BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c2854_g1_i1 len=1088 path=[1:0-1087]

Length=1088
                                                                      Score     E

ref|XP_009622685.1|  PREDICTED: serine/threonine-protein kinase P...    462   8e-159   
ref|XP_009765259.1|  PREDICTED: serine/threonine-protein kinase P...    462   2e-158   
ref|XP_011100482.1|  PREDICTED: serine/threonine-protein kinase CDL1    460   2e-157   
ref|XP_004238437.1|  PREDICTED: serine/threonine-protein kinase P...    457   1e-156   
ref|XP_006342250.1|  PREDICTED: serine/threonine-protein kinase P...    456   4e-156   
ref|XP_009795599.1|  PREDICTED: serine/threonine-protein kinase P...    456   8e-156   
ref|XP_009620554.1|  PREDICTED: serine/threonine-protein kinase P...    454   6e-155   
gb|EPS67560.1|  protein kinase                                          447   5e-154   
gb|EPS58248.1|  protein kinase                                          446   9e-153   
ref|XP_006342702.1|  PREDICTED: serine/threonine-protein kinase P...    444   3e-151   
ref|XP_010314862.1|  PREDICTED: serine/threonine-protein kinase P...    444   4e-151   
ref|XP_010247085.1|  PREDICTED: serine/threonine-protein kinase P...    437   7e-149   
ref|XP_010247084.1|  PREDICTED: serine/threonine-protein kinase P...    438   8e-149   
ref|XP_007210692.1|  hypothetical protein PRUPE_ppa027153mg             435   2e-148   
ref|XP_004300677.1|  PREDICTED: serine/threonine-protein kinase P...    436   3e-148   
ref|XP_010094561.1|  Serine/threonine-protein kinase PBS1               436   4e-148   
ref|XP_009365692.1|  PREDICTED: serine/threonine-protein kinase P...    435   9e-148   
ref|XP_009365691.1|  PREDICTED: serine/threonine-protein kinase P...    435   9e-148   
ref|XP_010061183.1|  PREDICTED: serine/threonine-protein kinase P...    434   2e-147   
ref|XP_010061182.1|  PREDICTED: serine/threonine-protein kinase P...    434   4e-147   
ref|XP_008452969.1|  PREDICTED: serine/threonine-protein kinase P...    432   7e-147   
ref|XP_008364473.1|  PREDICTED: serine/threonine-protein kinase P...    433   7e-147   
ref|XP_008364474.1|  PREDICTED: serine/threonine-protein kinase A...    432   8e-147   
ref|XP_008452968.1|  PREDICTED: serine/threonine-protein kinase P...    432   8e-147   
ref|XP_004157074.1|  PREDICTED: serine/threonine-protein kinase P...    432   9e-147   
ref|XP_008237980.1|  PREDICTED: serine/threonine-protein kinase P...    432   1e-146   
ref|XP_011034867.1|  PREDICTED: serine/threonine-protein kinase C...    429   1e-145   
ref|XP_011034868.1|  PREDICTED: serine/threonine-protein kinase C...    429   1e-145   
ref|XP_010663978.1|  PREDICTED: serine/threonine-protein kinase C...    429   3e-145   
gb|KEH36324.1|  receptor Serine/Threonine kinase                        427   4e-145   
gb|KDO85108.1|  hypothetical protein CISIN_1g017246mg                   427   4e-145   
ref|XP_004500868.1|  PREDICTED: serine/threonine-protein kinase P...    427   6e-145   
ref|XP_008464836.1|  PREDICTED: serine/threonine-protein kinase PBS1    427   8e-145   
gb|KEH36323.1|  receptor Serine/Threonine kinase                        427   8e-145   
ref|XP_006435370.1|  hypothetical protein CICLE_v10001525mg             427   9e-145   
ref|XP_004145543.1|  PREDICTED: serine/threonine-protein kinase P...    427   1e-144   
emb|CBI40722.3|  unnamed protein product                                428   2e-144   
ref|XP_011074086.1|  PREDICTED: serine/threonine-protein kinase C...    426   2e-144   
ref|XP_002307795.2|  hypothetical protein POPTR_0005s27340g             426   3e-144   Populus trichocarpa [western balsam poplar]
ref|XP_011041217.1|  PREDICTED: serine/threonine-protein kinase C...    425   8e-144   
gb|KHG07081.1|  Serine/threonine-protein kinase PBS1                    424   5e-143   
ref|XP_002300640.2|  hypothetical protein POPTR_0002s01030g             422   7e-143   Populus trichocarpa [western balsam poplar]
ref|XP_007136023.1|  hypothetical protein PHAVU_009G011600g             421   2e-142   
emb|CDP07283.1|  unnamed protein product                                421   3e-142   
ref|XP_002510682.1|  receptor serine-threonine protein kinase, pu...    421   3e-142   Ricinus communis
ref|XP_011041219.1|  PREDICTED: serine/threonine-protein kinase C...    420   6e-142   
ref|XP_007018060.1|  Kinase superfamily protein                         420   1e-141   
ref|XP_004144242.1|  PREDICTED: serine/threonine-protein kinase P...    418   3e-141   
ref|XP_011041220.1|  PREDICTED: serine/threonine-protein kinase C...    417   6e-141   
emb|CDX96628.1|  BnaA08g21710D                                          416   1e-140   
ref|XP_006416375.1|  hypothetical protein EUTSA_v10007921mg             416   2e-140   
ref|XP_009110218.1|  PREDICTED: serine/threonine-protein kinase PBS1    416   2e-140   
ref|XP_010459753.1|  PREDICTED: serine/threonine-protein kinase P...    416   2e-140   
ref|XP_010459752.1|  PREDICTED: serine/threonine-protein kinase P...    416   2e-140   
gb|KHN33796.1|  Serine/threonine-protein kinase PBS1                    415   3e-140   
ref|XP_010459751.1|  PREDICTED: serine/threonine-protein kinase P...    416   4e-140   
gb|ADN33950.1|  protein kinase                                          416   4e-140   
ref|XP_010459750.1|  PREDICTED: serine/threonine-protein kinase P...    416   4e-140   
ref|XP_006416376.1|  hypothetical protein EUTSA_v10007921mg             415   7e-140   
gb|KFK44177.1|  hypothetical protein AALP_AA1G224600                    415   7e-140   
emb|CDY33638.1|  BnaC08g19380D                                          414   8e-140   
ref|XP_010477315.1|  PREDICTED: serine/threonine-protein kinase P...    414   1e-139   
dbj|BAD44229.1|  unknown protein                                        414   1e-139   Arabidopsis thaliana [mouse-ear cress]
ref|NP_173489.2|  protein ALTERED SEED GERMINATION 5                    414   1e-139   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006304635.1|  hypothetical protein CARUB_v10011749mg             414   2e-139   
ref|XP_010498498.1|  PREDICTED: serine/threonine-protein kinase P...    413   3e-139   
ref|XP_002893124.1|  protein kinase                                     411   1e-138   
ref|XP_010539791.1|  PREDICTED: serine/threonine-protein kinase P...    410   3e-138   
ref|NP_001241209.1|  serine/threonine-protein kinase PBS1-like          408   9e-138   
gb|ACU23090.1|  unknown                                                 407   2e-137   Glycine max [soybeans]
gb|KHN20109.1|  Serine/threonine-protein kinase PBS1                    407   2e-137   
ref|XP_010534191.1|  PREDICTED: serine/threonine-protein kinase P...    407   6e-137   
ref|XP_009149542.1|  PREDICTED: serine/threonine-protein kinase P...    404   9e-136   
ref|XP_006855747.1|  hypothetical protein AMTR_s00044p00167070          404   2e-135   
ref|XP_010645818.1|  PREDICTED: serine/threonine-protein kinase C...    402   2e-135   
gb|EPS64019.1|  hypothetical protein M569_10762                         400   1e-134   
emb|CDY29515.1|  BnaA06g14550D                                          398   2e-133   
ref|XP_009418675.1|  PREDICTED: serine/threonine-protein kinase P...    398   3e-133   
emb|CDY31493.1|  BnaC05g16020D                                          397   6e-133   
ref|XP_008809102.1|  PREDICTED: serine/threonine-protein kinase P...    397   6e-133   
ref|XP_009390872.1|  PREDICTED: serine/threonine-protein kinase P...    395   4e-132   
ref|XP_009604106.1|  PREDICTED: serine/threonine-protein kinase P...    394   5e-132   
ref|XP_010666681.1|  PREDICTED: serine/threonine-protein kinase CDL1    399   6e-132   
ref|XP_003549479.1|  PREDICTED: serine/threonine-protein kinase P...    393   8e-132   
ref|XP_009798942.1|  PREDICTED: serine/threonine-protein kinase P...    393   1e-131   
ref|XP_010905510.1|  PREDICTED: serine/threonine-protein kinase C...    394   1e-131   
ref|XP_009382067.1|  PREDICTED: serine/threonine-protein kinase P...    394   1e-131   
ref|XP_011011462.1|  PREDICTED: serine/threonine-protein kinase C...    398   2e-131   
ref|XP_009352224.1|  PREDICTED: serine/threonine-protein kinase P...    398   2e-131   
emb|CDO98901.1|  unnamed protein product                                397   4e-131   
gb|KHF97868.1|  Serine/threonine-protein kinase PBS1                    397   5e-131   
ref|XP_010024632.1|  PREDICTED: serine/threonine-protein kinase P...    396   6e-131   
ref|XP_011012992.1|  PREDICTED: serine/threonine-protein kinase C...    396   8e-131   
ref|XP_009339847.1|  PREDICTED: serine/threonine-protein kinase P...    396   1e-130   
ref|XP_008340835.1|  PREDICTED: serine/threonine-protein kinase P...    396   1e-130   
ref|XP_010558477.1|  PREDICTED: serine/threonine-protein kinase P...    395   1e-130   
ref|XP_009369116.1|  PREDICTED: serine/threonine-protein kinase P...    396   2e-130   
ref|XP_010037906.1|  PREDICTED: serine/threonine-protein kinase PBS1    391   2e-130   
ref|XP_010558479.1|  PREDICTED: serine/threonine-protein kinase P...    395   2e-130   
ref|XP_008390725.1|  PREDICTED: serine/threonine-protein kinase P...    395   2e-130   
gb|KDP40013.1|  hypothetical protein JCGZ_02011                         395   2e-130   
ref|XP_006419642.1|  hypothetical protein CICLE_v10004734mg             395   3e-130   
ref|XP_010243575.1|  PREDICTED: serine/threonine-protein kinase P...    395   3e-130   
gb|EPS73300.1|  hypothetical protein M569_01455                         389   3e-130   
ref|XP_006435369.1|  hypothetical protein CICLE_v10001525mg             387   4e-130   
ref|XP_009387655.1|  PREDICTED: serine/threonine-protein kinase P...    389   4e-130   
gb|EPS66443.1|  hypothetical protein M569_08334                         391   7e-130   
ref|XP_010098328.1|  Serine/threonine-protein kinase PBS1               394   9e-130   
ref|XP_009386542.1|  PREDICTED: serine/threonine-protein kinase P...    389   9e-130   
ref|XP_006342769.1|  PREDICTED: serine/threonine-protein kinase P...    394   9e-130   
ref|XP_004134473.1|  PREDICTED: serine/threonine-protein kinase P...    394   1e-129   
ref|XP_002516880.1|  receptor serine-threonine protein kinase, pu...    394   1e-129   Ricinus communis
ref|XP_004229213.1|  PREDICTED: serine/threonine-protein kinase PBS1    393   1e-129   
gb|EEC72116.1|  hypothetical protein OsI_05101                          392   1e-129   Oryza sativa Indica Group [Indian rice]
ref|XP_008438820.1|  PREDICTED: serine/threonine-protein kinase PBS1    393   1e-129   
ref|NP_177763.1|  putative protein kinase                               388   1e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003593976.1|  Protein kinase-like protein                        393   2e-129   
dbj|BAK02422.1|  predicted protein                                      392   2e-129   
ref|XP_010231481.1|  PREDICTED: serine/threonine-protein kinase P...    392   2e-129   
ref|XP_007035503.1|  Serine/threonine-protein kinase PBS1               393   2e-129   
ref|XP_004971195.1|  PREDICTED: serine/threonine-protein kinase P...    392   2e-129   
ref|XP_010690217.1|  PREDICTED: serine/threonine-protein kinase C...    388   2e-129   
gb|EYU45575.1|  hypothetical protein MIMGU_mgv1a004753mg                392   2e-129   
gb|KHG02623.1|  Serine/threonine-protein kinase PBS1                    392   3e-129   
emb|CBI26102.3|  unnamed protein product                                391   3e-129   
gb|EMS62361.1|  Serine/threonine-protein kinase PBS1                    391   3e-129   
ref|XP_010918258.1|  PREDICTED: serine/threonine-protein kinase C...    389   3e-129   
ref|XP_010241610.1|  PREDICTED: serine/threonine-protein kinase P...    392   4e-129   
ref|XP_008781320.1|  PREDICTED: serine/threonine-protein kinase P...    387   4e-129   
ref|XP_003565026.1|  PREDICTED: serine/threonine-protein kinase P...    391   4e-129   
ref|NP_001045326.1|  Os01g0936100                                       391   5e-129   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008442622.1|  PREDICTED: serine/threonine-protein kinase PBS1    387   5e-129   
ref|XP_004493931.1|  PREDICTED: serine/threonine-protein kinase P...    387   5e-129   
ref|XP_006645297.1|  PREDICTED: serine/threonine-protein kinase P...    391   5e-129   
gb|KHN47300.1|  Serine/threonine-protein kinase PBS1                    389   5e-129   
ref|XP_010546918.1|  PREDICTED: serine/threonine-protein kinase P...    389   5e-129   
ref|XP_009763396.1|  PREDICTED: serine/threonine-protein kinase PBS1    392   6e-129   
ref|XP_009412812.1|  PREDICTED: serine/threonine-protein kinase P...    391   6e-129   
ref|XP_002889078.1|  predicted protein                                  387   6e-129   
ref|XP_009606861.1|  PREDICTED: serine/threonine-protein kinase PBS1    391   7e-129   
ref|XP_002439693.1|  hypothetical protein SORBIDRAFT_09g018500          390   7e-129   Sorghum bicolor [broomcorn]
ref|XP_004296802.1|  PREDICTED: serine/threonine-protein kinase P...    391   7e-129   
ref|XP_008226810.1|  PREDICTED: serine/threonine-protein kinase P...    387   7e-129   
ref|XP_002439692.1|  hypothetical protein SORBIDRAFT_09g018490          390   7e-129   Sorghum bicolor [broomcorn]
ref|XP_010692532.1|  PREDICTED: serine/threonine-protein kinase P...    387   8e-129   
ref|XP_004962284.1|  PREDICTED: serine/threonine-protein kinase P...    390   9e-129   
ref|XP_006844582.1|  hypothetical protein AMTR_s00016p00203440          389   9e-129   
ref|XP_008807447.1|  PREDICTED: serine/threonine-protein kinase P...    386   1e-128   
ref|XP_010428694.1|  PREDICTED: serine/threonine-protein kinase P...    386   1e-128   
gb|AFW62440.1|  putative protein kinase superfamily protein             388   1e-128   
ref|XP_002312759.2|  hypothetical protein POPTR_0008s21040g             390   1e-128   Populus trichocarpa [western balsam poplar]
ref|XP_010471787.1|  PREDICTED: serine/threonine-protein kinase P...    386   1e-128   
ref|XP_004486047.1|  PREDICTED: serine/threonine-protein kinase P...    390   2e-128   
ref|XP_008655202.1|  PREDICTED: uncharacterized LOC100382129 isof...    390   2e-128   
ref|XP_008672176.1|  PREDICTED: uncharacterized protein LOC100193...    389   2e-128   
ref|XP_002275431.1|  PREDICTED: serine/threonine-protein kinase CDL1    391   2e-128   Vitis vinifera
ref|XP_010922485.1|  PREDICTED: serine/threonine-protein kinase C...    386   2e-128   
ref|XP_002978708.1|  hypothetical protein SELMODRAFT_13751              384   2e-128   
ref|XP_002525053.1|  receptor serine-threonine protein kinase, pu...    385   3e-128   Ricinus communis
ref|XP_009591503.1|  PREDICTED: serine/threonine-protein kinase P...    385   3e-128   
ref|XP_008792563.1|  PREDICTED: serine/threonine-protein kinase P...    385   3e-128   
ref|XP_010911042.1|  PREDICTED: serine/threonine-protein kinase C...    385   3e-128   
ref|XP_010937771.1|  PREDICTED: serine/threonine-protein kinase C...    385   3e-128   
ref|XP_003542923.1|  PREDICTED: serine/threonine-protein kinase P...    390   3e-128   
ref|XP_001769582.1|  predicted protein                                  385   3e-128   
ref|XP_009420286.1|  PREDICTED: serine/threonine-protein kinase P...    389   3e-128   
ref|XP_009417937.1|  PREDICTED: serine/threonine-protein kinase P...    389   3e-128   
ref|XP_008242015.1|  PREDICTED: serine/threonine-protein kinase PBS1    385   3e-128   
ref|XP_008223116.1|  PREDICTED: serine/threonine-protein kinase PBS1    389   4e-128   
ref|XP_007205320.1|  hypothetical protein PRUPE_ppa006902mg             385   4e-128   
ref|XP_008226809.1|  PREDICTED: serine/threonine-protein kinase P...    386   4e-128   
ref|XP_008784546.1|  PREDICTED: serine/threonine-protein kinase P...    386   5e-128   
ref|XP_002276042.1|  PREDICTED: serine/threonine-protein kinase CDL1    385   5e-128   Vitis vinifera
ref|XP_010937772.1|  PREDICTED: serine/threonine-protein kinase C...    385   5e-128   
ref|XP_003521368.1|  PREDICTED: serine/threonine-protein kinase P...    384   5e-128   
ref|XP_010921748.1|  PREDICTED: serine/threonine-protein kinase C...    387   6e-128   
gb|KHN09461.1|  Serine/threonine-protein kinase PBS1                    384   6e-128   
ref|XP_008792570.1|  PREDICTED: serine/threonine-protein kinase P...    385   6e-128   
gb|AFW71565.1|  putative protein kinase superfamily protein             387   6e-128   
ref|XP_001785516.1|  predicted protein                                  384   6e-128   
ref|XP_004295806.1|  PREDICTED: serine/threonine-protein kinase P...    384   7e-128   
emb|CDX97232.1|  BnaC09g43930D                                          387   7e-128   
ref|XP_006597536.1|  PREDICTED: serine/threonine-protein kinase P...    389   7e-128   
ref|XP_003554350.1|  PREDICTED: serine/threonine-protein kinase PBS1    384   7e-128   
ref|XP_009121792.1|  PREDICTED: serine/threonine-protein kinase PBS1    387   7e-128   
gb|KHN33127.1|  Serine/threonine-protein kinase PBS1                    389   8e-128   
ref|XP_010935291.1|  PREDICTED: serine/threonine-protein kinase C...    385   8e-128   
ref|XP_006301389.1|  hypothetical protein CARUB_v10021802mg             384   8e-128   
ref|XP_011090918.1|  PREDICTED: serine/threonine-protein kinase CDL1    389   9e-128   
ref|XP_008776230.1|  PREDICTED: serine/threonine-protein kinase P...    388   9e-128   
ref|XP_006858117.1|  hypothetical protein AMTR_s00062p00107880          385   1e-127   
ref|XP_008789020.1|  PREDICTED: serine/threonine-protein kinase P...    384   1e-127   
ref|XP_006367263.1|  PREDICTED: serine/threonine-protein kinase P...    384   1e-127   
ref|XP_010492062.1|  PREDICTED: serine/threonine-protein kinase PBS1    386   1e-127   
ref|XP_009404641.1|  PREDICTED: serine/threonine-protein kinase P...    384   1e-127   
ref|XP_006828265.1|  hypothetical protein AMTR_s00023p00210090          384   1e-127   
ref|XP_008789021.1|  PREDICTED: serine/threonine-protein kinase P...    384   1e-127   
ref|XP_009404642.1|  PREDICTED: serine/threonine-protein kinase P...    384   1e-127   
ref|XP_002452162.1|  hypothetical protein SORBIDRAFT_04g020990          388   1e-127   Sorghum bicolor [broomcorn]
ref|XP_006381520.1|  kinase family protein                              384   1e-127   
ref|NP_196820.1|  serine/threonine-protein kinase PBS1                  386   1e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009779569.1|  PREDICTED: serine/threonine-protein kinase P...    383   2e-127   
gb|ABR46067.1|  avrPphB susceptible 1                                   386   2e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007162707.1|  hypothetical protein PHAVU_001G173600g             382   2e-127   
ref|XP_010907662.1|  PREDICTED: serine/threonine-protein kinase P...    384   2e-127   
ref|XP_009342001.1|  PREDICTED: serine/threonine-protein kinase P...    383   2e-127   
ref|NP_001237717.1|  protein kinase-like protein                        383   2e-127   
ref|XP_007144514.1|  hypothetical protein PHAVU_007G162300g             383   2e-127   
ref|XP_006399804.1|  hypothetical protein EUTSA_v10013511mg             385   2e-127   
ref|NP_001149465.1|  LOC100283091                                       388   2e-127   Zea mays [maize]
gb|KHN48337.1|  Serine/threonine-protein kinase PBS1-like protein       383   2e-127   
ref|XP_007009661.1|  Kinase superfamily protein                         383   2e-127   
ref|XP_004246710.1|  PREDICTED: serine/threonine-protein kinase PBS1    383   2e-127   
ref|XP_010682694.1|  PREDICTED: serine/threonine-protein kinase PBS1    387   2e-127   
ref|XP_009774239.1|  PREDICTED: serine/threonine-protein kinase P...    383   2e-127   
ref|XP_002975807.1|  hypothetical protein SELMODRAFT_103605             386   2e-127   
ref|XP_003575029.2|  PREDICTED: serine/threonine-protein kinase P...    388   2e-127   
gb|KFK42057.1|  hypothetical protein AALP_AA2G205800                    383   3e-127   
ref|XP_010921747.1|  PREDICTED: serine/threonine-protein kinase C...    387   3e-127   
ref|XP_008796224.1|  PREDICTED: serine/threonine-protein kinase P...    386   3e-127   
ref|XP_007160596.1|  hypothetical protein PHAVU_001G000900g             381   3e-127   
dbj|BAK00146.1|  predicted protein                                      386   3e-127   
ref|XP_007223158.1|  hypothetical protein PRUPE_ppa004394mg             387   3e-127   
emb|CDX88927.1|  BnaA03g07220D                                          385   3e-127   
gb|AAT58829.1|  putative serine/threonine protein kinase                386   3e-127   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002316332.2|  hypothetical protein POPTR_0010s22220g             382   3e-127   Populus trichocarpa [western balsam poplar]
ref|XP_011027057.1|  PREDICTED: serine/threonine-protein kinase C...    380   4e-127   
ref|XP_007147876.1|  hypothetical protein PHAVU_006G162400g             387   4e-127   
ref|XP_009341993.1|  PREDICTED: serine/threonine-protein kinase P...    382   4e-127   
ref|XP_002973759.1|  hypothetical protein SELMODRAFT_99936              385   4e-127   
ref|XP_004163074.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    381   4e-127   
ref|XP_010931807.1|  PREDICTED: serine/threonine-protein kinase CDL1    384   4e-127   
ref|XP_004137797.1|  PREDICTED: serine/threonine-protein kinase P...    382   5e-127   
ref|XP_010645824.1|  PREDICTED: serine/threonine-protein kinase C...    379   5e-127   
ref|XP_004249609.1|  PREDICTED: serine/threonine-protein kinase P...    381   5e-127   
ref|XP_001769585.1|  predicted protein                                  384   5e-127   
ref|XP_011010693.1|  PREDICTED: serine/threonine-protein kinase C...    381   5e-127   
ref|XP_010253451.1|  PREDICTED: serine/threonine-protein kinase P...    382   6e-127   
ref|XP_010260133.1|  PREDICTED: serine/threonine-protein kinase P...    382   6e-127   
ref|XP_008371260.1|  PREDICTED: serine/threonine-protein kinase PBS1    382   6e-127   
ref|XP_010250600.1|  PREDICTED: serine/threonine-protein kinase PBS1    385   6e-127   
ref|XP_011027056.1|  PREDICTED: serine/threonine-protein kinase C...    381   6e-127   
ref|XP_006363681.1|  PREDICTED: serine/threonine-protein kinase P...    381   7e-127   
ref|XP_011004127.1|  PREDICTED: serine/threonine-protein kinase CDL1    382   7e-127   
gb|KFK26099.1|  hypothetical protein AALP_AA8G202700                    386   7e-127   
ref|XP_010926780.1|  PREDICTED: serine/threonine-protein kinase P...    384   7e-127   
