BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c28611_g1_i1 len=785 path=[763:0-784]

Length=785
                                                                      Score     E

ref|XP_009761027.1|  PREDICTED: uncharacterized protein LOC104213261  88.6    2e-18   
emb|CDP09860.1|  unnamed protein product                              87.4    5e-18   
ref|XP_009588361.1|  PREDICTED: uncharacterized protein LOC104085944  85.5    2e-17   
ref|XP_009794963.1|  PREDICTED: uncharacterized protein LOC104241727  83.2    2e-16   
ref|XP_009623040.1|  PREDICTED: uncharacterized protein LOC104114325  82.8    2e-16   
ref|XP_004245693.1|  PREDICTED: uncharacterized protein LOC101259274  78.6    6e-15   
ref|XP_006363714.1|  PREDICTED: uncharacterized protein LOC102602347  78.2    1e-14   
ref|XP_010108098.1|  hypothetical protein L484_023184                 77.4    2e-14   
ref|XP_002303541.2|  hypothetical protein POPTR_0003s11710g           76.3    5e-14   Populus trichocarpa [western balsam poplar]
ref|XP_011033863.1|  PREDICTED: uncharacterized protein LOC105132212  75.1    1e-13   
ref|XP_011070028.1|  PREDICTED: uncharacterized protein LOC105155...  75.1    2e-13   
ref|XP_010661675.1|  PREDICTED: uncharacterized protein LOC100241...  73.6    3e-13   
ref|XP_002281385.1|  PREDICTED: uncharacterized protein LOC100241...  71.6    1e-12   Vitis vinifera
ref|XP_011070045.1|  PREDICTED: uncharacterized protein LOC105155...  72.4    2e-12   
ref|XP_011070037.1|  PREDICTED: uncharacterized protein LOC105155...  72.4    2e-12   
gb|KDO63715.1|  hypothetical protein CISIN_1g044622mg                 70.9    2e-12   
ref|XP_006440446.1|  hypothetical protein CICLE_v10023705mg           71.2    3e-12   
ref|XP_006477317.1|  PREDICTED: uncharacterized protein LOC102616014  71.2    3e-12   
ref|XP_006358368.1|  PREDICTED: uncharacterized protein LOC102579247  69.7    9e-12   
gb|KDP25574.1|  hypothetical protein JCGZ_20730                       67.8    4e-11   
ref|XP_007040023.1|  Uncharacterized protein TCM_016107               68.9    5e-11   
ref|XP_002509639.1|  conserved hypothetical protein                   67.0    7e-11   Ricinus communis
ref|XP_006368732.1|  hypothetical protein POPTR_0001s08220g           66.6    1e-10   
ref|XP_008437719.1|  PREDICTED: uncharacterized protein LOC103483063  63.2    2e-09   
gb|EYU40547.1|  hypothetical protein MIMGU_mgv1a017079mg              62.4    3e-09   
ref|XP_011017507.1|  PREDICTED: uncharacterized protein LOC105120821  62.4    4e-09   
ref|XP_002302541.2|  hypothetical protein POPTR_0002s15060g           62.0    6e-09   Populus trichocarpa [western balsam poplar]
ref|XP_004133904.1|  PREDICTED: uncharacterized protein LOC101211719  61.2    1e-08   
ref|XP_004166247.1|  PREDICTED: uncharacterized LOC101211719          61.2    1e-08   
gb|KGN50180.1|  hypothetical protein Csa_5G157390                     59.7    3e-08   
ref|XP_010540163.1|  PREDICTED: uncharacterized protein LOC104814010  60.1    4e-08   
ref|XP_007134903.1|  hypothetical protein PHAVU_010G085600g           59.7    4e-08   
ref|XP_008438145.1|  PREDICTED: uncharacterized protein LOC103483340  58.5    1e-07   
ref|XP_002320732.1|  hypothetical protein POPTR_0014s06690g           57.8    2e-07   Populus trichocarpa [western balsam poplar]
ref|NP_001236921.1|  uncharacterized protein LOC100305804             57.4    4e-07   
ref|XP_004306906.1|  PREDICTED: uncharacterized protein LOC101314...  56.6    6e-07   
ref|XP_010276171.1|  PREDICTED: uncharacterized protein LOC104610982  55.8    1e-06   
gb|KCW72048.1|  hypothetical protein EUGRSUZ_E00491                   55.8    1e-06   
gb|KCW72049.1|  hypothetical protein EUGRSUZ_E00491                   55.5    1e-06   
ref|XP_007052025.1|  Homeobox-leucine zipper protein HOX9, putative   55.1    2e-06   
ref|XP_009379274.1|  PREDICTED: uncharacterized protein LOC103967705  54.3    5e-06   
ref|XP_010092855.1|  hypothetical protein L484_022450                 54.3    5e-06   
ref|XP_003534604.1|  PREDICTED: uncharacterized protein LOC100788403  53.5    6e-06   
ref|XP_008375831.1|  PREDICTED: uncharacterized protein LOC103439061  53.5    7e-06   
ref|XP_002511736.1|  conserved hypothetical protein                   53.9    7e-06   Ricinus communis
gb|EEE70065.1|  hypothetical protein OsJ_30045                        55.5    8e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010277419.1|  PREDICTED: uncharacterized protein LOC104611866  53.1    9e-06   
gb|KDP28738.1|  hypothetical protein JCGZ_14509                       53.1    1e-05   
gb|EEC84896.1|  hypothetical protein OsI_32073                        54.7    1e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_010053887.1|  PREDICTED: uncharacterized protein LOC104442232  52.8    1e-05   
gb|KHN40134.1|  hypothetical protein glysoja_028755                   52.8    1e-05   
ref|XP_003517061.1|  PREDICTED: uncharacterized protein LOC100800538  52.8    1e-05   
ref|NP_001063700.1|  Os09g0520500                                     52.8    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006851800.1|  hypothetical protein AMTR_s00041p00014360        52.0    2e-05   
tpg|DAA40572.1|  TPA: hypothetical protein ZEAMMB73_842207            53.5    2e-05   
gb|ACG43837.1|  hypothetical protein                                  52.0    3e-05   Zea mays [maize]
ref|XP_009757506.1|  PREDICTED: uncharacterized protein LOC104210326  52.0    3e-05   
ref|XP_008343114.1|  PREDICTED: uncharacterized protein LOC103405871  51.6    4e-05   
ref|XP_007219393.1|  hypothetical protein PRUPE_ppa020346mg           51.2    4e-05   
ref|NP_001143513.1|  uncharacterized protein LOC100276196             50.8    6e-05   Zea mays [maize]
gb|KHN20467.1|  hypothetical protein glysoja_037343                   50.4    8e-05   
ref|XP_004492646.1|  PREDICTED: putative leucine-rich repeat-cont...  50.4    8e-05   
ref|XP_008232687.1|  PREDICTED: uncharacterized protein LOC103331807  50.4    8e-05   
gb|EPS64511.1|  hypothetical protein M569_10271                       49.7    9e-05   
ref|NP_001132632.1|  hypothetical protein                             50.4    9e-05   Zea mays [maize]
ref|XP_009594357.1|  PREDICTED: uncharacterized protein LOC104090865  50.4    1e-04   
gb|ACG44072.1|  hypothetical protein                                  50.1    1e-04   Zea mays [maize]
emb|CDY37042.1|  BnaA04g26200D                                        49.7    1e-04   
ref|NP_001142861.1|  uncharacterized protein LOC100275255             50.1    1e-04   Zea mays [maize]
ref|XP_007139987.1|  hypothetical protein PHAVU_008G075300g           50.1    1e-04   
ref|XP_003623732.1|  hypothetical protein MTR_7g075120                49.3    2e-04   
gb|EMS68667.1|  hypothetical protein TRIUR3_04821                     48.9    2e-04   
gb|ABA95824.1|  hypothetical protein LOC_Os12g05560                   48.9    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009351011.1|  PREDICTED: uncharacterized protein LOC103942550  49.3    2e-04   
gb|ACG31125.1|  hypothetical protein                                  48.1    3e-04   Zea mays [maize]
ref|XP_006660854.1|  PREDICTED: uncharacterized protein LOC102712750  48.9    3e-04   
ref|XP_006851488.1|  hypothetical protein AMTR_s00040p00144690        48.1    3e-04   
ref|XP_003576737.1|  PREDICTED: uncharacterized protein LOC100827005  48.5    4e-04   
gb|EMT10406.1|  hypothetical protein F775_03761                       47.8    5e-04   
emb|CDY13349.1|  BnaC06g14080D                                        47.4    7e-04   
ref|XP_008776046.1|  PREDICTED: uncharacterized protein LOC103696263  47.8    8e-04   
ref|XP_002462683.1|  hypothetical protein SORBIDRAFT_02g030180        47.8    8e-04   Sorghum bicolor [broomcorn]
ref|XP_003581196.1|  PREDICTED: uncharacterized protein LOC100822193  47.4    8e-04   
ref|NP_001235598.1|  uncharacterized protein LOC100527916             47.8    8e-04   
emb|CDY27385.1|  BnaC04g50200D                                        47.4    0.001   



