BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c28603_g1_i1 len=1190 path=[1168:0-1189]

Length=1190
                                                                      Score     E

ref|XP_009780350.1|  PREDICTED: probable xyloglucan endotransgluc...    367   9e-122   
ref|XP_009605698.1|  PREDICTED: probable xyloglucan endotransgluc...    362   4e-120   
ref|XP_009335370.1|  PREDICTED: probable xyloglucan endotransgluc...    358   3e-118   
ref|XP_009346542.1|  PREDICTED: probable xyloglucan endotransgluc...    356   2e-117   
ref|XP_010245632.1|  PREDICTED: probable xyloglucan endotransgluc...    355   4e-117   
ref|XP_006367106.1|  PREDICTED: probable xyloglucan endotransgluc...    354   7e-117   
ref|XP_004230670.1|  PREDICTED: probable xyloglucan endotransgluc...    353   1e-116   
ref|XP_007041418.1|  Xyloglucan endotransglucosylase/hydrolase 10       352   3e-116   
ref|XP_007200513.1|  hypothetical protein PRUPE_ppa009365mg             352   3e-116   
ref|XP_011088148.1|  PREDICTED: probable xyloglucan endotransgluc...    351   9e-116   
ref|XP_010095629.1|  putative xyloglucan endotransglucosylase/hyd...    350   2e-115   
ref|XP_002522076.1|  Xyloglucan endotransglucosylase/hydrolase pr...    350   3e-115   Ricinus communis
ref|XP_006486864.1|  PREDICTED: probable xyloglucan endotransgluc...    348   9e-115   
gb|KEH43977.1|  xyloglucan endotransglucosylase/hydrolase family ...    349   1e-114   
ref|XP_004496796.1|  PREDICTED: probable xyloglucan endotransgluc...    348   1e-114   
emb|CAN70891.1|  hypothetical protein VITISV_039824                     348   1e-114   Vitis vinifera
ref|XP_004289703.1|  PREDICTED: probable xyloglucan endotransgluc...    348   1e-114   
ref|XP_002270633.1|  PREDICTED: probable xyloglucan endotransgluc...    348   2e-114   Vitis vinifera
ref|XP_010248303.1|  PREDICTED: probable xyloglucan endotransgluc...    348   2e-114   
ref|XP_006422726.1|  hypothetical protein CICLE_v10029863mg             348   3e-114   
gb|KDO49501.1|  hypothetical protein CISIN_1g022638mg                   347   4e-114   
ref|XP_008785762.1|  PREDICTED: probable xyloglucan endotransgluc...    347   7e-114   
ref|XP_008236227.1|  PREDICTED: probable xyloglucan endotransgluc...    345   2e-113   
emb|CBI25107.3|  unnamed protein product                                344   1e-112   
ref|XP_003555312.1|  PREDICTED: probable xyloglucan endotransgluc...    343   2e-112   
ref|XP_007143154.1|  hypothetical protein PHAVU_007G048300g             342   3e-112   
ref|XP_002883839.1|  hypothetical protein ARALYDRAFT_480350             342   4e-112   
emb|CCH26628.1|  putative xyloglucan endotransglucosylase/hydrolase     342   7e-112   
ref|XP_010467246.1|  PREDICTED: probable xyloglucan endotransgluc...    341   8e-112   
ref|XP_004150273.1|  PREDICTED: probable xyloglucan endotransgluc...    342   1e-111   
gb|EYU18352.1|  hypothetical protein MIMGU_mgv1a011021mg                341   1e-111   
gb|AFK39293.1|  unknown                                                 341   1e-111   
ref|XP_010065849.1|  PREDICTED: probable xyloglucan endotransgluc...    340   2e-111   
ref|XP_003535672.1|  PREDICTED: probable xyloglucan endotransgluc...    340   2e-111   
emb|CDO97322.1|  unnamed protein product                                340   2e-111   
ref|XP_010517601.1|  PREDICTED: probable xyloglucan endotransgluc...    339   7e-111   
ref|XP_008454432.1|  PREDICTED: probable xyloglucan endotransgluc...    339   8e-111   
ref|XP_006298221.1|  hypothetical protein CARUB_v10014279mg             337   5e-110   
ref|XP_010547938.1|  PREDICTED: probable xyloglucan endotransgluc...    335   1e-109   
ref|XP_010488900.1|  PREDICTED: probable xyloglucan endotransgluc...    335   3e-109   
ref|XP_011002572.1|  PREDICTED: probable xyloglucan endotransgluc...    334   4e-109   
ref|XP_010065854.1|  PREDICTED: probable xyloglucan endotransgluc...    334   4e-109   
ref|XP_002313201.1|  xyloglucan endotransglucosylase/hydrolase pr...    334   5e-109   Populus trichocarpa [western balsam poplar]
emb|CDX71167.1|  BnaC07g04460D                                          333   2e-108   
ref|XP_010939323.1|  PREDICTED: probable xyloglucan endotransgluc...    332   3e-108   
ref|XP_006848852.1|  hypothetical protein AMTR_s00026p00206650          331   4e-108   
gb|KDP37615.1|  hypothetical protein JCGZ_06958                         330   8e-108   
ref|NP_179069.1|  xyloglucan endotransglucosylase/hydrolase prote...    329   4e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006409649.1|  hypothetical protein EUTSA_v10022791mg             329   5e-107   
ref|XP_009402073.1|  PREDICTED: probable xyloglucan endotransgluc...    328   7e-107   
ref|XP_010691526.1|  PREDICTED: probable xyloglucan endotransgluc...    328   8e-107   
ref|XP_009123190.1|  PREDICTED: probable xyloglucan endotransgluc...    318   7e-103   
gb|KHN01563.1|  Putative xyloglucan endotransglucosylase/hydrolas...    286   1e-90    
ref|XP_002993509.1|  hypothetical protein SELMODRAFT_431582             263   1e-81    
ref|XP_002975683.1|  hypothetical protein SELMODRAFT_267868             261   6e-81    
gb|EPS69904.1|  hypothetical protein M569_04855                         261   1e-80    
ref|XP_008781817.1|  PREDICTED: probable xyloglucan endotransgluc...    258   3e-79    
ref|XP_002437518.1|  hypothetical protein SORBIDRAFT_10g028550          251   1e-76    Sorghum bicolor [broomcorn]
ref|XP_010913699.1|  PREDICTED: probable xyloglucan endotransgluc...    250   2e-76    
gb|ABM91062.1|  xyloglucan endotransglycosylase/hydrolase precurs...    246   3e-76    Populus tremula x Populus tremuloides
ref|XP_010927057.1|  PREDICTED: probable xyloglucan endotransgluc...    249   6e-76    
ref|XP_010927058.1|  PREDICTED: probable xyloglucan endotransgluc...    249   8e-76    
gb|ABL10090.1|  xyloglucan endotransglycosylase                         248   1e-75    Musa acuminata [banana]
ref|XP_008801408.1|  PREDICTED: probable xyloglucan endotransgluc...    248   2e-75    
ref|XP_007204042.1|  hypothetical protein PRUPE_ppa021295mg             248   2e-75    
ref|XP_008801540.1|  PREDICTED: probable xyloglucan endotransgluc...    247   2e-75    
ref|NP_001058455.2|  Os06g0696400                                       246   3e-75    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010099402.1|  putative xyloglucan endotransglucosylase/hyd...    247   3e-75    
ref|XP_006845717.1|  hypothetical protein AMTR_s00019p00242730          247   3e-75    
ref|XP_003563483.1|  PREDICTED: xyloglucan endotransglucosylase/h...    247   4e-75    
gb|AAD39086.1|AF093507_1  xyloglucan endo-transglycosylase-like p...    246   5e-75    Medicago truncatula
ref|XP_010927056.1|  PREDICTED: probable xyloglucan endotransgluc...    246   6e-75    
ref|XP_006656424.1|  PREDICTED: xyloglucan endotransglucosylase/h...    246   7e-75    
dbj|BAJ10396.1|  xyloglucan endotransglucosylase/hydrolase              246   7e-75    
ref|XP_008801539.1|  PREDICTED: probable xyloglucan endotransgluc...    246   8e-75    
gb|AAU89381.1|  xyloglucan endotransglycosylase hydrolase 1             246   9e-75    Medicago truncatula
dbj|BAD53910.1|  putative xyloglucan endotransglycosylase               246   1e-74    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003608572.1|  Xyloglucan endotransglycosylase hydrolase          247   1e-74    
ref|XP_003608566.1|  Xyloglucan endotransglycosylase hydrolase          246   1e-74    
gb|KGN65065.1|  Xyloglucan endotransglycosylase/hydrolase               245   2e-74    
ref|XP_009390493.1|  PREDICTED: probable xyloglucan endotransgluc...    244   2e-74    
ref|XP_009611598.1|  PREDICTED: probable xyloglucan endotransgluc...    245   2e-74    
ref|XP_009401564.1|  PREDICTED: probable xyloglucan endotransgluc...    244   2e-74    
ref|XP_009792284.1|  PREDICTED: probable xyloglucan endotransgluc...    244   3e-74    
ref|XP_009392942.1|  PREDICTED: probable xyloglucan endotransgluc...    244   3e-74    
ref|XP_009773101.1|  PREDICTED: probable xyloglucan endotransgluc...    244   4e-74    
gb|KFK28426.1|  hypothetical protein AALP_AA8G513200                    243   5e-74    
gb|AAU89382.1|  xyloglucan endotransglycosylase hydrolase 2             244   6e-74    Medicago truncatula
ref|XP_002280688.1|  PREDICTED: probable xyloglucan endotransgluc...    244   6e-74    Vitis vinifera
ref|XP_008242631.1|  PREDICTED: probable xyloglucan endotransgluc...    243   7e-74    
ref|XP_011099425.1|  PREDICTED: probable xyloglucan endotransgluc...    243   7e-74    
gb|ABK21095.1|  unknown                                                 243   1e-73    Picea sitchensis
gb|ABK22987.1|  unknown                                                 243   1e-73    Picea sitchensis
gb|KHN41652.1|  Putative xyloglucan endotransglucosylase/hydrolas...    242   1e-73    
ref|XP_011073659.1|  PREDICTED: probable xyloglucan endotransgluc...    243   1e-73    
ref|XP_009628114.1|  PREDICTED: probable xyloglucan endotransgluc...    243   1e-73    
ref|XP_009415319.1|  PREDICTED: probable xyloglucan endotransgluc...    243   1e-73    
ref|XP_011048362.1|  PREDICTED: probable xyloglucan endotransgluc...    243   1e-73    
ref|XP_003524400.2|  PREDICTED: probable xyloglucan endotransgluc...    243   2e-73    
gb|AIE54304.1|  xyloglucan endotransglucosylase-hydrolase XTH7          243   2e-73    
gb|ADJ67812.1|  xyloglucan endotransglycosylase                         243   2e-73    
gb|AEK32594.1|  xyloglucan endotransglucosylase/hydrolase               243   2e-73    
ref|XP_009409758.1|  PREDICTED: probable xyloglucan endotransgluc...    242   2e-73    
ref|XP_004139618.1|  PREDICTED: probable xyloglucan endotransgluc...    246   3e-73    
gb|AAT94297.1|  endotransglucosylase/hydrolase XTH5                     242   3e-73    Triticum aestivum [Canadian hard winter wheat]
gb|EMT27816.1|  Putative xyloglucan endotransglucosylase/hydrolas...    242   3e-73    
ref|XP_008799438.1|  PREDICTED: probable xyloglucan endotransgluc...    242   3e-73    
gb|ADO24300.1|  xyloglucan endotransglucosylase/hydrolase               242   3e-73    
emb|CAA63663.1|  xyloglucan endotransglycosylase (XET)                  242   3e-73    Hordeum vulgare [barley]
ref|XP_004966141.1|  PREDICTED: xyloglucan endotransglucosylase/h...    242   3e-73    
gb|KHG03304.1|  putative xyloglucan endotransglucosylase/hydrolas...    242   3e-73    
ref|XP_007160314.1|  hypothetical protein PHAVU_002G311200g             242   3e-73    
ref|XP_008783308.1|  PREDICTED: probable xyloglucan endotransgluc...    240   4e-73    
ref|XP_004308638.1|  PREDICTED: probable xyloglucan endotransgluc...    241   4e-73    
ref|XP_010929301.1|  PREDICTED: xyloglucan endotransglucosylase/h...    241   4e-73    
gb|AFN71023.1|  xyloglucan endotransglucosylase/hydrolase               241   5e-73    
gb|KHN36328.1|  Putative xyloglucan endotransglucosylase/hydrolas...    242   5e-73    
gb|KDP32131.1|  hypothetical protein JCGZ_12592                         241   5e-73    
ref|XP_003517365.2|  PREDICTED: probable xyloglucan endotransgluc...    241   5e-73    
gb|ADJ00314.1|  xyloglucan endotransglycosylase/hydrolase               241   5e-73    
ref|NP_001151103.1|  xyloglucan endotransglucosylase/hydrolase pr...    241   5e-73    Zea mays [maize]
emb|CAA16685.1|  endoxyloglucan tranferase-like protein                 241   6e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010936207.1|  PREDICTED: probable xyloglucan endotransgluc...    244   6e-73    
ref|XP_009336854.1|  PREDICTED: probable xyloglucan endotransgluc...    241   6e-73    
ref|XP_009390494.1|  PREDICTED: probable xyloglucan endotransgluc...    241   6e-73    
ref|XP_006363788.1|  PREDICTED: probable xyloglucan endotransgluc...    241   7e-73    
gb|ADK92389.1|  xyloglucan endotransglycosylase                         241   9e-73    
ref|XP_003524704.1|  PREDICTED: probable xyloglucan endotransgluc...    241   9e-73    
gb|ADP94235.2|  xyloglucan endotransglucosylase                         241   9e-73    
ref|NP_001234475.1|  xyloglucan endotransglucosylase-hydrolase XTH7     241   1e-72    
ref|XP_004509043.1|  PREDICTED: probable xyloglucan endotransgluc...    241   1e-72    
ref|XP_008790430.1|  PREDICTED: probable xyloglucan endotransgluc...    240   1e-72    
ref|XP_009354593.1|  PREDICTED: probable xyloglucan endotransgluc...    241   1e-72    
gb|ABV46534.1|  xyloglucan endotransglucosylase hydrolase 2             240   1e-72    
ref|NP_569019.1|  probable xyloglucan endotransglucosylase/hydrol...    240   1e-72    Arabidopsis thaliana [mouse-ear cress]
gb|ADO24304.1|  putative xyloglucan endotransglucosylase/hydrolase      240   1e-72    
ref|XP_003549996.1|  PREDICTED: probable xyloglucan endotransgluc...    240   1e-72    
ref|XP_007047639.1|  Xyloglucan endotransglycosylase                    240   1e-72    
emb|CDP03294.1|  unnamed protein product                                241   1e-72    
gb|KHN01716.1|  Putative xyloglucan endotransglucosylase/hydrolas...    240   1e-72    
gb|ABC55454.2|  xyloglucan endotransglucosylase/hydrolase 2             240   1e-72    Rosa x borboniana [Bourbon rose]
ref|XP_010246431.1|  PREDICTED: probable xyloglucan endotransgluc...    240   2e-72    
gb|ABM91067.1|  xyloglucan endotransglycosylase/hydrolase precurs...    240   2e-72    Populus tremula x Populus tremuloides
ref|XP_009412280.1|  PREDICTED: probable xyloglucan endotransgluc...    240   2e-72    
ref|XP_008237031.1|  PREDICTED: probable xyloglucan endotransgluc...    240   2e-72    
ref|XP_010550327.1|  PREDICTED: probable xyloglucan endotransgluc...    240   2e-72    
emb|CDY45623.1|  BnaCnng13310D                                          239   2e-72    
gb|KHG00928.1|  putative xyloglucan endotransglucosylase/hydrolas...    239   2e-72    
ref|XP_009150664.1|  PREDICTED: probable xyloglucan endotransgluc...    239   3e-72    
ref|XP_002864977.1|  hypothetical protein ARALYDRAFT_496809             239   3e-72    
gb|AAM61529.1|  xyloglucan endo-transglycosylase-like protein           239   3e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004966138.1|  PREDICTED: probable xyloglucan endotransgluc...    239   3e-72    
ref|XP_009354613.1|  PREDICTED: probable xyloglucan endotransgluc...    239   3e-72    
ref|XP_006393992.1|  hypothetical protein EUTSA_v10004708mg             239   3e-72    
ref|XP_007013098.1|  Xyloglucan endotransglucosylase/hydrolase 26       239   3e-72    
gb|KGN65066.1|  Xyloglucan endotransglycosylase                         239   4e-72    
ref|XP_006584814.1|  PREDICTED: probable xyloglucan endotransgluc...    239   4e-72    
gb|EYU44533.1|  hypothetical protein MIMGU_mgv1a011266mg                239   4e-72    
ref|XP_004288290.1|  PREDICTED: probable xyloglucan endotransgluc...    239   4e-72    
ref|XP_004172513.1|  PREDICTED: probable xyloglucan endotransgluc...    239   4e-72    
ref|XP_010248304.1|  PREDICTED: probable xyloglucan endotransgluc...    239   4e-72    
ref|XP_010646925.1|  PREDICTED: probable xyloglucan endotransgluc...    239   5e-72    
ref|XP_010463516.1|  PREDICTED: probable xyloglucan endotransgluc...    239   5e-72    
ref|XP_006656426.1|  PREDICTED: probable xyloglucan endotransgluc...    238   5e-72    
ref|XP_006381725.1|  hypothetical protein POPTR_0006s16380g             239   5e-72    
ref|XP_007155788.1|  hypothetical protein PHAVU_003G231900g             239   6e-72    
ref|XP_007156682.1|  hypothetical protein PHAVU_002G008400g             239   6e-72    
gb|ABK21428.1|  unknown                                                 239   6e-72    Picea sitchensis
ref|XP_010667998.1|  PREDICTED: probable xyloglucan endotransgluc...    238   7e-72    
gb|ADO24299.1|  xyloglucan endotransglucosylase/hydrolase               238   9e-72    
ref|XP_006451230.1|  hypothetical protein CICLE_v10010330mg             238   9e-72    
ref|XP_009417487.1|  PREDICTED: probable xyloglucan endotransgluc...    237   1e-71    
ref|XP_003539234.1|  PREDICTED: probable xyloglucan endotransgluc...    238   1e-71    
gb|ABB72442.1|  xyloglucan endotransglucosylase                         238   1e-71    Gerbera hybrid cultivar
gb|KHN13026.1|  Putative xyloglucan endotransglucosylase/hydrolas...    238   1e-71    
ref|XP_006426162.1|  hypothetical protein CICLE_v10026210mg             238   2e-71    
gb|KDO78788.1|  hypothetical protein CISIN_1g022933mg                   238   2e-71    
gb|ABK21757.1|  unknown                                                 238   2e-71    Picea sitchensis
ref|XP_010437183.1|  PREDICTED: probable xyloglucan endotransgluc...    238   2e-71    
gb|ACB86852.1|  xyloglucan endotransglycosylase                         238   2e-71    Brassica rapa subsp. pekinensis [bai cai]
ref|XP_007205666.1|  hypothetical protein PRUPE_ppa009472mg             237   2e-71    
gb|ADO24302.1|  putative xyloglucan endotransglucosylase/hydrolase      237   2e-71    
ref|XP_002980921.1|  hypothetical protein SELMODRAFT_178522             237   2e-71    
gb|AAM62514.1|  endo-xyloglucan transferase-like protein                237   2e-71    Arabidopsis thaliana [mouse-ear cress]
gb|KHN16622.1|  Putative xyloglucan endotransglucosylase/hydrolas...    237   3e-71    
ref|NP_195494.1|  xyloglucan endotransglucosylase/hydrolase prote...    237   3e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006411851.1|  hypothetical protein EUTSA_v10025884mg             237   3e-71    
ref|XP_008458950.1|  PREDICTED: probable xyloglucan endotransgluc...    237   3e-71    
ref|XP_002270973.2|  PREDICTED: brassinosteroid-regulated protein...    237   3e-71    Vitis vinifera
ref|XP_010245633.1|  PREDICTED: probable xyloglucan endotransgluc...    236   4e-71    
ref|NP_001280943.1|  probable xyloglucan endotransglucosylase/hyd...    236   4e-71    
ref|XP_010668001.1|  PREDICTED: probable xyloglucan endotransgluc...    236   4e-71    
ref|XP_010028049.1|  PREDICTED: probable xyloglucan endotransgluc...    236   4e-71    
ref|XP_008344375.1|  PREDICTED: probable xyloglucan endotransgluc...    236   4e-71    
ref|XP_009138533.1|  PREDICTED: probable xyloglucan endotransgluc...    236   4e-71    
gb|AII99392.1|  xyloglucan endotransglucosylase/hydrolase2              236   4e-71    
gb|KHN22714.1|  Putative xyloglucan endotransglucosylase/hydrolas...    236   4e-71    
dbj|BAJ10423.1|  xyloglucan endotransglucosylase/hydrolase              236   4e-71    
gb|AEQ37177.1|  xyloglucan endotransglucosylase/hydrolase               236   5e-71    
ref|XP_010915887.1|  PREDICTED: LOW QUALITY PROTEIN: probable xyl...    237   5e-71    
ref|XP_008458951.1|  PREDICTED: probable xyloglucan endotransgluc...    236   5e-71    
ref|NP_001242530.1|  uncharacterized protein LOC100785313 precursor     236   5e-71    
ref|XP_010677534.1|  PREDICTED: probable xyloglucan endotransgluc...    236   5e-71    
gb|ADO24303.1|  putative xyloglucan endotransglucosylase/hydrolase      236   5e-71    
ref|XP_006474161.1|  PREDICTED: probable xyloglucan endotransgluc...    236   6e-71    
ref|XP_003517063.1|  PREDICTED: probable xyloglucan endotransgluc...    236   6e-71    
ref|XP_008344370.1|  PREDICTED: probable xyloglucan endotransgluc...    236   6e-71    
ref|XP_002324432.1|  xyloglucan endotransglycosylase family protein     236   6e-71    Populus trichocarpa [western balsam poplar]
ref|XP_003534215.1|  PREDICTED: probable xyloglucan endotransgluc...    236   7e-71    
ref|XP_008799496.1|  PREDICTED: probable xyloglucan endotransgluc...    236   7e-71    
ref|XP_009390698.1|  PREDICTED: probable xyloglucan endotransgluc...    236   7e-71    
gb|KDO66473.1|  hypothetical protein CISIN_1g040673mg                   236   8e-71    
ref|XP_002961354.1|  hypothetical protein SELMODRAFT_140273             235   9e-71    
ref|XP_010911439.1|  PREDICTED: probable xyloglucan endotransgluc...    235   9e-71    
gb|AGI42460.1|  xyloglucan endotransglycosylase/hydrolase               235   9e-71    
gb|AGI42451.1|  xyloglucan endotransglycosylase/hydrolase               235   9e-71    
emb|CDP02962.1|  unnamed protein product                                236   9e-71    
ref|XP_001752377.1|  predicted protein                                  235   9e-71    
gb|AFP93557.1|  xyloglucan endotransglycosylase/hydrolase 1             235   1e-70    
ref|XP_009338970.1|  PREDICTED: probable xyloglucan endotransgluc...    236   1e-70    
ref|NP_001130486.1|  xyloglucan endotransglucosylase/hydrolase pr...    236   1e-70    Zea mays [maize]
gb|AGI42452.1|  xyloglucan endotransglycosylase/hydrolase               235   1e-70    
ref|XP_006280895.1|  hypothetical protein CARUB_v10026888mg             235   1e-70    
gb|AGI42459.1|  xyloglucan endotransglycosylase/hydrolase               235   1e-70    
pdb|1UMZ|A  Chain A, Xyloglucan Endotransglycosylase In Complex W...    235   1e-70    
dbj|BAO57277.1|  xyloglucan endotransglucosylase/hydrolase              235   1e-70    
gb|AGI42456.1|  xyloglucan endotransglycosylase/hydrolase               235   1e-70    
ref|XP_010432029.1|  PREDICTED: probable xyloglucan endotransgluc...    235   1e-70    
gb|EPS73414.1|  hypothetical protein M569_01341                         234   1e-70    
ref|XP_010555436.1|  PREDICTED: probable xyloglucan endotransgluc...    235   1e-70    
ref|XP_001773859.1|  predicted protein                                  236   2e-70    
ref|XP_002310324.1|  xyloglucan endotransglycosylase hydrolase 2 ...    235   2e-70    Populus trichocarpa [western balsam poplar]
emb|CDP02651.1|  unnamed protein product                                235   2e-70    
ref|XP_008343991.1|  PREDICTED: probable xyloglucan endotransgluc...    234   2e-70    
ref|NP_001267702.1|  probable xyloglucan endotransglucosylase/hyd...    234   2e-70    
gb|AAN87142.1|  xyloglucan endotransglycosylase precursor               235   2e-70    Populus tremula x Populus tremuloides
ref|XP_008367892.1|  PREDICTED: probable xyloglucan endotransgluc...    234   2e-70    
gb|AAF80591.1|AF223420_1  xyloglucan endotransglycosylase XET2          234   2e-70    Asparagus officinalis
gb|AGI42449.1|  xyloglucan endotransglycosylase/hydrolase               234   2e-70    
ref|XP_002514259.1|  Xyloglucan endotransglucosylase/hydrolase pr...    234   3e-70    Ricinus communis
ref|XP_010047926.1|  PREDICTED: probable xyloglucan endotransgluc...    234   3e-70    
ref|XP_002304625.1|  EXGT1 family protein                               234   3e-70    Populus trichocarpa [western balsam poplar]
ref|XP_009408365.1|  PREDICTED: probable xyloglucan endotransgluc...    234   3e-70    
ref|XP_009352690.1|  PREDICTED: probable xyloglucan endotransgluc...    234   3e-70    
ref|XP_006385866.1|  hypothetical protein POPTR_0003s15800g             234   3e-70    
ref|XP_006353474.1|  PREDICTED: probable xyloglucan endotransgluc...    234   3e-70    
ref|XP_008462753.1|  PREDICTED: probable xyloglucan endotransgluc...    234   3e-70    
gb|ABY86635.1|  xyloglucan endotransglycosylase/hydrolase               234   4e-70    Gossypium raimondii
gb|AGI42458.1|  xyloglucan endotransglycosylase/hydrolase               234   4e-70    
gb|ABK92523.1|  unknown                                                 234   4e-70    Populus trichocarpa [western balsam poplar]
ref|XP_010446621.1|  PREDICTED: probable xyloglucan endotransgluc...    234   5e-70    
dbj|BAN09212.1|  xyloglucan endotransglucosylase/hydrolase              234   5e-70    
ref|XP_002866931.1|  hypothetical protein ARALYDRAFT_490836             234   5e-70    
gb|KGN65091.1|  hypothetical protein Csa_1G202300                       233   5e-70    
ref|XP_009413812.1|  PREDICTED: probable xyloglucan endotransgluc...    234   5e-70    
ref|XP_011020925.1|  PREDICTED: probable xyloglucan endotransgluc...    234   5e-70    
ref|XP_010677922.1|  PREDICTED: probable xyloglucan endotransgluc...    233   6e-70    
emb|CBL95263.1|  hypothetical protein                                   233   6e-70    
gb|ACG35105.1|  xyloglucan endotransglucosylase/hydrolase protein...    234   6e-70    Zea mays [maize]
dbj|BAE06063.1|  xyloglucan endotransglucosylase/hydrolase              234   6e-70    Sagittaria pygmaea
ref|XP_008796499.1|  PREDICTED: xyloglucan endotransglucosylase/h...    233   6e-70    
gb|AGI42450.1|  xyloglucan endotransglycosylase/hydrolase               233   7e-70    
gb|AGI42454.1|  xyloglucan endotransglycosylase/hydrolase               233   7e-70    
gb|KFK30391.1|  hypothetical protein AALP_AA7G254800                    233   7e-70    
ref|XP_010677921.1|  PREDICTED: probable xyloglucan endotransgluc...    233   7e-70    
ref|XP_009364685.1|  PREDICTED: probable xyloglucan endotransgluc...    233   7e-70    
ref|NP_001284443.1|  probable xyloglucan endotransglucosylase/hyd...    233   8e-70    
ref|NP_001058459.1|  Os06g0697000                                       233   9e-70    Oryza sativa Japonica Group [Japonica rice]
ref|XP_001752481.1|  predicted protein                                  233   1e-69    
gb|ACD03215.1|  xyloglucan endotransglucosylase/hydrolase 5             233   1e-69    Actinidia deliciosa [Chinese gooseberry]
ref|XP_002512703.1|  Xyloglucan endotransglucosylase/hydrolase pr...    233   2e-69    Ricinus communis
gb|ABP04059.1|  xyloglucan endo-transglucosylase/hydrolase 1            232   2e-69    
ref|XP_010049656.1|  PREDICTED: probable xyloglucan endotransgluc...    232   2e-69    
ref|XP_003630750.1|  Xyloglucan endotransglycosylase                    232   2e-69    
gb|ACD03216.1|  xyloglucan endotransglucosylase/hydrolase 6             232   2e-69    Actinidia deliciosa [Chinese gooseberry]
ref|XP_006284228.1|  hypothetical protein CARUB_v10005387mg             232   2e-69    
gb|AFW69276.1|  xyloglucan endotransglucosylase/hydrolase protein 23    232   2e-69    
ref|XP_010107383.1|  putative xyloglucan endotransglucosylase/hyd...    232   2e-69    
ref|XP_002518528.1|  Xyloglucan endotransglucosylase/hydrolase pr...    232   2e-69    Ricinus communis
gb|KDP23230.1|  hypothetical protein JCGZ_23063                         232   2e-69    
ref|XP_004252059.2|  PREDICTED: probable xyloglucan endotransgluc...    232   2e-69    
gb|ABK22955.1|  unknown                                                 232   2e-69    
ref|XP_004171098.1|  PREDICTED: probable xyloglucan endotransgluc...    231   3e-69    
ref|XP_011078292.1|  PREDICTED: probable xyloglucan endotransgluc...    231   3e-69    
gb|AII99393.1|  xyloglucan endotransglucosylase/hydrolase2              231   3e-69    
ref|XP_011021810.1|  PREDICTED: probable xyloglucan endotransgluc...    232   3e-69    
gb|EMT12047.1|  Putative xyloglucan endotransglucosylase/hydrolas...    231   3e-69    
gb|ABM91069.1|  xyloglucan endotransglycosylase/hydrolase precurs...    231   3e-69    
emb|CDY31620.1|  BnaA03g54320D                                          231   3e-69    
gb|KDP20789.1|  hypothetical protein JCGZ_21260                         232   3e-69    
gb|AAC09388.1|  xyloglucan endotransglycosylase precursor               231   4e-69    
gb|KDO78790.1|  hypothetical protein CISIN_1g022933mg                   228   4e-69    
ref|XP_009120273.1|  PREDICTED: xyloglucan endotransglucosylase/h...    231   4e-69    
gb|EMS61566.1|  putative xyloglucan endotransglucosylase/hydrolas...    231   4e-69    
dbj|BAJ89557.1|  predicted protein                                      231   4e-69    
ref|NP_001149503.1|  LOC100283129 precursor                             231   4e-69    
dbj|BAJ99431.1|  predicted protein                                      231   5e-69    
dbj|BAA21107.1|  endo-xyloglucan transferase                            231   5e-69    
ref|XP_009397067.1|  PREDICTED: probable xyloglucan endotransgluc...    231   5e-69    
gb|AGI42461.1|  xyloglucan endotransglycosylase/hydrolase               231   5e-69    
ref|XP_010536923.1|  PREDICTED: probable xyloglucan endotransgluc...    231   5e-69    
gb|EMS61565.1|  putative xyloglucan endotransglucosylase/hydrolas...    231   5e-69    
ref|XP_008371123.1|  PREDICTED: probable xyloglucan endotransgluc...    231   5e-69    
ref|XP_004293262.1|  PREDICTED: probable xyloglucan endotransgluc...    231   5e-69    
ref|XP_010693035.1|  PREDICTED: probable xyloglucan endotransgluc...    231   5e-69    
ref|XP_009381589.1|  PREDICTED: xyloglucan endotransglucosylase/h...    231   6e-69    
ref|XP_010910383.1|  PREDICTED: probable xyloglucan endotransgluc...    231   6e-69    
ref|XP_011004327.1|  PREDICTED: probable xyloglucan endotransgluc...    231   7e-69    
gb|KDP36430.1|  hypothetical protein JCGZ_08699                         231   7e-69    
ref|XP_006474156.1|  PREDICTED: probable xyloglucan endotransgluc...    230   7e-69    
ref|XP_006474633.1|  PREDICTED: probable xyloglucan endotransgluc...    231   7e-69    
gb|ABU41234.1|  xyloglucan endotransglycosylase                         231   7e-69    
ref|XP_006467988.1|  PREDICTED: probable xyloglucan endotransgluc...    231   7e-69    
gb|ABU41235.1|  xyloglucan endotransglycosylase                         230   8e-69    
emb|CAA62847.1|  Endoxyloglucan transferase (EXT)                       231   8e-69    
ref|XP_001773865.1|  predicted protein                                  229   8e-69    
ref|XP_006279674.1|  hypothetical protein CARUB_v10026912mg             230   9e-69    
ref|XP_002297895.1|  EXGT1 family protein                               231   9e-69    
gb|ABB86296.1|  xyloglucan endotransglucosylase hydrolase               230   9e-69    
ref|XP_003620659.1|  Xyloglucan endotransglycosylase                    230   1e-68    
ref|XP_004251620.1|  PREDICTED: probable xyloglucan endotransgluc...    230   1e-68    
dbj|BAA03922.1|  endo-xyloglucan transferase                            230   1e-68    
ref|XP_004513018.1|  PREDICTED: probable xyloglucan endotransgluc...    230   1e-68    
gb|KDO46531.1|  hypothetical protein CISIN_1g045763mg                   229   1e-68    
gb|KHN46820.1|  Putative xyloglucan endotransglucosylase/hydrolase      230   1e-68    
ref|NP_001242655.1|  xyloglucan endotransglucosylase/hydrolase 1 ...    230   1e-68    
ref|XP_009621801.1|  PREDICTED: probable xyloglucan endotransgluc...    230   1e-68    
ref|XP_006453403.1|  hypothetical protein CICLE_v10010760mg             229   1e-68    
gb|ABU41233.1|  xyloglucan endotransglycosylase                         230   1e-68    
ref|XP_004965095.1|  PREDICTED: xyloglucan endotransglucosylase/h...    230   1e-68    
gb|KDP33712.1|  hypothetical protein JCGZ_07283                         230   1e-68    
ref|XP_010250428.1|  PREDICTED: probable xyloglucan endotransgluc...    230   1e-68    
ref|XP_009401856.1|  PREDICTED: xyloglucan endotransglucosylase/h...    231   1e-68    
dbj|BAJ89051.1|  predicted protein                                      230   2e-68    
ref|XP_007161789.1|  hypothetical protein PHAVU_001G098200g             230   2e-68    
dbj|BAJ10395.1|  xyloglucan endotransglucosylase/hydrolase              229   2e-68    
gb|AIJ10712.1|  xyloglucan endotransglucosylase/hydrolase 3             229   2e-68    
ref|NP_001266903.1|  XET precursor                                      229   2e-68    
ref|XP_010052819.1|  PREDICTED: probable xyloglucan endotransgluc...    230   2e-68    
ref|XP_002512792.1|  Xyloglucan endotransglucosylase/hydrolase pr...    229   2e-68    
ref|XP_006844710.1|  hypothetical protein AMTR_s00016p00250350          229   2e-68    
gb|ACN40969.1|  unknown                                                 229   3e-68    
sp|Q41542.1|XTH_WHEAT  RecName: Full=Probable xyloglucan endotran...    229   3e-68    
ref|XP_007152888.1|  hypothetical protein PHAVU_004G168700g             229   3e-68    
gb|ABK23987.1|  unknown                                                 229   3e-68    
ref|XP_010932220.1|  PREDICTED: xyloglucan endotransglucosylase/h...    229   3e-68    
emb|CAA63662.1|  xyloglucan endotransglycosylase (XET)                  229   3e-68    
gb|ACF88385.1|  unknown                                                 229   3e-68    
ref|XP_010676725.1|  PREDICTED: probable xyloglucan endotransgluc...    228   3e-68    
ref|XP_009784848.1|  PREDICTED: probable xyloglucan endotransgluc...    229   3e-68    
ref|XP_010525738.1|  PREDICTED: xyloglucan endotransglucosylase/h...    228   4e-68    
ref|XP_010545425.1|  PREDICTED: probable xyloglucan endotransgluc...    229   4e-68    
gb|AAO92743.1|  xyloglucan endotransglycosylase                         229   4e-68    
gb|ACK36946.1|  xyloglucan endotransglycosylase                         229   4e-68    
ref|XP_006449090.1|  hypothetical protein CICLE_v10015776mg             231   4e-68    
ref|XP_002438936.1|  hypothetical protein SORBIDRAFT_10g028580          229   4e-68    
gb|AGL76311.1|  xyloglucan endotransglycosylase/hydrolase 1             226   4e-68    
ref|XP_010240917.1|  PREDICTED: probable xyloglucan endotransgluc...    229   4e-68    
gb|KDP41894.1|  hypothetical protein JCGZ_26912                         229   4e-68    
ref|XP_009597028.1|  PREDICTED: brassinosteroid-regulated protein...    229   5e-68    
gb|ACF79515.1|  unknown                                                 226   5e-68    
ref|XP_009784847.1|  PREDICTED: probable xyloglucan endotransgluc...    228   5e-68    
ref|XP_008779173.1|  PREDICTED: xyloglucan endotransglucosylase/h...    229   5e-68    
gb|ABK22283.1|  unknown                                                 228   5e-68    
ref|XP_010927060.1|  PREDICTED: brassinosteroid-regulated protein...    228   6e-68    
gb|ABI37007.2|  xyloglucan endotransglycosylase                         228   6e-68    
ref|XP_009394877.1|  PREDICTED: probable xyloglucan endotransgluc...    228   6e-68    
ref|XP_006453414.1|  hypothetical protein CICLE_v10009119mg             228   6e-68    
ref|XP_008812130.1|  PREDICTED: probable xyloglucan endotransgluc...    228   6e-68    
gb|KHG09063.1|  Xyloglucan endotransglucosylase/hydrolase 22 -lik...    228   6e-68    
ref|XP_003624550.1|  Xyloglucan endotransglucosylase                    228   7e-68    
ref|XP_009120272.1|  PREDICTED: xyloglucan endotransglucosylase/h...    228   7e-68    
ref|XP_006453421.1|  hypothetical protein CICLE_v10009118mg             228   7e-68    
ref|XP_010066388.1|  PREDICTED: probable xyloglucan endotransgluc...    228   7e-68    
gb|AFK39987.1|  unknown                                                 228   7e-68    
gb|EYU29578.1|  hypothetical protein MIMGU_mgv1a011198mg                228   7e-68    
gb|AEX07596.1|  xyloglucosyl transferase 1                              228   7e-68    
gb|ABK22206.1|  unknown                                                 228   8e-68    
ref|NP_001291229.1|  probable xyloglucan endotransglucosylase/hyd...    228   8e-68    
ref|XP_006401194.1|  hypothetical protein EUTSA_v10014326mg             228   8e-68    
ref|XP_006423881.1|  hypothetical protein CICLE_v10028851mg             228   8e-68    
gb|EMT07366.1|  Putative xyloglucan endotransglucosylase/hydrolas...    228   9e-68    
emb|CDP02960.1|  unnamed protein product                                225   9e-68    
ref|XP_003624546.1|  Xyloglucan endotransglucosylase/hydrolase          228   1e-67    
gb|ABV46535.1|  xyloglucan endotransglucosylase hydrolase 3             228   1e-67    
ref|XP_006412727.1|  hypothetical protein EUTSA_v10025941mg             227   1e-67    
ref|XP_002274520.1|  PREDICTED: probable xyloglucan endotransgluc...    228   1e-67    
ref|XP_006487657.1|  PREDICTED: probable xyloglucan endotransgluc...    228   1e-67    
ref|NP_001068033.1|  Os11g0539200                                       228   1e-67    
ref|XP_006423880.1|  hypothetical protein CICLE_v10028851mg             228   1e-67    
ref|XP_010526452.1|  PREDICTED: probable xyloglucan endotransgluc...    228   1e-67    
ref|NP_001289204.1|  probable xyloglucan endotransglucosylase/hyd...    227   1e-67    
gb|KFK27294.1|  hypothetical protein AALP_AA8G363800                    227   1e-67    
gb|EAY81204.1|  hypothetical protein OsI_36383                          228   1e-67    
ref|XP_006848861.1|  hypothetical protein AMTR_s00026p00217290          227   1e-67    
gb|AAF80590.1|AF223419_1  xyloglucan endotransglycosylase XET1          227   1e-67    
gb|ABK23125.1|  unknown                                                 227   1e-67    
ref|XP_010102170.1|  putative xyloglucan endotransglucosylase/hyd...    227   1e-67    
ref|XP_008225386.1|  PREDICTED: brassinosteroid-regulated protein...    227   1e-67    
ref|XP_002866213.1|  hypothetical protein ARALYDRAFT_918931             227   1e-67    
ref|XP_003577501.1|  PREDICTED: probable xyloglucan endotransgluc...    227   1e-67    
gb|AIS86152.1|  xyloglucan endo-transglycosylase                        227   1e-67    
ref|NP_001148984.1|  LOC100282604 precursor                             227   2e-67    
ref|XP_010483277.1|  PREDICTED: LOW QUALITY PROTEIN: probable xyl...    227   2e-67    
dbj|BAE06060.1|  xyloglucan endotransglucosylase/hydrolase              228   2e-67    
ref|XP_010446167.1|  PREDICTED: probable xyloglucan endotransgluc...    226   2e-67    
gb|AAR37363.1|  xyloglucan endo-transglycosylase                        226   2e-67    
gb|AAB18364.1|  xyloglucan endotransglycosylase-related protein         226   2e-67    
ref|XP_003624548.1|  Xyloglucan endotransglucosylase                    227   2e-67    
ref|NP_568859.2|  probable xyloglucan endotransglucosylase/hydrol...    227   2e-67    
ref|XP_002866212.1|  hypothetical protein ARALYDRAFT_495853             227   2e-67    
ref|XP_006474160.1|  PREDICTED: xyloglucan endotransglucosylase/h...    227   2e-67    
ref|XP_004251619.1|  PREDICTED: probable xyloglucan endotransgluc...    227   2e-67    
gb|ABE73118.1|  endo-transglycosylase                                   227   2e-67    
ref|XP_010929528.1|  PREDICTED: probable xyloglucan endotransgluc...    227   2e-67    
ref|XP_001781670.1|  predicted protein                                  226   2e-67    
ref|XP_010112970.1|  putative xyloglucan endotransglucosylase/hyd...    227   2e-67    
ref|NP_001265913.1|  probable xyloglucan endotransglucosylase/hyd...    227   2e-67    
ref|XP_010240916.1|  PREDICTED: probable xyloglucan endotransgluc...    225   2e-67    
dbj|BAH36874.1|  xyloglucan endotransglucosylase/hydrolase              227   2e-67    
ref|XP_010545428.1|  PREDICTED: xyloglucan endotransglucosylase/h...    226   2e-67    
ref|XP_006826491.1|  hypothetical protein AMTR_s00004p00248810          227   2e-67    
ref|XP_007025220.1|  Xyloglucan endotransglucosylase/hydrolase 16       227   2e-67    
gb|ADE76299.1|  unknown                                                 226   3e-67    
ref|XP_006353568.1|  PREDICTED: probable xyloglucan endotransgluc...    226   3e-67    
ref|XP_010688270.1|  PREDICTED: probable xyloglucan endotransgluc...    226   3e-67    
ref|XP_008799439.1|  PREDICTED: probable xyloglucan endotransgluc...    226   3e-67    
emb|CDX68640.1|  BnaC01g08130D                                          226   3e-67    
ref|XP_010526338.1|  PREDICTED: probable xyloglucan endotransgluc...    227   3e-67    
ref|XP_009417169.1|  PREDICTED: probable xyloglucan endotransgluc...    226   3e-67    
ref|XP_010249375.1|  PREDICTED: probable xyloglucan endotransgluc...    226   4e-67    
ref|XP_006385865.1|  hypothetical protein POPTR_0003s15800g             224   4e-67    
ref|NP_001281042.1|  probable xyloglucan endotransglucosylase/hyd...    226   4e-67    
ref|XP_008778441.1|  PREDICTED: probable xyloglucan endotransgluc...    226   4e-67    
ref|NP_001267579.1|  probable xyloglucan endotransglucosylase/hyd...    226   4e-67    
ref|XP_002320401.1|  xyloglucan endo-1 family protein                   226   4e-67    
ref|XP_006446867.1|  hypothetical protein CICLE_v10016123mg             226   4e-67    
ref|XP_011037716.1|  PREDICTED: probable xyloglucan endotransgluc...    226   4e-67    
ref|XP_006348946.1|  PREDICTED: probable xyloglucan endotransgluc...    226   5e-67    
ref|XP_001781702.1|  predicted protein                                  226   5e-67    
ref|XP_006848854.1|  hypothetical protein AMTR_s00026p00209160          224   5e-67    
ref|XP_010536922.1|  PREDICTED: probable xyloglucan endotransgluc...    226   5e-67    
ref|XP_009798277.1|  PREDICTED: probable xyloglucan endotransgluc...    225   5e-67    
ref|XP_008222293.1|  PREDICTED: probable xyloglucan endotransgluc...    226   5e-67    
gb|AEX07595.1|  xyloglucosyl transferase 2                              225   5e-67    
sp|Q41638.1|XTHA_PHAAN  RecName: Full=Xyloglucan endotransglucosy...    226   5e-67    
gb|AIS86114.1|  xyloglucan endo-transglycosylase                        226   5e-67    
ref|XP_007211780.1|  hypothetical protein PRUPE_ppa009685mg             225   6e-67    
gb|KEH43921.1|  xyloglucan endotransglucosylase/hydrolase family ...    226   6e-67    
ref|XP_007151620.1|  hypothetical protein PHAVU_004G062400g             226   6e-67    
ref|XP_002304928.2|  xyloglucan:xyloglucosyl transferase family p...    226   6e-67    
ref|XP_009414407.1|  PREDICTED: probable xyloglucan endotransgluc...    226   6e-67    
ref|XP_004493114.1|  PREDICTED: probable xyloglucan endotransgluc...    226   7e-67    
ref|XP_007161790.1|  hypothetical protein PHAVU_001G098300g             226   7e-67    
ref|XP_007223252.1|  hypothetical protein PRUPE_ppa009387mg             226   7e-67    
ref|XP_011086906.1|  PREDICTED: probable xyloglucan endotransgluc...    226   7e-67    
ref|NP_001280965.1|  probable xyloglucan endotransglucosylase/hyd...    226   7e-67    
ref|XP_001781705.1|  predicted protein                                  226   7e-67    
ref|XP_009380745.1|  PREDICTED: probable xyloglucan endotransgluc...    224   8e-67    
gb|ACT67416.1|  xyloglucan endotransglycosylase                         225   8e-67    
gb|KDP36434.1|  hypothetical protein JCGZ_08703                         225   8e-67    
gb|ABL10091.1|  xyloglucan endotransglycosylase                         225   8e-67    
gb|EYU32955.1|  hypothetical protein MIMGU_mgv1a022549mg                224   8e-67    
gb|AIS86132.1|  xyloglucan endo-transglycosylase                        225   8e-67    
gb|AIS86145.1|  xyloglucan endo-transglycosylase                        225   8e-67    
dbj|BAA34946.1|  EXGT1                                                  225   9e-67    
gb|AIS86151.1|  xyloglucan endo-transglycosylase                        225   9e-67    
gb|AIS86125.1|  xyloglucan endo-transglycosylase                        225   9e-67    
ref|XP_001780149.1|  predicted protein                                  225   9e-67    
gb|AIS86121.1|  xyloglucan endo-transglycosylase                        225   9e-67    
gb|AFK39245.1|  unknown                                                 225   9e-67    
gb|AIS86126.1|  xyloglucan endo-transglycosylase                        225   9e-67    
ref|XP_004979406.1|  PREDICTED: probable xyloglucan endotransgluc...    225   9e-67    
ref|XP_010101479.1|  putative xyloglucan endotransglucosylase/hyd...    226   9e-67    
gb|AAB39950.1|  xyloglucan endotransglycosylase                         225   1e-66    
ref|XP_008369587.1|  PREDICTED: probable xyloglucan endotransgluc...    226   1e-66    
ref|XP_007211698.1|  hypothetical protein PRUPE_ppa009245mg             225   1e-66    
ref|XP_010656825.1|  PREDICTED: probable xyloglucan endotransgluc...    225   1e-66    
ref|XP_009602932.1|  PREDICTED: probable xyloglucan endotransgluc...    225   1e-66    
emb|CDX69621.1|  BnaA10g19700D                                          225   1e-66    
gb|AIS86124.1|  xyloglucan endo-transglycosylase                        225   1e-66    
ref|XP_009121720.1|  PREDICTED: probable xyloglucan endotransgluc...    225   1e-66    
ref|XP_006858036.1|  hypothetical protein AMTR_s00062p00016540          225   1e-66    
emb|CAN80250.1|  hypothetical protein VITISV_036640                     225   1e-66    
gb|AIS86142.1|  xyloglucan endo-transglycosylase                        225   1e-66    
ref|XP_009108993.1|  PREDICTED: xyloglucan endotransglucosylase/h...    224   1e-66    
gb|KHF98175.1|  putative xyloglucan endotransglucosylase/hydrolas...    225   1e-66    
gb|AAW27915.1|  xyloglucan endotransglucosylase/hydrolase precursor     224   1e-66    
gb|AEQ37176.1|  xyloglucan endotransglucosylase/hydrolase               225   1e-66    
ref|XP_008453618.1|  PREDICTED: probable xyloglucan endotransgluc...    226   1e-66    
ref|XP_004299202.1|  PREDICTED: probable xyloglucan endotransgluc...    225   1e-66    
ref|XP_010929299.1|  PREDICTED: xyloglucan endotransglucosylase/h...    225   1e-66    
gb|ABM91063.1|  xyloglucan endotransglycosylase/hydrolase precurs...    225   1e-66    
gb|AAT84462.1|  putative xyloglucan endotransglucosylase/hydrolase      224   1e-66    
gb|ADE42490.1|  xyloglucan endotransglucosylase/hydrolase 1             225   1e-66    
ref|XP_008360204.1|  PREDICTED: xyloglucan endotransglucosylase/h...    225   1e-66    
gb|KHG12145.1|  putative xyloglucan endotransglucosylase/hydrolase B    226   1e-66    
gb|EPS65701.1|  xyloglucan endotransglycosylase                         224   1e-66    
ref|NP_001289208.1|  probable xyloglucan endotransglucosylase/hyd...    224   2e-66    
emb|CDY09832.1|  BnaC09g43290D                                          224   2e-66    



>ref|XP_009780350.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 10 [Nicotiana sylvestris]
Length=294

 Score =   367 bits (941),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 179/278 (64%), Positives = 216/278 (78%), Gaps = 2/278 (1%)
 Frame = -3

Query  1101  HVSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQF  922
             H+SLAS+VSTGDFN+DF VI  +P H+NTSADG + SL  D  + S   S    YLFGQF
Sbjct  19    HISLASIVSTGDFNKDFPVITWSPNHVNTSADGHTRSLIFDKESGSGIASNDT-YLFGQF  77

Query  921   VMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQ  742
              MK+KL+PG SAGTV AFYL S    +RDE+DFEFLGNV G  YTLQTNV+ +G  +REQ
Sbjct  78    DMKIKLIPGNSAGTVVAFYLTS-YQPNRDEVDFEFLGNVPGKPYTLQTNVYVDGLDDREQ  136

Query  741   KIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWD  562
             +I LWFDPT+DFH Y+ILWN++ IVFMVD VPIRTYRNHADKG  YP  QP   Q+S+W+
Sbjct  137   RINLWFDPTQDFHTYSILWNLHQIVFMVDRVPIRTYRNHADKGAKYPRWQPMGLQLSIWN  196