ref|XP_009600576.1|  PREDICTED: serine/threonine-protein kinase P...    382   7e-127   
ref|XP_008233392.1|  PREDICTED: serine/threonine-protein kinase P...    381   8e-127   
ref|XP_002871549.1|  avrPphB susceptible 1                              384   8e-127   
ref|XP_010416553.1|  PREDICTED: serine/threonine-protein kinase P...    381   8e-127   
gb|KGN58922.1|  hypothetical protein Csa_3G736700                       383   8e-127   
gb|EYU39571.1|  hypothetical protein MIMGU_mgv1a008374mg                381   8e-127   
gb|KFK25542.1|  hypothetical protein AALP_AA8G128500                    384   8e-127   
ref|XP_008445831.1|  PREDICTED: serine/threonine-protein kinase P...    381   9e-127   
ref|XP_003542489.1|  PREDICTED: serine/threonine-protein kinase P...    381   9e-127   
ref|XP_006400410.1|  hypothetical protein EUTSA_v10013282mg             386   9e-127   
gb|ADE76472.1|  unknown                                                 384   9e-127   
gb|KEH42304.1|  receptor Serine/Threonine kinase                        381   9e-127   
ref|XP_010524756.1|  PREDICTED: serine/threonine-protein kinase P...    382   9e-127   
gb|ABR46086.1|  avrPphB susceptible 1                                   384   9e-127   Arabidopsis lyrata [lyrate rockcress]
ref|XP_008796223.1|  PREDICTED: serine/threonine-protein kinase P...    385   9e-127   
gb|KGN50481.1|  hypothetical protein Csa_5G176030                       381   1e-126   
ref|XP_004140546.1|  PREDICTED: serine/threonine-protein kinase P...    384   1e-126   
ref|XP_011009980.1|  PREDICTED: serine/threonine-protein kinase C...    381   1e-126   
ref|XP_010454113.1|  PREDICTED: serine/threonine-protein kinase P...    385   1e-126   
ref|XP_006370671.1|  kinase family protein                              381   1e-126   
ref|NP_197362.1|  protein kinase family protein                         385   1e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287535.1|  hypothetical protein CARUB_v10000743mg             385   1e-126   
ref|XP_010492877.1|  PREDICTED: serine/threonine-protein kinase P...    385   1e-126   
ref|XP_003625560.1|  Serine/threonine protein kinase PBS1               380   1e-126   
ref|XP_004143601.1|  PREDICTED: serine/threonine-protein kinase P...    381   1e-126   
gb|ABK28701.1|  unknown                                                 385   1e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008645721.1|  PREDICTED: serine/threonine-protein kinase PBS1    385   1e-126   
ref|XP_004152921.1|  PREDICTED: serine/threonine-protein kinase P...    382   1e-126   
ref|XP_002871824.1|  kinase family protein                              385   1e-126   
ref|XP_001781597.1|  predicted protein                                  383   2e-126   
ref|XP_010092124.1|  Serine/threonine-protein kinase PBS1               381   2e-126   
ref|XP_002525201.1|  receptor serine-threonine protein kinase, pu...    381   2e-126   Ricinus communis
gb|KHG29499.1|  Serine/threonine-protein kinase PBS1                    386   2e-126   
ref|XP_010922992.1|  PREDICTED: serine/threonine-protein kinase A...    382   2e-126   
ref|XP_010907661.1|  PREDICTED: serine/threonine-protein kinase P...    383   2e-126   
ref|XP_010260132.1|  PREDICTED: serine/threonine-protein kinase P...    382   2e-126   
ref|XP_010923933.1|  PREDICTED: serine/threonine-protein kinase C...    382   2e-126   
ref|XP_008387691.1|  PREDICTED: serine/threonine-protein kinase P...    380   2e-126   
ref|XP_004164336.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    381   2e-126   
ref|XP_010101497.1|  Serine/threonine-protein kinase PBS1               380   2e-126   
ref|XP_011009289.1|  PREDICTED: serine/threonine-protein kinase PBS1    380   2e-126   
gb|ACJ85744.1|  unknown                                                 381   2e-126   
ref|XP_007213881.1|  hypothetical protein PRUPE_ppa006853mg             380   2e-126   
ref|XP_008463434.1|  PREDICTED: serine/threonine-protein kinase P...    381   3e-126   
ref|XP_011071471.1|  PREDICTED: serine/threonine-protein kinase C...    385   3e-126   
ref|XP_002311125.1|  kinase 2 family protein                            380   3e-126   
gb|KHG04693.1|  Serine/threonine-protein kinase PBS1                    385   3e-126   
ref|XP_010276134.1|  PREDICTED: serine/threonine-protein kinase PBS1    380   3e-126   
ref|XP_010420637.1|  PREDICTED: serine/threonine-protein kinase P...    384   3e-126   
ref|XP_008349942.1|  PREDICTED: serine/threonine-protein kinase P...    379   3e-126   
gb|KDO67869.1|  hypothetical protein CISIN_1g0171752mg                  379   3e-126   
ref|XP_010100845.1|  Serine/threonine-protein kinase PBS1               380   3e-126   
ref|XP_009397999.1|  PREDICTED: serine/threonine-protein kinase P...    379   4e-126   
gb|KHG27222.1|  Serine/threonine-protein kinase PBS1                    380   4e-126   
ref|XP_006648669.1|  PREDICTED: serine/threonine-protein kinase P...    383   4e-126   
ref|NP_195900.2|  protein CDG1-LIKE 1                                   379   4e-126   
gb|EPS59174.1|  hypothetical protein M569_15636                         379   4e-126   
ref|XP_006438819.1|  hypothetical protein CICLE_v10031492mg             382   4e-126   
ref|XP_009402800.1|  PREDICTED: serine/threonine-protein kinase P...    380   5e-126   
ref|XP_009378601.1|  PREDICTED: serine/threonine-protein kinase P...    379   5e-126   
ref|XP_011084379.1|  PREDICTED: serine/threonine-protein kinase C...    382   5e-126   
ref|XP_004952572.1|  PREDICTED: serine/threonine-protein kinase P...    384   5e-126   
ref|XP_009131681.1|  PREDICTED: serine/threonine-protein kinase P...    384   5e-126   
emb|CDP04337.1|  unnamed protein product                                379   5e-126   
ref|XP_009391574.1|  PREDICTED: serine/threonine-protein kinase P...    383   5e-126   
ref|XP_008459890.1|  PREDICTED: serine/threonine-protein kinase PBS1    382   6e-126   
ref|XP_007043875.1|  Kinase superfamily protein                         382   6e-126   
gb|KDP26856.1|  hypothetical protein JCGZ_18014                         382   6e-126   
ref|XP_010032246.1|  PREDICTED: serine/threonine-protein kinase P...    379   6e-126   
gb|EEE63489.1|  hypothetical protein OsJ_18305                          386   8e-126   
ref|XP_011077018.1|  PREDICTED: serine/threonine-protein kinase C...    379   8e-126   
ref|XP_007027193.1|  Kinase superfamily protein isoform 1               379   8e-126   
ref|XP_009414192.1|  PREDICTED: serine/threonine-protein kinase PBS1    383   8e-126   
gb|EEC79090.1|  hypothetical protein OsI_19711                          386   8e-126   
gb|KEH44558.1|  receptor Serine/Threonine kinase                        382   9e-126   
emb|CAB86034.1|  protein kinase-like                                    379   9e-126   
emb|CDX85669.1|  BnaA02g01440D                                          380   9e-126   
ref|XP_006436178.1|  hypothetical protein CICLE_v10031854mg             379   9e-126   
gb|AFW62442.1|  putative protein kinase superfamily protein             384   9e-126   
emb|CBI23192.3|  unnamed protein product                                379   9e-126   
emb|CDP04377.1|  unnamed protein product                                378   1e-125   
ref|XP_002984636.1|  hypothetical protein SELMODRAFT_120844             383   1e-125   
ref|XP_006287412.1|  hypothetical protein CARUB_v10000618mg             385   1e-125   
ref|XP_009125889.1|  PREDICTED: serine/threonine-protein kinase P...    381   1e-125   
ref|XP_008791099.1|  PREDICTED: serine/threonine-protein kinase P...    382   1e-125   
emb|CDX91145.1|  BnaC02g04520D                                          380   1e-125   
gb|KHG17799.1|  Serine/threonine-protein kinase PBS1                    381   1e-125   
ref|XP_010062992.1|  PREDICTED: serine/threonine-protein kinase P...    379   2e-125   
ref|XP_009334856.1|  PREDICTED: serine/threonine-protein kinase A...    383   2e-125   
ref|XP_002514864.1|  receptor serine-threonine protein kinase, pu...    381   2e-125   
ref|XP_004497448.1|  PREDICTED: serine/threonine-protein kinase P...    378   2e-125   
ref|XP_002522988.1|  receptor serine-threonine protein kinase, pu...    378   2e-125   
emb|CDX92596.1|  BnaA10g16350D                                          381   2e-125   
ref|XP_006390205.1|  hypothetical protein EUTSA_v10018707mg             378   2e-125   
ref|XP_010534706.1|  PREDICTED: serine/threonine-protein kinase PBS1    380   2e-125   
emb|CDY13906.1|  BnaC09g39200D                                          381   2e-125   
ref|NP_001146011.1|  uncharacterized protein LOC100279542               380   2e-125   
gb|AFW82174.1|  putative protein kinase superfamily protein             380   2e-125   
ref|NP_001046943.1|  Os02g0513000                                       382   3e-125   
gb|EAY86023.1|  hypothetical protein OsI_07384                          382   3e-125   
ref|XP_002873066.1|  kinase family protein                              377   3e-125   
ref|XP_010908391.1|  PREDICTED: serine/threonine-protein kinase C...    377   3e-125   
ref|XP_008654811.1|  PREDICTED: uncharacterized protein LOC100279...    381   3e-125   
gb|KFK24731.1|  hypothetical protein AALP_AA8G017200                    377   3e-125   
ref|XP_008804099.1|  PREDICTED: serine/threonine-protein kinase P...    380   3e-125   
emb|CDY53627.1|  BnaC03g71490D                                          381   3e-125   
gb|KHG17801.1|  Serine/threonine-protein kinase PBS1                    380   3e-125   
ref|XP_009421368.1|  PREDICTED: serine/threonine-protein kinase P...    377   4e-125   
ref|XP_010543354.1|  PREDICTED: serine/threonine-protein kinase P...    377   4e-125   
ref|XP_006588366.1|  PREDICTED: serine/threonine protein kinase i...    380   4e-125   
ref|XP_008775515.1|  PREDICTED: serine/threonine-protein kinase P...    378   4e-125   
ref|XP_009120958.1|  PREDICTED: serine/threonine-protein kinase PBS1    382   4e-125   
ref|XP_008340255.1|  PREDICTED: serine/threonine-protein kinase P...    380   5e-125   
ref|NP_001238726.1|  serine/threonine protein kinase                    379   5e-125   
emb|CDP13387.1|  unnamed protein product                                379   5e-125   
emb|CDX70830.1|  BnaC03g09140D                                          380   6e-125   
ref|XP_010466249.1|  PREDICTED: serine/threonine-protein kinase P...    377   6e-125   
ref|XP_009349479.1|  PREDICTED: serine/threonine-protein kinase P...    379   6e-125   
ref|XP_006857383.1|  hypothetical protein AMTR_s00067p00132580          378   6e-125   
emb|CAN68637.1|  hypothetical protein VITISV_030804                     376   6e-125   
ref|XP_009421367.1|  PREDICTED: serine/threonine-protein kinase P...    377   6e-125   
ref|XP_010044856.1|  PREDICTED: serine/threonine-protein kinase P...    379   6e-125   
ref|XP_010655363.1|  PREDICTED: serine/threonine-protein kinase CDL1    376   6e-125   
ref|XP_002283397.3|  PREDICTED: serine/threonine-protein kinase C...    378   7e-125   
dbj|BAB01161.1|  receptor protein kinase-like protein                   376   7e-125   
ref|NP_001060744.1|  Os07g0695300                                       377   8e-125   
gb|EMT17519.1|  Serine/threonine-protein kinase PBS1                    381   8e-125   
gb|AGU91423.1|  serine/threonine-protein kinase PBS1                    376   1e-124   
ref|XP_009131321.1|  PREDICTED: serine/threonine-protein kinase P...    378   1e-124   
ref|XP_008389922.1|  PREDICTED: serine/threonine-protein kinase P...    379   1e-124   
emb|CAN68395.1|  hypothetical protein VITISV_021095                     377   1e-124   
ref|XP_004958623.1|  PREDICTED: serine/threonine-protein kinase P...    379   1e-124   
ref|XP_009763258.1|  PREDICTED: serine/threonine-protein kinase PBS1    378   1e-124   
gb|EMT04522.1|  Serine/threonine-protein kinase PBS1                    377   1e-124   
gb|KEH36325.1|  receptor Serine/Threonine kinase                        371   1e-124   
ref|XP_010929601.1|  PREDICTED: serine/threonine-protein kinase P...    379   1e-124   
ref|XP_006655252.1|  PREDICTED: serine/threonine-protein kinase P...    379   1e-124   
ref|XP_006398733.1|  hypothetical protein EUTSA_v10013827mg             375   1e-124   
emb|CDX78510.1|  BnaA03g04220D                                          378   2e-124   
ref|XP_008369577.1|  PREDICTED: serine/threonine-protein kinase P...    375   2e-124   
ref|XP_002883253.1|  kinase family protein                              375   2e-124   
emb|CDX85945.1|  BnaC06g21890D                                          375   2e-124   
ref|XP_010025276.1|  PREDICTED: serine/threonine-protein kinase P...    378   2e-124   
ref|XP_003556585.1|  PREDICTED: serine/threonine-protein kinase P...    378   2e-124   
ref|XP_010908394.1|  PREDICTED: serine/threonine-protein kinase C...    375   2e-124   
ref|XP_006606603.1|  PREDICTED: serine/threonine-protein kinase P...    378   2e-124   
ref|XP_009608033.1|  PREDICTED: serine/threonine-protein kinase P...    376   2e-124   
gb|AAQ96340.1|  protein kinase-like protein                             375   2e-124   
ref|NP_001235164.1|  serine/threonine-protein kinase                    378   2e-124   
ref|XP_009619102.1|  PREDICTED: serine/threonine-protein kinase PBS1    377   2e-124   
ref|XP_010090682.1|  Serine/threonine-protein kinase PBS1               378   2e-124   
ref|NP_188689.1|  protein kinase family protein                         375   2e-124   
ref|XP_010558291.1|  PREDICTED: serine/threonine-protein kinase P...    375   3e-124   
ref|XP_010488036.1|  PREDICTED: serine/threonine-protein kinase P...    375   3e-124   
ref|XP_010509033.1|  PREDICTED: serine/threonine-protein kinase P...    375   3e-124   
ref|XP_007020923.1|  Kinase superfamily protein isoform 1               375   3e-124   
ref|XP_006406373.1|  hypothetical protein EUTSA_v10020863mg             375   3e-124   
ref|XP_010423818.1|  PREDICTED: serine/threonine-protein kinase P...    375   3e-124   
ref|XP_006287938.1|  hypothetical protein CARUB_v10001173mg             375   3e-124   
emb|CBI38166.3|  unnamed protein product                                377   3e-124   
ref|XP_010490743.1|  PREDICTED: serine/threonine-protein kinase P...    375   3e-124   
ref|XP_009131322.1|  PREDICTED: serine/threonine-protein kinase P...    374   3e-124   
ref|XP_009799954.1|  PREDICTED: serine/threonine-protein kinase P...    375   3e-124   
ref|XP_007142261.1|  hypothetical protein PHAVU_008G265800g             374   4e-124   
ref|XP_009349857.1|  PREDICTED: serine/threonine-protein kinase A...    384   4e-124   
ref|XP_009357614.1|  PREDICTED: serine/threonine-protein kinase P...    375   4e-124   
ref|XP_008783775.1|  PREDICTED: serine/threonine-protein kinase P...    378   4e-124   
ref|XP_010694191.1|  PREDICTED: serine/threonine-protein kinase CDL1    376   4e-124   
ref|XP_010239842.1|  PREDICTED: serine/threonine-protein kinase P...    375   4e-124   
gb|EMT16313.1|  Serine/threonine-protein kinase PBS1                    374   4e-124   
gb|EPS68489.1|  hypothetical protein M569_06278                         374   5e-124   
ref|XP_004310112.1|  PREDICTED: serine/threonine-protein kinase P...    377   5e-124   
ref|XP_004497429.1|  PREDICTED: serine/threonine-protein kinase P...    377   5e-124   
ref|XP_004497430.1|  PREDICTED: serine/threonine-protein kinase P...    377   6e-124   
gb|AAY17587.1|  serine/threonine kinase                                 375   6e-124   
dbj|BAK04587.1|  predicted protein                                      375   6e-124   
ref|XP_010452126.1|  PREDICTED: serine/threonine-protein kinase P...    374   6e-124   
ref|XP_009110389.1|  PREDICTED: serine/threonine-protein kinase P...    374   7e-124   
ref|XP_009621176.1|  PREDICTED: serine/threonine-protein kinase A...    376   7e-124   
emb|CDX68101.1|  BnaA07g21410D                                          374   7e-124   
ref|XP_002265076.1|  PREDICTED: serine/threonine-protein kinase PBS1    377   7e-124   
ref|XP_010024631.1|  PREDICTED: serine/threonine-protein kinase P...    380   8e-124   
ref|XP_006584465.1|  PREDICTED: serine/threonine-protein kinase i...    377   8e-124   
ref|XP_002281418.1|  PREDICTED: serine/threonine-protein kinase CDL1    374   8e-124   
ref|XP_002463358.1|  hypothetical protein SORBIDRAFT_02g042320          377   8e-124   
ref|XP_004958813.1|  PREDICTED: serine/threonine-protein kinase P...    374   8e-124   
ref|XP_010267692.1|  PREDICTED: serine/threonine-protein kinase P...    375   8e-124   
ref|XP_010693107.1|  PREDICTED: serine/threonine-protein kinase C...    374   8e-124   
ref|XP_011094757.1|  PREDICTED: serine/threonine-protein kinase CDL1    374   8e-124   
ref|XP_004307435.1|  PREDICTED: serine/threonine-protein kinase P...    373   1e-123   
ref|XP_009389629.1|  PREDICTED: serine/threonine-protein kinase P...    376   1e-123   
dbj|BAK06731.1|  predicted protein                                      377   1e-123   
gb|ADP09025.1|  protein serine/threonine kinase                         377   1e-123   
ref|XP_002304664.2|  Serine/threonine-protein kinase PBS1               376   1e-123   
emb|CDP06697.1|  unnamed protein product                                374   1e-123   
gb|ACL18059.1|  STK                                                     377   1e-123   
ref|XP_010693106.1|  PREDICTED: serine/threonine-protein kinase C...    373   1e-123   
ref|XP_010693108.1|  PREDICTED: serine/threonine-protein kinase C...    373   1e-123   
gb|AAO41930.1|  putative protein kinase                                 373   2e-123   
ref|XP_009338563.1|  PREDICTED: serine/threonine-protein kinase P...    374   2e-123   
ref|XP_006584464.1|  PREDICTED: serine/threonine-protein kinase i...    377   2e-123   
ref|XP_007142595.1|  hypothetical protein PHAVU_007G000800g             376   2e-123   
ref|XP_008651298.1|  PREDICTED: uncharacterized protein LOC100279...    375   2e-123   
ref|XP_003579656.1|  PREDICTED: serine/threonine-protein kinase P...    376   2e-123   
ref|XP_009336453.1|  PREDICTED: serine/threonine-protein kinase P...    375   2e-123   
ref|XP_007142596.1|  hypothetical protein PHAVU_007G000800g             376   2e-123   
ref|XP_010904786.1|  PREDICTED: serine/threonine-protein kinase C...    378   2e-123   
gb|KDP44145.1|  hypothetical protein JCGZ_05612                         371   2e-123   
gb|KDP39094.1|  hypothetical protein JCGZ_00851                         372   2e-123   
ref|XP_010233499.1|  PREDICTED: serine/threonine-protein kinase P...    373   2e-123   
ref|XP_002461283.1|  hypothetical protein SORBIDRAFT_02g044090          373   3e-123   
ref|XP_008783727.1|  PREDICTED: serine/threonine-protein kinase A...    374   3e-123   
ref|XP_009372484.1|  PREDICTED: serine/threonine-protein kinase A...    374   3e-123   
ref|XP_010267690.1|  PREDICTED: serine/threonine-protein kinase P...    374   3e-123   
ref|XP_010267693.1|  PREDICTED: serine/threonine-protein kinase P...    374   3e-123   
ref|XP_011086845.1|  PREDICTED: serine/threonine-protein kinase PBS1    375   3e-123   
emb|CDY55687.1|  BnaC02g03480D                                          372   3e-123   
gb|KFK39360.1|  hypothetical protein AALP_AA3G234600                    372   3e-123   
gb|EMS58821.1|  Serine/threonine-protein kinase PBS1                    380   4e-123   
ref|XP_009333618.1|  PREDICTED: serine/threonine-protein kinase P...    372   4e-123   
ref|XP_008372620.1|  PREDICTED: serine/threonine-protein kinase A...    371   4e-123   
ref|XP_008651297.1|  PREDICTED: uncharacterized protein LOC100279...    375   4e-123   
ref|XP_009125464.1|  PREDICTED: serine/threonine-protein kinase PBS1    372   4e-123   
ref|XP_004239305.1|  PREDICTED: serine/threonine-protein kinase P...    375   4e-123   
gb|ADP09024.1|  protein serine/threonine kinase                         375   4e-123   
emb|CDX82241.1|  BnaA03g35800D                                          372   5e-123   
gb|KCW50183.1|  hypothetical protein EUGRSUZ_K03611                     372   5e-123   
ref|XP_002446325.1|  hypothetical protein SORBIDRAFT_06g014310          375   5e-123   
ref|XP_010321113.1|  PREDICTED: serine/threonine-protein kinase P...    375   5e-123   
ref|XP_002297857.2|  hypothetical protein POPTR_0001s13420g             375   5e-123   
emb|CDY36035.1|  BnaC03g41630D                                          371   5e-123   
ref|XP_009405514.1|  PREDICTED: serine/threonine-protein kinase P...    375   5e-123   
ref|XP_010530947.1|  PREDICTED: serine/threonine-protein kinase P...    374   5e-123   
gb|KCW70161.1|  hypothetical protein EUGRSUZ_F03450                     372   6e-123   
emb|CBI26605.3|  unnamed protein product                                370   6e-123   
ref|XP_004500141.1|  PREDICTED: serine/threonine-protein kinase P...    374   6e-123   
ref|XP_011030818.1|  PREDICTED: serine/threonine-protein kinase P...    371   7e-123   
ref|XP_011030821.1|  PREDICTED: serine/threonine-protein kinase P...    371   7e-123   
ref|XP_009402169.1|  PREDICTED: serine/threonine-protein kinase P...    374   7e-123   
ref|XP_010039298.1|  PREDICTED: serine/threonine-protein kinase A...    373   8e-123   
emb|CDX88266.1|  BnaC06g37100D                                          371   1e-122   
gb|ACL18058.1|  STK                                                     374   1e-122   
emb|CDY01360.1|  BnaA07g11330D                                          370   1e-122   
gb|KCW44453.1|  hypothetical protein EUGRSUZ_L02048                     370   1e-122   
ref|XP_002284672.1|  PREDICTED: serine/threonine-protein kinase C...    373   1e-122   
ref|XP_010545540.1|  PREDICTED: serine/threonine-protein kinase PBS1    371   1e-122   
ref|XP_007049794.1|  Kinase superfamily protein                         372   1e-122   
ref|XP_004975429.1|  PREDICTED: serine/threonine-protein kinase P...    374   1e-122   
ref|XP_009605721.1|  PREDICTED: serine/threonine-protein kinase A...    373   1e-122   
ref|XP_009419365.1|  PREDICTED: serine/threonine-protein kinase P...    374   1e-122   
ref|XP_002441330.1|  hypothetical protein SORBIDRAFT_09g024560          375   2e-122   
ref|NP_001147850.1|  serine/threonine-protein kinase NAK                374   2e-122   
gb|EMT00385.1|  Serine/threonine-protein kinase PBS1                    373   2e-122   
ref|XP_006452255.1|  hypothetical protein CICLE_v10010152mg             371   2e-122   



