BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c28554_g1_i1 len=904 path=[882:0-903]

Length=904
                                                                      Score     E

ref|XP_004230035.1|  PREDICTED: sigma factor binding protein 1, c...  74.7    5e-13   
ref|XP_009593624.1|  PREDICTED: sigma factor binding protein 1, c...  72.4    3e-12   
ref|XP_009785038.1|  PREDICTED: sigma factor binding protein 2, c...  71.2    1e-11   
ref|XP_011091856.1|  PREDICTED: sigma factor binding protein 2, c...  67.8    2e-10   
gb|EYU42924.1|  hypothetical protein MIMGU_mgv1a015864mg              67.0    2e-10   
ref|XP_002513029.1|  protein with unknown function                    64.7    2e-09   Ricinus communis
ref|XP_009361997.1|  PREDICTED: uncharacterized protein LOC103952175  64.3    2e-09   
dbj|BAI52954.1|  sigma factor binding protein 1                       63.5    5e-09   Citrullus lanatus subsp. vulgaris
ref|XP_011020968.1|  PREDICTED: uncharacterized protein LOC105123154  62.8    9e-09   
ref|XP_008375494.1|  PREDICTED: uncharacterized protein LOC103438726  62.4    1e-08   
ref|XP_008446972.1|  PREDICTED: sigma factor binding protein 1, c...  62.4    1e-08   
ref|XP_008348784.1|  PREDICTED: uncharacterized protein LOC103411950  62.0    1e-08   
gb|KDP40549.1|  hypothetical protein JCGZ_24548                       62.0    2e-08   
ref|XP_002303937.1|  hypothetical protein POPTR_0003s19420g           61.2    3e-08   Populus trichocarpa [western balsam poplar]
ref|XP_004308571.1|  PREDICTED: sigma factor binding protein 2, c...  61.2    3e-08   
ref|XP_004142385.1|  PREDICTED: sigma factor binding protein 1, c...  61.2    4e-08   
ref|XP_010095987.1|  hypothetical protein L484_023976                 59.3    1e-07   
ref|XP_011000627.1|  PREDICTED: sigma factor binding protein 1, c...  58.9    2e-07   
ref|XP_011086234.1|  PREDICTED: uncharacterized protein LOC105168022  59.3    2e-07   
ref|XP_008231630.1|  PREDICTED: uncharacterized protein LOC103330797  58.5    2e-07   
ref|XP_007218589.1|  hypothetical protein PRUPE_ppa013276mg           58.5    3e-07   
emb|CAN69541.1|  hypothetical protein VITISV_025656                   58.2    3e-07   Vitis vinifera
ref|XP_010659135.1|  PREDICTED: uncharacterized protein LOC104881276  58.2    3e-07   
ref|XP_010276684.1|  PREDICTED: sigma factor binding protein 1, c...  58.5    3e-07   
ref|XP_006368633.1|  hypothetical protein POPTR_0001s06690g           58.5    4e-07   
ref|XP_010245501.1|  PREDICTED: sigma factor binding protein 1, c...  58.2    5e-07   
ref|XP_009372819.1|  PREDICTED: uncharacterized protein LOC103961901  56.2    1e-06   
gb|EYU38292.1|  hypothetical protein MIMGU_mgv1a025895mg              55.8    3e-06   
gb|EPS64879.1|  hypothetical protein M569_09902                       53.5    5e-06   
ref|XP_010068946.1|  PREDICTED: uncharacterized protein LOC104455939  55.1    7e-06   
ref|XP_010232473.1|  PREDICTED: uncharacterized protein LOC100832135  54.3    1e-05   
ref|XP_004498685.1|  PREDICTED: uncharacterized protein LOC101489304  53.1    2e-05   
gb|AFK35294.1|  unknown                                               52.8    2e-05   
ref|XP_003598460.1|  Sigma factor binding protein                     52.8    2e-05   
gb|AFK34874.1|  unknown                                               52.0    4e-05   
ref|XP_006576783.1|  PREDICTED: sigma factor binding protein 1, c...  52.4    6e-05   
emb|CDM84632.1|  unnamed protein product                              51.2    9e-05   
ref|XP_003546708.1|  PREDICTED: uncharacterized protein LOC100783939  50.8    9e-05   
ref|XP_007148914.1|  hypothetical protein PHAVU_005G024800g           50.8    1e-04   
ref|XP_007010917.1|  Sigma factor binding protein 1, putative         50.8    1e-04   
ref|XP_003625000.1|  hypothetical protein MTR_7g089860                50.8    2e-04   
ref|XP_006578424.1|  PREDICTED: uncharacterized protein LOC102665525  50.1    2e-04   
gb|KHN45074.1|  hypothetical protein glysoja_047566                   50.1    2e-04   
ref|XP_010548817.1|  PREDICTED: uncharacterized protein LOC104820144  50.1    2e-04   
ref|XP_002468446.1|  hypothetical protein SORBIDRAFT_01g046040        50.4    2e-04   Sorghum bicolor [broomcorn]
ref|XP_008243117.1|  PREDICTED: uncharacterized protein LOC103341384  50.1    3e-04   
ref|XP_004511048.1|  PREDICTED: uncharacterized protein LOC101493795  49.3    3e-04   
ref|XP_007163886.1|  hypothetical protein PHAVU_L008100g              49.3    4e-04   
emb|CDP09565.1|  unnamed protein product                              49.3    4e-04   
gb|KHN37698.1|  hypothetical protein glysoja_007401                   48.9    4e-04   
ref|NP_001235674.1|  uncharacterized protein LOC100306482             48.9    4e-04   
ref|XP_008788483.1|  PREDICTED: sigma factor binding protein 2, c...  48.5    8e-04   
ref|XP_004493402.1|  PREDICTED: sigma factor binding protein 1, c...  48.5    8e-04   