Query  561   GSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTP  382
             G +WATDGG+ KIDWSKAPFIAS  DYTIDACVWKG+   CR +  +NWWN++ +STLT 
Sbjct  197   GETWATDGGKTKIDWSKAPFIASLGDYTIDACVWKGNARFCRGESENNWWNKEKFSTLTW  256

Query  381   IQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              QR L++WV KY +TYDYC D+QRF  ++P+ECSLPKY
Sbjct  257   TQRRLFKWVRKYHLTYDYCMDNQRFQNNLPIECSLPKY  294



>ref|XP_009605698.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 10 [Nicotiana tomentosiformis]
Length=293

 Score =   362 bits (930),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 177/278 (64%), Positives = 216/278 (78%), Gaps = 3/278 (1%)
 Frame = -3

Query  1101  HVSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQF  922
             H++LAS+VSTGDFN+DF V ++ P H+NTSADG + SL  D  + S   S    YLFGQF
Sbjct  19    HITLASIVSTGDFNKDFIVPWS-PNHVNTSADGHTRSLIFDKESGSGIASNDT-YLFGQF  76

Query  921   VMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQ  742
              MK+KL+PG SAGTV AFYL S    +RDE+DFEFLGNV G  YTLQTNV+ +G  +REQ
Sbjct  77    DMKIKLIPGNSAGTVVAFYLTS-YQPNRDEVDFEFLGNVPGKPYTLQTNVYVDGLDDREQ  135

Query  741   KIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWD  562
             +I LWFDPT+DFH Y+ILWN++ IVFMVD VPIRTYRNHADKG  YP  QP   QIS+W+
Sbjct  136   RINLWFDPTQDFHTYSILWNLHQIVFMVDRVPIRTYRNHADKGAKYPRWQPMALQISIWN  195

Query  561   GSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTP  382
             G SWATDGG+ KIDWSKAPF+AS  +YTIDACVWKG+   CR +  +NWWN++ +STLT 
Sbjct  196   GESWATDGGKTKIDWSKAPFVASLGNYTIDACVWKGNARFCRGESENNWWNKEKFSTLTW  255

Query  381   IQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              QR L++WV KY +TYDYC D+QRF  ++P+ECSLPKY
Sbjct  256   TQRRLFKWVRKYHLTYDYCMDNQRFQNNLPIECSLPKY  293



>ref|XP_009335370.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 10 [Pyrus x bretschneideri]
Length=295

 Score =   358 bits (918),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 173/274 (63%), Positives = 217/274 (79%), Gaps = 3/274 (1%)
 Frame = -3

Query  1089  ASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVMKM  910
             ASVVSTGDFN+DFFV ++ PGH+NTSADG++ SL LD  + +   S +  +LFGQ  M++
Sbjct  25    ASVVSTGDFNKDFFVTWS-PGHVNTSADGKTMSLKLDQESGAGFASNQM-FLFGQIDMQI  82

Query  909   KLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKIKL  730
             KLVPG+SAGTV A+YL SD   +RDE+D+EFLGNV G  Y LQTN+F +G  +RE++I L
Sbjct  83    KLVPGHSAGTVVAYYLTSD-QPNRDEVDYEFLGNVEGKPYILQTNIFADGLDDREERINL  141

Query  729   WFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGSSW  550
             WFDPT+DFH Y+ILWN++ IVFMVD VPIR YRNHADKGVA+P  QP   + SLW+G SW
Sbjct  142   WFDPTKDFHTYSILWNLHQIVFMVDWVPIRVYRNHADKGVAFPRWQPMSIKASLWNGDSW  201

Query  549   ATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQRG  370
             AT GGR KIDWSK PFIASF+++TIDACVWKG+P  CRAD P+NWWN++ + TL+  QR 
Sbjct  202   ATGGGRDKIDWSKGPFIASFRNHTIDACVWKGNPRFCRADSPTNWWNEERFGTLSNAQRR  261

Query  369   LYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
             L++WV KY + YDYC D +RF G++P ECSLPKY
Sbjct  262   LFKWVRKYHMIYDYCEDKERFQGNLPKECSLPKY  295



>ref|XP_009346542.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 10 [Pyrus x bretschneideri]
Length=295

 Score =   356 bits (913),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 172/274 (63%), Positives = 217/274 (79%), Gaps = 3/274 (1%)
 Frame = -3

Query  1089  ASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVMKM  910
             ASVVSTGDFN+DFFV ++ PGH+NTSADG++ SL LD  + +   S +  +LFGQ  M++
Sbjct  25    ASVVSTGDFNKDFFVTWS-PGHVNTSADGKTMSLKLDQESGAGFASNQM-FLFGQIDMQI  82

Query  909   KLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKIKL  730
             KLVPG+SAGTV A+YL SD   +RDE+D+EFLGNV G  Y LQTN+F +G  +RE++I L
Sbjct  83    KLVPGHSAGTVVAYYLTSD-QPNRDEVDYEFLGNVEGKPYILQTNIFADGLDDREERINL  141

Query  729   WFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGSSW  550
             WFDPT+DFH Y+ILWN++ IVFMVD VPIR YRNHADKGVA+P  QP   + SLW+G SW
Sbjct  142   WFDPTKDFHTYSILWNLHQIVFMVDWVPIRVYRNHADKGVAFPRWQPMSIKASLWNGDSW  201

Query  549   ATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQRG  370
             AT GGR KIDWSK PFIASF+++TIDACVWKG+   CRA+ P+NWWN++ +STL+  QR 
Sbjct  202   ATGGGRDKIDWSKGPFIASFRNHTIDACVWKGNARFCRAESPTNWWNEERFSTLSNAQRR  261

Query  369   LYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
             L++WV KY + YDYC D +RF G++P ECSLPKY
Sbjct  262   LFKWVRKYHMIYDYCEDKERFQGNLPKECSLPKY  295



>ref|XP_010245632.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 10 [Nelumbo nucifera]
Length=294

 Score =   355 bits (910),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 174/276 (63%), Positives = 216/276 (78%), Gaps = 3/276 (1%)
 Frame = -3

Query  1095  SLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVM  916
             SL+SVVS GDFN+DF+V+++ P H+NTSADGR+ SL LD  + +   S +  +LFG+  M
Sbjct  22    SLSSVVSVGDFNKDFYVMWS-PNHVNTSADGRTRSLILDKDSGAGFASNEM-FLFGEIDM  79

Query  915   KMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKI  736
             ++KLVPG+SAGTV AFYL SD   +RDE+DFEFLGNV G  Y LQTNVF +G+  RE++I
Sbjct  80    QIKLVPGHSAGTVVAFYLTSD-QPNRDEIDFEFLGNVTGQPYILQTNVFADGFDNREERI  138

Query  735   KLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGS  556
              LWFDPT+DFH Y+ILWN++ IVFMVD VPIR YRNHADKGVA+P  QP   +ISLW+G 
Sbjct  139   HLWFDPTKDFHTYSILWNLHQIVFMVDWVPIRVYRNHADKGVAFPRWQPMGIKISLWNGD  198

Query  555   SWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQ  376
             SWAT GGR K+DWSK PFIASF++Y IDAC+WKG+   CRAD  +NWWN+D YSTLT  Q
Sbjct  199   SWATRGGRDKVDWSKGPFIASFRNYKIDACIWKGNARFCRADSTTNWWNKDRYSTLTSTQ  258

Query  375   RGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
             R L++WV KY + YDYC D+ RF  ++P ECSLPKY
Sbjct  259   RRLFKWVRKYFLIYDYCLDNIRFQNNLPRECSLPKY  294



>ref|XP_006367106.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 10-like [Solanum tuberosum]
Length=293

 Score =   354 bits (909),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 168/278 (60%), Positives = 215/278 (77%), Gaps = 3/278 (1%)
 Frame = -3

Query  1101  HVSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQF  922
             H++LAS+VSTGD+N+DF+V Y+ P HINTS DGR+ +L  D  + +   +    YLFGQF
Sbjct  19    HIALASIVSTGDYNKDFYVTYS-PSHINTSVDGRTRNLIFDKESGTEIATKDM-YLFGQF  76

Query  921   VMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQ  742
              MK+KL+PG SAGTV AFYL S    +RDE+DFEFLGNVAG  YTLQTNV+ +G+ +REQ
Sbjct  77    DMKIKLIPGNSAGTVVAFYLASG-QPNRDEVDFEFLGNVAGKPYTLQTNVYVDGFDDREQ  135

Query  741   KIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWD  562
             +I LWFDPT+D+H Y+ILWN++ IVFMVD VPIRTYRNHADKG  YP  QP   ++S+W+
Sbjct  136   RINLWFDPTQDYHTYSILWNLHQIVFMVDWVPIRTYRNHADKGAKYPHWQPMELKLSIWN  195

Query  561   GSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTP  382
             G  WATDGG+ KI+WSKAPF+A+  +Y IDACVWKG+   CR +  ++WWN+   STLT 
Sbjct  196   GEDWATDGGKTKIEWSKAPFVATLGNYKIDACVWKGNARFCRVESENHWWNKGQSSTLTW  255

Query  381   IQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              QR L++WV KY +TYDYC D+QRF  ++P+ECSLPKY
Sbjct  256   TQRRLFKWVRKYHLTYDYCMDNQRFQNNMPIECSLPKY  293



>ref|XP_004230670.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 10 [Solanum lycopersicum]
Length=293

 Score =   353 bits (907),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 170/278 (61%), Positives = 214/278 (77%), Gaps = 3/278 (1%)
 Frame = -3

Query  1101  HVSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQF  922
             H++LAS+VSTGD+N+DF+V Y+ P HINTSADGR+ SL  D  + +   S    YLFGQF
Sbjct  19    HIALASIVSTGDYNKDFYVTYS-PNHINTSADGRTRSLIFDKESGTEIASKDM-YLFGQF  76

Query  921   VMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQ  742
              MK+KL+PG SAGTV AFYL S    +RDE+DFEFLGNV G  YTLQTNV+ +G+ +REQ
Sbjct  77    DMKIKLIPGNSAGTVVAFYLASG-QPNRDEIDFEFLGNVDGKRYTLQTNVYVDGFDDREQ  135

Query  741   KIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWD  562
             +I LWFDPT+D+H Y+ILWN++ IVFMVD VPIRTYRNHADKG  YP  QP   ++SLW+
Sbjct  136   RINLWFDPTQDYHTYSILWNLHQIVFMVDWVPIRTYRNHADKGAKYPHWQPMELKMSLWN  195

Query  561   GSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTP  382
             G  WATDGG+ KIDWSK+PF+A+   Y IDACVWKG+   CR +  ++WWN+   STLT 
Sbjct  196   GEDWATDGGKTKIDWSKSPFVATLGSYKIDACVWKGNARFCRVENENHWWNKGQSSTLTW  255

Query  381   IQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              QR L++WV KY +TYDYC D++RF  ++P+ECSLPKY
Sbjct  256   TQRRLFKWVRKYHLTYDYCMDNKRFQNNMPIECSLPKY  293



>ref|XP_007041418.1| Xyloglucan endotransglucosylase/hydrolase 10 [Theobroma cacao]
 gb|EOX97249.1| Xyloglucan endotransglucosylase/hydrolase 10 [Theobroma cacao]
Length=295

 Score =   352 bits (904),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 172/278 (62%), Positives = 215/278 (77%), Gaps = 3/278 (1%)
 Frame = -3

Query  1101  HVSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQF  922
              +S+ASVVSTGDF+ DFFV++A P H+NTSADGR  SL LD  + S   S +  +LFG+ 
Sbjct  21    RISIASVVSTGDFSNDFFVMWA-PSHVNTSADGRERSLKLDQESGSGFASNQM-FLFGRI  78

Query  921   VMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQ  742
              M++KLVPG SAGTV A+YL SD   +RDE+D EFLGNV+G  Y +QTN++ +G+  RE+
Sbjct  79    DMQIKLVPGNSAGTVLAYYLTSD-QPNRDEIDIEFLGNVSGQPYIVQTNIYADGFDNREE  137

Query  741   KIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWD  562
             +I LWFDPTEDFH Y++LWN+Y I+FMVDS+PIR YRNHADKGVAYP  QP   ++SLW+
Sbjct  138   RIYLWFDPTEDFHTYSVLWNLYQIMFMVDSIPIRLYRNHADKGVAYPRWQPMSIKVSLWN  197

Query  561   GSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTP  382
             G SWAT GG  KIDWSK PFIASFKDY IDACVW+G+P  CRAD   NWWN+  +STLT 
Sbjct  198   GGSWATRGGLEKIDWSKGPFIASFKDYKIDACVWQGNPRFCRADSSLNWWNRPRFSTLTR  257

Query  381   IQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
             +Q+  ++WV KY + YDYC D+QRF  ++P ECSLPKY
Sbjct  258   VQKRWFKWVRKYHMVYDYCQDNQRFQNNLPKECSLPKY  295



>ref|XP_007200513.1| hypothetical protein PRUPE_ppa009365mg [Prunus persica]
 gb|EMJ01712.1| hypothetical protein PRUPE_ppa009365mg [Prunus persica]
Length=295

 Score =   352 bits (904),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 170/278 (61%), Positives = 214/278 (77%), Gaps = 3/278 (1%)
 Frame = -3

Query  1101  HVSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQF  922
              ++  SVVSTGDFN+DFFV ++ P H+NTSADGR+ S+ LD  + +   S +  +LFGQ 
Sbjct  21    RITDCSVVSTGDFNKDFFVTWS-PSHVNTSADGRTRSMKLDQESGAGFASNQM-FLFGQI  78

Query  921   VMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQ  742
              M++KLVPG SAGTV A+YL SD   +RDE+DFEFLGNVAG  Y +QTN+F +G G RE+
Sbjct  79    DMQIKLVPGDSAGTVVAYYLTSD-QPNRDEVDFEFLGNVAGKPYIIQTNMFADGLGNREE  137

Query  741   KIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWD  562
             ++ LWFDPT+DFH Y+ILWN++ IVFMVD VPIR YRNHADKGVA+P  QP   + SLW+
Sbjct  138   RVNLWFDPTKDFHTYSILWNLHQIVFMVDWVPIRVYRNHADKGVAFPRWQPMSIKTSLWN  197

Query  561   GSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTP  382
             G SWAT GG+ K DWSK PFIASF++Y IDACVWKG+   CRA+ P+NWWN+  +STLT 
Sbjct  198   GDSWATRGGKDKTDWSKGPFIASFRNYKIDACVWKGNARFCRAESPTNWWNKKKFSTLTK  257

Query  381   IQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              QR L++WV K+ + YDYC D QRF G++P ECSLPKY
Sbjct  258   TQRRLFKWVRKHHMIYDYCQDKQRFQGNLPKECSLPKY  295



>ref|XP_011088148.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 10 [Sesamum indicum]
Length=292

 Score =   351 bits (901),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 172/274 (63%), Positives = 215/274 (78%), Gaps = 3/274 (1%)
 Frame = -3

Query  1089  ASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVMKM  910
             ASVVSTGDFN+DFFV ++ P H+ TSADGR+ SL LD  + S   S    +LFGQF M++
Sbjct  22    ASVVSTGDFNRDFFVTWS-PNHVKTSADGRNRSLILDKDSGSGFASNDM-FLFGQFDMQI  79

Query  909   KLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKIKL  730
             KLVPG SAGTV AFYL S+   +RDE+DFEFLGNVAG  Y LQTNV+ NG+  REQ+I+L
Sbjct  80    KLVPGNSAGTVVAFYLTSN-QPNRDEIDFEFLGNVAGQPYILQTNVYANGFDGREQRIRL  138

Query  729   WFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGSSW  550
             WFDPT+DFH Y++LWN++ IVFMVD VPIRTYRNHADKGVAYP  QP   Q+S+W+G SW
Sbjct  139   WFDPTKDFHTYSVLWNLHQIVFMVDWVPIRTYRNHADKGVAYPRWQPMGLQMSIWNGDSW  198

Query  549   ATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQRG  370
             AT GG+VK DW++ PF+ASF+++ IDAC+WKG+P  CRA  P+NWWN+D++S+L   QR 
Sbjct  199   ATSGGKVKTDWAQGPFVASFRNHKIDACIWKGNPRFCRAQSPTNWWNKDSFSSLNWAQRR  258

Query  369   LYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
             L+ WV KY + YDYC D++RFN S+P EC L KY
Sbjct  259   LFRWVRKYYLIYDYCQDNKRFNNSLPKECLLTKY  292



>ref|XP_010095629.1| putative xyloglucan endotransglucosylase/hydrolase protein 10 
[Morus notabilis]
 gb|EXB61536.1| putative xyloglucan endotransglucosylase/hydrolase protein 10 
[Morus notabilis]
Length=294

 Score =   350 bits (898),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 168/278 (60%), Positives = 213/278 (77%), Gaps = 3/278 (1%)
 Frame = -3

Query  1101  HVSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQF  922
              ++ +SVVSTGDFN+DFFV ++ P H+NTSA GR  SL LD  + +   S +  +LFG+ 
Sbjct  20    QIAESSVVSTGDFNKDFFVTWS-PSHVNTSAHGRERSLKLDQESGAGFSSNQM-FLFGEI  77

Query  921   VMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQ  742
              M++KLVPG+SAGTV A+YL SD   +RDE+DFEFLGNVAG  Y LQTN+F +G+  RE+
Sbjct  78    DMQVKLVPGHSAGTVVAYYLTSD-QPNRDEIDFEFLGNVAGQPYILQTNIFADGFDNREE  136

Query  741   KIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWD  562
             ++ LWFDPT+DFH Y+ILWN++ IVFMVD VPIR YRNHADKGV +P  QP   ++SLWD
Sbjct  137   RVNLWFDPTKDFHTYSILWNLHQIVFMVDWVPIRVYRNHADKGVGFPRWQPMSIKVSLWD  196

Query  561   GSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTP  382
             G SWAT GGR KIDWSK PFIASFK+Y IDAC+W G+   CR + P+NWW++  YSTLT 
Sbjct  197   GDSWATRGGRDKIDWSKGPFIASFKNYKIDACIWNGNARFCRGESPTNWWHKHKYSTLTS  256

Query  381   IQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              QR L++WV KY + YDYC D++RF  ++P ECSLPKY
Sbjct  257   TQRRLFKWVRKYHMIYDYCQDNERFQNNLPKECSLPKY  294



>ref|XP_002522076.1| Xyloglucan endotransglucosylase/hydrolase protein A precursor, 
putative [Ricinus communis]
 gb|EEF40276.1| Xyloglucan endotransglucosylase/hydrolase protein A precursor, 
putative [Ricinus communis]
Length=294

 Score =   350 bits (898),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 174/278 (63%), Positives = 213/278 (77%), Gaps = 3/278 (1%)
 Frame = -3

Query  1101  HVSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQF  922
              +S +SVVSTGDFN+DFFV ++ P HINTSADGR+ SL LD  + S   S +  +LFGQF
Sbjct  20    QISFSSVVSTGDFNKDFFVSWS-PSHINTSADGRTRSLELDQESGSGFDSKQM-FLFGQF  77

Query  921   VMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQ  742
              M++KLVPG SAGTV AFYL SD   +RDE+DFEFLG V G  Y LQTNV+ +G+ +RE+
Sbjct  78    DMQIKLVPGNSAGTVVAFYLASD-QPNRDEIDFEFLGTVPGQPYILQTNVYADGFDDREE  136

Query  741   KIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWD  562
             +I LWFDPT  FH Y++LWNIY IVFMVDS+PIR YRNHADKGVAYP  QP   + S+W+
Sbjct  137   RIILWFDPTLKFHTYSVLWNIYQIVFMVDSIPIRVYRNHADKGVAYPRWQPMSIKGSIWN  196

Query  561   GSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTP  382
             G +WAT GG+ KIDWS+APFI SF +Y IDAC+WKG+P  CRAD  +NWWN+  Y+TLTP
Sbjct  197   GENWATRGGKDKIDWSQAPFITSFSNYRIDACIWKGNPRFCRADSSTNWWNKKAYNTLTP  256

Query  381   IQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
             IQR  Y+WV  + + YDYC D QRF+  +P ECSLPKY
Sbjct  257   IQRRWYKWVRLHHLIYDYCQDKQRFHNILPKECSLPKY  294



>ref|XP_006486864.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 10-like [Citrus sinensis]
Length=294

 Score =   348 bits (894),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 170/278 (61%), Positives = 213/278 (77%), Gaps = 3/278 (1%)
 Frame = -3

Query  1101  HVSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQF  922
              +S ASVVSTGDFN+DFFV ++ P H+NTSADG++ SL LD  + +   S +  +LFGQ 
Sbjct  20    QISRASVVSTGDFNKDFFVTWS-PSHVNTSADGKARSLKLDQESGAGFSSNQM-FLFGQL  77

Query  921   VMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQ  742
              M++KLVPG SAGTV  FY+ SD   +RDE+DFEFLGNV+G  Y LQTN++ +G   REQ
Sbjct  78    DMQIKLVPGDSAGTVLGFYMASD-QPNRDEIDFEFLGNVSGQPYILQTNIYADGSDNREQ  136

Query  741   KIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWD  562
             +I LWFDPT+DFH Y+ILWN++ IV MVDSVPIRTYRNHA++GV YP  QP   +ISLW+
Sbjct  137   RIYLWFDPTKDFHTYSILWNLHQIVLMVDSVPIRTYRNHANEGVPYPRWQPMSIKISLWN  196

Query  561   GSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTP  382
             G SWAT GG+ KIDWS+ PF+ASF++Y IDACVW G+P  CRA  P+NWWNQ  +STLT 
Sbjct  197   GDSWATRGGQDKIDWSQGPFVASFRNYKIDACVWNGNPRFCRAGSPTNWWNQKQFSTLTS  256

Query  381   IQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
             IQR L++WV  Y + YDYC D+QRF  ++P ECSL KY
Sbjct  257   IQRRLFKWVRNYHVIYDYCQDNQRFQNNLPKECSLSKY  294



>gb|KEH43977.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
Length=296

 Score =   349 bits (895),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 167/278 (60%), Positives = 216/278 (78%), Gaps = 3/278 (1%)
 Frame = -3

Query  1101  HVSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQF  922
             H+S+AS+VSTGDFN+DFFVI++ P H+NTS DG++ SL LD  + +   S +  +LFGQ 
Sbjct  22    HISIASIVSTGDFNKDFFVIWS-PNHVNTSDDGKTRSLKLDQESGAGFASNQM-FLFGQI  79

Query  921   VMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQ  742
              M++KLVPG SAGTV AFYL SD   +RDE+D EFLGNV+G  Y LQTN++ +G+  RE+
Sbjct  80    DMQIKLVPGDSAGTVLAFYLTSD-QPNRDEIDLEFLGNVSGQPYILQTNIYADGFDNREE  138

Query  741   KIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWD  562
             +I LWFDPT+DFH Y++LWN++ IVFMVD++PIR YRNHADKGVA+P  QP   + +LW+
Sbjct  139   RIFLWFDPTKDFHTYSVLWNLHQIVFMVDTIPIRVYRNHADKGVAFPRWQPMSLKATLWN  198

Query  561   GSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTP  382
             G SWAT GG+ KIDW   PFIASF++Y IDACVWKG+P  CRA   +NWWNQ N+S+LT 
Sbjct  199   GDSWATRGGQDKIDWKNGPFIASFRNYKIDACVWKGNPRFCRAASSTNWWNQFNFSSLTS  258

Query  381   IQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
             IQR  ++WV KY + YDYC D++RF  ++P ECSLPKY
Sbjct  259   IQRRWFKWVRKYHMIYDYCQDNERFQNNLPKECSLPKY  296



>ref|XP_004496796.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 10-like [Cicer arietinum]
Length=295

 Score =   348 bits (894),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 168/278 (60%), Positives = 215/278 (77%), Gaps = 3/278 (1%)
 Frame = -3

Query  1101  HVSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQF  922
              VS+AS+VSTGDFN+DFFVI++ P H+NTS+DG++ SL LD  + +   S +  +LFGQ 
Sbjct  21    QVSIASIVSTGDFNEDFFVIWS-PTHVNTSSDGKTRSLKLDQESGAGFASNQM-FLFGQI  78

Query  921   VMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQ  742
              M++KLVPG+SAG+V AFYL SD   +RDE+D EFLGNV+G  Y LQTN+F +G+  RE+
Sbjct  79    DMEIKLVPGHSAGSVLAFYLTSD-QPNRDEIDLEFLGNVSGQPYILQTNIFADGFDNREE  137

Query  741   KIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWD  562
             +I LWFDPT+DFH Y++LWN++ IVFMVD +PIR YRNHADKGVA+P  QP   + +LW+
Sbjct  138   RIYLWFDPTKDFHTYSVLWNLHQIVFMVDRIPIRVYRNHADKGVAFPRWQPMSLKATLWN  197

Query  561   GSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTP  382
             G SWAT GG+ KIDW   PFIASF++Y IDACVWKG+P  CRA   +NWWNQ N+STLT 
Sbjct  198   GDSWATRGGQDKIDWKYGPFIASFRNYKIDACVWKGNPRFCRASTSTNWWNQYNFSTLTS  257

Query  381   IQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              QR  ++WV KY I YDYC D++RF  ++P ECSLPKY
Sbjct  258   TQRSWFKWVRKYHIIYDYCQDNERFQNNLPRECSLPKY  295



>emb|CAN70891.1| hypothetical protein VITISV_039824 [Vitis vinifera]
Length=277

 Score =   348 bits (892),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 169/277 (61%), Positives = 216/277 (78%), Gaps = 3/277 (1%)
 Frame = -3

Query  1098  VSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFV  919
             VS ASVVSTGDFN+DFFVI++ P H+NTSADG + SL LD  + +   S +  +LFGQ  
Sbjct  4     VSDASVVSTGDFNKDFFVIWS-PSHVNTSADGHARSLKLDKESGAGFASNQL-FLFGQID  61

Query  918   MKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQK  739
             M++KLV G+SAGTV A+YL SD   +RDE+DFEFLGNV+G  Y LQTNVF +G+  RE++
Sbjct  62    MQIKLVTGHSAGTVVAYYLTSD-QPNRDEVDFEFLGNVSGQPYILQTNVFADGFDNREER  120

Query  738   IKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDG  559
             I LWFDPTEDFH Y+ILWN++ IVFMVD VPIR YRNHADKGVA+P  QP   +ISLW+G
Sbjct  121   IYLWFDPTEDFHTYSILWNLHQIVFMVDWVPIRVYRNHADKGVAFPRWQPMSIKISLWNG  180

Query  558   SSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPI  379
              SWAT GG+ KIDW+K PFIASF++Y +DAC+W+G+   CRAD P+NWWN++ +S+LT  
Sbjct  181   DSWATRGGKDKIDWTKGPFIASFRNYKLDACIWRGNARFCRADSPTNWWNKERFSSLTST  240

Query  378   QRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
             QR L++WV  + + YDYC D++RF  ++P EC LPKY
Sbjct  241   QRRLFKWVRTHHLIYDYCQDNERFQNNLPKECFLPKY  277



>ref|XP_004289703.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 10-like [Fragaria vesca subsp. vesca]
Length=294

 Score =   348 bits (893),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 168/278 (60%), Positives = 212/278 (76%), Gaps = 3/278 (1%)
 Frame = -3

Query  1101  HVSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQF  922
              ++  SVVSTGDFN+DFFV ++ P H+NTSADG++ SL LD  + +   S +  +LFGQ 
Sbjct  20    QITSGSVVSTGDFNKDFFVTWS-PSHVNTSADGKTRSLKLDQESGAGFASNQM-FLFGQI  77

Query  921   VMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQ  742
              M++KLVPG SAGTV A+YL SD    RDE+DFEFLGNV G  Y +QTN+F +G+  RE+
Sbjct  78    DMQIKLVPGRSAGTVVAYYLTSD-QPKRDEVDFEFLGNVEGKPYIIQTNIFADGFDNREE  136

Query  741   KIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWD  562
             +I LWFDPT+DFH Y+ILWN++ IVFMVD VPIR YRNHADKGVAYP  QP   + SLW+
Sbjct  137   RINLWFDPTKDFHTYSILWNLHQIVFMVDWVPIRVYRNHADKGVAYPRWQPMSIKTSLWN  196

Query  561   GSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTP  382
             G +WAT GGR KIDWSK PFIASF+++ IDAC+W+G+   CRA+ P+NWW+Q  YSTLT 
Sbjct  197   GDTWATGGGRDKIDWSKGPFIASFRNHKIDACIWEGNARFCRAESPTNWWHQKKYSTLTS  256

Query  381   IQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              QR L++WV KY + YDYC D +RF G++P EC LPKY
Sbjct  257   AQRRLFKWVRKYHMIYDYCQDKERFQGNLPKECLLPKY  294



>ref|XP_002270633.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 10 [Vitis vinifera]
Length=295

 Score =   348 bits (893),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 169/278 (61%), Positives = 216/278 (78%), Gaps = 3/278 (1%)
 Frame = -3

Query  1101  HVSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQF  922
              VS ASVVSTGDFN+DFFVI++ P H+NTSADG + SL LD  + +   S +  +LFGQ 
Sbjct  21    QVSDASVVSTGDFNKDFFVIWS-PSHVNTSADGHARSLKLDKESGAGFASNQL-FLFGQI  78

Query  921   VMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQ  742
              M++KLV G+SAGTV A+YL SD   +RDE+DFEFLGNV+G  Y LQTNVF +G+  RE+
Sbjct  79    DMQIKLVTGHSAGTVVAYYLTSD-QPNRDEVDFEFLGNVSGQPYILQTNVFADGFDNREE  137

Query  741   KIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWD  562
             +I LWFDPTEDFH Y+ILWN++ IVFMVD VPIR YRNHADKGVA+P  QP   +ISLW+
Sbjct  138   RIYLWFDPTEDFHTYSILWNLHQIVFMVDWVPIRVYRNHADKGVAFPRWQPMSIKISLWN  197

Query  561   GSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTP  382
             G SWAT GG+ KIDW+K PFIASF++Y +DAC+W+G+   CRAD P+NWWN++ +S+LT 
Sbjct  198   GDSWATRGGKDKIDWTKGPFIASFRNYKLDACIWRGNARFCRADSPTNWWNKERFSSLTS  257

Query  381   IQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              QR L++WV  + + YDYC D++RF  ++P EC LPKY
Sbjct  258   TQRRLFKWVRTHHLIYDYCQDNERFQNNLPKECFLPKY  295



>ref|XP_010248303.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 10 [Nelumbo nucifera]
Length=295

 Score =   348 bits (893),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 171/276 (62%), Positives = 213/276 (77%), Gaps = 3/276 (1%)
 Frame = -3

Query  1095  SLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVM  916
             S +SVVS GDFN+DF+V ++ P H+NTSADGR+ SL LD  + +   S +  +LFG+  M
Sbjct  23    SQSSVVSVGDFNKDFYVTWS-PNHVNTSADGRTRSLILDKDSGAGFASNEM-FLFGEIDM  80

Query  915   KMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKI  736
             ++KLVPG+SAGTV AFYL SD   +RDE+DFEFLGNVAG  Y LQTN+F +G+  RE++I
Sbjct  81    QIKLVPGHSAGTVVAFYLTSD-QPNRDEIDFEFLGNVAGKPYILQTNIFVDGFDNREERI  139

Query  735   KLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGS  556
              LWFDPT+DFH Y+ILWN++ IVFMVD VP R YRNHADKGVA+P  QP   +ISLW+G 
Sbjct  140   NLWFDPTKDFHTYSILWNLHQIVFMVDWVPFRVYRNHADKGVAFPRWQPMSIKISLWNGE  199

Query  555   SWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQ  376
             SWAT GGR KIDWSK PF+ASF +Y IDAC+W+G+   CRAD  SNWWN+D YSTLT  Q
Sbjct  200   SWATHGGRDKIDWSKGPFVASFGNYKIDACIWRGNARFCRADSTSNWWNKDRYSTLTWPQ  259

Query  375   RGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
             R L++WV  + + YDYC D+QRF  ++P ECSLPKY
Sbjct  260   RRLFKWVRMHHLIYDYCQDNQRFQNNLPKECSLPKY  295



>ref|XP_006422726.1| hypothetical protein CICLE_v10029863mg [Citrus clementina]
 gb|ESR35966.1| hypothetical protein CICLE_v10029863mg [Citrus clementina]
Length=304

 Score =   348 bits (892),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 169/278 (61%), Positives = 212/278 (76%), Gaps = 3/278 (1%)
 Frame = -3

Query  1101  HVSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQF  922
              +S ASVVSTGDFN+DFFV ++ P H+NTS DG++ SL LD  + +   S +  +LFGQ 
Sbjct  30    QISRASVVSTGDFNKDFFVTWS-PSHVNTSEDGKARSLKLDQESGAGFSSNQM-FLFGQL  87

Query  921   VMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQ  742
              M++KLVPG SAGTV  FY+ SD   +RDE+DFEFLGNV+G  Y LQTN++ +G   REQ
Sbjct  88    DMQIKLVPGDSAGTVVGFYMASD-QPNRDEIDFEFLGNVSGQPYILQTNIYADGSDNREQ  146

Query  741   KIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWD  562
             +I LWFDPT+DFH Y+ILWN++ IV MVDSVPIRTYRNHA++GV YP  QP   +ISLW+
Sbjct  147   RIYLWFDPTKDFHTYSILWNLHQIVLMVDSVPIRTYRNHANEGVPYPRWQPMSIKISLWN  206

Query  561   GSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTP  382
             G SWAT GG+ KIDWS+ PF+ASF++Y IDACVW G+P  CRA  P+NWWNQ  +STLT 
Sbjct  207   GDSWATRGGQDKIDWSQGPFVASFRNYKIDACVWNGNPRFCRAGSPTNWWNQKQFSTLTS  266

Query  381   IQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
             IQR L++WV  Y + YDYC D+QRF  ++P ECSL KY
Sbjct  267   IQRRLFKWVRNYHVIYDYCQDNQRFQNNLPKECSLSKY  304



>gb|KDO49501.1| hypothetical protein CISIN_1g022638mg [Citrus sinensis]
Length=294

 Score =   347 bits (891),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 169/278 (61%), Positives = 212/278 (76%), Gaps = 3/278 (1%)
 Frame = -3

Query  1101  HVSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQF  922
              +S ASVVSTGDFN+DFFV ++ P H+NTS DG++ SL LD  + +   S +  +LFGQ 
Sbjct  20    QISRASVVSTGDFNKDFFVTWS-PSHVNTSEDGKARSLKLDQESGAGFSSNQM-FLFGQL  77

Query  921   VMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQ  742
              M++KLVPG SAGTV  FY+ SD   +RDE+DFEFLGNV+G  Y LQTN++ +G   REQ
Sbjct  78    DMQIKLVPGDSAGTVVGFYMASD-QPNRDEIDFEFLGNVSGQPYILQTNIYADGSDNREQ  136

Query  741   KIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWD  562
             +I LWFDPT+DFH Y+ILWN++ IV MVDSVPIRTYRNHA++GV YP  QP   +ISLW+
Sbjct  137   RIYLWFDPTKDFHTYSILWNLHQIVLMVDSVPIRTYRNHANEGVPYPRWQPMSIKISLWN  196

Query  561   GSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTP  382
             G SWAT GG+ KIDWS+ PF+ASF++Y IDACVW G+P  CRA  P+NWWNQ  +STLT 
Sbjct  197   GDSWATRGGQDKIDWSQGPFVASFRNYKIDACVWNGNPRFCRAGSPTNWWNQKQFSTLTS  256

Query  381   IQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
             IQR L++WV  Y + YDYC D+QRF  ++P ECSL KY
Sbjct  257   IQRRLFKWVRNYHVIYDYCQDNQRFQNNLPKECSLSKY  294



>ref|XP_008785762.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 10 [Phoenix dactylifera]
Length=295

 Score =   347 bits (889),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 171/277 (62%), Positives = 210/277 (76%), Gaps = 3/277 (1%)
 Frame = -3

Query  1098  VSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFV  919
             +++ASVVSTG+FN DF++ ++ P H+NTSADG + SL LD  + SS  S    +LFGQ  
Sbjct  22    IAIASVVSTGNFNGDFYITWS-PSHVNTSADGHARSLKLDQESGSSIASNDM-FLFGQID  79

Query  918   MKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQK  739
             M++KL+PGYSAGTV AFYL SD   +RDE+DFEFLGNV G  Y LQTNVF +G   RE++
Sbjct  80    MQIKLIPGYSAGTVLAFYLTSD-QPNRDEIDFEFLGNVTGQPYILQTNVFADGLDNREER  138

Query  738   IKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDG  559
             I LWFDPT DFH Y+ILWN Y IVFMVD VPIR YRNHADKG A+P  QP   ++SLW+G
Sbjct  139   IYLWFDPTRDFHTYSILWNRYQIVFMVDWVPIRVYRNHADKGAAFPRWQPMSLKVSLWNG  198

Query  558   SSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPI  379
              +WAT GGR K+DWSK PFIAS ++Y IDACVWKG+P  CRAD  +NWWN+  +S+LT  
Sbjct  199   DNWATRGGRDKVDWSKGPFIASMRNYKIDACVWKGNPRLCRADSSTNWWNKPRFSSLTWS  258

Query  378   QRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
             QR L++WVMKY + YDYC D +RF   +P ECSLPKY
Sbjct  259   QRRLFKWVMKYHLIYDYCQDPKRFQNRLPRECSLPKY  295



>ref|XP_008236227.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 10 isoform X1 [Prunus mume]
 ref|XP_008236228.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 10 isoform X2 [Prunus mume]
Length=294

 Score =   345 bits (886),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 168/278 (60%), Positives = 214/278 (77%), Gaps = 4/278 (1%)
 Frame = -3

Query  1101  HVSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQF  922
              ++  SVVSTGDFN+DFFV ++ P H+NTSADGR+ S+ LD  + +   S +  +LFGQ 
Sbjct  21    RITDGSVVSTGDFNKDFFVTWS-PSHVNTSADGRARSMKLDQESGAGFASNQM-FLFGQI  78

Query  921   VMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQ  742
              M++KLVPG SAGTV A+YL SD   +RDE+DFEFLGNVAG  Y +QTN+F +G+G RE+
Sbjct  79    DMQIKLVPGDSAGTVVAYYLTSD-QPNRDEVDFEFLGNVAGKPYIIQTNMFADGFGNREE  137

Query  741   KIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWD  562
             ++ LWFDPT+DFH Y+ILWN++ IVFMVD VPIR YRNHADKGVA+P  QP   + SLW+
Sbjct  138   RVNLWFDPTKDFHTYSILWNLHQIVFMVDWVPIRVYRNHADKGVAFPRWQPMSIKTSLWN  197

Query  561   GSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTP  382
             G SWAT  G+ K DWSK PFIASF++Y IDACVWKG+   CRA+ P+NWWN+  +STLT 
Sbjct  198   GVSWATR-GKDKTDWSKGPFIASFRNYKIDACVWKGNARFCRAESPTNWWNKKKFSTLTK  256

Query  381   IQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              QR L++WV K+ + Y+YC D QRF G++P ECSLPKY
Sbjct  257   TQRRLFKWVRKHHMIYEYCQDKQRFQGNLPKECSLPKY  294



>emb|CBI25107.3| unnamed protein product [Vitis vinifera]
Length=323

 Score =   344 bits (883),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 167/276 (61%), Positives = 214/276 (78%), Gaps = 3/276 (1%)
 Frame = -3

Query  1101  HVSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQF  922
              VS ASVVSTGDFN+DFFVI++ P H+NTSADG + SL LD  + +   S +  +LFGQ 
Sbjct  21    QVSDASVVSTGDFNKDFFVIWS-PSHVNTSADGHARSLKLDKESGAGFASNQL-FLFGQI  78

Query  921   VMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQ  742
              M++KLV G+SAGTV A+YL SD   +RDE+DFEFLGNV+G  Y LQTNVF +G+  RE+
Sbjct  79    DMQIKLVTGHSAGTVVAYYLTSD-QPNRDEVDFEFLGNVSGQPYILQTNVFADGFDNREE  137

Query  741   KIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWD  562
             +I LWFDPTEDFH Y+ILWN++ IVFMVD VPIR YRNHADKGVA+P  QP   +ISLW+
Sbjct  138   RIYLWFDPTEDFHTYSILWNLHQIVFMVDWVPIRVYRNHADKGVAFPRWQPMSIKISLWN  197

Query  561   GSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTP  382
             G SWAT GG+ KIDW+K PFIASF++Y +DAC+W+G+   CRAD P+NWWN++ +S+LT 
Sbjct  198   GDSWATRGGKDKIDWTKGPFIASFRNYKLDACIWRGNARFCRADSPTNWWNKERFSSLTS  257

Query  381   IQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLP  274
              QR L++WV  + + YDYC D++RF  ++P EC LP
Sbjct  258   TQRRLFKWVRTHHLIYDYCQDNERFQNNLPKECFLP  293



>ref|XP_003555312.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 10-like [Glycine max]
Length=296

 Score =   343 bits (879),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 168/278 (60%), Positives = 214/278 (77%), Gaps = 3/278 (1%)
 Frame = -3

Query  1101  HVSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQF  922
              VS+AS+VSTGDFN+DFFVI++ P H+NTS+DG + SL LD  + S   S +  +LFGQ 
Sbjct  22    QVSVASIVSTGDFNKDFFVIWS-PTHVNTSSDGHTRSLILDQESGSGFASNQM-FLFGQI  79

Query  921   VMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQ  742
              M++KLVP  SAGTV A+YL SD   +RDE+DFEFLGNV+G  Y LQTN+F +G   RE+
Sbjct  80    DMQIKLVPADSAGTVLAYYLTSD-QPNRDEIDFEFLGNVSGQPYILQTNIFADGTDNREE  138

Query  741   KIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWD  562
             +I LWFDPT+DFH+Y++LWN++ IV MVD +PIR YRNHADKGVA+P  QP   + +LW+
Sbjct  139   RIYLWFDPTKDFHSYSVLWNMHQIVLMVDMIPIRVYRNHADKGVAFPRWQPMSLKATLWN  198

Query  561   GSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTP  382
             G SWAT GG+ KIDW+K PFIASF++Y IDACVWKG+P  CRA  P+NWWNQ + STLT 
Sbjct  199   GDSWATRGGQDKIDWTKGPFIASFRNYKIDACVWKGNPRFCRAASPTNWWNQYSSSTLTS  258

Query  381   IQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              QR  ++WV KY + YDYC D++RF  ++P ECSLPKY
Sbjct  259   TQRRWFKWVRKYHMIYDYCQDNERFQNNLPRECSLPKY  296



>ref|XP_007143154.1| hypothetical protein PHAVU_007G048300g [Phaseolus vulgaris]
 gb|ESW15148.1| hypothetical protein PHAVU_007G048300g [Phaseolus vulgaris]
Length=295

 Score =   342 bits (877),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 167/276 (61%), Positives = 214/276 (78%), Gaps = 3/276 (1%)
 Frame = -3

Query  1095  SLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVM  916
             S+ASVVSTGDFN+DFFVI++ P H+NTSADG++ SL LD  + +   S +  +LFGQ  M
Sbjct  23    SVASVVSTGDFNKDFFVIWS-PTHVNTSADGQTRSLKLDQESGAGFASNQM-FLFGQIDM  80

Query  915   KMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKI  736
             ++KLVPG SAGTV A+YL SD   +RDE+DFEFLGNV+G  Y LQTN+F +G   RE++I
Sbjct  81    QIKLVPGDSAGTVLAYYLTSD-QPNRDEIDFEFLGNVSGQPYILQTNIFADGTDNREERI  139

Query  735   KLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGS  556
              LWFDPT+DFH Y++LWN++ IV MVD++P+R YRNHA+KGVA+P  QP   + +LW+G 
Sbjct  140   YLWFDPTKDFHTYSVLWNMHQIVLMVDTIPVRVYRNHAEKGVAFPRWQPMSLKATLWNGD  199

Query  555   SWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQ  376
             SWAT GG+ KIDW+K PFIASF++Y ID CVWKG+P  CRA  P+NWWNQ + STLT  Q
Sbjct  200   SWATRGGQDKIDWTKGPFIASFRNYKIDGCVWKGNPRFCRAATPANWWNQYSSSTLTSTQ  259

Query  375   RGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
             R  ++WV KY + YDYC D+QRF  ++P ECSLPKY
Sbjct  260   RRWFKWVRKYHMIYDYCQDNQRFQNNLPRECSLPKY  295



>ref|XP_002883839.1| hypothetical protein ARALYDRAFT_480350 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60098.1| hypothetical protein ARALYDRAFT_480350 [Arabidopsis lyrata subsp. 
lyrata]
Length=298

 Score =   342 bits (877),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 168/277 (61%), Positives = 208/277 (75%), Gaps = 3/277 (1%)
 Frame = -3

Query  1098  VSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFV  919
             VS ASVVS+GDFN+DFFV ++ P H+NTS DGRS +L LD  + +S  S    +LFGQ  
Sbjct  25    VSQASVVSSGDFNKDFFVTWS-PTHVNTSNDGRSRTLKLDQESGASFSSIHR-FLFGQID  82

Query  918   MKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQK  739
             MK+KL+PG S GTV A+Y MS    +RDE+DFEFLGNV G  Y LQTNV+ +G   RE++
Sbjct  83    MKIKLIPGSSQGTVVAYY-MSSNQPNRDEIDFEFLGNVNGQPYILQTNVYADGIDNREER  141

Query  738   IKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDG  559
             I LWFDPT+DFH Y+ILWNI+ IVFMVD +PIR YRNHA+KGVAYP  +P   Q SLW+G
Sbjct  142   IHLWFDPTKDFHTYSILWNIHQIVFMVDQIPIRLYRNHAEKGVAYPRLEPMSVQTSLWNG  201

Query  558   SSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPI  379
              SWAT GGR KIDW+K PF+ASF DY IDACVWKG+PS C  +   NWWN++ +S+LT +
Sbjct  202   ESWATRGGRDKIDWAKGPFVASFGDYKIDACVWKGNPSLCNGESNENWWNKNEFSSLTRV  261

Query  378   QRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
             Q+  ++WV KY + YDYC D+ RFN  +P ECSLPKY
Sbjct  262   QKRWFKWVRKYHLIYDYCQDNGRFNNKLPKECSLPKY  298



>emb|CCH26628.1| putative xyloglucan endotransglucosylase/hydrolase [Cucumis sativus]
Length=296

 Score =   342 bits (876),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 164/278 (59%), Positives = 210/278 (76%), Gaps = 3/278 (1%)
 Frame = -3

Query  1101  HVSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQF  922
              +S AS++STGD+N+DFF+ ++ P H+NTS DGR+ +L LD  + +   S +  +LFGQ 
Sbjct  22    QLSYASLISTGDYNKDFFITWS-PSHVNTSLDGRARNLKLDNDSGAGFASNEM-FLFGQM  79

Query  921   VMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQ  742
              MK+KLVPG SAGTV A+YL SD   +RDE+DFEFLGNV G    LQTN+F +G+ +RE+
Sbjct  80    DMKIKLVPGNSAGTVVAYYLTSD-QPNRDEIDFEFLGNVEGQPIILQTNIFADGFDDREE  138

Query  741   KIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWD  562
             +IKLWFDPT+DFH Y+ILWNIY IVFMVD VPIR YRNH DKGV YP  QP   ++SLW+
Sbjct  139   RIKLWFDPTKDFHTYSILWNIYQIVFMVDWVPIRVYRNHGDKGVGYPRWQPMSLKVSLWN  198

Query  561   GSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTP  382
             G SWAT GG+ KIDWSK PF+ASF DY +DAC+W+G+   CR +  SNWW+   Y+TL+P
Sbjct  199   GESWATRGGKDKIDWSKGPFVASFGDYKLDACIWRGNARFCRGESSSNWWHLPKYNTLSP  258

Query  381   IQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              QR L++WV KY + YDYC D+ RF+  +P ECSLPKY
Sbjct  259   FQRRLFKWVRKYHLIYDYCQDNLRFHNQLPKECSLPKY  296



>ref|XP_010467246.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 10 [Camelina sativa]
Length=298

 Score =   341 bits (875),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 170/277 (61%), Positives = 206/277 (74%), Gaps = 3/277 (1%)
 Frame = -3

Query  1098  VSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFV  919
             VS ASVVS+GDFN+DFFV ++ P H+NTS DGRS +L LD  + +S  ST+  +LFGQ  
Sbjct  25    VSQASVVSSGDFNKDFFVTWS-PSHVNTSNDGRSRTLKLDQESGASFASTQT-FLFGQID  82

Query  918   MKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQK  739
             MK+KL+PG S GTV A+Y+ SD    RDE+DFEFLGNV G  Y LQTNV+  G   RE++
Sbjct  83    MKIKLIPGSSQGTVVAYYMTSD-QPKRDEIDFEFLGNVNGQPYILQTNVYAEGIDNREER  141

Query  738   IKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDG  559
             I LWFDPT+DFH Y+ILWNI+ IVFMVD VPIR YRNHADKGVAYP  QP   Q SLW+G
Sbjct  142   IHLWFDPTKDFHTYSILWNIHQIVFMVDQVPIRLYRNHADKGVAYPRLQPMNVQASLWNG  201

Query  558   SSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPI  379
              SWAT GG  KIDWSK PF+ASF DY IDACVWKG P  C A+   NWWN++++S+LT +
Sbjct  202   ESWATRGGHDKIDWSKGPFVASFGDYKIDACVWKGSPKLCNAESNENWWNKNDFSSLTRV  261

Query  378   QRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
             Q+  ++WV KY + YDYC D  RFN  +P EC+ PKY
Sbjct  262   QKRWFKWVRKYHLIYDYCQDYGRFNNKLPKECNFPKY  298



>ref|XP_004150273.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 10-like [Cucumis sativus]
 ref|XP_004173764.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 10-like [Cucumis sativus]
 gb|KGN52729.1| hypothetical protein Csa_4G000010 [Cucumis sativus]
Length=308

 Score =   342 bits (876),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/278 (59%), Positives = 210/278 (76%), Gaps = 3/278 (1%)
 Frame = -3

Query  1101  HVSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQF  922
              +S AS++STGD+N+DFF+ ++ P H+NTS DGR+ +L LD  + +   S +  +LFGQ 
Sbjct  34    QLSYASLISTGDYNKDFFITWS-PSHVNTSLDGRARNLKLDNDSGAGFASNEM-FLFGQM  91

Query  921   VMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQ  742
              MK+KLVPG SAGTV A+YL SD   +RDE+DFEFLGNV G    LQTN+F +G+ +RE+
Sbjct  92    DMKIKLVPGNSAGTVVAYYLTSD-QPNRDEIDFEFLGNVEGQPIILQTNIFADGFDDREE  150

Query  741   KIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWD  562
             +IKLWFDPT+DFH Y+ILWNIY IVFMVD VPIR YRNH DKGV YP  QP   ++SLW+
Sbjct  151   RIKLWFDPTKDFHTYSILWNIYQIVFMVDWVPIRVYRNHGDKGVGYPRWQPMSLKVSLWN  210

Query  561   GSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTP  382
             G SWAT GG+ KIDWSK PF+ASF DY +DAC+W+G+   CR +  SNWW+   Y+TL+P
Sbjct  211   GESWATRGGKDKIDWSKGPFVASFGDYKLDACIWRGNARFCRGESSSNWWHLPKYNTLSP  270

Query  381   IQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              QR L++WV KY + YDYC D+ RF+  +P ECSLPKY
Sbjct  271   FQRRLFKWVRKYHLIYDYCQDNLRFHNQLPKECSLPKY  308



>gb|EYU18352.1| hypothetical protein MIMGU_mgv1a011021mg [Erythranthe guttata]
Length=294

 Score =   341 bits (874),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 171/277 (62%), Positives = 205/277 (74%), Gaps = 4/277 (1%)
 Frame = -3

Query  1095  SLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVM  916
             S A VVSTGDFN+DF V ++ P H+NTS DG +    +    +     T D +LFGQF M
Sbjct  21    SWALVVSTGDFNKDFSVNWS-PSHVNTSPDG-TERTLILDKNSGGGFVTNDMFLFGQFDM  78