>ref|XP_009761027.1| PREDICTED: uncharacterized protein LOC104213261 [Nicotiana sylvestris]
Length=109

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 61/86 (71%), Gaps = 9/86 (10%)
 Frame = -3

Query  612  WIQSHNLYISMHKQRSKRSKVQVQGLITRRRKRREEKSDGEKDMTVMILQNLKLYMENMS  433
            W +S  LYIS  KQ+ KRS++QV      RRK+ EEK  G KDM    L+NLKLYMENMS
Sbjct  8    WSKSRILYISGQKQKPKRSRIQVY-----RRKKSEEKLAG-KDME---LRNLKLYMENMS  58

Query  432  ILEENERLRKKASFLHTENLTLMYEL  355
            ILEENE+LRKKA+ LH ENL LM E 
Sbjct  59   ILEENEKLRKKANLLHQENLALMSEF  84



>emb|CDP09860.1| unnamed protein product [Coffea canephora]
Length=105

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 67/100 (67%), Gaps = 9/100 (9%)
 Frame = -3

Query  612  WIQSHNLYISMHKQRSKRSKVQVQGLITRRRKRREEKSDGEKDMTVMILQNLKLYMENMS  433
             I SHN+Y  MH ++S+R K+Q+  L TRRR R +E+   +     M+L+NLKLY+EN++
Sbjct  2    CISSHNIYTFMHNKQSRRCKIQLPRL-TRRRIRCQEEVGKD-----MVLKNLKLYIENIT  55

Query  432  ILEENERLRKKASFLHTENLTLMYELSSNRYFLAPSSTTT  313
            ILEENE+LRKKAS LH ENL LM E+       APS   +
Sbjct  56   ILEENEKLRKKASLLHQENLELMSEIQKK---FAPSDRVS  92



>ref|XP_009588361.1| PREDICTED: uncharacterized protein LOC104085944 [Nicotiana tomentosiformis]
Length=112

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 60/87 (69%), Gaps = 8/87 (9%)
 Frame = -3

Query  612  WIQSHNLYISMHK-QRSKRSKVQVQGLITRRRKRREEKSDGEKDMTVMILQNLKLYMENM  436
            W  S  +Y  M K QRSK S+VQV  L   RRKR EEK+  + +M     +NLKLYMENM
Sbjct  8    WSSSRPIYFLMQKKQRSKLSRVQVHRLT--RRKRSEEKTSEDMEM-----RNLKLYMENM  60

Query  435  SILEENERLRKKASFLHTENLTLMYEL  355
            SILEENE+LRKKAS LH ENLTLM E 
Sbjct  61   SILEENEKLRKKASLLHQENLTLMSEF  87



>ref|XP_009794963.1| PREDICTED: uncharacterized protein LOC104241727 [Nicotiana sylvestris]
Length=112

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 63/100 (63%), Gaps = 8/100 (8%)
 Frame = -3

Query  612  WIQSHNLYISMHK-QRSKRSKVQVQGLITRRRKRREEKSDGEKDMTVMILQNLKLYMENM  436
            W  S  +Y+ M K QR K S+VQV  L   RRKR EEK+  + +M     +NLKLYMENM
Sbjct  8    WSSSRPIYVLMQKKQRPKLSRVQVHRLT--RRKRSEEKAAEDMEM-----RNLKLYMENM  60

Query  435  SILEENERLRKKASFLHTENLTLMYELSSNRYFLAPSSTT  316
            SILEENE+LRKKAS LH ENL+LM +           STT
Sbjct  61   SILEENEKLRKKASLLHQENLSLMSQFQKKFSQFDTGSTT  100



>ref|XP_009623040.1| PREDICTED: uncharacterized protein LOC104114325 [Nicotiana tomentosiformis]
Length=110

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 59/80 (74%), Gaps = 9/80 (11%)
 Frame = -3

Query  594  LYISMHKQRSKRSKVQVQGLITRRRKRREEKSDGEKDMTVMILQNLKLYMENMSILEENE  415
            LYIS  KQ+ KRS++QV      RRK+ EEK+ G KDM    L+NLKLYMENMS+LEENE
Sbjct  14   LYISGQKQKPKRSRIQVH-----RRKKSEEKAAG-KDME---LRNLKLYMENMSMLEENE  64

Query  414  RLRKKASFLHTENLTLMYEL  355
            +LRKKA+ L  EN+ LM E+
Sbjct  65   KLRKKANLLRQENIALMSEI  84



>ref|XP_004245693.1| PREDICTED: uncharacterized protein LOC101259274 [Solanum lycopersicum]
Length=115

 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 58/84 (69%), Gaps = 7/84 (8%)
 Frame = -3

Query  603  SHNLYISMHK-QRSKRSKVQVQGLITRRRKRREEKSDGEKDMTVMILQNLKLYMENMSIL  427
            S  LY SM K QR K S+VQ+  L    RK+R E  + + DM    ++NLKLYMENMSIL
Sbjct  13   SRPLYFSMQKKQRPKISRVQLHRLA---RKKRGEGKETKVDME---MRNLKLYMENMSIL  66

Query  426  EENERLRKKASFLHTENLTLMYEL  355
            EENE+LRKKAS LH EN+ LM+E 
Sbjct  67   EENEKLRKKASLLHEENIALMFEF  90



>ref|XP_006363714.1| PREDICTED: uncharacterized protein LOC102602347 [Solanum tuberosum]
Length=115

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 57/84 (68%), Gaps = 7/84 (8%)
 Frame = -3

Query  603  SHNLYISMHK-QRSKRSKVQVQGLITRRRKRREEKSDGEKDMTVMILQNLKLYMENMSIL  427
            S  LY SM K QR K S+VQ+  L  R+R      S+G++    M ++NLKLYMENMSIL
Sbjct  13   SRPLYFSMQKKQRPKISRVQLHRLARRKR------SEGKETKVDMEMRNLKLYMENMSIL  66

Query  426  EENERLRKKASFLHTENLTLMYEL  355
            +ENE+LRKKAS LH EN+ LM E 
Sbjct  67   QENEKLRKKASLLHEENIALMTEF  90



>ref|XP_010108098.1| hypothetical protein L484_023184 [Morus notabilis]
 gb|EXC17830.1| hypothetical protein L484_023184 [Morus notabilis]
Length=107

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 5/78 (6%)
 Frame = -3

Query  588  ISMHKQRSKRSKVQVQGLITRRRKRREEKSDGEKDMTVMILQNLKLYMENMSILEENERL  409
            I ++ +RSKRSK+QVQ LITRRR    E+  G  DM +M   NLKLY+EN +I+EENE+L
Sbjct  14   IFLYSRRSKRSKLQVQRLITRRRC--SEEKVGSTDMELM---NLKLYLENKTIIEENEKL  68

Query  408  RKKASFLHTENLTLMYEL  355
            RK A+ LH ENL+L+ +L
Sbjct  69   RKTANLLHQENLSLLSKL  86



>ref|XP_002303541.2| hypothetical protein POPTR_0003s11710g [Populus trichocarpa]
 gb|EEE78520.2| hypothetical protein POPTR_0003s11710g [Populus trichocarpa]
Length=106

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 55/80 (69%), Gaps = 6/80 (8%)
 Frame = -3

Query  594  LYISMHKQRSKRSKVQVQGLITRRRKRREEKSDGEKDMTVMILQNLKLYMENMSILEENE  415
             + S  +QRSK+ KVQV GL  RR    E +   EK+M    L+NLKLY+EN SI+EENE
Sbjct  13   FHPSKRRQRSKKCKVQVIGLTCRRSGYEEWE---EKNME---LKNLKLYLENQSIVEENE  66

Query  414  RLRKKASFLHTENLTLMYEL  355
            +LRKKAS LH ENL LM EL
Sbjct  67   KLRKKASLLHQENLALMSEL  86



>ref|XP_011033863.1| PREDICTED: uncharacterized protein LOC105132212 [Populus euphratica]
Length=106

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 55/82 (67%), Gaps = 10/82 (12%)
 Frame = -3

Query  594  LYISMHKQRSKRSKVQVQGLITRRR--KRREEKSDGEKDMTVMILQNLKLYMENMSILEE  421
             + S  +QRSK+ KVQV GL  RR   +  EEK+        M L+NLKLY+EN SI+EE
Sbjct  13   FHPSKRRQRSKKCKVQVIGLTCRRSGYEGWEEKN--------MELKNLKLYLENQSIVEE  64

Query  420  NERLRKKASFLHTENLTLMYEL  355
            NE+LRKKAS LH ENL LM EL
Sbjct  65   NEKLRKKASLLHQENLALMSEL  86



>ref|XP_011070028.1| PREDICTED: uncharacterized protein LOC105155776 isoform X1 [Sesamum 
indicum]
Length=144