>ref|XP_004230035.1| PREDICTED: sigma factor binding protein 1, chloroplastic-like 
[Solanum lycopersicum]
Length=158

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 65/119 (55%), Gaps = 16/119 (13%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARIMEANDGATDFEFVPdlaaaaggddGVIF  462
            YISTPMKVKTSASRFRSLVQELTGR SD ARIME N   T++E +               
Sbjct  25   YISTPMKVKTSASRFRSLVQELTGRDSDIARIMETNGSITEYEDIHSERDDF--------  76

Query  461  GALKNEGRHSSPSFFRYPMVNNSVEESPTSSES---LAEPPLDDQVFSSQVDEQFQAMF  294
                NE    S S     ++  S   +P SSES     EP  DD +F+SQ+ EQF A  
Sbjct  77   ----NELPVKSSSPSSSSLLAKSSNSTPMSSESDNYFIEPNFDD-LFNSQMQEQFLAFL  130



>ref|XP_009593624.1| PREDICTED: sigma factor binding protein 1, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=156

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 71/123 (58%), Gaps = 22/123 (18%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARIMEANDGATDFEFVPdlaaaaggddGVIF  462
            YISTPMKVKTSASRFR+LVQELTG  SD ARIME+N GAT+FE                 
Sbjct  33   YISTPMKVKTSASRFRALVQELTGPDSDIARIMESN-GATEFEDHN--------------  77

Query  461  GALKNEGRHSSPSFFRYPMVNNSVEESPTSSES-------LAEPPLDDQVFSSQVDEQFQ  303
            G   NE R    S    P  ++S+ ++ ++S S         EP  +D +FSSQ++EQF 
Sbjct  78   GHGNNELRELLKSSSPSPSPSSSLLQAKSNSSSVSSESNYFTEPNFEDLLFSSQMEEQFL  137

Query  302  AMF  294
            A+ 
Sbjct  138  ALL  140



>ref|XP_009785038.1| PREDICTED: sigma factor binding protein 2, chloroplastic-like 
[Nicotiana sylvestris]
Length=161

