77   KKRPDNYRLACQSIV-----NGRVVVKTKPKRK  104



>ref|WP_015216294.1| ferredoxin [Anabaena cylindrica]
 ref|YP_007158588.1| ferredoxin [Anabaena cylindrica PCC 7122]
 gb|AFZ59678.1| ferredoxin [Anabaena cylindrica PCC 7122]
Length=98

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +1

Query  487  MVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNS  612
            +V+VVEG E LSPRT+ EN K K+KP N+RLACQT V  P S
Sbjct  52   IVQVVEGLENLSPRTDFENRKFKKKPDNYRLACQTLVNGPVS  93



>ref|WP_006631487.1| iron ABC transporter substrate-binding protein [Microcoleus vaginatus]
 gb|EGK90509.1| ferredoxin [Microcoleus vaginatus FGP-2]
Length=98

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 43/75 (57%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  373  AKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKL  552
            A  G  LR   L+  ++LY  +S  L NCGG+G CGTC+VE+VEG E LSPRT+ EN KL
Sbjct  15   AADGANLRLKALENRIDLY-TFSGKLMNCGGIGQCGTCIVEIVEGSENLSPRTDFENRKL  73

Query  553  KRKPRNWRLACQTTV  597
            K+KP N+RLACQ  V
Sbjct  74   KKKPENYRLACQAMV  88



>ref|XP_001695531.1| 2Fe-2S ferredoxin [Chlamydomonas reinhardtii]
 gb|EDP01789.1| 2Fe-2S ferredoxin [Chlamydomonas reinhardtii]
Length=117

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 48/87 (55%), Gaps = 1/87 (1%)
 Frame = +1

Query  382  GQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRK  561
            G KLRD+++   VELY  + +     GG       +V+V  G ++L+ RT  E +KL  K
Sbjct  32   GDKLRDVLMANKVELYTTWGKVWSCGGGGQCGTC-IVDVKSGADILTERTGAEKKKLSGK  90

Query  562  PRNWRLACQTTVGTPNSKGTLVIQQLP  642
            P ++RLACQT VG   + G + I   P
Sbjct  91   PESFRLACQTLVGDGENSGAVTIATKP  117



>ref|WP_009628823.1| ferredoxin [Pseudanabaena biceps]
 gb|ELS31096.1| ferredoxin [Pseudanabaena biceps PCC 7429]
Length=99

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 42/79 (53%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = +1

Query  373  AKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKL  552
            A  G  LR   L+ N+++Y  +   L NC G G C TC VE+VEG E LSPRTE E +KL
Sbjct  15   AMDGANLRIKALENNIDIY-KFVAKLTNCNGYGQCATCTVEIVEGLENLSPRTEFEEKKL  73

Query  553  KRKPRNWRLACQTTVGTPN  609
            K KP+N+RLACQT V   N
Sbjct  74   KNKPKNYRLACQTLVNQGN  92



>ref|WP_013322272.1| iron ABC transporter substrate-binding protein [Cyanothece sp. 
PCC 7822]
 ref|YP_003887442.1| ferredoxin [Cyanothece sp. PCC 7822]
 gb|ADN14167.1| ferredoxin [Cyanothece sp. PCC 7822]
Length=98

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  382  GQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRK  561
            G  LR+  L  +V++Y  +   L NCGG G CGTC+VE+VEG E LSP+T+ E  KLK+K
Sbjct  18   GANLREKALQNSVDIY-TFKGKLTNCGGYGQCGTCIVEIVEGMENLSPKTDFEQRKLKKK  76

Query  562  PRNWRLACQTTVGTP  606
            P N+RLACQT V  P
Sbjct  77   PENYRLACQTLVNGP  91



>ref|WP_009455493.1| MULTISPECIES: iron ABC transporter substrate-binding protein 
[Fischerella]
 gb|EHC18102.1| ferredoxin [Fischerella sp. JSC-11]
Length=99

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 54/80 (68%), Gaps = 1/80 (1%)
 Frame = +1

Query  373  AKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKL  552
            A  G  LR   L+  +++Y  + + + NCGG G CGTC+VE++EG+E LSP T+ EN  L
Sbjct  15   AADGANLRQKALENGIDIYKLWGK-MMNCGGYGQCGTCIVEIIEGRENLSPPTQAENRFL  73

Query  553  KRKPRNWRLACQTTVGTPNS  612
            K+KP N+RLACQT V  P S
Sbjct  74   KKKPANYRLACQTVVNGPVS  93



>ref|WP_012407088.1| iron ABC transporter substrate-binding protein [Nostoc punctiforme]
 ref|YP_001864005.1| ferredoxin [Nostoc punctiforme PCC 73102]
 gb|ACC79062.1| ferredoxin [Nostoc punctiforme PCC 73102]
Length=98