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 53/84 (63%), Gaps = 4/84 (5%)
 Frame = -3

Query  606  QSHNLYISMHKQRSKRSKVQVQGLITRRRKRREEKSDGEKDMTVMILQNLKLYMENMSIL  427
            Q+H L+    K +  R +V       RRRK R    D EK  T M LQNLKLYMEN+SIL
Sbjct  34   QAHKLHFFPRKPKRIRVRVLSLSGYDRRRKPR----DVEKAGTDMELQNLKLYMENISIL  89

Query  426  EENERLRKKASFLHTENLTLMYEL  355
            EENE+LRKKA  LH ENL+LM E 
Sbjct  90   EENEKLRKKACLLHQENLSLMSEF  113



>ref|XP_010661675.1| PREDICTED: uncharacterized protein LOC100241009 isoform X1 [Vitis 
vinifera]
Length=100

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 57/88 (65%), Gaps = 14/88 (16%)
 Frame = -3

Query  612  WIQSHNLYISMHKQRSKRSKVQVQGLITRRRKRREEKSDGEKDMTVMILQNLKLYMENMS  433
            WI S        + R+KRSKVQV  L +RRR+    +   EKDM    L+NLKLY+EN +
Sbjct  8    WIPS--------RPRTKRSKVQVHRLTSRRRR---CEVQVEKDME---LKNLKLYLENRN  53

Query  432  ILEENERLRKKASFLHTENLTLMYELSS  349
            I+EENE+LRKKA+ LH ENL LM E  +
Sbjct  54   IMEENEKLRKKATLLHQENLALMSEFQT  81



>ref|XP_002281385.1| PREDICTED: uncharacterized protein LOC100241009 isoform X2 [Vitis 
vinifera]
 emb|CBI34806.3| unnamed protein product [Vitis vinifera]
Length=99

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 55/88 (63%), Gaps = 15/88 (17%)
 Frame = -3

Query  612  WIQSHNLYISMHKQRSKRSKVQVQGLITRRRKRREEKSDGEKDMTVMILQNLKLYMENMS  433
            WI S        + R+KRSKVQV  L  RRR     +   EKDM    L+NLKLY+EN +
Sbjct  8    WIPS--------RPRTKRSKVQVHRLTRRRRC----EVQVEKDME---LKNLKLYLENRN  52

Query  432  ILEENERLRKKASFLHTENLTLMYELSS  349
            I+EENE+LRKKA+ LH ENL LM E  +
Sbjct  53   IMEENEKLRKKATLLHQENLALMSEFQT  80



>ref|XP_011070045.1| PREDICTED: uncharacterized protein LOC105155776 isoform X3 [Sesamum 
indicum]
Length=140

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 55/84 (65%), Gaps = 8/84 (10%)
 Frame = -3

Query  606  QSHNLYISMHKQRSKRSKVQVQGLITRRRKRREEKSDGEKDMTVMILQNLKLYMENMSIL  427
            Q+H L+     ++ KR +V+V  L  R+ +      D EK  T M LQNLKLYMEN+SIL
Sbjct  34   QAHKLHF--FPRKPKRIRVRVLSLSGRKPR------DVEKAGTDMELQNLKLYMENISIL  85

Query  426  EENERLRKKASFLHTENLTLMYEL  355
            EENE+LRKKA  LH ENL+LM E 
Sbjct  86   EENEKLRKKACLLHQENLSLMSEF  109



>ref|XP_011070037.1| PREDICTED: uncharacterized protein LOC105155776 isoform X2 [Sesamum 
indicum]
Length=143

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 56/85 (66%), Gaps = 7/85 (8%)
 Frame = -3

Query  606  QSHNLYISMHKQRSKRSKVQVQGLIT-RRRKRREEKSDGEKDMTVMILQNLKLYMENMSI  430
            Q+H L+     ++ KR +V+V  L    RRK R    D EK  T M LQNLKLYMEN+SI
Sbjct  34   QAHKLHF--FPRKPKRIRVRVLSLSGYDRRKPR----DVEKAGTDMELQNLKLYMENISI  87

Query  429  LEENERLRKKASFLHTENLTLMYEL  355
            LEENE+LRKKA  LH ENL+LM E 
Sbjct  88   LEENEKLRKKACLLHQENLSLMSEF  112



>gb|KDO63715.1| hypothetical protein CISIN_1g044622mg [Citrus sinensis]
Length=87

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 52/79 (66%), Gaps = 9/79 (11%)
 Frame = -3

Query  591  YISMHKQRSKRSKVQVQGLITRRRKRREEKSDGEKDMTVMILQNLKLYMENMSILEENER  412
            Y S  K RSK  KVQ+ GL TRRR   EE  D       M L+N+KLY+EN SI+EENE+
Sbjct  12   YASKSKHRSK-PKVQIYGL-TRRRCEAEEGRD-------MQLKNIKLYLENQSIIEENEK  62

Query  411  LRKKASFLHTENLTLMYEL  355
            LRK+A+ LH ENL LM E 
Sbjct  63   LRKQANLLHQENLALMSEF  81



>ref|XP_006440446.1| hypothetical protein CICLE_v10023705mg, partial [Citrus clementina]
 gb|ESR53686.1| hypothetical protein CICLE_v10023705mg, partial [Citrus clementina]
Length=115

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 52/79 (66%), Gaps = 9/79 (11%)
 Frame = -3

Query  591  YISMHKQRSKRSKVQVQGLITRRRKRREEKSDGEKDMTVMILQNLKLYMENMSILEENER  412
            Y S  K RSK  KVQ+ GL TRRR   EE  D       M L+N+KLY+EN SI+EENE+
Sbjct  40   YASKSKHRSK-PKVQIYGL-TRRRCEAEEGRD-------MQLKNIKLYLENQSIIEENEK  90

Query  411  LRKKASFLHTENLTLMYEL  355
            LRK+A+ LH ENL LM E 
Sbjct  91   LRKQANLLHQENLALMSEF  109



>ref|XP_006477317.1| PREDICTED: uncharacterized protein LOC102616014 [Citrus sinensis]
Length=122

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 52/79 (66%), Gaps = 9/79 (11%)
 Frame = -3

Query  591  YISMHKQRSKRSKVQVQGLITRRRKRREEKSDGEKDMTVMILQNLKLYMENMSILEENER  412
            Y S  K RSK  KVQ+ GL TRRR   EE  D       M L+N+KLY+EN SI+EENE+
Sbjct  47   YASKRKHRSK-PKVQIYGL-TRRRCEAEEGRD-------MQLKNIKLYLENQSIIEENEK  97

Query  411  LRKKASFLHTENLTLMYEL  355
            LRK+A+ LH ENL LM E 
Sbjct  98   LRKQANLLHQENLALMSEF  116



>ref|XP_006358368.1| PREDICTED: uncharacterized protein LOC102579247 [Solanum tuberosum]
Length=111

 Score = 69.7 bits (169),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 60/102 (59%), Gaps = 5/102 (5%)
 Frame = -3

Query  612  WIQSHNLYISMHKQRSKRSKVQVQGLITRRRKRREEKSDGEKDMTVMILQNLKLYMENMS  433
            W  S   Y S  KQ+ K+SKVQV  L  R  KR EEK+   K+M    L+NLKLYMENMS
Sbjct  8    WSASRIHYFSGKKQKPKKSKVQVHRLAWR--KRSEEKAAAGKNME---LKNLKLYMENMS  62

Query  432  ILEENERLRKKASFLHTENLTLMYELSSNRYFLAPSSTTTQV  307
            ILEENE LRKKA+ LH ENL L  E       L   S T  V
Sbjct  63   ILEENENLRKKANLLHQENLALYSEFEKKVSHLDRVSATLNV  104



>gb|KDP25574.1| hypothetical protein JCGZ_20730 [Jatropha curcas]
Length=112

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 53/74 (72%), Gaps = 4/74 (5%)
 Frame = -3

Query  576  KQRSKRSKVQVQGLITRRRKRREEKSDGEKDMTVMILQNLKLYMENMSILEENERLRKKA  397
            KQR K+ K+QV GL TR   RR ++ +  KDM    L+NLKLY+EN SI+EENE+LRKKA
Sbjct  21   KQRLKKPKLQVLGL-TRIMNRRCQEEELGKDME---LKNLKLYLENQSIVEENEKLRKKA  76

Query  396  SFLHTENLTLMYEL  355
            +FL  ENL L+ + 
Sbjct  77   NFLLQENLALISQF  90



>ref|XP_007040023.1| Uncharacterized protein TCM_016107 [Theobroma cacao]
 gb|EOY24524.1| Uncharacterized protein TCM_016107 [Theobroma cacao]
Length=178

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 53/77 (69%), Gaps = 8/77 (10%)
 Frame = -3