Query  915   KMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKI  736
             K+KL+PG SAGTV AFYL S+   +RDE+DFEFLGNVAG  Y LQTNV+ NG+ EREQ+I
Sbjct  79    KIKLIPGNSAGTVVAFYLTSN-QTNRDEVDFEFLGNVAGQPYILQTNVYANGFDEREQRI  137

Query  735   KLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGS  556
             KLWFDPT+DFH Y+ILWNI+ IVFMVD VPIRTYRNHADKGV YP  QP   Q S+W+G 
Sbjct  138   KLWFDPTKDFHTYSILWNIHQIVFMVDWVPIRTYRNHADKGVPYPTWQPMALQTSIWNGE  197

Query  555   SWATDGGRVKIDWSKAPFIASFKDYTIDACVWKG-DPSECRADGPSNWWNQDNYSTLTPI  379
              WAT+GG+ KIDW+ +PF ASFKD+ IDAC+WKG DP  C A+ P+NWWN D + +LT  
Sbjct  198   DWATNGGKDKIDWTNSPFTASFKDHKIDACIWKGDDPGLCSAESPTNWWNNDRFGSLTWA  257

Query  378   QRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
             QR LY WV KY + YDYC D  RFN ++P ECSL KY
Sbjct  258   QRRLYRWVRKYYLVYDYCRDYPRFNNNLPRECSLTKY  294



>gb|AFK39293.1| unknown [Lotus japonicus]
Length=295

 Score =   341 bits (874),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/278 (58%), Positives = 212/278 (76%), Gaps = 3/278 (1%)
 Frame = -3

Query  1101  HVSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQF  922
              VS+ASVVSTGDFN+DFFVI++ P H+NTSADG + +L LD  + +   S +  +LFGQ 
Sbjct  21    QVSVASVVSTGDFNKDFFVIWS-PTHVNTSADGHTRTLKLDQESGAGFASNQK-FLFGQI  78

Query  921   VMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQ  742
              M++KLVPG+SAGTV A+YL SD   +RDE+D EFLGN++G+ Y LQTN++ NG   RE+
Sbjct  79    DMQIKLVPGHSAGTVLAYYLTSD-QPNRDEIDIEFLGNISGEPYILQTNIYANGSDNREE  137

Query  741   KIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWD  562
             +I LWFDPT+DFH Y+ILWN++ IV MVD++P+R YRNHADKG A+P  QP   +++LW+
Sbjct  138   RIHLWFDPTKDFHTYSILWNLHQIVIMVDTIPVRLYRNHADKGAAFPRWQPMSLKVTLWN  197

Query  561   GSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTP  382
             G  WAT GG+ KI+W+K PFIASF+DY IDACVWK +P  CRA  P+NWWNQ  +S+LT 
Sbjct  198   GDEWATRGGQDKINWTKGPFIASFRDYKIDACVWKRNPRFCRAASPANWWNQYKFSSLTS  257

Query  381   IQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
             IQR  ++WV KY + YDYC D++RF  + P EC  PKY
Sbjct  258   IQRRWFKWVRKYHMIYDYCQDNERFQNNFPRECFFPKY  295



>ref|XP_010065849.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 10 [Eucalyptus grandis]
 gb|KCW63538.1| hypothetical protein EUGRSUZ_G01174 [Eucalyptus grandis]
Length=292

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 162/269 (60%), Positives = 209/269 (78%), Gaps = 3/269 (1%)
 Frame = -3

Query  1074  TGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVMKMKLVPG  895
             TG+FN+DFFV+++ P H+NTSADGR+ S+ LD  + +   S    +LFGQ  MK+KL+ G
Sbjct  27    TGNFNKDFFVMWS-PDHVNTSADGRTRSMVLDQESGAGFSSNDM-FLFGQIDMKIKLISG  84

Query  894   YSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKIKLWFDPT  715
             +SAGTV AFYL SD   +RDE+DFEFLGNV+G  Y LQTNV+ +G+  RE++I LWFDPT
Sbjct  85    HSAGTVVAFYLTSD-QPNRDEIDFEFLGNVSGQPYILQTNVYADGFDNREERIYLWFDPT  143

Query  714   EDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGSSWATDGG  535
             +DFHNY+ILWN++ IVF VDS+PIRTYRNHADKGVA+P  QP   + +LW+G SWAT GG
Sbjct  144   QDFHNYSILWNLHQIVFFVDSIPIRTYRNHADKGVAFPRWQPMGVKATLWNGDSWATRGG  203

Query  534   RVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQRGLYEWV  355
               KIDWSK PF+ASF DY +DACVWKG+P  CRA+ P+NWWN +++S+LT  QR  ++WV
Sbjct  204   HDKIDWSKGPFVASFGDYKMDACVWKGNPRFCRAESPTNWWNNEDFSSLTSTQRRWFKWV  263

Query  354   MKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              +Y + YDYC D+ RF  ++P ECSLPKY
Sbjct  264   RRYHMIYDYCQDNARFQNNLPKECSLPKY  292



>ref|XP_003535672.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 10-like [Glycine max]
 gb|KHN23186.1| Putative xyloglucan endotransglucosylase/hydrolase protein 10 
[Glycine soja]
Length=296

 Score =   340 bits (873),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 168/278 (60%), Positives = 213/278 (77%), Gaps = 3/278 (1%)
 Frame = -3

Query  1101  HVSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQF  922
              VS+AS+VSTGDFN+DFF+I++ P H+NTSADG + SL LD  + S   S +  +LFGQ 
Sbjct  22    QVSVASIVSTGDFNKDFFLIWS-PTHVNTSADGHARSLKLDQESGSGFASNQM-FLFGQI  79

Query  921   VMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQ  742
              M++KLVPG SAGTV A+YL SD   +RDE+DFEFLGNV+G  Y LQTN+F +G   RE+
Sbjct  80    DMQIKLVPGDSAGTVLAYYLTSD-QPNRDEIDFEFLGNVSGQPYILQTNIFADGTDNREE  138

Query  741   KIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWD  562
             +I LWFDPT+DFH Y++LWN++ IV MVD +PIR YRNHADKGVA+P  QP   + +LW+
Sbjct  139   RIYLWFDPTKDFHTYSVLWNMHQIVLMVDMIPIRVYRNHADKGVAFPRWQPMSLKATLWN  198

Query  561   GSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTP  382
             G SWAT GG+ KIDW+K PFIASF++Y IDACVWKG+P  CRA  P+NWWNQ + STLT 
Sbjct  199   GDSWATRGGQDKIDWTKGPFIASFRNYKIDACVWKGNPRFCRAASPTNWWNQYSSSTLTS  258

Query  381   IQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              QR  ++WV KY + YDYC D++RF  ++P ECSL KY
Sbjct  259   TQRRWFKWVRKYHMIYDYCQDNERFQNNLPRECSLLKY  296



>emb|CDO97322.1| unnamed protein product [Coffea canephora]
Length=296

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 170/281 (60%), Positives = 212/281 (75%), Gaps = 6/281 (2%)
 Frame = -3

Query  1101  HVSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQF  922
              +S+ASVVS GDFN+DFFV ++ P H+NTSADGR+ SL LD  + S+  S    +LFGQF
Sbjct  19    QISIASVVSAGDFNRDFFVTWS-PSHVNTSADGRARSLKLDPDSGSAFASNDM-FLFGQF  76

Query  921   VMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDL---YTLQTNVFTNGYGE  751
              M++KL+PG SAG V AFYL S+   +RDE+DFEFLGN  G     Y LQTNV+ +G+ +
Sbjct  77    DMQIKLIPGNSAGAVVAFYLSSN-QPNRDELDFEFLGNADGGQQQPYILQTNVYVDGFDD  135

Query  750   REQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQIS  571
             RE++IKLWFDPT+DFH YTILWNI+ IVFMVD VPIRT+RNHADKGVA+P  QP   Q S
Sbjct  136   REERIKLWFDPTKDFHTYTILWNIHQIVFMVDWVPIRTFRNHADKGVAFPRWQPMALQAS  195

Query  570   LWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYST  391
             +WDGSSWAT GG+ KIDWS+ PF+ASF+++ IDAC+WKG    C A+ P+NWWNQ   ++
Sbjct  196   IWDGSSWATGGGKDKIDWSRGPFVASFQNHKIDACIWKGSAGFCTAESPTNWWNQGGSNS  255

Query  390   LTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
             LT  QR L+ WV KY + YDYC D  RF  ++P ECSLPKY
Sbjct  256   LTSAQRRLFRWVRKYYVIYDYCQDRPRFKNNLPKECSLPKY  296



>ref|XP_010517601.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 10 [Camelina sativa]
Length=298

 Score =   339 bits (869),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 169/277 (61%), Positives = 206/277 (74%), Gaps = 3/277 (1%)
 Frame = -3

Query  1098  VSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFV  919
             VS ASVVS+GDFN+DFFV ++ P H+NTS +GRS  L LD  + +S  ST+  +LFGQ  
Sbjct  25    VSQASVVSSGDFNKDFFVSWS-PSHVNTSNNGRSRILNLDQESGASFASTQT-FLFGQID  82

Query  918   MKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQK  739
             MK+KL+PG S GTV A+Y+ SD    RDE+DFEFLGNV G  Y LQTNV+  G   RE++
Sbjct  83    MKIKLIPGSSQGTVVAYYMTSD-QPKRDEIDFEFLGNVNGQPYILQTNVYAEGIDNREER  141

Query  738   IKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDG  559
             I LWFDPT+DFH Y+ILWNI+ IVFMVD VPIR YRNHADKGVAYP  QP   Q SLW+G
Sbjct  142   IHLWFDPTKDFHTYSILWNIHQIVFMVDQVPIRLYRNHADKGVAYPRLQPMNVQASLWNG  201

Query  558   SSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPI  379
              SWAT GG  KIDWSK PF+ASF DY IDACVWKG+P  C  +   NWWN++++S+LT +
Sbjct  202   ESWATRGGHDKIDWSKGPFVASFGDYKIDACVWKGNPRLCNGESDENWWNKNDFSSLTRV  261

Query  378   QRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
             Q+  ++WV KY + YDYC D  RFN  +P EC+LPKY
Sbjct  262   QKRWFKWVRKYHLIYDYCQDYGRFNNELPKECNLPKY  298



>ref|XP_008454432.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 10 [Cucumis melo]
Length=305

 Score =   339 bits (869),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 165/278 (59%), Positives = 208/278 (75%), Gaps = 3/278 (1%)
 Frame = -3

Query  1101  HVSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQF  922
               S AS +STGD+N+DFF+ ++ P H+NTS DGRS +L LD  + +   S +  +LFGQ 
Sbjct  31    QFSFASPISTGDYNKDFFITWS-PSHVNTSLDGRSRNLKLDNDSGAGFASNEM-FLFGQM  88

Query  921   VMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQ  742
              MK+KLVPG SAGTV A+YL SD   +RDE+DFEFLGNV G    LQTN+F +G+ +RE+
Sbjct  89    DMKIKLVPGNSAGTVVAYYLTSD-QPNRDEIDFEFLGNVEGQPIILQTNIFADGFDDREE  147

Query  741   KIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWD  562
             +IKLWFDPT+DFH Y+ILWNIY IVFMVD VPIR YRNH DKGV YP  QP   ++SLW+
Sbjct  148   RIKLWFDPTKDFHTYSILWNIYQIVFMVDWVPIRVYRNHGDKGVGYPRWQPMSLKVSLWN  207

Query  561   GSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTP  382
             G SWAT GG+ KIDWSK PF+ASF DY +DAC+W+G+   CR +  SNWW+   Y+TL+P
Sbjct  208   GESWATRGGKDKIDWSKGPFVASFGDYKVDACIWRGNARFCRGESSSNWWHLPKYNTLSP  267

Query  381   IQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              QR L++WV KY + YDYC D+ RF+  +P ECSLPKY
Sbjct  268   SQRRLFKWVRKYHLIYDYCQDNLRFHNQLPKECSLPKY  305



>ref|XP_006298221.1| hypothetical protein CARUB_v10014279mg [Capsella rubella]
 gb|EOA31119.1| hypothetical protein CARUB_v10014279mg [Capsella rubella]
Length=299

 Score =   337 bits (863),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 167/277 (60%), Positives = 205/277 (74%), Gaps = 3/277 (1%)
 Frame = -3

Query  1098  VSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFV  919
             VS AS+VS+GD+N+DFFV ++ P H+NTS DGRS +L LD  + +S  S K  +LFGQ  
Sbjct  26    VSQASLVSSGDYNKDFFVTWS-PSHVNTSNDGRSRTLKLDQESGASFASMKT-FLFGQVD  83

Query  918   MKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQK  739
             MK+KL+PG S GTV A+Y+ SD    RDE+DFEFLGNV G  Y LQTNV+  G   RE++
Sbjct  84    MKIKLIPGSSQGTVVAYYMTSD-QPKRDEIDFEFLGNVNGQPYILQTNVYAEGVDNREER  142

Query  738   IKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDG  559
             I LWFDPT+DFH Y+ILWNI+ IVFMVD VPIR YRNHADKGVAYP  QP   Q SLW+G
Sbjct  143   IHLWFDPTKDFHTYSILWNIHQIVFMVDQVPIRLYRNHADKGVAYPRLQPMKVQASLWNG  202

Query  558   SSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPI  379
              SWAT GG  KIDWSK P +ASF DY IDACVWK +P  C  +   NWWN+D++S+LT +
Sbjct  203   ESWATRGGHDKIDWSKGPLVASFGDYKIDACVWKENPRLCNGESNENWWNKDDFSSLTRV  262

Query  378   QRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
             Q+  ++WV KY + YDYC D  RFN ++P EC+LPKY
Sbjct  263   QKRWFKWVRKYHLIYDYCQDYGRFNNNLPKECNLPKY  299



>ref|XP_010547938.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 10 [Tarenaya hassleriana]
Length=295

 Score =   335 bits (860),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 163/277 (59%), Positives = 210/277 (76%), Gaps = 3/277 (1%)
 Frame = -3

Query  1098  VSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFV  919
             +SL+SVVSTGDF++DFFV ++ P H+NTS  GRS +L LD  + +S  S +  +LFGQ  
Sbjct  22    MSLSSVVSTGDFDKDFFVTWS-PSHVNTSNYGRSRTLKLDQESGASFASNQM-FLFGQID  79

Query  918   MKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQK  739
             MK+KL+PG SAGTV A+Y+ SD   +RDE+DFEFLGNV+G  Y LQTN++ +G   RE++
Sbjct  80    MKIKLIPGDSAGTVVAYYISSD-QPNRDEIDFEFLGNVSGQPYILQTNIYADGSDNREER  138

Query  738   IKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDG  559
             I LWFDPT+DFH Y+ILWNI+ IVF VD +PIR YRNH DKGVA+P  QP   + SLW+G
Sbjct  139   IYLWFDPTKDFHTYSILWNIHQIVFFVDQIPIRVYRNHTDKGVAFPRRQPMSVKASLWNG  198

Query  558   SSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPI  379
              SWAT GGR K+DWSK PF+A+F DY IDACVW+G+P  CR  G  NWWN+D +S+LT +
Sbjct  199   DSWATRGGRDKVDWSKGPFLATFGDYKIDACVWRGNPRFCRERGEENWWNKDEFSSLTRL  258

Query  378   QRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
             Q+  ++WV KY + YDYC D QRF+ ++P ECSLP Y
Sbjct  259   QKRWFKWVRKYHMIYDYCQDHQRFHDNLPKECSLPNY  295



>ref|XP_010488900.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 10 [Camelina sativa]
Length=298

 Score =   335 bits (858),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 168/277 (61%), Positives = 204/277 (74%), Gaps = 3/277 (1%)
 Frame = -3

Query  1098  VSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFV  919
             VS AS VS+GDFN+DFFV ++ P H+NTS DGRS +L LD  + +S  ST+  +LFGQ  
Sbjct  25    VSQASFVSSGDFNKDFFVTWS-PSHVNTSNDGRSRTLKLDQESGASFASTQT-FLFGQID  82

Query  918   MKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQK  739
             MK+KL+PG S GTV A+Y+ SD    RDE+DFEFLGNV G  Y LQTNV+  G   RE++
Sbjct  83    MKIKLIPGSSQGTVVAYYMTSD-QLKRDEIDFEFLGNVNGQPYILQTNVYAEGIDNREER  141

Query  738   IKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDG  559
             I LWFDPT+DFH Y+ILWNI+ IVFMVD VPIR YRNHADKGVAYP  QP   Q SLW+G
Sbjct  142   IHLWFDPTKDFHTYSILWNIHQIVFMVDQVPIRLYRNHADKGVAYPRLQPMNVQASLWNG  201

Query  558   SSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPI  379
              SWAT GG  KIDWSK PF+ASF DY I ACVWKG+P  C  +   NWWN++++S+LT +
Sbjct  202   ESWATRGGHDKIDWSKGPFVASFGDYKIYACVWKGNPRLCNGESNENWWNKNDFSSLTRV  261

Query  378   QRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
             Q+  ++WV KY + YDYC D  RFN   P EC+LPKY
Sbjct  262   QKRWFKWVRKYHLIYDYCQDYGRFNNQRPKECNLPKY  298



>ref|XP_011002572.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 10 [Populus euphratica]
Length=294

 Score =   334 bits (857),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 160/278 (58%), Positives = 207/278 (74%), Gaps = 3/278 (1%)
 Frame = -3

Query  1101  HVSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQF  922
              VS +SV+STGDFN+DF V ++ PGH+ T+ADG  T        + S  ++   +LFGQ 
Sbjct  20    QVSFSSVISTGDFNKDFSVAWS-PGHVYTTADG-GTRSLKLDQESGSGFASNQMFLFGQI  77

Query  921   VMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQ  742
              M++KLVPG+SAGTV AFYL SD    RDE+DFEFLGNV+G  Y LQTNV+ +G  +RE+
Sbjct  78    DMQIKLVPGHSAGTVVAFYLSSD-QPKRDEIDFEFLGNVSGQPYILQTNVYADGNDDREE  136

Query  741   KIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWD  562
             +I LWFDPT++FH Y++LWN++ IVFMVD +PIR YRNHADKGVAYP  QP   + SLW+
Sbjct  137   RIYLWFDPTKNFHTYSVLWNLHQIVFMVDGIPIRLYRNHADKGVAYPRWQPMSIKASLWN  196

Query  561   GSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTP  382
             G SWAT GG+ KIDWSK PFIASF++Y IDAC W G+P  CRA+  +NWWN++ YS+LT 
Sbjct  197   GDSWATRGGKDKIDWSKGPFIASFRNYKIDACPWNGNPRFCRAESSTNWWNKERYSSLTS  256

Query  381   IQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              QR  ++WV  + + YDYC D++RF  ++P ECSLPKY
Sbjct  257   TQRRWFKWVRLHHMIYDYCQDNKRFQNNLPKECSLPKY  294



>ref|XP_010065854.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 10 [Eucalyptus grandis]
 gb|KCW63549.1| hypothetical protein EUGRSUZ_G01182 [Eucalyptus grandis]
Length=292

 Score =   334 bits (857),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 159/269 (59%), Positives = 208/269 (77%), Gaps = 3/269 (1%)
 Frame = -3

Query  1074  TGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVMKMKLVPG  895
             TG+FN+DFFV+++ P H+NTSADGR+ S+ LD  + +   S    +LFGQ  MK+KL+ G
Sbjct  27    TGNFNKDFFVMWS-PDHVNTSADGRTRSMVLDQESGAGFSSNDM-FLFGQIDMKIKLISG  84

Query  894   YSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKIKLWFDPT  715
             +SAGTV A+YL SD   +RDE+DFEFLGNV+G  Y LQTNV+ +G+  RE++I LWFDPT
Sbjct  85    HSAGTVVAYYLTSD-QPNRDEIDFEFLGNVSGQPYILQTNVYADGFDNREERIYLWFDPT  143

Query  714   EDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGSSWATDGG  535
             +DFH+Y+ILWN++ IVF VDS+PIRTYRNHADKGVA+P  QP   + +LW+G SWAT GG
Sbjct  144   QDFHSYSILWNLHQIVFFVDSIPIRTYRNHADKGVAFPRWQPMGVKATLWNGDSWATRGG  203

Query  534   RVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQRGLYEWV  355
               KIDWSK PF+ASF DY +DACVWKG+P  CRA+ P++WWN + +S+LT  QR  ++WV
Sbjct  204   HDKIDWSKGPFVASFGDYKMDACVWKGNPRFCRAESPTSWWNNEEFSSLTSTQRRWFKWV  263

Query  354   MKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              +Y + YDYC D+ RF  ++P ECSLPKY
Sbjct  264   RRYHMIYDYCQDNARFQNNLPKECSLPKY  292



>ref|XP_002313201.1| xyloglucan endotransglucosylase/hydrolase protein 10 precursor 
[Populus trichocarpa]
 gb|EEE87156.1| xyloglucan endotransglucosylase/hydrolase protein 10 precursor 
[Populus trichocarpa]
Length=294

 Score =   334 bits (856),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 164/278 (59%), Positives = 211/278 (76%), Gaps = 3/278 (1%)
 Frame = -3

Query  1101  HVSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQF  922
              VS +SV+STGDFN+DF V ++ P H+ T+A+GR+ SL LD  + S   S +  +LFGQ 
Sbjct  20    QVSFSSVISTGDFNKDFSVAWS-PSHVYTTANGRTRSLKLDQESGSGFASNQM-FLFGQI  77

Query  921   VMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQ  742
              M++KLVPG+SAGTV AFYL SD    RDE+DFEFLGNV+G  Y LQTNV+ +G  +RE+
Sbjct  78    DMQIKLVPGHSAGTVVAFYLSSD-QPKRDEIDFEFLGNVSGQPYILQTNVYADGNDDREE  136

Query  741   KIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWD  562
             +I LWFDPT++FH Y++LWN++ IVFMVD +PIR YRNHADKGVAYP  QP   + SLW+
Sbjct  137   RIYLWFDPTKNFHTYSVLWNLHQIVFMVDWIPIRLYRNHADKGVAYPRWQPMSIKASLWN  196

Query  561   GSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTP  382
             G SWAT GG+ KIDWSK PFIASF++Y IDAC W G+P  CRA+  +NWWN++ YSTLT 
Sbjct  197   GDSWATRGGKDKIDWSKGPFIASFRNYKIDACPWNGNPRFCRAESSTNWWNKERYSTLTS  256

Query  381   IQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              QR  ++WV  + + YDYC D++RF  ++P ECSLPKY
Sbjct  257   TQRRWFKWVRLHHMIYDYCQDNKRFQNNLPKECSLPKY  294



>emb|CDX71167.1| BnaC07g04460D [Brassica napus]
Length=297

 Score =   333 bits (853),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/278 (57%), Positives = 209/278 (75%), Gaps = 3/278 (1%)
 Frame = -3

Query  1101  HVSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQF  922
              VS ASVVS+GDF++DF V ++ P H+NTS+DGRS +L LD  + +S  S +  +LFG+ 
Sbjct  23    RVSEASVVSSGDFSKDFLVTWS-PTHVNTSSDGRSRTLKLDQESGASFSSIQT-FLFGKI  80

Query  921   VMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQ  742
              MK+KL+PG S GTV A+Y+ SD   +RDE+DFEFLGNV G  Y LQTN++ +G   RE+
Sbjct  81    DMKIKLIPGPSQGTVVAYYMSSD-QTNRDEIDFEFLGNVNGQPYILQTNIYADGVDNREE  139

Query  741   KIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWD  562
             +I LWFDPT+DFH Y+ILWN++ IVFMVD +PIR YRNH++KGVAYP  QP   ++SLW+
Sbjct  140   RIHLWFDPTKDFHTYSILWNVHQIVFMVDQIPIRLYRNHSEKGVAYPRLQPMSIKVSLWN  199

Query  561   GSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTP  382
             G SWAT GG  K+DWSKAPF+ASF DY IDAC+WKG+P+ C  +   NWWN++ +S+LT 
Sbjct  200   GESWATSGGHEKVDWSKAPFVASFGDYKIDACIWKGNPTLCNEESNENWWNKNEFSSLTR  259

Query  381   IQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
             +Q+  ++WV KY + YDYC D  RF+   P ECSLPKY
Sbjct  260   VQKRWFKWVSKYHLIYDYCQDYARFHNKRPKECSLPKY  297



>ref|XP_010939323.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 10 [Elaeis guineensis]
Length=295

 Score =   332 bits (851),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 165/269 (61%), Positives = 203/269 (75%), Gaps = 3/269 (1%)
 Frame = -3

Query  1074  TGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVMKMKLVPG  895
             TG+FN DF++ ++ P H+  SADG S SL LD  + SS  S    +LFGQ  M++KL+PG
Sbjct  30    TGNFNSDFYITWS-PSHVYASADGHSRSLKLDQESGSSIASNDM-FLFGQIDMQIKLIPG  87

Query  894   YSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKIKLWFDPT  715
             YSAGTV AFYL SD   +RDE+DFEFLGNV G  Y LQTNV+ +G+  RE++I LWFDPT
Sbjct  88    YSAGTVLAFYLASD-QPNRDEIDFEFLGNVTGQPYILQTNVYADGFDNREERIFLWFDPT  146

Query  714   EDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGSSWATDGG  535
             +DFH Y+ILWN+Y IVFMVD VPIR YRNHADKGVA+P  QP   ++SLW+G SWAT GG
Sbjct  147   KDFHTYSILWNLYQIVFMVDWVPIRVYRNHADKGVAFPRRQPMSLKVSLWNGDSWATRGG  206

Query  534   RVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQRGLYEWV  355
             R K+DWSK PFIAS ++Y IDACVWKG+P  CRAD  +NWWN+  +S+LT  QR L++WV
Sbjct  207   RDKVDWSKGPFIASMRNYKIDACVWKGNPRFCRADSTANWWNEPRFSSLTWNQRRLFKWV  266

Query  354   MKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              KY + YDYC D +RF   +P ECSLPKY
Sbjct  267   RKYYLIYDYCQDPKRFQNQLPRECSLPKY  295



>ref|XP_006848852.1| hypothetical protein AMTR_s00026p00206650 [Amborella trichopoda]
 gb|ERN10433.1| hypothetical protein AMTR_s00026p00206650 [Amborella trichopoda]
Length=272

 Score =   331 bits (848),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 158/275 (57%), Positives = 203/275 (74%), Gaps = 3/275 (1%)
 Frame = -3

Query  1092  LASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVMK  913
             +ASVVS GDFN+DF+ I  +P H+NTS D       +   ++ S  ++ D +LFGQ  M+
Sbjct  1     MASVVSVGDFNKDFY-ITCSPNHVNTSKD-EHERSLILDQSSGSGFASNDMFLFGQIDMQ  58

Query  912   MKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKIK  733
             +KLV G+SAGTV A+YL SD   +RDE+DFEFLGNV G  Y LQTN+F +G+  RE+++ 
Sbjct  59    IKLVSGHSAGTVVAYYLTSD-QPNRDELDFEFLGNVTGQPYILQTNIFADGFDNREERMY  117

Query  732   LWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGSS  553
             LWFDPT+DFH Y+ILWN++ IVFMVD VPIR YRNHADKGV +P  QP   + SLW+G S
Sbjct  118   LWFDPTKDFHTYSILWNLHQIVFMVDWVPIRVYRNHADKGVPFPRRQPMSIKASLWNGDS  177

Query  552   WATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQR  373
             WAT GG  KIDWSK PFIASF++Y IDACVW+G+   CR D  +NWWN++ +STL   QR
Sbjct  178   WATRGGHDKIDWSKGPFIASFRNYKIDACVWRGNARFCRTDSETNWWNKERFSTLNWRQR  237

Query  372   GLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              L++W +KY + YDYC D++RFN  +P ECSLPKY
Sbjct  238   KLFKWAIKYHLIYDYCKDNKRFNNILPKECSLPKY  272



>gb|KDP37615.1| hypothetical protein JCGZ_06958 [Jatropha curcas]
Length=256

 Score =   330 bits (845),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 159/256 (62%), Positives = 199/256 (78%), Gaps = 2/256 (1%)
 Frame = -3

Query  1035  APGHINTSADGRstsltldtaaasssmstkdKYLFGQFVMKMKLVPGYSAGTVTAFYLMS  856
             +P H+NTSADGR+ SL LD  + S   S +  +LFG+  M++KLVPGYSAGTV AFYL S
Sbjct  3     SPSHVNTSADGRTRSLKLDQESGSGFASNQM-FLFGRIDMQIKLVPGYSAGTVVAFYLTS  61

Query  855   DPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKIKLWFDPTEDFHNYTILWNIY  676
             D   +RDE+DFEFLGNV+G+ Y LQTN++ +G+  RE++I LWFDPT+DFHNY++LWN++
Sbjct  62    D-QPNRDEIDFEFLGNVSGEPYILQTNIYADGFDNREERIYLWFDPTKDFHNYSVLWNLH  120

Query  675   HIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGSSWATDGGRVKIDWSKAPFIA  496
              IVFMVD +PIR YRNHADKGVAYP  QP   +ISLW+G SWAT GG+ KIDWSK PFIA
Sbjct  121   QIVFMVDWIPIRVYRNHADKGVAYPRWQPMGIKISLWNGDSWATRGGKDKIDWSKGPFIA  180

Query  495   SFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQRGLYEWVMKYQITYDYCTDS  316
             SFKDY IDACVW G+P  CRA+  +NWW++ +Y+TLTPIQR  ++WV  + + YDYC D 
Sbjct  181   SFKDYKIDACVWNGNPRFCRAESSTNWWHKHSYNTLTPIQRRWFKWVRLHHMIYDYCQDK  240

Query  315   QRFNGSIPLECSLPKY  268
              RF   +P ECSLPKY
Sbjct  241   NRFQNKLPKECSLPKY  256



>ref|NP_179069.1| xyloglucan endotransglucosylase/hydrolase protein 10 [Arabidopsis 
thaliana]
 sp|Q9ZVK1.1|XTH10_ARATH RecName: Full=Probable xyloglucan endotransglucosylase/hydrolase 
protein 10; Short=At-XTH10; Short=XTH-10; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAC69380.1| xyloglucan endotransglycosylase, putative [Arabidopsis thaliana]
 gb|AAL49911.1| putative endoxyloglucan glycosyltransferase [Arabidopsis thaliana]
 gb|AAM20246.1| putative endoxyloglucan glycosyltransferase [Arabidopsis thaliana]
 gb|AEC06315.1| xyloglucan endotransglucosylase/hydrolase protein 10 [Arabidopsis 
thaliana]
Length=299

 Score =   329 bits (844),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 163/277 (59%), Positives = 202/277 (73%), Gaps = 3/277 (1%)
 Frame = -3

Query  1098  VSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFV  919
             VS ASVVS+GDFN+DFFV ++ P H+NTS DGRS +L LD  + +S  S +  +LFGQ  
Sbjct  26    VSQASVVSSGDFNKDFFVTWS-PTHVNTSNDGRSRTLKLDQESGASFSSIQT-FLFGQID  83

Query  918   MKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQK  739
             MK+KL+ G S GTV A+Y+ SD   +RDE+DFEFLGNV G  Y LQTNV+  G   RE++
Sbjct  84    MKIKLIRGSSQGTVVAYYMSSD-QPNRDEIDFEFLGNVNGQPYILQTNVYAEGLDNREER  142

Query  738   IKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDG  559
             I LWFDP +DFH Y+ILWNI+ IVFMVD +PIR YRNH +KGVAYP  QP   Q SLW+G
Sbjct  143   IHLWFDPAKDFHTYSILWNIHQIVFMVDQIPIRLYRNHGEKGVAYPRLQPMSVQASLWNG  202

Query  558   SSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPI  379
              SWAT GG  KIDWSK PF+ASF DY IDAC+W G+ S C  +   NWWN++ +S+LT +
Sbjct  203   ESWATRGGHDKIDWSKGPFVASFGDYKIDACIWIGNTSFCNGESTENWWNKNEFSSLTRV  262

Query  378   QRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
             Q+  ++WV KY + YDYC D  RFN  +P ECSLPKY
Sbjct  263   QKRWFKWVRKYHLIYDYCQDYGRFNNKLPKECSLPKY  299



>ref|XP_006409649.1| hypothetical protein EUTSA_v10022791mg [Eutrema salsugineum]
 gb|ESQ51102.1| hypothetical protein EUTSA_v10022791mg [Eutrema salsugineum]
Length=303

 Score =   329 bits (844),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 158/277 (57%), Positives = 205/277 (74%), Gaps = 3/277 (1%)
 Frame = -3

Query  1098  VSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFV  919
             V+ ASVVS+G+FN+DF V ++ P H+NTS+DGRS +L LD  + +S  S +  +LFG+  
Sbjct  30    VTEASVVSSGNFNEDFLVTWS-PTHVNTSSDGRSRTLKLDQESGASFSSIQM-FLFGKID  87

Query  918   MKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQK  739
             MK+KL+PG S GTV A+Y+ SD   +RDE+DFEFLGNV G  Y LQTN++ +G   RE++
Sbjct  88    MKIKLIPGPSQGTVVAYYMSSD-QTNRDEIDFEFLGNVNGQPYILQTNIYADGIDNREER  146

Query  738   IKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDG  559
             I LWFDPT+DFH Y+I WNI+ IVFMVD +PIR YRNH +KGVAYP  QP   + SLW+G
Sbjct  147   IHLWFDPTKDFHTYSIFWNIHQIVFMVDQIPIRLYRNHTEKGVAYPRLQPMSVKASLWNG  206

Query  558   SSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPI  379
              SWAT GGR K+DWS  PF+ASF DY IDACVW G+P  CR +   NWWN++ +S+LT +
Sbjct  207   ESWATRGGRDKVDWSNGPFVASFGDYKIDACVWNGNPELCREESSENWWNKNEFSSLTRV  266

Query  378   QRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
             Q+  ++WV KY + YDYC D  RF+  +P ECSLPKY
Sbjct  267   QKRWFKWVRKYHLIYDYCQDYARFHNKLPKECSLPKY  303



>ref|XP_009402073.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 10 [Musa acuminata subsp. malaccensis]
Length=296

 Score =   328 bits (842),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 164/275 (60%), Positives = 202/275 (73%), Gaps = 3/275 (1%)
 Frame = -3

Query  1092  LASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVMK  913
             LASVVSTGDFN DF + ++ P H+NTSADG S +L LD  + SS  S    +LFG+  M+
Sbjct  25    LASVVSTGDFNTDFHITWS-PSHVNTSADGHSRTLMLDQESGSSFASNNM-FLFGEIDMR  82

Query  912   MKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKIK  733
             +KL+ GYSAGTV A+YL SD   +RDE+DFEFLGNV G  Y LQTN++ +G G RE++I 
Sbjct  83    IKLILGYSAGTVLAYYLTSD-RPNRDEIDFEFLGNVTGQPYILQTNIYADGSGNREERIY  141

Query  732   LWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGSS  553
             LWFDPT+DFH Y+I WN+Y IV MVD VP+R YRNHAD+GVA+P  QP   + SLW+G S
Sbjct  142   LWFDPTKDFHTYSIFWNLYQIVLMVDWVPVRVYRNHADEGVAFPRWQPMTLKASLWNGDS  201

Query  552   WATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQR  373
             WAT GG  K+DWSK PF+A+  DY IDACVWKG+P  CRA   SNWWN+    +LT  QR
Sbjct  202   WATRGGEDKVDWSKGPFVATLGDYKIDACVWKGNPRFCRAGSNSNWWNKPRLRSLTGRQR  261

Query  372   GLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              L +WV KY + YDYC D +RF+G +P ECSLPKY
Sbjct  262   RLLKWVRKYHLIYDYCQDPKRFHGQLPTECSLPKY  296



>ref|XP_010691526.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 10 [Beta vulgaris subsp. vulgaris]
Length=296

 Score =   328 bits (842),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 157/277 (57%), Positives = 208/277 (75%), Gaps = 3/277 (1%)
 Frame = -3

Query  1098  VSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFV  919
             +SLASV   G+FN DFF+ +A P H+NTS DG+  SL LD  + S   S    +LFGQ  
Sbjct  23    LSLASVTPIGNFNNDFFISWA-PTHVNTSVDGKIRSLKLDQESGSGFDSNNM-FLFGQID  80

Query  918   MKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQK  739
             M++KL+PG SAG+V A+YL SD + +RDE+D EFLGNV+G  Y LQTN++++G+G+RE++
Sbjct  81    MQIKLIPGSSAGSVVAYYLASD-SPNRDEIDLEFLGNVSGQPYILQTNIYSDGFGDREER  139

Query  738   IKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDG  559
             I LWFDP+ DFH Y+ILWNIY IV MVD VPIR +RNH DKG+++P+ QP   + SLW+G
Sbjct  140   IYLWFDPSADFHTYSILWNIYQIVIMVDWVPIRVFRNHKDKGISFPISQPMSIKASLWNG  199

Query  558   SSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPI  379
               WAT GG+ KI+WSKAPFIASF++Y IDACVW+G+P  C+    +NWWN+D +++L   
Sbjct  200   EDWATRGGKDKINWSKAPFIASFRNYKIDACVWRGNPKICKQVSSTNWWNKDKFNSLNWN  259

Query  378   QRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
             QR  Y WV KY + YDYC D+QRF+G++P ECSLP Y
Sbjct  260   QRRFYRWVRKYHLIYDYCQDNQRFSGNLPKECSLPIY  296



>ref|XP_009123190.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 10 [Brassica rapa]
Length=297

 Score =   318 bits (816),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 160/278 (58%), Positives = 210/278 (76%), Gaps = 3/278 (1%)
 Frame = -3

Query  1101  HVSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQF  922
              VS ASVVS+GDFN+DF V ++ P H+NTS+DGRS +L LD  + +S  S +  +LFG+ 
Sbjct  23    RVSEASVVSSGDFNKDFLVTWS-PTHVNTSSDGRSRTLKLDQESGASFSSIQT-FLFGKI  80

Query  921   VMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQ  742
              MK+KL+PG S GTV A+Y+ SD   +RDE+DFEFLGNV G  Y LQTN++ +G   RE+
Sbjct  81    DMKIKLIPGPSQGTVVAYYMSSD-QTNRDEIDFEFLGNVNGQPYILQTNIYADGVDNREE  139

Query  741   KIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWD  562
             +I LWFDPT+DFH Y+ILWN++ IVFMVD +PIR YRNH++KGVAYP  QP   ++SLW+
Sbjct  140   RIHLWFDPTKDFHTYSILWNVHQIVFMVDQIPIRLYRNHSEKGVAYPRLQPMSIKVSLWN  199

Query  561   GSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTP  382
             G SWAT GG  K+DWSKAPF+ASF DY IDAC+WKG+P+ C  +   NWWN++ +S+LT 
Sbjct  200   GESWATSGGHEKVDWSKAPFVASFGDYKIDACIWKGNPTLCNEENNENWWNKNEFSSLTR  259

Query  381   IQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
             +Q+  ++WV KY + YDYC D  RF+  +P ECSLPKY
Sbjct  260   VQKRWFKWVSKYHLIYDYCQDYARFHNKLPKECSLPKY  297



>gb|KHN01563.1| Putative xyloglucan endotransglucosylase/hydrolase protein 10 
[Glycine soja]
Length=261

 Score =   286 bits (731),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 142/238 (60%), Positives = 185/238 (78%), Gaps = 3/238 (1%)
 Frame = -3

Query  1101  HVSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQF  922
              VS+AS+VSTGDFN+DFFVI++ P H+NTS+DG + SL LD  + S   S +  +LFGQ 
Sbjct  22    QVSVASIVSTGDFNKDFFVIWS-PTHVNTSSDGHTRSLILDQESGSGFASNQM-FLFGQI  79

Query  921   VMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQ  742
              M++KLVP  SAGTV A+YL SD   +RDE+DFEFLGNV+G  Y LQTN+F +G   RE+
Sbjct  80    DMQIKLVPADSAGTVLAYYLTSD-QPNRDEIDFEFLGNVSGQPYILQTNIFADGTDNREE  138

Query  741   KIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWD  562
             +I LWFDPT+DFH+Y++LWN++ IV MVD +PIR YRNHADKGVA+P  QP   + +LW+
Sbjct  139   RIYLWFDPTKDFHSYSVLWNMHQIVLMVDMIPIRVYRNHADKGVAFPRWQPMSLKATLWN  198

Query  561   GSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTL  388
             G SWAT GG+ KIDW+K PFIASF++Y IDACVWKG+P  CRA  P+NWWN ++ +++
Sbjct  199   GDSWATRGGQDKIDWTKGPFIASFRNYKIDACVWKGNPRFCRAASPTNWWNVNSLASV  256



>ref|XP_002993509.1| hypothetical protein SELMODRAFT_431582 [Selaginella moellendorffii]
 gb|EFJ05401.1| hypothetical protein SELMODRAFT_431582 [Selaginella moellendorffii]
Length=286

 Score =   263 bits (673),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 136/271 (50%), Positives = 183/271 (68%), Gaps = 5/271 (2%)
 Frame = -3

Query  1095  SLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVM  916
             SLA+ V+  +FN DF V ++ P H+NT   G S        ++ S  ++K ++LFG+  M
Sbjct  17    SLAATVNK-NFNTDFAVTWS-PDHVNTLLGG-SALQLRLDNSSGSGFASKGQFLFGKISM  73

Query  915   KMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKI  736
              MKLVPG SAGTVTA+YL S    +RDE+DFEFLGNV+G+ Y LQTN+++NG G REQ+I
Sbjct  74    DMKLVPGDSAGTVTAYYLTSGQTPNRDELDFEFLGNVSGEPYILQTNIYSNGVGAREQRI  133

Query  735   KLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGS  556
              LWFDPT  FH+Y++LWN + IVF+VD +PIR +RN+  KGVA+P  Q   A  S+W+G 
Sbjct  134   FLWFDPTTSFHSYSVLWNQHQIVFLVDEIPIRVFRNNEAKGVAFPSKQSMGAFSSIWNGD  193

Query  555   SWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQ  376
              WAT GG VKIDWSKAPF+AS++++ +DAC   G    C A   S WWN++ Y +L   Q
Sbjct  194   QWATRGGVVKIDWSKAPFVASYRNFAVDACE-SGKVEACSAMASSAWWNEERYRSLNRNQ  252

Query  375   RGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
             R   +WV K  + YDYC D+ R+  + P EC
Sbjct  253   RHRLKWVQKNYMVYDYCIDTSRY-PTPPAEC  282



>ref|XP_002975683.1| hypothetical protein SELMODRAFT_267868 [Selaginella moellendorffii]
 gb|EFJ23312.1| hypothetical protein SELMODRAFT_267868 [Selaginella moellendorffii]
Length=286

 Score =   261 bits (668),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 136/271 (50%), Positives = 183/271 (68%), Gaps = 5/271 (2%)
 Frame = -3

Query  1095  SLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVM  916
             SLA+ V+  +FN DF V ++ P H+NT   G S        ++ S  ++K ++LFG+  M
Sbjct  17    SLAAPVNK-NFNTDFAVTWS-PDHVNTLLGG-SALQLRLDNSSGSGFASKGQFLFGKISM  73

Query  915   KMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKI  736
              MKLVPG SAGTVTA+YL S    +RDE+DFEFLGNV+G+ Y LQTN+++NG G REQ+I
Sbjct  74    DMKLVPGDSAGTVTAYYLTSGQTPNRDELDFEFLGNVSGEPYILQTNIYSNGVGAREQRI  133

Query  735   KLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGS  556
              LWFDPT  FH+Y++LWN + IVF+VD +PIR +RN+  KGVA+P  Q   A  S+W+G 
Sbjct  134   FLWFDPTTSFHSYSVLWNQHQIVFLVDEIPIRVFRNNEAKGVAFPSKQSMGAFSSIWNGD  193

Query  555   SWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQ  376
              WAT GG VKIDWSKAPF+AS++++ +DAC   G    C A   S WWNQ+ Y +L   Q
Sbjct  194   QWATRGGVVKIDWSKAPFVASYRNFAVDACE-SGKVEACSAMAGSAWWNQERYRSLNRNQ  252

Query  375   RGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
             R   +WV K  + Y+YC D+ R+  + P EC
Sbjct  253   RHRLKWVQKNYMVYNYCIDTSRY-PTPPAEC  282



>gb|EPS69904.1| hypothetical protein M569_04855, partial [Genlisea aurea]
Length=281

 Score =   261 bits (666),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 143/272 (53%), Positives = 189/272 (69%), Gaps = 7/272 (3%)
 Frame = -3

Query  1077  STGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVMKMKLVP  898
             +  DFN+DFFV ++ P  + TSADG S SL LD  + S   S    +L+G F +++KLVP
Sbjct  15    TASDFNKDFFVTWS-PDRVITSADGNSRSLALDRYSGSGFASYGT-FLYGHFSVRIKLVP  72

Query  897   GYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKIKLWFDP  718
             G SAGTV AFYL+S+    RDE+DFEFLG+V G LYTLQTNV+ NG+ +REQ+I+LWFDP
Sbjct  73    GNSAGTVVAFYLVSE-GDQRDELDFEFLGDVEGKLYTLQTNVYVNGFDDREQRIRLWFDP  131

Query  717   TEDFHNYTILWNIYHIVFMVDSVPIRTYRNH--ADKGVAYPMGQPAPAQISLWDGSSWAT  544
             T DFH Y+ILWN + IVF VD VPIRTYRNH   + GV YP  +P     S+W+G +WAT
Sbjct  132   TVDFHTYSILWNDHQIVFFVDWVPIRTYRNHYSDNNGVPYPSVRPMRLMGSIWNGENWAT  191

Query  543   DGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQRGLY  364
             +GG+ KI+W+++PF A F    IDAC+W   P+ C      N  N ++ S+L  +QR LY
Sbjct  192   NGGQTKINWAQSPFEAQFMSPIIDACIWAQSPNNCSMTKWWN--NPNSSSSLNWMQRRLY  249

Query  363   EWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
             +WV  + + YDYC D+QRFN ++P EC+L KY
Sbjct  250   KWVRLHYLNYDYCRDNQRFNNTLPKECALTKY  281



>ref|XP_008781817.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6 [Phoenix dactylifera]
Length=290

 Score =   258 bits (658),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 133/272 (49%), Positives = 175/272 (64%), Gaps = 5/272 (2%)
 Frame = -3

Query  1098  VSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFV  919
             +SL S      F++DF   +A   HI    +G      L   ++    ++ +K++FG   
Sbjct  20    LSLPSAAKPAIFSRDFHATWAG-SHIKQLNNG-IAIQLLLDQSSGCGFASNNKFMFGHVS  77

Query  918   MKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQK  739
             MK+KL+PG SAGTVTAFYL SD  A RDE+DFEFLGN +G  YT+QTNV+ +G G+REQ+
Sbjct  78    MKIKLIPGDSAGTVTAFYLNSDTEAVRDELDFEFLGNRSGHPYTVQTNVYAHGKGDREQR  137

Query  738   IKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDG  559
             + LWFDP+ DFH Y+I WN  HIVF VD++PIR ++N+  +GVAYP  QP     +LW+ 
Sbjct  138   VNLWFDPSADFHTYSIFWNRQHIVFFVDAIPIRVFKNNQARGVAYPNAQPMGIYSTLWNA  197

Query  558   SSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPI  379
              +WAT GG  KIDWSKAPF A +KD+ I+AC   G PS C  +  SNWW+  +Y  L+PI
Sbjct  198   DNWATRGGLEKIDWSKAPFYAYYKDFNIEACAVPGAPSHC--NTLSNWWDAPSYHQLSPI  255

Query  378   QRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
             Q   Y WV  + + YDYCTD  R N   P EC
Sbjct  256   QARAYRWVRLHHMVYDYCTDRPR-NPVPPPEC  286



>ref|XP_002437518.1| hypothetical protein SORBIDRAFT_10g028550 [Sorghum bicolor]
 gb|EER88885.1| hypothetical protein SORBIDRAFT_10g028550 [Sorghum bicolor]
Length=292

 Score =   251 bits (640),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/233 (50%), Positives = 153/233 (66%), Gaps = 17/233 (7%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  M++KLVPG SAGTVT FYL S    + DE+DFEFLGNV+G+ YTL TNVFT G
Sbjct  64   YLFGKIDMQIKLVPGNSAGTVTTFYLSSQ-GPTHDEIDFEFLGNVSGEPYTLHTNVFTGG  122

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ+ +LWFDPT+DFH Y+++WN  H++F VD  PIR ++NH  +GV +P  QP   
Sbjct  123  QGQREQQFRLWFDPTKDFHTYSVVWNPQHVIFAVDGTPIRDFKNHEARGVGFPRTQPMRL  182

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSEC------------R  436
              SLW+   WAT GGRVK DW++APF+ASF+ ++ DACVW     +C            R
Sbjct  183  YASLWNADDWATQGGRVKADWTQAPFVASFRGFSADACVWANGKQQCPVGTMAAAATGGR  242

Query  435  ADGPSNWWNQDNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
              GP +WWNQ     L+ +      WV +  + Y+YCTD++RF   +P EC L
Sbjct  243  RGGPGSWWNQQ----LSDMSYRRMRWVQRKFMIYNYCTDAKRFPQGVPAECKL  291



>ref|XP_010913699.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 7 [Elaeis guineensis]
Length=290

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 153/219 (70%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            ++FG   MK+KLVPG SAGTVTAFYL S   A RDE+DFEFLGN +G  YT+QTNV+ +G
Sbjct  71   FMFGHVRMKIKLVPGDSAGTVTAFYLNSATEAIRDELDFEFLGNRSGQPYTVQTNVYAHG  130

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP+ DFH Y+ILWN  HIVF VD++PIR Y+N+  +GVAYP  QP   
Sbjct  131  KGDREQRVNLWFDPSADFHTYSILWNHQHIVFFVDAIPIRVYKNNEARGVAYPNAQPMGI  190

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDWSKAPF A +KD+ I+AC   G  S+C  +  S+WW+  +
Sbjct  191  YSTLWNADDWATRGGLEKIDWSKAPFYAYYKDFDIEACAVPGARSDC--NTVSSWWDAPS  248

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L+PIQ   Y WV  + + YDYCTD  R+  + P EC
Sbjct  249  YHQLSPIQARAYRWVRLHHMIYDYCTDRARYPVAPP-EC  286



>gb|ABM91062.1| xyloglucan endotransglycosylase/hydrolase precursor XTH-29 [Populus 
tremula x Populus tremuloides]
Length=180

 Score =   246 bits (627),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = -3

Query  807  VAGDLYTLQTNVFTNGYGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRN  628
            V+G  Y LQTNV+ +G  +RE++I LWFDPT++FH Y++LWN++ IVFMVD +PIR YRN
Sbjct  1    VSGQPYILQTNVYADGNDDREERIYLWFDPTKNFHTYSVLWNLHQIVFMVDWIPIRLYRN  60

Query  627  HADKGVAYPMGQPAPAQISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDP  448
            HADKGVAYP  QP   + SLW+G SWAT GG+ KIDWSK PFIASF++Y IDAC W G+P
Sbjct  61   HADKGVAYPRWQPMSIKASLWNGDSWATRGGKDKIDWSKGPFIASFRNYKIDACPWNGNP  120

Query  447  SECRADGPSNWWNQDNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              CRA+  +NWWN++ Y+TLT  QR  ++WV  + + YDYC D++RF  ++P ECSLPKY
Sbjct  121  RFCRAESSTNWWNKERYTTLTSTQRRWFKWVRLHHMIYDYCQDNKRFQNNLPKECSLPKY  180



>ref|XP_010927057.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Elaeis guineensis]
Length=279

 Score =   249 bits (635),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 131/275 (48%), Positives = 174/275 (63%), Gaps = 9/275 (3%)
 Frame = -3

Query  1095  SLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVM  916
             SL +  S G+  QDF + +   G      +G+  +L+LD A+ S   S  + YLFG+  M
Sbjct  11    SLMTGASAGNLYQDFQITWG-DGRAKILENGQLLTLSLDKASGSGFQSKNE-YLFGKIDM  68

Query  915   KMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKI  736
             ++KLVPG SAGTVTA+YL S    + DE+DFEFLGN++GD YTL TNVF  G G RE + 
Sbjct  69    QLKLVPGNSAGTVTAYYL-SSQGPTHDEIDFEFLGNLSGDPYTLHTNVFAQGKGNREMQF  127