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  487  MVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTV  597
            +VE+VEG E LSPRT+ EN K K+KP N+RLACQT V
Sbjct  52   IVEIVEGLENLSPRTDVENRKFKKKPENYRLACQTLV  88



>ref|WP_036008260.1| iron ABC transporter substrate-binding protein [Leptolyngbya 
sp. JSC-1]
Length=101

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = +1

Query  373  AKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKL  552
            A  G  LR   L+  ++LY  ++  L NCGG G CGTC+V + EG E LSPRTE EN KL
Sbjct  16   AASGANLRFKALENGIDLY-TFTGKLMNCGGYGQCGTCVVAIAEGMENLSPRTEVENRKL  74

Query  553  KRKPRNWRLACQTTVGTPNS  612
            K++P N RLACQT V  P S
Sbjct  75   KKRPNNCRLACQTLVYGPVS  94



>ref|WP_006101464.1| iron ABC transporter substrate-binding protein [Coleofasciculus 
chthonoplastes]
 gb|EDX75192.1| hypothetical protein MC7420_2196 [Coleofasciculus chthonoplastes 
PCC 7420]
Length=98

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 45/83 (54%), Positives = 53/83 (64%), Gaps = 1/83 (1%)
 Frame = +1

Query  373  AKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKL  552
            A  G  LR+  L   ++LY  +   L NCGG G CGTC+VEVVEG E LSPRTE E  KL
Sbjct  15   AADGANLREKALQNKIDLY-TFKGKLMNCGGYGQCGTCIVEVVEGMENLSPRTEVEQRKL  73

Query  553  KRKPRNWRLACQTTVGTPNSKGT  621
            K+KP ++RLACQ  V  P S  T
Sbjct  74   KKKPESYRLACQALVNGPVSVKT  96



>ref|WP_016874262.1| iron ABC transporter substrate-binding protein [Chlorogloeopsis 
fritschii]
Length=98

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 46/80 (58%), Gaps = 1/80 (1%)
 Frame = +1

Query  373  AKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKL  552
            A  G  LR   L+  +++Y  + + +   G        +VE+VEG+E LSP TE EN  L
Sbjct  15   AADGANLRLKALENGIDIYKIWGKMMNCGGYGQCGTC-IVEIVEGRENLSPPTEVENRLL  73

Query  553  KRKPRNWRLACQTTVGTPNS  612
            K+KP N+RLACQT V  P S
Sbjct  74   KKKPANYRLACQTLVNGPVS  93



>ref|WP_027403249.1| iron ABC transporter substrate-binding protein [Aphanizomenon 
flos-aquae]
Length=98

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  487  MVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTP  606
            +V++VEG E LSPRT+ EN K K KP N+RLACQT V  P
Sbjct  52   VVQIVEGLENLSPRTDLENRKFKNKPDNYRLACQTVVNGP  91



>ref|WP_026721485.1| iron ABC transporter substrate-binding protein [Fischerella sp. 
PCC 9431]
Length=98

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 54/80 (68%), Gaps = 1/80 (1%)
 Frame = +1

Query  373  AKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKL  552
            A  G  LR   L+  +++Y  + + + NCGG G CGTC+VE++EG+E LSP TE EN  L
Sbjct  15   AADGANLRLKALENGIDIYKVWGK-MMNCGGYGQCGTCIVEIIEGQENLSPPTEVENRFL  73

Query  553  KRKPRNWRLACQTTVGTPNS  612
            K+KP N+RLACQT V  P S
Sbjct  74   KKKPANYRLACQTVVNGPVS  93



>ref|WP_039200258.1| iron ABC transporter substrate-binding protein [Aphanizomenon 
flos-aquae]
 gb|KHG42684.1| iron ABC transporter substrate-binding protein [Aphanizomenon 
flos-aquae 2012/KM/D3]
Length=98

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  487  MVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTP  606
            +V++VEG E LSPRT+ EN K K KP N+RLACQT V  P
Sbjct  52   VVQIVEGLENLSPRTDLENRKFKNKPDNYRLACQTVVNGP  91



>ref|WP_017311897.1| iron ABC transporter substrate-binding protein [Fischerella sp. 
PCC 9339]
Length=98

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 55/80 (69%), Gaps = 1/80 (1%)
 Frame = +1

Query  373  AKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKL  552
            A  G  LR   L+ ++++Y  + + + NCGG G CGTC+VE++EG+E LSP TE EN  L
Sbjct  15   AADGANLRLKALENSIDIYKVWGK-MMNCGGYGQCGTCIVEIIEGQENLSPPTEVENRFL  73