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 39/43 (91%), Gaps = 1/43 (2%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARIMEANDGATDFE  513
            YISTPMKVKTSASRFR+LVQELTG  SD ARIME+N GAT+FE
Sbjct  33   YISTPMKVKTSASRFRALVQELTGPDSDIARIMESN-GATEFE  74



>ref|XP_011091856.1| PREDICTED: sigma factor binding protein 2, chloroplastic-like 
[Sesamum indicum]
Length=157

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 65/111 (59%), Gaps = 13/111 (12%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARIMEANDGATDFEFVPdlaaaaggddGVIF  462
            YIS+PMKVKTSASRFRSLVQ+LTG++SD +  M            P  +        +  
Sbjct  34   YISSPMKVKTSASRFRSLVQKLTGKNSDISHYMAE----------PSNSYGFIDFCEIDC  83

Query  461  GALKNEGRHSSPSFFRYPMVNNSVEESPTSSESLAEPPLDDQVFSSQVDEQ  309
             A ++  + +S     + + + S E++PTSS+SL EP   D VF+SQ+DEQ
Sbjct  84   DANQSLAKQTSDDQC-HLLSSISAEDTPTSSDSLFEPI--DNVFASQMDEQ  131



>gb|EYU42924.1| hypothetical protein MIMGU_mgv1a015864mg [Erythranthe guttata]
Length=142

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 71/118 (60%), Gaps = 22/118 (19%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARIMEANDGATD--FEFVPdlaaaaggddGV  468
            YIS+PMKVKTSAS+FRSLVQ+LTG++SD ++ ME ++   +  F    ++  +   D+  
Sbjct  23   YISSPMKVKTSASKFRSLVQQLTGKNSDISQYMEESNNINNEVFRDFCEIDRSLANDNDR  82

Query  467  IFGALKNEGRHSSPSFFRYPMVNNSVEESPTSSESLAEPPLDDQVFSSQVDEQFQAMF  294
            +F ++       SPS           +E+ TSSESL  P  D  VF+SQ+ EQF+ +F
Sbjct  83   MFSSI-------SPS-----------DETTTSSESLLGPFED--VFTSQMKEQFEGIF  120



>ref|XP_002513029.1| protein with unknown function [Ricinus communis]
 gb|EEF49532.1| protein with unknown function [Ricinus communis]
Length=143

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARIMEANDGATDF  516
            YIS+PMKV+TSAS+FR+LVQELTG+ SD AR M+ N+GA ++
Sbjct  26   YISSPMKVETSASKFRALVQELTGKDSDAARFMDVNNGAENY  67



>ref|XP_009361997.1| PREDICTED: uncharacterized protein LOC103952175 [Pyrus x bretschneideri]
Length=129

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARIMEANDGA  525
            YIS+PMKVKTSAS FR+LVQELTGRHSD  R ME N+  
Sbjct  27   YISSPMKVKTSASEFRALVQELTGRHSDAERFMETNNSG  65



>dbj|BAI52954.1| sigma factor binding protein 1 [Citrullus lanatus subsp. vulgaris]
Length=146

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 55/123 (45%), Gaps = 28/123 (23%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARIMEANDGATDFEFVPdlaaaaggddGVIF  462
            YIS+PMKVKTSAS+FRSLVQ LTG+ SD  R ME    A                     
Sbjct  24   YISSPMKVKTSASKFRSLVQRLTGQDSDAERFMELTASA---------------------  62

Query  461  GALKNEGRHSSPSFFRYPM-------VNNSVEESPTSSESLAEPPLDDQVFSSQVDEQFQ  303
             + +N    +S +FF Y +       V   VE +   S   A PP DD      +D  F 
Sbjct  63   ASDRNLQSSASATFFDYQLLGDDDLVVAGKVETAAYESSVAALPPPDDLAVLHNLDASFG  122

Query  302  AMF  294
             MF
Sbjct  123  GMF  125



>ref|XP_011020968.1| PREDICTED: uncharacterized protein LOC105123154 [Populus euphratica]
Length=138