>ref|XP_009622685.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Nicotiana 
tomentosiformis]
Length=374

 Score =   462 bits (1190),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 233/289 (81%), Positives = 263/289 (91%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            ATQNF+E+NL+GEGGFGSVYKG ++S  +VA+KQL+ +GLQGNQEFIVEVLMLSLLHH N
Sbjct  68   ATQNFRETNLIGEGGFGSVYKGRLESALIVAIKQLNLDGLQGNQEFIVEVLMLSLLHHKN  127

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYCT GDQRLLVYE+MP GSLENHLF+LE GK+ L+W  RLKIAAGAA GLEYLH
Sbjct  128  LVNLIGYCTDGDQRLLVYEFMPMGSLENHLFDLELGKKPLSWSTRLKIAAGAAHGLEYLH  187

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C ANPPVIYRDLKSSNILLD +FNP+LSDFGLAKLGPVG+NTHVSTRVMGTYGYCAPEYA
Sbjct  188  CEANPPVIYRDLKSSNILLDNDFNPKLSDFGLAKLGPVGENTHVSTRVMGTYGYCAPEYA  247

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYS GVVLLELITGR+AYDS  K GEQNLV + RPFLKD+R+FV M DPL
Sbjct  248  MSGKLTLKSDIYSLGVVLLELITGRKAYDSSRKTGEQNLVVWSRPFLKDRRKFVHMVDPL  307

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L  +FSVRSLHHAVAITAMC+Q+QA+FRP ISDI +ALDYLV+QA++S+
Sbjct  308  LYGQFSVRSLHHAVAITAMCIQEQANFRPIISDIVVALDYLVSQAESSD  356



>ref|XP_009765259.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Nicotiana 
sylvestris]
Length=374

 Score =   462 bits (1188),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 233/289 (81%), Positives = 263/289 (91%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            ATQNF+E+NL+GEGGFGSVYKG ++S  +VA+KQL+ +GLQGNQEFIVEVLMLSLLHH N
Sbjct  68   ATQNFRETNLIGEGGFGSVYKGRLESGLIVAIKQLNLDGLQGNQEFIVEVLMLSLLHHKN  127

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYCT GDQRLLVYE+MP GSLENHLF+LE GK+ L+W  RLKIAAGAA GLEYLH
Sbjct  128  LVNLIGYCTDGDQRLLVYEFMPMGSLENHLFDLEPGKKPLSWSTRLKIAAGAAHGLEYLH  187

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C ANPPVIYRDLKSSNILLD +FNP+LSDFGLAKLGPVG+NTHVSTRVMGTYGYCAPEYA
Sbjct  188  CEANPPVIYRDLKSSNILLDNDFNPKLSDFGLAKLGPVGENTHVSTRVMGTYGYCAPEYA  247

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYS GVVLLELITGR+AYDS  K GEQNLV + RPFLKD+R+FV M DPL
Sbjct  248  MSGKLTLKSDIYSLGVVLLELITGRKAYDSSRKTGEQNLVVWSRPFLKDRRKFVHMVDPL  307

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L  +FSVRSLHHAVAITAMC+Q+QA+FRP ISDI +ALDYLV+QA++S+
Sbjct  308  LYGQFSVRSLHHAVAITAMCIQEQANFRPIISDIVVALDYLVSQAESSD  356



>ref|XP_011100482.1| PREDICTED: serine/threonine-protein kinase CDL1 [Sesamum indicum]
Length=390

 Score =   460 bits (1183),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 232/290 (80%), Positives = 261/290 (90%), Gaps = 0/290 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            ATQNF+++NL+GEGGFGSV+KG ++S  VVAVKQL+ EGLQGNQEFIVEVLMLSLLHH N
Sbjct  73   ATQNFRDANLIGEGGFGSVFKGRLESGLVVAVKQLNLEGLQGNQEFIVEVLMLSLLHHPN  132

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYCT GDQRLLVYE+MP GSLENHLF++E G++ L+W  RLKIA GAARGLEYLH
Sbjct  133  LVNLIGYCTDGDQRLLVYEFMPMGSLENHLFDVEPGQKPLSWSTRLKIAVGAARGLEYLH  192

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C ANPPVIYRDLKSSNILLD +FN +LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  193  CKANPPVIYRDLKSSNILLDNDFNVKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  252

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYSFGVV+LELITGR+A D    PGEQNLV++ RPFLKD+R+FV+M DPL
Sbjct  253  MSGKLTLKSDIYSFGVVMLELITGRKAIDCTRMPGEQNLVAWSRPFLKDRRKFVQMVDPL  312

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSER  871
            LE RFSVRSLHHA+AITAMCLQ+QASFRP ISDI MAL+YL +QA+   R
Sbjct  313  LEGRFSVRSLHHAIAITAMCLQEQASFRPLISDIVMALEYLASQAEEKGR  362



>ref|XP_004238437.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Solanum 
lycopersicum]
Length=370

 Score =   457 bits (1176),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 229/289 (79%), Positives = 262/289 (91%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            ATQNF+E+NL+GEGGFGSVYKG ++S  VVA+KQL+ +GLQG+QEFIVEVLMLSLLHH N
Sbjct  64   ATQNFREANLIGEGGFGSVYKGRLESGLVVAIKQLNLDGLQGHQEFIVEVLMLSLLHHKN  123

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL GYCT GDQRLL+YE+MP GSLENHLF++E GK+ L+W  RLKIA+GAA GLEYLH
Sbjct  124  LVNLTGYCTDGDQRLLIYEFMPMGSLENHLFDVEPGKKPLSWSTRLKIASGAAHGLEYLH  183

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C ANPPVIYRDLKSSNILLD +FNP+LSDFGLAKLGPVG+NTHVSTRVMGTYGYCAPEYA
Sbjct  184  CKANPPVIYRDLKSSNILLDNDFNPKLSDFGLAKLGPVGENTHVSTRVMGTYGYCAPEYA  243

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYS GVVLLELITGR+AYD+  + GEQNLV + RPFLKD+R+FV M DPL
Sbjct  244  MSGKLTLKSDIYSLGVVLLELITGRKAYDNSKEAGEQNLVVWSRPFLKDRRKFVHMVDPL  303

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L  +FSVRSLHHAVAITAMC+Q+QASFRP ISDI +ALDYLV+QA++S+
Sbjct  304  LNGQFSVRSLHHAVAITAMCIQEQASFRPIISDIVVALDYLVSQAESSD  352



>ref|XP_006342250.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Solanum 
tuberosum]
Length=370

 Score =   456 bits (1172),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 230/289 (80%), Positives = 261/289 (90%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            ATQNF+E+NLLGEGGFG VYKG ++S  VVA+KQL+ +GLQG QEFIVEVLMLSLLHH N
Sbjct  64   ATQNFREANLLGEGGFGRVYKGRLESGLVVAIKQLNLDGLQGQQEFIVEVLMLSLLHHKN  123

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYCT GDQ+LLVYE+MP GSLENHLF+LE GK+ L+W  RLKIA+GAA GLEYLH
Sbjct  124  LVNLIGYCTDGDQKLLVYEFMPMGSLENHLFDLEPGKKPLSWSTRLKIASGAAHGLEYLH  183

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C ANPPVIYRDLKSSNILLD +FNP+LSDFGLAKLGPVG+NTHVSTRVMGTYGYCAPEYA
Sbjct  184  CEANPPVIYRDLKSSNILLDNDFNPKLSDFGLAKLGPVGENTHVSTRVMGTYGYCAPEYA  243

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYS GVVLLELITGR+AYD+  + GEQNLV + RPFLKD+R+FV M DPL
Sbjct  244  MSGKLTLKSDIYSLGVVLLELITGRKAYDNSKEAGEQNLVVWSRPFLKDRRKFVHMVDPL  303

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L  +FSVRSLHHAVAITAMC+Q+QASFRP ISDI +ALDYLV+QA++S+
Sbjct  304  LNGQFSVRSLHHAVAITAMCIQEQASFRPIISDIVVALDYLVSQAESSD  352



>ref|XP_009795599.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Nicotiana 
sylvestris]
Length=398

 Score =   456 bits (1173),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 233/288 (81%), Positives = 256/288 (89%), Gaps = 1/288 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            ATQNFKE+NL+GEGGFG VYKG +DS  +VA+KQL+ EGLQGNQEFIVEVLMLSLLHH N
Sbjct  76   ATQNFKETNLIGEGGFGCVYKGRLDSGLIVAIKQLNLEGLQGNQEFIVEVLMLSLLHHKN  135

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYCTHGDQRLLVYE+MP GSLENHLF+LE G E L+W  RLKIAAGAA GLEYLH
Sbjct  136  LVNLIGYCTHGDQRLLVYEFMPMGSLENHLFDLEPGTEPLSWRTRLKIAAGAAHGLEYLH  195

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
              ANPPVIYRDLKSSNILLD EFNP+LSDFGLAKLGPVGDNTHVSTRVMG+YGYCAPEYA
Sbjct  196  -KANPPVIYRDLKSSNILLDNEFNPKLSDFGLAKLGPVGDNTHVSTRVMGSYGYCAPEYA  254

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+GKLTLKSDIYS GVVLLELITGR+AYD+  KPGEQNLV +  PFLKD+R++V M DP 
Sbjct  255  MTGKLTLKSDIYSMGVVLLELITGRKAYDTSKKPGEQNLVVWSSPFLKDRRKYVHMVDPS  314

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTS  865
            L  +FS R LHHAVAITAMCLQ+QA+FRP ISDI  ALDYLVAQAQ+S
Sbjct  315  LHGQFSARCLHHAVAITAMCLQEQANFRPMISDIVTALDYLVAQAQSS  362



>ref|XP_009620554.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Nicotiana 
tomentosiformis]
Length=398

 Score =   454 bits (1167),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 231/288 (80%), Positives = 255/288 (89%), Gaps = 1/288 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            ATQNF+E+NL+GEGGFG VYKG +DS  +VA+KQL+ EGLQGNQEFIVEVLMLSLLHH N
Sbjct  76   ATQNFRETNLIGEGGFGCVYKGRLDSGLIVAIKQLNLEGLQGNQEFIVEVLMLSLLHHKN  135

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYCTHGDQRLLVYE+MP GSLENHLF+LE G E L+W  RLKIAAGAA GLEYLH
Sbjct  136  LVNLIGYCTHGDQRLLVYEFMPMGSLENHLFDLEPGTEPLSWRTRLKIAAGAAHGLEYLH  195

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
              ANPPVIYRDLK+SNILLD EFNP+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  196  -KANPPVIYRDLKTSNILLDNEFNPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  254

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+GKLTLKSDIYS GVVLLELITGR+AYD+  KPGEQNLV +  PFLKD+R++V M +P 
Sbjct  255  MTGKLTLKSDIYSMGVVLLELITGRKAYDTSKKPGEQNLVVWSSPFLKDRRKYVHMVEPS  314

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTS  865
            L  +FS R LHHAVAITAMCLQ+QA+FRP ISDI  ALDYLVAQAQ S
Sbjct  315  LHGQFSARCLHHAVAITAMCLQEQANFRPMISDIVTALDYLVAQAQNS  362



>gb|EPS67560.1| protein kinase, partial [Genlisea aurea]
Length=296

 Score =   447 bits (1151),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 227/288 (79%), Positives = 258/288 (90%), Gaps = 3/288 (1%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            ATQNF+E+NL+GEGGFGSVYKG ++S +VVAVKQL+ EGLQGNQEFIVEVLMLSLLHH N
Sbjct  12   ATQNFREANLIGEGGFGSVYKGRLESGTVVAVKQLNHEGLQGNQEFIVEVLMLSLLHHPN  71

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYC  GDQRLLVYE+MP GSLENHLF++E+G   L+W  RLKI  G ARGLEYLH
Sbjct  72   LVNLIGYCADGDQRLLVYEFMPLGSLENHLFDVESG---LSWSTRLKIGYGTARGLEYLH  128

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C ANPPVIYRDLKSSNILLD++F  +LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  129  CKANPPVIYRDLKSSNILLDDDFGVKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  188

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYSFGVVLLELITGR+A D D  PGEQNLV++ RPFLKD+R+F+++ DPL
Sbjct  189  MSGKLTLKSDIYSFGVVLLELITGRKAIDGDRDPGEQNLVAWARPFLKDRRKFLQIVDPL  248

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTS  865
            LE RFS RSLHHA+AITAMCLQ+QASFRP I+DI +AL+YL +QA+ S
Sbjct  249  LEGRFSTRSLHHAIAITAMCLQEQASFRPLITDIVLALEYLSSQAEDS  296



>gb|EPS58248.1| protein kinase, partial [Genlisea aurea]
Length=354

 Score =   446 bits (1148),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 225/288 (78%), Positives = 257/288 (89%), Gaps = 0/288 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            ATQNF+++NL+GEGGFGSVYKG ++S +VVAVKQL+ EGLQGNQEFIVEVLMLSLLHH N
Sbjct  62   ATQNFRDANLIGEGGFGSVYKGRLESGTVVAVKQLNHEGLQGNQEFIVEVLMLSLLHHPN  121

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYC  GDQRLLVYE+MP GSLENHLF+L +G + L+W  RLKI  G ARGLEYLH
Sbjct  122  LVNLIGYCADGDQRLLVYEFMPMGSLENHLFDLHSGHKPLSWSTRLKIGFGTARGLEYLH  181

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C ANPPVIYRDLKSSNILLD +FN +LSDFGLAKLGPVG+NTHVSTRVMGTYGYCAPEYA
Sbjct  182  CKANPPVIYRDLKSSNILLDNDFNVKLSDFGLAKLGPVGNNTHVSTRVMGTYGYCAPEYA  241

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+GKLTLKSDIYSFGVVLLELITGR+A DS+   GEQNLVS+ RPFLKD+R+FV++ DP 
Sbjct  242  MTGKLTLKSDIYSFGVVLLELITGRKAIDSERALGEQNLVSWARPFLKDRRKFVQIVDPS  301

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTS  865
            LE RFS RSLHHA+AITAMCLQ+QASFRP I+DI +AL+YL +QA+ S
Sbjct  302  LEGRFSTRSLHHAIAITAMCLQEQASFRPLITDIVLALEYLSSQAEDS  349



>ref|XP_006342702.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Solanum 
tuberosum]
Length=400

 Score =   444 bits (1143),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 224/288 (78%), Positives = 257/288 (89%), Gaps = 1/288 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            ATQ+F+E+NL+GEGGFGSVYKG IDS  +VA+KQL+ EGLQGNQEF+VEVLMLSL+HHNN
Sbjct  77   ATQSFRETNLIGEGGFGSVYKGRIDSGQIVAIKQLNLEGLQGNQEFVVEVLMLSLMHHNN  136

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYCTHG+QRLLVYE+MP GSLENHLF+LE G   L+W  RLKIAAGAA GLEYLH
Sbjct  137  LVNLIGYCTHGEQRLLVYEFMPLGSLENHLFDLEPGTTPLSWKTRLKIAAGAAHGLEYLH  196

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
              ANPPVIYRDLKSSNILLD +FNP+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  197  -KANPPVIYRDLKSSNILLDNDFNPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  255

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+GKLTLKSDIYSFGVVLLELITGR+AYD+  K GEQNLV +  PFLKD+R+++ + DP+
Sbjct  256  MTGKLTLKSDIYSFGVVLLELITGRKAYDTSKKQGEQNLVVWSNPFLKDRRKYIHLVDPM  315

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTS  865
            L+ +FS R LHHAVA+TAMCLQ+QASFRP+ +DI  ALDYL+ QAQ S
Sbjct  316  LDGQFSSRCLHHAVAVTAMCLQEQASFRPSTTDIVTALDYLLLQAQHS  363



>ref|XP_010314862.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Solanum 
lycopersicum]
Length=415

 Score =   444 bits (1143),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 225/288 (78%), Positives = 257/288 (89%), Gaps = 1/288 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            ATQ+F+E+NL+GEGGFGSVYKG IDS  +VA+KQL+ EGLQGNQEF+VEVLMLSL+HHNN
Sbjct  77   ATQSFRETNLIGEGGFGSVYKGRIDSGQIVAIKQLNLEGLQGNQEFVVEVLMLSLMHHNN  136

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYCTHG+QRLLVYE+MP GSLENHLF+LE G   L+W  RLKIAAGAA GLEYLH
Sbjct  137  LVNLIGYCTHGEQRLLVYEFMPLGSLENHLFDLEPGTTPLSWKTRLKIAAGAAHGLEYLH  196

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
              ANPPVIYRDLKSSNILLD +FNP+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  197  -KANPPVIYRDLKSSNILLDNDFNPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  255

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+GKLTLKSDIYSFGVVLLELITGR+AYD   K GEQNLV +  PFLKD+R+++ + DP+
Sbjct  256  MTGKLTLKSDIYSFGVVLLELITGRKAYDRTKKQGEQNLVVWSNPFLKDRRKYIHLVDPM  315

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTS  865
            L+ +FS R LHHAVA+TAMCLQ+QASFRP+I+DI  ALDYL+ QAQ S
Sbjct  316  LDGQFSSRCLHHAVAVTAMCLQEQASFRPSITDIVTALDYLLLQAQHS  363



>ref|XP_010247085.1| PREDICTED: serine/threonine-protein kinase PBS1-like isoform 
X2 [Nelumbo nucifera]
Length=383

 Score =   437 bits (1125),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 218/284 (77%), Positives = 249/284 (88%), Gaps = 0/284 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NFK +NL+GEGGFG VYKG +++  +VAVKQLDQ GLQGNQEFIVEVLMLSLLHH+N
Sbjct  67   ATKNFKATNLIGEGGFGRVYKGRLETGQIVAVKQLDQNGLQGNQEFIVEVLMLSLLHHSN  126

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYCT GDQRLLVYEYMP GSLE+HLF+L   KE L W  R+KIA GAARGLEYLH
Sbjct  127  LVNLIGYCTDGDQRLLVYEYMPMGSLEDHLFDLTPNKEPLEWNTRMKIAVGAARGLEYLH  186

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C ANPPVIYRDLKS+NILLD +FNP+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  187  CKANPPVIYRDLKSANILLDNDFNPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  246

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSD+YSFGVVLLELITGR+A D     GEQNLVS+ RPF KD+R+FV++ DP 
Sbjct  247  MSGKLTLKSDVYSFGVVLLELITGRKAIDCTKVQGEQNLVSWSRPFFKDRRKFVQLVDPQ  306

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            L+ RF +R LHHA+AITAMCLQ+Q +FRP I+DI +AL+YL +Q
Sbjct  307  LQGRFPLRCLHHAIAITAMCLQEQPTFRPLIADIVVALEYLASQ  350



>ref|XP_010247084.1| PREDICTED: serine/threonine-protein kinase PBS1-like isoform 
X1 [Nelumbo nucifera]
Length=393

 Score =   438 bits (1126),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 218/284 (77%), Positives = 249/284 (88%), Gaps = 0/284 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NFK +NL+GEGGFG VYKG +++  +VAVKQLDQ GLQGNQEFIVEVLMLSLLHH+N
Sbjct  77   ATKNFKATNLIGEGGFGRVYKGRLETGQIVAVKQLDQNGLQGNQEFIVEVLMLSLLHHSN  136

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYCT GDQRLLVYEYMP GSLE+HLF+L   KE L W  R+KIA GAARGLEYLH
Sbjct  137  LVNLIGYCTDGDQRLLVYEYMPMGSLEDHLFDLTPNKEPLEWNTRMKIAVGAARGLEYLH  196

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C ANPPVIYRDLKS+NILLD +FNP+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  197  CKANPPVIYRDLKSANILLDNDFNPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  256

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSD+YSFGVVLLELITGR+A D     GEQNLVS+ RPF KD+R+FV++ DP 
Sbjct  257  MSGKLTLKSDVYSFGVVLLELITGRKAIDCTKVQGEQNLVSWSRPFFKDRRKFVQLVDPQ  316