Query  553  KRKPRNWRLACQTTVGTPNS  612
            K+KP N+RLACQT V  P S
Sbjct  74   KKKPANYRLACQTLVNGPVS  93



>ref|WP_015147815.1| ferredoxin [Oscillatoria acuminata]
 ref|YP_007085088.1| ferredoxin [Oscillatoria acuminata PCC 6304]
 gb|AFY81168.1| ferredoxin [Oscillatoria acuminata PCC 6304]
Length=98

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 54/83 (65%), Gaps = 1/83 (1%)
 Frame = +1

Query  373  AKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKL  552
            A  G  LR   L+  +ELY  +   L NCGG G CGTC+VEVVEG E LS RT  EN+KL
Sbjct  15   AADGANLRLKALENGIELY-KFVGKLMNCGGYGQCGTCIVEVVEGMENLSDRTPAENQKL  73

Query  553  KRKPRNWRLACQTTVGTPNSKGT  621
            K+KP ++RLACQT V  P S  T
Sbjct  74   KKKPPSYRLACQTLVNGPVSVKT  96



>ref|WP_023076016.1| ferredoxin [Leptolyngbya sp. Heron Island J]
 gb|ESA32920.1| ferredoxin [Leptolyngbya sp. Heron Island J]
Length=102

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 50/80 (63%), Gaps = 1/80 (1%)
 Frame = +1

Query  373  AKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKL  552
            A  G  LR   +D  V++Y  ++  + NCGG G C  C+VE+ EG E LSPRT  E +KL
Sbjct  15   AADGANLRQKAIDNGVDIY-TFTGKMMNCGGYGQCALCVVEIAEGLENLSPRTAVEEKKL  73

Query  553  KRKPRNWRLACQTTVGTPNS  612
            K++P N RLACQT V  P S
Sbjct  74   KKRPSNCRLACQTLVNGPIS  93



>ref|WP_016864736.1| iron ABC transporter substrate-binding protein [Fischerella muscicola]
Length=99

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 46/80 (58%), Gaps = 1/80 (1%)
 Frame = +1

Query  373  AKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKL  552
            A  G  LR   L+  +++Y  + + +   G        +VE++EG+E LSP T+ EN  L
Sbjct  15   AADGANLRQKALENGIDIYKLWGKMMNCGGYGQCGTC-IVEIIEGQENLSPPTQVENRFL  73

Query  553  KRKPRNWRLACQTTVGTPNS  612
            K+KP N+RLACQT V  P S
Sbjct  74   KKKPANYRLACQTVVNGPVS  93



>ref|WP_017719765.1| iron ABC transporter substrate-binding protein [Oscillatoria 
sp. PCC 10802]
Length=98

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  487  MVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTP  606
            +VE+VEG E LSPRTE E  KLKRKP+ +RLACQ  V  P
Sbjct  52   IVEIVEGMENLSPRTEVEERKLKRKPKTYRLACQALVNGP  91



>ref|WP_039743855.1| iron ABC transporter substrate-binding protein [Hassallia byssoidea]
 gb|KIF36002.1| iron ABC transporter substrate-binding protein [Hassallia byssoidea 
VB512170]
Length=98

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 52/83 (63%), Gaps = 1/83 (1%)
 Frame = +1

Query  373  AKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKL  552
            A  G  LR   +  N+++Y  +   + NCGG G CGTC+VE+VEG E LSPRT+ E   L
Sbjct  15   AANGANLRLKAMQNNIDIY-KFIGKMTNCGGGGNCGTCIVEIVEGMENLSPRTDTEKRIL  73

Query  553  KRKPRNWRLACQTTVGTPNSKGT  621
            K+KP N+RLACQT V    S  T
Sbjct  74   KKKPENYRLACQTVVNGAVSVAT  96



>ref|WP_015166068.1| ferredoxin [Pseudanabaena sp. PCC 7367]
 ref|YP_007103540.1| ferredoxin [Pseudanabaena sp. PCC 7367]
 gb|AFY71112.1| ferredoxin [Pseudanabaena sp. PCC 7367]
Length=98

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  487  MVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTV  597
            +VE+ EG E LSPRT  E+ KLKRKP N+RLACQT V
Sbjct  52   IVEINEGMEHLSPRTNAEDRKLKRKPDNYRLACQTMV  88



>ref|WP_011057369.1| iron ABC transporter substrate-binding protein [Thermosynechococcus 
elongatus]
 ref|NP_682319.1| ferredoxin [Thermosynechococcus elongatus BP-1]
 dbj|BAC09081.1| tll1529 [Thermosynechococcus elongatus BP-1]
Length=108