Query  585  SMHKQRSKRSKVQVQGLITRRRKRREEKSDGEKDMTVMILQNLKLYMENMSILEENERLR  406
            S  + RSK+SKVQ+  L    RKR EE  + EKDM  +   NLKLY+EN SI+EENE+LR
Sbjct  89   SKRRHRSKQSKVQIYRL---SRKRCEE--NVEKDMERL---NLKLYLENQSIIEENEKLR  140

Query  405  KKASFLHTENLTLMYEL  355
            KKA+ LH ENL LM + 
Sbjct  141  KKANLLHQENLALMSDF  157



>ref|XP_002509639.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51026.1| conserved hypothetical protein [Ricinus communis]
Length=108

 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 46/66 (70%), Gaps = 8/66 (12%)
 Frame = -3

Query  552  VQVQGLITRRRKRREEKSDGEKDMTVMILQNLKLYMENMSILEENERLRKKASFLHTENL  373
            VQV GL TRRR + EE  D       M L+NLKLY+EN SI+EENE+LRKKA+ LH ENL
Sbjct  28   VQVLGL-TRRRCQEEEGKD-------MELKNLKLYLENQSIVEENEKLRKKANLLHQENL  79

Query  372  TLMYEL  355
             L+ E 
Sbjct  80   ALISEF  85



>ref|XP_006368732.1| hypothetical protein POPTR_0001s08220g [Populus trichocarpa]
 gb|ERP65301.1| hypothetical protein POPTR_0001s08220g [Populus trichocarpa]
Length=109

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 56/93 (60%), Gaps = 6/93 (6%)
 Frame = -3

Query  594  LYISMHKQRSKRSKVQVQGLITRRRKRREEKSDGEKDMTVMILQNLKLYMENMSILEENE  415
             + S  +QRSK+ KVQV GL  RR     E+ +G KDM    L+NLKL +EN  I+EENE
Sbjct  13   FHPSKRRQRSKKCKVQVIGLTCRRSGY--EEMEG-KDME---LKNLKLCLENQRIVEENE  66

Query  414  RLRKKASFLHTENLTLMYELSSNRYFLAPSSTT  316
            +LRKKA+ L  ENL LM E       L   STT
Sbjct  67   KLRKKANLLRQENLALMSEFQKKFPHLDRLSTT  99



>ref|XP_008437719.1| PREDICTED: uncharacterized protein LOC103483063 [Cucumis melo]
Length=96

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 54/82 (66%), Gaps = 8/82 (10%)
 Frame = -3

Query  600  HNLYISMHKQRSKRSKVQVQGLITRRRKRREEKSDGEKDMTVMILQNLKLYMENMSILEE  421
            H +  S +K+ SKRSK QV  L    R+R EEK   E +     L+NL+LY+EN +I+EE
Sbjct  12   HTIQSSKNKRSSKRSKFQVLRLT---RRRCEEKLGKEIE-----LKNLQLYLENQTIIEE  63

Query  420  NERLRKKASFLHTENLTLMYEL  355
            NE+LR+KA+ LH ENL L+ E 
Sbjct  64   NEKLREKANILHQENLALLTEF  85



>gb|EYU40547.1| hypothetical protein MIMGU_mgv1a017079mg [Erythranthe guttata]
Length=94

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 58/88 (66%), Gaps = 9/88 (10%)
 Frame = -3

Query  612  WIQSHNLYISMHKQRSKRSKVQVQGLITRRRKRREEK--SDGEKDMTVMILQNLKLYMEN  439
            W+Q H  + S  K    R++V++  L   RRK+REE   ++  K+M    L+N+KLYMEN
Sbjct  9    WMQVHKPHFSTRK--PTRTRVRILRLA--RRKQREEGIINNNGKEME---LKNMKLYMEN  61

Query  438  MSILEENERLRKKASFLHTENLTLMYEL  355
            + IL+ENE+LRKKA+ LH ENL L+ + 
Sbjct  62   IIILQENEKLRKKANLLHQENLALISQF  89



>ref|XP_011017507.1| PREDICTED: uncharacterized protein LOC105120821 [Populus euphratica]
Length=113

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 41/61 (67%), Gaps = 5/61 (8%)
 Frame = -3

Query  522  RKRREEKSDGEKDMTVMI-----LQNLKLYMENMSILEENERLRKKASFLHTENLTLMYE  358
            RKRR  K   EK M V++     ++NLKLYMEN SI+EENE+LRKKA  LH EN  L Y 
Sbjct  37   RKRRLTKQTKEKKMAVLVKKEMEIKNLKLYMENKSIIEENEKLRKKALLLHQENQALFYL  96

Query  357  L  355
            L
Sbjct  97   L  97



>ref|XP_002302541.2| hypothetical protein POPTR_0002s15060g [Populus trichocarpa]
 gb|EEE81814.2| hypothetical protein POPTR_0002s15060g [Populus trichocarpa]
Length=113

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 49/77 (64%), Gaps = 10/77 (13%)
 Frame = -3

Query  522  RKRREEKSDGEKDMTVMI-----LQNLKLYMENMSILEENERLRKKASFLHTENLTLMYE  358
            RKRR  K   EK M V++     ++NLKLYMEN SI+EENE+LRKKA  LH EN  L Y 
Sbjct  37   RKRRLTKQTKEKKMAVLVKKEMEIKNLKLYMENKSIIEENEKLRKKALLLHQENQALSYL  96

Query  357  L---SSNRY--FLAPSS  322
            L   SSN     LAP++
Sbjct  97   LQKKSSNTLHDHLAPNN  113



>ref|XP_004133904.1| PREDICTED: uncharacterized protein LOC101211719 [Cucumis sativus]
 gb|KGN56585.1| hypothetical protein Csa_3G125520 [Cucumis sativus]
Length=115

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = -3

Query  534  ITRRRKRREEKSDGEKDMTVMILQNLKLYMENMSILEENERLRKKASFLHTENLTLMYEL  355
            + RR +  +E+++       M ++NLKLYMEN SI+EENERLRKKA  LH EN  L+ +L
Sbjct  29   LLRRMRFAKEEANSAGVKVEMEIKNLKLYMENQSIIEENERLRKKAFLLHKENQVLLSQL  88

Query  354  SSNRYFLAP-SSTTTQVCN  301
             +  ++  P SS+    C+
Sbjct  89   QNFSHYKPPHSSSDLSACS  107



>ref|XP_004166247.1| PREDICTED: uncharacterized LOC101211719 [Cucumis sativus]
Length=115

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = -3

Query  534  ITRRRKRREEKSDGEKDMTVMILQNLKLYMENMSILEENERLRKKASFLHTENLTLMYEL  355
            + RR +  +E+++       M ++NLKLYMEN SI+EENERLRKKA  LH EN  L+ +L
Sbjct  29   LLRRMRFAKEEANSAGVKVEMEIKNLKLYMENQSIIEENERLRKKAFLLHKENQVLLSQL  88

Query  354  SSNRYFLAP-SSTTTQVCN  301
             +  ++  P SS+    C+
Sbjct  89   QNFSHYKPPHSSSDLSACS  107



>gb|KGN50180.1| hypothetical protein Csa_5G157390 [Cucumis sativus]
Length=96

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 54/82 (66%), Gaps = 8/82 (10%)
 Frame = -3

Query  600  HNLYISMHKQRSKRSKVQVQGLITRRRKRREEKSDGEKDMTVMILQNLKLYMENMSILEE  421
            H +  S +++ SKRS  QV  L    R+R EEK    KD+    L+NL+LY+EN +I+EE
Sbjct  12   HTIQSSKNRRSSKRSNFQVLRLT---RRRCEEKLG--KDIE---LKNLQLYLENQTIIEE  63

Query  420  NERLRKKASFLHTENLTLMYEL  355
            NE+LR+KA+ LH ENL L+ E 
Sbjct  64   NEKLREKANILHQENLALLTEF  85



>ref|XP_010540163.1| PREDICTED: uncharacterized protein LOC104814010 [Tarenaya hassleriana]
Length=114

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 51/86 (59%), Gaps = 8/86 (9%)
 Frame = -3

Query  612  WIQSHNLYISMHKQRSKRSKVQVQGLITRRRKRREEKSDGEKDMTVMILQNLKLYMENMS  433
            +  +H  +    K R KR ++QV  L  RR          EK++  M L+NLKLY++N  
Sbjct  8    YTPTHPTFACNGKSRLKRPRLQVYRLSRRR--------CAEKEVEDMELKNLKLYLKNKG  59

Query  432  ILEENERLRKKASFLHTENLTLMYEL  355
            I+EEN +LRK+A+ L+ ENL LM E+
Sbjct  60   IMEENAKLRKRANLLYLENLGLMSEM  85



>ref|XP_007134903.1| hypothetical protein PHAVU_010G085600g [Phaseolus vulgaris]
 gb|ESW06897.1| hypothetical protein PHAVU_010G085600g [Phaseolus vulgaris]
Length=108