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            L+ RF +R LHHA+AITAMCLQ+Q +FRP I+DI +AL+YL +Q
Sbjct  317  LQGRFPLRCLHHAIAITAMCLQEQPTFRPLIADIVVALEYLASQ  360



>ref|XP_007210692.1| hypothetical protein PRUPE_ppa027153mg, partial [Prunus persica]
 gb|EMJ11891.1| hypothetical protein PRUPE_ppa027153mg, partial [Prunus persica]
Length=344

 Score =   435 bits (1118),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 215/285 (75%), Positives = 248/285 (87%), Gaps = 0/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+ F+E NL+GEGGFG VYKG +D+  VVA+KQL+ +GLQG QEFIVEVLMLSLLHH N
Sbjct  55   ATKGFREVNLIGEGGFGRVYKGRLDAGQVVAIKQLNHDGLQGFQEFIVEVLMLSLLHHTN  114

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HLF+L   +E L+W  R+KIA GAARGLEYLH
Sbjct  115  LVTLIGYCTDGDQRLLVYEYMPRGSLEDHLFDLSPDREPLSWDTRIKIAVGAARGLEYLH  174

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C ANPPVIYRDLKS+NILLD++FNP+LSDFGLAKL PVGD THVSTRVMGTYGYCAPEYA
Sbjct  175  CKANPPVIYRDLKSANILLDDQFNPKLSDFGLAKLAPVGDKTHVSTRVMGTYGYCAPEYA  234

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYSFGVV+LELITG++A D   +PGEQNLVS+ RPFLKD+R+FV++ DPL
Sbjct  235  MSGKLTLKSDIYSFGVVMLELITGKKAIDCSKRPGEQNLVSWSRPFLKDRRKFVQLVDPL  294

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
            L+ RF VR LHHAVAITAMCLQ+Q +FRP I DI +AL+YL +Q 
Sbjct  295  LQGRFPVRCLHHAVAITAMCLQEQPTFRPLIGDIVVALEYLASQT  339



>ref|XP_004300677.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Fragaria 
vesca subsp. vesca]
Length=389

 Score =   436 bits (1121),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 217/284 (76%), Positives = 251/284 (88%), Gaps = 0/284 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+ F+E NL+GEGGFG VYKG +++  VVA+KQL+ +GLQG QEFIVEVLMLSLLHH N
Sbjct  68   ATKGFREVNLIGEGGFGRVYKGRLEAGQVVAIKQLNHDGLQGFQEFIVEVLMLSLLHHTN  127

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEY+P GSLE+HLF+L   +E L+W  R+KIA GAARGLEYLH
Sbjct  128  LVTLIGYCTDGDQRLLVYEYLPRGSLEDHLFDLNPDQEPLSWDTRIKIAVGAARGLEYLH  187

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C ANPPVIYRDLKS+NILLD+ FNP+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  188  CKANPPVIYRDLKSANILLDDHFNPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  247

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYSFGVV+LELITG++A DS  K GEQNLV++ RPFLKD+R+FV++ DPL
Sbjct  248  MSGKLTLKSDIYSFGVVMLELITGKKAIDSTKKQGEQNLVAWSRPFLKDRRKFVQLVDPL  307

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            L+ RF VR LHHAVAITAMCLQ+Q +FRP ISDI +AL+YLV+Q
Sbjct  308  LQGRFPVRCLHHAVAITAMCLQEQPTFRPLISDIVVALEYLVSQ  351



>ref|XP_010094561.1| Serine/threonine-protein kinase PBS1 [Morus notabilis]
 gb|EXB56315.1| Serine/threonine-protein kinase PBS1 [Morus notabilis]
Length=378

 Score =   436 bits (1120),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 218/289 (75%), Positives = 252/289 (87%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+ F+E NL+GEGGFG V+KG +++  VVA+KQL+ +GLQG QEFIVEVLMLSLLHH+N
Sbjct  55   ATRGFREVNLIGEGGFGRVFKGRLETGQVVAIKQLNHDGLQGFQEFIVEVLMLSLLHHSN  114

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYM  GSLE+HLF+L   K  L+W  R+KIA GAARGLEYLH
Sbjct  115  LVTLIGYCTDGDQRLLVYEYMAMGSLEDHLFDLVPDKVLLSWETRIKIAVGAARGLEYLH  174

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C ANPPVIYRDLKS+NILLD EFNP+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  175  CKANPPVIYRDLKSANILLDNEFNPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  234

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYSFGVVLLELITGR+A D   +PGEQNLVS+ RPFLKD+R+FV++ DPL
Sbjct  235  MSGKLTLKSDIYSFGVVLLELITGRKAIDVTKRPGEQNLVSWSRPFLKDRRKFVQLVDPL  294

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L+ RF VR LHHA+AITAMCLQ+Q +FRP ISDI +AL+YL +Q+  +E
Sbjct  295  LQGRFPVRCLHHAIAITAMCLQEQPTFRPLISDIVVALEYLASQSSKAE  343



>ref|XP_009365692.1| PREDICTED: serine/threonine-protein kinase PBS1-like isoform 
X2 [Pyrus x bretschneideri]
Length=387

 Score =   435 bits (1118),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 213/289 (74%), Positives = 251/289 (87%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+ F+E NL+GEGGFG VYKG +D+  VVA+KQL+ +G+QG QEFIVEVLMLSLLHH N
Sbjct  64   ATKGFREVNLIGEGGFGRVYKGRLDAGQVVAIKQLNHDGVQGFQEFIVEVLMLSLLHHTN  123

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HLF+L  G+E L+W  R+KIA GAARGLEYLH
Sbjct  124  LVTLIGYCTDGDQRLLVYEYMPRGSLEDHLFDLSPGQEPLSWDTRIKIAVGAARGLEYLH  183

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C ANPPVIYRDLKS+NILLD+EFNP+LSDFGLAKL PVGD THVSTRVMGTYGYCAPEYA
Sbjct  184  CKANPPVIYRDLKSANILLDDEFNPKLSDFGLAKLAPVGDKTHVSTRVMGTYGYCAPEYA  243

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYS GVV+LELITG++A D   +PGEQNLVS+ RPFLKD+R+FV++ DPL
Sbjct  244  MSGKLTLKSDIYSLGVVMLELITGKKAIDCSKRPGEQNLVSWSRPFLKDRRKFVQLVDPL  303

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L+ RF VR LHHA+AITAMCLQ+Q +FRP ++DI +AL+YL +Q+   +
Sbjct  304  LQGRFPVRCLHHAIAITAMCLQEQPTFRPLVTDIVVALEYLASQSHKPD  352



>ref|XP_009365691.1| PREDICTED: serine/threonine-protein kinase PBS1-like isoform 
X1 [Pyrus x bretschneideri]
Length=388

 Score =   435 bits (1118),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 213/289 (74%), Positives = 251/289 (87%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+ F+E NL+GEGGFG VYKG +D+  VVA+KQL+ +G+QG QEFIVEVLMLSLLHH N
Sbjct  65   ATKGFREVNLIGEGGFGRVYKGRLDAGQVVAIKQLNHDGVQGFQEFIVEVLMLSLLHHTN  124

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HLF+L  G+E L+W  R+KIA GAARGLEYLH
Sbjct  125  LVTLIGYCTDGDQRLLVYEYMPRGSLEDHLFDLSPGQEPLSWDTRIKIAVGAARGLEYLH  184

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C ANPPVIYRDLKS+NILLD+EFNP+LSDFGLAKL PVGD THVSTRVMGTYGYCAPEYA
Sbjct  185  CKANPPVIYRDLKSANILLDDEFNPKLSDFGLAKLAPVGDKTHVSTRVMGTYGYCAPEYA  244

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYS GVV+LELITG++A D   +PGEQNLVS+ RPFLKD+R+FV++ DPL
Sbjct  245  MSGKLTLKSDIYSLGVVMLELITGKKAIDCSKRPGEQNLVSWSRPFLKDRRKFVQLVDPL  304

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L+ RF VR LHHA+AITAMCLQ+Q +FRP ++DI +AL+YL +Q+   +
Sbjct  305  LQGRFPVRCLHHAIAITAMCLQEQPTFRPLVTDIVVALEYLASQSHKPD  353



>ref|XP_010061183.1| PREDICTED: serine/threonine-protein kinase PBS1-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW68105.1| hypothetical protein EUGRSUZ_F01782 [Eucalyptus grandis]
Length=379

 Score =   434 bits (1115),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 216/284 (76%), Positives = 248/284 (87%), Gaps = 0/284 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NFKE NL+GEGGFG VYKG +++  VVA+KQL+ +GLQG QEFIVEVLMLSLLHH+N
Sbjct  69   ATRNFKEVNLIGEGGFGKVYKGRLETGEVVAIKQLNHDGLQGFQEFIVEVLMLSLLHHSN  128

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L GYCT GDQRLLVYEYMP GSLE+HLF+L+ GK  L+W  R+KIA GAARGLEYLH
Sbjct  129  LVTLFGYCTDGDQRLLVYEYMPMGSLEDHLFDLDPGKAPLDWGTRMKIAVGAARGLEYLH  188

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C ANPPVIYRDLKS+NILLD +FNP+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  189  CKANPPVIYRDLKSANILLDNDFNPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  248

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYSFGVVLLELI+GR+A D   KPGEQNLV++ RP+LKD+R+F  +ADPL
Sbjct  249  MSGKLTLKSDIYSFGVVLLELISGRKAIDGTKKPGEQNLVAWSRPYLKDRRKFAHLADPL  308

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            L+  F VR L+HA+AITAMCLQ+Q +FRP I DI +AL+YL  Q
Sbjct  309  LQGHFPVRCLYHAIAITAMCLQEQPNFRPLIGDIVVALEYLATQ  352



>ref|XP_010061182.1| PREDICTED: serine/threonine-protein kinase PBS1-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW68106.1| hypothetical protein EUGRSUZ_F01782 [Eucalyptus grandis]
Length=392

 Score =   434 bits (1115),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 216/284 (76%), Positives = 248/284 (87%), Gaps = 0/284 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NFKE NL+GEGGFG VYKG +++  VVA+KQL+ +GLQG QEFIVEVLMLSLLHH+N
Sbjct  82   ATRNFKEVNLIGEGGFGKVYKGRLETGEVVAIKQLNHDGLQGFQEFIVEVLMLSLLHHSN  141

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L GYCT GDQRLLVYEYMP GSLE+HLF+L+ GK  L+W  R+KIA GAARGLEYLH
Sbjct  142  LVTLFGYCTDGDQRLLVYEYMPMGSLEDHLFDLDPGKAPLDWGTRMKIAVGAARGLEYLH  201

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C ANPPVIYRDLKS+NILLD +FNP+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  202  CKANPPVIYRDLKSANILLDNDFNPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  261

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYSFGVVLLELI+GR+A D   KPGEQNLV++ RP+LKD+R+F  +ADPL
Sbjct  262  MSGKLTLKSDIYSFGVVLLELISGRKAIDGTKKPGEQNLVAWSRPYLKDRRKFAHLADPL  321

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            L+  F VR L+HA+AITAMCLQ+Q +FRP I DI +AL+YL  Q
Sbjct  322  LQGHFPVRCLYHAIAITAMCLQEQPNFRPLIGDIVVALEYLATQ  365



>ref|XP_008452969.1| PREDICTED: serine/threonine-protein kinase PBS1 isoform X2 [Cucumis 
melo]
Length=375

 Score =   432 bits (1112),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 216/290 (74%), Positives = 252/290 (87%), Gaps = 0/290 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+ FKE NL+GEGGFG VYKG ++S  +VA+KQL+ +GLQG QEFIVEVLMLSLLHH+N
Sbjct  53   ATRGFKEVNLIGEGGFGRVYKGRLESGQIVAIKQLNHDGLQGYQEFIVEVLMLSLLHHSN  112

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYM  GSLENHLF L   +  L+W  R+KIA GAA+GLEYLH
Sbjct  113  LVTLIGYCTDGDQRLLVYEYMSMGSLENHLFGLFPKRSPLSWNTRIKIALGAAQGLEYLH  172

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            CTANPPVIYRDLKS+NILLD++FNP+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  173  CTANPPVIYRDLKSANILLDDDFNPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  232

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIY FGVVLLE+ITGR+A D+  KPGEQNLV++ RPFLKD+R+FV++ DPL
Sbjct  233  MSGKLTLKSDIYCFGVVLLEIITGRKAIDTTKKPGEQNLVAWSRPFLKDRRKFVQLVDPL  292

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSER  871
            LE R+ +R LHHA+AI AMCLQ+Q  FRP ISDI +AL+YL +Q+  SE+
Sbjct  293  LEGRYPLRCLHHAIAIAAMCLQEQPMFRPIISDIVVALEYLASQSHASEQ  342



>ref|XP_008364473.1| PREDICTED: serine/threonine-protein kinase PBS1-like isoform 
X1 [Malus domestica]
Length=388

 Score =   433 bits (1113),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 212/289 (73%), Positives = 250/289 (87%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+ F+E NL+GEGGFG VYKG +D+  VVA+KQL+ +G+QG QEFIVEVLMLSLLHH N
Sbjct  65   ATKGFREVNLIGEGGFGRVYKGRLDAGQVVAIKQLNHDGVQGFQEFIVEVLMLSLLHHTN  124

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLL+YEYMP GSLE+HLF+L  G+E L+W  R+KIA GAARGLEYLH
Sbjct  125  LVTLIGYCTDGDQRLLIYEYMPRGSLEDHLFDLSPGQEPLSWDTRIKIAVGAARGLEYLH  184

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C ANPPVIYRDLKS+NILLD+EFNP+LSDFGLAKL PVGD THVSTRVMGTYGYCAPEYA
Sbjct  185  CKANPPVIYRDLKSANILLDDEFNPKLSDFGLAKLAPVGDKTHVSTRVMGTYGYCAPEYA  244

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYS GVV+LELITG++A D   +PGEQNLVS+  PFLKD+R+FV++ DPL
Sbjct  245  MSGKLTLKSDIYSLGVVMLELITGKKAIDCSKRPGEQNLVSWSHPFLKDRRKFVQLVDPL  304

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L+ RF VR LHHA+AITAMCLQ+Q +FRP I+DI +AL+YL +Q+   +
Sbjct  305  LQGRFPVRCLHHAIAITAMCLQEQPTFRPLITDIVVALEYLASQSHKPD  353



>ref|XP_008364474.1| PREDICTED: serine/threonine-protein kinase At3g07070-like isoform 
X2 [Malus domestica]
Length=387

 Score =   432 bits (1112),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 212/289 (73%), Positives = 250/289 (87%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+ F+E NL+GEGGFG VYKG +D+  VVA+KQL+ +G+QG QEFIVEVLMLSLLHH N
Sbjct  64   ATKGFREVNLIGEGGFGRVYKGRLDAGQVVAIKQLNHDGVQGFQEFIVEVLMLSLLHHTN  123

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLL+YEYMP GSLE+HLF+L  G+E L+W  R+KIA GAARGLEYLH
Sbjct  124  LVTLIGYCTDGDQRLLIYEYMPRGSLEDHLFDLSPGQEPLSWDTRIKIAVGAARGLEYLH  183

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C ANPPVIYRDLKS+NILLD+EFNP+LSDFGLAKL PVGD THVSTRVMGTYGYCAPEYA
Sbjct  184  CKANPPVIYRDLKSANILLDDEFNPKLSDFGLAKLAPVGDKTHVSTRVMGTYGYCAPEYA  243

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYS GVV+LELITG++A D   +PGEQNLVS+  PFLKD+R+FV++ DPL
Sbjct  244  MSGKLTLKSDIYSLGVVMLELITGKKAIDCSKRPGEQNLVSWSHPFLKDRRKFVQLVDPL  303

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L+ RF VR LHHA+AITAMCLQ+Q +FRP I+DI +AL+YL +Q+   +
Sbjct  304  LQGRFPVRCLHHAIAITAMCLQEQPTFRPLITDIVVALEYLASQSHKPD  352



>ref|XP_008452968.1| PREDICTED: serine/threonine-protein kinase PBS1 isoform X1 [Cucumis 
melo]
Length=385

 Score =   432 bits (1112),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 216/290 (74%), Positives = 252/290 (87%), Gaps = 0/290 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+ FKE NL+GEGGFG VYKG ++S  +VA+KQL+ +GLQG QEFIVEVLMLSLLHH+N
Sbjct  63   ATRGFKEVNLIGEGGFGRVYKGRLESGQIVAIKQLNHDGLQGYQEFIVEVLMLSLLHHSN  122

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYM  GSLENHLF L   +  L+W  R+KIA GAA+GLEYLH
Sbjct  123  LVTLIGYCTDGDQRLLVYEYMSMGSLENHLFGLFPKRSPLSWNTRIKIALGAAQGLEYLH  182

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            CTANPPVIYRDLKS+NILLD++FNP+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  183  CTANPPVIYRDLKSANILLDDDFNPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  242

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIY FGVVLLE+ITGR+A D+  KPGEQNLV++ RPFLKD+R+FV++ DPL
Sbjct  243  MSGKLTLKSDIYCFGVVLLEIITGRKAIDTTKKPGEQNLVAWSRPFLKDRRKFVQLVDPL  302

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSER  871
            LE R+ +R LHHA+AI AMCLQ+Q  FRP ISDI +AL+YL +Q+  SE+
Sbjct  303  LEGRYPLRCLHHAIAIAAMCLQEQPMFRPIISDIVVALEYLASQSHASEQ  352



>ref|XP_004157074.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Cucumis 
sativus]
 gb|KGN55504.1| hypothetical protein Csa_4G663630 [Cucumis sativus]
Length=385

 Score =   432 bits (1112),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 216/290 (74%), Positives = 252/290 (87%), Gaps = 0/290 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+ FKE NL+GEGGFG VYKG ++S  +VA+KQL+ +GLQG QEFIVEVLMLSLLHH+N
Sbjct  63   ATRGFKEVNLIGEGGFGRVYKGRLESGQIVAIKQLNHDGLQGYQEFIVEVLMLSLLHHSN  122

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYM  GSLENHLF L   +  L+W  R+KIA GAA+GLEYLH
Sbjct  123  LVTLIGYCTDGDQRLLVYEYMSMGSLENHLFGLFPKRSPLSWNTRIKIALGAAQGLEYLH  182

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            CTANPPVIYRDLKS+NILLD++FNP+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  183  CTANPPVIYRDLKSANILLDDDFNPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  242

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIY FGVVLLE+ITGR+A D+  KPGEQNLV++ RPFLKD+R+FV++ DPL
Sbjct  243  MSGKLTLKSDIYCFGVVLLEIITGRKAIDTTKKPGEQNLVAWSRPFLKDRRKFVQLVDPL  302

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSER  871
            LE R+ +R LHHA+AI AMCLQ+Q  FRP ISDI +AL+YL +Q+  SE+
Sbjct  303  LEGRYPLRCLHHAIAIAAMCLQEQPMFRPIISDIVVALEYLASQSHASEQ  352



>ref|XP_008237980.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Prunus 
mume]
Length=389

 Score =   432 bits (1112),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 214/285 (75%), Positives = 249/285 (87%), Gaps = 0/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+ F+E NL+GEGGFG VYKG +D+  VVA+KQL+ +GLQG QEFIVEVLMLSLLHH N
Sbjct  66   ATKGFREVNLIGEGGFGRVYKGRLDAGQVVAIKQLNHDGLQGFQEFIVEVLMLSLLHHTN  125

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HLF+L   +E L+W  R+KIA GAA+GLEYLH
Sbjct  126  LVTLIGYCTDGDQRLLVYEYMPRGSLEDHLFDLSPDREPLSWDTRIKIAVGAAQGLEYLH  185

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C ANPPVIYRDLKS+NILLD++FNP+LSDFGLAKL PVGD THVSTRVMGTYGYCAPEYA
Sbjct  186  CKANPPVIYRDLKSANILLDDQFNPKLSDFGLAKLAPVGDKTHVSTRVMGTYGYCAPEYA  245

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYSFGVV+LELITG++A D   +PGEQNLVS+ RPFLKD+R+FV++ DPL
Sbjct  246  MSGKLTLKSDIYSFGVVMLELITGKKAIDCSKRPGEQNLVSWSRPFLKDRRKFVQLVDPL  305

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
            L+ RF VR LHHAVAITAMCLQ+Q +FRP I DI +AL+YL +Q+
Sbjct  306  LQGRFPVRCLHHAVAITAMCLQEQPTFRPLIGDIVVALEYLASQS  350



>ref|XP_011034867.1| PREDICTED: serine/threonine-protein kinase CDL1-like isoform 
X1 [Populus euphratica]
Length=380

 Score =   429 bits (1104),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 214/289 (74%), Positives = 258/289 (89%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+E NL+GEGGFG VYKG +++  +VAVKQL+Q+GLQG+QEFIVEVLMLSLLHH+N
Sbjct  59   ATRNFREINLIGEGGFGRVYKGRLETGEIVAVKQLNQDGLQGDQEFIVEVLMLSLLHHSN  118

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HLF+LE  KE L+W  R+KIA GAARGLEYLH
Sbjct  119  LVTLIGYCTSGDQRLLVYEYMPMGSLEDHLFDLEPDKEPLSWSTRMKIAVGAARGLEYLH  178

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C A+PPVIYRDLKS+NILLD +FNP+LSDFGLAKLGPVG+NTHVSTRVMGTYGYCAPEYA
Sbjct  179  CKADPPVIYRDLKSANILLDNDFNPKLSDFGLAKLGPVGENTHVSTRVMGTYGYCAPEYA  238

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLT+KSDIYSFGVVLLELITGR+A D   KPGEQNLV++ RPFLK+++++ ++ADPL
Sbjct  239  MSGKLTVKSDIYSFGVVLLELITGRKAIDRSKKPGEQNLVAWSRPFLKEQKKYCQLADPL  298

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            LE  +  R L++A+AITAMCL ++A+FRP ISDI +AL+YLV+Q++ SE
Sbjct  299  LEGCYPRRCLNYAIAITAMCLNEEANFRPLISDILVALEYLVSQSRVSE  347



>ref|XP_011034868.1| PREDICTED: serine/threonine-protein kinase CDL1-like isoform 
X2 [Populus euphratica]
Length=377

 Score =   429 bits (1103),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 214/289 (74%), Positives = 258/289 (89%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+E NL+GEGGFG VYKG +++  +VAVKQL+Q+GLQG+QEFIVEVLMLSLLHH+N
Sbjct  56   ATRNFREINLIGEGGFGRVYKGRLETGEIVAVKQLNQDGLQGDQEFIVEVLMLSLLHHSN  115

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HLF+LE  KE L+W  R+KIA GAARGLEYLH
Sbjct  116  LVTLIGYCTSGDQRLLVYEYMPMGSLEDHLFDLEPDKEPLSWSTRMKIAVGAARGLEYLH  175