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 44/89 (49%), Gaps = 19/89 (21%)
 Frame = +1

Query  373  AKGGQKLRDIMLDGNVELY---------GPYSRAlcncgglgtcgtcMVEVVEGKELLSP  525
            A  G  LR   ++  V+LY         G Y +              +VE+VEG E LSP
Sbjct  23   AANGANLRLKAMEAGVDLYTLKGKLFNCGGYGQCGTC----------IVEIVEGMEHLSP  72

Query  526  RTEKENEKLKRKPRNWRLACQTTVGTPNS  612
            RT  E  KL+RKP N+RLACQT V  P S
Sbjct  73   RTPVEERKLRRKPENYRLACQTLVYGPVS  101



>ref|WP_026101278.1| iron ABC transporter substrate-binding protein [Synechococcus 
sp. PCC 7336]
Length=98

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 39/72 (54%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +1

Query  382  GQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRK  561
            G  LR I L+ +++LY  +   + NCGG G CGTC+V+V+EG + LSPRT  E  KLKRK
Sbjct  18   GANLRRIALENDIDLY-KFVAKMTNCGGAGQCGTCIVDVIEGSDRLSPRTTPEERKLKRK  76

Query  562  PRNWRLACQTTV  597
            P  +RLACQT V
Sbjct  77   PDTYRLACQTKV  88



>ref|WP_019492324.1| iron ABC transporter substrate-binding protein [Calothrix sp. 
PCC 7103]
Length=99

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +1

Query  487  MVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNS  612
            +VE+ EG E LSPRT+ EN  LK+KP N+RLACQT V  P S
Sbjct  52   IVEITEGIENLSPRTDAENRILKKKPENYRLACQTLVNGPVS  93



>ref|WP_016863374.1| iron ABC transporter substrate-binding protein [Fischerella muscicola]
Length=98

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +1

Query  487  MVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNS  612
            +VE++EG+E LSP T+ EN  LK+KP N+RLACQT V  P S
Sbjct  52   IVEIIEGQENLSPPTQVENRFLKKKPANYRLACQTVVNGPVS  93



>ref|WP_027845148.1| iron ABC transporter substrate-binding protein [Mastigocoleus 
testarum]
Length=98

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 45/78 (58%), Gaps = 1/78 (1%)
 Frame = +1

Query  373  AKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKL  552
            A  G  LR   ++ +V++Y  + + +   G         VE+V G E LSPRT+ EN+ L
Sbjct  15   AATGANLRLKAMENSVDIYKMWGKMMNCGGYGQCGTCA-VEIVSGMENLSPRTDAENKLL  73

Query  553  KRKPRNWRLACQTTVGTP  606
            K+KP N+RLACQT V  P
Sbjct  74   KKKPDNYRLACQTLVNGP  91



>ref|WP_017323135.1| iron ABC transporter substrate-binding protein [cyanobacterium 
PCC 7702]
Length=98

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 46/80 (58%), Gaps = 1/80 (1%)
 Frame = +1

Query  373  AKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKL  552
            A  G  LR   ++  +++Y  + + +   G        +VE++EG+E LSP TE EN  L
Sbjct  15   AANGANLRLKAIENGIDIYKIWGKMINCGGYGQCGTC-IVEIIEGRENLSPPTEVENRFL  73

Query  553  KRKPRNWRLACQTTVGTPNS  612
            K+KP N+RLACQT V  P S
Sbjct  74   KKKPVNYRLACQTLVNGPVS  93



>ref|WP_026731793.1| iron ABC transporter substrate-binding protein [Fischerella sp. 
PCC 9605]
Length=99

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 45/80 (56%), Gaps = 1/80 (1%)
 Frame = +1

Query  373  AKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKL  552
            A  G  LR   L+  +++Y  + + +   G        +VE+VEGKE LSP T+ E   L
Sbjct  15   AANGANLRQKALENGIDIYKIWGKMMNCGGYGQCGTC-IVEIVEGKENLSPPTDVEKRFL  73

Query  553  KRKPRNWRLACQTTVGTPNS  612
            K+KP N+RLACQT V  P S
Sbjct  74   KKKPANYRLACQTLVNGPVS  93



>ref|WP_015955483.1| iron ABC transporter substrate-binding protein [Cyanothece sp. 
PCC 7424]
 ref|YP_002378757.1| ferredoxin [Cyanothece sp. PCC 7424]
 gb|ACK71889.1| ferredoxin [Cyanothece sp. PCC 7424]
Length=98