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 56/84 (67%), Gaps = 14/84 (17%)
 Frame = -3

Query  600  HNLYISMHKQRSKRSKVQVQGLITRRRKRREEKSDGEKDMTVMILQNLKLYMENMSILEE  421
            H+L +S+HK+R    + QV+    RRRK+   K +       M ++NLKLYM+N SI+EE
Sbjct  28   HHLRLSLHKRR----RAQVE---ERRRKKMILKKE-------MKMRNLKLYMKNQSIIEE  73

Query  420  NERLRKKASFLHTENLTLMYELSS  349
            NE+LRK+A  LH EN TL++EL +
Sbjct  74   NEKLRKQALLLHKENETLLFELQN  97



>ref|XP_008438145.1| PREDICTED: uncharacterized protein LOC103483340 [Cucumis melo]
Length=116

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = -3

Query  534  ITRRRKRREEKSDGEKDMTVMILQNLKLYMENMSILEENERLRKKASFLHTENLTLMYEL  355
            + RR +   E+++       M ++NLKLYMEN SI+EENERLRKKA  LH EN  L+ +L
Sbjct  30   LLRRMRFATEEANSAGVKVEMEIKNLKLYMENQSIIEENERLRKKAFLLHKENQVLLSQL  89

Query  354  SSNRYFLAPSSTT  316
             +   +  P S++
Sbjct  90   QNFSDYKPPQSSS  102



>ref|XP_002320732.1| hypothetical protein POPTR_0014s06690g [Populus trichocarpa]
 gb|EEE99047.1| hypothetical protein POPTR_0014s06690g [Populus trichocarpa]
Length=112

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 5/58 (9%)
 Frame = -3

Query  501  SDGEKDMTVMI-----LQNLKLYMENMSILEENERLRKKASFLHTENLTLMYELSSNR  343
            S G++   V++     ++NLKLYMEN SI+EENE+LRKKA  LH EN  L+Y+L   R
Sbjct  42   SKGKRVALVLVKKEMEIKNLKLYMENKSIIEENEKLRKKAFLLHQENQALLYQLQKKR  99



>ref|NP_001236921.1| uncharacterized protein LOC100305804 [Glycine max]
 gb|ACU13670.1| unknown [Glycine max]
 gb|KHM98874.1| hypothetical protein glysoja_040095 [Glycine soja]
Length=116

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 53/88 (60%), Gaps = 20/88 (23%)
 Frame = -3

Query  606  QSHNLYISMHKQRSKRSKVQVQGLITRRRKRREEKSDGEKDMTVMI----LQNLKLYMEN  439
            Q  +L  S+HK+R    + Q+Q    RRRKR          M ++     ++NLKLYMEN
Sbjct  27   QPQHLRFSLHKRR----RAQLQE--ARRRKR----------MIILKTEIKMRNLKLYMEN  70

Query  438  MSILEENERLRKKASFLHTENLTLMYEL  355
             SI+EENE+LRK+A  LH EN  L+++L
Sbjct  71   QSIIEENEKLRKQAVLLHKENEALLFQL  98



>ref|XP_004306906.1| PREDICTED: uncharacterized protein LOC101314600 isoform 1 [Fragaria 
vesca subsp. vesca]
Length=106

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 56/101 (55%), Gaps = 6/101 (6%)
 Frame = -3

Query  609  IQSHNLYISMHKQRS-KRSKVQVQGLITRRRKRREEKSDGEKDMTVMILQNLKLYMENMS  433
            IQ+  LY S H +RS K    +V  LI RRR   +E  + E     M ++NLKLYMEN S
Sbjct  9    IQNSPLYSSFHLRRSSKHHSFRVHRLINRRRSITKEAKEKE-----MEIKNLKLYMENKS  63

Query  432  ILEENERLRKKASFLHTENLTLMYELSSNRYFLAPSSTTTQ  310
            ++EEN +LR+KA  L  EN  L  +L       A S+T  Q
Sbjct  64   LIEENNKLRRKALLLVQENQALFSQLQQKFPDHACSATMKQ  104



>ref|XP_010276171.1| PREDICTED: uncharacterized protein LOC104610982 [Nelumbo nucifera]
Length=110

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  480  TVMILQNLKLYMENMSILEENERLRKKASFLHTENLTLMYEL  355
            T M L+NLKLY+EN SI+EENE+LRKKA  LH EN  LM EL
Sbjct  47   TEMELKNLKLYLENQSIIEENEKLRKKAILLHQENRELMIEL  88



>gb|KCW72048.1| hypothetical protein EUGRSUZ_E00491 [Eucalyptus grandis]
Length=106

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 34/46 (74%), Gaps = 3/46 (7%)
 Frame = -3

Query  492  EKDMTVMILQNLKLYMENMSILEENERLRKKASFLHTENLTLMYEL  355
            EKDM    LQN KLY EN +I+EENE+LRKKA+ LH ENL L+ E 
Sbjct  43   EKDME---LQNWKLYFENRTIIEENEKLRKKANLLHQENLALLLEF  85



>gb|KCW72049.1| hypothetical protein EUGRSUZ_E00491 [Eucalyptus grandis]
Length=103

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 34/46 (74%), Gaps = 3/46 (7%)
 Frame = -3

Query  492  EKDMTVMILQNLKLYMENMSILEENERLRKKASFLHTENLTLMYEL  355
            EKDM    LQN KLY EN +I+EENE+LRKKA+ LH ENL L+ E 
Sbjct  40   EKDME---LQNWKLYFENRTIIEENEKLRKKANLLHQENLALLLEF  82



>ref|XP_007052025.1| Homeobox-leucine zipper protein HOX9, putative [Theobroma cacao]
 gb|EOX96182.1| Homeobox-leucine zipper protein HOX9, putative [Theobroma cacao]
Length=106

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 37/55 (67%), Gaps = 5/55 (9%)
 Frame = -3

Query  504  KSDGEKDMTV-----MILQNLKLYMENMSILEENERLRKKASFLHTENLTLMYEL  355
            K  G K + V     M ++NLKLYM+N  I+EENERLRKKA  LH EN TL+ +L
Sbjct  41   KGAGTKKVVVGVQTDMQMKNLKLYMQNQIIIEENERLRKKAILLHQENQTLLAQL  95



>ref|XP_009379274.1| PREDICTED: uncharacterized protein LOC103967705 [Pyrus x bretschneideri]
Length=112

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 57/105 (54%), Gaps = 8/105 (8%)
 Frame = -3

Query  603  SHNLYISMHKQR-SKRSKVQVQGLITRRRKRREEKSDGEKDMTV-----MILQNLKLYME  442
            S  LY S   +R SK+   +V+ LI R  KR+      ++  T      M ++NLKLYME
Sbjct  10   SSPLYSSFRLRRPSKQHSFRVRRLINRNWKRKPAGPAAKEGETGGAKVEMEMKNLKLYME  69

Query  441  NMSILEENERLRKKASFLHTENLTLMYELSSNRYFLAPSSTTTQV  307
            N SI+EEN +LR+KA  L  EN  L  +L   + FL  + TT  V
Sbjct  70   NQSIIEENNKLRRKALLLVQENQALFSQLQQKQLFL--NKTTAAV  112



>ref|XP_010092855.1| hypothetical protein L484_022450 [Morus notabilis]
 gb|EXB52673.1| hypothetical protein L484_022450 [Morus notabilis]
Length=129

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 53/88 (60%), Gaps = 4/88 (5%)
 Frame = -3

Query  609  IQSHNLYISMHKQR-SKRSKVQVQGLITRRRKRREEKSDGEKDMTV--MILQNLKLYMEN  439
            +     Y S  ++R SKR  ++V GL  R RK ++    G+   T   M + NLKLYMEN
Sbjct  9    LPGKTFYSSFRRRRLSKRYNLRVHGL-NRLRKLKKGADYGKIVGTKVEMEINNLKLYMEN  67

Query  438  MSILEENERLRKKASFLHTENLTLMYEL  355
             SI+EEN++LRKKA  LH EN  L+ +L
Sbjct  68   QSIMEENQKLRKKALLLHQENQALLSQL  95



>ref|XP_003534604.1| PREDICTED: uncharacterized protein LOC100788403 [Glycine max]
 gb|KHN29439.1| hypothetical protein glysoja_005163 [Glycine soja]
Length=111

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 44/65 (68%), Gaps = 3/65 (5%)
 Frame = -3

Query  540  GLITRRRKRREEKSDGEKDMTV---MILQNLKLYMENMSILEENERLRKKASFLHTENLT  370
            G++ RRR   +E    ++ + V   + ++NLKLYMEN +I+EENE+LRK+A  LH EN  
Sbjct  33   GMLNRRRAHLKEARQRKRIVVVKSEIQMKNLKLYMENQTIIEENEKLRKQAMLLHKENQA  92