Query  735   KLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGS  556
              LWFDPT+DFH ++ILWN  HI+FMVD  PIR ++N   KGVA+P  QP     SLW+  
Sbjct  128   HLWFDPTKDFHTHSILWNPKHIIFMVDGTPIRDFKNMESKGVAFPKNQPMRIYSSLWNAD  187

Query  555   SWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSEC--RADGPSNWWNQDNYSTLTP  382
              WAT GGR+K DW+KAPF AS++++  DACVW    S C  +    ++WWNQD    L  
Sbjct  188   DWATQGGRIKTDWTKAPFTASYRNFNADACVWSSGTSNCPPKKSNSADWWNQD----LDS  243

Query  381   IQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
               +    WV +  + Y+YCTD +RF   +P ECS+
Sbjct  244   TSQARMRWVQRNYMIYNYCTDQKRFPQGLPPECSM  278



>ref|XP_010927058.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Elaeis guineensis]
Length=296

 Score =   249 bits (635),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 133/280 (48%), Positives = 178/280 (64%), Gaps = 13/280 (5%)
 Frame = -3

Query  1098  VSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFV  919
              SL ++ S G+F++DF + +   G      +G+  +L+LD A+ S   S  + YLFG+  
Sbjct  23    CSLMAIASAGNFHRDFQITWG-DGRAKILDNGQHLTLSLDKASGSGFQSKNE-YLFGKIH  80

Query  918   MKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQK  739
             M++KLVPG SAGTVTA+YL S    + DE+DFEFLGN++GD YTL TNVFT G G RE +
Sbjct  81    MQLKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFTQGKGNREMQ  139

Query  738   IKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDG  559
               LWFDPT+DFH Y+ILWN  HI+FMVD +PIR ++N   +G+A+P  QP     SLW+ 
Sbjct  140   FHLWFDPTKDFHTYSILWNPRHIIFMVDGIPIRDFKNLESRGIAFPKNQPMRIYSSLWNA  199

Query  558   SSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPS------NWWNQDNY  397
               WAT GGRVK DW+KAPF AS++++  DACVW    S C +   S      +WWNQ+  
Sbjct  200   DDWATQGGRVKTDWTKAPFTASYRNFKADACVWSSAASNCPSKKSSTDSASDDWWNQE--  257

Query  396   STLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
               L    +    WV    + Y+YCTD +RF   +P ECSL
Sbjct  258   --LDFTSQERMRWVQNNYMIYNYCTDLKRFPQGLPPECSL  295



>gb|ABL10090.1| xyloglucan endotransglycosylase [Musa acuminata]
Length=280

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 131/277 (47%), Positives = 176/277 (64%), Gaps = 10/277 (4%)
 Frame = -3

Query  1098  VSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFV  919
              SL ++ S G+F Q+F V +   G    + D           A+ S   +K++YLFG+  
Sbjct  10    CSLVAIASAGNFYQEFDVTWG--GDRAKNLDNGQLLTLSLDKASGSGFQSKNQYLFGKID  67

Query  918   MKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQK  739
             M++KLVPG SAGTVTA+YL S    + DE+DFEFLGN +GD YTL TNVFT G G RE +
Sbjct  68    MQIKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNPSGDPYTLHTNVFTQGKGNREMQ  126

Query  738   IKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDG  559
              KLWFDPTEDFH Y+ILWN  H++FMVD  PIR ++N   +G+A+P  QP     SLW+ 
Sbjct  127   FKLWFDPTEDFHTYSILWNPRHVIFMVDGTPIRDFKNLESRGIAFPNSQPMRIYSSLWNA  186

Query  558   SSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADG-PSN--WWNQDNYSTL  388
               WAT GG VK DWSKAPF AS++++  D CV     +EC ++  PSN  WWNQ+    L
Sbjct  187   DDWATRGGLVKTDWSKAPFTASYRNFKADTCVPSSATTECASNSVPSNGGWWNQE----L  242

Query  387   TPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
               + +   +WV K  + Y+YC+D +RF+  +P ECS+
Sbjct  243   DSMGQQRMKWVQKNYMIYNYCSDLKRFSQGLPPECSI  279



>ref|XP_008801408.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Phoenix dactylifera]
Length=283

 Score =   248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 136/279 (49%), Positives = 175/279 (63%), Gaps = 13/279 (5%)
 Frame = -3

Query  1098  VSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFV  919
              SL +  S G+F+QDF + +   G      +G+  +L+LD A+ S   S  + YLFG+  
Sbjct  10    CSLMAGASAGNFHQDFQITWGE-GRAQILENGQLLTLSLDKASGSGFQSKNE-YLFGKID  67

Query  918   MKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQK  739
             M++KLVPG SAGTVTA+YL S    + DE+DFEFLGN++GD YTL TNVF  G G RE +
Sbjct  68    MQLKLVPGNSAGTVTAYYL-SSQGPTHDEIDFEFLGNLSGDPYTLHTNVFGLGKGNREMQ  126

Query  738   IKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDG  559
               LWFDPT DFH Y+ILWN  HI+FMVD +PIR ++N   +GVA+P  QP     SLW+ 
Sbjct  127   FHLWFDPTNDFHTYSILWNPKHIIFMVDDIPIRDFKNMESRGVAFPRNQPMRIYSSLWNA  186

Query  558   SSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGP------SNWWNQDNY  397
               WAT GGRVK DW+ APF AS++++  DAC+W    S C A         S+WWNQ+  
Sbjct  187   DDWATQGGRVKTDWTNAPFTASYRNFHADACIWSSGASNCPAKKSSTASTNSDWWNQELD  246

Query  396   STLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECS  280
             ST     R    WV K  + YDYCTD +RF   +P ECS
Sbjct  247   STSQERMR----WVQKNYMIYDYCTDLKRFPQGLPPECS  281



>ref|XP_007204042.1| hypothetical protein PRUPE_ppa021295mg [Prunus persica]
 gb|EMJ05241.1| hypothetical protein PRUPE_ppa021295mg [Prunus persica]
Length=290

 Score =   248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/226 (52%), Positives = 151/226 (67%), Gaps = 3/226 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            +LFG   M +KLVPG SAGTVTA+YL S      DE+DFEFLGN++G  Y + TNV+T G
Sbjct  66   FLFGSIEMLIKLVPGNSAGTVTAYYL-SSTGTKHDEIDFEFLGNISGQPYIVHTNVYTQG  124

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G +EQ+  LWFDPT DFHNYTI WN   IV+ VDS+PIR +RN+ ++G+AYP  Q    
Sbjct  125  NGSKEQQFYLWFDPTADFHNYTIHWNPTEIVWYVDSLPIRVFRNYENQGIAYPNKQGMRV  184

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGD--PSECRADGPSNWWNQ  406
              SLW+  +WAT GG VKIDW+ APF A F+++   AC W GD   S+C    P+NWW  
Sbjct  185  YSSLWNADNWATRGGLVKIDWTSAPFTARFRNFRARACKWNGDISISQCGTTSPANWWTS  244

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              YS L+  +RG  +WV    + YDYC D++RFNG IP EC + ++
Sbjct  245  PIYSQLSSAKRGQLQWVRDSFMIYDYCKDTKRFNGQIPAECFIQQF  290



>ref|XP_008801540.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Phoenix dactylifera]
Length=267

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/223 (53%), Positives = 150/223 (67%), Gaps = 7/223 (3%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  M++KLVPG SAGTVTA+YL S    + DE+DFEFLGN++GD YTL TNVF  G
Sbjct  49   YLFGKIDMQLKLVPGNSAGTVTAYYL-SSQGPTHDEIDFEFLGNLSGDPYTLHTNVFAQG  107

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G +E +  LWFDPT+DFH Y+ILWN  HI+FMVD +PIR ++N   KGVA+P  QP   
Sbjct  108  KGNKEMQFHLWFDPTKDFHTYSILWNPRHIIFMVDGMPIRDFKNMESKGVAFPKNQPMRI  167

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSEC--RADGPSNWWNQ  406
              SLW+   WAT GGR+K DW+KAPF AS++++  DACVW    S C  +    + WWNQ
Sbjct  168  YSSLWNADDWATQGGRIKTDWAKAPFTASYRNFNADACVWSSGASNCPSKKSNSAGWWNQ  227

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
            +  ST     R    WV K  + Y+YCTD +RF   +P ECS+
Sbjct  228  ELDSTSQQRMR----WVQKNYMIYNYCTDLKRFPQGLPPECSI  266



>ref|NP_001058455.2| Os06g0696400 [Oryza sativa Japonica Group]
 dbj|BAF20369.2| Os06g0696400 [Oryza sativa Japonica Group]
Length=259

 Score =   246 bits (628),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 147/221 (67%), Gaps = 15/221 (7%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  M++KLVPG SAGTVT FYL S   ++ DE+DFEFLGNV G+ YTL TNVFT G
Sbjct  53   YLFGKIDMQIKLVPGNSAGTVTTFYL-SSQGSTHDEIDFEFLGNVTGEPYTLHTNVFTQG  111

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ+ +LWFDPT+ FH Y+I+WN  H++F VD  PIR ++NH  +GVA+P  QP   
Sbjct  112  QGQREQQFRLWFDPTQSFHTYSIIWNPQHVIFAVDGTPIRDFKNHEARGVAFPKSQPMRV  171

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              SLW+   WAT GGRVK DWSKAPF+ASF+D+  DACVW              WWNQ+ 
Sbjct  172  YASLWNADDWATQGGRVKADWSKAPFVASFRDFNADACVWSN----------GGWWNQE-  220

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
               L+ +      WV +  + Y+YCTD++RF    P EC L
Sbjct  221  ---LSDMSYRRMRWVQRKFMIYNYCTDAKRFPQGTPAECKL  258



>ref|XP_010099402.1| putative xyloglucan endotransglucosylase/hydrolase protein 6 
[Morus notabilis]
 gb|EXB78247.1| putative xyloglucan endotransglucosylase/hydrolase protein 6 
[Morus notabilis]
Length=290

 Score =   247 bits (631),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/219 (54%), Positives = 152/219 (69%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KLVPG SAGTVTAFY+ SD  A RDE+DFEFLGN +G  YT+QTN++ +G
Sbjct  71   YLFGRVSMKIKLVPGDSAGTVTAFYMNSDTNAVRDELDFEFLGNRSGQPYTVQTNIYAHG  130

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ+I LWFDP  +FH YTI+WN +HIVF VD VPIR Y+N+  KG+ YP+ QP   
Sbjct  131  KGDREQRINLWFDPALEFHTYTIMWNHHHIVFYVDEVPIRVYKNNEVKGIPYPLHQPMGV  190

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDWSKAPF+A +KD+ ++ C   G P+ C A+  +NWW    
Sbjct  191  YSTLWEADDWATRGGLEKIDWSKAPFLAYYKDFDLEGCAVPG-PANCAAN-TANWWEGSA  248

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y +LT I+   Y+WV    + YDYCTD  R+    P EC
Sbjct  249  YQSLTAIEYRRYKWVRVNHMIYDYCTDRSRYPVPPP-EC  286



>ref|XP_006845717.1| hypothetical protein AMTR_s00019p00242730 [Amborella trichopoda]
 gb|ERN07392.1| hypothetical protein AMTR_s00019p00242730 [Amborella trichopoda]
Length=283

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 153/219 (70%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            Y+FG+  MK+KL+PG SAGTVTAFY+ SD    RDE+DFEFLGN +G  YT+QTNV+ +G
Sbjct  64   YMFGRVSMKIKLIPGDSAGTVTAFYMNSDTDTIRDELDFEFLGNRSGQPYTVQTNVYAHG  123

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G REQ++ LWFDP+ DFH Y+ILWN +H+VF VD  PIR Y+N+  +GV+YP  QP   
Sbjct  124  SGNREQRVNLWFDPSADFHTYSILWNRHHVVFSVDDTPIRVYKNNMIRGVSYPTSQPMGV  183

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+  +WAT GG  KI+W++APF+A  KD+ I+ C   G PS C ++ PSNWW+   
Sbjct  184  YSTLWNADNWATRGGLEKINWAQAPFLAYMKDFDIEGCSVPG-PSSCPSN-PSNWWDTQP  241

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L+P Q   Y+WV  + + YDYCTD  RF   +P EC
Sbjct  242  YQQLSPYQARKYKWVRMHYMIYDYCTDKSRF-PVVPPEC  279



>ref|XP_003563483.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Brachypodium distachyon]
Length=290

 Score =   247 bits (630),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 130/285 (46%), Positives = 169/285 (59%), Gaps = 19/285 (7%)
 Frame = -3

Query  1092  LASVVSTGDFNQDFFVIYAAPGHINTSA-DGRstsltldtaaasssmstkdKYLFGQFVM  916
             L  +   G+FNQD  + +   GH N    DG             S   +K +YLFG+  M
Sbjct  14    LVGMAQGGNFNQDAEMTW---GHGNGKVVDGGRGLDLTLDRTTGSGFQSKSEYLFGKIDM  70

Query  915   KMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKI  736
             ++KLVPG SAGTVT FYL S  +A  DE+DFEFLGNV G+ YTL TNVF  G G+REQ+ 
Sbjct  71    QIKLVPGNSAGTVTTFYLSSQGSA-HDEIDFEFLGNVTGEPYTLHTNVFAKGQGQREQQF  129

Query  735   KLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGS  556
             +LWFDPT  FH Y+I+WN  H++F VD  PIR ++N+  +GV++P  QP     SLW+  
Sbjct  130   RLWFDPTTSFHTYSIIWNPQHVIFAVDGTPIRDFKNNEARGVSFPKSQPMRLYASLWNAD  189

Query  555   SWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRAD----------GPSNWWNQ  406
              WAT GGRVK DWSKAPF+ASF+D+  DACVW      C A             S+WWNQ
Sbjct  190   DWATQGGRVKADWSKAPFVASFRDFNADACVWSAGAQRCPAGTMEASSATGASGSSWWNQ  249

Query  405   DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPK  271
                  L+ +      WV +  + Y+YCTD++RF   +P EC L +
Sbjct  250   Q----LSDMSYRRMRWVQRKFMIYNYCTDAKRFPQGVPAECKLRR  290



>gb|AAD39086.1|AF093507_1 xyloglucan endo-transglycosylase-like protein [Medicago truncatula]
Length=276

 Score =   246 bits (628),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 131/261 (50%), Positives = 167/261 (64%), Gaps = 5/261 (2%)
 Frame = -3

Query  1065  FNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVMKMKLVPGYSA  886
             FNQDF V ++ P HI     GR+  LTLD  +     S    YLFG+  MK+KLVPG SA
Sbjct  17    FNQDFHVTWSEP-HIKQIDQGRTIQLTLDQGSGCGFASKVK-YLFGRVSMKIKLVPGDSA  74

Query  885   GTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKIKLWFDPTEDF  706
             GTVTAFY+ SD  + RDE+DFEFLGN  G  YT+QTN++ +G G+REQ++ LWFDP+ DF
Sbjct  75    GTVTAFYMNSDTDSVRDELDFEFLGNRTGQPYTVQTNIYAHGKGDREQRVNLWFDPSADF  134

Query  705   HNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGSSWATDGGRVK  526
             H Y+ILWN +HIVF VD VPIR Y+N+  KG+ YP  Q      +LW+  +WAT GG  K
Sbjct  135   HTYSILWNHHHIVFYVDEVPIRVYKNNEAKGIPYPKMQAMGVFSTLWEADNWATRGGLEK  194

Query  525   IDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQRGLYEWVMKY  346
             I+WSKAPF A +KD+ I+ C   G P+ C  + P NWW    Y  L+ I+   Y WV   
Sbjct  195   INWSKAPFYAYYKDFDIEGCAIPG-PTTCSTN-PKNWWEGVEYQALSAIEARRYRWVRMN  252

Query  345   QITYDYCTDSQRFNGSIPLEC  283
              + YDYC D  R+  + P EC
Sbjct  253   HVIYDYCQDKSRYPMT-PHEC  272



>ref|XP_010927056.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Elaeis guineensis]
Length=277

 Score =   246 bits (627),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 129/273 (47%), Positives = 171/273 (63%), Gaps = 10/273 (4%)
 Frame = -3

Query  1092  LASVVSTGDFNQDFFVIYA-APGHINTSADGRstsltldtaaasssmstkdKYLFGQFVM  916
             L +  S G+F Q+F + +    G I    D           A+ S   +K++YLFG+  M
Sbjct  13    LMATASAGNFYQEFDITWGDGRGKI---LDNGQLLTLALDKASGSGFQSKNEYLFGKIDM  69

Query  915   KMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKI  736
             ++KLVPG SAGTVTA+YL S    + DE+DFEFLGN++G+ YTL TNVFT G G RE + 
Sbjct  70    QLKLVPGNSAGTVTAYYL-SSQGPTHDEIDFEFLGNLSGEPYTLHTNVFTQGKGNREMQF  128

Query  735   KLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGS  556
              LWF+PTEDFH Y+ILWN  H++FMVD  PIR ++N   KGVA+P  QP     SLW+  
Sbjct  129   HLWFNPTEDFHTYSILWNPEHVIFMVDGTPIRDFKNMESKGVAFPKSQPMRIYSSLWNAD  188

Query  555   SWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQ  376
              WAT GGRVK DW+KAPF AS++++  DAC+W    S C +   S+WWNQ+  ST     
Sbjct  189   DWATQGGRVKTDWTKAPFTASYRNFNADACIWSSGTSSCNSQ-KSDWWNQELDSTGQERM  247

Query  375   RGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
             R    W  +  + Y+YCTD +RF   +P ECS+
Sbjct  248   R----WAQENYMIYNYCTDLKRFPQGLPPECSI  276



>ref|XP_006656424.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Oryza brachyantha]
Length=290

 Score =   246 bits (628),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 118/234 (50%), Positives = 151/234 (65%), Gaps = 21/234 (9%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  M++KLVPG SAGTVT FYL S   ++ DE+DFEFLGNV G+ YTL TNVFT G
Sbjct  64   YLFGKIDMQIKLVPGNSAGTVTTFYL-SSQGSTHDEIDFEFLGNVTGEPYTLHTNVFTQG  122

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ+ +LWFDPT+ FH Y+I+WN  H++F VD  PIR ++NH  +GVA+P  QP   
Sbjct  123  QGQREQQFRLWFDPTQSFHTYSIIWNPQHVIFAVDGTPIRDFKNHEARGVAFPKSQPMRV  182

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSEC-------------  439
              SLW+   WAT GGRVK DWSKAPF+ASF++Y  DACVW      C             
Sbjct  183  YASLWNADDWATQGGRVKADWSKAPFVASFRNYNADACVWSNGARRCPVGTMETAAAAAG  242

Query  438  RADGPSNWWNQDNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
            R+ G   WWNQ+    L+ +      WV +  + Y+YCTD +R+   +P EC L
Sbjct  243  RSGG---WWNQE----LSDMSYRRMRWVQRKFMIYNYCTDLKRYPQGVPAECKL  289



>dbj|BAJ10396.1| xyloglucan endotransglucosylase/hydrolase [Dianthus caryophyllus]
 gb|AIJ10711.1| xyloglucan endotransglucosylase/hydrolase4 [Dianthus caryophyllus]
Length=287

 Score =   246 bits (628),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 118/219 (54%), Positives = 149/219 (68%), Gaps = 4/219 (2%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            Y++G+  +++KLVPG SAGTVTAFY+ SD  A  DE+DFEFLGN +G  YT+QTN+F  G
Sbjct  69   YMYGRVSIRIKLVPGDSAGTVTAFYMNSD-NAMHDELDFEFLGNRSGQPYTVQTNIFAQG  127

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             GEREQ++ LWFDP+  +H YT+LWN +HIVFMVD VPIR Y+N+  +G+ YP  QP   
Sbjct  128  KGEREQRVNLWFDPSLQYHTYTLLWNHHHIVFMVDEVPIRVYKNNEARGIPYPKSQPMGV  187

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+  +WAT GG  KIDWSKAPF+A ++D+ I+ C + G P  C A  PSN W   N
Sbjct  188  YSTLWEADNWATRGGLEKIDWSKAPFLAYYRDFDIEGCPYPG-PMSC-ASNPSNMWESAN  245

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L P Q  LY WV    + YDYCTD  R N   P EC
Sbjct  246  YKELNPTQARLYRWVRTNHLVYDYCTDKSR-NPVPPPEC  283



>ref|XP_008801539.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Phoenix dactylifera]
Length=284

 Score =   246 bits (627),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 151/221 (68%), Gaps = 6/221 (3%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  M++KLVPG SAGTVTA+YL S    + DE+DFEFLGN++G+ YTL TNVF  G
Sbjct  69   YLFGKIDMQLKLVPGNSAGTVTAYYL-SSQGPTHDEIDFEFLGNLSGEPYTLHTNVFAQG  127

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G RE +  LWFDPTEDFH Y+ILWN  H+++MVD +PIR ++N   +G+A+P  QP   
Sbjct  128  KGNREMQFHLWFDPTEDFHTYSILWNPGHVIYMVDGIPIRDFKNLESRGIAFPKNQPMRI  187

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              SLW+   WAT GGR+K DW+KAPF AS++++  DAC+W    S C +   S+WWNQ+ 
Sbjct  188  YSSLWNADDWATQGGRIKTDWTKAPFTASYRNFNADACIWSSGASSCNSQ-KSDWWNQEL  246

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
             ST     R    W  +  + Y+YCTD +RF   +PLECS+
Sbjct  247  DSTSQERMR----WAQENYMIYNYCTDLKRFPQGLPLECSV  283



>gb|AAU89381.1| xyloglucan endotransglycosylase hydrolase 1 [Medicago truncatula]
Length=293

 Score =   246 bits (628),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 131/261 (50%), Positives = 167/261 (64%), Gaps = 5/261 (2%)
 Frame = -3

Query  1065  FNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVMKMKLVPGYSA  886
             FNQDF V ++ P HI     GR+  LTLD  +     S    YLFG+  MK+KLVPG SA
Sbjct  34    FNQDFHVTWSEP-HIKQIDQGRTIQLTLDQGSGCGFASKVK-YLFGRVSMKIKLVPGDSA  91

Query  885   GTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKIKLWFDPTEDF  706
             GTVTAFY+ SD  + RDE+DFEFLGN  G  YT+QTN++ +G G+REQ++ LWFDP+ DF
Sbjct  92    GTVTAFYMNSDTDSVRDELDFEFLGNRTGQPYTVQTNIYAHGKGDREQRVNLWFDPSADF  151

Query  705   HNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGSSWATDGGRVK  526
             H Y+ILWN +HIVF VD VPIR Y+N+  KG+ YP  Q      +LW+  +WAT GG  K
Sbjct  152   HTYSILWNHHHIVFYVDEVPIRVYKNNEAKGIPYPKMQAMGVFSTLWEADNWATRGGLEK  211

Query  525   IDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQRGLYEWVMKY  346
             I+WSKAPF A +KD+ I+ C   G P+ C  + P NWW    Y  L+ I+   Y WV   
Sbjct  212   INWSKAPFYAYYKDFDIEGCAIPG-PTTCSTN-PKNWWEGVEYQALSAIEARRYRWVRMN  269

Query  345   QITYDYCTDSQRFNGSIPLEC  283
              + YDYC D  R+  + P EC
Sbjct  270   HVIYDYCQDKSRYPMT-PHEC  289



>dbj|BAD53910.1| putative xyloglucan endotransglycosylase [Oryza sativa Japonica 
Group]
 dbj|BAD54446.1| putative xyloglucan endotransglycosylase [Oryza sativa Japonica 
Group]
 gb|EAZ02220.1| hypothetical protein OsI_24315 [Oryza sativa Indica Group]
 gb|EAZ38140.1| hypothetical protein OsJ_22491 [Oryza sativa Japonica Group]
 dbj|BAG89831.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97023.1| unnamed protein product [Oryza sativa Japonica Group]
Length=293

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/235 (51%), Positives = 150/235 (64%), Gaps = 19/235 (8%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  M++KLVPG SAGTVT FYL S   ++ DE+DFEFLGNV G+ YTL TNVFT G
Sbjct  63   YLFGKIDMQIKLVPGNSAGTVTTFYL-SSQGSTHDEIDFEFLGNVTGEPYTLHTNVFTQG  121

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ+ +LWFDPT+ FH Y+I+WN  H++F VD  PIR ++NH  +GVA+P  QP   
Sbjct  122  QGQREQQFRLWFDPTQSFHTYSIIWNPQHVIFAVDGTPIRDFKNHEARGVAFPKSQPMRV  181

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSEC-------------  439
              SLW+   WAT GGRVK DWSKAPF+ASF+D+  DACVW      C             
Sbjct  182  YASLWNADDWATQGGRVKADWSKAPFVASFRDFNADACVWSNGAQRCPVGTMETVAAPAG  241

Query  438  -RADGPSNWWNQDNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
             R  G   WWNQ+    L+ +      WV +  + Y+YCTD++RF    P EC L
Sbjct  242  GRRGGAGGWWNQE----LSDMSYRRMRWVQRKFMIYNYCTDAKRFPQGTPAECKL  292



>ref|XP_003608572.1| Xyloglucan endotransglycosylase hydrolase [Medicago truncatula]
 gb|AES90769.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
Length=328

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/261 (50%), Positives = 167/261 (64%), Gaps = 5/261 (2%)
 Frame = -3

Query  1065  FNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVMKMKLVPGYSA  886
             FNQDF V ++ P HI     GR+  LTLD  +     S    YLFG+  MK+KLVPG SA
Sbjct  69    FNQDFHVTWSEP-HIKQIDQGRTIQLTLDQGSGCGFASKVK-YLFGRVSMKIKLVPGDSA  126

Query  885   GTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKIKLWFDPTEDF  706
             GTVTAFY+ SD  + RDE+DFEFLGN  G  YT+QTN++ +G G+REQ++ LWFDP+ DF
Sbjct  127   GTVTAFYMNSDTDSVRDELDFEFLGNRTGQPYTVQTNIYAHGKGDREQRVNLWFDPSADF  186

Query  705   HNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGSSWATDGGRVK  526
             H Y+ILWN +HIVF VD VPIR Y+N+  KG+ YP  Q      +LW+  +WAT GG  K
Sbjct  187   HTYSILWNHHHIVFYVDEVPIRVYKNNEAKGIPYPKMQAMGVFSTLWEADNWATRGGLEK  246

Query  525   IDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQRGLYEWVMKY  346
             I+WSKAPF A +KD+ I+ C   G P+ C  + P NWW    Y  L+ I+   Y WV   
Sbjct  247   INWSKAPFYAYYKDFDIEGCAIPG-PTTCSTN-PKNWWEGVEYQALSAIEARRYRWVRMN  304

Query  345   QITYDYCTDSQRFNGSIPLEC  283
              + YDYC D  R+  + P EC
Sbjct  305   HVIYDYCQDKSRYPMT-PHEC  324



>ref|XP_003608566.1| Xyloglucan endotransglycosylase hydrolase [Medicago truncatula]
 ref|XP_003608569.1| Xyloglucan endotransglycosylase hydrolase [Medicago truncatula]
 gb|AES90763.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
 gb|AES90766.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
Length=291

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/261 (50%), Positives = 167/261 (64%), Gaps = 5/261 (2%)
 Frame = -3

Query  1065  FNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVMKMKLVPGYSA  886
             FNQDF V ++ P HI     GR+  LTLD  +     S    YLFG+  MK+KLVPG SA
Sbjct  32    FNQDFHVTWSEP-HIKQIDQGRTIQLTLDQGSGCGFASKVK-YLFGRVSMKIKLVPGDSA  89

Query  885   GTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKIKLWFDPTEDF  706
             GTVTAFY+ SD  + RDE+DFEFLGN  G  YT+QTN++ +G G+REQ++ LWFDP+ DF
Sbjct  90    GTVTAFYMNSDTDSVRDELDFEFLGNRTGQPYTVQTNIYAHGKGDREQRVNLWFDPSADF  149

Query  705   HNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGSSWATDGGRVK  526
             H Y+ILWN +HIVF VD VPIR Y+N+  KG+ YP  Q      +LW+  +WAT GG  K
Sbjct  150   HTYSILWNHHHIVFYVDEVPIRVYKNNEAKGIPYPKMQAMGVFSTLWEADNWATRGGLEK  209

Query  525   IDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQRGLYEWVMKY  346
             I+WSKAPF A +KD+ I+ C   G P+ C  + P NWW    Y  L+ I+   Y WV   
Sbjct  210   INWSKAPFYAYYKDFDIEGCAIPG-PTTCSTN-PKNWWEGVEYQALSAIEARRYRWVRMN  267

Query  345   QITYDYCTDSQRFNGSIPLEC  283
              + YDYC D  R+  + P EC
Sbjct  268   HVIYDYCQDKSRYPMT-PHEC  287



>gb|KGN65065.1| Xyloglucan endotransglycosylase/hydrolase [Cucumis sativus]
Length=293

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 129/276 (47%), Positives = 176/276 (64%), Gaps = 7/276 (3%)
 Frame = -3

Query  1098  VSLASVVS--TGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQ  925
             V+L+ VVS     F +DF V +A   H+    DG      +   ++    +++ +YLFG+
Sbjct  20    VALSIVVSGRPATFLEDFRVTWAD-NHVR-QLDGGRGIQLVLDQSSGCGFASRRQYLFGK  77

Query  924   FVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGERE  745
               MK+KLVPG SAGTVTAFY+ SD    RDE+DFEFLGN +G  YT+QTN++ +G G+RE
Sbjct  78    VSMKIKLVPGDSAGTVTAFYMNSDTDTIRDELDFEFLGNRSGQPYTVQTNIYAHGKGDRE  137

Query  744   QKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLW  565
             Q++ LWFDP  DFH Y+I+W  + I+F VD +PIR Y+NH +KG+ YP  QP     +LW
Sbjct  138   QRVNLWFDPAADFHTYSIMWTRWLIIFGVDDIPIRVYKNHEEKGIPYPKLQPMGVYSTLW  197

Query  564   DGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLT  385
             +   WAT GG  KIDW KAPF A +KD+ I+ C   G P+ C ++ P+NWW    Y TL+
Sbjct  198   EADDWATRGGLEKIDWKKAPFYAYYKDFDIEGCPVPG-PANCPSN-PNNWWEGTAYRTLS  255

Query  384   PIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
             P Q   Y+WV    + YDYCTD  R+  + P EC+L
Sbjct  256   PAQAKNYQWVKANHMIYDYCTDKSRYPQTPP-ECAL  290



>ref|XP_009390493.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Musa acuminata subsp. malaccensis]
Length=275

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 152/221 (69%), Gaps = 7/221 (3%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  M++KLVPG SAGTVTA+YL S    + DE+DFEFLGN++GD YTL TNVFT G
Sbjct  61   YLFGKIDMQIKLVPGNSAGTVTAYYL-SSQGPTHDEIDFEFLGNLSGDPYTLHTNVFTQG  119

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G RE + KLWFDPTEDFH Y+ILWN  H++FMVD  PIR ++N   +G+A+P  QP   
Sbjct  120  KGNREMQFKLWFDPTEDFHTYSILWNPRHVIFMVDGTPIRDFKNLESRGIAFPKNQPMRI  179

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              SLW+   WAT GG VK DWSKAPF+AS++++  DACV +G  S+C     S WWNQ+ 
Sbjct  180  YSSLWNADDWATRGGLVKTDWSKAPFVASYRNFNADACV-RGS-SKCGGSTKSGWWNQE-  236

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
               L    +G   WV K  + Y+YC D++RF   +P EC++
Sbjct  237  ---LDLSSQGRMRWVQKNYMIYNYCNDAKRFPQGLPPECAI  274



>ref|XP_009611598.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 7 [Nicotiana tomentosiformis]
Length=291

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 132/274 (48%), Positives = 171/274 (62%), Gaps = 7/274 (3%)
 Frame = -3

Query  1098  VSLASVVST--GDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQ  925
             ++ +S VS     F QDF V +A   HI    DG      +    +    ++K KYLFG+
Sbjct  19    LTFSSSVSARPATFLQDFKVAWAD-SHIK-QIDGGKAIQLILDQNSGCGFASKSKYLFGR  76

Query  924   FVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGERE  745
               MK+KLVPG SAGTVTAFY+ SD    RDE+DFEFLGN +G  YT+QTNV+ +G G++E
Sbjct  77    VSMKIKLVPGDSAGTVTAFYMNSDTDNVRDELDFEFLGNRSGQPYTVQTNVYVHGKGDKE  136

Query  744   QKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLW  565
             Q+I LWFDP+ DFH YTILWN +H VF VD+VPIR Y+N+  KG+ +P  QP     +LW
Sbjct  137   QRINLWFDPSADFHTYTILWNHHHTVFYVDAVPIRVYKNNEAKGIPFPKFQPMGVYSTLW  196

Query  564   DGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLT  385
             +   WAT GG  KI+WS++PF A +KD+ I+ C   G P+ C A  P NWW   NY  L+
Sbjct  197   EADDWATRGGLEKINWSRSPFYAYYKDFDIEGCAMPG-PANC-ASNPRNWWEGANYQQLS  254

Query  384   PIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
              ++   Y WV    + YDYCTD  R N   P EC
Sbjct  255   AVEAKQYRWVRMNHMIYDYCTDKSR-NPVTPPEC  287



>ref|XP_009401564.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Musa acuminata subsp. malaccensis]
Length=280

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 129/277 (47%), Positives = 176/277 (64%), Gaps = 10/277 (4%)
 Frame = -3

Query  1098  VSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFV  919
              SL ++ S G+F Q+F V +   G    + D           A+ S   +K++YLFG+  
Sbjct  10    CSLVAIASAGNFYQEFDVTWG--GDRAKNLDNGQLLTLSLDKASGSGFQSKNQYLFGKID  67

Query  918   MKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQK  739
             M++KLVPG SAGTVTA+YL S    + DE+DFEFLGN++GD YTL TNVFT G G RE +
Sbjct  68    MQIKLVPGNSAGTVTAYYL-SSQGPTHDEIDFEFLGNLSGDPYTLHTNVFTQGKGNREMQ  126

Query  738   IKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDG  559
              KLWFDPT+DFH Y+ILWN  H++FMVD  PIR ++N   +G+A+P  QP     SLW+ 
Sbjct  127   FKLWFDPTDDFHTYSILWNPRHVIFMVDGTPIRDFKNLESRGIAFPNSQPMRIYSSLWNA  186

Query  558   SSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADG-PSN--WWNQDNYSTL  388
               WAT GG VK DWS+APF AS++++  + CV     SEC ++  PSN  WWNQ+    L
Sbjct  187   DDWATRGGLVKTDWSRAPFTASYRNFKANTCVPSSATSECASNSVPSNGGWWNQE----L  242

Query  387   TPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
               + +   +WV K  + Y+YC+D +RF   +P ECS+
Sbjct  243   DSMGQQRMKWVQKNYMIYNYCSDLKRFPQGLPPECSI  279



>ref|XP_009792284.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 7 [Nicotiana sylvestris]
Length=292

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 130/261 (50%), Positives = 165/261 (63%), Gaps = 5/261 (2%)
 Frame = -3

Query  1065  FNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVMKMKLVPGYSA  886
             F QDF V +A   HI    DG      +    +    ++K KYLFG+  MK+KLVPG SA
Sbjct  33    FLQDFKVAWAD-SHIK-QIDGGKAIQLILDQNSGCGFASKSKYLFGRVSMKIKLVPGDSA  90

Query  885   GTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKIKLWFDPTEDF  706
             GTVTAFY+ SD    RDE+DFEFLGN +G  YT+QTNV+ +G G++EQ+I LWFDP+ DF
Sbjct  91    GTVTAFYMNSDTDNVRDELDFEFLGNRSGQPYTVQTNVYVHGKGDKEQRINLWFDPSADF  150

Query  705   HNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGSSWATDGGRVK  526
             H YTILWN +H VF VD+VPIR Y+N+  KG+ +P  QP     +LW+   WAT GG  K
Sbjct  151   HTYTILWNHHHTVFYVDAVPIRVYKNNEAKGIPFPKFQPMGVYSTLWEADDWATRGGLEK  210

Query  525   IDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQRGLYEWVMKY  346
             I+WSK+PF A +KD+ I+ C   G P+ C A  P NWW   NY  L+ ++   Y WV   
Sbjct  211   INWSKSPFYAYYKDFDIEGCAMPG-PANC-ASNPRNWWEGANYQQLSAVEARQYRWVRTN  268

Query  345   QITYDYCTDSQRFNGSIPLEC  283
              + YDYCTD  R N   P EC
Sbjct  269   HMIYDYCTDKSR-NPVPPPEC  288



>ref|XP_009392942.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 7 [Musa acuminata subsp. malaccensis]
Length=286

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 148/219 (68%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            Y +G+  MK+KL+PG SAGTVTAFY+ SD  A RDE+DFEFLGN +G  YT+QTN++ +G
Sbjct  67   YHYGRVSMKIKLIPGDSAGTVTAFYMNSDTDAVRDELDFEFLGNRSGQPYTVQTNIYAHG  126

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP  D+H YTILWN +H+VF VD VPIR Y+N+  +G+ YP  QP   
Sbjct  127  KGDREQRVNLWFDPAADYHTYTILWNHFHVVFSVDDVPIRVYKNNEGRGIPYPKVQPMGV  186

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+G  WAT GG  KIDWSKAPF A +KD+ I+ C   G P+ C A  P+NWW    
Sbjct  187  YSTLWEGDDWATRGGLEKIDWSKAPFYAYYKDFDIEGCAVPG-PANC-ASNPNNWWEGSA  244

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L+P Q   Y WV    + YDYCTD  R+    P EC
Sbjct  245  YRQLSPEQARKYRWVRANHMIYDYCTDKPRYP-VPPPEC  282



>ref|XP_009773101.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6 [Nicotiana sylvestris]
Length=292

 Score =   244 bits (624),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 148/219 (68%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KLVPG SAGTVTAFY+ SD    RDE+DFEFLGN +G  YT+QTNV+ +G
Sbjct  73   YLFGRVSMKIKLVPGDSAGTVTAFYMNSDTDNVRDELDFEFLGNRSGQPYTVQTNVYVHG  132

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G++EQ++ LWFDP+ DFH YTILWN +H VF VD+VPIR Y+N+  KG+ +P  QP   
Sbjct  133  KGDKEQRVNLWFDPSADFHTYTILWNHHHAVFYVDAVPIRVYKNNEAKGIPFPKFQPMGV  192

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KI+WSK+PF A +KD+ I+ C   G P+ C A  P NWW   N
Sbjct  193  YSTLWEADDWATRGGLEKINWSKSPFYAYYKDFDIEGCAMPG-PANC-ASNPRNWWEGAN  250

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L+ ++   Y WV    + YDYCTD  R N   P EC
Sbjct  251  YQQLSAVEARQYRWVRMNHMIYDYCTDKSR-NPVTPPEC  288



>gb|KFK28426.1| hypothetical protein AALP_AA8G513200 [Arabis alpina]
Length=269

 Score =   243 bits (621),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 118/219 (54%), Positives = 149/219 (68%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KLVPG SAGTVTAFY+ SD    RDE+DFEFLGN +G  Y++QTN+F +G
Sbjct  52   YLFGRVSMKIKLVPGDSAGTVTAFYMNSDTDTVRDELDFEFLGNRSGQPYSVQTNIFAHG  111

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP+ DFH YTILW+  HIVF VD VPIR Y+N+  K ++YP  QP   
Sbjct  112  KGDREQRVNLWFDPSLDFHTYTILWSHKHIVFYVDDVPIREYKNNVAKNISYPTSQPMGV  171

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDWSKAPF A +KD+ I+AC   G P+ C ++ P NWW    
Sbjct  172  YSTLWEADDWATRGGLEKIDWSKAPFYAYYKDFDIEACSVPG-PTNCPSN-PHNWWEGYA  229

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y +L  ++   Y WV    + YDYCTD  R+    PLEC
Sbjct  230  YQSLNAVEARRYRWVRVNHMVYDYCTDKSRYPVP-PLEC  267



>gb|AAU89382.1| xyloglucan endotransglycosylase hydrolase 2 [Medicago truncatula]
Length=291

 Score =   244 bits (622),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 130/261 (50%), Positives = 166/261 (64%), Gaps = 5/261 (2%)
 Frame = -3

Query  1065  FNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVMKMKLVPGYSA  886
             FNQDF V ++ P HI     GR+  LTLD  +     S    YLFG+  MK+KLVPG SA
Sbjct  32    FNQDFHVTWSEP-HIKQIDQGRTIQLTLDQGSGCGFASKVK-YLFGRVSMKIKLVPGDSA  89

Query  885   GTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKIKLWFDPTEDF  706
             GTVTAFY+ SD  + RDE+DFEFLGN  G  YT+QTN++ +G G+REQ++ LWFDP+ DF
Sbjct  90    GTVTAFYMNSDTDSVRDELDFEFLGNRTGQPYTVQTNIYAHGKGDREQRVNLWFDPSADF  149

Query  705   HNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGSSWATDGGRVK  526
             H Y+ILWN +HIVF VD VPIR Y+N+  KG+ YP  Q      +LW+  +WAT GG  K
Sbjct  150   HTYSILWNHHHIVFYVDEVPIRVYKNNEAKGIPYPKMQAMGVFSTLWEADNWATRGGLEK  209

Query  525   IDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQRGLYEWVMKY  346
             I+WSKAPF A +KD+ I+ C   G P+ C  + P NWW    Y   + I+   Y WV   
Sbjct  210   INWSKAPFYAYYKDFDIEGCAISG-PNTCSTN-PKNWWGGVEYQAFSAIEARRYRWVCMN  267

Query  345   QITYDYCTDSQRFNGSIPLEC  283
              + YDYC D  R+  + P EC
Sbjct  268   HVIYDYCQDKSRYPMT-PHEC  287



>ref|XP_002280688.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 26 [Vitis vinifera]
Length=291

 Score =   244 bits (622),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 113/226 (50%), Positives = 152/226 (67%), Gaps = 3/226 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            +LFG   M +KLVPG SAGTVTA+YL S   +  DE+DFEFLGNV+G  YT+ TN++T G
Sbjct  67   FLFGSIEMLIKLVPGNSAGTVTAYYL-SSTGSKHDEIDFEFLGNVSGQPYTIHTNIYTQG  125

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G REQ+  LWFDPT DFHNYTI WN   +V+ +DS+PIR +RN+ ++G+AYP  Q    
Sbjct  126  NGSREQQFYLWFDPTADFHNYTIHWNPTEVVWYIDSIPIRVFRNYENEGIAYPSKQGMRV  185

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPS--ECRADGPSNWWNQ  406
              S+W+  +WAT GG VKIDW  APF+A F+ +   AC W G  S  +C +  P+NWW  
Sbjct  186  YSSIWNADNWATRGGLVKIDWYSAPFVARFRHFRARACKWNGPVSIDQCASKSPANWWTS  245

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              YS L+  ++G  +WV    + YDYC D++RF G++P EC  P++
Sbjct  246  PVYSQLSYAKKGQMKWVRDNHMIYDYCKDTKRFQGNMPPECFKPQF  291



>ref|XP_008242631.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 26 [Prunus mume]
Length=258

 Score =   243 bits (619),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 116/226 (51%), Positives = 150/226 (66%), Gaps = 3/226 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            +LFG   M +KLVPG SAGTVTA+YL S      DE+DFEFLGN++G  Y + TNV+T G
Sbjct  34   FLFGSIEMLIKLVPGNSAGTVTAYYL-SSTGTKHDEIDFEFLGNISGQPYIVHTNVYTQG  92

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G +EQ+  LWFDPT DFHNYTI WN   IV+ VDS+PIR +RN+ ++G+AYP  Q    
Sbjct  93   NGSKEQQFYLWFDPTADFHNYTIHWNPTEIVWYVDSLPIRVFRNYENQGIAYPNKQGMRV  152

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGD--PSECRADGPSNWWNQ  406
              SLW+  +WAT GG VKIDW+ APF A F+++   AC W GD   S+C    P+NWW  
Sbjct  153  YSSLWNADNWATRGGLVKIDWTSAPFTARFRNFRARACKWNGDISISQCGTTSPANWWTS  212

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              YS L+  +RG  +WV    + YDYC D++RF G IP EC + ++
Sbjct  213  PIYSQLSSAKRGQLQWVRDNFMIYDYCKDTKRFIGQIPPECFMQQF  258



>ref|XP_011099425.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 7 [Sesamum indicum]
Length=288

 Score =   243 bits (621),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 129/272 (47%), Positives = 167/272 (61%), Gaps = 5/272 (2%)
 Frame = -3

Query  1098  VSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFV  919
             +S         F QDF + +A   HI    DG      +   ++    ++K +YLFG+  
Sbjct  18    LSCTVTARPATFLQDFRITWAD-SHIR-QLDGGRAIQLVLDQSSGCGFASKYQYLFGRVS  75

Query  918   MKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQK  739
             MK+KLVPG SAGTVTAFY+ SD    RDE+DFEFLGN +G  YT+QTNV+ +G G+REQ+
Sbjct  76    MKIKLVPGDSAGTVTAFYMNSDTDTIRDELDFEFLGNRSGQPYTVQTNVYAHGKGDREQR  135

Query  738   IKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDG  559
             I LWFDP  +FH Y+ILWN  H+VF VD VPIR Y+N+  +G+ +P  QP     +LW+ 
Sbjct  136   INLWFDPAAEFHTYSILWNHRHVVFYVDEVPIRVYKNNEARGIPFPKFQPMGVYSTLWEA  195

Query  558   SSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPI  379
               WAT GG  KIDWSKAPF A +KD+ I+ C   G P+ C A  PSNWW    Y  L P 
Sbjct  196   DDWATRGGLEKIDWSKAPFYAYYKDFDIEGCPVPG-PANC-ASNPSNWWEGAAYQQLNPE  253

Query  378   QRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
             +   Y+WV    + YDYCTD  R+  + P EC
Sbjct  254   EAKRYKWVRMNHMIYDYCTDKSRYPNTPP-EC  284



>gb|ABK21095.1| unknown [Picea sitchensis]
Length=297

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 148/219 (68%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG F M++K+VPG S+GTVTAFYL S   A  DE+DFEFLGN +G+ Y LQTNVFT G
Sbjct  75   YLFGHFSMQIKMVPGDSSGTVTAFYL-SSQTAEHDEIDFEFLGNKSGEPYILQTNVFTGG  133

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             GERE +I LWFDPT+D+H+Y +LWN+Y IVF+VD VPIR ++N  D GV YP  QP   
Sbjct  134  KGEREHRIYLWFDPTQDYHSYAVLWNMYQIVFLVDEVPIRVFKNSKDLGVRYPFNQPMKI  193

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              SLW+   WAT GG  K DW+KAPFIAS++++ +DAC      S C   G   WW+Q+ 
Sbjct  194  YSSLWNADDWATRGGLEKTDWTKAPFIASYREFHVDACEASAPQSVCATQG-RRWWDQEE  252

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            +  L   Q    +WV K+   Y+YCTD+ R N  +P EC
Sbjct  253  FRDLDGRQWRFLKWVRKHYTIYNYCTDTPR-NKQMPPEC  290



>gb|ABK22987.1| unknown [Picea sitchensis]
Length=297

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/219 (54%), Positives = 147/219 (67%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG F M++K+VPG S+GTVTAFYL S   A  DE+DFEFLGN +G+ Y LQTNVFT G
Sbjct  75   YLFGHFSMQIKMVPGDSSGTVTAFYL-SSQTAEHDEIDFEFLGNKSGEPYILQTNVFTGG  133

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             GERE +I LWFDPT+D+H+Y +LWN+Y IVF+VD VPIR ++N  D GV YP  QP   
Sbjct  134  KGEREHRIYLWFDPTKDYHSYAVLWNMYQIVFLVDEVPIRVFKNSKDLGVRYPFNQPMKL  193

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              SLW+   WAT GG  K DWSKAPFIAS+K + +DAC      S C   G   WW+Q+ 
Sbjct  194  YSSLWNADDWATRGGLEKTDWSKAPFIASYKQFHVDACEASAPHSVCATQG-RRWWDQEE  252

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            +  L   Q    +WV K+   Y+YCTD+ R N  +P EC
Sbjct  253  FRDLDGRQWRYLKWVRKHYTIYNYCTDTPR-NKQMPPEC  290



>gb|KHN41652.1| Putative xyloglucan endotransglucosylase/hydrolase protein 26 
[Glycine soja]
Length=259

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/226 (52%), Positives = 144/226 (64%), Gaps = 3/226 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            +LFG   M +KLVPG SAGTVTA+YL S   +  DE+DFEFLGN  G  YT+ TN++T G
Sbjct  35   FLFGSIEMLIKLVPGNSAGTVTAYYL-SSAGSQHDEIDFEFLGNSTGQPYTVHTNIYTQG  93

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G REQ+  LWFDPT DFHNYTI WN   IV+ VDSVPIR +RN+  +G+AYP  Q    
Sbjct  94   KGSREQQFYLWFDPTADFHNYTIHWNPTAIVWYVDSVPIRVFRNYEKEGIAYPTKQGMRV  153

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPS--ECRADGPSNWWNQ  406
              +LW+   WAT GG VK DW  APF A F  +   AC W G  S  +C ++ P+NWW  
Sbjct  154  YTTLWNADDWATRGGLVKTDWHSAPFTARFHHFRARACKWGGAKSINQCASNLPANWWTS  213

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              Y  L+  Q G   WV    + YDYCTD++RFNG IP EC  P++
Sbjct  214  RRYKQLSHSQMGQLNWVRNNYMIYDYCTDTKRFNGQIPPECFKPQF  259



>ref|XP_011073659.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 7 [Sesamum indicum]
Length=288

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 148/219 (68%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KLVPG SAGTVTAFY+ SD    RDE+DFEFLGN +G  YT+QTNV+ +G
Sbjct  69   YLFGRVSMKIKLVPGDSAGTVTAFYMNSDTDTVRDELDFEFLGNRSGQPYTVQTNVYAHG  128

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ+I LWFDP+ DFH Y+ILWN +H+VF VD VPIR Y+N+  KGV +P  QP   
Sbjct  129  KGDREQRINLWFDPSADFHTYSILWNHHHVVFSVDEVPIRVYKNNEAKGVPFPKFQPMAV  188

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDWSKAPF A +KD+ I+ C+  G P+ C A   +NWW    
Sbjct  189  YSTLWEADDWATRGGLEKIDWSKAPFYAYYKDFDIEGCLAPG-PTSC-ASNLNNWWEGAA  246

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L P Q   Y WV    + YDYCTD  R+  + P EC
Sbjct  247  YQELNPDQARRYHWVRMNHMIYDYCTDKARYPVTPP-EC  284



>ref|XP_009628114.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 7 [Nicotiana tomentosiformis]
Length=292

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 147/219 (67%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KLVPG SAGTVTAFY+ SD    RDE+DFEFLGN +G  YT+QTNV+ +G
Sbjct  73   YLFGRVSMKIKLVPGDSAGTVTAFYMNSDTDNVRDELDFEFLGNRSGQPYTVQTNVYVHG  132

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G++EQ++ LWFDP+ DFH YTILWN +H VF VD+VPIR Y+N+  KG+ +P  QP   
Sbjct  133  KGDKEQRVNLWFDPSADFHTYTILWNHHHAVFYVDAVPIRVYKNNEAKGIPFPKFQPMGV  192

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KI+WSK+PF A +KD+ I+ C   G P+ C A  P NWW   N
Sbjct  193  YSTLWEADDWATRGGLEKINWSKSPFYAYYKDFDIEGCAMPG-PANC-ASNPRNWWEGAN  250

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L+  +   Y WV    + YDYCTD  R N   P EC
Sbjct  251  YQQLSAAEARQYRWVRMNHMIYDYCTDKSR-NPVTPPEC  288



>ref|XP_009415319.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 7 [Musa acuminata subsp. malaccensis]
Length=286

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 147/219 (67%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            Y +G+  MK+KL+PG SAGTVTAFYL SD    RDE+DFEFLGN +G  YT+QTNV+ +G
Sbjct  67   YHYGRVSMKIKLIPGDSAGTVTAFYLNSDTDTVRDELDFEFLGNRSGQPYTVQTNVYAHG  126