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 59/95 (62%), Gaps = 4/95 (4%)
 Frame = +1

Query  322  VHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVV  501
            + S+ F   + DV   +   G  LR+  L  ++++Y  +   L NCGG G CGTC+VE+V
Sbjct  1    MSSITFVKENKDVVVAQ---GANLREKALQNSIDIY-TFKGKLTNCGGYGQCGTCIVEIV  56

Query  502  EGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTP  606
            EG E LSP+T+ E  KLK+KP  +RLACQT V  P
Sbjct  57   EGMENLSPKTDFEQRKLKKKPETYRLACQTLVNGP  91



>ref|WP_024124589.1| ferredoxin (2Fe-2S) [Thermosynechococcus sp. NK55a]
 ref|YP_008899695.1| ferredoxin (2Fe-2S) [Thermosynechococcus sp. NK55a]
 gb|AHB88182.1| ferredoxin (2Fe-2S) [Thermosynechococcus sp. NK55a]
Length=101

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +1

Query  487  MVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNS  612
            +VE+VEG E LSPRT  E  KL+RKP N+RLACQT V  P S
Sbjct  53   IVEIVEGMENLSPRTPVEERKLRRKPENYRLACQTLVYGPVS  94



>ref|WP_025781684.1| hypothetical protein [Candidatus Synechococcus spongiarum]
Length=153

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 53/114 (46%), Gaps = 18/114 (16%)
 Frame = +1

Query  352  PDVHYRK------AKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKE  513
            P +H+ +         G  LRD+ LD  VELYG   +      G     +     V G++
Sbjct  2    PTIHFLREQLDVDCPTGAILRDVALDAGVELYG--LKGKLGNCGGCGQCSTCFVAVAGRD  59

Query  514  ---LLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQLPE--WKGHE  660
                L+PRT  E   LKR+P NWRLACQ  +     + +LV+   P+  W G +
Sbjct  60   EDACLTPRTAPEQRFLKRRPVNWRLACQAVI-----RDSLVVVTRPQAGWPGGD  108



>ref|WP_023066838.1| 2Fe-2S iron-sulfur cluster binding domain protein [Lyngbya aestuarii]
 gb|ERT06938.1| 2Fe-2S iron-sulfur cluster binding domain protein [Lyngbya aestuarii 
BL J]
Length=98

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  487  MVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTP  606
            +VEVVEG E LSPRT+ E   LK+KP ++RLACQT V  P
Sbjct  52   IVEVVEGMENLSPRTDTEKRILKKKPESYRLACQTMVNGP  91



>ref|WP_015186075.1| ferredoxin [Microcoleus sp. PCC 7113]
 ref|YP_007125354.1| ferredoxin [Microcoleus sp. PCC 7113]
 gb|AFZ21948.1| ferredoxin [Microcoleus sp. PCC 7113]
Length=100

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 42/83 (51%), Positives = 53/83 (64%), Gaps = 1/83 (1%)
 Frame = +1

Query  373  AKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKL  552
            A  G  LR+  L   ++LY  ++  + NCGG G CGTC+VEV +G E LSPRT+ EN KL
Sbjct  15   AANGANLREKALQNGIDLY-TFTGKMMNCGGYGQCGTCIVEVTDGIENLSPRTDVENRKL  73

Query  553  KRKPRNWRLACQTTVGTPNSKGT  621
            K+KP  +RLACQ  V  P S  T
Sbjct  74   KKKPDTYRLACQALVNGPVSVKT  96



>ref|WP_015160171.1| ferredoxin [Chamaesiphon minutus]
 ref|YP_007097555.1| ferredoxin [Chamaesiphon minutus PCC 6605]
 gb|AFY94028.1| ferredoxin [Chamaesiphon minutus PCC 6605]
Length=98

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  487  MVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTV  597
            +VE+ EG E LSPRT+ EN KL +KP N+RLACQT V
Sbjct  52   VVEIAEGMENLSPRTDFENRKLAKKPANYRLACQTLV  88



>ref|WP_028082439.1| iron ABC transporter substrate-binding protein [Dolichospermum 
circinale]
Length=98

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +1

Query  487  MVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNS  612
            +V++ EG E LSPRT+ EN K K KP N+RLACQT V  P S
Sbjct  52   VVQITEGLENLSPRTDLENRKFKNKPDNYRLACQTLVNGPVS  93



>ref|WP_035149126.1| iron ABC transporter substrate-binding protein [Calothrix sp. 
336/3]
 gb|KFB81654.1| iron ABC transporter substrate-binding protein [Calothrix sp. 
336/3]
Length=98