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 64/118 (54%), Gaps = 23/118 (19%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARIMEANDGATDFEFVPdlaaaaggddGVIF  462
            YIS+PMKVKTSAS+FR+LVQELTG+ SD  R M+ N GA D   +P   A          
Sbjct  27   YISSPMKVKTSASKFRALVQELTGKDSDAERFMDIN-GAHDSLEIPHQTAEYD-------  78

Query  461  GALKNEGRHSSPSFFRYPMVNNSVEESP--TSSESLAEPPLDDQVFSSQVDEQFQAMF  294
                   RH  PS F  P+ N+  ++SP  TSSES     LD + F S ++  F  M 
Sbjct  79   -------RH--PSVF--PLTNSCHDQSPSTTSSESFL-GSLDGEFFPS-MEGSFMGML  123



>ref|XP_008375494.1| PREDICTED: uncharacterized protein LOC103438726 [Malus domestica]
Length=129

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARIMEANDGA  525
            YIS+PMKV TSAS FR+LVQELTGRHSD  R ME N+  
Sbjct  27   YISSPMKVNTSASEFRALVQELTGRHSDAERFMETNNSG  65



>ref|XP_008446972.1| PREDICTED: sigma factor binding protein 1, chloroplastic-like 
[Cucumis melo]
Length=140

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARIMEANDGATD  519
            YIS+PMKVKTSAS+FRSLVQ+LTG+ SD  R ME   GA+D
Sbjct  24   YISSPMKVKTSASKFRSLVQKLTGQDSDAERFMEMASGASD  64



>ref|XP_008348784.1| PREDICTED: uncharacterized protein LOC103411950 [Malus domestica]
Length=124

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARIMEANDGA  525
            YIS+PMKV+TSAS FR+LVQELTGR SD  R ME N+G 
Sbjct  27   YISSPMKVQTSASEFRALVQELTGRDSDAERFMETNNGG  65



>gb|KDP40549.1| hypothetical protein JCGZ_24548 [Jatropha curcas]
Length=141

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARIMEANDGATDFEFVP  504
            YIS+PMKV+TSAS+FR+LVQELTG+ SD AR M+ N G  +    P
Sbjct  25   YISSPMKVQTSASKFRALVQELTGKDSDAARFMDVNGGDQNLNSSP  70



>ref|XP_002303937.1| hypothetical protein POPTR_0003s19420g [Populus trichocarpa]
 gb|EEE78916.1| hypothetical protein POPTR_0003s19420g [Populus trichocarpa]
Length=138

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 64/118 (54%), Gaps = 23/118 (19%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARIMEANDGATDFEFVPdlaaaaggddGVIF  462
            YIS+PMKVKTSAS+FR+LVQELTG+ SD  R M+ N GA D   +P   A          
Sbjct  27   YISSPMKVKTSASKFRALVQELTGKDSDAERFMDIN-GARDSLEIPHQTA----------  75

Query  461  GALKNEGRHSSPSFFRYPMVNNSVEESP--TSSESLAEPPLDDQVFSSQVDEQFQAMF  294
                 E  H  PS F  P+ N+  ++SP  TSSES     LD + F S ++  F  M 
Sbjct  76   -----EYDH-HPSVF--PLTNSCNDQSPSTTSSESFL-GSLDGEFFPS-MEGSFMGML  123



>ref|XP_004308571.1| PREDICTED: sigma factor binding protein 2, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=132

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARIMEANDG  528
            YIS+PMKV+TSAS+FR+LVQELTGR SD  R ME N G
Sbjct  27   YISSPMKVQTSASKFRALVQELTGRDSDAERFMETNGG  64



>ref|XP_004142385.1| PREDICTED: sigma factor binding protein 1, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004157503.1| PREDICTED: sigma factor binding protein 1, chloroplastic-like 
[Cucumis sativus]
 gb|KGN52329.1| hypothetical protein Csa_5G623915 [Cucumis sativus]
Length=140

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARIMEANDGATD  519
            YIS+PMKVKTSAS+FRSLVQ+LTG+ SD  R ME   G +D
Sbjct  24   YISSPMKVKTSASKFRSLVQKLTGQDSDAERFMEMASGGSD  64