Query  369  LMYEL  355
            L+ +L
Sbjct  93   LLSQL  97



>ref|XP_008375831.1| PREDICTED: uncharacterized protein LOC103439061 [Malus domestica]
 ref|XP_008364801.1| PREDICTED: uncharacterized protein LOC103428478 [Malus domestica]
Length=115

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 49/91 (54%), Gaps = 5/91 (5%)
 Frame = -3

Query  567  SKRSKVQVQGLITRRRKRRE-----EKSDGEKDMTVMILQNLKLYMENMSILEENERLRK  403
            SK++  +V+ LI R RK R      E   G      M ++NLKLYMEN SI+EEN +LR+
Sbjct  23   SKQNHFRVRRLINRNRKGRPGAAATEAETGGGAKIEMQMKNLKLYMENQSIIEENNKLRR  82

Query  402  KASFLHTENLTLMYELSSNRYFLAPSSTTTQ  310
            KA  L  EN  L  +L   +  L  ++   Q
Sbjct  83   KALLLVQENQALFSQLQQKQLSLTKTTAAVQ  113



>ref|XP_002511736.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50405.1| conserved hypothetical protein [Ricinus communis]
Length=120

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 42/55 (76%), Gaps = 5/55 (9%)
 Frame = -3

Query  513  REEKSDG--EKDMTVMILQNLKLYMENMSILEENERLRKKASFLHTENLTLMYEL  355
            +E+K +G  +K+M +   +NLKLYM+N SI+EENE+LRKKA FL+ EN  L+ +L
Sbjct  49   KEKKKEGILKKEMEI---KNLKLYMKNKSIIEENEKLRKKAYFLNQENQALLIQL  100



>gb|EEE70065.1| hypothetical protein OsJ_30045 [Oryza sativa Japonica Group]
Length=239

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -3

Query  486  DMTVMILQNLKLYMENMSILEENERLRKKASFLHTENLTLMYEL  355
            D   M + NLKLY+EN  ILEENERLR+KAS LH ENL L  +L
Sbjct  180  DGMEMEMVNLKLYLENRCILEENERLREKASALHRENLALRADL  223



>ref|XP_010277419.1| PREDICTED: uncharacterized protein LOC104611866 [Nelumbo nucifera]
Length=114

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  480  TVMILQNLKLYMENMSILEENERLRKKASFLHTENLTLMYEL  355
            T M L+NL+LY+EN SI+EENE+LR+KA  LH EN  LM EL
Sbjct  49   TEMELKNLRLYLENRSIIEENEKLRQKALLLHQENRALMCEL  90



>gb|KDP28738.1| hypothetical protein JCGZ_14509 [Jatropha curcas]
Length=108

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 38/56 (68%), Gaps = 4/56 (7%)
 Frame = -3

Query  504  KSDGEKDMTV----MILQNLKLYMENMSILEENERLRKKASFLHTENLTLMYELSS  349
            K   E  M V    M ++NLKLYM+N SI+EENE+LRKKA  LH EN  L+++L +
Sbjct  45   KQAKENKMAVAKKEMEIKNLKLYMKNKSIIEENEKLRKKALLLHQENQALLFQLQT  100



>gb|EEC84896.1| hypothetical protein OsI_32073 [Oryza sativa Indica Group]
Length=221

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -3

Query  486  DMTVMILQNLKLYMENMSILEENERLRKKASFLHTENLTLMYEL  355
            D   M + NLKLY+EN  ILEENERLR+KAS LH ENL L  +L
Sbjct  162  DGMEMEMVNLKLYLENRCILEENERLREKASALHRENLALRADL  205



>ref|XP_010053887.1| PREDICTED: uncharacterized protein LOC104442232 [Eucalyptus grandis]
Length=100

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = -3

Query  474  MILQNLKLYMENMSILEENERLRKKASFLHTENLTLMYELSSNRYFLAPSS  322
            M ++NL+LY+EN SI+E NERLR++A FLH EN  L+ +L S   F  P+S
Sbjct  52   MEMKNLRLYVENRSIMEANERLRQRALFLHRENRALLVQLQSK--FTRPTS  100



>gb|KHN40134.1| hypothetical protein glysoja_028755 [Glycine soja]
Length=112

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 50/76 (66%), Gaps = 5/76 (7%)
 Frame = -3

Query  567  SKRSKVQVQGLITRRRKRREEKSDGEKDMTVMIL-----QNLKLYMENMSILEENERLRK  403
            SKR    ++  I +RR+ + +++   K M ++ L     +NLKLYMEN SI+EEN++LRK
Sbjct  24   SKRQHQHLRLNIHKRRRAQLQEARRRKRMIILKLTEIKMRNLKLYMENQSIIEENQKLRK  83

Query  402  KASFLHTENLTLMYEL  355
            +A  LH EN  L+++L
Sbjct  84   QAMLLHKENDVLLFQL  99



>ref|XP_003517061.1| PREDICTED: uncharacterized protein LOC100800538 [Glycine max]
Length=112

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 50/76 (66%), Gaps = 5/76 (7%)
 Frame = -3

Query  567  SKRSKVQVQGLITRRRKRREEKSDGEKDMTVMIL-----QNLKLYMENMSILEENERLRK  403
            SKR    ++  I +RR+ + +++   K M ++ L     +NLKLYMEN SI+EEN++LRK
Sbjct  24   SKRQHQHLRLNIHKRRRAQLQEARRRKRMIILKLTEIKMRNLKLYMENQSIIEENQKLRK  83

Query  402  KASFLHTENLTLMYEL  355
            +A  LH EN  L+++L
Sbjct  84   QAMLLHKENDVLLFQL  99



>ref|NP_001063700.1| Os09g0520500 [Oryza sativa Japonica Group]
 dbj|BAD46675.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF25614.1| Os09g0520500 [Oryza sativa Japonica Group]
 dbj|BAG98232.1| unnamed protein product [Oryza sativa Japonica Group]
Length=116

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 4/49 (8%)
 Frame = -3

Query  501  SDGEKDMTVMILQNLKLYMENMSILEENERLRKKASFLHTENLTLMYEL  355
            SDG +    M + NLKLY+EN  ILEENERLR+KAS LH ENL L  +L
Sbjct  56   SDGME----MEMVNLKLYLENRCILEENERLREKASALHRENLALRADL  100



>ref|XP_006851800.1| hypothetical protein AMTR_s00041p00014360 [Amborella trichopoda]
 gb|ERN13267.1| hypothetical protein AMTR_s00041p00014360 [Amborella trichopoda]
Length=94

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 50/85 (59%), Gaps = 12/85 (14%)
 Frame = -3

Query  606  QSHNLYISMHKQRSKRSKVQVQGLITRRRKRREEKSDGEKDMTVMILQNLKLYMENMSIL  427
               +L  S  K R K+ KV++  LI   R+R EE S+ E       + NL+LY++N  I+
Sbjct  9    PPSSLNPSFAKLRIKKPKVRI--LI---RRRFEEASEME-------ISNLELYLQNWCII  56

Query  426  EENERLRKKASFLHTENLTLMYELS  352
            EENERLRKKA  L  EN  L+ EL+
Sbjct  57   EENERLRKKALVLDQENRALLSELN  81



>tpg|DAA40572.1| TPA: hypothetical protein ZEAMMB73_842207 [Zea mays]
Length=178

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 2/50 (4%)
 Frame = -3

Query  498  DGEKDMTVMILQNLKLYMENMSILEENERLRKKASFLHTENLTLMYELSS  349
            DG  +   M+  NLKLY+EN  I+ ENERLR++AS L  ENL L+  LSS
Sbjct  118  DGGAEAMEMV--NLKLYLENRCIIAENERLRERASALRRENLALLQNLSS  165



>gb|ACG43837.1| hypothetical protein [Zea mays]
Length=108

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 2/50 (4%)
 Frame = -3

Query  498  DGEKDMTVMILQNLKLYMENMSILEENERLRKKASFLHTENLTLMYELSS  349
            DG  +   M+  NLKLY+EN  I+ ENERLR++AS L  ENL L+  LSS
Sbjct  48   DGGAEAMEMV--NLKLYLENRCIIAENERLRERASALRRENLALLQNLSS  95



>ref|XP_009757506.1| PREDICTED: uncharacterized protein LOC104210326 [Nicotiana sylvestris]
Length=110

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 53/95 (56%), Gaps = 6/95 (6%)
 Frame = -3

Query  597  NLYISMH-KQRSKRSKVQVQGL---ITRRRKRREEKSDGEKDMTVMILQNLKLYMENMSI  430
            + Y   H  Q SK +K+ V  L     R  K  +E++   K    M ++NLKLY EN +I
Sbjct  16   SCYTDFHSPQLSKTAKIHVLKLRRNGGRLSKEAKERTRLRKLKKAMKMKNLKLYKENKTI  75