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 43/75 (57%), Gaps = 1/75 (1%)
 Frame = +1

Query  373  AKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKL  552
            A  G  LR   ++  V++Y  + + +   GG        + +VEG E LSPRT+ EN  L
Sbjct  15   AANGANLRLKAMENGVDIYKTWGKMMNCGGGGQCGCCA-IAIVEGMENLSPRTDAENRLL  73

Query  553  KRKPRNWRLACQTTV  597
            K+KP N+RLACQT V
Sbjct  74   KKKPENYRLACQTIV  88



>ref|WP_011243144.1| ferredoxin [Synechococcus elongatus]
 ref|YP_171542.1| ferredoxin [Synechococcus elongatus PCC 6301]
 ref|YP_399717.1| ferredoxin [Synechococcus elongatus PCC 7942]
 dbj|BAD79022.1| probable ferredoxin [Synechococcus elongatus PCC 6301]
 gb|ABB56730.1| probable ferredoxin [Synechococcus elongatus PCC 7942]
 gb|AJD58728.1| ferredoxin [Synechococcus sp. UTEX 2973]
Length=144

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = +1

Query  373  AKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKL  552
            A  G  LR   ++  V+LY  +   + NCGG G CGTC+VE+V+G E LSPRT  E  KL
Sbjct  15   AADGANLRFKAVENQVDLYT-FGGKMMNCGGYGQCGTCIVEIVQGAENLSPRTSFEERKL  73

Query  553  KRKPRNWRLACQTTVGTP  606
            KRKP ++RLACQ TV  P
Sbjct  74   KRKPDSYRLACQATVNGP  91



>ref|WP_009782902.1| iron ABC transporter substrate-binding protein [Lyngbya sp. PCC 
8106]
 gb|EAW38435.1| probable ferredoxin [Lyngbya sp. PCC 8106]
Length=98

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  487  MVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTP  606
            +VEVVEG E LSPRT+ E   LK+KP ++RLACQT V  P
Sbjct  52   IVEVVEGMENLSPRTDTEKRILKKKPDSYRLACQTMVNGP  91



>ref|WP_036477598.1| iron ABC transporter substrate-binding protein [Myxosarcina sp. 
GI1]
Length=104

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 51/101 (50%), Gaps = 4/101 (4%)
 Frame = +1

Query  304  MVKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgt  483
            M  I FV      +G   +    A  G  LR+  L  NV++Y    +     G       
Sbjct  1    MTTITFVKD---KNGKEVITEVVAANGSNLREKALQNNVDIYKLKGKLTNCGGVGQCSTC  57

Query  484  cMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTP  606
             +V++VEG E LSPRT+ E ++L +KP ++RL+CQT V  P
Sbjct  58   -IVDIVEGMENLSPRTDFEQKRLGKKPDSYRLSCQTVVKGP  97



>ref|WP_007100551.1| ferredoxin [Synechococcus sp. RS9917]
 gb|EAQ68475.1| possible ferredoxin (2Fe-2S) [Synechococcus sp. RS9917]
Length=155

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 56/90 (62%), Gaps = 8/90 (9%)
 Frame = +1

Query  382  GQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKEL--LSPRTEKENEKLK  555
            G+ LRD+ L   + LYG     L NCGG G C TC V+V EG  L  LSPRT  E  KL+
Sbjct  18   GENLRDVALREGIALYG-LKGQLGNCGGCGQCITCFVDVQEGGALGALSPRTAVEEAKLR  76

Query  556  RKPRNWRLACQTTVGTPNSKGTLVIQQLPE  645
            R+P++WRLACQT V     +G+++I   P+
Sbjct  77   RRPQSWRLACQTLV-----EGSVLIMTRPQ  101



>ref|WP_006512418.1| ferredoxin [Xenococcus sp. PCC 7305]
 gb|ELS00477.1| ferredoxin [Xenococcus sp. PCC 7305]
Length=111

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 59/124 (48%), Gaps = 27/124 (22%)
 Frame = +1

Query  307  VKIAFVHSVLFPDGSPDVHYRKAKGGQKLRDIMLDGNVELY---------GPYSRAlcnc  459
            +K A + S+ F     +V +     G  LR+  L+  +++Y         G Y +     
Sbjct  1    MKTAVMSSIKFVKEEKEVVFAL---GANLRERALENKIDIYTLKGKLTNCGGYGQCGTC-  56

Query  460  gglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTLVIQQL  639
                     +VE+VEG E LSPRT  E  KLK+KP ++RLACQ TV      G++ +   
Sbjct  57   ---------VVEIVEGMENLSPRTAFEQRKLKKKPDSYRLACQATVN-----GSVTVATK  102