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C A+PPVIYRDLKS+NILLD +FNP+LSDFGLAKLGPVG+NTHVSTRVMGTYGYCAPEYA
Sbjct  176  CKADPPVIYRDLKSANILLDNDFNPKLSDFGLAKLGPVGENTHVSTRVMGTYGYCAPEYA  235

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLT+KSDIYSFGVVLLELITGR+A D   KPGEQNLV++ RPFLK+++++ ++ADPL
Sbjct  236  MSGKLTVKSDIYSFGVVLLELITGRKAIDRSKKPGEQNLVAWSRPFLKEQKKYCQLADPL  295

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            LE  +  R L++A+AITAMCL ++A+FRP ISDI +AL+YLV+Q++ SE
Sbjct  296  LEGCYPRRCLNYAIAITAMCLNEEANFRPLISDILVALEYLVSQSRVSE  344



>ref|XP_010663978.1| PREDICTED: serine/threonine-protein kinase CDL1-like [Vitis vinifera]
Length=401

 Score =   429 bits (1103),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 212/289 (73%), Positives = 252/289 (87%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NFK +NL+GEGGFG VYKG +D+  +VA+KQL+ +GLQG QEFIVEVLMLSLLHH+N
Sbjct  80   ATRNFKATNLIGEGGFGKVYKGRLDTGEIVAIKQLNHDGLQGFQEFIVEVLMLSLLHHSN  139

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYM  GSLE+HLF+L   +E L W  R++IA GAARGLEYLH
Sbjct  140  LVTLIGYCTDGDQRLLVYEYMAMGSLEHHLFDLGPDQEPLGWNTRIQIAVGAARGLEYLH  199

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C ANPPVIYRDLKS+NILLD EFNP+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  200  CKANPPVIYRDLKSANILLDNEFNPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  259

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYSFGVVLLELITGR+A D+  + GEQNLV++ RPFLKD+++F+++ DP 
Sbjct  260  MSGKLTLKSDIYSFGVVLLELITGRKAIDTSKRQGEQNLVAWSRPFLKDRKKFIQLVDPQ  319

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L+  F VR+LHHA+AITAMCLQ+Q +FRP I DI +AL+YL +++ +SE
Sbjct  320  LQGNFPVRALHHAIAITAMCLQEQPNFRPLIGDIVVALEYLASESHSSE  368



>gb|KEH36324.1| receptor Serine/Threonine kinase [Medicago truncatula]
Length=355

 Score =   427 bits (1098),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 213/286 (74%), Positives = 246/286 (86%), Gaps = 0/286 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+ FKE+NL+GEGGFG V+KG + +  +VAVKQL  +G QG QEF+ EVLMLSLLHH+N
Sbjct  46   ATRGFKEANLIGEGGFGKVFKGRLSTGELVAVKQLSHDGRQGFQEFVTEVLMLSLLHHSN  105

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HLF+L   KE L+W +R+KIA GAARGLEYLH
Sbjct  106  LVKLIGYCTDGDQRLLVYEYMPMGSLEDHLFDLPQDKEPLSWSSRMKIAVGAARGLEYLH  165

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C A+PPVIYRDLKS+NILLD +F+P+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  166  CKADPPVIYRDLKSANILLDSDFSPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  225

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYSFGVVLLELITGRRA D+  KPGEQNLVS+ RP+  D+R+FV MADPL
Sbjct  226  MSGKLTLKSDIYSFGVVLLELITGRRAIDASKKPGEQNLVSWSRPYFSDRRKFVHMADPL  285

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQ  859
            L+  F VR LH A+AITAMCLQ+Q  FRP I DI +AL+YL +Q+Q
Sbjct  286  LQGHFPVRCLHQAIAITAMCLQEQPKFRPLIGDIVVALEYLASQSQ  331



>gb|KDO85108.1| hypothetical protein CISIN_1g017246mg [Citrus sinensis]
Length=360

 Score =   427 bits (1098),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 214/284 (75%), Positives = 251/284 (88%), Gaps = 0/284 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+E+NL+GEGGFG VYKG ++S  +VA+KQL+ EGLQG+QEFIVEVLMLSLLHH+N
Sbjct  43   ATRNFREANLIGEGGFGKVYKGRLESGQLVAIKQLNHEGLQGHQEFIVEVLMLSLLHHDN  102

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HL++LE  +E L+W  R+KIA GAARGLEYLH
Sbjct  103  LVTLIGYCTSGDQRLLVYEYMPMGSLEDHLYDLEPDQEPLSWNTRMKIAVGAARGLEYLH  162

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C ANPPVIYRDLKS+NILLD +FNP+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  163  CKANPPVIYRDLKSANILLDNDFNPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  222

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYSFGVVLLELITGR+A D     GEQNLVS+ RPFLKD+++FV + DPL
Sbjct  223  MSGKLTLKSDIYSFGVVLLELITGRKAMDLSKGQGEQNLVSWSRPFLKDQKKFVHLVDPL  282

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            L  R+  R L++AVA+TAMCL ++A+FRP I+DI +ALDYLV+Q
Sbjct  283  LHGRYPRRCLNYAVAVTAMCLNEEANFRPLINDIVVALDYLVSQ  326



>ref|XP_004500868.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Cicer arietinum]
Length=380

 Score =   427 bits (1099),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 215/284 (76%), Positives = 244/284 (86%), Gaps = 0/284 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+ FKE+NL+GEGGFG VYKG + +  VVAVKQL  +G QG QEF+ EVLMLSLLHH+N
Sbjct  73   ATRGFKEANLIGEGGFGRVYKGRLSTGEVVAVKQLSHDGRQGFQEFVTEVLMLSLLHHSN  132

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HLF+L   KE L+W +R+KIA GAARGLEYLH
Sbjct  133  LVKLIGYCTDGDQRLLVYEYMPMGSLEDHLFDLTQDKEPLSWSSRMKIAVGAARGLEYLH  192

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C A+PPVIYRDLKS+NILLD +FNP+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  193  CKADPPVIYRDLKSANILLDNDFNPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  252

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYSFGVVLLELITGRRA DS  +PGEQNLVS+ RP+  D+R+FV MADPL
Sbjct  253  MSGKLTLKSDIYSFGVVLLELITGRRAIDSSKRPGEQNLVSWSRPYFSDRRKFVHMADPL  312

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            L+  F VR LH A+AITAMCLQ+Q  FRP I DI +AL+YL +Q
Sbjct  313  LQGLFPVRCLHQAIAITAMCLQEQPKFRPLIGDIVVALEYLASQ  356



>ref|XP_008464836.1| PREDICTED: serine/threonine-protein kinase PBS1 [Cucumis melo]
 ref|XP_008464837.1| PREDICTED: serine/threonine-protein kinase PBS1 [Cucumis melo]
 ref|XP_008464838.1| PREDICTED: serine/threonine-protein kinase PBS1 [Cucumis melo]
Length=383

 Score =   427 bits (1099),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 215/289 (74%), Positives = 249/289 (86%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+ FKE NLLGEGGFG VYKG ++S  +VAVKQL+++GLQG QEFIVEVLMLSLLHH N
Sbjct  67   ATRGFKEVNLLGEGGFGRVYKGRLESGQIVAVKQLNRDGLQGFQEFIVEVLMLSLLHHPN  126

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYE+MP GSLE+HLF+L   K+ L+W  R+KIA  AARGLEYLH
Sbjct  127  LVTLIGYCTDGDQRLLVYEFMPMGSLEDHLFDLGTDKKPLSWNTRMKIAVSAARGLEYLH  186

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C ANPPVIYRDLKS+NILLD++FNP+LSDFGLAKLGPVGDNTHVSTR+MGTYGYCAPEYA
Sbjct  187  CKANPPVIYRDLKSANILLDDDFNPKLSDFGLAKLGPVGDNTHVSTRIMGTYGYCAPEYA  246

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLT+KSDIYSFGVVLLELITGR+  D   +PGEQNLV++ RP LKD+RRF+E+ DPL
Sbjct  247  MSGKLTIKSDIYSFGVVLLELITGRKVIDIKRRPGEQNLVAWSRPLLKDRRRFMELVDPL  306

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            LE  F +R L HAVAITAMCLQ+Q SFRP I+DI +AL+YL +Q+   E
Sbjct  307  LEGHFPLRCLQHAVAITAMCLQEQPSFRPLITDIVVALEYLASQSCLRE  355



>gb|KEH36323.1| receptor Serine/Threonine kinase [Medicago truncatula]
Length=373

 Score =   427 bits (1098),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 213/286 (74%), Positives = 246/286 (86%), Gaps = 0/286 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+ FKE+NL+GEGGFG V+KG + +  +VAVKQL  +G QG QEF+ EVLMLSLLHH+N
Sbjct  64   ATRGFKEANLIGEGGFGKVFKGRLSTGELVAVKQLSHDGRQGFQEFVTEVLMLSLLHHSN  123

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HLF+L   KE L+W +R+KIA GAARGLEYLH
Sbjct  124  LVKLIGYCTDGDQRLLVYEYMPMGSLEDHLFDLPQDKEPLSWSSRMKIAVGAARGLEYLH  183

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C A+PPVIYRDLKS+NILLD +F+P+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  184  CKADPPVIYRDLKSANILLDSDFSPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  243

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYSFGVVLLELITGRRA D+  KPGEQNLVS+ RP+  D+R+FV MADPL
Sbjct  244  MSGKLTLKSDIYSFGVVLLELITGRRAIDASKKPGEQNLVSWSRPYFSDRRKFVHMADPL  303

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQ  859
            L+  F VR LH A+AITAMCLQ+Q  FRP I DI +AL+YL +Q+Q
Sbjct  304  LQGHFPVRCLHQAIAITAMCLQEQPKFRPLIGDIVVALEYLASQSQ  349



>ref|XP_006435370.1| hypothetical protein CICLE_v10001525mg [Citrus clementina]
 ref|XP_006473799.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Citrus 
sinensis]
 gb|ESR48610.1| hypothetical protein CICLE_v10001525mg [Citrus clementina]
 gb|KDO85107.1| hypothetical protein CISIN_1g017246mg [Citrus sinensis]
Length=375

 Score =   427 bits (1097),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 214/284 (75%), Positives = 251/284 (88%), Gaps = 0/284 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+E+NL+GEGGFG VYKG ++S  +VA+KQL+ EGLQG+QEFIVEVLMLSLLHH+N
Sbjct  58   ATRNFREANLIGEGGFGKVYKGRLESGQLVAIKQLNHEGLQGHQEFIVEVLMLSLLHHDN  117

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HL++LE  +E L+W  R+KIA GAARGLEYLH
Sbjct  118  LVTLIGYCTSGDQRLLVYEYMPMGSLEDHLYDLEPDQEPLSWNTRMKIAVGAARGLEYLH  177

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C ANPPVIYRDLKS+NILLD +FNP+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  178  CKANPPVIYRDLKSANILLDNDFNPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  237

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYSFGVVLLELITGR+A D     GEQNLVS+ RPFLKD+++FV + DPL
Sbjct  238  MSGKLTLKSDIYSFGVVLLELITGRKAMDLSKGQGEQNLVSWSRPFLKDQKKFVHLVDPL  297

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            L  R+  R L++AVA+TAMCL ++A+FRP I+DI +ALDYLV+Q
Sbjct  298  LHGRYPRRCLNYAVAVTAMCLNEEANFRPLINDIVVALDYLVSQ  341



>ref|XP_004145543.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Cucumis 
sativus]
Length=389

 Score =   427 bits (1099),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 216/294 (73%), Positives = 253/294 (86%), Gaps = 4/294 (1%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDS----QSVVAVKQLDQEGLQGNQEFIVEvlmlsll  169
            AT+ FKE NL+GEGGFG VYKG ++S    + +VA+KQL+ +GLQG QEFIVEVLMLSLL
Sbjct  63   ATRGFKEVNLIGEGGFGRVYKGRLESGQGFKEIVAIKQLNHDGLQGYQEFIVEVLMLSLL  122

Query  170  hhnnlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGL  349
            HH+NLV L+GYCT GDQRLLVYEYM  GSLENHLF L   +  L+W  R+KIA GAA+GL
Sbjct  123  HHSNLVTLIGYCTDGDQRLLVYEYMSMGSLENHLFGLFPKRSPLSWNTRIKIALGAAQGL  182

Query  350  EYLHCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCA  529
            EYLHCTANPPVIYRDLKS+NILLD++FNP+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCA
Sbjct  183  EYLHCTANPPVIYRDLKSANILLDDDFNPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCA  242

Query  530  PEYAMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEM  709
            PEYAMSGKLTLKSDIY FGVVLLE+ITGR+A D+  KPGEQNLV++ RPFLKD+R+FV++
Sbjct  243  PEYAMSGKLTLKSDIYCFGVVLLEIITGRKAIDTTKKPGEQNLVAWSRPFLKDRRKFVQL  302

Query  710  ADPLLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSER  871
             DPLLE R+ +R LHHA+AI AMCLQ+Q  FRP ISDI +AL+YL +Q+  SE+
Sbjct  303  VDPLLEGRYPLRCLHHAIAIAAMCLQEQPMFRPIISDIVVALEYLASQSHASEQ  356



>emb|CBI40722.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   428 bits (1101),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 212/289 (73%), Positives = 252/289 (87%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NFK +NL+GEGGFG VYKG +D+  +VA+KQL+ +GLQG QEFIVEVLMLSLLHH+N
Sbjct  112  ATRNFKATNLIGEGGFGKVYKGRLDTGEIVAIKQLNHDGLQGFQEFIVEVLMLSLLHHSN  171

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYM  GSLE+HLF+L   +E L W  R++IA GAARGLEYLH
Sbjct  172  LVTLIGYCTDGDQRLLVYEYMAMGSLEHHLFDLGPDQEPLGWNTRIQIAVGAARGLEYLH  231

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C ANPPVIYRDLKS+NILLD EFNP+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  232  CKANPPVIYRDLKSANILLDNEFNPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  291

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYSFGVVLLELITGR+A D+  + GEQNLV++ RPFLKD+++F+++ DP 
Sbjct  292  MSGKLTLKSDIYSFGVVLLELITGRKAIDTSKRQGEQNLVAWSRPFLKDRKKFIQLVDPQ  351

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L+  F VR+LHHA+AITAMCLQ+Q +FRP I DI +AL+YL +++ +SE
Sbjct  352  LQGNFPVRALHHAIAITAMCLQEQPNFRPLIGDIVVALEYLASESHSSE  400



>ref|XP_011074086.1| PREDICTED: serine/threonine-protein kinase CDL1-like [Sesamum 
indicum]
Length=374

 Score =   426 bits (1095),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 215/290 (74%), Positives = 250/290 (86%), Gaps = 0/290 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            ATQNFKE+NL+GEGGFG VYKG ++S  +VAVKQL+ EGLQGNQEF+VEVLMLSLLHH N
Sbjct  72   ATQNFKEANLIGEGGFGCVYKGRLESGMIVAVKQLNHEGLQGNQEFVVEVLMLSLLHHPN  131

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYC+  DQRLLVYE+MP GSLENHLF+LE  +  L+W  RLKIA GAARGLE+LH
Sbjct  132  LVNLIGYCSDRDQRLLVYEFMPMGSLENHLFDLEPNQTPLSWSTRLKIAVGAARGLEFLH  191

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C ANPPVIYRDLKSSNILLD ++N +LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  192  CRANPPVIYRDLKSSNILLDNDYNVKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEYA  251

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYSFGVVLLELI+GRRA D   KPGEQNLV + RPFLKD+++FV+M DPL
Sbjct  252  MSGKLTLKSDIYSFGVVLLELISGRRAMDFSKKPGEQNLVVWSRPFLKDRKQFVQMVDPL  311

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSER  871
            LE R+SV+SL  AV IT++C+ +QA+ RP I+++  AL+YL  QA TS +
Sbjct  312  LEGRYSVKSLQQAVLITSLCIHEQANVRPNITEVVHALEYLATQADTSRK  361



>ref|XP_002307795.2| hypothetical protein POPTR_0005s27340g [Populus trichocarpa]
 gb|EEE94791.2| hypothetical protein POPTR_0005s27340g [Populus trichocarpa]
Length=389

 Score =   426 bits (1095),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 214/291 (74%), Positives = 251/291 (86%), Gaps = 0/291 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+E NL+GEGGFG VYKG +++  +VAVKQL+Q+GLQG+QEFIVEVLMLSLLHH+N
Sbjct  68   ATRNFREVNLIGEGGFGRVYKGRLETGELVAVKQLNQDGLQGDQEFIVEVLMLSLLHHSN  127

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L GYCT GDQRLLVYEYMP GSLE+HLF+LE GKE L+W  R+KIA GAARGLEYLH
Sbjct  128  LVTLTGYCTSGDQRLLVYEYMPMGSLEDHLFDLEPGKEPLSWSTRIKIAVGAARGLEYLH  187

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C A+PPVIYRDLKS+NILLD +F P+LSDFG+AKLGPVG+NTHVSTRVMGTYGYCAPEYA
Sbjct  188  CKADPPVIYRDLKSANILLDNDFQPKLSDFGIAKLGPVGENTHVSTRVMGTYGYCAPEYA  247

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYSFGVVLLELITGR+A D   KPGEQNL ++ +PFLKD++++ ++ADPL
Sbjct  248  MSGKLTLKSDIYSFGVVLLELITGRKAIDRSKKPGEQNLAAWSQPFLKDQKKYCQLADPL  307

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSERN  874
            LE  +  R  ++A+AITAMCL +QASFRP I DI  AL+YL AQ   SE N
Sbjct  308  LEGCYPRRCFNYAIAITAMCLNEQASFRPLIGDILGALEYLAAQCHVSEPN  358



>ref|XP_011041217.1| PREDICTED: serine/threonine-protein kinase CDL1-like isoform 
X1 [Populus euphratica]
 ref|XP_011041218.1| PREDICTED: serine/threonine-protein kinase CDL1-like isoform 
X1 [Populus euphratica]
Length=389

 Score =   425 bits (1092),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 214/289 (74%), Positives = 251/289 (87%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+E NL+GEGGFG VYKG +++  +VAVKQL+Q+GLQG+QEFIVEVLMLSLLHH+N
Sbjct  68   ATKNFREVNLIGEGGFGRVYKGRLETGELVAVKQLNQDGLQGDQEFIVEVLMLSLLHHSN  127

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HLF+LE GKE L+W  R+KIA GAARGLEYLH
Sbjct  128  LVTLIGYCTSGDQRLLVYEYMPMGSLEDHLFDLEPGKEPLSWSTRIKIAVGAARGLEYLH  187

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C A+PPVIYRDLKS+NILLD +FNP+LSDFGLAKLGPVG+NTHVSTRVMGTYGYCAPEYA
Sbjct  188  CKADPPVIYRDLKSANILLDNDFNPKLSDFGLAKLGPVGENTHVSTRVMGTYGYCAPEYA  247

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYSFGVVLLELITGR+A D    PGEQNLV++ +PFLKD++++ ++ADP 
Sbjct  248  MSGKLTLKSDIYSFGVVLLELITGRKAIDRSKIPGEQNLVAWSQPFLKDQKKYCQLADPR  307

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            LE  +  R  ++A+AITAMCL +QASFRP I DI  AL+YL AQ   SE
Sbjct  308  LEGCYPRRCFNYAIAITAMCLNEQASFRPLIGDILAALEYLAAQCHVSE  356



>gb|KHG07081.1| Serine/threonine-protein kinase PBS1 [Gossypium arboreum]
Length=412

 Score =   424 bits (1090),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 211/286 (74%), Positives = 252/286 (88%), Gaps = 0/286 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+E+NLLGEGGFG V+KG ++++ +VAVKQL+ +GLQG QEFIVEVLMLSLLHH N
Sbjct  73   ATRNFRETNLLGEGGFGRVFKGRLETREIVAVKQLNHDGLQGYQEFIVEVLMLSLLHHVN  132

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HLF+LE G+E L+W NR+KIA GAARG+EYLH
Sbjct  133  LVTLIGYCTAGDQRLLVYEYMPMGSLEDHLFDLEPGQEPLSWNNRIKIAVGAARGIEYLH  192

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C ANPPVIYRDLKS+NILLD +FNP+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  193  CKANPPVIYRDLKSANILLDNDFNPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  252

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYSFGVVLLELITGR+A D+  K GEQNLVS+ RP+LKD+++F  + DPL
Sbjct  253  MSGKLTLKSDIYSFGVVLLELITGRKAIDTSKKHGEQNLVSWSRPYLKDQKKFSLLVDPL  312

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQ  859
            +   +  R L++A+AITAMCL ++A+FRP I DI +AL+YL +Q+Q
Sbjct  313  IRGCYPHRCLNYAIAITAMCLNEEANFRPLIGDIVVALEYLASQSQ  358



>ref|XP_002300640.2| hypothetical protein POPTR_0002s01030g [Populus trichocarpa]
 gb|EEE79913.2| hypothetical protein POPTR_0002s01030g [Populus trichocarpa]
Length=377

 Score =   422 bits (1085),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 211/289 (73%), Positives = 255/289 (88%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+E NL+GEGGFG VYKG +++  +VAVKQL+Q+GLQG+QEFIVEVLMLSLLHH+N
Sbjct  56   ATRNFREINLIGEGGFGRVYKGRLETGEIVAVKQLNQDGLQGHQEFIVEVLMLSLLHHSN  115

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HLF+LE  KE L+W  R+KIA GAARGLEYLH
Sbjct  116  LVTLIGYCTSGDQRLLVYEYMPMGSLEDHLFDLEPDKEPLSWSTRMKIAVGAARGLEYLH  175

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C A+PPVIYRDLKS+NILLD +FNP+LSDFGLAKLGPVG+NTHVSTRVMGTYGYCAPEYA
Sbjct  176  CKADPPVIYRDLKSANILLDNDFNPKLSDFGLAKLGPVGENTHVSTRVMGTYGYCAPEYA  235

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLT+KSDIYSFGVVLLELITGR+A D   KPGEQNLV++ R FLK+++++ ++ADPL
Sbjct  236  MSGKLTVKSDIYSFGVVLLELITGRKAIDRSKKPGEQNLVAWSRAFLKEQKKYCQLADPL  295

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            LE  +  R L++A+AITAMCL ++A+FRP ISDI +AL+YL +Q++  E
Sbjct  296  LEGCYPRRCLNYAIAITAMCLNEEANFRPLISDILVALEYLASQSRVPE  344



>ref|XP_007136023.1| hypothetical protein PHAVU_009G011600g [Phaseolus vulgaris]
 gb|ESW08017.1| hypothetical protein PHAVU_009G011600g [Phaseolus vulgaris]
Length=375

 Score =   421 bits (1082),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 212/285 (74%), Positives = 242/285 (85%), Gaps = 0/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+ FKE NL+GEGGFG VYKG + +  +VAVKQL  +G QG QEF+ EVLMLSLLHH+N
Sbjct  68   ATRGFKEVNLIGEGGFGRVYKGRLSTGELVAVKQLSHDGRQGFQEFVTEVLMLSLLHHSN  127