>ref|XP_010095987.1| hypothetical protein L484_023976 [Morus notabilis]
 gb|EXB62680.1| hypothetical protein L484_023976 [Morus notabilis]
Length=125

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARIMEANDG  528
            YIS+PMKVKTSAS FR+LVQELTGR+SD  R ME  +G
Sbjct  28   YISSPMKVKTSASEFRALVQELTGRNSDAERFMEEING  65



>ref|XP_011000627.1| PREDICTED: sigma factor binding protein 1, chloroplastic-like 
[Populus euphratica]
Length=120

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARIMEAN  534
            YIS+PMKVKTSAS FR+LVQELTG+ SD AR M+ N
Sbjct  27   YISSPMKVKTSASEFRALVQELTGKDSDAARFMDIN  62



>ref|XP_011086234.1| PREDICTED: uncharacterized protein LOC105168022 [Sesamum indicum]
Length=152

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARIMEANDGATDF  516
            YIS+PMKVKTSA RFRSLVQ+LTG++SD +R  E+N  A  F
Sbjct  33   YISSPMKVKTSACRFRSLVQQLTGKNSDISRYAESNYWADGF  74



>ref|XP_008231630.1| PREDICTED: uncharacterized protein LOC103330797 [Prunus mume]
Length=127

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARIME  540
            YIS+PMKVKTSAS+FR+LVQELTGR SD  R ME
Sbjct  28   YISSPMKVKTSASKFRALVQELTGRDSDAERFME  61



>ref|XP_007218589.1| hypothetical protein PRUPE_ppa013276mg [Prunus persica]
 gb|EMJ19788.1| hypothetical protein PRUPE_ppa013276mg [Prunus persica]
Length=131

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARIME  540
            YIS+PMKVKTSAS+FR+LVQELTGR SD  R ME
Sbjct  28   YISSPMKVKTSASKFRALVQELTGRDSDAERFME  61



>emb|CAN69541.1| hypothetical protein VITISV_025656 [Vitis vinifera]
Length=124

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARIME  540
            YIS+PMKVKTSAS+FR+LVQELTGR SD  R ME
Sbjct  16   YISSPMKVKTSASKFRALVQELTGRDSDVERYME  49



>ref|XP_010659135.1| PREDICTED: uncharacterized protein LOC104881276 [Vitis vinifera]
Length=124

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARIMEAND  531
            YIS+PMKVKTSAS+FR+LVQELTGR SD  R ME  +
Sbjct  16   YISSPMKVKTSASKFRALVQELTGRDSDVERYMENKE  52



>ref|XP_010276684.1| PREDICTED: sigma factor binding protein 1, chloroplastic-like 
[Nelumbo nucifera]
Length=142

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 56/118 (47%), Gaps = 21/118 (18%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARIMEANDGATDFEFVPdlaaaaggddGVIF  462
            YIS PMKVKTSAS FR+LVQELTGR SD    +         + VPD             
Sbjct  26   YISNPMKVKTSASEFRALVQELTGRDSDLTDTVARFSDTDSVQRVPDQPI----------  75

Query  461  GALKNEGRHSSPSFFRYPMVNNSVEESP-TSSESLAEPPLDDQVFSSQVDEQFQAMFP  291
              + NEG    P    Y       +ESP  SS+SL EP   D VF+ Q+ E F    P
Sbjct  76   -KITNEGVAEVPRVDAY-------QESPAASSDSLLEP--FDDVFTPQMLENFVGFLP  123



>ref|XP_006368633.1| hypothetical protein POPTR_0001s06690g [Populus trichocarpa]
 gb|ERP65202.1| hypothetical protein POPTR_0001s06690g [Populus trichocarpa]
Length=151

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARIMEAN  534
            YIS+PMKVKTSAS FR+LVQELTG+ SD AR M+ N
Sbjct  20   YISSPMKVKTSASEFRALVQELTGKDSDAARFMDIN  55