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP  D+H YTILWN YH+VF VD+VP+R ++N+  +G+ YP  QP   
Sbjct  127  KGDREQRVNLWFDPAADYHTYTILWNHYHVVFSVDNVPVRVFKNNERRGIPYPTLQPMGV  186

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDW KAPF A +KD+ I+ C   G P+ C A  P+NWW    
Sbjct  187  YSTLWEADDWATRGGLEKIDWGKAPFYAYYKDFDIEGCAVPG-PANC-ASNPNNWWEGPA  244

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L+P Q  LY WV    + YDYCTD  R+    P EC
Sbjct  245  YRQLSPEQARLYRWVRTNHMIYDYCTDKSRYPVPPP-EC  282



>ref|XP_011048362.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 26 [Populus euphratica]
Length=291

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 150/221 (68%), Gaps = 3/221 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            +LFG   M +KLVPG SAGTVTA+Y+ S    + DE+DFEFLGN +G  YT+ TN++T G
Sbjct  67   FLFGSMQMLIKLVPGNSAGTVTAYYV-SSSGDTHDEIDFEFLGNTSGQPYTIHTNIYTQG  125

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G REQ+ + WFDPT DFHNYTI WN   +V+ +D+VPIR +RN+ ++G+AYP  Q    
Sbjct  126  NGSREQQFRPWFDPTADFHNYTIHWNPTEVVWYIDNVPIRVFRNYENEGIAYPNKQGMRV  185

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPS--ECRADGPSNWWNQ  406
              SLW+  +WAT GGRVKIDW+ APFIA ++++   AC W G  S  +C A+ P+NWW  
Sbjct  186  YSSLWNADNWATQGGRVKIDWTVAPFIARYRNFRARACKWNGPVSINQCAANTPANWWTS  245

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
              YS L+  Q G   WV    + Y+YC D++RFNG +P EC
Sbjct  246  PTYSKLSDAQLGQMNWVRDNYMIYNYCNDTRRFNGQMPPEC  286



>ref|XP_003524400.2| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 26-like [Glycine max]
Length=289

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/226 (52%), Positives = 144/226 (64%), Gaps = 3/226 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            +LFG   M +KLVPG SAGTVTA+YL S   +  DE+DFEFLGN  G  YT+ TN++T G
Sbjct  65   FLFGSIEMLIKLVPGNSAGTVTAYYL-SSAGSQHDEIDFEFLGNSTGQPYTVHTNIYTQG  123

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G REQ+  LWFDPT DFHNYTI WN   IV+ VDSVPIR +RN+  +G+AYP  Q    
Sbjct  124  KGSREQQFYLWFDPTADFHNYTIHWNPTAIVWYVDSVPIRVFRNYEKEGIAYPTKQGMRV  183

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPS--ECRADGPSNWWNQ  406
              +LW+   WAT GG VK DW  APF A F  +   AC W G  S  +C ++ P+NWW  
Sbjct  184  YTTLWNADDWATRGGLVKTDWHSAPFTARFHHFRARACKWGGAKSINQCASNLPANWWTS  243

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              Y  L+  Q G   WV    + YDYCTD++RFNG IP EC  P++
Sbjct  244  RRYKQLSHSQMGQLNWVRNNYMIYDYCTDTKRFNGQIPPECFKPQF  289



>gb|AIE54304.1| xyloglucan endotransglucosylase-hydrolase XTH7 [Nicotiana tabacum]
Length=292

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 147/219 (67%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KLVPG SAGTVTAFY+ SD    RDE+DFEFLGN +G  YT+QT+V+ +G
Sbjct  73   YLFGRVSMKIKLVPGDSAGTVTAFYMNSDTDNVRDELDFEFLGNRSGQPYTVQTSVYVHG  132

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G++EQ++ LWFDP+ DFH YTILWN YH VF VD+VPIR Y+N+  KG+ +P  QP   
Sbjct  133  KGDKEQRVNLWFDPSADFHTYTILWNHYHAVFYVDAVPIRVYKNNEAKGIPFPKFQPMGV  192

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KI+WSK+PF A +KD+ I+ C   G P+ C A  P NWW   N
Sbjct  193  YSTLWEADDWATRGGLEKINWSKSPFYAYYKDFDIEGCAMPG-PANC-ASNPRNWWEGAN  250

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L+  +   Y WV    + YDYCTD  R N   P EC
Sbjct  251  YQQLSAAEARQYRWVRMNHMIYDYCTDKSR-NPVTPPEC  288



>gb|ADJ67812.1| xyloglucan endotransglycosylase [Dahlia pinnata]
Length=293

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 147/219 (67%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KL+PG SAGTVTAFY+ SD    RDE+DFEFLGN +G  Y++QTNV+ +G
Sbjct  74   YLFGRVSMKIKLIPGDSAGTVTAFYMNSDTDQVRDELDFEFLGNRSGQPYSVQTNVYAHG  133

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP  D+H Y+ILWN +H+VF VD VPIR Y+N+  KGV +P  QP   
Sbjct  134  KGDREQRVNLWFDPAADYHTYSILWNHHHVVFSVDDVPIRVYKNNEAKGVPFPKFQPMGV  193

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDW KAPF A +KD+ I+ C   G P+ C A  PSNWW   +
Sbjct  194  YSTLWEADDWATRGGLEKIDWRKAPFYAYYKDFDIEGCPAPG-PASC-ASNPSNWWEGSS  251

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L P+    Y WV    + YDYCTD  R+  + P EC
Sbjct  252  YQQLDPVAARRYRWVRMNHMVYDYCTDKSRYPVTPP-EC  289



>gb|AEK32594.1| xyloglucan endotransglucosylase/hydrolase [Tagetes patula]
Length=293

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 147/219 (67%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KL+PG SAGTVTAFY+ SD    RDE+DFEFLGN +G  Y++QTNV+ +G
Sbjct  74   YLFGRVSMKIKLIPGDSAGTVTAFYMNSDTDQVRDELDFEFLGNRSGQPYSVQTNVYAHG  133

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP  D+H Y+ILWN +H+VF VD VPIR Y+N+  KGV +P  QP   
Sbjct  134  KGDREQRVNLWFDPAADYHTYSILWNHHHVVFSVDDVPIRVYKNNEAKGVPFPKFQPMGV  193

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDW KAPF A +KD+ I+ C   G P+ C A  PSNWW   +
Sbjct  194  YSTLWEADDWATRGGLEKIDWRKAPFYAYYKDFDIEGCPAPG-PASC-ASNPSNWWEGSS  251

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L P+    Y WV    + YDYCTD  R+  + P EC
Sbjct  252  YQQLDPVAARRYRWVRMNHMVYDYCTDKSRYPVTPP-EC  289



>ref|XP_009409758.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Musa acuminata subsp. malaccensis]
Length=280

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 130/277 (47%), Positives = 173/277 (62%), Gaps = 10/277 (4%)
 Frame = -3

Query  1098  VSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFV  919
              SLA++ + G+F +DF + +   G      +G             S   ++++YLFG+  
Sbjct  10    CSLAAIATAGNFYRDFDITWG-DGRAKI-LEGGQLLTLTLDKTTGSGFQSRNEYLFGKID  67

Query  918   MKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQK  739
             M++KLVPG SAGTVTA+YL S    + DE+DFEFLGN++GD YTL TNVFT G G RE +
Sbjct  68    MQIKLVPGNSAGTVTAYYL-SSQGPTHDEIDFEFLGNLSGDPYTLHTNVFTQGKGNREMQ  126

Query  738   IKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDG  559
              KLWFDPT+DFH Y+ILWN  H++FMVD  PIR ++N   +G+A+P  QP     SLW+ 
Sbjct  127   FKLWFDPTKDFHTYSILWNPRHVIFMVDGTPIRDFKNLESRGIAFPKNQPMRIYSSLWNA  186

Query  558   SSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSEC---RADGPSNWWNQDNYSTL  388
               WAT GG VK DWSKA F AS++D+  DACV     S C    A G S WWNQ+    L
Sbjct  187   DDWATRGGLVKTDWSKAAFTASYRDFRADACVPSSAASRCASNAAPGNSGWWNQE--LDL  244

Query  387   TPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
             T  QR   +WV +  + Y+YC+D +RF   +P ECS+
Sbjct  245   TGQQR--MKWVQRNYMVYNYCSDLKRFPQGLPPECSI  279



>ref|XP_004139618.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 7-like [Cucumis sativus]
Length=423

 Score =   246 bits (629),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 129/276 (47%), Positives = 176/276 (64%), Gaps = 7/276 (3%)
 Frame = -3

Query  1098  VSLASVVS--TGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQ  925
             V+L+ VVS     F +DF V +A   H+    DG      +   ++    +++ +YLFG+
Sbjct  150   VALSIVVSGRPATFLEDFRVTWAD-NHVR-QLDGGRGIQLVLDQSSGCGFASRRQYLFGK  207

Query  924   FVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGERE  745
               MK+KLVPG SAGTVTAFY+ SD    RDE+DFEFLGN +G  YT+QTN++ +G G+RE
Sbjct  208   VSMKIKLVPGDSAGTVTAFYMNSDTDTIRDELDFEFLGNRSGQPYTVQTNIYAHGKGDRE  267

Query  744   QKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLW  565
             Q++ LWFDP  DFH Y+I+W  + I+F VD +PIR Y+NH +KG+ YP  QP     +LW
Sbjct  268   QRVNLWFDPAADFHTYSIMWTRWLIIFGVDDIPIRVYKNHEEKGIPYPKLQPMGVYSTLW  327

Query  564   DGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLT  385
             +   WAT GG  KIDW KAPF A +KD+ I+ C   G P+ C ++ P+NWW    Y TL+
Sbjct  328   EADDWATRGGLEKIDWKKAPFYAYYKDFDIEGCPVPG-PANCPSN-PNNWWEGTAYRTLS  385

Query  384   PIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
             P Q   Y+WV    + YDYCTD  R+  + P EC+L
Sbjct  386   PAQAKNYQWVKANHMIYDYCTDKSRYPQTPP-ECAL  420



>gb|AAT94297.1| endotransglucosylase/hydrolase XTH5 [Triticum aestivum]
Length=287

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/229 (50%), Positives = 147/229 (64%), Gaps = 13/229 (6%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  M++KLVPG SAGTVT FYL S   A  DE+DFEFLGNV G+ YTL TNVF  G
Sbjct  63   YLFGKIDMQIKLVPGNSAGTVTTFYLSSQGTA-HDEIDFEFLGNVTGEPYTLHTNVFAKG  121

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ+ +LWFDPT+ FH Y+I+WN  H++F VD   IR ++NH  +GV++P  QP   
Sbjct  122  QGQREQQFRLWFDPTKAFHTYSIIWNPQHVIFAVDGTAIRDFKNHEARGVSFPKSQPMRL  181

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSEC--------RADGP  424
              SLW+   WAT GGRVK DWSKAPF+ASF+++  DACV  G    C         A G 
Sbjct  182  YASLWNADDWATQGGRVKTDWSKAPFVASFRNFNADACVMSGGAQRCPAGTMEASAAGGS  241

Query  423  SNWWNQDNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
             +WWNQ+    L+ +      WV +  + Y+YCTD +R    +P EC L
Sbjct  242  GSWWNQE----LSGMGYRRMRWVQRKFMIYNYCTDPKRVAQGVPAECKL  286



>gb|EMT27816.1| Putative xyloglucan endotransglucosylase/hydrolase protein 23 
[Aegilops tauschii]
Length=287

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/229 (50%), Positives = 147/229 (64%), Gaps = 13/229 (6%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  M++KLVPG SAGTVT FYL S   A  DE+DFEFLGNV G+ YTL TNVF  G
Sbjct  63   YLFGKIDMQIKLVPGNSAGTVTTFYLSSQGTA-HDEIDFEFLGNVTGEPYTLHTNVFAKG  121

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ+ +LWFDPT+ FH Y+I+WN  H++F VD   IR ++NH  +GV++P  QP   
Sbjct  122  QGQREQQFRLWFDPTKAFHTYSIIWNPQHVIFAVDGTAIRDFKNHEARGVSFPKSQPMRL  181

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSEC--------RADGP  424
              SLW+   WAT GGRVK DWSKAPF+ASF+++  DACV  G    C         A G 
Sbjct  182  YASLWNADDWATQGGRVKTDWSKAPFVASFRNFNADACVMSGGAQRCPAGRMEASAAGGS  241

Query  423  SNWWNQDNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
             +WWNQ+    L+ +      WV +  + Y+YCTD +R    +P EC L
Sbjct  242  GSWWNQE----LSGMGYRRMRWVQRKFMIYNYCTDPKRVAQGVPAECKL  286



>ref|XP_008799438.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Phoenix dactylifera]
Length=280

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 126/273 (46%), Positives = 168/273 (62%), Gaps = 11/273 (4%)
 Frame = -3

Query  1092  LASVVSTGDFNQDFFVIYA-APGHINTSADGRstsltldtaaasssmstkdKYLFGQFVM  916
             L ++ S G+F Q+F + +    G I    D           A+ S   +K++YLFG+  M
Sbjct  13    LMAIASAGNFYQEFDITWGDGRGKI---LDNGQLLTLSLNKASGSGFESKNEYLFGEIDM  69

Query  915   KMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKI  736
             ++KLVPG SAGTVTA+YL S    S DE++FEFLGN++GD YTL TNVFT G G RE + 
Sbjct  70    QLKLVPGNSAGTVTAYYL-SSQGPSHDEINFEFLGNLSGDPYTLHTNVFTQGKGNREMQF  128

Query  735   KLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGS  556
              LWFDPT DFH Y+ILWN  H++FMVD +PIR ++N   +G+A+P  QP     SLW+  
Sbjct  129   HLWFDPTRDFHTYSILWNPRHVIFMVDGIPIRDFKNLESRGIAFPKSQPMGIYSSLWNAD  188

Query  555   SWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSN--WWNQDNYSTLTP  382
              WAT GGRVK DW+KAPF AS++++  DAC+W    S C +    N  WWNQ+  ST   
Sbjct  189   DWATQGGRVKTDWTKAPFTASYRNFNADACIWSSGTSNCPSQKSDNAGWWNQELDSTSQE  248

Query  381   IQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
               R    W  +  + Y+YC D +RF   +P EC
Sbjct  249   RMR----WAQQNYMIYNYCNDLKRFPQGLPPEC  277



>gb|ADO24300.1| xyloglucan endotransglucosylase/hydrolase [Gossypium hirsutum]
Length=290

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 145/219 (66%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KL+PG SAGTVTAFY+ SD    RDE+DFEFLGN  G  YT+QTN++ +G
Sbjct  71   YLFGRVSMKIKLIPGDSAGTVTAFYMNSDTDTVRDELDFEFLGNRTGQPYTVQTNIYAHG  130

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP  DFH YTI+WN +HIVF VD VPIR Y+N+  K + YP  QP   
Sbjct  131  KGDREQRVNLWFDPAADFHTYTIMWNHHHIVFYVDEVPIRVYKNNEAKNIPYPKFQPMGV  190

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDWSKAPF+A +KD+ I+ C   G P+ C A  P NWW    
Sbjct  191  YSTLWEADDWATRGGLEKIDWSKAPFLAYYKDFDIEGCPVPG-PANC-ASNPRNWWEGTA  248

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L  ++   Y WV    + YDYCTD  R+  + P EC
Sbjct  249  YQALNAMEARRYRWVRMNHMIYDYCTDKSRYPVT-PPEC  286



>emb|CAA63663.1| xyloglucan endotransglycosylase (XET) [Hordeum vulgare subsp. 
vulgare]
 dbj|BAJ98866.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=286

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/228 (50%), Positives = 147/228 (64%), Gaps = 12/228 (5%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  M++KLVPG SAGTVT FYL S   A  DE+DFEFLGNV G+ YTL TNVF  G
Sbjct  63   YLFGKIDMQIKLVPGNSAGTVTTFYLSSQGTA-HDEIDFEFLGNVTGEPYTLHTNVFAQG  121

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ+ +LWFDPT+ FH Y+I+WN  H++F VD   IR ++NH  +GV++P  QP   
Sbjct  122  QGQREQQFRLWFDPTKAFHTYSIIWNPQHVIFAVDGTAIRDFKNHEARGVSFPKSQPMRL  181

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSEC-------RADGPS  421
              SLW+   WAT GGRVK DWSKAPF+ASF+++  DACV  G    C        A G  
Sbjct  182  YASLWNADDWATQGGRVKTDWSKAPFVASFRNFNADACVMSGGAQRCPAGTMEASAAGGG  241

Query  420  NWWNQDNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
            +WWNQ+    L+ +      WV +  + Y+YCTD +R    +P EC L
Sbjct  242  SWWNQE----LSGMGYRRMRWVQRKFMIYNYCTDPKRVAQGVPAECKL  285



>ref|XP_004966141.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Setaria italica]
Length=292

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/232 (50%), Positives = 148/232 (64%), Gaps = 16/232 (7%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  M++KLVPG SAGTVT FYL S   ++ DE+DFEFLGN  G+ YTL TNVFT G
Sbjct  65   YLFGKIDMQIKLVPGNSAGTVTTFYL-SSQGSTHDEIDFEFLGNETGEPYTLHTNVFTQG  123

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ+ +LWFDPT  FH Y+I+WN  H++F VD  PIR ++NH  +GVA+P  QP   
Sbjct  124  QGQREQQFRLWFDPTTSFHTYSIVWNPQHVIFAVDGTPIRDFKNHEARGVAFPKSQPMRL  183

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRAD----------  430
              SLW+   WAT GGRVK DWS APF+ASF+ ++ DACVW     +C             
Sbjct  184  YASLWNADDWATQGGRVKADWSHAPFVASFRGFSADACVWANGRQQCPVGTMETAAVAGR  243

Query  429  -GPSNWWNQDNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
             G  +WWNQ     L+ +      WV +  + Y+YCTD++RF   +P EC L
Sbjct  244  RGGRSWWNQQ----LSDMSYRRMRWVQRKFMIYNYCTDAKRFPQGVPAECHL  291



>gb|KHG03304.1| putative xyloglucan endotransglucosylase/hydrolase 6 -like protein 
[Gossypium arboreum]
Length=290

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 145/219 (66%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KL+PG SAGTVTAFY+ SD    RDE+DFEFLGN  G  YT+QTN++ +G
Sbjct  71   YLFGRVSMKIKLIPGDSAGTVTAFYMNSDTDTVRDELDFEFLGNRTGKPYTVQTNIYAHG  130

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP  DFH YTI+WN +HIVF VD VPIR Y+N+  K + YP  QP   
Sbjct  131  KGDREQRVNLWFDPAADFHTYTIMWNHHHIVFYVDEVPIRVYKNNEAKNIPYPKFQPMGV  190

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDWSKAPF+A +KD+ I+ C   G P+ C A  P NWW    
Sbjct  191  YSTLWEADDWATRGGLEKIDWSKAPFLAYYKDFDIEGCPVPG-PANC-ASNPRNWWEGTA  248

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L  ++   Y WV    + YDYCTD  R+  + P EC
Sbjct  249  YQALNAMEARRYRWVRMNHMIYDYCTDKSRYPVT-PPEC  286



>ref|XP_007160314.1| hypothetical protein PHAVU_002G311200g [Phaseolus vulgaris]
 gb|ESW32308.1| hypothetical protein PHAVU_002G311200g [Phaseolus vulgaris]
Length=289

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/226 (50%), Positives = 143/226 (63%), Gaps = 3/226 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            +LFG   M++KLV G SAGTVTA+YL S   +  DE+DFEFLGN  G  YT+ TN++T G
Sbjct  65   FLFGSIEMQIKLVHGNSAGTVTAYYL-SSAGSEHDEIDFEFLGNSTGQPYTVHTNLYTQG  123

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G REQ+  LWFDPT DFHNYTI WN   IV+ VD VPIR +RNH  +G+ YP  Q    
Sbjct  124  KGSREQQFYLWFDPTADFHNYTIHWNPTEIVWYVDDVPIRVFRNHEKEGITYPNKQGMRV  183

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPS--ECRADGPSNWWNQ  406
              SLW+  +WAT GG VK DW+ APF   F  +   AC W G  S  +C ++ P+NWW  
Sbjct  184  YTSLWNADNWATRGGLVKTDWNHAPFTVRFHHFRARACKWAGAKSIYQCASNAPANWWTS  243

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              Y  LT  Q G   W+    + YDYCTD++RFNG +P EC  P++
Sbjct  244  ARYKKLTQTQLGQLNWIRNNYMIYDYCTDTKRFNGQMPPECFKPQF  289



>ref|XP_008783308.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 26 [Phoenix dactylifera]
Length=240

 Score =   240 bits (612),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 116/226 (51%), Positives = 146/226 (65%), Gaps = 3/226 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            +LFG   M++KLVPG SAGTVTA+Y MS   +  DE+DFEFLGN++G  Y + TNVFT G
Sbjct  16   FLFGSIEMQIKLVPGNSAGTVTAYY-MSSTGSKHDEIDFEFLGNLSGQPYIIHTNVFTQG  74

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G REQ+   WFDPT DFHNYTI WN   IV+ VD +PIR YRN+   G+ +P  Q   A
Sbjct  75   VGNREQQFYPWFDPTSDFHNYTIHWNPSQIVWFVDGLPIRVYRNYERYGIPFPNKQAMRA  134

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKG--DPSECRADGPSNWWNQ  406
              SLW+   WAT GG +KIDWS APFIA ++   + AC W G    S+C    P+NWW  
Sbjct  135  YSSLWNADDWATRGGLIKIDWSNAPFIARYRQLRLRACAWTGPNSISQCAQTTPANWWTS  194

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              YS L  +Q+G   WV +  + YDYC D++RFNG    ECSL ++
Sbjct  195  PVYSELNDMQKGQLNWVRQNFMIYDYCKDTKRFNGQFHPECSLLQF  240



>ref|XP_004308638.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 26-like [Fragaria vesca subsp. vesca]
Length=289

 Score =   241 bits (616),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 113/226 (50%), Positives = 150/226 (66%), Gaps = 3/226 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            +LFG   M +KLVP  SAGTVTAFYL S   +  DE+DFEFLGNV+G  Y + TN++T G
Sbjct  65   FLFGSIEMLIKLVPNNSAGTVTAFYL-SSTGSKHDEIDFEFLGNVSGQPYIIHTNIYTQG  123

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G REQ+  LWFDPT DFHNYTI WN   +V+ +D +PIR +RN+ ++G+AYP  Q    
Sbjct  124  NGSREQQFYLWFDPTADFHNYTIHWNPTTVVWYIDGLPIRVFRNYENEGIAYPSKQGMRV  183

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPS--ECRADGPSNWWNQ  406
              SLW+  +WAT GG VKIDW+ APFIA  +++   AC W G  S  +C A  P+NWW  
Sbjct  184  YSSLWNADNWATRGGLVKIDWTSAPFIARLRNFRARACKWDGPSSITQCAAATPANWWTS  243

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              Y  L+  + G  +WV    + YDYC D++RFNG++P+ECS  ++
Sbjct  244  PIYKQLSNAKLGQLKWVRDNHMIYDYCKDTKRFNGNMPVECSKQQF  289



>ref|XP_010929301.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Elaeis guineensis]
Length=281

 Score =   241 bits (615),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 125/277 (45%), Positives = 167/277 (60%), Gaps = 10/277 (4%)
 Frame = -3

Query  1098  VSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFV  919
              SL ++   G+F QDF + +   G      D           ++ S   +K++YLFG+  
Sbjct  11    CSLMTIAWAGNFYQDFDITWGE-GRAKI-LDNAQLLTLSLDKSSGSGFQSKNEYLFGKID  68

Query  918   MKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQK  739
             M++KLVPG SAGTVTA+YL S    S DE+DFEFLGN+ GD YTL TNVFT G G RE +
Sbjct  69    MQLKLVPGNSAGTVTAYYL-SSQGPSHDEIDFEFLGNLGGDPYTLHTNVFTQGKGNREMQ  127

Query  738   IKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDG  559
               LWFDPT+DFH Y+ILWN  H++FMVD +PIR ++N   +GVA+P  QP     SLW+ 
Sbjct  128   FHLWFDPTKDFHTYSILWNPRHVIFMVDGIPIRDFKNLESRGVAFPKSQPMRIYSSLWNA  187

Query  558   SSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSN---WWNQDNYSTL  388
               WAT GGR+K DW+ APF AS++++  DAC+W    S C     S+   WWNQ+    L
Sbjct  188   DDWATQGGRIKTDWTNAPFTASYRNFNADACIWSSGTSNCPNSQKSDNAGWWNQE----L  243

Query  387   TPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
                 +    W  +  + Y+YCTD  RF   +P ECS+
Sbjct  244   DSASQQRMRWAQQNYMIYNYCTDLNRFPQGLPPECSI  280



>gb|AFN71023.1| xyloglucan endotransglucosylase/hydrolase [Dahlia pinnata]
Length=292

 Score =   241 bits (616),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 146/219 (67%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KL+PG SAGTVTAFY+ SD    RDE+DFEFLGN +G  Y++QTNV+ +G
Sbjct  73   YLFGRVSMKIKLIPGDSAGTVTAFYMNSDTDQVRDELDFEFLGNRSGQPYSVQTNVYAHG  132

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP  D+H Y+ILWN  H+VF VD VPIR Y+N+  KGV +P  QP   
Sbjct  133  KGDREQRVNLWFDPAADYHTYSILWNHQHVVFYVDEVPIRVYKNNEAKGVPFPKFQPMGV  192

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDW KAPF A +KD+ I+ C   G P+ C A  PSNWW   +
Sbjct  193  YSTLWEADDWATRGGLEKIDWRKAPFYAYYKDFDIEGCPAPG-PASC-ASNPSNWWEGSS  250

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L P+    Y WV    + YDYCTD  R+  + P EC
Sbjct  251  YQQLDPVAARRYRWVRMNHMVYDYCTDKSRYPVTPP-EC  288



>gb|KHN36328.1| Putative xyloglucan endotransglucosylase/hydrolase protein 6 
[Glycine soja]
Length=296

 Score =   242 bits (617),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 118/219 (54%), Positives = 145/219 (66%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            Y+FG+  MK+KL+PG SAGTVTAFY+ SD    RDE+DFEFLGN +G  YT+QTN++ +G
Sbjct  77   YMFGRVSMKIKLIPGDSAGTVTAFYMNSDTDTVRDELDFEFLGNRSGQPYTVQTNIYAHG  136

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP+ DFH YTI+WN +HIVF VD  PIR Y+N   KG+ YP  QP   
Sbjct  137  KGDREQRVNLWFDPSADFHTYTIMWNHHHIVFYVDDFPIRVYKNSEGKGIPYPTMQPMGV  196

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+  +WAT GG  KIDWSKAPF A +KD+ I+ C   G P+ C A   SNWW    
Sbjct  197  YSTLWEADNWATRGGLEKIDWSKAPFYAYYKDFDIEGCPVPG-PANC-ASNQSNWWEGAA  254

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L  I+   Y WV    I YDYC D  RF   IP EC
Sbjct  255  YQALNAIEARRYRWVRLNHIIYDYCQDKSRF-PVIPPEC  292



>gb|KDP32131.1| hypothetical protein JCGZ_12592 [Jatropha curcas]
Length=292

 Score =   241 bits (616),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 117/220 (53%), Positives = 150/220 (68%), Gaps = 3/220 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  M++KLVPG SAGTVTAFY+ SD  + RDE+DFEFLGN  G  YT+QTN++ +G
Sbjct  73   YLFGRVSMRIKLVPGDSAGTVTAFYMNSDTDSVRDELDFEFLGNRTGQPYTVQTNIYAHG  132

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ+I LWFDP+ DFH YTILWN +HIVF VD VPIR ++N+  +G+ YP  Q    
Sbjct  133  KGDREQRINLWFDPSSDFHLYTILWNHHHIVFYVDDVPIRVFKNNEARGIPYPKFQAMGV  192

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDWSKAPF A +KD+ I+ C   G P+ C ++ P NWW   N
Sbjct  193  YSTLWEADDWATRGGLEKIDWSKAPFYAYYKDFDIEGCPVPG-PANCVSN-PRNWWEGAN  250

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECS  280
            Y  L+ ++   Y WV    + YDYCTD  R+  + P ECS
Sbjct  251  YQALSAMEARRYRWVRMNHMIYDYCTDKSRYPVA-PPECS  289



>ref|XP_003517365.2| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6-like [Glycine max]
Length=296

 Score =   241 bits (616),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 118/219 (54%), Positives = 145/219 (66%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            Y+FG+  MK+KL+PG SAGTVTAFY+ SD    RDE+DFEFLGN +G  YT+QTN++ +G
Sbjct  77   YMFGRVSMKIKLIPGDSAGTVTAFYMNSDTDTVRDELDFEFLGNRSGQPYTVQTNIYAHG  136

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP+ DFH YTI+WN +HIVF VD  PIR Y+N   KG+ YP  QP   
Sbjct  137  KGDREQRVNLWFDPSADFHTYTIMWNHHHIVFYVDDFPIRVYKNSEGKGIPYPTMQPMGV  196

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+  +WAT GG  KIDWSKAPF A +KD+ I+ C   G P+ C A   SNWW    
Sbjct  197  YSTLWEADNWATRGGLEKIDWSKAPFYAYYKDFDIEGCPVPG-PANC-ASNQSNWWEGAA  254

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L  I+   Y WV    I YDYC D  RF   IP EC
Sbjct  255  YQALNAIEARRYRWVRLNHIIYDYCQDKSRF-PVIPPEC  292



>gb|ADJ00314.1| xyloglucan endotransglycosylase/hydrolase [Corchorus olitorius]
Length=290

 Score =   241 bits (616),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 118/220 (54%), Positives = 146/220 (66%), Gaps = 3/220 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KLVPG SAGTVTAFYL SD    RDE+DFEFLGN +G  YT+QTNVF +G
Sbjct  71   YLFGRVSMKIKLVPGDSAGTVTAFYLNSDTDTVRDELDFEFLGNRSGQPYTVQTNVFAHG  130

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP++DFH+Y I WN   IVF+VD  PIR Y+N+  K V YP  QP   
Sbjct  131  KGDREQRVNLWFDPSQDFHDYQIRWNHKEIVFLVDDTPIRVYKNNEAKNVPYPKSQPMGV  190

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDWSKAPF+A +KD+ I+ C   G P++C A  P NWW    
Sbjct  191  YSTLWEADDWATRGGLEKIDWSKAPFLAYYKDFDIEGCAVPG-PADC-ASNPRNWWEGTA  248

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECS  280
            Y  L  ++   Y WV    + YDYCTD  R+    P EC+
Sbjct  249  YQGLNALEARRYRWVRMNHMIYDYCTDKSRYP-VPPPECT  287



>ref|NP_001151103.1| xyloglucan endotransglucosylase/hydrolase protein 23 precursor 
[Zea mays]
 gb|ACG41635.1| xyloglucan endotransglucosylase/hydrolase protein 23 precursor 
[Zea mays]
Length=294

 Score =   241 bits (616),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 118/232 (51%), Positives = 148/232 (64%), Gaps = 16/232 (7%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  M++KLVPG SAGTVT FYL S   A  DE+DFEFLGNV+G+ YTL TNVFT G
Sbjct  67   YLFGKIDMQIKLVPGNSAGTVTTFYLSSQGDA-HDEIDFEFLGNVSGEPYTLHTNVFTRG  125

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ+ +LWFDPT  FH Y+ILWN  H++F VD  P+R ++NH  +GVA+P  QP   
Sbjct  126  QGQREQQFRLWFDPTTAFHTYSILWNPQHVIFAVDGTPVRDFKNHEARGVAFPRMQPMRL  185

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSEC-----------RA  433
              SLW+   WAT GGRVK DWSKAPF+ASF+ ++ DACVW G    C            A
Sbjct  186  YASLWNADDWATQGGRVKADWSKAPFVASFRGFSADACVWDGGRQRCPEGTMEAAAVAGA  245

Query  432  DGPSNWWNQDNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
                 WWNQ     L+ +      WV +  + Y+YC D++RF   +P EC L
Sbjct  246  GSGRGWWNQQ----LSDMSYRRMRWVQRKFMIYNYCADAKRFPQGVPAECKL  293



>emb|CAA16685.1| endoxyloglucan tranferase-like protein [Arabidopsis thaliana]
 dbj|BAB10680.1| xyloglucan endo-transglycosylase-like protein [Arabidopsis thaliana]
 gb|AAK73270.1| xyloglucan endo-transglycosylase-like protein [Arabidopsis thaliana]
Length=269

 Score =   241 bits (614),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 148/219 (68%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KL+PG SAGTVTAFY+ SD A  RDE+DFEFLGN +G  Y++QTN+F +G
Sbjct  52   YLFGRVSMKIKLIPGDSAGTVTAFYMNSDTATVRDELDFEFLGNRSGQPYSVQTNIFAHG  111

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP+ D+H YTILW+  HIVF VD VPIR Y+N+  K +AYP  QP   
Sbjct  112  KGDREQRVNLWFDPSMDYHTYTILWSHKHIVFYVDDVPIREYKNNEAKNIAYPTSQPMGV  171

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDWSKAPF A +KD+ I+ C   G P+ C ++ P NWW    
Sbjct  172  YSTLWEADDWATRGGLEKIDWSKAPFYAYYKDFDIEGCPVPG-PTFCPSN-PHNWWEGYA  229

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y +L  ++   Y WV    + YDYCTD  RF    P EC
Sbjct  230  YQSLNAVEARRYRWVRVNHMVYDYCTDRSRFPVP-PPEC  267



>ref|XP_010936207.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6 [Elaeis guineensis]
Length=366

 Score =   244 bits (622),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 117/220 (53%), Positives = 146/220 (66%), Gaps = 3/220 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KL+PG SAGTVTAFYL S+    RDE+DFEFLGN  G  YT+QTNV+T G
Sbjct  147  YLFGRVSMKIKLIPGDSAGTVTAFYLNSNTDRIRDELDFEFLGNRTGHPYTVQTNVYTRG  206

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP  DFH Y+ILWN YH VF VD VPIR ++N+  +G+ +P  QP   
Sbjct  207  KGDREQRVNLWFDPAADFHTYSILWNHYHAVFFVDEVPIRVFKNNEARGIPFPKSQPMGV  266

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDWSKAPF A ++D+ I+ C   G P  C A  P+NWW    
Sbjct  267  YSTLWEADDWATRGGLEKIDWSKAPFYAYYEDFDIEGCAKPG-PESC-ASNPNNWWEAPA  324

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECS  280
            Y  L+ IQ   Y WV    + YDYCTD  R+  + P EC+
Sbjct  325  YRQLSAIQARKYRWVRVNHMIYDYCTDKSRYPVTPP-ECT  363



>ref|XP_009336854.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 26 [Pyrus x bretschneideri]
Length=287

 Score =   241 bits (615),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 116/226 (51%), Positives = 149/226 (66%), Gaps = 3/226 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            +LFG   M +KLVPG SAGTVTA+YL S      DE+DFEFLGNV+G  Y + TN++T G
Sbjct  63   FLFGSIEMLIKLVPGNSAGTVTAYYL-SSTGTKHDEIDFEFLGNVSGQPYIVHTNIYTQG  121

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G +EQ+  LWFDPT DFHNYTI WN   +V+ VDS+PIR +RN+ ++G+AYP  Q    
Sbjct  122  NGSKEQQFYLWFDPTADFHNYTIHWNPTEVVWYVDSLPIRVFRNYENQGIAYPNKQGMRV  181

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDP--SECRADGPSNWWNQ  406
              SLW+  +WAT GG VKI+W+ APF A FK +   AC W G    S C A   +NWW  
Sbjct  182  YSSLWNADNWATRGGLVKINWTGAPFTAGFKHFRARACKWTGAASISVCAATSQANWWTS  241

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              YS L+  + G  +WV    +TYDYC D+QRFNG++P ECS  ++
Sbjct  242  PVYSQLSNSKLGQLQWVRNNYMTYDYCKDTQRFNGNMPPECSKQQF  287



>ref|XP_009390494.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Musa acuminata subsp. malaccensis]
Length=276

 Score =   241 bits (614),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 129/274 (47%), Positives = 170/274 (62%), Gaps = 8/274 (3%)
 Frame = -3

Query  1098  VSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFV  919
              SL +V S G+F QDF + +   G      +G   +L+LD A+ S   S  + YLFG+  
Sbjct  10    CSLVAVASAGNFYQDFDITWG-DGRAKILNNGHLLTLSLDKASGSGFQSKNE-YLFGKID  67

Query  918   MKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQK  739
             M++KLVPG SAGTVTA+YL S    + DE+DFEFLGN++GD YTL TNVFT G G RE +
Sbjct  68    MQIKLVPGNSAGTVTAYYL-SSQGPTHDEIDFEFLGNLSGDPYTLHTNVFTQGKGNREMQ  126

Query  738   IKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDG  559
              KLWFDPT+DFH Y+ILWN  HI+FMVD  PIR ++N   +G+A+P  QP     SLW+ 
Sbjct  127   FKLWFDPTKDFHTYSILWNPRHIIFMVDGTPIRDFKNLESRGIAFPKNQPMRIYSSLWNA  186

Query  558   SSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPI  379
               WAT GG +K DW+KAPF+AS++++  +AC+     S C     S WWNQ+    L   
Sbjct  187   EDWATRGGLIKTDWTKAPFVASYRNFNANACIKASGRSSC-TPAKSGWWNQE----LDSA  241

Query  378   QRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
                   W  K  + Y+YC D  RF   +P ECS+
Sbjct  242   SHARMRWAQKNYMIYNYCNDVNRFPQGLPPECSI  275



>ref|XP_006363788.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 7-like [Solanum tuberosum]
Length=295

 Score =   241 bits (615),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 145/219 (66%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KLVPG SAGTVTAFY+ SD    RDE+DFEFLGN  G  YT+QTNV+ +G
Sbjct  76   YLFGRVSMKIKLVPGDSAGTVTAFYMNSDTDTVRDELDFEFLGNRTGQPYTVQTNVYVHG  135

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G++EQ++ LWFDP+ DFH YTI WN +  VF VD +PIR Y+N+  KG+ +P  QP   
Sbjct  136  KGDKEQRVNLWFDPSADFHTYTIFWNHHQAVFSVDGIPIRVYKNNEAKGIPFPKFQPMGV  195

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KI+WSK+PF A +KD+ I+ C   G P+ C A  PSNWW    
Sbjct  196  YSTLWEADDWATRGGLEKINWSKSPFYAYYKDFDIEGCAMPG-PANC-ASNPSNWWEGPA  253

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L+P+Q   Y WV    + YDYCTD  R N   P EC
Sbjct  254  YQQLSPVQARQYRWVRMNHMIYDYCTDKSR-NPVPPPEC  291



>gb|ADK92389.1| xyloglucan endotransglycosylase [Chrysanthemum x morifolium]
Length=293

 Score =   241 bits (614),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 146/219 (67%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KL+PG SAGTVTAFY+ SD    RDE+DFEFLGN +G  Y++QTNV+ +G
Sbjct  74   YLFGRVSMKIKLIPGDSAGTVTAFYMNSDTDQVRDELDFEFLGNRSGQPYSVQTNVYAHG  133

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP  D H Y+ILWN +H+VF VD VPIR Y+N+  KGV +P  QP   
Sbjct  134  KGDREQRVNLWFDPAADCHTYSILWNHHHVVFSVDDVPIRVYKNNEAKGVPFPKFQPMGV  193

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDW KAPF A +KD+ I+ C   G P+ C A  PSNWW   +
Sbjct  194  YSTLWEADDWATRGGLEKIDWRKAPFYAYYKDFDIEGCPAPG-PASC-ASNPSNWWEGSS  251

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L P+    Y WV    + YDYCTD  R+  + P EC
Sbjct  252  YQQLDPVAARRYRWVRMNHMVYDYCTDKSRYPVTPP-EC  289



>ref|XP_003524704.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6-like [Glycine max]
 gb|KHN47560.1| Putative xyloglucan endotransglucosylase/hydrolase protein 6 
[Glycine soja]
Length=291

 Score =   241 bits (614),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 144/219 (66%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            Y+FG+  MK+KLVPG SAGTVTAFYL SD    RDE+DFEFLGN  G  YT+QTN++ +G
Sbjct  72   YMFGRVSMKIKLVPGDSAGTVTAFYLNSDTNYVRDELDFEFLGNRTGQPYTVQTNIYAHG  131

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP  DFH Y+ILWN +HIVF VD  PIR Y+N+  +G+ YP  Q    
Sbjct  132  KGDREQRVNLWFDPAADFHTYSILWNHHHIVFYVDDFPIRVYKNNEARGIPYPKMQAMGV  191

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+  +WAT GG  KIDWSKAPF A +KD+ I+ C   G P+ C A  PSNWW    
Sbjct  192  YSTLWEADNWATRGGLEKIDWSKAPFYAYYKDFNIEGCAVPG-PANC-ASNPSNWWEGAA  249

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L  I+   Y WV    + YDYC D  RF  + P EC
Sbjct  250  YQALNSIEARRYRWVRLNHVIYDYCKDKSRFPVTPP-EC  287



>gb|ADP94235.2| xyloglucan endotransglucosylase [Cenchrus americanus]
Length=291

 Score =   241 bits (614),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 117/232 (50%), Positives = 148/232 (64%), Gaps = 19/232 (8%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  M++KLVPG SAGTVT FYL S      DE+DFEFLGNV+G+ YTL TNVFT G
Sbjct  67   YLFGKIDMQIKLVPGNSAGTVTTFYLSSHD----DEIDFEFLGNVSGEPYTLHTNVFTRG  122

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ+ +LWFDPT  FH Y+ILWN  H++F VD  P+R ++NH  +GVA+P  QP   
Sbjct  123  QGQREQQFRLWFDPTTAFHTYSILWNPQHVIFAVDGTPVRDFKNHEARGVAFPRTQPMRL  182

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSEC-----------RA  433
              SLW+   WAT+GGRVK DWSKAPF+ASF+ ++ DACVW G    C            A
Sbjct  183  YASLWNADDWATEGGRVKADWSKAPFVASFRGFSADACVWDGGRQRCPEGTMEAAAVAGA  242

Query  432  DGPSNWWNQDNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
                 WWNQ     L+ +      WV +  + Y+YC D++RF   +P EC L
Sbjct  243  GSGRGWWNQQ----LSDMSYRRMRWVQRKFMIYNYCADAKRFPQGVPAECKL  290



>ref|NP_001234475.1| xyloglucan endotransglucosylase-hydrolase XTH7 [Solanum lycopersicum]
 gb|AAS46243.1| xyloglucan endotransglucosylase-hydrolase XTH7 [Solanum lycopersicum]
Length=295

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 145/219 (66%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KLVPG SAGTVTAFY+ SD    RDE+DFEFLGN  G  YT+QTNV+ +G
Sbjct  76   YLFGRVSMKIKLVPGDSAGTVTAFYMNSDTDNVRDELDFEFLGNRTGQPYTVQTNVYVHG  135

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G++EQ++ LWFDP+ DFH YTI WN +  VF VD +PIR Y+N+  KG+ +P  QP   
Sbjct  136  KGDKEQRVNLWFDPSADFHTYTIFWNHHQAVFSVDGIPIRVYKNNEAKGIPFPKFQPMGV  195

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KI+WSK+PF A +KD+ I+ C   G P+ C A  PSNWW    
Sbjct  196  YSTLWEADDWATRGGLEKINWSKSPFFAYYKDFDIEGCAMPG-PANC-ASNPSNWWEGPA  253

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L+P+Q   Y WV    + YDYCTD  R N   P EC
Sbjct  254  YQQLSPVQARQYRWVRMNHMIYDYCTDKSR-NPVPPPEC  291



>ref|XP_004509043.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6-like [Cicer arietinum]
Length=301

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 130/271 (48%), Positives = 165/271 (61%), Gaps = 5/271 (2%)
 Frame = -3

Query  1095  SLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVM  916
             S+  +     F QDF V ++   HI     GR+  L LD  +     S    Y+FG+  M
Sbjct  32    SMCVLGRPATFQQDFRVTWS-DSHIKQIDQGRTIQLVLDQGSGCGFASKVK-YMFGRVSM  89

Query  915   KMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKI  736
             K+KLVPG SAGTVTAFY+ SD  + RDE+DFEFLGN  G  YT+QTN++ +G G REQ++
Sbjct  90    KIKLVPGDSAGTVTAFYMNSDTDSVRDELDFEFLGNRTGQPYTVQTNIYAHGKGNREQRV  149

Query  735   KLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGS  556
              LWFDP+ DFH Y+ILWN +HIVF VD +PIR Y+N+  KG+ YP  Q      +LW+  
Sbjct  150   NLWFDPSADFHTYSILWNHHHIVFYVDEIPIRVYKNNEAKGIPYPKLQAMGVFSTLWEAD  209

Query  555   SWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQ  376
             +WAT GG  KIDWSKAPF A +KD+ I+ C   G P  C A  P+NWW    Y  L  I+
Sbjct  210   NWATRGGLEKIDWSKAPFYAYYKDFDIEGCAIPG-PVSC-ASNPTNWWEGAAYQALNAIE  267

Query  375   RGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
                Y WV    + YDYC D  RF  + P EC
Sbjct  268   ARRYRWVRINHVIYDYCQDKSRFPVT-PPEC  297



>ref|XP_008790430.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6 [Phoenix dactylifera]
Length=285

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 128/274 (47%), Positives = 172/274 (63%), Gaps = 7/274 (3%)
 Frame = -3

Query  1098  VSLASVVST--GDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQ  925
             ++LA+ VS     F QDF V +A   HI     G +        ++    ++K +YLFG+
Sbjct  13    LTLAAYVSALPATFLQDFRVTWADT-HIK-QLQGGAAIQLTLDQSSGCGFASKRQYLFGR  70

Query  924   FVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGERE  745
               MK+KL+PG SAGTV AFY+ S+ +  RDE+DFEFLGN +G  YT+QTNV+T+G G+RE
Sbjct  71    VSMKIKLIPGDSAGTVAAFYMNSNTSGIRDELDFEFLGNRSGHPYTVQTNVYTHGKGDRE  130

Query  744   QKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLW  565
             Q++ LWFDP  DFH Y+ILWN YH++F VD VPIR ++++  +G+A+P  QP     +LW
Sbjct  131   QRVNLWFDPAADFHTYSILWNHYHVLFFVDEVPIRVFKSNQARGIAFPKSQPMGVYSTLW  190

Query  564   DGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLT  385
             +   WAT GG  KIDW KAPF A +KD+ I+ C   G P+ C A  P+NWW    +  L+
Sbjct  191   EADDWATRGGLEKIDWRKAPFHAFYKDFDIEGCPNPG-PASC-ASNPNNWWEGPAFRQLS  248

Query  384   PIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
              IQ   Y WV    + YDYCTD  R N   P EC
Sbjct  249   AIQARKYRWVRVNYMVYDYCTDKSR-NPVTPPEC  281



>ref|XP_009354593.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6 [Pyrus x bretschneideri]
 ref|XP_009354596.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6 [Pyrus x bretschneideri]
Length=294

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 129/272 (47%), Positives = 169/272 (62%), Gaps = 5/272 (2%)
 Frame = -3

Query  1095  SLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVM  916
             SL++      F QDF V ++   HI    DG      +    +    ++K KYLFG+  M
Sbjct  25    SLSAFGRPATFLQDFQVTWS-DSHIR-QIDGGRAIQLVLDQNSGCGFASKHKYLFGRVSM  82

Query  915   KMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKI  736
             K+KL+PG SAGTVTAFY+ SD    RDE+DFEFLGN  G  YT+QTN++ +G G+REQ++
Sbjct  83    KIKLIPGDSAGTVTAFYMNSDTNTVRDELDFEFLGNRTGQPYTVQTNIYAHGKGDREQRV  142

Query  735   KLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGS  556
              LWFDP  DFH YTILWN +HIVF VD+VPIR Y+N+  KG+ YP  QP     +LW+  
Sbjct  143   NLWFDPAADFHTYTILWNHHHIVFYVDAVPIRVYKNNEAKGIPYPKLQPMGVFSTLWEAD  202

Query  555   SWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQ  376
              WAT GG  KIDWSKAPF + +KD+ I+ C   G P+ C A   +NWW   +Y  L  ++
Sbjct  203   DWATRGGLEKIDWSKAPFYSYYKDFDIEGCPVPG-PASC-ASSTNNWWEGASYQALNALE  260

Query  375   RGLYEWVMKYQITYDYCTDSQRFNGSIPLECS  280
                Y WV    + YDYCTD  R+  + P EC+
Sbjct  261   YRRYRWVRINHMIYDYCTDRSRYPVAPP-ECT  291



>gb|ABV46534.1| xyloglucan endotransglucosylase hydrolase 2 [Bambusa oldhamii]
Length=280

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/230 (49%), Positives = 149/230 (65%), Gaps = 14/230 (6%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  M+++LVPG SAGTVT FYL S   ++ DE+D EFLGNV G+ YTL TNVFT G
Sbjct  55   YLFGKIDMQIRLVPGNSAGTVTTFYL-SSQGSTHDEIDMEFLGNVTGEPYTLHTNVFTQG  113

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ+ +LWFDPT+ FH Y+I+WN  H++F VD  PIR ++N   +GVA+P  QP   
Sbjct  114  QGQREQQFRLWFDPTKAFHTYSIIWNPQHVIFAVDGTPIRDFKNMEARGVAFPKSQPMRL  173

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSEC---------RADG  427
              SLW+   WAT GGRVK DWS+APF+ASF+++  DACVW      C            G
Sbjct  174  YASLWNADDWATQGGRVKADWSQAPFVASFRNFNADACVWSAGAQRCPVGTMEAAAAPGG  233

Query  426  PSNWWNQDNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
             S+WWNQ+     + +      WV +  + Y+YCTD++R+   +P EC L
Sbjct  234  RSSWWNQE----FSDMSYRRMRWVQRKFMIYNYCTDTKRYPQGVPAECKL  279



>ref|NP_569019.1| probable xyloglucan endotransglucosylase/hydrolase protein 6 
[Arabidopsis thaliana]
 sp|Q8LF99.2|XTH6_ARATH RecName: Full=Probable xyloglucan endotransglucosylase/hydrolase 
protein 6; Short=At-XTH6; Short=XTH-6; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL09803.1| AT5g65730/MPA24_8 [Arabidopsis thaliana]
 gb|AAM16244.1| AT5g65730/MPA24_8 [Arabidopsis thaliana]
 dbj|BAE99106.1| xyloglucan endotransglycosylase - like protein [Arabidopsis thaliana]
 gb|AED98096.1| probable xyloglucan endotransglucosylase/hydrolase protein 6 
[Arabidopsis thaliana]
Length=292

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 148/219 (68%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KL+PG SAGTVTAFY+ SD A  RDE+DFEFLGN +G  Y++QTN+F +G
Sbjct  75   YLFGRVSMKIKLIPGDSAGTVTAFYMNSDTATVRDELDFEFLGNRSGQPYSVQTNIFAHG  134

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP+ D+H YTILW+  HIVF VD VPIR Y+N+  K +AYP  QP   
Sbjct  135  KGDREQRVNLWFDPSMDYHTYTILWSHKHIVFYVDDVPIREYKNNEAKNIAYPTSQPMGV  194

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDWSKAPF A +KD+ I+ C   G P+ C ++ P NWW    
Sbjct  195  YSTLWEADDWATRGGLEKIDWSKAPFYAYYKDFDIEGCPVPG-PTFCPSN-PHNWWEGYA  252

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y +L  ++   Y WV    + YDYCTD  RF    P EC
Sbjct  253  YQSLNAVEARRYRWVRVNHMVYDYCTDRSRFPVPPP-EC  290



>gb|ADO24304.1| putative xyloglucan endotransglucosylase/hydrolase [Gossypium 
hirsutum]
Length=290

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 145/219 (66%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KL+PG SAGTVTAFY+ SD    RDE+DFEFLGN  G  YT+QTN++ +G
Sbjct  71   YLFGRVSMKIKLIPGDSAGTVTAFYMNSDTDTVRDELDFEFLGNRTGQPYTVQTNIYAHG  130