Query  640  PEWK  651
            P+ K
Sbjct  103  PKLK  106



>ref|WP_019502206.1| iron ABC transporter substrate-binding protein [Pseudanabaena 
sp. PCC 6802]
Length=98

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  487  MVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTV  597
            +VE+ EG E LSPRT+ E  KLKRKP ++RLACQT V
Sbjct  52   IVEITEGGEQLSPRTDFEKRKLKRKPNSYRLACQTLV  88



>gb|EAZ92725.1| hydrogenase component [Cyanothece sp. CCY0110]
Length=103

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 49/75 (65%), Gaps = 1/75 (1%)
 Frame = +1

Query  382  GQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRK  561
            G  LR+  L   V++Y  +   L NCGG G CGTC+VE+ EG E LSPRT+ E   LK+K
Sbjct  22   GANLREKALQNKVDIY-TFKGKLMNCGGYGQCGTCIVEIAEGMENLSPRTDFEKRVLKKK  80

Query  562  PRNWRLACQTTVGTP  606
            P N+RLACQT V  P
Sbjct  81   PDNYRLACQTIVNGP  95



>ref|WP_029637864.1| iron ABC transporter substrate-binding protein [[Scytonema hofmanni] 
UTEX B 1581]
Length=98

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 49/75 (65%), Gaps = 1/75 (1%)
 Frame = +1

Query  373  AKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKL  552
            A  G  LR   +  N+++Y    + + NCGG G CGTC+VE+ EG E LS RT+ EN  L
Sbjct  15   AANGANLRLKAMQNNIDIYKLIGK-MTNCGGGGNCGTCIVEIAEGMENLSQRTDTENRML  73

Query  553  KRKPRNWRLACQTTV  597
            K+KP N+RLACQT V
Sbjct  74   KKKPENYRLACQTVV  88



>ref|WP_026786683.1| MULTISPECIES: iron ABC transporter substrate-binding protein 
[Planktothrix]
Length=102

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 54/83 (65%), Gaps = 1/83 (1%)
 Frame = +1

Query  373  AKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKL  552
            A  G  LR   L+  ++LY  ++  + NCGG G CGTC+VE+VEG + L PRTE E+  L
Sbjct  15   AADGANLRIKALENQIDLY-TFTGKMMNCGGYGQCGTCIVEIVEGIDNLPPRTEAESRIL  73

Query  553  KRKPRNWRLACQTTVGTPNSKGT  621
            K+KP ++RLACQT V  P S  T
Sbjct  74   KKKPDSYRLACQTIVNGPISVQT  96



>tpg|DAA55519.1| TPA: hypothetical protein ZEAMMB73_916473, partial [Zea mays]
Length=559

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  487  MVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVG  600
            +VE+++GKELL+ RT  EN  LK+KP +WRLACQT VG
Sbjct  519  IVEIIDGKELLNERTSTENRYLKKKPDSWRLACQTIVG  556



>ref|WP_035798607.1| iron ABC transporter substrate-binding protein [Cyanothece sp. 
CCY0110]
Length=98

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 49/75 (65%), Gaps = 1/75 (1%)
 Frame = +1

Query  382  GQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRK  561
            G  LR+  L   V++Y  +   L NCGG G CGTC+VE+ EG E LSPRT+ E   LK+K
Sbjct  17   GANLREKALQNKVDIY-TFKGKLMNCGGYGQCGTCIVEIAEGMENLSPRTDFEKRVLKKK  75

Query  562  PRNWRLACQTTVGTP  606
            P N+RLACQT V  P
Sbjct  76   PDNYRLACQTIVNGP  90



>ref|WP_009768006.1| ferredoxin [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ68895.1| ferredoxin [Oscillatoriales cyanobacterium JSC-12]
Length=98

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +1

Query  487  MVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNS  612
            +VEVV+G E LSP+TE E  KLK+KP ++RLACQT V  P S
Sbjct  52   VVEVVDGIENLSPKTEVEKRKLKKKPDSYRLACQTLVNGPIS  93



>gb|AIE74406.1| Ferredoxin [Synechocystis sp. PCC 6714]
Length=99

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +1

Query  487  MVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGT  621
            +VE+  G E LSPRT+ EN  L++KP N+RLACQT V  P S  T
Sbjct  51   IVEITAGMENLSPRTDFENRVLRKKPENFRLACQTLVNGPVSVNT  95



>ref|WP_038023870.1| ferredoxin [Synechococcus sp. RS9916]
Length=163

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 65/118 (55%), Gaps = 13/118 (11%)
 Frame = +1