>ref|XP_010245501.1| PREDICTED: sigma factor binding protein 1, chloroplastic-like 
[Nelumbo nucifera]
Length=145

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 59/117 (50%), Gaps = 17/117 (15%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARIMEANDGATDFEFVPdlaaaaggddGVIF  462
            YIS PMKVKTSAS+FR+LVQELTGR SD           +DF+ V  +         V +
Sbjct  26   YISNPMKVKTSASQFRALVQELTGRDSDETDATR----FSDFDSVDGVQVVPDQVAKVTY  81

Query  461  GALKNEGRHSSPSFFRYPMVNNSVEESPTSSESLAEPPLDDQVFSSQVDEQFQAMFP  291
                      SP   R     ++ +ESP SS+S    P +D VF+ Q+ E F   FP
Sbjct  82   --------DDSPEIPRV----DTYQESPASSDSNLFEPFND-VFTPQMLESFAGFFP  125



>ref|XP_009372819.1| PREDICTED: uncharacterized protein LOC103961901 [Pyrus x bretschneideri]
Length=118

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARIME  540
            YIS+PMKV+TSAS FR+LVQELTGR SD  R ME
Sbjct  27   YISSPMKVQTSASEFRALVQELTGRDSDAERFME  60



>gb|EYU38292.1| hypothetical protein MIMGU_mgv1a025895mg, partial [Erythranthe 
guttata]
Length=150

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARIMEANDG-ATDF  516
            YIS+PMKV+TSASRFRSLVQ+LTG+ S  A+ ME++   A+DF
Sbjct  34   YISSPMKVRTSASRFRSLVQQLTGKDSYVAQYMESDTTRASDF  76



>gb|EPS64879.1| hypothetical protein M569_09902, partial [Genlisea aurea]
Length=55

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTAR  549
            YISTPMKVKTSAS FRSLVQ+LTG++SD ++
Sbjct  23   YISTPMKVKTSASNFRSLVQQLTGKNSDISQ  53



>ref|XP_010068946.1| PREDICTED: uncharacterized protein LOC104455939 [Eucalyptus grandis]
 gb|KCW65895.1| hypothetical protein EUGRSUZ_G03218 [Eucalyptus grandis]
Length=169

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARIMEAN  534
            YIS+PMKVKTSA+ FR+ VQ LTGR SD AR M+A+
Sbjct  37   YISSPMKVKTSAAEFRATVQGLTGRDSDVARFMDAD  72



>ref|XP_010232473.1| PREDICTED: uncharacterized protein LOC100832135 [Brachypodium 
distachyon]
Length=162

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARIMEANDGATDFEFVP  504
            YIS PM+VKTSA+ FR+LVQELTGR +D ++    +DG    E  P
Sbjct  45   YISNPMRVKTSAAGFRALVQELTGRDADPSKYSTDDDGGAAQELSP  90



>ref|XP_004498685.1| PREDICTED: uncharacterized protein LOC101489304 [Cicer arietinum]
Length=137

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 1/38 (3%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARI-MEAND  531
            YIS+PMKVKTSAS FR+LVQELTG+ S+ A + +E ND
Sbjct  34   YISSPMKVKTSASNFRALVQELTGQDSNVAEMFVEVND  71



>gb|AFK35294.1| unknown [Medicago truncatula]
Length=135

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 1/38 (3%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARI-MEAND  531
            YIS+PMKVKTSAS FR+LVQELTG+ S+ A + +E ND
Sbjct  33   YISSPMKVKTSASNFRALVQELTGQDSNVADMFVEVND  70



>ref|XP_003598460.1| Sigma factor binding protein [Medicago truncatula]
 gb|AES68711.1| VQ motif protein [Medicago truncatula]
Length=128

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 1/38 (3%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARI-MEAND  531
            YIS+PMKVKTSAS FR+LVQELTG+ S+ A + +E ND
Sbjct  26   YISSPMKVKTSASNFRALVQELTGQDSNVADMFVEVND  63