Query  429  LEENERLRKKASFLHTENLTLMYELSSNRYFLAPS  325
            +EENERLRKKA  LH EN  L  +L   + F +P+
Sbjct  76   IEENERLRKKALLLHQENKALFSKL--QQVFQSPN  108



>ref|XP_008343114.1| PREDICTED: uncharacterized protein LOC103405871 [Malus domestica]
Length=112

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 53/94 (56%), Gaps = 11/94 (12%)
 Frame = -3

Query  567  SKRSKVQVQGLITRRRKRR-------EEKSDGEKDMTVMILQNLKLYMENMSILEENERL  409
            SK+   +V+ LI R  KR+       E ++ G K    M ++NLKLYMEN SI+EEN +L
Sbjct  23   SKQHSFRVRRLINRNWKRKPAGPAAKEAETGGAK--VEMEMKNLKLYMENQSIIEENIKL  80

Query  408  RKKASFLHTENLTLMYELSSNRYFLAPSSTTTQV  307
            R+KA  L  EN  L  +L   + FL  + TT  V
Sbjct  81   RRKALLLVQENQALFSQLQQKQLFL--NKTTAAV  112



>ref|XP_007219393.1| hypothetical protein PRUPE_ppa020346mg [Prunus persica]
 gb|EMJ20592.1| hypothetical protein PRUPE_ppa020346mg [Prunus persica]
Length=98

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 44/73 (60%), Gaps = 4/73 (5%)
 Frame = -3

Query  537  LITRRRKRREEKSDGE--KDMTVMILQNLKLYMENMSILEENERLRKKASFLHTENLTLM  364
            LI R+RK  +E    E       M ++NLKLYMEN SI+EEN++LR+KA  L  EN  L 
Sbjct  27   LINRKRKTAKEPKGAEIGGAKVEMEIKNLKLYMENQSIIEENKKLRRKALLLVQENQALF  86

Query  363  YELSSNRYFLAPS  325
             +L   +  L+P+
Sbjct  87   SQLQQKK--LSPN  97



>ref|NP_001143513.1| uncharacterized protein LOC100276196 [Zea mays]
 gb|ACG32705.1| hypothetical protein [Zea mays]
Length=114

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -3

Query  477  VMILQNLKLYMENMSILEENERLRKKASFLHTENLTLMYELS  352
             M + NLKLY+EN  I+ ENERLR++AS L  ENL L+ +LS
Sbjct  60   AMEMVNLKLYLENRCIIAENERLRERASALRRENLALLQDLS  101



>gb|KHN20467.1| hypothetical protein glysoja_037343 [Glycine soja]
Length=110

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 4/65 (6%)
 Frame = -3

Query  540  GLITRRRKRREEKSDGEKDMTV---MILQNLKLYMENMSILEENERLRKKASFLHTENLT  370
            G++ RRR   +E +   K + V   + ++NLKLYMEN +I+EENE+LRK+A  LH EN  
Sbjct  33   GMLNRRRANLKE-ARQRKRIVVKSEIQMKNLKLYMENQTIIEENEKLRKQAMLLHKENQA  91

Query  369  LMYEL  355
            L  +L
Sbjct  92   LSSQL  96



>ref|XP_004492646.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503-like 
[Cicer arietinum]
Length=108

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 8/70 (11%)
 Frame = -3

Query  564  KRSKVQVQGLITRRRKRREEKSDGEKDMTVMILQNLKLYMENMSILEENERLRKKASFLH  385
            KR + Q++    R+RKR  E  +  K      ++NLKLYMEN +I+EENE+LRK+A  LH
Sbjct  30   KRRRTQLKE--ARQRKRMIEVKEEIK------MKNLKLYMENQTIIEENEKLRKQAMLLH  81

Query  384  TENLTLMYEL  355
             EN  LM +L
Sbjct  82   KENQDLMTQL  91



>ref|XP_008232687.1| PREDICTED: uncharacterized protein LOC103331807 [Prunus mume]
Length=105

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (62%), Gaps = 4/73 (5%)
 Frame = -3

Query  537  LITRRRKRREEKSDGE-KDMTV-MILQNLKLYMENMSILEENERLRKKASFLHTENLTLM  364
            LI R+RK  +E    E +   V M ++NLKLYMEN SI+EEN +LR+KA  L  EN  L 
Sbjct  34   LINRKRKTAKEPKGAEIRGAKVEMEIKNLKLYMENQSIIEENNKLRRKALLLVQENQALF  93

Query  363  YELSSNRYFLAPS  325
             +L   +  L+P+
Sbjct  94   SQLQEKK--LSPN  104



>gb|EPS64511.1| hypothetical protein M569_10271 [Genlisea aurea]
Length=74

 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  465  QNLKLYMENMSILEENERLRKKASFLHTENLTLMYELS  352
            +NLKLYM+NM I +ENE+LRK+A  LH EN+ L  EL+
Sbjct  32   ENLKLYMKNMRIFKENEKLRKQAHLLHQENIALASELN  69



>ref|NP_001132632.1| hypothetical protein [Zea mays]
 gb|ACF81560.1| unknown [Zea mays]
 gb|ACG25616.1| hypothetical protein [Zea mays]
 tpg|DAA62338.1| TPA: hypothetical protein ZEAMMB73_312619 [Zea mays]
Length=114

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -3

Query  477  VMILQNLKLYMENMSILEENERLRKKASFLHTENLTLMYELS  352
             M + NLKLY+EN  I+ ENERLR++AS L  ENL L+ +LS
Sbjct  58   AMEMVNLKLYLENRCIIAENERLRERASALRRENLALLQDLS  99



>ref|XP_009594357.1| PREDICTED: uncharacterized protein LOC104090865 [Nicotiana tomentosiformis]
Length=108

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 50/87 (57%), Gaps = 8/87 (9%)
 Frame = -3

Query  597  NLYISMHK-QRSKRSKVQVQGLITRRRKRR-----EEKSDGEKDMTVMILQNLKLYMENM  436
            + Y   H+ Q SK +K+ V  L  RR   R     +E++   K    M ++NLKLY EN 
Sbjct  14   SCYTDFHRSQLSKTAKIHV--LKLRRNGGRLSNEAKERAKLRKLKKAMKMKNLKLYKENK  71

Query  435  SILEENERLRKKASFLHTENLTLMYEL  355
            +I+EENE+LRKKA  LH EN  L  +L
Sbjct  72   TIIEENEKLRKKALLLHQENKALFSKL  98



>gb|ACG44072.1| hypothetical protein [Zea mays]
Length=107

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = -3

Query  477  VMILQNLKLYMENMSILEENERLRKKASFLHTENLTLMYELSSNRYFL  334
             M + NLKLY+EN  I+ ENERLR++AS L  ENL LM   S    F 
Sbjct  60   AMEMVNLKLYLENRCIIAENERLRERASALRRENLALMPHCSPGIRFC  107



>emb|CDY37042.1| BnaA04g26200D [Brassica napus]
Length=92

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 43/75 (57%), Gaps = 8/75 (11%)
 Frame = -3

Query  552  VQVQGLITRRRKRREEKSDGEKDMTVMILQNLKLYMENMSILEENERLRKKASFLHTENL  373
            V++  L  RR+  REEK         M + N++LYMEN  +++ENE+LRKKA  LH EN 
Sbjct  26   VRIPRLSRRRKMWREEKE--------MEINNIRLYMENQYMIQENEKLRKKALILHQENK  77

Query  372  TLMYELSSNRYFLAP  328
             L+  L +    L P
Sbjct  78   ALLSLLQTKNVSLVP  92



>ref|NP_001142861.1| uncharacterized protein LOC100275255 [Zea mays]
 gb|ACG27134.1| hypothetical protein [Zea mays]
Length=113

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -3

Query  477  VMILQNLKLYMENMSILEENERLRKKASFLHTENLTLMYELSS  349
             M + NLKLY+EN  I+ ENERLR++AS L  ENL L+  LSS
Sbjct  58   AMEMVNLKLYLENRCIIAENERLRERASALRRENLALLRNLSS  100



>ref|XP_007139987.1| hypothetical protein PHAVU_008G075300g [Phaseolus vulgaris]
 gb|ESW11981.1| hypothetical protein PHAVU_008G075300g [Phaseolus vulgaris]
Length=112

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  468  LQNLKLYMENMSILEENERLRKKASFLHTENLTLMYEL  355
            ++NLKLYMEN +I+EENE+LRK+A  LH EN  L+ +L
Sbjct  61   MKNLKLYMENQTIIEENEKLRKQAMLLHKENQALLSQL  98



>ref|XP_003623732.1| hypothetical protein MTR_7g075120 [Medicago truncatula]
 gb|AES79950.1| hypothetical protein MTR_7g075120 [Medicago truncatula]
Length=95