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HLF+    KE L+W +R+KIA GAARGLEYLH
Sbjct  128  LVKLIGYCTDGDQRLLVYEYMPMGSLEDHLFDPTQDKEPLSWSSRMKIAVGAARGLEYLH  187

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C A+PPVIYRDLKS+NILLD EFNP+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  188  CKADPPVIYRDLKSANILLDNEFNPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  247

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYSFGVVLLELITGRRA D+  KPGEQNLVS+ RP+  D+R+FV M DPL
Sbjct  248  MSGKLTLKSDIYSFGVVLLELITGRRAIDASRKPGEQNLVSWSRPYFSDRRKFVHMVDPL  307

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
            L+  F +R LH A+AITAMCLQ+Q  FRP I DI +AL+YL +Q+
Sbjct  308  LQGNFPLRCLHQAIAITAMCLQEQPKFRPLIGDIVVALEYLASQS  352



>emb|CDP07283.1| unnamed protein product [Coffea canephora]
Length=373

 Score =   421 bits (1081),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 218/289 (75%), Positives = 243/289 (84%), Gaps = 10/289 (3%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            ATQNF+E+NL+GEGGFG +          VA+KQL+ EGLQGNQEFIVEVLMLSLLHH N
Sbjct  63   ATQNFREANLIGEGGFGCI----------VAIKQLNLEGLQGNQEFIVEVLMLSLLHHPN  112

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYCT GDQRLLVYEYMP GSLE HLF+L+ GKE L+W  RLKIA GAARGL+YLH
Sbjct  113  LVNLIGYCTDGDQRLLVYEYMPMGSLEYHLFDLDPGKEPLSWGTRLKIAVGAARGLKYLH  172

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C+ANPPVIYRDLKSSNILLD +FNP+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  173  CSANPPVIYRDLKSSNILLDNDFNPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEYA  232

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYSFGVVLLELITGR+A D   KPGEQNLV + RPFLKD+R+FV M DP 
Sbjct  233  MSGKLTLKSDIYSFGVVLLELITGRKAIDCTRKPGEQNLVVWSRPFLKDRRKFVLMIDPQ  292

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L+    +R LHHAVAI AMCLQ+Q SFRP I DI +AL+YL +Q   S+
Sbjct  293  LDGHIPLRCLHHAVAIAAMCLQEQPSFRPIIDDIVVALEYLASQVDKSD  341



>ref|XP_002510682.1| receptor serine-threonine protein kinase, putative [Ricinus communis]
 gb|EEF52869.1| receptor serine-threonine protein kinase, putative [Ricinus communis]
Length=381

 Score =   421 bits (1081),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 210/291 (72%), Positives = 250/291 (86%), Gaps = 0/291 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT NF+E NL+GEGGFG VYKG ++S  +VAVKQL+ +G+QG QEFIVEVLMLSLLHH+N
Sbjct  60   ATNNFREMNLIGEGGFGRVYKGRLESGQIVAVKQLNHDGVQGFQEFIVEVLMLSLLHHSN  119

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYM  GS+E+H+F+L+  KE LNW  R+KIA GAARGLEYLH
Sbjct  120  LVTLIGYCTAGDQRLLVYEYMQMGSVEDHIFDLDPDKEPLNWSTRMKIAIGAARGLEYLH  179

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C ANPPVIYRDLKS+NILLD +FNP+LSDFGLAKLGPVG+NTHVSTRVMGTYGYCAPEYA
Sbjct  180  CKANPPVIYRDLKSANILLDTDFNPKLSDFGLAKLGPVGENTHVSTRVMGTYGYCAPEYA  239

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYSFGVVLLELITGR+A D   +PGEQNLV++ RPFLKD+++F ++ DPL
Sbjct  240  MSGKLTLKSDIYSFGVVLLELITGRKAIDRSKRPGEQNLVAWARPFLKDQKKFYQLVDPL  299

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSERN  874
            L+  +  R L++A+AITAMCL ++A+FRP I DI +AL+YL +Q   SE N
Sbjct  300  LQGCYPRRCLNYAIAITAMCLHEEANFRPLIGDIVVALEYLASQCHGSESN  350



>ref|XP_011041219.1| PREDICTED: serine/threonine-protein kinase CDL1-like isoform 
X2 [Populus euphratica]
Length=387

 Score =   420 bits (1080),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 214/289 (74%), Positives = 250/289 (87%), Gaps = 2/289 (1%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+E NL+GEGGFG VYKG +++  +VAVKQL+Q+GLQG+QEFIVEVLMLSLLHH+N
Sbjct  68   ATKNFREVNLIGEGGFGRVYKGRLETGELVAVKQLNQDGLQGDQEFIVEVLMLSLLHHSN  127

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HLF+LE GKE L+W  R+KIA GAARGLEYLH
Sbjct  128  LVTLIGYCTSGDQRLLVYEYMPMGSLEDHLFDLEPGKEPLSWSTRIKIAVGAARGLEYLH  187

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C A+PPVIYRDLKS+NILLD +FNP+LSDFGLAKLGPVG+NTHVSTRVMGTYGYCAPEYA
Sbjct  188  CKADPPVIYRDLKSANILLDNDFNPKLSDFGLAKLGPVGENTHVSTRVMGTYGYCAPEYA  247

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYSFGVVLLELITGR+A D    PGEQNLV++  PFLKD++++ ++ADP 
Sbjct  248  MSGKLTLKSDIYSFGVVLLELITGRKAIDRSKIPGEQNLVAW--PFLKDQKKYCQLADPR  305

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            LE  +  R  ++A+AITAMCL +QASFRP I DI  AL+YL AQ   SE
Sbjct  306  LEGCYPRRCFNYAIAITAMCLNEQASFRPLIGDILAALEYLAAQCHVSE  354



>ref|XP_007018060.1| Kinase superfamily protein [Theobroma cacao]
 gb|EOY15285.1| Kinase superfamily protein [Theobroma cacao]
Length=397

 Score =   420 bits (1079),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 211/286 (74%), Positives = 249/286 (87%), Gaps = 0/286 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT NF+E+NLLGEGGFG V+KG +++  +VAVKQL+ +GLQG QEFIVEVLMLSLLHH N
Sbjct  73   ATSNFRETNLLGEGGFGRVFKGRLETGEIVAVKQLNHDGLQGYQEFIVEVLMLSLLHHVN  132

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HLF+LE G+E L+W  R+KIA GAARGLEYLH
Sbjct  133  LVTLIGYCTAGDQRLLVYEYMPMGSLEDHLFDLEPGQEPLSWNKRIKIAVGAARGLEYLH  192

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C ANPPVIYRDLKS+NILLD +FNP+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  193  CKANPPVIYRDLKSANILLDNDFNPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  252

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYSFGVVLLELITGR+A D++ K  EQNLVS+ RP LKD+++F  + DPL
Sbjct  253  MSGKLTLKSDIYSFGVVLLELITGRKAIDTNKKHAEQNLVSWSRPLLKDQKKFGLLVDPL  312

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQ  859
            +   +  R L++A+AITAMCL ++A+FRP I DIA+AL+YL +Q+Q
Sbjct  313  IRGCYPRRCLNYAIAITAMCLNEEANFRPLIGDIAVALEYLASQSQ  358



>ref|XP_004144242.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Cucumis 
sativus]
 gb|KGN47531.1| hypothetical protein Csa_6G355990 [Cucumis sativus]
Length=383

 Score =   418 bits (1075),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 210/289 (73%), Positives = 246/289 (85%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+ FKE NLLGEGGFG VYKG ++S  +VAVKQL+++GLQG QEFIVEVLMLSLLHH N
Sbjct  67   ATRGFKEVNLLGEGGFGRVYKGRLESGQIVAVKQLNRDGLQGFQEFIVEVLMLSLLHHPN  126

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYE+MP GSLE+HLF++   K+ L+W  R+KIA  AARG+EYLH
Sbjct  127  LVTLIGYCTDGDQRLLVYEFMPMGSLEDHLFDIGTDKKPLSWNTRMKIAVAAARGIEYLH  186

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C ANPPVIYRDLKS+NILLD +FNP+LSDFGLAKLGPVGDNTHVSTR+MGTYGYCAPEYA
Sbjct  187  CKANPPVIYRDLKSANILLDNDFNPKLSDFGLAKLGPVGDNTHVSTRIMGTYGYCAPEYA  246

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLT+KSDIYSFGVVLLELITGR+  D+  +PGEQNLV + RP L D+RR +E+ DPL
Sbjct  247  MSGKLTVKSDIYSFGVVLLELITGRKVIDTKRRPGEQNLVVWSRPILGDRRRVLELVDPL  306

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            LE +F +R L HAVAITAMCLQ+Q  FRP I+DI +AL+YL +Q+   E
Sbjct  307  LEGQFPLRCLQHAVAITAMCLQEQPLFRPLITDIVVALEYLASQSYLRE  355



>ref|XP_011041220.1| PREDICTED: serine/threonine-protein kinase CDL1-like isoform 
X3 [Populus euphratica]
Length=387

 Score =   417 bits (1073),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 213/289 (74%), Positives = 249/289 (86%), Gaps = 2/289 (1%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+E NL+GEGGFG VYKG +++  +VAVKQL+Q+GLQG+QEFIVEVLMLSLLHH+N
Sbjct  68   ATKNFREVNLIGEGGFGRVYKGRLETGELVAVKQLNQDGLQGDQEFIVEVLMLSLLHHSN  127

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HLFE   GKE L+W  R+KIA GAARGLEYLH
Sbjct  128  LVTLIGYCTSGDQRLLVYEYMPMGSLEDHLFE--PGKEPLSWSTRIKIAVGAARGLEYLH  185

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C A+PPVIYRDLKS+NILLD +FNP+LSDFGLAKLGPVG+NTHVSTRVMGTYGYCAPEYA
Sbjct  186  CKADPPVIYRDLKSANILLDNDFNPKLSDFGLAKLGPVGENTHVSTRVMGTYGYCAPEYA  245

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYSFGVVLLELITGR+A D    PGEQNLV++ +PFLKD++++ ++ADP 
Sbjct  246  MSGKLTLKSDIYSFGVVLLELITGRKAIDRSKIPGEQNLVAWSQPFLKDQKKYCQLADPR  305

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            LE  +  R  ++A+AITAMCL +QASFRP I DI  AL+YL AQ   SE
Sbjct  306  LEGCYPRRCFNYAIAITAMCLNEQASFRPLIGDILAALEYLAAQCHVSE  354



>emb|CDX96628.1| BnaA08g21710D [Brassica napus]
Length=377

 Score =   416 bits (1070),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 207/289 (72%), Positives = 247/289 (85%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+E NLLGEGGFG VYKG +DS  VVA+KQL+ +GLQGN+EFIVEVLMLSL HH N
Sbjct  70   ATRNFREVNLLGEGGFGRVYKGRLDSGQVVAIKQLNPDGLQGNREFIVEVLMLSLFHHPN  129

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HLF+L++ +E L W  R+KIA GAARG+EYLH
Sbjct  130  LVTLIGYCTSGDQRLLVYEYMPMGSLEDHLFDLDSNQEPLTWNTRMKIAVGAARGIEYLH  189

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            CTANPPVIYRDLKS+NILLD+EFNP+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  190  CTANPPVIYRDLKSANILLDKEFNPKLSDFGLAKLGPVGDRTHVSTRVMGTYGYCAPEYA  249

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLT+KSDIY FGVVLLEL+TGR+A D   K GEQNLV++ RP+LKD+++F  + DP 
Sbjct  250  MSGKLTVKSDIYCFGVVLLELVTGRKAIDLSQKQGEQNLVAWSRPYLKDQKKFGHLVDPS  309

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L  ++  R L++A+AI AMCL ++A +RP I DI +AL+YL AQ+Q+ E
Sbjct  310  LRGKYPRRCLNYAIAIIAMCLNEEAHYRPFIGDIVVALEYLAAQSQSHE  358



>ref|XP_006416375.1| hypothetical protein EUTSA_v10007921mg [Eutrema salsugineum]
 gb|ESQ34728.1| hypothetical protein EUTSA_v10007921mg [Eutrema salsugineum]
Length=380

 Score =   416 bits (1070),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 209/289 (72%), Positives = 249/289 (86%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+E NL+GEGGFG VYKG +DS  VVA+KQL+ +GLQGN+EFIVEVLMLSLLHH N
Sbjct  73   ATRNFREVNLIGEGGFGRVYKGRLDSGQVVAIKQLNPDGLQGNREFIVEVLMLSLLHHPN  132

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HLF+LEA +E L+W  R+KIA GAARG+EYLH
Sbjct  133  LVTLIGYCTSGDQRLLVYEYMPMGSLEDHLFDLEANQEPLSWNTRMKIAVGAARGIEYLH  192

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            CTANPPVIYRDLKS+NILLD+EFNP+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  193  CTANPPVIYRDLKSANILLDKEFNPKLSDFGLAKLGPVGDRTHVSTRVMGTYGYCAPEYA  252

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLT+KSDIY FGVVLLELITGR+A D   K GEQNLV + RP+LKD+++F ++ DP 
Sbjct  253  MSGKLTIKSDIYCFGVVLLELITGRKAIDFSQKQGEQNLVVWSRPYLKDQKKFGQLVDPS  312

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L  ++  R L++A+AI AMCL ++A +RP I DI +AL+YL AQ+++ E
Sbjct  313  LRGKYPRRCLNYAIAIIAMCLNEEAHYRPFIGDIVVALEYLSAQSRSHE  361



>ref|XP_009110218.1| PREDICTED: serine/threonine-protein kinase PBS1 [Brassica rapa]
 ref|XP_009110220.1| PREDICTED: serine/threonine-protein kinase PBS1 [Brassica rapa]
Length=377

 Score =   416 bits (1069),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 207/289 (72%), Positives = 247/289 (85%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+E NLLGEGGFG VYKG +DS  VVA+KQL+ +GLQGN+EFIVEVLMLSL HH N
Sbjct  70   ATRNFREVNLLGEGGFGRVYKGRLDSGQVVAIKQLNPDGLQGNREFIVEVLMLSLFHHPN  129

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HLF+L++ +E L W  R+KIA GAARG+EYLH
Sbjct  130  LVTLIGYCTSGDQRLLVYEYMPMGSLEDHLFDLDSNQEPLTWNTRMKIAVGAARGIEYLH  189

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            CTANPPVIYRDLKS+NILLD+EFNP+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  190  CTANPPVIYRDLKSANILLDKEFNPKLSDFGLAKLGPVGDRTHVSTRVMGTYGYCAPEYA  249

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLT+KSDIY FGVVLLEL+TGR+A D   K GEQNLV++ RP+LKD+++F  + DP 
Sbjct  250  MSGKLTVKSDIYCFGVVLLELVTGRKAIDLSQKQGEQNLVAWSRPYLKDQKKFGHLVDPS  309

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L  ++  R L++A+AI AMCL ++A +RP I DI +AL+YL AQ+Q+ E
Sbjct  310  LRGKYPRRCLNYAIAIIAMCLNEEAHYRPFIGDIVVALEYLAAQSQSHE  358



>ref|XP_010459753.1| PREDICTED: serine/threonine-protein kinase PBS1-like isoform 
X4 [Camelina sativa]
Length=382

 Score =   416 bits (1069),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 209/289 (72%), Positives = 248/289 (86%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+E NLLGEGGFG VYKG +DS  VVA+KQL+ +GLQGN+EFIVEVLMLSLLHH N
Sbjct  74   ATRNFREVNLLGEGGFGRVYKGRLDSGQVVAIKQLNPDGLQGNREFIVEVLMLSLLHHPN  133

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HLF+LE+  E L+W  R+KIA GAARG+EYLH
Sbjct  134  LVTLIGYCTSGDQRLLVYEYMPMGSLEDHLFDLESHPEPLSWNTRMKIAVGAARGIEYLH  193

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            CTANPPVIYRDLKS+NILLD+EFNP+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  194  CTANPPVIYRDLKSANILLDKEFNPKLSDFGLAKLGPVGDRTHVSTRVMGTYGYCAPEYA  253

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLT+KSDIY FGVVLLELITGR+A D   K GEQNLV++ RP+LKD+++F  + DP 
Sbjct  254  MSGKLTVKSDIYCFGVVLLELITGRKAIDLSQKQGEQNLVTWSRPYLKDQKKFGHLVDPT  313

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L  ++  R L++A+AI AMCL ++A +RP I DI +AL+YL AQ+++ E
Sbjct  314  LRGKYPRRCLNYAIAIIAMCLNEEAHYRPFIGDIVVALEYLAAQSRSHE  362



>ref|XP_010459752.1| PREDICTED: serine/threonine-protein kinase PBS1-like isoform 
X3 [Camelina sativa]
Length=385

 Score =   416 bits (1069),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 209/289 (72%), Positives = 248/289 (86%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+E NLLGEGGFG VYKG +DS  VVA+KQL+ +GLQGN+EFIVEVLMLSLLHH N
Sbjct  77   ATRNFREVNLLGEGGFGRVYKGRLDSGQVVAIKQLNPDGLQGNREFIVEVLMLSLLHHPN  136

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HLF+LE+  E L+W  R+KIA GAARG+EYLH
Sbjct  137  LVTLIGYCTSGDQRLLVYEYMPMGSLEDHLFDLESHPEPLSWNTRMKIAVGAARGIEYLH  196

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            CTANPPVIYRDLKS+NILLD+EFNP+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  197  CTANPPVIYRDLKSANILLDKEFNPKLSDFGLAKLGPVGDRTHVSTRVMGTYGYCAPEYA  256

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLT+KSDIY FGVVLLELITGR+A D   K GEQNLV++ RP+LKD+++F  + DP 
Sbjct  257  MSGKLTVKSDIYCFGVVLLELITGRKAIDLSQKQGEQNLVTWSRPYLKDQKKFGHLVDPT  316

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L  ++  R L++A+AI AMCL ++A +RP I DI +AL+YL AQ+++ E
Sbjct  317  LRGKYPRRCLNYAIAIIAMCLNEEAHYRPFIGDIVVALEYLAAQSRSHE  365



>gb|KHN33796.1| Serine/threonine-protein kinase PBS1 [Glycine soja]
Length=359

 Score =   415 bits (1066),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 209/285 (73%), Positives = 239/285 (84%), Gaps = 0/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+ FKE NLLGEGGFG VYKG + +   VAVKQL  +G QG QEF+ EVLMLSLLH++N
Sbjct  73   ATRGFKEVNLLGEGGFGRVYKGRLATGEYVAVKQLSHDGRQGFQEFVTEVLMLSLLHNSN  132

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HLF+    KE L+W  R+KIA GAARGLEYLH
Sbjct  133  LVKLIGYCTDGDQRLLVYEYMPMGSLEDHLFDPHPDKEPLSWSTRMKIAVGAARGLEYLH  192

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C A+PPVIYRDLKS+NILLD EFNP+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  193  CKADPPVIYRDLKSANILLDNEFNPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  252

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYSFGVVLLELITGRRA D++ +PGEQNLVS+ R F  D+++FV+M DPL
Sbjct  253  MSGKLTLKSDIYSFGVVLLELITGRRAIDTNRRPGEQNLVSWSRQFFSDRKKFVQMVDPL  312

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
            L   F VR LH A+AITAMC+Q+Q  FRP I DI +AL+YL + +
Sbjct  313  LHENFPVRCLHQAMAITAMCIQEQPKFRPLIGDIVVALEYLASHS  357



>ref|XP_010459751.1| PREDICTED: serine/threonine-protein kinase PBS1-like isoform 
X2 [Camelina sativa]
Length=389

 Score =   416 bits (1068),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 209/289 (72%), Positives = 248/289 (86%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+E NLLGEGGFG VYKG +DS  VVA+KQL+ +GLQGN+EFIVEVLMLSLLHH N
Sbjct  81   ATRNFREVNLLGEGGFGRVYKGRLDSGQVVAIKQLNPDGLQGNREFIVEVLMLSLLHHPN  140

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HLF+LE+  E L+W  R+KIA GAARG+EYLH
Sbjct  141  LVTLIGYCTSGDQRLLVYEYMPMGSLEDHLFDLESHPEPLSWNTRMKIAVGAARGIEYLH  200

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            CTANPPVIYRDLKS+NILLD+EFNP+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  201  CTANPPVIYRDLKSANILLDKEFNPKLSDFGLAKLGPVGDRTHVSTRVMGTYGYCAPEYA  260

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLT+KSDIY FGVVLLELITGR+A D   K GEQNLV++ RP+LKD+++F  + DP 
Sbjct  261  MSGKLTVKSDIYCFGVVLLELITGRKAIDLSQKQGEQNLVTWSRPYLKDQKKFGHLVDPT  320

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L  ++  R L++A+AI AMCL ++A +RP I DI +AL+YL AQ+++ E
Sbjct  321  LRGKYPRRCLNYAIAIIAMCLNEEAHYRPFIGDIVVALEYLAAQSRSHE  369



>gb|ADN33950.1| protein kinase [Cucumis melo subsp. melo]
Length=402

 Score =   416 bits (1069),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 215/308 (70%), Positives = 249/308 (81%), Gaps = 19/308 (6%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+ FKE NLLGEGGFG VYKG ++S  +VAVKQL+++GLQG QEFIVEVLMLSLLHH N
Sbjct  67   ATRGFKEVNLLGEGGFGRVYKGRLESGQIVAVKQLNRDGLQGFQEFIVEVLMLSLLHHPN  126

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFEL-------------------EAGKEALN  304
            LV L+GYCT GDQRLLVYE+MP GSLE+HLF+L                      K+ L+
Sbjct  127  LVTLIGYCTDGDQRLLVYEFMPMGSLEDHLFDLLKKQITWYLHGEFLFISDLGTDKKPLS  186

Query  305  WYNRLKIAAGAARGLEYLHCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDN  484
            W  R+KIA  AARGLEYLHC ANPPVIYRDLKS+NILLD++FNP+LSDFGLAKLGPVGDN
Sbjct  187  WNTRMKIAVSAARGLEYLHCKANPPVIYRDLKSANILLDDDFNPKLSDFGLAKLGPVGDN  246

Query  485  THVSTRVMGTYGYCAPEYAMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVS  664
            THVSTR+MGTYGYCAPEYAMSGKLT+KSDIYSFGVVLLELITGR+  D   +PGEQNLV+
Sbjct  247  THVSTRIMGTYGYCAPEYAMSGKLTIKSDIYSFGVVLLELITGRKVIDIKRRPGEQNLVA  306

Query  665  YCRPFLKDKRRFVEMADPLLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYL  844
            + RP LKD+RRF+E+ DPLLE  F +R L HAVAITAMCLQ+Q SFRP I+DI +AL+YL
Sbjct  307  WSRPLLKDRRRFMELVDPLLEGHFPLRCLQHAVAITAMCLQEQPSFRPLITDIVVALEYL  366

Query  845  VAQAQTSE  868
             +Q+   E
Sbjct  367  ASQSCLRE  374



>ref|XP_010459750.1| PREDICTED: serine/threonine-protein kinase PBS1-like isoform 
X1 [Camelina sativa]
Length=392