Query  382  GQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVV--EGKELLSPRTEKENEKLK  555
            G+ LRD+ L   +ELYG   R L NC G G C TC VE+    G + LSPRT  E+ KLK
Sbjct  18   GENLRDVALREGIELYGLKGR-LGNCNGCGQCITCFVEISGGAGPDSLSPRTAVEDAKLK  76

Query  556  RKPRNWRLACQTTVGTPNSKGTLVIQQ----LPEWKGH--EWNYKELKSSGGAWAELE  711
            R+P +WRLACQ  V     +  +V+ +    LP+ +G       +EL +   AW  +E
Sbjct  77   RRPEDWRLACQALV----QRSAIVLTKPQTGLPDREGKIAAARAQELPAGPTAWPVVE  130



>gb|KDO79620.1| hypothetical protein CISIN_1g029369mg [Citrus sinensis]
Length=165

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 52/125 (42%), Gaps = 23/125 (18%)
 Frame = +1

Query  268  TVTPDEAEEEEAMVKIAFVHSVLFPDGSPDVHYRKAKGGQKL-RDIMLDGNVELYGPYSR  444
            +  P   E E+  +++ F+      DGS  V   KA  G+KL R+IMLD  +ELY  Y  
Sbjct  45   STEPSSPEPEKPEIELEFIAPRAGDDGSYPVERAKAISGEKLLRNIMLDNKIELYATY--  102

Query  445  AlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGTL  624
                                GK +           +  KP +WRLACQT VG   + G  
Sbjct  103  --------------------GKVMNCGGGGSCGTCIVEKPESWRLACQTIVGNKENSGKC  142

Query  625  VIQQL  639
             I+ L
Sbjct  143  RIKYL  147



>ref|WP_017662478.1| iron ABC transporter substrate-binding protein [Geitlerinema 
sp. PCC 7105]
Length=98

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 52/83 (63%), Gaps = 1/83 (1%)
 Frame = +1

Query  373  AKGGQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVVEGKELLSPRTEKENEKL  552
            A  G  LR   L+  V++Y  + + L NCGG G CGTC+VEVVEG E LSP TE E  KL
Sbjct  15   AADGANLRTKALENKVDIYKTWGK-LTNCGGYGQCGTCIVEVVEGMENLSPPTEAEKRKL  73

Query  553  KRKPRNWRLACQTTVGTPNSKGT  621
            ++KP  +RLACQ  V  P S  T
Sbjct  74   RKKPDTYRLACQVIVNGPVSVKT  96



>gb|EAU72934.1| possible ferredoxin (2Fe-2S) [Synechococcus sp. RS9916]
Length=200

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 65/118 (55%), Gaps = 13/118 (11%)
 Frame = +1

Query  382  GQKLRDIMLDGNVELYGPYSRAlcncgglgtcgtcMVEVV--EGKELLSPRTEKENEKLK  555
            G+ LRD+ L   +ELYG   R L NC G G C TC VE+    G + LSPRT  E+ KLK
Sbjct  55   GENLRDVALREGIELYGLKGR-LGNCNGCGQCITCFVEISGGAGPDSLSPRTAVEDAKLK  113

Query  556  RKPRNWRLACQTTVGTPNSKGTLVIQQ----LPEWKGH--EWNYKELKSSGGAWAELE  711
            R+P +WRLACQ  V     +  +V+ +    LP+ +G       +EL +   AW  +E
Sbjct  114  RRPEDWRLACQALV----QRSAIVLTKPQTGLPDREGKIAAARAQELPAGPTAWPVVE  167



>ref|WP_012626344.1| iron ABC transporter substrate-binding protein [Cyanothece sp. 
PCC 7425]
 ref|YP_002481607.1| ferredoxin [Cyanothece sp. PCC 7425]
 gb|ACL43246.1| ferredoxin [Cyanothece sp. PCC 7425]
Length=98

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  487  MVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTP  606
            +VEVV+G E LS RTE EN KLK KP  +RLACQT V  P
Sbjct  52   IVEVVDGLEHLSDRTEVENRKLKNKPPTYRLACQTLVEGP  91



>ref|WP_026080057.1| iron ABC transporter substrate-binding protein [Spirulina subsalsa]
Length=98

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +1

Query  487  MVEVVEGKELLSPRTEKENEKLKRKPRNWRLACQTTVGTPNSKGT  621
            +VE+VEG E LS  TE E  KLK+KP N+RLACQT V  P S  T
Sbjct  52   IVEIVEGLENLSAPTEFEQRKLKKKPSNYRLACQTIVNGPVSVKT  96



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1875420020936