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G++EQ++ LWFDP  DFH YTI+WN +HIVF VD VPIR Y+N+  K + YP  QP   
Sbjct  131  KGDKEQRVNLWFDPAADFHTYTIIWNHHHIVFYVDEVPIRVYKNNEAKNIPYPKFQPMGV  190

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDWSKAPF+A +KD+ I+ C   G P+ C A  P NWW    
Sbjct  191  YSTLWEADDWATRGGLEKIDWSKAPFLAYYKDFDIEGCPVPG-PANC-ASNPRNWWEGTA  248

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L  ++   Y WV    + YDYCTD  R+  + P EC
Sbjct  249  YQALNAMEARRYRWVRMNHMIYDYCTDKSRYPVT-PPEC  286



>ref|XP_003549996.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6-like [Glycine max]
Length=292

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 144/219 (66%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            Y+FG+  MK+KLVPG SAGTVTAFYL SD    RDE+DFEFLGN  G  YT+QTN++ +G
Sbjct  73   YMFGRVSMKIKLVPGDSAGTVTAFYLNSDTNYVRDELDFEFLGNRTGQPYTVQTNIYAHG  132

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP  DFH Y+ILWN +HIVF VD  PIR Y+N+  +G+ YP  Q    
Sbjct  133  KGDREQRVNLWFDPAADFHTYSILWNHHHIVFYVDDFPIRVYKNNEARGIPYPKMQAMGV  192

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+  +WAT GG  KIDWSKAPF A +KD+ I+ C   G P+ C A  PSNWW    
Sbjct  193  YSTLWEADNWATRGGLEKIDWSKAPFYAYYKDFDIEGCAMPG-PANC-ASNPSNWWEGAA  250

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L  I+   Y WV    + YDYC D  RF  + P EC
Sbjct  251  YQALNSIEARRYRWVRVNHVIYDYCKDKSRFPVTPP-EC  288



>ref|XP_007047639.1| Xyloglucan endotransglycosylase [Theobroma cacao]
 gb|EOX91796.1| Xyloglucan endotransglycosylase [Theobroma cacao]
Length=289

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 147/219 (67%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KL+PG SAGTVTAFY+ SD    RDE+DFEFLGN +G  YT+QTN++ +G
Sbjct  70   YLFGRVSMKIKLIPGDSAGTVTAFYMNSDTDNVRDELDFEFLGNRSGQPYTVQTNIYAHG  129

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP  DFH YTI+WN +HIV+ VD VPIR Y+N+  + + YP  QP   
Sbjct  130  KGDREQRVNLWFDPAADFHTYTIMWNHHHIVYYVDDVPIRVYKNNEARNIPYPKFQPMGV  189

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDWSKAPF+A +KD+ I+ C   G P+ C A  P NWW    
Sbjct  190  YSTLWEADDWATRGGLEKIDWSKAPFLAYYKDFDIEGCPVPG-PANC-ASSPRNWWEGTA  247

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L+ ++   Y WV    + YDYCTD  R+  + P EC
Sbjct  248  YQALSAMEARRYRWVRMNHMIYDYCTDKSRYPVTPP-EC  285



>emb|CDP03294.1| unnamed protein product [Coffea canephora]
Length=305

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/226 (51%), Positives = 147/226 (65%), Gaps = 3/226 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG F M++K VPG SAGTVTA+YL S      DE+DFEFLGN +G  YT+ TN++T G
Sbjct  81   YLFGSFEMQIKFVPGNSAGTVTAYYL-SSTGNKHDEVDFEFLGNSSGQPYTIHTNIYTQG  139

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G +EQ+  LWFDPT D+HNYTI WN   IV+ VD VP+R  RN+  +G+ YP  Q   A
Sbjct  140  VGGKEQQFYLWFDPTSDYHNYTIHWNPKAIVWYVDGVPLRVCRNYQSRGIPYPNQQGMRA  199

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKG--DPSECRADGPSNWWNQ  406
              SLWD  +WAT GG VKIDW ++PFIA  +++   AC W G    S+C    P NWW  
Sbjct  200  YTSLWDADNWATRGGLVKIDWKRSPFIARIRNFRPRACTWNGPLSISQCALPSPGNWWTS  259

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              Y  L+  + G   W+ +  +TYDYC D++RFNG +P ECSL +Y
Sbjct  260  PAYGQLSFAKLGQMNWIRQKYMTYDYCKDTKRFNGLMPAECSLAQY  305



>gb|KHN01716.1| Putative xyloglucan endotransglucosylase/hydrolase protein 6, 
partial [Glycine soja]
Length=293

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 144/219 (66%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            Y+FG+  MK+KLVPG SAGTVTAFYL SD    RDE+DFEFLGN  G  YT+QTN++ +G
Sbjct  74   YMFGRVSMKIKLVPGDSAGTVTAFYLNSDTNYVRDELDFEFLGNRTGQPYTVQTNIYAHG  133

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP  DFH Y+ILWN +HIVF VD  PIR Y+N+  +G+ YP  Q    
Sbjct  134  KGDREQRVNLWFDPAADFHTYSILWNHHHIVFYVDDFPIRVYKNNEARGIPYPKMQAMGV  193

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+  +WAT GG  KIDWSKAPF A +KD+ I+ C   G P+ C A  PSNWW    
Sbjct  194  YSTLWEADNWATRGGLEKIDWSKAPFYAYYKDFDIEGCAMPG-PANC-ASNPSNWWEGAA  251

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L  I+   Y WV    + YDYC D  RF  + P EC
Sbjct  252  YQALNSIEARRYRWVRVNHVIYDYCKDKSRFPVTPP-EC  289



>gb|ABC55454.2| xyloglucan endotransglucosylase/hydrolase 2 [Rosa x borboniana]
Length=287

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 130/271 (48%), Positives = 164/271 (61%), Gaps = 5/271 (2%)
 Frame = -3

Query  1095  SLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVM  916
             SL++      F QDF V ++   HI    DG      +    +    S+K KYLFG+  M
Sbjct  18    SLSAFARPATFLQDFQVTWS-DSHIR-QIDGGRAIQLVLDQNSGCGFSSKHKYLFGRVSM  75

Query  915   KMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKI  736
             K+KL+PG SAGTVTAFY+ SD    RDE+DFEFLGN  G  YT+QTN++  G G REQ++
Sbjct  76    KIKLIPGDSAGTVTAFYMNSDTDTVRDELDFEFLGNRTGQPYTVQTNIYARGQGNREQRV  135

Query  735   KLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGS  556
              LWFDP  DFH YTILWN +HIVF VD VPIR Y+N+  KG+ YP  QP     +LW+  
Sbjct  136   NLWFDPAADFHTYTILWNHHHIVFYVDDVPIRLYKNNEAKGIPYPKLQPMGVFSTLWEAD  195

Query  555   SWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQ  376
              WAT GG  KI+WSKAPF A +KD+ I+ C   G P+ C A   +NWW    Y  L  ++
Sbjct  196   DWATRGGLEKINWSKAPFYAYYKDFDIEGCSVPG-PANC-ASSTNNWWEGTAYQALNALE  253

Query  375   RGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
                Y+WV    + YDYC+D  RF    P EC
Sbjct  254   YRRYKWVRMNHMIYDYCSDRSRFPKPPP-EC  283



>ref|XP_010246431.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 17 [Nelumbo nucifera]
Length=280

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 132/265 (50%), Positives = 168/265 (63%), Gaps = 10/265 (4%)
 Frame = -3

Query  1071  GDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVMKMKLVPGY  892
              DF+ D  V++  P H+  S DGR   L +D +  S   S K  ++FG+F ++MKL+ G 
Sbjct  26    ADFHSDTGVLFC-PNHMKVSPDGRQVDLVMDQSCGSGFQSNKA-FIFGKFDIRMKLITGM  83

Query  891   SAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKIKLWFDPTE  712
             SAGTVT FYL S      DE+DFEFLG++    Y LQTN+FT   G REQ+I LWF+PT 
Sbjct  84    SAGTVTTFYLNSTLGKWHDEIDFEFLGHIGATHYILQTNIFTKNVGSREQRIHLWFNPTA  143

Query  711   DFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGSSWATDGGR  532
             DFHNY+ILWN + I+F VD+VPIR +R  A  GV YP  QP     SLWDGS+WAT+GG+
Sbjct  144   DFHNYSILWNPHQIIFYVDNVPIRVFRTGA-TGVPYPSQQPMTVYGSLWDGSNWATEGGK  202

Query  531   VKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQRGLYEWVM  352
             +K+DWSKAPF+AS++DY +DACVW G     R   PS  W      TL   +    EWV 
Sbjct  203   IKVDWSKAPFVASYRDYNVDACVWSGHGQSTRCTNPSLPWMS---HTLDAGELKQLEWVR  259

Query  351   KYQITYDYCTDSQRFNGSIPLECSL  277
             K  + YDYCTD     G+ P ECS+
Sbjct  260   KNYLIYDYCTDP---TGTKP-ECSV  280



>gb|ABM91067.1| xyloglucan endotransglycosylase/hydrolase precursor XTH-36 [Populus 
tremula x Populus tremuloides]
Length=294

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 143/219 (65%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  M++KL+PG SAGTVTAFY+ SD  A RDE+DFEFLGN  G  YT+QTN+F +G
Sbjct  75   YLFGRVSMRIKLIPGDSAGTVTAFYMNSDTDAVRDELDFEFLGNRTGQPYTVQTNIFAHG  134

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP  DFH YTI WN  HIVF VD VPIR Y+NH  KG+ +P  QP   
Sbjct  135  KGDREQRVNLWFDPAADFHLYTIFWNHQHIVFYVDDVPIRVYKNHEAKGIPFPKLQPMGV  194

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDWSKAPF A +KD+ I+ C   G P+ C A    NWW    
Sbjct  195  YSTLWEADDWATRGGLEKIDWSKAPFYAYYKDFDIEGCPVPG-PATC-ASNRGNWWEGAT  252

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L  ++   Y WV    + YDYCTD  R+  + P EC
Sbjct  253  YQALNAMEARKYRWVRMNHMIYDYCTDKSRYP-TTPPEC  290



>ref|XP_009412280.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 7 [Musa acuminata subsp. malaccensis]
Length=286

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 145/219 (66%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            Y +G+  MK+KL+P  SAGTVTAFY+ SD    RDE+DFEFLGN +G  YT+QTN++ +G
Sbjct  67   YQYGRVSMKIKLIPADSAGTVTAFYMNSDTDTVRDELDFEFLGNRSGQPYTVQTNIYAHG  126

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP  D+H Y+ILWN YH+VF VD VPIR Y+N+  +GV YP  QP   
Sbjct  127  KGDREQRVNLWFDPAADYHTYSILWNHYHVVFSVDDVPIRVYKNNEGRGVPYPKAQPMGV  186

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDWSKAPF A +KD+ I+ C   G P+ C A  P+NWW    
Sbjct  187  YSTLWEADDWATRGGLEKIDWSKAPFYAYYKDFDIEGCAVPG-PANC-ASNPNNWWEGAV  244

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L+P Q   Y WV    + YDYCTD  R+    P EC
Sbjct  245  YRQLSPEQARKYRWVRTQYMIYDYCTDKSRYPVPPP-EC  282



>ref|XP_008237031.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 7 [Prunus mume]
Length=291

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/271 (47%), Positives = 168/271 (62%), Gaps = 5/271 (2%)
 Frame = -3

Query  1095  SLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVM  916
             SL++      F QDF V ++   HI    DG      +    +    ++K KYLFG+  M
Sbjct  22    SLSAFGRPATFLQDFQVTWS-DSHIR-QIDGGRAIQLILDQNSGCGFASKRKYLFGRVSM  79

Query  915   KMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKI  736
             K+KL+PG SAGTVTAFY+ SD  A RDE+DFEFLGN  G  YT+QTN++ +G G REQ++
Sbjct  80    KIKLIPGDSAGTVTAFYMNSDTDAVRDELDFEFLGNRTGQPYTVQTNIYAHGKGNREQRV  139

Query  735   KLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGS  556
              LWFDP+ DFH YTILWN +HIVF VD VPIR Y+N+  +GV YP  QP     +LW+  
Sbjct  140   NLWFDPSADFHTYTILWNHHHIVFYVDEVPIRVYKNNEARGVPYPKLQPMGVFSTLWEAD  199

Query  555   SWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQ  376
              WAT GG  KI+WS+APF + ++D+ I+ C   G P+ C A   +NWW    Y  L+ +Q
Sbjct  200   DWATRGGLEKINWSRAPFYSYYRDFDIEGCSVPG-PANC-ASSATNWWEGTAYQALSALQ  257

Query  375   RGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
                Y WV    + YDYCTD  R+  + P EC
Sbjct  258   YRRYRWVRINHMIYDYCTDKSRYPVAPP-EC  287



>ref|XP_010550327.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6 [Tarenaya hassleriana]
Length=291

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 146/219 (67%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KL+PG SAGTVTAFY+ SD  + RDE+DFEFLGN +G  YT+QTN++ +G
Sbjct  74   YLFGRVSMKIKLIPGDSAGTVTAFYMNSDTDSVRDELDFEFLGNRSGQPYTVQTNIYAHG  133

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP  DFH YTILW   HIVF VD VPIR Y+N+  + + YP  QP   
Sbjct  134  KGDREQRVNLWFDPAADFHTYTILWTHKHIVFYVDDVPIREYKNNEARNIPYPTSQPMGI  193

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDWSKAPF A ++D+ I+ C   G P+ C ++ P NWW    
Sbjct  194  YSTLWEADDWATRGGLEKIDWSKAPFYAYYRDFDIEGCPVPG-PAICPSN-PKNWWEGYG  251

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y TL P++   Y WV    + YDYCTD  R+    P EC
Sbjct  252  YQTLNPVEARRYRWVRMNHMIYDYCTDRSRYPAP-PPEC  289



>emb|CDY45623.1| BnaCnng13310D [Brassica napus]
Length=285

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 148/219 (68%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KL+PG SAGTVTAFY+ SD    RDE+DFEFLGN +G  Y++QTN+F +G
Sbjct  68   YLFGKVSMKIKLIPGDSAGTVTAFYMNSDTDTVRDELDFEFLGNRSGQPYSVQTNIFAHG  127

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP+ DFH Y+ILW+  HIVF VD VPIR Y+N+  K +AYP  QP   
Sbjct  128  KGDREQRVNLWFDPSLDFHTYSILWSHKHIVFYVDDVPIREYKNNQAKNIAYPTSQPMGV  187

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDWSKAPF A +KD+ I+ C   G P+ C ++ P NWW    
Sbjct  188  YSTLWEADDWATRGGLEKIDWSKAPFYAYYKDFDIEGCPVPG-PTNCPSN-PHNWWEGYA  245

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y +L  ++   Y WV    + YDYCTD  R+    P+EC
Sbjct  246  YQSLNAVEARRYRWVRVNHMVYDYCTDKSRYPVP-PIEC  283



>gb|KHG00928.1| putative xyloglucan endotransglucosylase/hydrolase 6 -like protein 
[Gossypium arboreum]
Length=289

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 147/219 (67%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KL+PG SAGTVTAFY+ SD    RDE+DFEFLGN +G  YT+QTN++ +G
Sbjct  70   YLFGRVSMKIKLIPGDSAGTVTAFYMNSDTDTVRDELDFEFLGNRSGQPYTVQTNIYAHG  129

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP+ DFH YTI+WN +HIVF VD VPIR Y+N+  + + +P  QP   
Sbjct  130  KGDREQRVNLWFDPSADFHTYTIMWNHHHIVFYVDDVPIRVYKNNEARNIPFPKFQPMGV  189

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDWSKAPF+AS+KD+ I+ C   G P+ C A    NWW    
Sbjct  190  YSTLWEADDWATRGGLEKIDWSKAPFLASYKDFDIEGCPVPG-PASC-ASNTGNWWEGTT  247

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L  ++   Y WV    + YDYCTD  R+  S P EC
Sbjct  248  YQALNVMEARRYRWVRINHMIYDYCTDKSRYPVS-PPEC  285



>ref|XP_009150664.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6 [Brassica rapa]
 emb|CDY08756.1| BnaA06g24680D [Brassica napus]
Length=285

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 148/219 (68%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KL+PG SAGTVTAFY+ SD    RDE+DFEFLGN +G  Y++QTN+F +G
Sbjct  68   YLFGKVSMKIKLIPGDSAGTVTAFYMNSDTDTVRDELDFEFLGNRSGQPYSVQTNIFAHG  127

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP+ DFH Y+ILW+  HIVF VD VPIR Y+N+  K +AYP  QP   
Sbjct  128  KGDREQRVNLWFDPSLDFHTYSILWSHKHIVFYVDDVPIREYKNNQAKNIAYPTSQPMGV  187

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDWSKAPF A +KD+ I+ C   G P+ C ++ P NWW    
Sbjct  188  YSTLWEADDWATRGGLEKIDWSKAPFYAYYKDFDIEGCPVPG-PTNCPSN-PHNWWEGYA  245

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y +L  ++   Y WV    + YDYCTD  R+    P+EC
Sbjct  246  YQSLNAVEARRYRWVRVNHMVYDYCTDKSRYPVP-PVEC  283



>ref|XP_002864977.1| hypothetical protein ARALYDRAFT_496809 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41236.1| hypothetical protein ARALYDRAFT_496809 [Arabidopsis lyrata subsp. 
lyrata]
Length=292

 Score =   239 bits (611),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 148/219 (68%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KL+PG SAGTVTAFY+ SD A  RDE+DFEFLGN +G  Y++QTN+F +G
Sbjct  75   YLFGRVSMKIKLIPGDSAGTVTAFYMNSDTATVRDELDFEFLGNRSGQPYSVQTNIFAHG  134

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP+ D+H YTILW+  HIVF VD VPIR Y+N+  K +AYP  QP   
Sbjct  135  KGDREQRVNLWFDPSLDYHTYTILWSHKHIVFYVDDVPIREYKNNEAKNIAYPTSQPMGV  194

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDWSKAPF A +KD+ I+ C   G P+ C ++ P NWW    
Sbjct  195  YSTLWEADDWATRGGLEKIDWSKAPFYAYYKDFDIEGCPVPG-PTFCPSN-PHNWWEGYA  252

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y +L  ++   Y WV    + YDYCTD  RF    P EC
Sbjct  253  YQSLNALEARRYRWVRVNHMVYDYCTDRSRFPVPPP-EC  290



>gb|AAM61529.1| xyloglucan endo-transglycosylase-like protein [Arabidopsis thaliana]
Length=292

 Score =   239 bits (611),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 148/219 (68%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  M++KL+PG SAGTVTAFY+ SD A  RDE+DFEFLGN +G  Y++QTN+F +G
Sbjct  75   YLFGRVSMRIKLIPGDSAGTVTAFYMNSDTATVRDELDFEFLGNRSGQPYSVQTNIFAHG  134

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP+ D+H YTILW+  HIVF VD VPIR Y+N+  K +AYP  QP   
Sbjct  135  KGDREQRVNLWFDPSMDYHTYTILWSHKHIVFYVDDVPIREYKNNEAKNIAYPTSQPMGV  194

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDWSKAPF A +KD+ I+ C   G P+ C ++ P NWW    
Sbjct  195  YSTLWEADDWATRGGLEKIDWSKAPFYAYYKDFDIEGCPVPG-PTFCPSN-PHNWWEGYA  252

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y +L  ++   Y WV    + YDYCTD  RF    P EC
Sbjct  253  YQSLNAVEARRYRWVRVNHMVYDYCTDRSRFPVPPP-EC  290



>ref|XP_004966138.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 25-like [Setaria italica]
Length=291

 Score =   239 bits (611),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/233 (51%), Positives = 153/233 (66%), Gaps = 15/233 (6%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  M++KLVPG SAGTVTA+YL S    + DE+DFEFLGNV G+ YTL TNVFT G
Sbjct  64   YLFGKIDMQLKLVPGNSAGTVTAYYL-SSQGNTHDEIDFEFLGNVTGEPYTLHTNVFTQG  122

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ+ +LWFDPT+DFH Y+ILWN  H++FMVD +PIR +RN   KG+A+P  QP   
Sbjct  123  QGQREQQFRLWFDPTKDFHTYSILWNPKHVIFMVDDLPIRDFRNLESKGIAFPKNQPMRL  182

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVW-KGDPSECRAD---------  430
              SLW+   WAT GGRVK DWS APF AS++++  DACV   G  + C A          
Sbjct  183  YSSLWNADDWATQGGRVKTDWSHAPFSASYRNFRADACVAVAGGKTRCGATVGTEGSAGA  242

Query  429  GPSNWWNQDNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPK  271
               +W+NQ+   TL    R    WV +  + Y+YCTD +R+   +P ECS+ +
Sbjct  243  AAGDWYNQELDLTLQQRMR----WVQRKYMIYNYCTDPKRYAQGLPAECSMQQ  291



>ref|XP_009354613.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6 [Pyrus x bretschneideri]
Length=294

 Score =   239 bits (611),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 129/272 (47%), Positives = 168/272 (62%), Gaps = 5/272 (2%)
 Frame = -3

Query  1095  SLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVM  916
             SL++      F QDF V ++   HI    DG      +    +    ++K KYLFG+  M
Sbjct  25    SLSAFGRPATFLQDFQVTWS-DSHIR-QIDGGRAIQLVLDQNSGCGFTSKHKYLFGRVSM  82

Query  915   KMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKI  736
             K+KL+PG SAGTVTAFY+ SD    RDE+DFEFLGN  G  YT+QTN++ +G G+REQ++
Sbjct  83    KIKLIPGDSAGTVTAFYMNSDTNTVRDELDFEFLGNRTGQPYTVQTNIYAHGKGDREQRV  142

Query  735   KLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGS  556
              LWFDP  DFH YTILWN +HIVF VD VPIR Y+N+  KG+ YP  QP     +LW+  
Sbjct  143   NLWFDPAADFHTYTILWNHHHIVFYVDDVPIRVYKNNEAKGIPYPKLQPMGVFSTLWEAD  202

Query  555   SWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQ  376
              WAT GG  KIDWSKAPF + +KD+ I+ C   G P+ C A   +NWW   +Y  L  ++
Sbjct  203   DWATRGGLEKIDWSKAPFYSYYKDFDIEGCPVPG-PASC-ASSTNNWWEGASYQALNALE  260

Query  375   RGLYEWVMKYQITYDYCTDSQRFNGSIPLECS  280
                Y WV    + YDYCTD  R+  + P EC+
Sbjct  261   YRRYRWVRINHMIYDYCTDRSRYPVAPP-ECT  291



>ref|XP_006393992.1| hypothetical protein EUTSA_v10004708mg [Eutrema salsugineum]
 dbj|BAJ34562.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ31278.1| hypothetical protein EUTSA_v10004708mg [Eutrema salsugineum]
Length=292

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 146/219 (67%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KL+PG SAGTVTAFY+ SD    RDE+DFEFLGN +G  Y++QTN++ +G
Sbjct  75   YLFGRVSMKIKLIPGDSAGTVTAFYMNSDTDTVRDELDFEFLGNRSGQPYSVQTNIYAHG  134

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP  DFH YTILW   HIVF VD VPIR Y+N   K +AYP  QP   
Sbjct  135  KGDREQRVNLWFDPALDFHTYTILWTHKHIVFYVDDVPIREYKNKEAKNIAYPTSQPMGV  194

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDWSKAPF A +KD+ I+AC   G P+ C ++ P NWW    
Sbjct  195  YSTLWEADDWATRGGLEKIDWSKAPFSAYYKDFDIEACPVPG-PTFCPSN-PHNWWEGYA  252

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y +L  ++   Y WV    + YDYCTD  R+    PLEC
Sbjct  253  YQSLNAVEARRYRWVRVNHMVYDYCTDRSRYPVP-PLEC  290



>ref|XP_007013098.1| Xyloglucan endotransglucosylase/hydrolase 26 [Theobroma cacao]
 gb|EOY30717.1| Xyloglucan endotransglucosylase/hydrolase 26 [Theobroma cacao]
Length=291

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/226 (50%), Positives = 149/226 (66%), Gaps = 3/226 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            +LFG   M +KLVPG SAGTVTA+YL S      DE+DFEFLGNV+G  Y + TN++T G
Sbjct  67   FLFGSIEMLIKLVPGNSAGTVTAYYL-SSTRDKHDEIDFEFLGNVSGQPYIVHTNIYTQG  125

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G REQ+  LWFDPT DFHNYTI WN   +V+ +D++PIR +RN+  +G+A+P  Q    
Sbjct  126  NGSREQQFYLWFDPTADFHNYTIHWNPTEVVWYIDNLPIRVFRNYEKEGIAFPNKQGMRV  185

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPS--ECRADGPSNWWNQ  406
              SLW+  +WAT GG VKIDW+ APFIA F+ +   AC W G  S  +C +  P+NWW  
Sbjct  186  YSSLWNADNWATRGGLVKIDWNSAPFIARFRRFRAKACKWDGPVSINQCASRSPANWWTS  245

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              YS L+  + G  +WV    + YDYC D++RFNG +P EC  P++
Sbjct  246  PTYSQLSSSKMGQMKWVRDNFMIYDYCKDTKRFNGQMPPECFKPQF  291



>gb|KGN65066.1| Xyloglucan endotransglycosylase [Cucumis sativus]
Length=291

 Score =   239 bits (610),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 149/219 (68%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KLVPG SAGTVTAFY+ SD    RDE+DFEFLGN +G  YT+QTN++ +G
Sbjct  72   YLFGKVSMKIKLVPGDSAGTVTAFYMNSDTDTIRDELDFEFLGNRSGQPYTVQTNIYAHG  131

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP  DFH Y+I+W  + I+F VD +PIR Y+NH  KG+ YP  QP   
Sbjct  132  KGDREQRVNLWFDPAADFHTYSIMWTRWLIIFGVDDIPIRVYKNHEAKGIPYPKLQPMGI  191

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDW KAPF A +KD+ I+ C   G P+ C ++ P+NWW   +
Sbjct  192  YSTLWEADDWATRGGLEKIDWKKAPFYAYYKDFDIEGCPVPG-PANCPSN-PNNWWEAPS  249

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y +L+P+Q   Y WV    + YDYCTD  R+  + P EC
Sbjct  250  YQSLSPLQARNYRWVRMNHMIYDYCTDKSRYPVTPP-EC  287



>ref|XP_006584814.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 26-like [Glycine max]
Length=283

 Score =   239 bits (609),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 117/226 (52%), Positives = 143/226 (63%), Gaps = 3/226 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            +LFG   M +KLVPG SAGTVTA+YL S   +  DE+DFEFLGN  G  YT+ TN++T G
Sbjct  59   FLFGSIEMLIKLVPGNSAGTVTAYYL-SSAGSQHDEIDFEFLGNSTGQPYTVHTNIYTQG  117

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G REQ+  LWFDPT DFHNYTI WN   IV+ VDSVPIR +RNH  +G+AYP  Q    
Sbjct  118  KGSREQQFFLWFDPTADFHNYTIHWNPTAIVWYVDSVPIRVFRNHEKEGIAYPNKQGMRV  177

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPS--ECRADGPSNWWNQ  406
              +LW+   WAT GG VK DW  APF A F  +   AC   G  S  +C ++ P+NWW  
Sbjct  178  YTTLWNADDWATRGGLVKTDWHSAPFTARFHHFRARACKSGGARSTNQCASNVPANWWTS  237

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              Y  L+  Q G   WV    + YDYCTD++RFNG IP EC  P++
Sbjct  238  RRYKQLSHSQIGQLNWVRNNYMIYDYCTDTKRFNGQIPPECFKPQF  283



>gb|EYU44533.1| hypothetical protein MIMGU_mgv1a011266mg [Erythranthe guttata]
Length=287

 Score =   239 bits (609),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 127/273 (47%), Positives = 167/273 (61%), Gaps = 5/273 (2%)
 Frame = -3

Query  1098  VSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFV  919
             +S  +      F+QDF V +A   HI     G++  L LD  +     S    YLFG+  
Sbjct  17    LSCTANARPATFSQDFRVAWA-DNHIRQLEGGKAIQLVLDQTSGCGFASKYQ-YLFGRVS  74

Query  918   MKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQK  739
             MK+KLVPG SAGTVTAFY+ SD    RDE+DFEFLGN +G  YT+QTNV+ +G G+REQ+
Sbjct  75    MKIKLVPGDSAGTVTAFYMNSDTDTVRDELDFEFLGNRSGQPYTVQTNVYAHGKGDREQR  134

Query  738   IKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDG  559
             + LWFDP   FH Y+I WN +H+VF VD +PIR Y+N+  +G+ +P  QP     +LW+ 
Sbjct  135   VNLWFDPAAAFHTYSIFWNHHHVVFSVDDIPIRVYKNNEARGIPFPKFQPMGVYSTLWEA  194

Query  558   SSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPI  379
               WAT GG  KIDWSKAPF A +KD+ I+ C   G P+ C A  P NWW    +  L+P 
Sbjct  195   DDWATRGGLEKIDWSKAPFYAYYKDFDIEGCQMPG-PASC-ASNPGNWWEGAAHQQLSPE  252

Query  378   QRGLYEWVMKYQITYDYCTDSQRFNGSIPLECS  280
             +   Y WV    + YDYCTD  R+  + P EC+
Sbjct  253   EARRYRWVRMNHVIYDYCTDKSRYPVTPP-ECT  284



>ref|XP_004288290.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6-like [Fragaria vesca subsp. vesca]
Length=292

 Score =   239 bits (610),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 129/271 (48%), Positives = 165/271 (61%), Gaps = 5/271 (2%)
 Frame = -3

Query  1095  SLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVM  916
             SL++      F QDF V ++   HI    DG      +    +    S+K KYLFG+  M
Sbjct  23    SLSAFARPATFLQDFQVTWS-DSHIR-QIDGGRAIQLVLDQNSGCGFSSKHKYLFGRVSM  80

Query  915   KMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKI  736
             K+KL+PG SAGTVTAFY+ SD  A RDE+DFEFLGN  G  YT+QTN++ +G G RE+++
Sbjct  81    KIKLIPGDSAGTVTAFYMNSDTDAVRDELDFEFLGNRTGQPYTVQTNIYAHGQGNREERV  140

Query  735   KLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGS  556
              LWFDP  DFH YTILWN +HIVF VD VPIR Y+N+  KG+ YP  QP     +LW+  
Sbjct  141   NLWFDPAADFHTYTILWNHHHIVFYVDDVPIRLYKNNEAKGIPYPKLQPMGVFSTLWEAD  200

Query  555   SWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQ  376
              WAT GG  KI+WSKAPF A +KD+ I+ C   G P+ C A    NWW    Y  L  ++
Sbjct  201   DWATRGGLEKINWSKAPFYAYYKDFDIEGCSVPG-PANC-ASSAQNWWEGTAYQALNALE  258

Query  375   RGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
                Y+WV    + YDYC+D  R+    P EC
Sbjct  259   YRRYKWVRMNHMIYDYCSDRSRYPKPPP-EC  288



>ref|XP_004172513.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6-like [Cucumis sativus]
 emb|CCH26415.1| xyloglucan endotransglycosylase [Cucumis sativus]
Length=291

 Score =   239 bits (610),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 149/219 (68%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KLVPG SAGTVTAFY+ SD    RDE+DFEFLGN +G  YT+QTN++ +G
Sbjct  72   YLFGKVSMKIKLVPGDSAGTVTAFYMNSDTDTIRDELDFEFLGNRSGQPYTVQTNIYAHG  131

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP  DFH Y+I+W  + I+F VD +PIR Y+NH  KG+ YP  QP   
Sbjct  132  KGDREQRVNLWFDPAADFHTYSIMWTRWLIIFGVDDIPIRVYKNHEAKGIPYPKLQPMGI  191

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDW KAPF A +KD+ I+ C   G P+ C ++ P+NWW   +
Sbjct  192  YSTLWEADDWATRGGLEKIDWKKAPFYAYYKDFDIEGCPVPG-PANCPSN-PNNWWEAPS  249

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y +L+P+Q   Y WV    + YDYCTD  R+  + P EC
Sbjct  250  YQSLSPLQARNYRWVRMNHMIYDYCTDKSRYPVTPP-EC  287



>ref|XP_010248304.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6 [Nelumbo nucifera]
Length=288

 Score =   239 bits (609),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 118/219 (54%), Positives = 144/219 (66%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KL+PG SAGTVTAFY+ SD    RDE+DFEFLGN  G  YT+QTNVF +G
Sbjct  69   YLFGRVSMKIKLIPGDSAGTVTAFYMNSDTDNVRDELDFEFLGNRTGQPYTVQTNVFAHG  128

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ+I LWFDP  +FH Y+ILWN   +VF VD VPIR Y+N+  KG+ YP  QP   
Sbjct  129  KGDREQRINLWFDPAAEFHTYSILWNHDQVVFFVDDVPIRVYKNNEAKGIPYPKLQPMGV  188

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDWSKAPF A +KD+ I+ C   G P+ C A  P+NWW    
Sbjct  189  YSTLWEADDWATRGGLEKIDWSKAPFYAYYKDFDIEGCPVPG-PATC-ASNPNNWWESPA  246

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L  +Q   Y WV    + YDYCTD  R+  + P EC
Sbjct  247  YKQLDAVQLRNYRWVRMNHLIYDYCTDKSRYPVTPP-EC  284



>ref|XP_010646925.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 7 [Vitis vinifera]
 emb|CAN78176.1| hypothetical protein VITISV_037683 [Vitis vinifera]
Length=288

 Score =   239 bits (609),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 145/219 (66%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KL+PG SAGTVTAFY+ SD    RDE+DFEFLGN  G  YT+QTNV+ +G
Sbjct  69   YLFGRVSMKIKLIPGDSAGTVTAFYMNSDTDTIRDELDFEFLGNRTGQPYTVQTNVYAHG  128

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ+I LWFDP  ++H Y+ILWN Y + F +D VPIR Y+N+  +G+ YP  QP   
Sbjct  129  KGDREQRINLWFDPAAEYHTYSILWNHYRVTFYIDEVPIRVYKNNEARGIPYPKLQPMGV  188

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDW KAPF A +KD+ I+ C   G P  C A  P+NWW    
Sbjct  189  YSTLWEADDWATRGGLEKIDWRKAPFYAYYKDFDIEGCPMPG-PGTC-ASNPNNWWEGTA  246

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L+PI+   Y WV +  + YDYCTD  R+  + P EC
Sbjct  247  YHELSPIEARRYHWVRQNHMIYDYCTDKSRYPVT-PPEC  284



>ref|XP_010463516.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6 [Camelina sativa]
 ref|XP_010444588.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6 [Camelina sativa]
 ref|XP_010484417.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6 [Camelina sativa]
Length=292

 Score =   239 bits (609),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 145/219 (66%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KL+PG SAGTVTAFY+ SD    RDE+DFEFLGN +G  Y++QTN+F +G
Sbjct  75   YLFGRVSMKIKLIPGDSAGTVTAFYMNSDTNTVRDELDFEFLGNRSGQPYSVQTNIFAHG  134

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP  DFH YTILW+  HIVF VD VPIR Y+N+  K +AYP  QP   
Sbjct  135  KGDREQRVNLWFDPALDFHTYTILWSHKHIVFYVDDVPIREYKNNEAKNIAYPTSQPMGV  194

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDW KAPF A +KD+ I+ C   G P+ C ++ P NWW    
Sbjct  195  YSTLWEADDWATRGGLEKIDWKKAPFYAYYKDFDIEGCPVPG-PTSCPSN-PHNWWEGYA  252

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y +L  ++   Y WV    + YDYCTD  RF    P EC
Sbjct  253  YQSLNAVEARRYRWVRVNHMVYDYCTDRSRFPVPPP-EC  290



>ref|XP_006656426.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 25-like [Oryza brachyantha]
Length=280

 Score =   238 bits (608),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 117/222 (53%), Positives = 149/222 (67%), Gaps = 6/222 (3%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YL+G+  M+++LVPG SAGTVTA+YL S  AA  DE+DFEFLGNV G+ YTL TNVFT G
Sbjct  64   YLYGKIDMQLRLVPGNSAGTVTAYYLSSQGAA-HDEIDFEFLGNVTGEPYTLHTNVFTQG  122

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G RE + +LWFDPT+DFH Y+ILWN  HI+FMVD +PIR +RN   KG+A+P  QP   
Sbjct  123  QGNREMQFRLWFDPTKDFHTYSILWNPKHIIFMVDDMPIRDFRNLEGKGIAFPKNQPMRL  182

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGP-SNWWNQD  403
              SLW+   WAT GGR K DWS+APF+AS++ + +D C    +   C   G  S W+NQ+
Sbjct  183  YSSLWNADDWATRGGREKTDWSRAPFVASYRGFHVDGCEASAEARYCATQGARSAWYNQE  242

Query  402  NYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
                LT  QR    WV    + Y+YCTD +RF   +P ECS+
Sbjct  243  --LDLTRQQR--MRWVQSKYMIYNYCTDPKRFPQGLPAECSM  280



>ref|XP_006381725.1| hypothetical protein POPTR_0006s16380g [Populus trichocarpa]
 gb|ERP59522.1| hypothetical protein POPTR_0006s16380g [Populus trichocarpa]
Length=291

 Score =   239 bits (609),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 114/226 (50%), Positives = 147/226 (65%), Gaps = 3/226 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            +LFG   M +KLVPG SAGTVTA+Y+ S      DE+DFEFLGN +G  YT+ TN++T G
Sbjct  67   FLFGSIQMLIKLVPGNSAGTVTAYYV-SSSGDRHDEIDFEFLGNASGQPYTIHTNIYTQG  125

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G REQ+ + WFDPT DFHNYTI WN   +V+ VDSVPIR +RN+ ++G+AYP  Q    
Sbjct  126  NGSREQQFRPWFDPTADFHNYTIHWNPTEVVWYVDSVPIRVFRNYENEGIAYPNKQGMRV  185

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKG--DPSECRADGPSNWWNQ  406
              SLW+   WAT GGRVKIDW  APFIA ++ +   AC W G    S+C ++  +NWW  
Sbjct  186  YSSLWNADIWATQGGRVKIDWKVAPFIARYRSFRARACKWNGPVSISQCASNTAANWWTS  245

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              YS L+  + G   WV    + YDYC D++RFNG  P EC  P++
Sbjct  246  PTYSKLSNAKFGQLTWVRDNYMIYDYCKDTKRFNGKTPPECFKPQF  291



>ref|XP_007155788.1| hypothetical protein PHAVU_003G231900g [Phaseolus vulgaris]
 gb|ESW27782.1| hypothetical protein PHAVU_003G231900g [Phaseolus vulgaris]
Length=290

 Score =   239 bits (609),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 131/261 (50%), Positives = 159/261 (61%), Gaps = 5/261 (2%)
 Frame = -3

Query  1065  FNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVMKMKLVPGYSA  886
             F QDF V +A   HI     GR+  L LD  +     S    Y+FG+  MK+KLVPG SA
Sbjct  31    FVQDFRVAWA-DSHITQIDQGRAIQLKLDQNSGCGFASKAK-YMFGRVSMKIKLVPGDSA  88

Query  885   GTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKIKLWFDPTEDF  706
             GTVTAFYL SD    RDE+DFEFLGN  G  YT+QTNVF +G G+REQ++ LWFDP+ DF
Sbjct  89    GTVTAFYLNSDTDNVRDELDFEFLGNRTGQPYTVQTNVFAHGKGDREQRVNLWFDPSADF  148

Query  705   HNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGSSWATDGGRVK  526
             H Y+I+WN  HIVF VD  PIR Y+N+  +GV YP  Q      +LW+   WAT GG  K
Sbjct  149   HTYSIMWNHRHIVFYVDDFPIRVYKNNERRGVPYPKMQAMGVYSTLWEADDWATRGGLEK  208

Query  525   IDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQRGLYEWVMKY  346
             IDWSKAPF A +KD+ I+ C   G P+ C A  P NWW    Y  L  I+   Y WV   
Sbjct  209   IDWSKAPFYAYYKDFDIEGCAVPG-PANC-ASNPRNWWEGAEYQALNAIEARRYRWVRMN  266

Query  345   QITYDYCTDSQRFNGSIPLEC  283
              + YDYC D  R+  + P EC
Sbjct  267   HVIYDYCRDKSRYPLT-PPEC  286



>ref|XP_007156682.1| hypothetical protein PHAVU_002G008400g [Phaseolus vulgaris]
 gb|ESW28676.1| hypothetical protein PHAVU_002G008400g [Phaseolus vulgaris]
Length=293

 Score =   239 bits (609),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 146/219 (67%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            Y+FG+  MK+KL+PG SAGTVTAFY+ SD  + RDE+DFEFLGN +G  YT+QTN++ +G
Sbjct  74   YMFGRISMKIKLIPGDSAGTVTAFYMNSDTDSVRDELDFEFLGNRSGQPYTVQTNIYAHG  133

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP+ DFH YTI+WN +HIVF VD  PIR Y+N+  KG+ YP  Q    
Sbjct  134  KGDREQRVNLWFDPSLDFHTYTIMWNHHHIVFYVDDFPIRVYKNNEGKGIPYPRMQAMGV  193

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+  +WAT GG  KIDWSKAPF A +KD+ I+ C   G P+ C A   SNWW    
Sbjct  194  YSTLWEADNWATRGGLEKIDWSKAPFYAYYKDFDIEGCPTPG-PANC-ASNQSNWWEGAA  251

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L  I+   Y WV    I YDYC D  R+   IP EC
Sbjct  252  YQALNAIEARRYRWVRLNHIIYDYCQDKSRYT-LIPPEC  289



>gb|ABK21428.1| unknown [Picea sitchensis]
Length=296

 Score =   239 bits (609),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 120/263 (46%), Positives = 167/263 (63%), Gaps = 2/263 (1%)
 Frame = -3

Query  1065  FNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVMKMKLVPGYSA  886
             FN DF +++A+  H  T+ +G+   + LD  + S   +    Y FG F MK+KLV G SA
Sbjct  33    FNDDFQILFAS-DHFKTTENGQIWEVMLDKKSGSGFQTKHS-YRFGWFTMKLKLVAGDSA  90

Query  885   GTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKIKLWFDPTEDF  706
             G VTA+Y+ S    +RDE+DFEFLGN +G  Y LQTN++ NG G REQ+ +LWFDPTEDF
Sbjct  91    GVVTAYYMASKDFETRDELDFEFLGNRSGQPYALQTNIYVNGVGLREQRNELWFDPTEDF  150

Query  705   HNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGSSWATDGGRVK  526
             H Y+ LWN + I+F VD VP+R YR+       YP  +P     S+W+  +WAT GG  K
Sbjct  151   HTYSFLWNNHQIIFFVDLVPLRVYRHTNVTDDVYPKTRPMYVFSSIWNADNWATMGGLEK  210

Query  525   IDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQRGLYEWVMKY  346
              DW+KAPF++S+K +  DAC+W+     C +    NWW+Q    TLT  Q+  Y W  + 
Sbjct  211   TDWTKAPFVSSYKKFNADACMWEDPFPACVSTTGENWWDQPGAWTLTEAQKLDYAWARRN  270

Query  345   QITYDYCTDSQRFNGSIPLECSL  277
              + YDYC D++RFN ++P+ECS+
Sbjct  271   FLIYDYCLDTKRFNDTLPVECSV  293



>ref|XP_010667998.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Beta vulgaris subsp. vulgaris]
Length=286

 Score =   238 bits (608),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 115/222 (52%), Positives = 143/222 (64%), Gaps = 6/222 (3%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  M++KLVPG SAGTVTA+YL S    + DE+DFEFLGNV G  YTL TN+FT G
Sbjct  68   YLFGKIDMQIKLVPGNSAGTVTAYYL-SSQGPTHDEVDFEFLGNVTGQPYTLHTNIFTEG  126

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G REQ+ +LWFDPT DFH Y++LWN   I+F VD  PIR Y+N    GV +P  Q    
Sbjct  127  KGGREQQFRLWFDPTTDFHTYSVLWNPQRIIFSVDGTPIREYKNLESVGVLFPKKQAMRI  186

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGP-SNWWNQD  403
              SLWD   WAT GGR+K DW+KAPF+AS++++  +ACVW    S CR  G  S W NQ 
Sbjct  187  YSSLWDAEDWATQGGRIKTDWNKAPFMASYRNFNANACVWSNGKSSCRGSGSISAWMNQQ  246

Query  402  NYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
                L    +    WV K  + Y+YCTD+QRF   +P EC +
Sbjct  247  ----LDNTNQQRLRWVQKNFMIYNYCTDTQRFPQGLPKECKV  284



>gb|ADO24299.1| xyloglucan endotransglucosylase/hydrolase [Gossypium hirsutum]
Length=289

 Score =   238 bits (607),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 146/219 (67%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KL+PG +AGTVTAFY+ SD    RDE+DFEFLGN +G  YT+QTN++ +G
Sbjct  70   YLFGRVSMKIKLIPGDAAGTVTAFYMNSDTDTVRDELDFEFLGNRSGQPYTVQTNIYAHG  129

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP+ DFH YTI+WN +HIVF VD VPIR Y+N+  + + +P  QP   
Sbjct  130  KGDREQRVNLWFDPSADFHTYTIMWNHHHIVFYVDDVPIRVYKNNEARNIPFPKFQPMGV  189

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDWSKAPF+A +KD+ I+ C   G P+ C A    NWW    
Sbjct  190  YSTLWEADDWATRGGLEKIDWSKAPFLAYYKDFDIEGCPVPG-PASC-ASNTGNWWEGST  247

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L  ++   Y WV    + YDYCTD  R+   IP EC
Sbjct  248  YQALNAMEARRYRWVRMNHMIYDYCTDKSRY-PVIPPEC  285



>ref|XP_006451230.1| hypothetical protein CICLE_v10010330mg [Citrus clementina]
 gb|ESR64470.1| hypothetical protein CICLE_v10010330mg [Citrus clementina]
Length=283

 Score =   238 bits (607),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 115/226 (51%), Positives = 150/226 (66%), Gaps = 3/226 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            +LFG   M +KLVPG SAGTVTA+YL S   +  DE+DFEFLGNV+G  Y + TN++T G
Sbjct  59   FLFGSIEMLIKLVPGNSAGTVTAYYLTSS-GSQHDEIDFEFLGNVSGQPYIIHTNIYTQG  117

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ+  LWFDPT D+HNYTI WN   +V+ VDSVPIR +RN+  +G+AYP  Q    
Sbjct  118  KGDREQQFYLWFDPTADYHNYTIHWNPTEVVWYVDSVPIRVFRNYEKEGIAYPNKQGMRT  177

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKG--DPSECRADGPSNWWNQ  406
             +S+W+  +WAT GG  KIDWS APFIA  + +   AC W G    S+C A  P NWW  
Sbjct  178  HVSIWNADNWATRGGLDKIDWSNAPFIARLRRFRARACKWNGPVSISQCAAKTPGNWWTS  237

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              YS L+  + G  +WV +  + Y+YC D++RFNG +  ECS P+Y
Sbjct  238  PTYSQLSSARMGQLKWVREKYMIYNYCKDTKRFNGKMAPECSKPQY  283



>ref|XP_009417487.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Musa acuminata subsp. malaccensis]
Length=275

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 146/221 (66%), Gaps = 6/221 (3%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  M++KLVPG SAGTVTA+YL S+  A  DE+DFEFLGN++GD YTL TNVF  G
Sbjct  60   YLFGKIDMQIKLVPGNSAGTVTAYYLSSEGPA-HDEIDFEFLGNLSGDPYTLHTNVFAQG  118

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G RE + KLWFDPT+ FH Y+ILWN  HI+FMVD  PIR ++N   +GVA+P  QP   
Sbjct  119  KGNREMQFKLWFDPTKQFHTYSILWNPRHIIFMVDGTPIRDFKNLESRGVAFPKDQPMRI  178

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              SLW+   WAT GG VK DW+KAPF+AS++++  DACV     S C +   S WWNQ+ 
Sbjct  179  YSSLWNADDWATRGGLVKTDWTKAPFVASYRNFNADACVPASGRSRCDS-ANSGWWNQE-  236

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
               L         WV K  + Y+YC D +RF   +P ECS+
Sbjct  237  ---LDSASHARMRWVQKNYMIYNYCNDVKRFPQGLPPECSI  274



>ref|XP_003539234.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6-like [Glycine max]
Length=297

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 145/219 (66%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            Y+FG+  MK+KL+PG SAGTVTAFY+ SD    RDE+DFEFLGN +G  YT+QTN++ +G
Sbjct  78   YMFGRVSMKIKLIPGDSAGTVTAFYMNSDTDTVRDELDFEFLGNRSGQPYTVQTNIYAHG  137

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP+ DFH YTI+WN +HIVF VD  PIR Y+N   KG+ YP  Q    
Sbjct  138  KGDREQRVNLWFDPSADFHTYTIMWNHHHIVFYVDDFPIRVYKNSEGKGIPYPTMQAMGV  197

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+  +WAT GG  KIDWSKAPF A +KD+ I+ C   G P+ C A   SNWW    
Sbjct  198  YSTLWEADNWATRGGLEKIDWSKAPFYAYYKDFDIEGCPVPG-PANC-ASNQSNWWEGAA  255

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L  I+   Y WV    I YDYC D  RF+ + P EC
Sbjct  256  YQALNAIEARRYRWVRLNHIIYDYCQDKSRFSVT-PPEC  293



>gb|ABB72442.1| xyloglucan endotransglucosylase [Gerbera hybrid cultivar]
Length=297

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 144/219 (66%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KL+PG SAGTVTAFY+ SD    RDE+DFEFLGN  G  Y++QTNV+ +G
Sbjct  78   YLFGRVSMKIKLIPGDSAGTVTAFYMNSDTDNVRDELDFEFLGNRTGQPYSVQTNVYAHG  137

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP  DFH YTILWN +H+VF VD VPIR Y+N+  KGV +P  QP   
Sbjct  138  KGDREQRVNLWFDPAADFHVYTILWNHHHVVFSVDEVPIRVYKNNEAKGVPFPKFQPMGI  197

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDWSKAPF A +KD+ I+ C   G P+ C A   +NWW    
Sbjct  198  YSTLWEADDWATRGGLEKIDWSKAPFYAYYKDFDIEGCAMPG-PATC-ASNQANWWEGTG  255

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L  +    Y WV    + YDYCTD  R+  + P EC
Sbjct  256  YQQLDAVAARRYRWVRMNHMVYDYCTDKHRYPVTPP-EC  293



>gb|KHN13026.1| Putative xyloglucan endotransglucosylase/hydrolase protein 6 
[Glycine soja]
Length=295

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 145/219 (66%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            Y+FG+  MK+KL+PG SAGTVTAFY+ SD    RDE+DFEFLGN +G  YT+QTN++ +G
Sbjct  76   YMFGRVSMKIKLIPGDSAGTVTAFYMNSDTDTVRDELDFEFLGNRSGQPYTVQTNIYAHG  135

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP+ DFH YTI+WN +HIVF VD  PIR Y+N   KG+ YP  Q    
Sbjct  136  KGDREQRVNLWFDPSADFHTYTIMWNHHHIVFYVDDFPIRVYKNSEGKGIPYPTMQAMGV  195

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+  +WAT GG  KIDWSKAPF A +KD+ I+ C   G P+ C A   SNWW    
Sbjct  196  YSTLWEADNWATRGGLEKIDWSKAPFYAYYKDFDIEGCPVPG-PANC-ASNQSNWWEGAA  253

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L  I+   Y WV    I YDYC D  RF+ + P EC
Sbjct  254  YQALNAIEARRYRWVRLNHIIYDYCQDKSRFSVT-PPEC  291



>ref|XP_006426162.1| hypothetical protein CICLE_v10026210mg [Citrus clementina]
 ref|XP_006466405.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6-like [Citrus sinensis]
 gb|ESR39402.1| hypothetical protein CICLE_v10026210mg [Citrus clementina]
 gb|KDO78789.1| hypothetical protein CISIN_1g022933mg [Citrus sinensis]
Length=287