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  468  LQNLKLYMENMSILEENERLRKKASFLHTENLTLMYEL  355
            ++NLKLYMEN +I+E+NE+LRK+A  LH EN  LM +L
Sbjct  44   MKNLKLYMENQTIIEQNEKLRKQAMLLHKENQDLMSQL  81



>gb|EMS68667.1| hypothetical protein TRIUR3_04821 [Triticum urartu]
Length=83

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 36/61 (59%), Gaps = 0/61 (0%)
 Frame = -3

Query  462  NLKLYMENMSILEENERLRKKASFLHTENLTLMYELSSNRYFLAPSSTTTQVCNQLS*PQ  283
            N +LY+EN+ I++ENERLR+KA  L  EN  L+ +L   +  +A SS T     +   P 
Sbjct  14   NTELYLENLCIMQENERLRRKAQMLAQENEQLLADLKRKQQHMAASSKTAPQMAKGGEPS  73

Query  282  G  280
            G
Sbjct  74   G  74



>gb|ABA95824.1| hypothetical protein LOC_Os12g05560 [Oryza sativa Japonica Group]
 gb|EAY82276.1| hypothetical protein OsI_37485 [Oryza sativa Indica Group]
 gb|EAZ19664.1| hypothetical protein OsJ_35240 [Oryza sativa Japonica Group]
Length=81

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  462  NLKLYMENMSILEENERLRKKASFLHTENLTLMYELSSN  346
            NLKLY+EN+ I+EENERLR+KA  L+ EN  L+ +L++N
Sbjct  5    NLKLYLENVYIMEENERLRRKAQALNQENKALLAKLNTN  43



>ref|XP_009351011.1| PREDICTED: uncharacterized protein LOC103942550 [Pyrus x bretschneideri]
Length=112

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 51/92 (55%), Gaps = 7/92 (8%)
 Frame = -3

Query  567  SKRSKVQVQGLITRRRKRR--EEKSDGEKDMTVMI---LQNLKLYMENMSILEENERLRK  403
            SK++  +V+ LI R RK R  E  ++ E      I   ++NLKLYMEN  I+EEN +LR+
Sbjct  23   SKQNNFRVRRLINRNRKGRPGEAATEAETGGGAKIELQMKNLKLYMENQIIIEENNKLRR  82

Query  402  KASFLHTENLTLMYELSSNRYFLAPSSTTTQV  307
            KA  L  EN  L  +L   +  L  + TT  V
Sbjct  83   KALLLIQENQALFSQLQQKQLSL--TKTTAAV  112



>gb|ACG31125.1| hypothetical protein [Zea mays]
Length=55

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -3

Query  474  MILQNLKLYMENMSILEENERLRKKASFLHTENLTLMYELSS  349
            M + NLKLY+EN  I+ ENERLR++AS L  ENL L+  LSS
Sbjct  1    MEMVNLKLYLENRCIIAENERLRERASALRRENLALLQNLSS  42



>ref|XP_006660854.1| PREDICTED: uncharacterized protein LOC102712750 [Oryza brachyantha]
Length=111

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 33/50 (66%), Gaps = 4/50 (8%)
 Frame = -3

Query  501  SDGEKDMTVMILQNLKLYMENMSILEENERLRKKASFLHTENLTLMYELS  352
            SDG +    M++ NLKLY+EN  IL ENE LR+KA+ L  ENL L  +L 
Sbjct  52   SDGAE----MVMLNLKLYLENRCILAENEMLREKATALRRENLALRADLC  97



>ref|XP_006851488.1| hypothetical protein AMTR_s00040p00144690 [Amborella trichopoda]
 gb|ERN13069.1| hypothetical protein AMTR_s00040p00144690 [Amborella trichopoda]
Length=72

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -3

Query  462  NLKLYMENMSILEENERLRKKASFLHTENLTLMYEL  355
            NLKLY++N SI+EENERLRKKA  L+ EN  L+ EL
Sbjct  5    NLKLYLKNRSIIEENERLRKKALLLNQENQALLSEL  40



>ref|XP_003576737.1| PREDICTED: uncharacterized protein LOC100827005 [Brachypodium 
distachyon]
Length=115

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 35/59 (59%), Gaps = 2/59 (3%)
 Frame = -3

Query  474  MILQNLKLYMENMSILEENERLRKKASFLHTENLTLMYEL--SSNRYFLAPSSTTTQVC  304
            M + NLKL++EN  IL ENERLR+KAS L  ENL L  +L  ++    L P +     C
Sbjct  57   MEMLNLKLHLENRRILAENERLREKASALRGENLALRADLRNTATAVVLLPPAEAAHGC  115



>gb|EMT10406.1| hypothetical protein F775_03761 [Aegilops tauschii]
Length=79

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -3

Query  462  NLKLYMENMSILEENERLRKKASFLHTENLTLMYELSSNRYFLAPSSTTT  313
            N +LY+EN+ I+++NERLR+KA  L  EN  L+ +L   +  +A SS T 
Sbjct  5    NTELYLENLCIMQQNERLRRKAQLLAQENEQLLADLKRKQQHMAASSKTA  54



>emb|CDY13349.1| BnaC06g14080D [Brassica napus]
Length=69

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (58%), Gaps = 12/62 (19%)
 Frame = -3

Query  462  NLKLYMENMSILEENERLRKKASFLHTENLTLMYEL------------SSNRYFLAPSST  319
            N KLY+EN  I+ ENERLRKKA  L+ EN  L+++L            S+N   L PSS+
Sbjct  5    NSKLYVENCYIMRENERLRKKAELLNQENQQLLFQLKQKLSKTKNPSGSNNDKNLCPSSS  64

Query  318  TT  313
             +
Sbjct  65   AS  66



>ref|XP_008776046.1| PREDICTED: uncharacterized protein LOC103696263 [Phoenix dactylifera]
Length=113

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 52/86 (60%), Gaps = 5/86 (6%)
 Frame = -3

Query  582  MHKQRSKRSKVQVQ-----GLITRRRKRREEKSDGEKDMTVMILQNLKLYMENMSILEEN  418
            + +Q SK+S+V++        + RR+  R+E+ +  K  + M + NLKLY+EN  I+EEN
Sbjct  17   LFRQNSKKSRVRLSLTARIRRLRRRKGSRKEEKEQRKLGSNMEMVNLKLYLENRCIMEEN  76

Query  417  ERLRKKASFLHTENLTLMYELSSNRY  340
            ERLR+KA  L  EN  L+  L  N +
Sbjct  77   ERLREKALLLRQENQALLSNLRINSF  102



>ref|XP_002462683.1| hypothetical protein SORBIDRAFT_02g030180 [Sorghum bicolor]
 gb|EER99204.1| hypothetical protein SORBIDRAFT_02g030180 [Sorghum bicolor]
Length=113

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -3

Query  477  VMILQNLKLYMENMSILEENERLRKKASFLHTENLTLMYELS  352
             M + NLKLY+EN  IL ENERLR++A+ L  ENL L+  LS
Sbjct  59   AMEMLNLKLYLENRCILAENERLRERATALRRENLALLQNLS  100



>ref|XP_003581196.1| PREDICTED: uncharacterized protein LOC100822193 [Brachypodium 
distachyon]
Length=89

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -3

Query  462  NLKLYMENMSILEENERLRKKASFLHTENLTLMYEL  355
            N KLYM+N  IL+ENERLRKKA  L+ EN  L+ EL
Sbjct  5    NAKLYMQNCYILKENERLRKKAQLLNQENQALLTEL  40



>ref|NP_001235598.1| uncharacterized protein LOC100527916 [Glycine max]
 gb|ACU17140.1| unknown [Glycine max]
Length=110

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 42/65 (65%), Gaps = 4/65 (6%)
 Frame = -3

Query  540  GLITRRRKRREEKSDGEKDMTV---MILQNLKLYMENMSILEENERLRKKASFLHTENLT  370
            G++ RRR   +E +   K + V   + ++NLKLYMEN +I+EENE+LRK+A  LH  N  
Sbjct  33   GMLNRRRAHLKE-ARQRKRIVVKSEIQMKNLKLYMENQTIIEENEKLRKQAMLLHKGNQA  91

Query  369  LMYEL  355
            L  +L
Sbjct  92   LSSQL  96



>emb|CDY27385.1| BnaC04g50200D [Brassica napus]
Length=92

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 42/75 (56%), Gaps = 8/75 (11%)
 Frame = -3

Query  552  VQVQGLITRRRKRREEKSDGEKDMTVMILQNLKLYMENMSILEENERLRKKASFLHTENL  373
            V +  L  RR+  REEK         + + N++LYMEN  +++ENE+LRKKA  LH EN 
Sbjct  26   VHIPRLSRRRKMWREEKE--------LEMNNIRLYMENQYMIQENEKLRKKALILHQENK  77

Query  372  TLMYELSSNRYFLAP  328
             L+  L +    + P
Sbjct  78   ALLSLLQTKNVSIVP  92



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1413781731160