 Score =   416 bits (1068),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 209/289 (72%), Positives = 248/289 (86%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+E NLLGEGGFG VYKG +DS  VVA+KQL+ +GLQGN+EFIVEVLMLSLLHH N
Sbjct  84   ATRNFREVNLLGEGGFGRVYKGRLDSGQVVAIKQLNPDGLQGNREFIVEVLMLSLLHHPN  143

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HLF+LE+  E L+W  R+KIA GAARG+EYLH
Sbjct  144  LVTLIGYCTSGDQRLLVYEYMPMGSLEDHLFDLESHPEPLSWNTRMKIAVGAARGIEYLH  203

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            CTANPPVIYRDLKS+NILLD+EFNP+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  204  CTANPPVIYRDLKSANILLDKEFNPKLSDFGLAKLGPVGDRTHVSTRVMGTYGYCAPEYA  263

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLT+KSDIY FGVVLLELITGR+A D   K GEQNLV++ RP+LKD+++F  + DP 
Sbjct  264  MSGKLTVKSDIYCFGVVLLELITGRKAIDLSQKQGEQNLVTWSRPYLKDQKKFGHLVDPT  323

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L  ++  R L++A+AI AMCL ++A +RP I DI +AL+YL AQ+++ E
Sbjct  324  LRGKYPRRCLNYAIAIIAMCLNEEAHYRPFIGDIVVALEYLAAQSRSHE  372



>ref|XP_006416376.1| hypothetical protein EUTSA_v10007921mg [Eutrema salsugineum]
 gb|ESQ34729.1| hypothetical protein EUTSA_v10007921mg [Eutrema salsugineum]
Length=381

 Score =   415 bits (1066),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 210/290 (72%), Positives = 250/290 (86%), Gaps = 1/290 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDS-QSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+E NL+GEGGFG VYKG +DS Q VVA+KQL+ +GLQGN+EFIVEVLMLSLLHH 
Sbjct  73   ATRNFREVNLIGEGGFGRVYKGRLDSGQQVVAIKQLNPDGLQGNREFIVEVLMLSLLHHP  132

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLV L+GYCT GDQRLLVYEYMP GSLE+HLF+LEA +E L+W  R+KIA GAARG+EYL
Sbjct  133  NLVTLIGYCTSGDQRLLVYEYMPMGSLEDHLFDLEANQEPLSWNTRMKIAVGAARGIEYL  192

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            HCTANPPVIYRDLKS+NILLD+EFNP+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  193  HCTANPPVIYRDLKSANILLDKEFNPKLSDFGLAKLGPVGDRTHVSTRVMGTYGYCAPEY  252

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AMSGKLT+KSDIY FGVVLLELITGR+A D   K GEQNLV + RP+LKD+++F ++ DP
Sbjct  253  AMSGKLTIKSDIYCFGVVLLELITGRKAIDFSQKQGEQNLVVWSRPYLKDQKKFGQLVDP  312

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
             L  ++  R L++A+AI AMCL ++A +RP I DI +AL+YL AQ+++ E
Sbjct  313  SLRGKYPRRCLNYAIAIIAMCLNEEAHYRPFIGDIVVALEYLSAQSRSHE  362



>gb|KFK44177.1| hypothetical protein AALP_AA1G224600 [Arabis alpina]
Length=380

 Score =   415 bits (1066),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 209/289 (72%), Positives = 247/289 (85%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+E NLLGEGGFG VYKG +DS  VVA+KQL+ +GLQGN+EFIVEVLMLSLLHH N
Sbjct  74   ATRNFREVNLLGEGGFGRVYKGRLDSGQVVAIKQLNPDGLQGNREFIVEVLMLSLLHHPN  133

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HLF+LE+ +E L+W  R+KIA GAARG+EYLH
Sbjct  134  LVTLIGYCTSGDQRLLVYEYMPMGSLEDHLFDLESNQEPLSWNTRMKIAVGAARGIEYLH  193

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            CTANPPVIYRDLKS+NILLD EFNP+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  194  CTANPPVIYRDLKSANILLDIEFNPKLSDFGLAKLGPVGDRTHVSTRVMGTYGYCAPEYA  253

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLT+KSDIY FGVVLLELITGR+A D   K GEQNLV + RP+LKD+++F  + DP 
Sbjct  254  MSGKLTVKSDIYCFGVVLLELITGRKAIDLSQKQGEQNLVVWSRPYLKDQKKFGHLVDPS  313

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L  ++  R L++A+AI AMCL ++A +RP I DI +AL+YL AQ+++ E
Sbjct  314  LRGKYPKRCLNYAIAIIAMCLNEEAHYRPFIGDIVVALEYLAAQSRSHE  362



>emb|CDY33638.1| BnaC08g19380D [Brassica napus]
Length=378

 Score =   414 bits (1065),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 208/290 (72%), Positives = 248/290 (86%), Gaps = 1/290 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDS-QSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+E NLLGEGGFG VYKG +DS Q VVA+KQL+ +GLQGN+EFIVEVLMLSL HH 
Sbjct  70   ATRNFREVNLLGEGGFGRVYKGRLDSGQQVVAIKQLNPDGLQGNREFIVEVLMLSLFHHP  129

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLV L+GYCT GDQRLLVYEYMP GSLE+HLF+L++ +E L W  R+KIA GAARG+EYL
Sbjct  130  NLVTLIGYCTSGDQRLLVYEYMPMGSLEDHLFDLDSNQEPLTWNTRMKIAVGAARGIEYL  189

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            HCTANPPVIYRDLKS+NILLD+EFNP+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  190  HCTANPPVIYRDLKSANILLDKEFNPKLSDFGLAKLGPVGDRTHVSTRVMGTYGYCAPEY  249

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AMSGKLT+KSDIY FGVVLLEL+TGR+A D   K GEQNLV++ RP+LKD+++F  + DP
Sbjct  250  AMSGKLTVKSDIYCFGVVLLELVTGRKAIDLSQKQGEQNLVAWSRPYLKDQKKFGHLVDP  309

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
             L  ++  R L++A+AI AMCL ++A +RP I DI +AL+YL AQ+Q+ E
Sbjct  310  SLRGKYPRRCLNYAIAIIAMCLNEEAHYRPFIGDIVVALEYLAAQSQSHE  359



>ref|XP_010477315.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Camelina 
sativa]
Length=384

 Score =   414 bits (1065),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 208/289 (72%), Positives = 247/289 (85%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+E NLLGEGGFG VYKG +DS  VVA+KQL+ +GLQGN+EFIVEVLMLSLLHH N
Sbjct  76   ATRNFREVNLLGEGGFGRVYKGRLDSGQVVAIKQLNPDGLQGNREFIVEVLMLSLLHHPN  135

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HLF+LE+  E L+W  R+KIA GAARG+EYLH
Sbjct  136  LVTLIGYCTSGDQRLLVYEYMPMGSLEDHLFDLESHPEPLSWNTRMKIAVGAARGIEYLH  195

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            CTANPPVIYRDLKS+NILLD+EFNP+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  196  CTANPPVIYRDLKSANILLDKEFNPKLSDFGLAKLGPVGDRTHVSTRVMGTYGYCAPEYA  255

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLT+KSDIY FGVVLLELITGR+A D   K GEQNLV++ RP+LKD+++F  + DP 
Sbjct  256  MSGKLTVKSDIYCFGVVLLELITGRKAIDLSQKQGEQNLVTWSRPYLKDQKKFGHLVDPT  315

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L  ++  R L++A+AI AMCL ++A +RP I DI +AL+YL  Q+++ E
Sbjct  316  LRGKYPRRCLNYAIAIIAMCLNEEAHYRPFIGDIVVALEYLAVQSRSHE  364



>dbj|BAD44229.1| unknown protein [Arabidopsis thaliana]
Length=381

 Score =   414 bits (1064),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 208/289 (72%), Positives = 249/289 (86%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+E NLLGEGGFG VYKG +DS  VVA+KQL+ +GLQGN+EFIVEVLMLSLLHH N
Sbjct  74   ATRNFREVNLLGEGGFGRVYKGRLDSGQVVAIKQLNPDGLQGNREFIVEVLMLSLLHHPN  133

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HLF+LE+ +E L+W  R+KIA GAARG+EYLH
Sbjct  134  LVTLIGYCTSGDQRLLVYEYMPMGSLEDHLFDLESNQEPLSWNTRMKIAVGAARGIEYLH  193

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            CTANPPVIYRDLKS+NILLD+EF+P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  194  CTANPPVIYRDLKSANILLDKEFSPKLSDFGLAKLGPVGDRTHVSTRVMGTYGYCAPEYA  253

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLT+KSDIY FGVVLLELITGR+A D   K GEQNLV++ RP+LKD+++F  + DP 
Sbjct  254  MSGKLTVKSDIYCFGVVLLELITGRKAIDLGQKQGEQNLVTWSRPYLKDQKKFGHLVDPS  313

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L  ++  R L++A+AI AMCL ++A +RP I DI +AL+YL AQ+++ E
Sbjct  314  LRGKYPRRCLNYAIAIIAMCLNEEAHYRPFIGDIVVALEYLAAQSRSHE  362



>ref|NP_173489.2| protein ALTERED SEED GERMINATION 5 [Arabidopsis thaliana]
 gb|AAF79602.1|AC027665_3 F5M15.3 [Arabidopsis thaliana]
 gb|AAF80637.1|AC069251_30 F2D10.13 [Arabidopsis thaliana]
 dbj|BAD44289.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30001.1| protein ALTERED SEED GERMINATION 5 [Arabidopsis thaliana]
Length=381

 Score =   414 bits (1064),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 208/289 (72%), Positives = 249/289 (86%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+E NLLGEGGFG VYKG +DS  VVA+KQL+ +GLQGN+EFIVEVLMLSLLHH N
Sbjct  74   ATRNFREVNLLGEGGFGRVYKGRLDSGQVVAIKQLNPDGLQGNREFIVEVLMLSLLHHPN  133

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HLF+LE+ +E L+W  R+KIA GAARG+EYLH
Sbjct  134  LVTLIGYCTSGDQRLLVYEYMPMGSLEDHLFDLESNQEPLSWNTRMKIAVGAARGIEYLH  193

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            CTANPPVIYRDLKS+NILLD+EF+P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  194  CTANPPVIYRDLKSANILLDKEFSPKLSDFGLAKLGPVGDRTHVSTRVMGTYGYCAPEYA  253

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLT+KSDIY FGVVLLELITGR+A D   K GEQNLV++ RP+LKD+++F  + DP 
Sbjct  254  MSGKLTVKSDIYCFGVVLLELITGRKAIDLGQKQGEQNLVTWSRPYLKDQKKFGHLVDPS  313

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L  ++  R L++A+AI AMCL ++A +RP I DI +AL+YL AQ+++ E
Sbjct  314  LRGKYPRRCLNYAIAIIAMCLNEEAHYRPFIGDIVVALEYLAAQSRSHE  362



>ref|XP_006304635.1| hypothetical protein CARUB_v10011749mg [Capsella rubella]
 gb|EOA37533.1| hypothetical protein CARUB_v10011749mg [Capsella rubella]
Length=383

 Score =   414 bits (1064),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 208/289 (72%), Positives = 248/289 (86%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+E NLLGEGGFG V+KG +DS  VVA+KQL+ +GLQGN+EFIVEVLMLSLLHH N
Sbjct  75   ATRNFREVNLLGEGGFGRVFKGRLDSGQVVAIKQLNPDGLQGNREFIVEVLMLSLLHHPN  134

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HLF+LEA  E L+W  R+KIA GAARG+EYLH
Sbjct  135  LVTLIGYCTSGDQRLLVYEYMPMGSLEDHLFDLEAHPEPLSWNTRMKIAVGAARGIEYLH  194

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            CTANPPVIYRDLKS+NILLD++FNP+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  195  CTANPPVIYRDLKSANILLDKDFNPKLSDFGLAKLGPVGDRTHVSTRVMGTYGYCAPEYA  254

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLT+KSDIY FGVVLLELITGR+A D   K GEQNLV++ RP+LKD+++F  + DP 
Sbjct  255  MSGKLTVKSDIYCFGVVLLELITGRKAIDLSQKQGEQNLVTWSRPYLKDQKKFGHIVDPS  314

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L  ++  R L++A+AI AMCL ++A +RP I DI +AL+YL AQ+++ E
Sbjct  315  LRGKYPRRCLNYAIAIIAMCLNEEAHYRPFIGDIVVALEYLAAQSRSHE  363



>ref|XP_010498498.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Camelina 
sativa]
Length=384

 Score =   413 bits (1062),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 207/289 (72%), Positives = 246/289 (85%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+E NLLGEGGFG VYKG +DS  VVA+KQL+ +GLQGN+EFIVE+LMLSLLHH N
Sbjct  76   ATRNFREVNLLGEGGFGRVYKGRLDSGQVVAIKQLNPDGLQGNREFIVEILMLSLLHHPN  135

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HLF+LE   E L+W  R+KIA GAARG+EYLH
Sbjct  136  LVTLIGYCTSGDQRLLVYEYMPMGSLEDHLFDLELHPEPLSWNTRMKIAVGAARGIEYLH  195

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            CTANPPVIYRDLKS+NILLD+EFNP+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  196  CTANPPVIYRDLKSANILLDKEFNPKLSDFGLAKLGPVGDRTHVSTRVMGTYGYCAPEYA  255

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLT+KSDIY FGVVLLELITGR+A D   K GEQNLV++ RP+LKD+++F  + DP 
Sbjct  256  MSGKLTVKSDIYCFGVVLLELITGRKAIDLSQKQGEQNLVTWSRPYLKDQKKFGHLVDPT  315

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L  ++  R L++A+AI AMCL ++A +RP I DI +AL+YL  Q+++ E
Sbjct  316  LRGKYPRRCLNYAIAIIAMCLNEEAHYRPFIGDIVVALEYLAVQSRSHE  364



>ref|XP_002893124.1| protein kinase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69383.1| protein kinase [Arabidopsis lyrata subsp. lyrata]
Length=381

 Score =   411 bits (1057),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 207/289 (72%), Positives = 248/289 (86%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+E NLLGEGGFG VYKG +DS  VVA+KQL+ +GLQGN+EFIVEVLMLSLLHH N
Sbjct  74   ATRNFREVNLLGEGGFGRVYKGRLDSGQVVAIKQLNPDGLQGNREFIVEVLMLSLLHHPN  133

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HLF+LE+ +E L+W  R+KIA GAARG+EYLH
Sbjct  134  LVTLIGYCTSGDQRLLVYEYMPMGSLEDHLFDLESNQEPLSWNTRMKIAVGAARGIEYLH  193

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            CTANPPVIYRDLKS+NILLD+EF+P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  194  CTANPPVIYRDLKSANILLDKEFSPKLSDFGLAKLGPVGDRTHVSTRVMGTYGYCAPEYA  253

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLT+KSDIY FGVVLLELITGR+A D   K GEQNLV++ R +LKD+++F  + DP 
Sbjct  254  MSGKLTVKSDIYCFGVVLLELITGRKAIDLSQKQGEQNLVTWSRSYLKDQKKFGHLVDPS  313

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L  ++  R L++A+AI AMCL ++A +RP I DI +AL+YL AQ+++ E
Sbjct  314  LRGKYPRRCLNYAIAIIAMCLNEEAHYRPFIGDIVVALEYLAAQSRSHE  362



>ref|XP_010539791.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Tarenaya 
hassleriana]
Length=380

 Score =   410 bits (1054),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 208/288 (72%), Positives = 245/288 (85%), Gaps = 0/288 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+E NL+GEGGFG V+KG +DS  VVA+KQL+ +G QGNQEFIVEVLMLSLLHH N
Sbjct  75   ATRNFREVNLIGEGGFGRVFKGRLDSGQVVAIKQLNPDGHQGNQEFIVEVLMLSLLHHQN  134

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYC  GDQRLLVYEYM  GSLE+HLF+LE  +E LNW  R+KIA GAARGLEYLH
Sbjct  135  LVTLIGYCVSGDQRLLVYEYMSMGSLEDHLFDLEPDQEPLNWITRMKIAVGAARGLEYLH  194

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C ANPPVIYRDLKS+NILLDE+FNP+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  195  CKANPPVIYRDLKSANILLDEDFNPKLSDFGLAKLGPVGDRTHVSTRVMGTYGYCAPEYA  254

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLT+KSDIYSFGVVLLELITGR+A D   + GEQNLV++ RP LKD+++F ++ DP 
Sbjct  255  MSGKLTVKSDIYSFGVVLLELITGRKAIDVTRQQGEQNLVAWARPLLKDQKKFGQLVDPS  314

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTS  865
            L  R+  R L++A+AITAMCL ++A +RP I DI +AL+YL AQ++ S
Sbjct  315  LRGRYPRRCLNYALAITAMCLNEEAHYRPFIGDILVALEYLAAQSEAS  362



>ref|NP_001241209.1| serine/threonine-protein kinase PBS1-like [Glycine max]
 gb|ACM89496.1| protein kinase [Glycine max]
Length=344

 Score =   408 bits (1048),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 205/285 (72%), Positives = 238/285 (84%), Gaps = 0/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+ FKE NLLGEGGFG VYKG + +   VAVKQL  +G QG  EF+ EVLMLSLLH +N
Sbjct  58   ATRGFKEVNLLGEGGFGRVYKGRLSTGEYVAVKQLIHDGRQGFHEFVTEVLMLSLLHDSN  117

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HLF+    KE L+W  R+KIA GAARGLEYLH
Sbjct  118  LVKLIGYCTDGDQRLLVYEYMPMGSLEDHLFDPHPDKEPLSWSTRMKIAVGAARGLEYLH  177

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C A+PPVIYRDLKS+NILLD EFNP+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  178  CKADPPVIYRDLKSANILLDNEFNPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  237

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYSFGV+LLELITGRRA D++ +PGEQNLVS+ R F  D+++FV+M DPL
Sbjct  238  MSGKLTLKSDIYSFGVLLLELITGRRAIDTNRRPGEQNLVSWSRQFFSDRKKFVQMIDPL  297

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
            L+  F +R L+ A+AITAMC+Q+Q  FRP I DI +AL+YL + +
Sbjct  298  LQENFPLRCLNQAMAITAMCIQEQPKFRPLIGDIVVALEYLASHS  342



>gb|ACU23090.1| unknown [Glycine max]
Length=344

 Score =   407 bits (1046),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 205/285 (72%), Positives = 237/285 (83%), Gaps = 0/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+ FKE NLLGEGGFG VYKG + +   VAVKQL  +G QG  EF+ EVLMLSLLH +N
Sbjct  58   ATRGFKEVNLLGEGGFGRVYKGRLSTGEYVAVKQLIHDGRQGFHEFVTEVLMLSLLHDSN  117

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HLF+    KE L+W  R+KIA GAARGLEYLH
Sbjct  118  LVKLIGYCTDGDQRLLVYEYMPMGSLEDHLFDPHPDKEPLSWSTRMKIAVGAARGLEYLH  177

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C A+PPVIYRDLKS+NILLD EFNP+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  178  CKADPPVIYRDLKSANILLDNEFNPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  237

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYSFGV+LLELITGRRA D++ +PGEQNLVS+ R F  D+++FV+M DPL
Sbjct  238  MSGKLTLKSDIYSFGVLLLELITGRRAIDTNRRPGEQNLVSWSRQFFSDRKKFVQMIDPL  297

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
            L+  F +R L+ A+AITAMC Q+Q  FRP I DI +AL+YL + +
Sbjct  298  LQENFPLRCLNQAMAITAMCTQEQPKFRPLIGDIVVALEYLASHS  342



>gb|KHN20109.1| Serine/threonine-protein kinase PBS1 [Glycine soja]
Length=346

 Score =   407 bits (1046),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 205/285 (72%), Positives = 238/285 (84%), Gaps = 0/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+ FKE NLLGEGGFG VYKG + +   VAVKQL  +G QG  EF+ EVLMLSLLH +N
Sbjct  60   ATRGFKEVNLLGEGGFGRVYKGRLSTGEYVAVKQLIHDGRQGFHEFVTEVLMLSLLHDSN  119

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HLF+    KE L+W  R+KIA GAARGLEYLH
Sbjct  120  LVKLIGYCTDGDQRLLVYEYMPMGSLEDHLFDPHPDKEPLSWSTRMKIAVGAARGLEYLH  179

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C A+PPVIYRDLKS+NILLD EFNP+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  180  CKADPPVIYRDLKSANILLDNEFNPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  239

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYSFGV+LLELITGRRA D++ +PGEQNLVS+ R F  D+++FV+M DPL
Sbjct  240  MSGKLTLKSDIYSFGVLLLELITGRRAIDTNRRPGEQNLVSWSRQFFSDRKKFVQMIDPL  299

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
            L+  F +R L+ A+AITAMC+Q+Q  FRP I DI +AL+YL + +
Sbjct  300  LQENFPLRCLNQAMAITAMCIQEQPKFRPLIGDIVVALEYLASHS  344



>ref|XP_010534191.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Tarenaya 
hassleriana]
Length=379

 Score =   407 bits (1046),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 203/289 (70%), Positives = 245/289 (85%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT NF+E+N +GEGGFG V+KG +DS  VVA+KQL+ +GLQGNQEFIVEVLMLSLLHH N
Sbjct  75   ATMNFREANSIGEGGFGRVFKGRLDSGQVVAIKQLNPDGLQGNQEFIVEVLMLSLLHHPN  134

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEY+  GSLE+HLF+LE  +E LNW  R+KIA GAARG+EYLH
Sbjct  135  LVTLIGYCTSGDQRLLVYEYLSMGSLEDHLFDLEPDQEPLNWITRMKIAVGAARGIEYLH  194

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C ANPPVIYRDLKS+NILLD++FNP+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  195  CKANPPVIYRDLKSANILLDKDFNPKLSDFGLAKLGPVGDRTHVSTRVMGTYGYCAPEYA  254

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLT+KSDIYSFGVVLLELI+GR+A D   K  EQNL+++ RPFLKD+++F ++ DP 
Sbjct  255  MSGKLTVKSDIYSFGVVLLELISGRKAIDVSRKQSEQNLIAWSRPFLKDQKKFGQLVDPS  314

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L  R   R L++++AITAMCL ++A +RP I DI +AL+YL  Q++ S+
Sbjct  315  LRGRLPRRCLNYSIAITAMCLNEEAQYRPLIGDIVVALEYLAVQSEASD  363



>ref|XP_009149542.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Brassica 
rapa]
Length=381

 Score =   404 bits (1038),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 205/289 (71%), Positives = 243/289 (84%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+E NLLGEGGFG VYKG +DS  VVA+KQL+ +G+QGN+EFIVEVLMLSLLHH N
Sbjct  74   ATRNFREVNLLGEGGFGRVYKGRLDSGQVVAIKQLNPDGVQGNREFIVEVLMLSLLHHPN  133

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYM  GSLE+HLF+LE  +E L W  R+KIA GAARG+EYLH
Sbjct  134  LVTLIGYCTSGDQRLLVYEYMTMGSLEDHLFDLEPNQEPLGWNTRIKIAVGAARGIEYLH  193