 Score =   238 bits (606),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 144/219 (66%), Gaps = 5/219 (2%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KLVPG SAGTVTAFY+ S+    RDE+DFEFLGN  G  YT+QTN++ NG
Sbjct  70   YLFGRVSMKIKLVPGDSAGTVTAFYMNSNTENVRDELDFEFLGNRTGQPYTVQTNIYANG  129

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP  D+H YTILWN +HIVF VD VPIR Y+N       +PM QP   
Sbjct  130  KGDREQRVNLWFDPAADYHLYTILWNHHHIVFYVDDVPIRVYKNSGR--APFPMNQPMGV  187

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDWSKAPF A ++D+ I+ C   G P+ C A  P NWW  +N
Sbjct  188  YSTLWEADDWATRGGLEKIDWSKAPFYAYYRDFDIEGCPVPG-PANC-ASNPGNWWEANN  245

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  LT ++   Y WV    + YDYCTD  R+    P EC
Sbjct  246  YQALTAMEARRYRWVRLNHMIYDYCTDKSRYPVPPP-EC  283



>gb|KDO78788.1| hypothetical protein CISIN_1g022933mg [Citrus sinensis]
Length=290

 Score =   238 bits (606),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 144/219 (66%), Gaps = 5/219 (2%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KLVPG SAGTVTAFY+ S+    RDE+DFEFLGN  G  YT+QTN++ NG
Sbjct  73   YLFGRVSMKIKLVPGDSAGTVTAFYMNSNTENVRDELDFEFLGNRTGQPYTVQTNIYANG  132

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP  D+H YTILWN +HIVF VD VPIR Y+N       +PM QP   
Sbjct  133  KGDREQRVNLWFDPAADYHLYTILWNHHHIVFYVDDVPIRVYKNSGR--APFPMNQPMGV  190

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDWSKAPF A ++D+ I+ C   G P+ C A  P NWW  +N
Sbjct  191  YSTLWEADDWATRGGLEKIDWSKAPFYAYYRDFDIEGCPVPG-PANC-ASNPGNWWEANN  248

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  LT ++   Y WV    + YDYCTD  R+    P EC
Sbjct  249  YQALTAMEARRYRWVRLNHMIYDYCTDKSRYPVPPP-EC  286



>gb|ABK21757.1| unknown [Picea sitchensis]
Length=293

 Score =   238 bits (606),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/223 (52%), Positives = 152/223 (68%), Gaps = 7/223 (3%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG   M++KLV G SAGTVT++Y+ SD A+S DE+D+EFLGN+ G  YTLQTNVF NG
Sbjct  74   YLFGIVSMRIKLVSGNSAGTVTSYYMSSD-ASSHDELDYEFLGNLPGKPYTLQTNVFANG  132

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHAD-KGVAYPMGQPAP  583
             G REQ+I+LWFDPT  FHNY+ILWN   IVF VDS+PIR ++N+ +  G+ YP  +P  
Sbjct  133  VGNREQRIRLWFDPTAGFHNYSILWNHKQIVFWVDSIPIRVFKNNEEAAGIPYPNRRPMK  192

Query  582  AQISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDAC-VWKGDPSECRADGPSNWWNQ  406
               +LW+G SWATDGGRVK+DW  APF+AS++ + +DAC V  G    C     +NWW+Q
Sbjct  193  ILSTLWNGDSWATDGGRVKVDWDIAPFVASYQSFQVDACSVSSGSSLPC----ANNWWDQ  248

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
              + +L   Q     WV K+ +TYDYC D+     + P EC+ 
Sbjct  249  PEFQSLNQYQLRRIHWVRKHYMTYDYCHDTSGRFSAAPAECAF  291



>ref|XP_010437183.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 7 [Camelina sativa]
Length=294

 Score =   238 bits (606),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 127/260 (49%), Positives = 161/260 (62%), Gaps = 4/260 (2%)
 Frame = -3

Query  1059  QDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVMKMKLVPGYSAGT  880
             +D F I  + GHI T  DG          ++    ++K +YLFG   MK+KL+PG SAGT
Sbjct  36    EDDFRITWSDGHI-TQIDGGRAIQLKLDPSSGCGFASKKQYLFGHVSMKIKLLPGDSAGT  94

Query  879   VTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKIKLWFDPTEDFHN  700
             V AFY+ SD  + RDE+DFEFLGN +G  YT+QTNVF +G G+REQ++ LWFDP+ DFH 
Sbjct  95    VAAFYMNSDTDSVRDELDFEFLGNRSGQPYTVQTNVFAHGKGDREQRVNLWFDPSRDFHE  154

Query  699   YTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGSSWATDGGRVKID  520
             Y I WN   IVF VD VPIR Y+N+  + V YP  QP     +LW+   WAT GG  KI+
Sbjct  155   YAISWNHLRIVFYVDKVPIRVYKNNEARKVPYPRFQPMSIYSTLWEADDWATRGGIEKIN  214

Query  519   WSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQRGLYEWVMKYQI  340
             WS APF A +KD+ I+ C   G P+ C A+ P NWW    Y TL+P +   Y WV    +
Sbjct  215   WSGAPFYAYYKDFDIEGCPVPG-PANCPAN-PMNWWEGSAYHTLSPAEARGYRWVRVNHM  272

Query  339   TYDYCTDSQRFNGSIPLECS  280
              YDYCTD  RF+   P ECS
Sbjct  273   VYDYCTDKSRFHVPPP-ECS  291



>gb|ACB86852.1| xyloglucan endotransglycosylase [Brassica rapa subsp. pekinensis]
 emb|CDX72656.1| BnaC07g46780D [Brassica napus]
Length=292

 Score =   238 bits (606),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/220 (53%), Positives = 146/220 (66%), Gaps = 3/220 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KL+PG SAGTV AFY+ SD  + RDE+DFEFLGN +G  YT+QTNVF +G
Sbjct  73   YLFGRVSMKIKLIPGDSAGTVAAFYMNSDTDSVRDELDFEFLGNRSGQPYTVQTNVFAHG  132

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP+ DFH Y I WN   IVF VD+VPIR Y+N+  + V YP  QP   
Sbjct  133  KGDREQRVNLWFDPSRDFHEYAISWNHLRIVFYVDNVPIRVYKNNEARKVPYPRFQPMGV  192

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KI+WS+APF A +KD+ I+ C   G P+ C A+ P NWW    
Sbjct  193  YSTLWEADDWATRGGIEKINWSEAPFYAYYKDFDIEGCSVPG-PAGCPAN-PKNWWEGSA  250

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECS  280
            Y  LTP++   Y WV    + YDYCTD  RF    P ECS
Sbjct  251  YHQLTPVEARSYRWVRVNHMIYDYCTDKSRFPVP-PPECS  289



>ref|XP_007205666.1| hypothetical protein PRUPE_ppa009472mg [Prunus persica]
 gb|EMJ06865.1| hypothetical protein PRUPE_ppa009472mg [Prunus persica]
Length=291

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 128/271 (47%), Positives = 166/271 (61%), Gaps = 5/271 (2%)
 Frame = -3

Query  1095  SLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVM  916
             SL++      F QDF V ++   HI    DG      +    +    ++K KYLFG+  M
Sbjct  22    SLSAFGRPATFLQDFQVTWS-DSHIR-QIDGGRAIQLILDQNSGCGFASKRKYLFGRVSM  79

Query  915   KMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKI  736
             K+KL+PG SAGTVTAFY+ S+  A RDE+DFEFLGN  G  YT+QTN++ +G G REQ++
Sbjct  80    KIKLIPGDSAGTVTAFYMNSNTDAVRDEVDFEFLGNRTGQPYTVQTNIYAHGKGNREQRV  139

Query  735   KLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGS  556
              LWFDP  DFH YTILWN +HIVF VD VPIR Y+N+  +GV YP  QP     +LW+  
Sbjct  140   NLWFDPAADFHTYTILWNHHHIVFYVDDVPIRVYKNNEARGVPYPKLQPMGVFSTLWEAD  199

Query  555   SWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQ  376
              WAT GG  KI+WSKAPF + +KD+ I+ C   G P+ C A   +NWW    Y  L  ++
Sbjct  200   DWATRGGLEKINWSKAPFFSYYKDFDIEGCSVPG-PANC-ASSATNWWEGTAYQALNALE  257

Query  375   RGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
                Y WV    + YDYCTD  R+  + P EC
Sbjct  258   YRRYRWVRINHMIYDYCTDKSRYPVAPP-EC  287



>gb|ADO24302.1| putative xyloglucan endotransglucosylase/hydrolase [Gossypium 
hirsutum]
Length=289

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 145/219 (66%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KL+PG SAGTVTAFY+ SD    RDE+DFEFLGN +G  YT+QTN++ +G
Sbjct  70   YLFGRVSMKIKLIPGDSAGTVTAFYMNSDTDTVRDELDFEFLGNRSGQPYTVQTNIYAHG  129

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP+ DFH YTI+WN +HI F VD VP R Y+N+  + + +P  QP   
Sbjct  130  KGDREQRVNLWFDPSADFHTYTIMWNHHHIAFYVDDVPFRVYKNNEARNIPFPKFQPMGV  189

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDWSKAPF+AS+KD+ I+ C   G P+ C A    NWW    
Sbjct  190  YSTLWEADDWATRGGLEKIDWSKAPFLASYKDFDIEGCPVPG-PASC-ASNTGNWWEGTT  247

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L  ++   Y WV    I YDYCTD  R+  S P EC
Sbjct  248  YQALNVMEARRYRWVRINHIIYDYCTDKSRYPVS-PPEC  285



>ref|XP_002980921.1| hypothetical protein SELMODRAFT_178522 [Selaginella moellendorffii]
 gb|EFJ18106.1| hypothetical protein SELMODRAFT_178522 [Selaginella moellendorffii]
Length=278

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 126/268 (47%), Positives = 167/268 (62%), Gaps = 17/268 (6%)
 Frame = -3

Query  1050  FVIYAAPGHIN---------TSADGRstsltldtaaasssmstkdKYLFGQFVMKMKLVP  898
              V  AAPG+ N            DG      +    +++  ++K+KYLFG+  M++KLVP
Sbjct  15    IVSQAAPGNFNDLFTSNNDHVKVDGSGQVRLVLDHQSAAGFASKNKYLFGRVSMQIKLVP  74

Query  897   GYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKIKLWFDP  718
             G SAGTV A+Y+ SD   +RDE+D EFLGN +G+ Y LQTNV+ NG G REQ++ LWFDP
Sbjct  75    GDSAGTVAAYYMSSDDYRTRDEIDLEFLGNTSGNPYILQTNVYANGVGNREQRVYLWFDP  134

Query  717   TEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGSSWATDG  538
             T DFH+Y+ILWN   IVF VDS PIR ++N+ D G+ +P  Q      SLW+   WAT G
Sbjct  135   TADFHSYSILWNQKQIVFFVDSTPIRVFKNNQDMGLPFPTKQSMGVYSSLWNADDWATRG  194

Query  537   GRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSN--WWNQDNYSTLTPIQRGLY  364
             G VK DWS APFIAS+K++ +DAC  +     C   GP++  WW+   +  L+P   G  
Sbjct  195   GLVKTDWSHAPFIASYKNFDLDAC--QASSGSC---GPNSGKWWDSSAWQALSPSDAGKL  249

Query  363   EWVMKYQITYDYCTDSQRFNGSIPLECS  280
             +WV K  + YDYCTDS RF  S P EC+
Sbjct  250   KWVKKNYMIYDYCTDSARF-PSRPAECA  276



>gb|AAM62514.1| endo-xyloglucan transferase-like protein [Arabidopsis thaliana]
Length=293

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/220 (53%), Positives = 147/220 (67%), Gaps = 3/220 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KL+PG SAGTVTAFY+ SD  + RDE+DFEFLGN +G  YT+QTNVF +G
Sbjct  74   YLFGRVSMKIKLIPGDSAGTVTAFYMNSDTDSVRDELDFEFLGNRSGQPYTVQTNVFAHG  133

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP+ DFH Y I WN   IVF VD+VPIR Y+N+  + V YP  QP   
Sbjct  134  KGDREQRVNLWFDPSRDFHEYAISWNHLRIVFYVDNVPIRVYKNNEARKVPYPRFQPMGV  193

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KI+WS+APF A +KD+ I+ C   G P++C A+   NWW    
Sbjct  194  YSTLWEADDWATRGGIEKINWSRAPFYAYYKDFDIEGCPVPG-PADCPANS-KNWWEGSA  251

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECS  280
            Y  L+P++   Y WV    + YDYCTD  RF    P ECS
Sbjct  252  YHQLSPVEARSYRWVRVNHMVYDYCTDKSRFPVP-PPECS  290



>gb|KHN16622.1| Putative xyloglucan endotransglucosylase/hydrolase protein 26 
[Glycine soja]
Length=283

 Score =   237 bits (604),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/226 (51%), Positives = 143/226 (63%), Gaps = 3/226 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            +LFG   M +KLVPG SAGTVTA+YL S   +  DE+DFEFLGN  G  YT+ TN++T G
Sbjct  59   FLFGSIEMLIKLVPGNSAGTVTAYYL-SSAGSQHDEIDFEFLGNSTGQPYTVHTNIYTQG  117

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G REQ+  LWFDPT DFHNYTI WN   IV+ VDSVPIR +RN+  +G+AYP  Q    
Sbjct  118  KGSREQQFYLWFDPTADFHNYTIHWNPTAIVWYVDSVPIRVFRNYEKEGIAYPTKQGMRV  177

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPS--ECRADGPSNWWNQ  406
              +LW+   WAT GG VK DW  APF A F  +   AC   G  S  +C ++ P+NWW  
Sbjct  178  YTTLWNADDWATRGGLVKTDWHSAPFTARFHHFRARACKSGGARSTNQCASNVPANWWTS  237

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              Y  L+  Q G   WV    + YDYCTD++RFNG IP EC  P++
Sbjct  238  RRYKQLSHSQIGQLNWVRNNYMIYDYCTDTKRFNGQIPPECFKPQF  283



>ref|NP_195494.1| xyloglucan endotransglucosylase/hydrolase protein 7 [Arabidopsis 
thaliana]
 sp|Q8LER3.2|XTH7_ARATH RecName: Full=Probable xyloglucan endotransglucosylase/hydrolase 
protein 7; Short=At-XTH7; Short=XTH-7; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB38928.1| endo-xyloglucan transferase-like protein [Arabidopsis thaliana]
 emb|CAB80445.1| endo-xyloglucan transferase-like protein [Arabidopsis thaliana]
 gb|AAM13024.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91326.1| unknown protein [Arabidopsis thaliana]
 gb|AEE86839.1| xyloglucan endotransglucosylase/hydrolase protein 7 [Arabidopsis 
thaliana]
Length=293

 Score =   237 bits (605),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/220 (53%), Positives = 147/220 (67%), Gaps = 3/220 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KL+PG SAGTVTAFY+ SD  + RDE+DFEFLGN +G  YT+QTNVF +G
Sbjct  74   YLFGRVSMKIKLIPGDSAGTVTAFYMNSDTDSVRDELDFEFLGNRSGQPYTVQTNVFAHG  133

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP+ DFH Y I WN   IVF VD+VPIR Y+N+  + V YP  QP   
Sbjct  134  KGDREQRVNLWFDPSRDFHEYAISWNHLRIVFYVDNVPIRVYKNNEARKVPYPRFQPMGV  193

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KI+WS+APF A +KD+ I+ C   G P++C A+   NWW    
Sbjct  194  YSTLWEADDWATRGGIEKINWSRAPFYAYYKDFDIEGCPVPG-PADCPANS-KNWWEGSA  251

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECS  280
            Y  L+P++   Y WV    + YDYCTD  RF    P ECS
Sbjct  252  YHQLSPVEARSYRWVRVNHMVYDYCTDKSRFPVP-PPECS  290



>ref|XP_006411851.1| hypothetical protein EUTSA_v10025884mg [Eutrema salsugineum]
 gb|ESQ53304.1| hypothetical protein EUTSA_v10025884mg [Eutrema salsugineum]
Length=292

 Score =   237 bits (604),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 128/269 (48%), Positives = 165/269 (61%), Gaps = 4/269 (1%)
 Frame = -3

Query  1086  SVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVMKMK  907
             SV+S     +D F I  +  HI T  DG          ++    ++K +YLFG+  MK+K
Sbjct  25    SVLSRPARFEDDFRITWSDAHI-TQLDGGRAIQLKLDPSSGCGFASKKQYLFGRVSMKIK  83

Query  906   LVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKIKLW  727
             L+PG SAGTV AFY+ SD  + RDE+DFEFLGN +G  YT+QTNVF +G G+REQ++ LW
Sbjct  84    LIPGDSAGTVAAFYMNSDTDSIRDELDFEFLGNRSGQPYTVQTNVFAHGKGDREQRVNLW  143

Query  726   FDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGSSWA  547
             FDP+ DFH Y I WN   IVF VD+VPIR Y+N+  + V YP  QP     +LW+   WA
Sbjct  144   FDPSRDFHEYAISWNHLRIVFYVDNVPIRVYKNNEARKVPYPRFQPMGVYSTLWEADDWA  203

Query  546   TDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQRGL  367
             T GG  KI+WS APF A +KD+ I+ C   G P+ C A+ P NWW    Y  L+P++   
Sbjct  204   TRGGMEKINWSGAPFYAYYKDFDIEGCPVPG-PANCPAN-PKNWWEGSAYHQLSPVEARG  261

Query  366   YEWVMKYQITYDYCTDSQRFNGSIPLECS  280
             Y WV    + YDYCTD  RF    P ECS
Sbjct  262   YRWVRVNHMVYDYCTDKSRFPIPPP-ECS  289



>ref|XP_008458950.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6 [Cucumis melo]
Length=292

 Score =   237 bits (604),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 146/219 (67%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KLVPG SAGTVTAFY+ SD    RDE+DFEFLGN +G  YT+QTN++ +G
Sbjct  73   YLFGKVSMKIKLVPGDSAGTVTAFYMNSDTDTIRDELDFEFLGNRSGQPYTVQTNIYAHG  132

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP  DFH Y+I W    IVF VD +PIR Y+NH  KG+ YP  QP   
Sbjct  133  KGDREQRVNLWFDPAADFHTYSIRWTHSLIVFGVDDIPIRVYKNHEAKGIPYPKQQPMGI  192

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDW KAPF A +KD+ I+ C   G P+ C ++ P+NWW   +
Sbjct  193  YSTLWEADDWATRGGLEKIDWKKAPFYAYYKDFDIEGCPVPG-PANCPSN-PNNWWEAPS  250

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y +L+P++   Y WV    + YDYCTD  R+    P EC
Sbjct  251  YQSLSPLEARNYRWVRMNHMIYDYCTDKSRYP-VTPPEC  288



>ref|XP_002270973.2| PREDICTED: brassinosteroid-regulated protein BRU1-like [Vitis 
vinifera]
Length=290

 Score =   237 bits (604),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 127/277 (46%), Positives = 166/277 (60%), Gaps = 12/277 (4%)
 Frame = -3

Query  1098  VSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFV  919
             VS     S G F QDF + +    H     DG          A+ S   +K +YLFG+  
Sbjct  19    VSSIMAASAGSFYQDFDLTWG--DHRAKILDGEKLLTLSLDKASGSGFQSKKEYLFGKID  76

Query  918   MKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQK  739
             M++KLV G SAGTVTA+YL S    + DE+DFEFLGN++GD Y L TNVFT G G REQ+
Sbjct  77    MQLKLVSGNSAGTVTAYYL-SSQGPTHDEIDFEFLGNLSGDPYILHTNVFTQGKGNREQQ  135

Query  738   IKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDG  559
               LWFDPTE+FH Y+I+WN+ +I+F+VD++PIR ++N    GV +P  QP     SLW+ 
Sbjct  136   FYLWFDPTENFHTYSIIWNLQNIIFLVDNIPIREFKNQESIGVPFPKSQPMRIYSSLWNA  195

Query  558   SSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPS-----NWWNQDNYS  394
               WAT GG VKIDWSKAPF AS++++   AC+W    S C +   S      W NQ    
Sbjct  196   DDWATRGGLVKIDWSKAPFTASYRNFNAAACLWSHGSSSCASKFTSPVSNIAWQNQG---  252

Query  393   TLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
              L    R   +WV K  + Y+YC+D +RF G +PLEC
Sbjct  253   -LDAKSRRKLQWVQKNYMIYNYCSDMKRFPGGLPLEC  288



>ref|XP_010245633.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6 [Nelumbo nucifera]
Length=289

 Score =   236 bits (603),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 129/261 (49%), Positives = 161/261 (62%), Gaps = 5/261 (2%)
 Frame = -3

Query  1065  FNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVMKMKLVPGYSA  886
             F QDF + +A   HI     GRS  L LD  +     S    YLFG+  MK+KL+PG SA
Sbjct  30    FLQDFRITWA-DSHIRQIEGGRSIQLILDQNSGCGFASKNQ-YLFGRVSMKIKLIPGDSA  87

Query  885   GTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKIKLWFDPTEDF  706
             GTVTAFY+ SD    RDE+DFEFLGN  G  YT+QTNV+ +G G+REQ+I LWFDP  ++
Sbjct  88    GTVTAFYMNSDTDTVRDELDFEFLGNRTGQPYTVQTNVYVHGKGDREQRINLWFDPAAEY  147

Query  705   HNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGSSWATDGGRVK  526
             H Y+ILWN YH+VF VD VPIR Y+N+  KG+ +P  QP     +LW+   WAT GG  K
Sbjct  148   HTYSILWNHYHVVFYVDDVPIRVYKNNEAKGLPFPKFQPMGVYSTLWEADDWATRGGLEK  207

Query  525   IDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQRGLYEWVMKY  346
             IDW+KAPF A +KD+ I+ C   G  S C A  P+NWW    Y  L  +Q   Y WV   
Sbjct  208   IDWTKAPFYAYYKDFDIEGCAAPGAAS-C-ASNPNNWWEGAGYQKLDELQARKYRWVRMN  265

Query  345   QITYDYCTDSQRFNGSIPLEC  283
              + YDYC D  R+  + P EC
Sbjct  266   HMIYDYCVDKSRYPVTPP-EC  285



>ref|NP_001280943.1| probable xyloglucan endotransglucosylase/hydrolase protein 6 
[Malus domestica]
 gb|ACD03228.1| xyloglucan endotransglucosylase/hydrolase 4 [Malus domestica]
Length=294

 Score =   236 bits (603),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 147/220 (67%), Gaps = 3/220 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KL+PG SAGTVTAFY+ SD    RDE+DFEFLGN  G  YT+QTN++ +G
Sbjct  75   YLFGRVSMKIKLIPGDSAGTVTAFYMNSDTNTVRDELDFEFLGNRTGQPYTVQTNIYAHG  134

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP  DFH YTILWN +HIVF VD +PIR Y+N+  KGV YP  QP   
Sbjct  135  KGDREQRVNLWFDPAADFHTYTILWNHHHIVFYVDDMPIRVYKNNEAKGVPYPKLQPMGV  194

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KI+WSKAPF + +KD+ I+ C   G P+ C A   +NWW   +
Sbjct  195  FSTLWEADDWATRGGLEKINWSKAPFFSYYKDFDIEGCSVPG-PASC-ASSTNNWWEGAS  252

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECS  280
            Y  L+ +    Y WV    + YDYCTD  R+  + P EC+
Sbjct  253  YQALSALDYRRYRWVRINHMIYDYCTDRSRYPVAPP-ECT  291



>ref|XP_010668001.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Beta vulgaris subsp. vulgaris]
Length=290

 Score =   236 bits (603),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 143/221 (65%), Gaps = 6/221 (3%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  M++KLVPG SAGTVT +YL S    + DE+DFEFLGN  G  YTL TNVF  G
Sbjct  66   YLFGKIDMQIKLVPGNSAGTVTTYYL-SSQGPNHDEIDFEFLGNATGQPYTLHTNVFAQG  124

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ+ +LWFDPT DFH Y+ILWN   I+F VD  PIR ++N    GV++P  Q    
Sbjct  125  KGDREQQFRLWFDPTADFHTYSILWNPQRIIFAVDGTPIREFKNMEAIGVSFPKSQAMRM  184

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSN-WWNQD  403
              SLWD   WAT GGR+K DWSKAPF+AS++++  +ACVW    S CR  G S+ W NQ 
Sbjct  185  YSSLWDAEDWATQGGRIKTDWSKAPFVASYRNFNANACVWSNGRSSCRGSGASSAWMNQQ  244

Query  402  NYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECS  280
                L    +   +WV +  + Y+YCTD QRF   +P EC+
Sbjct  245  ----LDGTSQQRLQWVQRNYMIYNYCTDIQRFPQGLPKECT  281



>ref|XP_010028049.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6 [Eucalyptus grandis]
 gb|KCW54710.1| hypothetical protein EUGRSUZ_I00659 [Eucalyptus grandis]
Length=292

 Score =   236 bits (603),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 114/220 (52%), Positives = 145/220 (66%), Gaps = 3/220 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KLVPG SAGTVTAFY+ S+    RDE+DFEFLGN  G  YT+QTNV+ +G
Sbjct  73   YLFGRVSMKIKLVPGDSAGTVTAFYMNSNTDNIRDELDFEFLGNRTGQPYTVQTNVYAHG  132

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP  DFH YTILWN +H+VF VD VPIR ++N+  + + YP  QP   
Sbjct  133  KGDREQRVNLWFDPAADFHTYTILWNHHHVVFYVDDVPIRVFKNNEARRLPYPTYQPMGV  192

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDWSKAPF A +KD+ I+ C   G P+ C A  P NWW   +
Sbjct  193  YSTLWEADDWATRGGLEKIDWSKAPFYAYYKDFDIEGCTVPG-PASC-ASNPRNWWEGAS  250

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECS  280
            Y  L+ ++   Y WV    + YDYC D  R+   +P EC 
Sbjct  251  YQQLSAMEARRYRWVRMNHMIYDYCADRSRY-PMVPPECE  289



>ref|XP_008344375.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6 [Malus domestica]
Length=294

 Score =   236 bits (603),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 147/220 (67%), Gaps = 3/220 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KL+PG SAGTVTAFY+ SD    RDE+DFEFLGN  G  YT+QTN++ +G
Sbjct  75   YLFGRVSMKIKLIPGDSAGTVTAFYMNSDTBTVRDELDFEFLGNRTGQPYTVQTNIYAHG  134

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP  DFH YTILWN +HIVF VD +PIR Y+N+  KGV YP  QP   
Sbjct  135  KGDREQRVNLWFDPAADFHTYTILWNHHHIVFYVDDMPIRVYKNNEAKGVPYPKLQPMGV  194

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KI+WSKAPF + +KD+ I+ C   G P+ C A   +NWW   +
Sbjct  195  FSTLWEADDWATRGGLEKINWSKAPFFSYYKDFDIEGCSVPG-PASC-ASSTNNWWEGAS  252

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECS  280
            Y  L+ +    Y WV    + YDYCTD  R+  + P EC+
Sbjct  253  YQALSALDYRRYRWVRINHMIYDYCTDRSRYPVAPP-ECT  291



>ref|XP_009138533.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 7 [Brassica rapa]
Length=292

 Score =   236 bits (603),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 117/220 (53%), Positives = 146/220 (66%), Gaps = 3/220 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KL+PG SAGTV AFY+ SD  + RDE+DFEFLGN +G  YT+QTNVF +G
Sbjct  73   YLFGRVSMKIKLIPGDSAGTVAAFYMNSDTDSVRDELDFEFLGNRSGQPYTVQTNVFAHG  132

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP+ DFH Y I WN   IVF VD+VPIR Y+N+  + V YP  QP   
Sbjct  133  KGDREQRVNLWFDPSRDFHEYAISWNHLRIVFYVDNVPIRVYKNNEARKVPYPRFQPMGV  192

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KI+WS+APF A +KD+ I+ C   G P+ C A+ P NWW    
Sbjct  193  YSTLWEADDWATRGGIEKINWSEAPFYAYYKDFDIEGCSVPG-PAGCPAN-PKNWWEGSA  250

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECS  280
            Y  LTP++   Y WV    + YDYCTD  RF    P ECS
Sbjct  251  YHQLTPVEARSYRWVRVNYMIYDYCTDKSRFPVP-PPECS  289



>gb|AII99392.1| xyloglucan endotransglucosylase/hydrolase2 [Dianthus caryophyllus]
Length=281

 Score =   236 bits (602),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 115/223 (52%), Positives = 144/223 (65%), Gaps = 7/223 (3%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  M++KLVPG SAG+VT +YL S    + DE+DFEFLGNV G+ YTL TNVF  G
Sbjct  62   YLFGKIDMQIKLVPGNSAGSVTTYYL-SSLGPTHDEIDFEFLGNVTGEPYTLHTNVFAQG  120

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G REQ+  LWFDPT +FH Y+ILWN   IVF VD VP+R ++N   KGV++P  QP   
Sbjct  121  KGNREQQFHLWFDPTTEFHTYSILWNPQRIVFSVDGVPLREFKNMESKGVSFPKNQPMRV  180

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECR--ADGPSNWWNQ  406
              SLW+   WAT GGRVK DWSKAPF+ASFK Y  +ACVW    S C+  +   SNW  +
Sbjct  181  YSSLWNADDWATQGGRVKADWSKAPFVASFKKYNANACVWGSGSSTCKSGSRSRSNWLTE  240

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
            +    L        +WV K  + Y+YC D QRF   +P EC++
Sbjct  241  E----LDSAGLERMKWVQKNYMVYNYCADVQRFPQGLPTECTI  279



>gb|KHN22714.1| Putative xyloglucan endotransglucosylase/hydrolase protein 23 
[Glycine soja]
Length=287

 Score =   236 bits (602),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 128/271 (47%), Positives = 171/271 (63%), Gaps = 11/271 (4%)
 Frame = -3

Query  1083  VVSTGDFNQDFFVIYA-APGHINTSADGRstsltldtaaasssmstkdKYLFGQFVMKMK  907
             V + G+FNQDF + +      I  +A+           A+ S   +K++YLFG+  M++K
Sbjct  23    VCAAGNFNQDFQITWGDGRAKILNNAN---LLTLSLDKASGSGFQSKNEYLFGKIDMQLK  79

Query  906   LVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKIKLW  727
             LVPG SAGTVTA+YL S   ++ DE+DFEFLGN++GD Y L TNVF+ G G REQ+  LW
Sbjct  80    LVPGNSAGTVTAYYL-SSKGSTWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLW  138

Query  726   FDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGSSWA  547
             FDPT DFH Y+ILWN   IVF VD  PIR ++N    GV +P  QP     SLW+   WA
Sbjct  139   FDPTADFHTYSILWNPQRIVFSVDGTPIREFKNLESIGVPFPKRQPMRIYSSLWNADDWA  198

Query  546   TDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSN--WWNQDNYSTLTPIQR  373
             T GGR+K DWSKAPF AS++++  +ACVW    S C+++ PS+  W +Q+  ST    QR
Sbjct  199   TRGGRIKTDWSKAPFTASYRNFNANACVWNRGKSTCKSNSPSSNAWLSQELDSTAQ--QR  256

Query  372   GLYEWVMKYQITYDYCTDSQRFNGSIPLECS  280
                 WV K  + Y+YC+D  RF   +PLEC+
Sbjct  257   --LSWVQKNYMIYNYCSDKNRFAQGLPLECT  285



>dbj|BAJ10423.1| xyloglucan endotransglucosylase/hydrolase [Dianthus caryophyllus]
Length=281

 Score =   236 bits (602),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 115/223 (52%), Positives = 144/223 (65%), Gaps = 7/223 (3%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  M++KLVPG SAG+VT +YL S    + DE+DFEFLGNV G+ YTL TNVF  G
Sbjct  62   YLFGKIDMQIKLVPGNSAGSVTTYYL-SSLGPTHDEIDFEFLGNVTGEPYTLHTNVFAQG  120

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G REQ+  LWFDPT +FH Y+ILWN   IVF VD VP+R ++N   KGV++P  QP   
Sbjct  121  KGNREQQFHLWFDPTTEFHTYSILWNPQRIVFSVDGVPLREFKNMESKGVSFPKNQPMRV  180

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECR--ADGPSNWWNQ  406
              SLW+   WAT GGRVK DWSKAPF+ASFK Y  +ACVW    S C+  +   SNW  +
Sbjct  181  YSSLWNADDWATQGGRVKADWSKAPFVASFKKYNANACVWGSGSSTCKSGSRSRSNWLTE  240

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
            +    L        +WV K  + Y+YC D QRF   +P EC++
Sbjct  241  E----LDSAGLERMKWVQKNYMVYNYCADVQRFPQGLPTECTI  279



>gb|AEQ37177.1| xyloglucan endotransglucosylase/hydrolase [Diospyros kaki]
Length=293

 Score =   236 bits (603),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 122/261 (47%), Positives = 165/261 (63%), Gaps = 5/261 (2%)
 Frame = -3

Query  1065  FNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVMKMKLVPGYSA  886
             F QDF + +A   HI    DG      +    +    ++K KY+FG+  MK+KL+PG SA
Sbjct  34    FVQDFKITWAD-SHIR-QIDGGRAIQLILDRNSGCGFASKSKYMFGRVSMKIKLIPGDSA  91

Query  885   GTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKIKLWFDPTEDF  706
             GTVTAFY+ SD    RDE+DFEFLGN +G  YT+QTN++ +G G+REQ++ LWFDP  DF
Sbjct  92    GTVTAFYMNSDTDTVRDELDFEFLGNRSGQPYTVQTNMYAHGKGDREQRVNLWFDPATDF  151

Query  705   HNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGSSWATDGGRVK  526
             H Y+ILWN +H+VF VD VPIR Y+N+  +G+ YP  QP     +LW+   WAT GG  K
Sbjct  152   HTYSILWNHHHVVFYVDEVPIRVYKNNEARGIPYPKVQPMGVYSTLWEADDWATRGGLEK  211

Query  525   IDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQRGLYEWVMKY  346
             IDWSKAPF A +KD+ I+ C   G P  C ++ P NWW   ++  L+ ++   Y WV   
Sbjct  212   IDWSKAPFYAYYKDFDIEGCPVPG-PGSCPSN-PGNWWEGASWQELSAVEARRYRWVRMN  269

Query  345   QITYDYCTDSQRFNGSIPLEC  283
              + YDYC+D  R+  + P EC
Sbjct  270   HMIYDYCSDKSRYPVT-PPEC  289



>ref|XP_010915887.1| PREDICTED: LOW QUALITY PROTEIN: probable xyloglucan endotransglucosylase/hydrolase 
protein 26 [Elaeis guineensis]
Length=313

 Score =   237 bits (605),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/226 (50%), Positives = 145/226 (64%), Gaps = 3/226 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            +LFG   M++KLVPG SAGTVTA+Y MS      DE+DFEFLGN++G  Y + TNVFT G
Sbjct  89   FLFGSIEMQIKLVPGNSAGTVTAYY-MSSTGTKHDEIDFEFLGNLSGQPYIIHTNVFTQG  147

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G REQ+   WFDPT DFHNYTI WN   IV  VD +PIR +RN+    + +P  Q   A
Sbjct  148  VGNREQQFYPWFDPTSDFHNYTIHWNPSQIVCFVDGLPIRVFRNYEKIRIPFPNKQAMTA  207

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKG--DPSECRADGPSNWWNQ  406
              SLW+  +WAT GG +KIDWS APFIA +++  + AC W G    S+C    P+ WW  
Sbjct  208  YSSLWNADNWATRGGLIKIDWSNAPFIARYRELRLRACTWTGPNSISQCAQTTPAKWWTS  267

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              YS L  +Q+G   WV +  + YDYC D+++F G +  ECSLP++
Sbjct  268  PAYSELNDMQKGQLNWVRQNFMIYDYCKDAKKFKGQVHPECSLPQF  313



>ref|XP_008458951.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 7 [Cucumis melo]
Length=296

 Score =   236 bits (603),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 127/277 (46%), Positives = 170/277 (61%), Gaps = 8/277 (3%)
 Frame = -3

Query  1098  VSLASVVSTGD---FNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFG  928
             V+L  VV +G    F +DF V +A   H+    DG      +   ++    +++ +YLFG
Sbjct  22    VALCMVVVSGRPATFLEDFRVTWAD-NHVR-QLDGGRGIQLVLDQSSGCGFASRRQYLFG  79

Query  927   QFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGER  748
             +  MK+KLVPG SAGTVTAFY+ SD    RDE+DFEFLGN +G  YT+QTN++ +G G+R
Sbjct  80    KVSMKIKLVPGDSAGTVTAFYMNSDTDTIRDELDFEFLGNRSGQPYTVQTNIYAHGKGDR  139

Query  747   EQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISL  568
             EQ++ LWFDP  DFH Y+I+W    I+F VD +PIR Y+N   KG+ YP  QP     +L
Sbjct  140   EQRVNLWFDPAADFHTYSIMWTHSLIIFGVDDIPIRVYKNQEAKGIPYPKQQPMGIYSTL  199

Query  567   WDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTL  388
             W+   WAT GG  KIDW KAPF A +KD+ I+ C   G P+ C  + P+NWW    Y  L
Sbjct  200   WEADDWATRGGLEKIDWKKAPFYAYYKDFDIEGCPVPG-PANCPWN-PNNWWEGPAYRAL  257

Query  387   TPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
             +P Q   Y+WV    + YDYCTD  R+  + P EC L
Sbjct  258   SPAQAKNYQWVKANHMIYDYCTDKSRYPQTPP-ECGL  293



>ref|NP_001242530.1| uncharacterized protein LOC100785313 precursor [Glycine max]
 gb|ACU21249.1| unknown [Glycine max]
Length=287

 Score =   236 bits (602),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 128/271 (47%), Positives = 171/271 (63%), Gaps = 11/271 (4%)
 Frame = -3

Query  1083  VVSTGDFNQDFFVIYA-APGHINTSADGRstsltldtaaasssmstkdKYLFGQFVMKMK  907
             V + G+FNQDF + +      I  +A+           A+ S   +K++YLFG+  M++K
Sbjct  23    VCAAGNFNQDFQITWGDGRAKILNNAN---LLTLSLDKASGSGFQSKNEYLFGKIDMQLK  79

Query  906   LVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKIKLW  727
             LVPG SAGTVTA+YL S   ++ DE+DFEFLGN++GD Y L TNVF+ G G REQ+  LW
Sbjct  80    LVPGNSAGTVTAYYL-SSKGSTWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLW  138

Query  726   FDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGSSWA  547
             FDPT DFH Y+ILWN   IVF VD  PIR ++N    GV +P  QP     SLW+   WA
Sbjct  139   FDPTADFHTYSILWNPQRIVFSVDGTPIREFKNLESIGVPFPKRQPMRIYSSLWNADDWA  198

Query  546   TDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSN--WWNQDNYSTLTPIQR  373
             T GGR+K DWSKAPF AS++++  +ACVW    S C+++ PS+  W +Q+  ST    QR
Sbjct  199   TRGGRIKTDWSKAPFTASYRNFNANACVWNRGKSTCKSNSPSSNAWLSQELDSTAQ--QR  256

Query  372   GLYEWVMKYQITYDYCTDSQRFNGSIPLECS  280
                 WV K  + Y+YC+D  RF   +PLEC+
Sbjct  257   --LSWVQKNYMIYNYCSDKNRFAQGLPLECT  285



>ref|XP_010677534.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6 [Beta vulgaris subsp. vulgaris]
Length=292

 Score =   236 bits (602),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 143/219 (65%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YL G+  MK+KLVPG SAGTVTAFY+ SD    RDE+DFEFLGN  G  YT+QTN++ +G
Sbjct  75   YLHGRVSMKLKLVPGDSAGTVTAFYMNSDTDKIRDELDFEFLGNRTGQPYTVQTNIYAHG  134

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP+ D+H YTILWN  H VF VD VPIR Y+N+  +G+ YP  QP   
Sbjct  135  KGDREQRVNLWFDPSADYHTYTILWNHNHTVFYVDEVPIRVYKNNEARGIPYPKVQPMGV  194

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDWSKAPF A +KD+ I+ C   G P+ C A  P N W    
Sbjct  195  FSTLWEADDWATRGGLEKIDWSKAPFYAYYKDFEIEGCPVPG-PASC-ASNPRNQWEGVA  252

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L+P Q  L+ WV    + YDYC D  RF  + P EC
Sbjct  253  YQGLSPTQARLHRWVRLNHMIYDYCNDKSRFTVTPP-EC  290



>gb|ADO24303.1| putative xyloglucan endotransglucosylase/hydrolase [Gossypium 
hirsutum]
Length=289

 Score =   236 bits (602),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 146/219 (67%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KL+PG +AGTVTAFY+ SD    RDE+DFEFLGN +G  YT+QTN++ +G
Sbjct  70   YLFGRVSMKIKLIPGDAAGTVTAFYMNSDTDTVRDELDFEFLGNRSGQPYTVQTNIYAHG  129

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP+ DFH YTI+WN +HIVF VD VPIR Y+N+  + + +P  QP   
Sbjct  130  KGDREQRVNLWFDPSADFHTYTIMWNHHHIVFYVDDVPIRVYKNNEARNIPFPKFQPMGV  189

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDWSKAPF+A +KD+ I+ C   G P+ C A    +WW    
Sbjct  190  YSTLWEADDWATRGGLEKIDWSKAPFLAYYKDFDIEGCPVPG-PASC-ASNTGSWWEGST  247

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L  ++   Y WV    + YDYCTD  R+   IP EC
Sbjct  248  YQALNAMEARRYRWVRMNHMIYDYCTDKSRY-PVIPPEC  285



>ref|XP_006474161.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like [Citrus sinensis]
 gb|KDO46536.1| hypothetical protein CISIN_1g023337mg [Citrus sinensis]
Length=283

 Score =   236 bits (601),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 148/221 (67%), Gaps = 5/221 (2%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  M++KLVPG SAGTVTA+YL S P ++ DE+DFEFLGN++GD YTL TNVFTNG
Sbjct  66   YLFGKIDMQLKLVPGNSAGTVTAYYLKS-PGSTWDEIDFEFLGNLSGDPYTLHTNVFTNG  124

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ+  LWFDPT DFH Y++LWN   IVF VD  PIR ++N    GV +P  QP   
Sbjct  125  KGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRI  184

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              SLW+   WAT GG +K DW++APF AS++++  +ACVW    S C +   + W++Q+ 
Sbjct  185  YSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANACVWSNGKSSCNSKNNNPWFSQE-  243

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
               L    +   +WV K  + Y+YC DS+RF   +P EC+ 
Sbjct  244  ---LDATGQERLKWVQKNYMIYNYCKDSKRFPQGLPKECAF  281



>ref|XP_003517063.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 26 [Glycine max]
 gb|KHN13138.1| Putative xyloglucan endotransglucosylase/hydrolase protein 26 
[Glycine soja]
Length=289

 Score =   236 bits (602),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 143/221 (65%), Gaps = 3/221 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            +LFG    ++KLVPG SAGTVTA+YL S   +  DE+DFEFLGN++G  Y + TN++T G
Sbjct  65   FLFGSIESRIKLVPGNSAGTVTAYYL-SSTGSQHDEIDFEFLGNISGQPYIVHTNIYTQG  123

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G REQ+  LWFDPT DFHNYTI WN   +V+ +DS+PIR YRN+ ++G+AYP  Q    
Sbjct  124  NGSREQQFYLWFDPTADFHNYTIHWNPIEVVWYIDSIPIRAYRNYENEGIAYPNKQGMRV  183

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPS--ECRADGPSNWWNQ  406
              SLW+   WAT GG VK +WS APFIA F  +   AC W G  S  +C  + P+NWW  
Sbjct  184  YTSLWNADDWATRGGLVKTNWSGAPFIARFNHFRARACKWNGAVSINQCALNFPANWWTS  243

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
              Y  L+  + G   WV    + YDYC D++RFNG +P EC
Sbjct  244  PTYKQLSYAKLGQMNWVRNNYMIYDYCRDTKRFNGRMPPEC  284



>ref|XP_008344370.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6 [Malus domestica]
Length=294

 Score =   236 bits (602),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 126/262 (48%), Positives = 163/262 (62%), Gaps = 5/262 (2%)
 Frame = -3

Query  1065  FNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVMKMKLVPGYSA  886
             F QDF V ++   HI    DG      +    +    ++K KYLFG+  MK+KL+PG SA
Sbjct  35    FLQDFRVTWS-DSHIR-QIDGXRAIQLVLDQNSGCGFASKQKYLFGRVSMKIKLIPGDSA  92

Query  885   GTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKIKLWFDPTEDF  706
             GTVTAFY+ SD    RDE+DFEFLGN  G  YT+QTN++  G G+REQ++ LWFDP  DF
Sbjct  93    GTVTAFYMNSDTBTVRDELDFEFLGNRTGQPYTVQTNIYAXGKGDREQRVNLWFDPAADF  152

Query  705   HNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGSSWATDGGRVK  526
             H YTILWN +HIVF VD +PIR Y+N+  KGV YP  QP     +LW+   WAT GG  K
Sbjct  153   HTYTILWNHHHIVFYVDDMPIRVYKNNEAKGVPYPKLQPMGVFSTLWEADDWATRGGLEK  212

Query  525   IDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQRGLYEWVMKY  346
             I+WSKAPF + +KD+ I+ C   G P+ C A   +NWW   +Y  L+ +    Y WV   
Sbjct  213   INWSKAPFFSYYKDFDIEGCSVPG-PASC-ASSTNNWWEGASYQALSALDYRRYRWVRIN  270

Query  345   QITYDYCTDSQRFNGSIPLECS  280
              + YDYCTD  R+  + P EC+
Sbjct  271   HMIYDYCTDRSRYPVAPP-ECT  291



>ref|XP_002324432.1| xyloglucan endotransglycosylase family protein [Populus trichocarpa]
 gb|EEF02997.1| xyloglucan endotransglycosylase family protein [Populus trichocarpa]
Length=291

 Score =   236 bits (602),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 112/221 (51%), Positives = 147/221 (67%), Gaps = 3/221 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            +LFG   M +KLVPG SAGTVTA+Y+ S      DE+DFEFLGN +G  YT+ TN++T G
Sbjct  67   FLFGSIQMLIKLVPGNSAGTVTAYYV-SSSGDRHDEIDFEFLGNTSGQPYTIHTNIYTQG  125

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G REQ+ + WFDPT DFHNYTI WN   +V+ +D+VPIR YRN+ ++G+AYP  Q    
Sbjct  126  NGSREQQFRPWFDPTADFHNYTIHWNPTEVVWYIDNVPIRVYRNYENEGIAYPNKQGMRV  185

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPS--ECRADGPSNWWNQ  406
              SLW+  +WAT GGRVKIDW+ APFIA ++++   AC W G  S  +C A  P+NWW  
Sbjct  186  YSSLWNADNWATQGGRVKIDWTVAPFIARYRNFRARACKWNGPVSINQCAAKTPANWWTS  245

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
              YS L+  Q    + V    + Y+YC D++RFNG +P EC
Sbjct  246  PAYSKLSNAQLDQMKRVRDNYMIYNYCNDTKRFNGQMPPEC  286



>ref|XP_003534215.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 26-like [Glycine max]
Length=289

 Score =   236 bits (601),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 143/221 (65%), Gaps = 3/221 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            +LFG    ++KLVPG SAGTVTA+YL S   +  DE+DFEFLGN++G  Y + TN++T G
Sbjct  65   FLFGSIESRIKLVPGNSAGTVTAYYL-SSTGSQHDEIDFEFLGNISGQPYIVHTNIYTQG  123

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G REQ+  LWFDPT DFHNYTI WN   +V+ +DS+PIR YRN+ ++G+AYP  Q    
Sbjct  124  NGSREQQFYLWFDPTSDFHNYTIHWNPIEVVWYIDSIPIRVYRNYENEGIAYPNKQGMRV  183

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPS--ECRADGPSNWWNQ  406
              SLW+   WAT GG VK +WS APFIA F  +   AC W G  S  +C  + P+NWW  
Sbjct  184  YTSLWNADDWATRGGLVKTNWSGAPFIARFNHFRARACKWNGAVSINQCALNFPANWWTS  243

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
              Y  L+  + G   WV    + YDYC D++RFNG +P EC
Sbjct  244  PTYKQLSYAKLGQMNWVRNNYMIYDYCRDTKRFNGMMPPEC  284



>ref|XP_008799496.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Phoenix dactylifera]
Length=306

 Score =   236 bits (603),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 128/283 (45%), Positives = 171/283 (60%), Gaps = 22/283 (8%)
 Frame = -3

Query  1080  VSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVMKMKLV  901
              S G+F+QDF + +   G      +G+  +L+LD A+ S   S  + YLFG+  M+++LV
Sbjct  16    ASAGNFHQDFQITWG-DGRAQILENGQLLTLSLDKASGSGFQSKNE-YLFGKIDMQLRLV  73

Query  900   PGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKIKLWFD  721
             PG SAGTVTA+YL S    + DE+DFEFLGN++GD YTL TNVF  G G RE +  LWFD
Sbjct  74    PGNSAGTVTAYYL-SSQGPTHDEIDFEFLGNLSGDPYTLHTNVFGQGKGNREMQFHLWFD  132

Query  720   PTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGSSWATD  541
             PT+DFH Y+ILWN  HI+FMVD +PIR ++N    GVA+P  QP     SLW+   WAT 
Sbjct  133   PTKDFHTYSILWNPKHIIFMVDDIPIRDFKNMESSGVAFPGNQPMRIYSSLWNADDWATQ  192

Query  540   GGRVKIDWSKAPFIASFKDYTIDACVWKGDPSEC---------------RADGPSNWWNQ  406
             GGR+K DW+ APF AS++++  DAC+W  + + C                    S+WWNQ
Sbjct  193   GGRIKTDWTNAPFTASYRNFNADACIWDFNANACTWSSSNSNCSSNKSSTGSASSDWWNQ  252

Query  405   DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
             +    L    R    WV K  + Y+YC D + F   +PLECSL
Sbjct  253   E----LDITSRERMSWVKKNYMVYNYCADLKLFPQGLPLECSL  291



>ref|XP_009390698.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 26 [Musa acuminata subsp. malaccensis]
Length=294

 Score =   236 bits (602),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 114/226 (50%), Positives = 148/226 (65%), Gaps = 3/226 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG   +++KLV G SAGTVTA+YL S      DE+DFEFLGN  G  Y + TN+FT G
Sbjct  70   YLFGSIEVQIKLVKGNSAGTVTAYYL-SSTGDKHDEIDFEFLGNETGQPYIIHTNIFTQG  128

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G RE++   WFDP++DFHNYTI WN   +V+ VD +PIR +RN+   GV +P  Q   A
Sbjct  129  VGNREEQFYPWFDPSDDFHNYTIHWNPSQVVWFVDGIPIRVFRNYESSGVPFPNRQAMRA  188

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPS--ECRADGPSNWWNQ  406
              S+W+   WAT GG VKIDW+ APF+A ++   + AC W G  S  EC A  P+NWW  
Sbjct  189  YSSIWEADEWATRGGLVKIDWNSAPFVAYYQYLQLRACPWYGPSSSGECSAASPANWWTS  248

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              YSTLT  ++G  +W     + YDYC D++RF+G++P ECSLPKY
Sbjct  249  PEYSTLTYQEQGQMKWARDNFMIYDYCKDTERFDGAMPPECSLPKY  294



>gb|KDO66473.1| hypothetical protein CISIN_1g040673mg [Citrus sinensis]
Length=291

 Score =   236 bits (601),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 114/226 (50%), Positives = 148/226 (65%), Gaps = 3/226 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            +LFG   M +KLVPG SAGTVTA+YL S   +  DE+DFEFLGNV+G  Y + TN++T G
Sbjct  67   FLFGSIEMLIKLVPGNSAGTVTAYYLTSS-GSQHDEIDFEFLGNVSGQPYIIHTNIYTQG  125

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ+  LWFDPT D+HNYTI WN   +V+ VDSVPIR +RN+  +G+AYP  Q    
Sbjct  126  KGDREQQFYLWFDPTADYHNYTIHWNPTEVVWYVDSVPIRVFRNYEKEGIAYPNKQGMRT  185