>gb|AFK34874.1| unknown [Lotus japonicus]
Length=120

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARIMEANDGA  525
            YIS+PMKVKTSAS FR+LVQELTG+ S+ A      +GA
Sbjct  27   YISSPMKVKTSASNFRALVQELTGQDSNVAETFVEANGA  65



>ref|XP_006576783.1| PREDICTED: sigma factor binding protein 1, chloroplastic-like 
[Glycine max]
 gb|KHN30364.1| hypothetical protein glysoja_025855 [Glycine soja]
Length=167

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 63/125 (50%), Gaps = 14/125 (11%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHS----DTARI--MEANDGATDFEFVPdlaaaagg  480
            YIS PMK+KTSAS FR+LVQELTG+ +    D  R   +   D ++  + + +       
Sbjct  36   YISNPMKIKTSASEFRALVQELTGQDAESPPDPTRFHGLIHPDSSSSVDHIEEEEDNVHS  95

Query  479  ddGVIFGALKNEGRHSSPSFFRYPMVNNSVEESPTSSESLA--EPPLDDQVFSSQVDEQF  306
             + V+  A+ +E    +  +          ++ P+S ES+   EP  DD VF+ Q+ E  
Sbjct  96   VNCVVPPAVADENMSLAGCY------EEEQQQQPSSMESINNFEPLDDDDVFTPQMIENI  149

Query  305  QAMFP  291
             A+ P
Sbjct  150  SALLP  154



>emb|CDM84632.1| unnamed protein product [Triticum aestivum]
Length=152

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 32/46 (70%), Gaps = 1/46 (2%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARIMEANDGATDFEFVP  504
            YIS PM+VKTS + FR+LVQELTGRH+D ++    +DG    E  P
Sbjct  42   YISNPMRVKTSEAGFRALVQELTGRHADPSK-YNTDDGRAAQELSP  86



>ref|XP_003546708.1| PREDICTED: uncharacterized protein LOC100783939 [Glycine max]
 gb|KHN35295.1| hypothetical protein glysoja_039642 [Glycine soja]
Length=122

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 35/44 (80%), Gaps = 3/44 (7%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARI---MEANDGATD  519
            YIS+P+KVKTSAS FR+LVQELTG++S+ A     ME ++G ++
Sbjct  19   YISSPVKVKTSASNFRALVQELTGQYSNVAETSIPMEEDNGHSE  62



>ref|XP_007148914.1| hypothetical protein PHAVU_005G024800g [Phaseolus vulgaris]
 gb|ESW20908.1| hypothetical protein PHAVU_005G024800g [Phaseolus vulgaris]
Length=131

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 35/46 (76%), Gaps = 5/46 (11%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARI-MEAN----DGATD  519
            YIS+PMKVKTSAS FR+LVQELTG+ S+ A + +EA+    DG  D
Sbjct  30   YISSPMKVKTSASNFRALVQELTGQASNVAEMFVEADFYNYDGVLD  75



>ref|XP_007010917.1| Sigma factor binding protein 1, putative [Theobroma cacao]
 gb|EOY19727.1| Sigma factor binding protein 1, putative [Theobroma cacao]
Length=144

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARIMEANDGATD  519
            YIS+PMKVKT AS+FR+LVQELTG+ SD +     N G+++
Sbjct  29   YISSPMKVKTCASQFRALVQELTGKDSDVSVQFMDNYGSSE  69



>ref|XP_003625000.1| hypothetical protein MTR_7g089860 [Medicago truncatula]
 gb|AES81218.1| VQ motif protein [Medicago truncatula]
Length=165

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 6/47 (13%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDT----ARIME--ANDGATD  519
            YIS PMKVKTSAS FR+LVQELTG+++++    +R  E   ND  TD
Sbjct  46   YISNPMKVKTSASEFRALVQELTGQYAESPPNPSRFQEFDVNDSGTD  92



>ref|XP_006578424.1| PREDICTED: uncharacterized protein LOC102665525 [Glycine max]
Length=127

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARI  546
            YIS+PMKVKTSAS FR+LVQELTG+ S+ A +
Sbjct  29   YISSPMKVKTSASNFRALVQELTGQASNVAEM  60