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKG--DPSECRADGPSNWWNQ  406
             +S+W+  +WAT GG  KIDWS APFIA  + +   AC W G    S C    P NWW  
Sbjct  186  HVSIWNADNWATRGGLDKIDWSNAPFIARLRRFRARACKWNGPVSISRCATKTPGNWWTS  245

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              YS L+  + G  +WV +  + Y+YC D++RFNG +  ECS P+Y
Sbjct  246  PTYSQLSSARMGQLKWVREKYMIYNYCKDTKRFNGKMAPECSKPQY  291



>ref|XP_002961354.1| hypothetical protein SELMODRAFT_140273 [Selaginella moellendorffii]
 gb|EFJ36614.1| hypothetical protein SELMODRAFT_140273 [Selaginella moellendorffii]
Length=278

 Score =   235 bits (600),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 167/268 (62%), Gaps = 17/268 (6%)
 Frame = -3

Query  1050  FVIYAAPGHIN---------TSADGRstsltldtaaasssmstkdKYLFGQFVMKMKLVP  898
              V  AAPG+ N            DG      +    +++  ++K+KYLFG+  M++KLVP
Sbjct  15    IVSQAAPGNFNDLFTSNNDHVKVDGSGQVRLVLDHQSAAGFASKNKYLFGRVSMQIKLVP  74

Query  897   GYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKIKLWFDP  718
             G SAGTV A+Y+ SD   +RDE+D EFLGN +G+ Y LQTNV+ NG G REQ++ LWFDP
Sbjct  75    GDSAGTVAAYYMSSDDYRTRDEIDLEFLGNTSGNPYILQTNVYANGVGNREQRVYLWFDP  134

Query  717   TEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGSSWATDG  538
             T DFH+Y+ILWN   IVF VDS PIR ++N+ D G+ +P  Q      SLW+   WAT G
Sbjct  135   TADFHSYSILWNQKQIVFFVDSTPIRVFKNNQDMGLPFPTKQSMGVYSSLWNADDWATRG  194

Query  537   GRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSN--WWNQDNYSTLTPIQRGLY  364
             G VK DWS APFIAS+K++ +DAC  +     C   GP++  WW+   +  L+P   G  
Sbjct  195   GLVKTDWSHAPFIASYKNFDLDAC--QASSGSC---GPNSGKWWDSSAWQALSPSDAGKL  249

Query  363   EWVMKYQITYDYCTDSQRFNGSIPLECS  280
             +WV K  + Y+YCTDS RF  S P EC+
Sbjct  250   KWVKKNYMIYNYCTDSARF-PSRPAECA  276



>ref|XP_010911439.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Elaeis guineensis]
Length=281

 Score =   235 bits (600),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 116/224 (52%), Positives = 147/224 (66%), Gaps = 9/224 (4%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  M++KLVPG SAGTVTA+YL S    + DE+DFEFLGN++GD YTL TNVF+ G
Sbjct  61   YLFGKIDMQLKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQG  119

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G RE +  LWFDPT+DFH Y+ILWN  HI+FMVD +PIR ++N   +GVA+P  QP   
Sbjct  120  KGNREMQFHLWFDPTKDFHTYSILWNPKHIIFMVDGIPIRDFKNMESRGVAFPRNQPMRI  179

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSEC----RADGPSNWW  412
              SLW+   WAT GGR+K DW+ APF AS++++  DAC+W    S C     A   S+WW
Sbjct  180  YSSLWNADDWATQGGRIKTDWTNAPFTASYRNFNADACIWSSGTSNCPSTSTASASSDWW  239

Query  411  NQDNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECS  280
            NQ+  ST     R    WV    + Y+YC D +RF    P ECS
Sbjct  240  NQELDSTSQERMR----WVQTNYMIYNYCADLKRFPQGPPPECS  279



>gb|AGI42460.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   235 bits (600),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 113/223 (51%), Positives = 147/223 (66%), Gaps = 7/223 (3%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  M++KLVPG SAGTVTA+YL S    + DE+DFEFLGN++GD YTL TNVF+ G
Sbjct  67   YLFGKIDMQLKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQG  125

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G REQ+  LWFDPT DFH Y+ILWN   I+F VD+ PIR ++N    GVAYP  Q    
Sbjct  126  KGGREQQFHLWFDPTADFHTYSILWNPQRIIFSVDNAPIREFKNAESVGVAYPKNQAMRI  185

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSN--WWNQ  406
              SLW+   WAT GG +K DWSKAPF AS++++   AC+W    S C ++ PSN  W N+
Sbjct  186  YSSLWNADDWATRGGLIKTDWSKAPFTASYRNFNAKACIWSSGRSSCNSNAPSNNAWLNE  245

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
            +    L    +   +WV K  + Y+YCTD++RF    P EC++
Sbjct  246  E----LDATSQQRLQWVQKNYMIYNYCTDAKRFPQGYPPECAI  284



>gb|AGI42451.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
 gb|AGI42453.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
 gb|AGI42462.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   235 bits (600),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 113/223 (51%), Positives = 147/223 (66%), Gaps = 7/223 (3%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  M++KLVPG SAGTVTA+YL S    + DE+DFEFLGN++GD YTL TNVF+ G
Sbjct  67   YLFGKIDMQLKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQG  125

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G REQ+  LWFDPT DFH Y+ILWN   I+F VD+ PIR ++N    GVAYP  Q    
Sbjct  126  KGGREQQFHLWFDPTADFHTYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRI  185

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSN--WWNQ  406
              SLW+   WAT GG +K DWSKAPF AS++++   AC+W    S C ++ PSN  W N+
Sbjct  186  YSSLWNADDWATRGGLIKTDWSKAPFTASYRNFNAKACIWSSGRSSCNSNAPSNNAWLNE  245

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
            +    L    +   +WV K  + Y+YCTD++RF    P EC++
Sbjct  246  E----LDATSQQRLQWVQKNYMIYNYCTDAKRFPQGYPPECAI  284



>emb|CDP02962.1| unnamed protein product [Coffea canephora]
Length=294

 Score =   236 bits (601),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 123/267 (46%), Positives = 169/267 (63%), Gaps = 7/267 (3%)
 Frame = -3

Query  1080  VSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVMKMKLV  901
             +  G+F+QDF V +   G   T  +G+  +L+LD A+ S   S  + YLFG+  M++KLV
Sbjct  29    ILAGNFDQDFAVTWG-DGRAKTLNNGKLLTLSLDKASGSGVQSKNE-YLFGRIDMQLKLV  86

Query  900   PGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKIKLWFD  721
             PG SAGTVT +YL S P ++RDE+DFEFLGN++GD Y + TNV+  G G++EQ+   WFD
Sbjct  87    PGNSAGTVTTYYL-SSPGSTRDEIDFEFLGNLSGDPYIVHTNVYAQGKGDKEQQFYAWFD  145

Query  720   PTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGSSWATD  541
             PT DFH Y+ILWN   I+F VD  PIR Y+N   +G+ YP  QP     SLWD   WAT 
Sbjct  146   PTADFHTYSILWNPRSILFYVDGTPIRVYKNLEARGIPYPKNQPMKVYASLWDAEDWATR  205

Query  540   GGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQRGLYE  361
             GG VK DWS++PF AS +D+  DACVW    S C ++    W++Q+    L    +   +
Sbjct  206   GGLVKTDWSQSPFTASLRDFKADACVWSSGRSSCGSNSTKPWFSQE----LDATSQARLK  261

Query  360   WVMKYQITYDYCTDSQRFNGSIPLECS  280
             WV +  + Y+YCTD++RF    P EC+
Sbjct  262   WVQQNYMIYNYCTDAKRFPQGFPPECT  288



>ref|XP_001752377.1| predicted protein [Physcomitrella patens]
 gb|EDQ82616.1| predicted protein [Physcomitrella patens]
Length=275

 Score =   235 bits (599),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 147/221 (67%), Gaps = 3/221 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG   M +KLVPG SAGTVTA+YL S    + DE+DFEFLGNV+G  Y+LQTNV+ NG
Sbjct  51   YLFGNITMMIKLVPGDSAGTVTAYYL-SSAQPNHDELDFEFLGNVSGQPYSLQTNVYANG  109

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G REQ+I LWFDPT D+H+Y +LWN   I+F VD+ PIR ++N+ D G+AYP  +P   
Sbjct  110  IGRREQRISLWFDPTTDYHSYGVLWNRKQIIFTVDNKPIRLFKNNEDVGIAYPNSKPMGL  169

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDY-TIDACVWKGDPSECRADGPSNWWNQD  403
              SLW+G SWAT  G VK +W+ APFI SF+D+ T+D CV   D + C    P++WW   
Sbjct  170  YASLWNGDSWATQNGWVKTNWTHAPFIVSFRDFSTLDGCVVTNDINPCTQVTPTHWWEAS  229

Query  402  NYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECS  280
             Y T+   Q     WV    + YDYCTD+ RF  S P+ECS
Sbjct  230  AYQTIDHNQAEQLLWVKNNYMIYDYCTDTSRF-PSPPVECS  269



>gb|AFP93557.1| xyloglucan endotransglycosylase/hydrolase 1 [Neolamarckia cadamba]
 gb|AGI42455.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
 gb|AGI42463.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/223 (51%), Positives = 147/223 (66%), Gaps = 7/223 (3%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  M++KLVPG SAGTVTA+YL S    + DE+DFEFLGN++GD YTL TNVF+ G
Sbjct  67   YLFGKIDMQLKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQG  125

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G REQ+  LWFDPT DFH Y+ILWN   I+F VD+ PIR ++N    GVAYP  Q    
Sbjct  126  KGGREQQFHLWFDPTADFHTYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRI  185

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSN--WWNQ  406
              SLW+   WAT GG +K DWSKAPF AS++++   AC+W    S C ++ PSN  W N+
Sbjct  186  YSSLWNADDWATRGGLIKTDWSKAPFTASYRNFNAKACIWSSGRSSCNSNAPSNNAWLNE  245

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
            +    L    +   +WV K  + Y+YCTD++RF    P EC++
Sbjct  246  E----LDATSQQRLQWVQKNYMIYNYCTDAKRFPQGYPPECAI  284



>ref|XP_009338970.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6 [Pyrus x bretschneideri]
Length=294

 Score =   236 bits (601),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/220 (52%), Positives = 147/220 (67%), Gaps = 3/220 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KL+PG SAGTVTAFY+ SD    RDE+DFEFLGN  G  YT+QTN++ +G
Sbjct  75   YLFGRVSMKIKLIPGDSAGTVTAFYMNSDTDTVRDELDFEFLGNRTGQPYTVQTNIYAHG  134

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP  DFH YTILWN +HIVF VD +PIR Y+N+  +GV YP  QP   
Sbjct  135  KGDREQRVNLWFDPAADFHTYTILWNHHHIVFYVDDMPIRVYKNNEARGVPYPKLQPMGV  194

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KI+WSKAPF + +KD+ I+ C   G P+ C A   +NWW   +
Sbjct  195  FSTLWEADDWATRGGLEKINWSKAPFYSYYKDFDIEGCSVPG-PASC-ASSTNNWWEGAS  252

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECS  280
            Y  L+ +    Y WV    + YDYCTD  R+  + P EC+
Sbjct  253  YQALSALDYRRYRWVRINHMIYDYCTDRSRYPVAPP-ECT  291



>ref|NP_001130486.1| xyloglucan endotransglucosylase/hydrolase protein 23 precursor 
[Zea mays]
 gb|ACF78719.1| unknown [Zea mays]
 gb|ACN27756.1| unknown [Zea mays]
 gb|AFW69280.1| xyloglucan endotransglucosylase/hydrolase protein 23 [Zea mays]
Length=298

 Score =   236 bits (601),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/235 (51%), Positives = 152/235 (65%), Gaps = 19/235 (8%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  M+++LVPG SAGTVTA+YL S   A  DE+DFEFLGNV+G+ YTL TNVFT G
Sbjct  68   YLFGKIDMQLRLVPGNSAGTVTAYYLSSQGGA-HDEIDFEFLGNVSGEPYTLHTNVFTRG  126

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ+ +LWFDPT DFH Y+ILWN  H++FMVD +PIR +RN   KGVA+P  QP   
Sbjct  127  QGQREQQFRLWFDPTADFHTYSILWNPKHVIFMVDDMPIRDFRNLESKGVAFPKSQPMRL  186

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVW-KGDPSECRA----------  433
              SLW+   WAT GGRVK DWS APF AS++ +  DACV   G  + C A          
Sbjct  187  YSSLWNADDWATQGGRVKTDWSHAPFSASYRGFKADACVAVAGGRTRCGATVGTEGTGAP  246

Query  432  ---DGPSNWWNQDNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
                G  +W+NQ+   TL    R    WV +  + Y+YCTD +R+   +P ECS+
Sbjct  247  ASAAGAGDWYNQELDLTLQQRMR----WVQRKYMIYNYCTDPKRYQQGLPAECSM  297



>gb|AGI42452.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/223 (51%), Positives = 147/223 (66%), Gaps = 7/223 (3%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  M++KLVPG SAGTVTA+YL S    + DE+DFEFLGN++GD YTL TNVF+ G
Sbjct  67   YLFGKIDMQLKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQG  125

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G REQ+  LWFDPT DFH Y+ILWN   I+F VD+ PIR ++N    GVAYP  Q    
Sbjct  126  KGGREQQFHLWFDPTADFHTYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKSQAMRI  185

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSN--WWNQ  406
              SLW+   WAT GG +K DWSKAPF AS++++   AC+W    S C ++ PSN  W N+
Sbjct  186  YSSLWNADDWATRGGLIKTDWSKAPFTASYRNFNAKACIWSSGRSSCNSNAPSNNAWLNE  245

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
            +    L    +   +WV K  + Y+YCTD++RF    P EC++
Sbjct  246  E----LDATSQQRLQWVQKNYMIYNYCTDAKRFPQGYPPECAI  284



>ref|XP_006280895.1| hypothetical protein CARUB_v10026888mg [Capsella rubella]
 gb|EOA13793.1| hypothetical protein CARUB_v10026888mg [Capsella rubella]
Length=293

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 145/219 (66%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KL+PG SAGTVTAFY+ SD    RDE+DFEFLGN +G  Y++QTN+F +G
Sbjct  76   YLFGRVSMKIKLIPGDSAGTVTAFYMNSDTNTVRDELDFEFLGNRSGQPYSVQTNIFAHG  135

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP  DFH YTILW+  HIVF VD VPIR Y+N+  K +AYP  QP   
Sbjct  136  KGDREQRVNLWFDPALDFHTYTILWSHKHIVFYVDDVPIREYKNNEAKKIAYPTSQPMGV  195

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDW+KAPF A +KD+ I+ C   G P+ C ++   NWW    
Sbjct  196  YSTLWEADDWATRGGLEKIDWNKAPFYAYYKDFDIEGCPVPG-PASCPSNT-HNWWEGFA  253

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y +L  ++   Y WV    + YDYCTD  RF    P EC
Sbjct  254  YHSLNAVEARRYRWVRVNHMVYDYCTDKSRFPVP-PPEC  291



>gb|AGI42459.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/223 (51%), Positives = 147/223 (66%), Gaps = 7/223 (3%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  M++KLVPG SAGTVTA+YL S    + DE+DFEFLGN++GD YTL TNVF+ G
Sbjct  67   YLFGKIDMQLKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQG  125

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G REQ+  LWFDPT DFH Y+ILWN   I+F VD+ PIR ++N    GVAYP  Q    
Sbjct  126  KGGREQQFHLWFDPTADFHTYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRI  185

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSN--WWNQ  406
              SLW+   WAT GG +K DWSKAPF AS++++   AC+W    S C ++ PSN  W N+
Sbjct  186  YSSLWNADDWATRGGLIKTDWSKAPFTASYRNFNARACIWSSGRSSCNSNAPSNNAWLNE  245

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
            +    L    +   +WV K  + Y+YCTD++RF    P EC++
Sbjct  246  E----LDATSQQRLQWVQKNYMIYNYCTDAKRFPQGYPPECAI  284



>pdb|1UMZ|A Chain A, Xyloglucan Endotransglycosylase In Complex With The 
Xyloglucan Nonasaccharide Xllg.
 pdb|1UMZ|B Chain B, Xyloglucan Endotransglycosylase In Complex With The 
Xyloglucan Nonasaccharide Xllg.
 pdb|1UN1|A Chain A, Xyloglucan Endotransglycosylase Native Structure.
 pdb|1UN1|B Chain B, Xyloglucan Endotransglycosylase Native Structure.
Length=278

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/220 (53%), Positives = 143/220 (65%), Gaps = 3/220 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG F M+MKLVPG SAGTVTAFYL S   +  DE+DFEFLGN  G  Y LQTNVFT G
Sbjct  57   YLFGHFSMQMKLVPGDSAGTVTAFYL-SSQNSEHDEIDFEFLGNRTGQPYILQTNVFTGG  115

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ+I LWFDPT++FH Y++LWN+Y IVF+VD VPIR ++N  D GV +P  QP   
Sbjct  116  KGDREQRIYLWFDPTKEFHYYSVLWNMYMIVFLVDDVPIRVFKNCKDLGVKFPFNQPMKI  175

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              SLW+   WAT GG  K DWSKAPFIAS++ + ID C    +   C   G + WW+Q  
Sbjct  176  YSSLWNADDWATRGGLEKTDWSKAPFIASYRSFHIDGCEASVEAKFCATQG-ARWWDQKE  234

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECS  280
            +  L   Q     WV +    Y+YCTD  R+  S+P EC 
Sbjct  235  FQDLDAFQYRRLSWVRQKYTIYNYCTDRSRY-PSMPPECK  273



>dbj|BAO57277.1| xyloglucan endotransglucosylase/hydrolase [Ipomoea nil]
Length=292

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 131/270 (49%), Positives = 166/270 (61%), Gaps = 5/270 (2%)
 Frame = -3

Query  1092  LASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVMK  913
             L+       F QDF V YA   H+  +  GR+  L LD ++ S   S    YL GQF MK
Sbjct  24    LSVTARPATFLQDFKVFYAD-YHVKQAEGGRAIQLVLDQSSGSGFGSRYK-YLNGQFSMK  81

Query  912   MKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKIK  733
             +KLVPG SAGTVTAFYL SD    RDE+DFEFLGN +G  YT+QTNV+ +G G+RE++I 
Sbjct  82    IKLVPGDSAGTVTAFYLNSDTGNVRDELDFEFLGNRSGQPYTVQTNVYVHGKGDREERIN  141

Query  732   LWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGSS  553
             LWFDP+ D+H Y +LWN +H VF VD +PIR ++N+  KG+ Y   QP     +LW+   
Sbjct  142   LWFDPSLDYHTYKVLWNHHHCVFYVDEIPIRVFKNNEAKGLPYLKYQPMVIYSTLWEADD  201

Query  552   WATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQR  373
             WAT GG  KIDWSKAPF A +KD+ I+ C   G P EC ++ P NWW    Y  L+  + 
Sbjct  202   WATRGGLEKIDWSKAPFNAYYKDFDIEGCPVPG-PKECSSN-PRNWWEGAAYQQLSADEA  259

Query  372   GLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
               Y WV    + YDYCTD  R+    P EC
Sbjct  260   RRYRWVRMNHMVYDYCTDKARYPVPPP-EC  288



>gb|AGI42456.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/223 (51%), Positives = 147/223 (66%), Gaps = 7/223 (3%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  M++KLVPG SAGTVTA+YL S    + DE+DFEFLGN++GD YTL TNVF+ G
Sbjct  67   YLFGKIDMQLKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQG  125

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G REQ+  LWFDPT DFH Y+ILWN   I+F VD+ PIR ++N    GVAYP  Q    
Sbjct  126  KGGREQQFHLWFDPTADFHTYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRI  185

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSN--WWNQ  406
              SLW+   WAT GG +K DWSKAPF AS++++   AC+W    S C ++ PSN  W N+
Sbjct  186  YSSLWNADDWATRGGLIKTDWSKAPFTASYRNFNAKACIWSSGRSSCNSNAPSNNAWLNE  245

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
            +    L    +   +WV K  + Y+YCTD++RF    P EC++
Sbjct  246  E----LDATSQQRLQWVQKNYMIYNYCTDAKRFPQGYPPECAI  284



>ref|XP_010432029.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 7 [Camelina sativa]
Length=293

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 126/260 (48%), Positives = 160/260 (62%), Gaps = 4/260 (2%)
 Frame = -3

Query  1059  QDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVMKMKLVPGYSAGT  880
             +D F I  +  HI T  DG          ++    ++K +YLFG   MK+KL+PG SAGT
Sbjct  35    EDDFRITWSDAHI-TQIDGGRAIQLKLDPSSGCGFASKKQYLFGHVSMKIKLLPGDSAGT  93

Query  879   VTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKIKLWFDPTEDFHN  700
             V AFY+ SD  + RDE+DFEFLGN +G  YT+QTNVF +G G+REQ++ LWFDP+ DFH 
Sbjct  94    VAAFYMNSDTDSVRDELDFEFLGNRSGQPYTVQTNVFAHGKGDREQRVNLWFDPSRDFHE  153

Query  699   YTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGSSWATDGGRVKID  520
             Y I WN   IVF VD VPIR Y+N+  + V YP  QP     +LW+   WAT GG  KI+
Sbjct  154   YAISWNHLRIVFYVDKVPIRVYKNNEARKVPYPRFQPMSIYSTLWEADDWATRGGIEKIN  213

Query  519   WSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQRGLYEWVMKYQI  340
             WS APF A +KD+ I+ C   G P+ C A+ P NWW    Y TL+P +   Y WV    +
Sbjct  214   WSGAPFYAYYKDFDIEGCPVPG-PANCPAN-PMNWWEGSAYHTLSPAEARGYRWVRVNHM  271

Query  339   TYDYCTDSQRFNGSIPLECS  280
              YDYCTD  RF+   P ECS
Sbjct  272   VYDYCTDKSRFHVP-PPECS  290



>gb|EPS73414.1| hypothetical protein M569_01341, partial [Genlisea aurea]
Length=264

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/261 (48%), Positives = 162/261 (62%), Gaps = 5/261 (2%)
 Frame = -3

Query  1065  FNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVMKMKLVPGYSA  886
             F QDF + +A   HI    DG           + S  ++K++YLFG+  M++KL+PG SA
Sbjct  5     FLQDFRITWAD-SHIK-QLDGGRVIQLNLDQNSGSGFASKNQYLFGKVSMRIKLIPGDSA  62

Query  885   GTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKIKLWFDPTEDF  706
             GTVTAFY++S   A RDE+DFEFLGN +G  YT+QTNV+ NG G REQ++ LWFDP+ DF
Sbjct  63    GTVTAFYMISSNFAVRDELDFEFLGNRSGQPYTVQTNVYANGKGNREQRVNLWFDPSADF  122

Query  705   HNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGSSWATDGGRVK  526
             H Y ILWN YH+VF VD VP+R ++N+  KGV +P  QP     +LW+   WAT GG  K
Sbjct  123   HTYAILWNHYHVVFYVDDVPVRVFKNNLAKGVPFPTSQPMGIYSTLWEADDWATRGGLDK  182

Query  525   IDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPIQRGLYEWVMKY  346
             IDWSKAPF   ++ + I+ C   G P  C ++   NWW    Y  LT  +   Y WV   
Sbjct  183   IDWSKAPFTTYYQGFDIEGCPNTG-PGSCPSN-VGNWWETATYQQLTADELRKYRWVRDN  240

Query  345   QITYDYCTDSQRFNGSIPLEC  283
              + YDYCTD  RF  +IP EC
Sbjct  241   YLIYDYCTDRPRF-PTIPPEC  260



>ref|XP_010555436.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 7 [Tarenaya hassleriana]
Length=289

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 147/219 (67%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  MK+KL+PG SAGTVTAFY+ SD    RDE+DFEFLGN +G  YT+QTNV+ +G
Sbjct  70   YLFGRVSMKIKLIPGDSAGTVTAFYMNSDTDMVRDELDFEFLGNRSGQPYTVQTNVYAHG  129

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ+I LWFDP++DFH+YTI WN   +VF VD+VPIR Y+N+  + V +P  QP   
Sbjct  130  KGDREQRINLWFDPSKDFHDYTISWNHLRVVFYVDNVPIRVYKNNEARNVPFPRFQPMGV  189

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KIDWSKAPF A +KD+ I+ C   G P +C A+ P NWW    
Sbjct  190  YSTLWEADDWATRGGIEKIDWSKAPFYAYYKDFDIEGCPVPG-PVDCPAN-PKNWWEGSE  247

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L+ ++   Y WV    + YDYCTD  R+    P EC
Sbjct  248  YHRLSSVEARRYRWVRMNHMVYDYCTDRSRYPVPPP-EC  285



>ref|XP_001773859.1| predicted protein [Physcomitrella patens]
 gb|EDQ61349.1| predicted protein [Physcomitrella patens]
Length=313

 Score =   236 bits (601),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 146/220 (66%), Gaps = 2/220 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            +LFG   M +KLVP  SAGTVTA+YL S P    DE+DFEFLGN +G  Y LQTNVF NG
Sbjct  83   FLFGSIKMDIKLVPADSAGTVTAYYLYS-PTDHHDELDFEFLGNSSGQPYILQTNVFANG  141

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             GEREQ+I LWFDPT D+H Y +LWN   I+F+VD +PIR + N+ D G+ +   QP   
Sbjct  142  TGEREQRINLWFDPTTDYHTYGVLWNRRQILFLVDDLPIRVFTNNEDMGMPFLNQQPMNI  201

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              S+W+G  WAT GGRVKIDW+ APFIAS+++Y +DAC+     + C     + WW+Q+ 
Sbjct  202  FSSIWNGDKWATQGGRVKIDWTHAPFIASYQNYNLDACIATDAYAPCAMPSANKWWDQEE  261

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECS  280
            Y  L+  Q+    WV +  + Y+YCTD +R N + P EC+
Sbjct  262  YQALSAAQQDKLRWVEENYMVYNYCTDVKR-NPTTPFECT  300



>ref|XP_002310324.1| xyloglucan endotransglycosylase hydrolase 2 family protein [Populus 
trichocarpa]
 gb|EEE90774.1| xyloglucan endotransglycosylase hydrolase 2 family protein [Populus 
trichocarpa]
Length=296

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 142/219 (65%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  M++KL+PG SAGTVTAFY+ SD  A RDE+DFEFLGN  G  YT+QTN+F +G
Sbjct  77   YLFGRVSMRIKLIPGDSAGTVTAFYMNSDTDAVRDELDFEFLGNRTGQPYTVQTNIFAHG  136

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ++ LWFDP  DFH YTI WN  HIVF VD VPIR Y+N+  KG+ +P  QP   
Sbjct  137  KGDREQRVNLWFDPAADFHLYTIFWNHQHIVFFVDDVPIRVYKNNEAKGIPFPKLQPMGV  196

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LW+   WAT GG  KI+WSKAPF A +KD+ I+ C   G P+ C A    NWW    
Sbjct  197  YSTLWEADDWATRGGLEKINWSKAPFYAYYKDFDIEGCPVPG-PATC-ASNRGNWWEGAT  254

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  L  ++   Y WV    + YDYC D  R+  + P EC
Sbjct  255  YQALNAMEARKYRWVRMNHMIYDYCADKSRYP-TTPPEC  292



>emb|CDP02651.1| unnamed protein product [Coffea canephora]
Length=296

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 144/219 (66%), Gaps = 3/219 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG F +K+KL+PG SAGTVTAFY+ SD    RDE+DFEFLGN +G   T+QTNV+ NG
Sbjct  77   YLFGSFSVKIKLIPGDSAGTVTAFYMNSDTNYVRDELDFEFLGNRSGQPTTVQTNVYVNG  136

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G REQ+I LWFDP+  FH YTI W   +I++ VD VPIR ++N+   G+ YP  QP   
Sbjct  137  KGSREQRINLWFDPSIGFHTYTIRWTRENIIYYVDDVPIRVFKNNEAIGIPYPKRQPMGI  196

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              +LWD   WAT GG  KIDWSKAPF   +KD+ +D CV  G P+ C A  P+NWW   N
Sbjct  197  FSTLWDADDWATRGGLEKIDWSKAPFYTYYKDFDVDGCVVPG-PAAC-AFNPNNWWEGPN  254

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
            Y  LTP++   Y WV    + YDYCTD  RF  + P EC
Sbjct  255  YRGLTPLEARKYHWVRANHMIYDYCTDRSRFPVA-PPEC  292



>ref|XP_008343991.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 26 [Malus domestica]
Length=287

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/226 (50%), Positives = 147/226 (65%), Gaps = 3/226 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            +LFG   M +KLVPG SAGTVTA+YL S      DE+DFEFLGNV+G  Y + TN++T G
Sbjct  63   FLFGSIEMLIKLVPGNSAGTVTAYYL-SSTGTKHDEIDFEFLGNVSGQPYIVHTNIYTQG  121

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G +EQ+  LWFDPT DFHNYTI WN   +V+ VDS+PIR +RN+ ++G+AYP  Q    
Sbjct  122  NGSKEQQFYLWFDPTADFHNYTIHWNPTEVVWYVDSLPIRVFRNYENQGIAYPNKQGMRV  181

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDP--SECRADGPSNWWNQ  406
              SLW+  +WAT GG  KI+W+ APF A FK +   AC W G    S C A   +NWW  
Sbjct  182  YSSLWNADNWATRGGLEKINWTGAPFTAGFKHFRARACKWNGAASISVCAATSRANWWTS  241

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              YS L+  + G  +WV    + YDYC D++RFNG++P ECS  ++
Sbjct  242  PIYSQLSNSKLGQLQWVRNNYMIYDYCKDNKRFNGNMPPECSKQQF  287



>ref|NP_001267702.1| probable xyloglucan endotransglucosylase/hydrolase protein 23-like 
precursor [Cucumis sativus]
 emb|CAD87535.1| putative xyloglucan endotransglycosylase [Cucumis sativus]
 emb|CAD87533.1| putative xyloglucan endotransglycosylase [Cucumis sativus]
 gb|KGN65438.1| hypothetical protein Csa_1G422470 [Cucumis sativus]
Length=283

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 127/273 (47%), Positives = 172/273 (63%), Gaps = 10/273 (4%)
 Frame = -3

Query  1083  VVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFVMKMKL  904
              +S+ +FNQDF + +   G      +G   +L+LD A+ S   S  + YLFG+  M++KL
Sbjct  18    AISSANFNQDFQITWG-DGRAKILNNGELLTLSLDKASGSGFQSQNE-YLFGKIDMQLKL  75

Query  903   VPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQKIKLWF  724
             V G SAGTVTA+YL S   ++ DE+DFEFLGN++GD YTL TNVF+ G G REQ+  LWF
Sbjct  76    VAGNSAGTVTAYYL-SSKGSTWDEIDFEFLGNLSGDPYTLHTNVFSQGKGNREQQFHLWF  134

Query  723   DPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDGSSWAT  544
             DPT DFH Y+ILWN   I+F VD  PIR ++N    GV +P  QP     SLW+   WAT
Sbjct  135   DPTADFHTYSILWNPNRIIFSVDGTPIREFKNWESNGVPFPKDQPMRIYSSLWNADDWAT  194

Query  543   DGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECR---ADGPSNWWNQDNYSTLTPIQR  373
              GG VK DW+KAPF AS+K++  +ACVW G  S C    A   ++W +Q+    +    +
Sbjct  195   RGGLVKTDWTKAPFTASYKNFKAEACVWSGGKSSCSPSPAGSSNSWLSQE----MDSASQ  250

Query  372   GLYEWVMKYQITYDYCTDSQRFNGSIPLECSLP  274
                +WV K  + Y+YCTD++RF   +P EC+LP
Sbjct  251   ERLKWVQKNYMIYNYCTDTKRFPQGLPTECNLP  283



>gb|AAN87142.1| xyloglucan endotransglycosylase precursor [Populus tremula x 
Populus tremuloides]
Length=294

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/220 (53%), Positives = 143/220 (65%), Gaps = 3/220 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG F M+MKLVPG SAGTVTAFYL S   +  DE+DFEFLGN  G  Y LQTNVFT G
Sbjct  73   YLFGHFSMQMKLVPGDSAGTVTAFYL-SSQNSEHDEIDFEFLGNRTGQPYILQTNVFTGG  131

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ+I LWFDPT++FH Y++LWN+Y IVF+VD VPIR ++N  D GV +P  QP   
Sbjct  132  KGDREQRIYLWFDPTKEFHYYSVLWNMYMIVFLVDDVPIRVFKNCKDLGVKFPFNQPMKI  191

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              SLW+   WAT GG  K DWSKAPFIAS++ + ID C    +   C   G + WW+Q  
Sbjct  192  YSSLWNADDWATRGGLEKTDWSKAPFIASYRSFHIDGCEASVEAKFCATQG-ARWWDQKE  250

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECS  280
            +  L   Q     WV +    Y+YCTD  R+  S+P EC 
Sbjct  251  FQDLDAFQYRRLSWVRQKYTIYNYCTDRSRYP-SMPPECK  289



>ref|XP_008367892.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 26 [Malus domestica]
Length=288

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/226 (50%), Positives = 146/226 (65%), Gaps = 3/226 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            +LFG   M +KLVPG SAG VTA+YL S      DE+DFEFLGNV+G  Y + TN++T G
Sbjct  64   FLFGSIEMLIKLVPGNSAGIVTAYYL-SSTGPKHDEIDFEFLGNVSGQPYIVHTNIYTQG  122

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G +EQ+  LWFDPT DFHNYTI WN   IV+ VDS+PIR +RN+ ++G+AYP  Q    
Sbjct  123  NGTKEQQFYLWFDPTADFHNYTIHWNPXEIVWYVDSLPIRVFRNYENQGIAYPNKQGMKV  182

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDP--SECRADGPSNWWNQ  406
              SLW+  +WAT GG  KI+W+ APF A FK++   AC W G    S C A   +NWW  
Sbjct  183  YSSLWNADNWATRGGLEKINWTGAPFTAGFKNFRARACKWDGAASISVCAATSRANWWTS  242

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              YS L+  + G  +WV    + YDYC D++RFNG +P ECS  ++
Sbjct  243  PIYSRLSSGKLGQLQWVRNNHMIYDYCKDTKRFNGKMPSECSKQQF  288



>gb|AAF80591.1|AF223420_1 xyloglucan endotransglycosylase XET2 [Asparagus officinalis]
Length=284

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 126/281 (45%), Positives = 167/281 (59%), Gaps = 15/281 (5%)
 Frame = -3

Query  1098  VSLASVVSTGDFNQDFFVIYA-APGHINTSADGRstsltldtaaasssmstkdKYLFGQF  922
             +S   +   G+FN DF + +    G I    D           A+ S   +  +YLFG+ 
Sbjct  11    LSSVGIAVAGNFNDDFKITWGDGRGRI---VDNGQLLSLSLDKASGSGFESTHEYLFGKI  67

Query  921   VMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQ  742
              M++KLVPG SAGTVTA+YL S    + DE+DFEFLGN++GD YTL TNVFT G G REQ
Sbjct  68    DMQLKLVPGNSAGTVTAYYL-SSQGPTHDEIDFEFLGNLSGDPYTLHTNVFTQGKGNREQ  126

Query  741   KIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWD  562
             +  LWFDPT+DFH Y+ILWN  HI+F VD +PIR ++N   +GVA+P  QP     SLW+
Sbjct  127   QFHLWFDPTKDFHTYSILWNPSHIIFSVDGIPIRDFKNMESRGVAFPKSQPMKIYSSLWN  186

Query  561   GSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSEC------RADGPSNWWNQDN  400
                WAT GG +K DW+KAPF AS++++  +ACVW    S C       A   + W N++ 
Sbjct  187   ADDWATRGGLIKTDWTKAPFTASYRNFNANACVWSAGTSTCSSKKSPSASPSNAWLNEEL  246

Query  399   YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
              ST     R    WV K  + Y+YC D +RF   +P ECS+
Sbjct  247   DSTRQERMR----WVQKNYMIYNYCADLKRFPQGLPPECSV  283



>gb|AGI42449.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/223 (51%), Positives = 146/223 (65%), Gaps = 7/223 (3%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  M++KLVPG SAGTVTA+YL S    + DE+DFEFLGN++GD YTL TNVF+ G
Sbjct  67   YLFGKIDMQLKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQG  125

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G REQ+  LWFDPT DFH Y+ILWN   I+F VD+ PIR ++N    GVAYP  Q    
Sbjct  126  KGGREQQFHLWFDPTADFHTYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRI  185

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSN--WWNQ  406
              SLW+   WAT GG +K DWSKAPF AS++++   AC+W    S C ++ PSN  W N+
Sbjct  186  YSSLWNADDWATRGGLIKTDWSKAPFTASYRNFNAKACIWSSGRSSCNSNAPSNNAWLNE  245

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
            +    L    +   +WV K  + Y+YCTD++RF    P EC +
Sbjct  246  E----LDATSQQRLQWVQKNYMIYNYCTDAKRFPQGYPPECDV  284



>ref|XP_002514259.1| Xyloglucan endotransglucosylase/hydrolase protein 14 precursor, 
putative [Ricinus communis]
 gb|EEF48213.1| Xyloglucan endotransglucosylase/hydrolase protein 14 precursor, 
putative [Ricinus communis]
Length=291

 Score =   234 bits (598),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/226 (50%), Positives = 149/226 (66%), Gaps = 3/226 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            +LFG   M +KLVPG SAGTVTA+Y+ S      DE+DFEFLGNV+G  Y + TN++T G
Sbjct  67   FLFGSIQMLIKLVPGNSAGTVTAYYV-SSSGDRHDEIDFEFLGNVSGQPYIIHTNIYTQG  125

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G REQ+   WFDPT DFHNYTI WN   +V+ VDSVPIR +RN+ ++G+AYP  Q    
Sbjct  126  NGSREQQFYPWFDPTADFHNYTIHWNPSMVVWYVDSVPIRVFRNYENEGIAYPNKQGMRV  185

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKG--DPSECRADGPSNWWNQ  406
              SLW+  +WAT GG +KIDW+ APF+A ++ +   AC W G    S C ++ P+NWW  
Sbjct  186  YSSLWNADNWATRGGLLKIDWNSAPFVARYRTFRPRACKWNGPVSISGCASNTPTNWWTL  245

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              YS LT  + G  +WV    + YDYC D++R+NG +P EC  P++
Sbjct  246  PTYSQLTNAKLGQMKWVRDNYMIYDYCKDTKRYNGQVPPECFKPQF  291



>ref|XP_010047926.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 26 [Eucalyptus grandis]
Length=291

 Score =   234 bits (598),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/226 (50%), Positives = 146/226 (65%), Gaps = 3/226 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            +LFG   M +KLVPG SAGTVTA+YL S   +  DE+DFEFLGNV+G  Y + TN++T G
Sbjct  67   FLFGSIEMLIKLVPGNSAGTVTAYYL-SSTGSRHDEIDFEFLGNVSGQPYIIHTNIYTQG  125

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G REQ+   WFDPT  +HNYTI WN   +V+ +D +PIR +RN+  +G+AYP  Q    
Sbjct  126  NGSREQQFYPWFDPTAAYHNYTIHWNPTEVVWYIDGLPIRVFRNYESEGIAYPNKQGMRV  185

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPS--ECRADGPSNWWNQ  406
              SLW+  +WAT GG VKIDWS APF A   ++   AC W G  S  +C A  P+NWW  
Sbjct  186  YSSLWNADNWATRGGLVKIDWSSAPFRAGLHNFRARACKWTGPVSITQCAATSPANWWTA  245

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              YS L+  + G  +WV    + Y+YC D++RFNG +P ECS P+Y
Sbjct  246  PTYSQLSFAKLGQMKWVRDNYMIYNYCNDTKRFNGQMPPECSKPQY  291



>ref|XP_002304625.1| EXGT1 family protein [Populus trichocarpa]
 gb|EEE79604.1| EXGT1 family protein [Populus trichocarpa]
Length=294

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 116/220 (53%), Positives = 144/220 (65%), Gaps = 3/220 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG F M+MKLVPG SAGTVTAFYL S   +  DE+DFEFLGN  G  Y LQTNVFT G
Sbjct  73   YLFGHFSMQMKLVPGDSAGTVTAFYL-SSQNSEHDEIDFEFLGNRTGQPYILQTNVFTGG  131

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ+I LWFDPT++FH Y++LWN+Y IVF+VD VPIR ++N  D GV +P  QP   
Sbjct  132  KGDREQRIYLWFDPTKEFHYYSVLWNMYIIVFLVDDVPIRVFKNCKDLGVKFPFNQPMKI  191

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              SLW+   WAT GG  K DWSKAPFIAS++ + +D C    +   C   G + WW+Q  
Sbjct  192  YSSLWNADDWATRGGLEKTDWSKAPFIASYRSFHVDGCEASVEAKFCATQG-ARWWDQKE  250

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECS  280
            +  L  +Q     WV +    Y+YCTD  R+  S+P EC 
Sbjct  251  FQDLDALQYRRLSWVRQKYTIYNYCTDRSRYP-SMPPECK  289



>ref|XP_009408365.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
[Musa acuminata subsp. malaccensis]
Length=296

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/223 (51%), Positives = 146/223 (65%), Gaps = 3/223 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG F M++K+VPG SAGTVTAFYL S   +  DE+DFEFLGN     Y LQTNVFT G
Sbjct  75   YLFGHFSMQIKMVPGDSAGTVTAFYL-SSQNSEHDEIDFEFLGNRTNQPYILQTNVFTGG  133

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ+I LWFDPT+D+H+Y++LWN+Y IVF VD VPIR ++N  D GV YP  QP   
Sbjct  134  KGDREQRIYLWFDPTKDYHSYSVLWNMYQIVFYVDDVPIRVFKNSKDLGVRYPFNQPMKI  193

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              SLW+G  WAT GG  K DWSKAPF+A+++ + ID C    +   C   G   WW+Q  
Sbjct  194  YSSLWNGDDWATRGGLEKTDWSKAPFVAAYRGFHIDGCEASAEAKFCATQG-MRWWDQKE  252

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPK  271
            +  L  +Q    +WV +    Y+YCTD +R+  ++P EC   K
Sbjct  253  FRDLDGLQYRRLQWVRQKYTIYNYCTDRKRYP-AMPPECRRDK  294



>ref|XP_009352690.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 26 [Pyrus x bretschneideri]
Length=288

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/226 (50%), Positives = 145/226 (64%), Gaps = 3/226 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            +LFG   M +KLVPG SAG VTA+YL S      DE+DFEFLGNV+G  Y + TN++T G
Sbjct  64   FLFGSIEMLIKLVPGNSAGIVTAYYL-SSTGPKHDEIDFEFLGNVSGQPYIVHTNIYTQG  122

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G +EQ+  LWFDPT DFHNYTI WN   IV+ VDS+PIR +RN+ ++G+AYP  Q    
Sbjct  123  NGTKEQQFYLWFDPTADFHNYTIHWNPTEIVWYVDSLPIRVFRNYENQGIAYPHKQGMRV  182

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDP--SECRADGPSNWWNQ  406
              SLW+  +WAT GG  KI+W+ APF A FK++   AC W G    S C A   +NWW  
Sbjct  183  YSSLWNADNWATRGGLEKINWTGAPFTAGFKNFRARACKWDGATSISVCAATSRANWWTS  242

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              YS L   + G  +WV    + YDYC D++RFNG +P ECS  ++
Sbjct  243  PIYSRLNSSKLGQLQWVRHNHMIYDYCNDTKRFNGKMPSECSKQQF  288



>ref|XP_006385866.1| hypothetical protein POPTR_0003s15800g [Populus trichocarpa]
 gb|ERP63663.1| hypothetical protein POPTR_0003s15800g [Populus trichocarpa]
Length=298

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 116/220 (53%), Positives = 144/220 (65%), Gaps = 3/220 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG F M+MKLVPG SAGTVTAFYL S   +  DE+DFEFLGN  G  Y LQTNVFT G
Sbjct  77   YLFGHFSMQMKLVPGDSAGTVTAFYL-SSQNSEHDEIDFEFLGNRTGQPYILQTNVFTGG  135

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ+I LWFDPT++FH Y++LWN+Y IVF+VD VPIR ++N  D GV +P  QP   
Sbjct  136  KGDREQRIYLWFDPTKEFHYYSVLWNMYIIVFLVDDVPIRVFKNCKDLGVKFPFNQPMKI  195

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              SLW+   WAT GG  K DWSKAPFIAS++ + +D C    +   C   G + WW+Q  
Sbjct  196  YSSLWNADDWATRGGLEKTDWSKAPFIASYRSFHVDGCEASVEAKFCATQG-ARWWDQKE  254

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECS  280
            +  L  +Q     WV +    Y+YCTD  R+  S+P EC 
Sbjct  255  FQDLDALQYRRLSWVRQKYTIYNYCTDRSRYP-SMPPECK  293



>ref|XP_006353474.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 26-like [Solanum tuberosum]
Length=296

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/226 (49%), Positives = 146/226 (65%), Gaps = 3/226 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            +LFG   M++KLVPG SAGTVTA+YL S      DE+DFEFLGNV+G  Y + TN+FT G
Sbjct  72   FLFGSIEMQIKLVPGNSAGTVTAYYL-SSTGDKHDEIDFEFLGNVSGQPYIIHTNIFTQG  130

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G REQ+   WFDPT D+HNYTI WN   +V+ VD +PIR Y+N+  +G+ YP  Q    
Sbjct  131  AGGREQQFYPWFDPTADYHNYTIHWNPNAVVWYVDDIPIRVYKNYQSQGIPYPNAQAMGV  190

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKG--DPSECRADGPSNWWNQ  406
              SLW+  SWAT GG VK DW+ APFIA ++++   AC W G    S+C    P+NW+  
Sbjct  191  YSSLWNADSWATRGGLVKCDWTNAPFIAKYRNFAPRACAWNGPISISQCATQTPNNWYTA  250

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              Y+ L+  ++G  EWV    + YDYC D++RFNG  P EC  P++
Sbjct  251  PEYNQLSYAKQGQMEWVRNNSMIYDYCKDTKRFNGQFPGECFKPQF  296



>ref|XP_008462753.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 26 [Cucumis melo]
Length=289

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/227 (50%), Positives = 146/227 (64%), Gaps = 5/227 (2%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            +LFG F  ++KLVPG SAG VTA+YL S    + DE+D+EFLGNV G  YT+ TN+F  G
Sbjct  65   FLFGSFEARIKLVPGNSAGVVTAYYL-SSTGTAHDEIDYEFLGNVTGQPYTIHTNIFAKG  123

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G REQ+ ++WFDPT DFHNYTI WN   +V+ +D  PIR +RN+  +G+A+P  Q    
Sbjct  124  VGNREQQFRVWFDPTADFHNYTIHWNPNAVVWYIDGTPIRVFRNYEKQGIAFPNKQGMRI  183

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPS--ECRADGPSNWWNQ  406
              SLW+   WAT GGRVK +W+ APFIA  + +   AC W G PS  +C     +NWWN 
Sbjct  184  YTSLWNADDWATQGGRVKTNWTNAPFIAGLRQFRPRACYWNGVPSITQCATKSLANWWNS  243

Query  405  DNYSTLTPIQRG-LYEWVMKYQITYDYCTDSQRFNGSIPLECSLPKY  268
              Y+ L+P Q   L E   KY+I YDYC D+ RFNG +P EC   +Y
Sbjct  244  PAYARLSPPQLAKLNEIQRKYKI-YDYCKDTMRFNGKMPPECYKAQY  289



>gb|ABY86635.1| xyloglucan endotransglycosylase/hydrolase [Gossypium raimondii]
Length=289

 Score =   234 bits (596),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 121/272 (44%), Positives = 165/272 (61%), Gaps = 5/272 (2%)
 Frame = -3

Query  1098  VSLASVVSTGDFNQDFFVIYAAPGHINTSADGRstsltldtaaasssmstkdKYLFGQFV  919
             +SL+ +     F +DF + ++   HI    DG      +    +    ++K +YLFG+  
Sbjct  19    LSLSVLGRPATFLEDFRITWSD-SHIR-QIDGGRAIQLVLDQNSGCGFASKRQYLFGRVS  76

Query  918   MKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNGYGEREQK  739
             MK+KL+PG SAGTVTAFY+ SD  A RDE+DFEFLGN  G  YT+QTN++ +G G+REQ+
Sbjct  77    MKIKLIPGDSAGTVTAFYMNSDTDAVRDELDFEFLGNRTGQPYTVQTNIYAHGKGDREQR  136

Query  738   IKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPAQISLWDG  559
             + LWFDP  DFH Y+I+WN + IVF +D VPIR Y+N+  + + YP  QP     +LW+ 
Sbjct  137   VNLWFDPAADFHTYSIMWNHHQIVFYIDEVPIRVYKNNEARNIPYPKLQPMGVYSTLWEA  196

Query  558   SSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDNYSTLTPI  379
               WAT GG  KIDW+KAPF+A +KD+ I+ C   G P  C A    NWW    Y  L  +
Sbjct  197   DDWATRGGLEKIDWTKAPFLAYYKDFDIEGCPVPG-PVNC-ATNSRNWWEGTAYQALNAM  254

Query  378   QRGLYEWVMKYQITYDYCTDSQRFNGSIPLEC  283
             +   Y WV    + YDYCTD  R+  + P EC
Sbjct  255   EAKRYRWVRMNHVIYDYCTDKSRYPVTPP-EC  285



>gb|AGI42458.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   234 bits (596),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 112/223 (50%), Positives = 146/223 (65%), Gaps = 7/223 (3%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG+  M++KLVPG SAGTVTA+YL S    + DE+DFEFLGN++GD YTL TNVF+ G
Sbjct  67   YLFGKIDMQLKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQG  125

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G REQ+  LWFDPT DFH Y+ILWN   I+F VD+ PIR ++N    GVAYP  Q    
Sbjct  126  KGGREQQFHLWFDPTADFHTYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRI  185

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSN--WWNQ  406
              SLW+   WAT GG +K DWSKAPF AS++++   AC+W    S C ++ PSN  W N+
Sbjct  186  YSSLWNADDWATRGGLIKTDWSKAPFTASYRNFNAKACIWSSGRSSCNSNAPSNNAWLNE  245

Query  405  DNYSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECSL  277
            +    L    +   +W  K  + Y+YCTD++RF    P EC++
Sbjct  246  E----LDATSQQRLQWAQKNYMIYNYCTDAKRFPQGYPPECAI  284



>gb|ABK92523.1| unknown [Populus trichocarpa]
Length=294

 Score =   234 bits (596),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 116/220 (53%), Positives = 144/220 (65%), Gaps = 3/220 (1%)
 Frame = -3

Query  939  YLFGQFVMKMKLVPGYSAGTVTAFYLMSDPAASRDEMDFEFLGNVAGDLYTLQTNVFTNG  760
            YLFG F M+MKLVPG SAGTVTAFYL S   +  DE+DFEFLGN  G  Y LQTNVFT G
Sbjct  73   YLFGHFSMQMKLVPGDSAGTVTAFYL-SSQNSEHDEIDFEFLGNRTGQPYILQTNVFTGG  131

Query  759  YGEREQKIKLWFDPTEDFHNYTILWNIYHIVFMVDSVPIRTYRNHADKGVAYPMGQPAPA  580
             G+REQ+I LWFDPT++FH Y++LWN+Y IVF+VD VPIR ++N  D GV +P  QP   
Sbjct  132  KGDREQRIYLWFDPTKEFHYYSVLWNMYIIVFLVDDVPIRVFKNCKDLGVKFPFNQPMKI  191

Query  579  QISLWDGSSWATDGGRVKIDWSKAPFIASFKDYTIDACVWKGDPSECRADGPSNWWNQDN  400
              SLW+   WAT GG  K DWSKAPFIAS++ + +D C    +   C   G + WW+Q  
Sbjct  192  YSSLWNADDWATRGGLEKTDWSKAPFIASYRSFHVDGCEASVEAKFCAPQG-ARWWDQKE  250

Query  399  YSTLTPIQRGLYEWVMKYQITYDYCTDSQRFNGSIPLECS  280
            +  L  +Q     WV +    Y+YCTD  R+  S+P EC 
Sbjct  251  FQDLDALQYRRLSWVRQKYTIYNYCTDRSRYP-SMPPECK  289



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3010318557645