>gb|KHN45074.1| hypothetical protein glysoja_047566 [Glycine soja]
Length=127

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARI  546
            YIS+PMKVKTSAS FR+LVQELTG+ S+ A +
Sbjct  29   YISSPMKVKTSASNFRALVQELTGQASNVAEM  60



>ref|XP_010548817.1| PREDICTED: uncharacterized protein LOC104820144 [Tarenaya hassleriana]
Length=134

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTA  552
            YIS+P+KVKTSAS FR+LVQELTG+ SD A
Sbjct  26   YISSPIKVKTSASEFRALVQELTGKDSDIA  55



>ref|XP_002468446.1| hypothetical protein SORBIDRAFT_01g046040 [Sorghum bicolor]
 gb|EER95444.1| hypothetical protein SORBIDRAFT_01g046040 [Sorghum bicolor]
Length=155

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTAR  549
            YI  PM+VKTSA+ FR+LVQELTGRH+D ++
Sbjct  38   YIDNPMRVKTSAAGFRALVQELTGRHADPSK  68



>ref|XP_008243117.1| PREDICTED: uncharacterized protein LOC103341384 [Prunus mume]
Length=160

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 3/37 (8%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHS---DTARIME  540
            YIS PMKV+TSAS FR+LVQELTG+ S   D AR +E
Sbjct  34   YISNPMKVRTSASEFRALVQELTGQDSELPDPARFLE  70



>ref|XP_004511048.1| PREDICTED: uncharacterized protein LOC101493795 [Cicer arietinum]
Length=119

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 32/45 (71%), Gaps = 4/45 (9%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTARI----MEANDGATD  519
            YIS+P+KVKT+AS FR+LVQELTG+ S+ A I    +E  D   D
Sbjct  19   YISSPVKVKTNASNFRALVQELTGQDSNVAEITTMPLEEKDCVID  63



>ref|XP_007163886.1| hypothetical protein PHAVU_L008100g [Phaseolus vulgaris]
 gb|ESW35880.1| hypothetical protein PHAVU_L008100g [Phaseolus vulgaris]
Length=117

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTA  552
            YIS+P+KVKTSAS FR+LVQELTG++S+ A
Sbjct  18   YISSPVKVKTSASNFRALVQELTGQYSNVA  47



>emb|CDP09565.1| unnamed protein product [Coffea canephora]
Length=148

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSD  558
            YIS PMKVKTSAS FR+LVQELTG+ +D
Sbjct  27   YISNPMKVKTSASEFRALVQELTGQDAD  54



>gb|KHN37698.1| hypothetical protein glysoja_007401 [Glycine soja]
Length=123

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTA  552
            YIS+P+KVKTSAS FR+LVQELTG++S+ A
Sbjct  19   YISSPVKVKTSASNFRALVQELTGQYSNVA  48



>ref|NP_001235674.1| uncharacterized protein LOC100306482 [Glycine max]
 gb|ACU14684.1| unknown [Glycine max]
Length=123

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTA  552
            YIS+P+KVKTSAS FR+LVQELTG++S+ A
Sbjct  19   YISSPVKVKTSASNFRALVQELTGQYSNVA  48



>ref|XP_008788483.1| PREDICTED: sigma factor binding protein 2, chloroplastic-like 
[Phoenix dactylifera]
Length=152

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 3/40 (8%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDTA---RIMEAND  531
            YIS PMKVK SA+ FR LVQELTGR S+ A   R+ +A D
Sbjct  26   YISNPMKVKASAAEFRDLVQELTGRDSNVAYLSRLPDAED  65



>ref|XP_004493402.1| PREDICTED: sigma factor binding protein 1, chloroplastic-like 
[Cicer arietinum]
Length=156

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  641  YISTPMKVKTSASRFRSLVQELTGRHSDT  555
            YIS PMKVKTSAS FR+LVQELTG+++++
Sbjct  41   YISNPMKVKTSASEFRALVQELTGQYAES  69



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1863241968852