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            CTANPPVIYRDLKS+NILLD++F P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  194  CTANPPVIYRDLKSANILLDKDFIPKLSDFGLAKLGPVGDRTHVSTRVMGTYGYCAPEYA  253

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLT+KSDIY FGVVLLEL+TGR+A D +   GEQNLVS+ RP+LKD+++F  + DP 
Sbjct  254  MSGKLTVKSDIYCFGVVLLELLTGRKAIDLNQTQGEQNLVSWSRPYLKDQKKFGHLVDPS  313

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L  R+  R L++A+AI AMCL ++A  RP I DI +AL+YL A +Q+ E
Sbjct  314  LRGRYPRRCLNYAIAIIAMCLNEEAHCRPFIGDIVVALEYLAAHSQSHE  362



>ref|XP_006855747.1| hypothetical protein AMTR_s00044p00167070 [Amborella trichopoda]
 gb|ERN17214.1| hypothetical protein AMTR_s00044p00167070 [Amborella trichopoda]
Length=404

 Score =   404 bits (1039),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 205/292 (70%), Positives = 245/292 (84%), Gaps = 1/292 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQ-SVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+ +NL+GEGGFG V+KG ++S   VVA+KQL+++G QGN+EFIVEVLMLSLLHH 
Sbjct  87   ATRNFRPANLIGEGGFGKVFKGRLESSGQVVAIKQLNRDGCQGNREFIVEVLMLSLLHHP  146

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+G+C  GDQRLLVYE+MP G+L +HLF+L  GK+ L W  R+KIA GAARGLEYL
Sbjct  147  NLVNLIGFCADGDQRLLVYEFMPMGNLGDHLFDLPPGKDPLQWNTRMKIAMGAARGLEYL  206

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKS+NILLD +F+P+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY
Sbjct  207  HDKANPPVIYRDLKSANILLDNDFDPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  266

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G +TLKSD+YSFGVVLLELITGR+  D     GEQNLV++ RP  KD+R+FV+MADP
Sbjct  267  AMTGHVTLKSDVYSFGVVLLELITGRKVLDCSRPVGEQNLVAWSRPLFKDRRKFVQMADP  326

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSERN  874
            LL+ +F +R LHHA+AI AMCLQ+QAS RP ISDI  AL+YL +Q    E N
Sbjct  327  LLQGQFPMRGLHHAIAICAMCLQEQASTRPLISDIVTALEYLASQPFAPEMN  378



>ref|XP_010645818.1| PREDICTED: serine/threonine-protein kinase CDL1-like isoform 
X1 [Vitis vinifera]
 emb|CBI37740.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   402 bits (1034),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 201/289 (70%), Positives = 241/289 (83%), Gaps = 2/289 (1%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT++FK   ++GEGGFG VYKG +++  +VA+K L+ EG+QG+QEFI+EVL+LSLL H+N
Sbjct  64   ATRSFKV--MIGEGGFGKVYKGKLENGQIVAIKWLNHEGIQGSQEFIMEVLLLSLLRHSN  121

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HLF++   K  L W  R+KIA G ARGLEYLH
Sbjct  122  LVCLIGYCTDGDQRLLVYEYMPMGSLEDHLFDVGPNKAPLEWNTRMKIAVGTARGLEYLH  181

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C ANPPVIYRDLKS+NILLD +F+P+LSDFGLAK GPVGDNTHV+TRVMGT+GYCAPEYA
Sbjct  182  CKANPPVIYRDLKSANILLDNDFHPKLSDFGLAKFGPVGDNTHVTTRVMGTHGYCAPEYA  241

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSD+YSFGVVLLELITGR A DS    GEQNLV++ RP  KD+RRF ++ DPL
Sbjct  242  MSGKLTLKSDVYSFGVVLLELITGRMAIDSTRLQGEQNLVNWARPLFKDRRRFSQLVDPL  301

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L  RF VR LHHA+AITAMCLQ+QA++RP ISD+ +AL+YL +Q    E
Sbjct  302  LRGRFPVRCLHHAIAITAMCLQEQATYRPLISDVLVALEYLASQPYNPE  350



>gb|EPS64019.1| hypothetical protein M569_10762, partial [Genlisea aurea]
Length=343

 Score =   400 bits (1027),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 201/281 (72%), Positives = 240/281 (85%), Gaps = 0/281 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            ATQNF E+NL+GEGGFG VYKG ++S  +VAVKQL+ EGLQGNQEF+VE+LMLSLLHH N
Sbjct  57   ATQNFAEANLIGEGGFGCVYKGQLESGQIVAVKQLNLEGLQGNQEFMVEILMLSLLHHPN  116

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYCTHG+QRLLVYE+MP GSLENHLF+LE  ++ L+W  RLKIA G+ARGLEYLH
Sbjct  117  LVNLIGYCTHGEQRLLVYEFMPMGSLENHLFDLEPYQKPLSWSTRLKIAIGSARGLEYLH  176

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C A+PPVIYRDLKSSNILLD++FN +LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  177  CRADPPVIYRDLKSSNILLDDDFNAKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEYA  236

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSD+YSFGV+LLELITGR+A D   K GEQNLV + RPFLK ++  +++ DPL
Sbjct  237  MSGKLTLKSDVYSFGVMLLELITGRKAIDFTKKHGEQNLVVWARPFLKHRKTLLKIVDPL  296

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYL  844
            LE +F  RS+  A+ IT MCLQ+ A  RP+I+ +  AL+++
Sbjct  297  LEGQFPARSVQQAIVITTMCLQEDAGSRPSINQVVEALEFI  337



>emb|CDY29515.1| BnaA06g14550D [Brassica napus]
Length=381

 Score =   398 bits (1023),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 201/289 (70%), Positives = 242/289 (84%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+E NLLGEGGFG VYKG +DS  VVA+KQL+ +G+QGN+EFIVEVLMLSLLHH N
Sbjct  74   ATRNFREVNLLGEGGFGRVYKGRLDSGQVVAIKQLNPDGVQGNREFIVEVLMLSLLHHPN  133

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYM  GSLE+HLF+L++ +E L W  R+KIA GAARG+EYLH
Sbjct  134  LVTLIGYCTSGDQRLLVYEYMTMGSLEDHLFDLDSNQEPLGWNTRIKIAVGAARGIEYLH  193

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            CTA+PPVIYRDLKS+NILLD++F P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  194  CTADPPVIYRDLKSANILLDKDFIPKLSDFGLAKLGPVGDRTHVSTRVMGTYGYCAPEYA  253

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLT+KSDIY FGV LLEL+TGR+A D     GEQNLVS+ RP+LKD+++F  + DP 
Sbjct  254  MSGKLTVKSDIYCFGVALLELLTGRKAIDPSQTQGEQNLVSWSRPYLKDQKKFGHLVDPS  313

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L  R+  R L++A+AI AMCL ++A  RP I DI +AL+YL A +++ E
Sbjct  314  LRGRYPRRCLNYAIAIIAMCLNEEAHCRPFIGDIVVALEYLAAHSESHE  362



>ref|XP_009418675.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Musa acuminata 
subsp. malaccensis]
Length=381

 Score =   398 bits (1022),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 193/289 (67%), Positives = 238/289 (82%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NFK  NL+GEGGFG V+KG ++S  VVAVKQL++ G+QG+QEF+VE LML++LHH N
Sbjct  62   ATRNFKPKNLIGEGGFGRVFKGHLESGQVVAVKQLNRNGMQGSQEFLVECLMLTMLHHIN  121

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV+L+GYC  GD+RLLVYEYMP GSLE+HLF+L   KE L+W  R+KIA GAA+GL YLH
Sbjct  122  LVSLIGYCAEGDERLLVYEYMPQGSLEHHLFDLPPPKEPLDWNTRIKIAVGAAKGLTYLH  181

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
               NPPVIYRDLKSSNILLD EFNP+LSDFGLAKLGPVGD+THVSTRVMGTYGYCAP+YA
Sbjct  182  DVVNPPVIYRDLKSSNILLDNEFNPKLSDFGLAKLGPVGDDTHVSTRVMGTYGYCAPDYA  241

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLT+KSD+YSFGVVLLELITGR+A+D   + GEQNL+ + RPF+KD+R+F ++ADPL
Sbjct  242  MSGKLTVKSDVYSFGVVLLELITGRKAFDFTKRLGEQNLIVWSRPFIKDRRKFSQLADPL  301

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L+ R+ +R  H    ITAMCL D    RP + ++++ALD++  Q   SE
Sbjct  302  LQGRYPIRPFHQLAMITAMCLHDHPHIRPTMREVSLALDHVATQLYVSE  350



>emb|CDY31493.1| BnaC05g16020D [Brassica napus]
Length=376

 Score =   397 bits (1020),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 203/289 (70%), Positives = 242/289 (84%), Gaps = 6/289 (2%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+E NLLGEGGFG VYKG +DS  VVA+KQL+ +G+QGN+EFIVEVLMLSLLHH N
Sbjct  75   ATRNFREVNLLGEGGFGRVYKGRLDSGKVVAIKQLNPDGVQGNREFIVEVLMLSLLHHPN  134

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT GDQRLLVYEYMP GSLE+HLFE       L W  R+KIA GAARG+EYLH
Sbjct  135  LVTLIGYCTSGDQRLLVYEYMPMGSLEDHLFE------PLGWNTRIKIAVGAARGIEYLH  188

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            CTA+PPVIYRDLKS+NILLD++F+P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  189  CTADPPVIYRDLKSANILLDKDFSPKLSDFGLAKLGPVGDRTHVSTRVMGTYGYCAPEYA  248

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLT+KSDIY FGVVLLEL+TGR+A D +   GEQNLVS+ RP+LKD+++F  + DP 
Sbjct  249  MSGKLTVKSDIYCFGVVLLELLTGRKAIDLNQTQGEQNLVSWSRPYLKDQKKFGHLVDPS  308

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L  R+  R L++A+AI AMCL ++A  RP I DI +AL+YL AQ+++ E
Sbjct  309  LRGRYPRRCLNYAIAIIAMCLNEEAHCRPFIGDIVVALEYLAAQSRSHE  357



>ref|XP_008809102.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Phoenix 
dactylifera]
Length=380

 Score =   397 bits (1020),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 188/284 (66%), Positives = 237/284 (83%), Gaps = 0/284 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            ATQNFK +NL+GEGGFG V+KG IDS  VVA+KQL+++GLQG++EF+VE+LML  L H N
Sbjct  56   ATQNFKTTNLIGEGGFGKVFKGRIDSGQVVAIKQLNRDGLQGSKEFLVEILMLITLQHEN  115

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYC  GDQRLL+YEYMP GSLE+HLF++  GK+ L+W  R+KIA GAA+GL YLH
Sbjct  116  LVRLIGYCAEGDQRLLIYEYMPQGSLEDHLFDVSPGKQHLDWNTRIKIAVGAAKGLTYLH  175

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
              ANPPVIYRD+K++N+LLD +FNP+LSDFGLAKLGPVGDNTHVSTRVMGTYGYC P+YA
Sbjct  176  DVANPPVIYRDMKAANVLLDNDFNPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCDPDYA  235

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLT+KSD+YSFGV+LLELITGR+A+DS    G++NL+ + RPFL DKRRF ++ADPL
Sbjct  236  MSGKLTIKSDVYSFGVLLLELITGRKAFDSTKTGGDKNLMKWSRPFLNDKRRFGQLADPL  295

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LE  +  R+ H  V + +MCLQDQA  RP + D+ +AL+++ +Q
Sbjct  296  LEGCYPPRAFHQLVVVASMCLQDQAHVRPIMHDVVIALNHIASQ  339



>ref|XP_009390872.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Musa acuminata 
subsp. malaccensis]
Length=385

 Score =   395 bits (1015),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 190/287 (66%), Positives = 238/287 (83%), Gaps = 0/287 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            ATQNF+E+NL+GEGGFG VY+G IDS  VVA+KQL+++GLQGN+EF+VEVLML +L H N
Sbjct  63   ATQNFREANLIGEGGFGRVYRGRIDSGQVVAIKQLNRDGLQGNKEFLVEVLMLIVLRHPN  122

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV+L+GYC  GD+RLLVYEYMP GSLE+HLF+    K  L+W  R+KIA G ARGL YLH
Sbjct  123  LVSLIGYCADGDERLLVYEYMPKGSLEDHLFDPPPSKPHLDWNTRIKIAVGVARGLTYLH  182

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
              ANPPVIYRD+K++N+LLD++FNP+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAP+YA
Sbjct  183  DVANPPVIYRDMKAANVLLDDDFNPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPDYA  242

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSD+YSFGV+LLELITGRRA+DS    G+Q L+++ RPFL D+R+F ++ADP 
Sbjct  243  MSGKLTLKSDVYSFGVLLLELITGRRAFDSSKIGGQQKLMTWSRPFLGDRRKFYQLADPF  302

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQT  862
            L+ R+  R  H  V I +MCLQ+Q   RP I+D+ +AL+++ +Q  T
Sbjct  303  LQGRYPPRPFHQLVVIASMCLQEQPHVRPIIADVVVALNHVASQPYT  349



>ref|XP_009604106.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Nicotiana 
tomentosiformis]
Length=365

 Score =   394 bits (1012),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 198/285 (69%), Positives = 240/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVID-SQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++ +  +VA+KQLDQ GLQGN+EF+VEVLMLSLLHH 
Sbjct  56   ATKNFRADYLLGEGGFGRVYKGRLERTNQIVAIKQLDQNGLQGNREFLVEVLMLSLLHHP  115

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            +LVNL+GYC  GDQRLLVYEYMP GSLE+HL EL   K  L+W  R+KIAAGAA+GLEYL
Sbjct  116  HLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHELSPEKRRLDWNTRMKIAAGAAKGLEYL  175

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLK SNILLDE++NP+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  176  HDKANPPVIYRDLKCSNILLDEDYNPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  235

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLE+ITGRRA D+    GEQNLV++ RP  KD+R+F +MADP
Sbjct  236  AMTGQLTLKSDVYSFGVVLLEIITGRRAIDTSRAAGEQNLVAWARPLFKDRRKFSQMADP  295

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            +L+ ++ VR L+ A+A+ AMC+Q+Q + RP I+D+  AL+YL +Q
Sbjct  296  MLQGQYPVRGLYQALAVAAMCVQEQPNMRPLIADVVTALNYLASQ  340



>ref|XP_010666681.1| PREDICTED: serine/threonine-protein kinase CDL1 [Beta vulgaris 
subsp. vulgaris]
Length=508

 Score =   399 bits (1025),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 203/285 (71%), Positives = 241/285 (85%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+  +LLGEGGFG VYKG ++S   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  82   ATKNFRPESLLGEGGFGRVYKGRLESTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  141

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL ++  GKE L+W  R+KIAAGAA+GLEYL
Sbjct  142  NLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDIPPGKEPLDWNTRMKIAAGAAKGLEYL  201

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILLDE ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  202  HDKANPPVIYRDLKSSNILLDEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  261

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+   PGE NLV++ RP  KD+R+F +MADP
Sbjct  262  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNTRAPGEHNLVAWARPLFKDRRKFPKMADP  321

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  322  LLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQ  366



>ref|XP_003549479.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Glycine 
max]
 gb|KHN48522.1| Serine/threonine-protein kinase PBS1 [Glycine soja]
Length=357

 Score =   393 bits (1010),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 202/289 (70%), Positives = 236/289 (82%), Gaps = 5/289 (2%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDS---QSVVAVKQL--DQEGLQGNQEFIVEvlmlsl  166
            A   FKE NL+GEGGFG VYKG + +     +VA+KQL  D E  QGN+EF+ EVLMLSL
Sbjct  46   AASGFKEVNLIGEGGFGKVYKGRLSATLGSQLVAIKQLRLDGESHQGNREFVTEVLMLSL  105

Query  167  lhhnnlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARG  346
            LHH+NLV L+GYCTHGDQRLLVYEYMP GSLENHLF+    KEAL+W  RL IA GAARG
Sbjct  106  LHHSNLVKLIGYCTHGDQRLLVYEYMPMGSLENHLFDPNPNKEALSWKTRLNIAVGAARG  165

Query  347  LEYLHCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYC  526
            L+YLHC ANPPVIYRDLKS+NILLD    P+LSDFGLAKLGPVGDNTHVSTRVMGTYGYC
Sbjct  166  LQYLHCEANPPVIYRDLKSANILLDYNLKPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYC  225

Query  527  APEYAMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVE  706
            APEYAMSGKLTLKSDIYSFGVVLLELITGR+A D + +P EQ+LV++ RPFL D+R+   
Sbjct  226  APEYAMSGKLTLKSDIYSFGVVLLELITGRKAMDVNRRPREQSLVAWSRPFLSDRRKLSH  285

Query  707  MADPLLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            + DP LE  + +R LH+A+AITAMCLQ+Q + RP+I DI +AL+YL ++
Sbjct  286  IVDPRLEGNYPLRCLHNAIAITAMCLQEQPNLRPSIGDIVVALEYLASE  334



>ref|XP_009798942.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Nicotiana 
sylvestris]
Length=366

 Score =   393 bits (1010),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 197/285 (69%), Positives = 240/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVID-SQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++ +  +VA+KQLDQ GLQGN+EF+VEVLMLSLLHH 
Sbjct  57   ATKNFRADYLLGEGGFGRVYKGRLERTNQIVAIKQLDQNGLQGNREFLVEVLMLSLLHHP  116

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            +LVNL+GYC  GDQRLLVYEYMP GSLE+HL EL   K  L+W  R+KIAAGAA+GLEYL
Sbjct  117  HLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHELSPKKRRLDWNTRMKIAAGAAKGLEYL  176

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLK SNILLDE++NP+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  177  HDKANPPVIYRDLKCSNILLDEDYNPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  236

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLE+I+GRRA D+    GEQNLV++ RP  KD+R+F +MADP
Sbjct  237  AMTGQLTLKSDVYSFGVVLLEIISGRRAIDTSRAAGEQNLVAWARPLFKDRRKFSQMADP  296

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            +L+ ++ VR L+ A+A+ AMC+Q+Q + RP I+D+  AL+YL +Q
Sbjct  297  MLQGQYPVRGLYQALAVAAMCVQEQPNMRPLIADVVTALNYLASQ  341



>ref|XP_010905510.1| PREDICTED: serine/threonine-protein kinase CDL1-like [Elaeis 
guineensis]
Length=390

 Score =   394 bits (1013),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 192/289 (66%), Positives = 239/289 (83%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NFK+SNL+GEGGFG VY G ++S  VVA+KQL+  GLQG  EF+VEVLML +LHH N
Sbjct  69   ATKNFKQSNLIGEGGFGKVYMGHLNSGQVVAIKQLNPNGLQGTHEFLVEVLMLIMLHHPN  128

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV+L+GYC  GD+RLLVYEYMP GSLENHLF+L  GKE L+W  R+KIA GAA+GL YLH
Sbjct  129  LVSLIGYCHEGDERLLVYEYMPQGSLENHLFDLPPGKEPLDWNTRIKIAVGAAKGLTYLH  188

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
               NPPVIYRDLKSSNILLD++FNP+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAP+YA
Sbjct  189  DVVNPPVIYRDLKSSNILLDDDFNPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPDYA  248

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
             SGKLT+K+D+YSFGVVLLELITG++A+D   +PGEQNL+    PFL D+R+F ++ADPL
Sbjct  249  TSGKLTVKADVYSFGVVLLELITGQKAFDLSKEPGEQNLIKRSHPFLNDRRKFTQLADPL  308

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L+  + +R+ +    IT+MCL ++A  RP++ D+A+ALD++ +Q   SE
Sbjct  309  LQGCYPLRAFYQLAVITSMCLHERAHLRPSMRDVAVALDHVASQPYISE  357



>ref|XP_009382067.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Musa acuminata 
subsp. malaccensis]
Length=386

 Score =   394 bits (1012),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 192/291 (66%), Positives = 239/291 (82%), Gaps = 0/291 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            ATQNFKE+NL+GEGGFG V+KG +DS  V+A+KQL Q+GLQG++EF+VEVLML++L H N
Sbjct  63   ATQNFKEANLIGEGGFGRVFKGRLDSGQVLAIKQLKQDGLQGSKEFLVEVLMLTVLRHPN  122

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV+L+GYC  GD+RLLVYE+MP GSLE+HLF+L   K  L W  R++IA GAA+GL YLH
Sbjct  123  LVSLIGYCAEGDERLLVYEFMPKGSLEDHLFDLSPQKPPLEWNTRIRIALGAAKGLTYLH  182

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
              A+PPVIYRD+K++NILLD  FNP+LSDFGLAKLGPVGD THVSTRVMGTYGYCAP+Y 
Sbjct  183  DVASPPVIYRDMKAANILLDNNFNPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPDYV  242

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSDIYSFGV+LLELITGRRA+D      EQNLV++ RPFL D+R+F+++ADP 
Sbjct  243  MSGKLTLKSDIYSFGVLLLELITGRRAFDYSRTRAEQNLVTWSRPFLNDRRKFLQLADPS  302

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSERN  874
            L   +  R+ H  V IT+MCLQ+QA  RP I+D+ +ALD++ +Q  T+E N
Sbjct  303  LRGHYPPRAFHQLVVITSMCLQEQAHVRPIIADVVVALDHVASQPYTAEPN  353



>ref|XP_011011462.1| PREDICTED: serine/threonine-protein kinase CDL1-like [Populus 
euphratica]
Length=515

 Score =   398 bits (1023),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 205/285 (72%), Positives = 240/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDS-QSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG I+S   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  86   ATKNFRPECLLGEGGFGRVYKGRIESTDQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  145

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KE L+W  R+KIAAGAA+GLEYL
Sbjct  146  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLAPDKEPLDWNTRMKIAAGAAKGLEYL  205

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H TANPPVIYRDLKSSNILLDE F+P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  206  HDTANPPVIYRDLKSSNILLDEGFHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  265

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+   PGE NLV++ RP  KD+R+F +MADP
Sbjct  266  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNTRAPGEHNLVAWARPLFKDRRKFPKMADP  325

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  326  LLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQ  370



>ref|XP_009352224.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Pyrus x 
bretschneideri]
Length=523

 Score =   398 bits (1023),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 204/286 (71%), Positives = 241/286 (84%), Gaps = 1/286 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  92   ATKNFRPECLLGEGGFGHVYKGRLESTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  151

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L + KE L+W  R+KIAAGAA+GLEYL
Sbjct  152  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPSDKEPLDWNTRMKIAAGAAKGLEYL  211

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILLDE F+P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  212  HDKANPPVIYRDLKSSNILLDEGFHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  271

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+D  PGE NLV++ RP  KD+R+F +MADP
Sbjct  272  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNDRGPGEHNLVAWARPLFKDRRKFPKMADP  331

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
            LL+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q 
Sbjct  332  LLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQT  377



>emb|CDO98901.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   397 bits (1020),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 202/284 (71%), Positives = 238/284 (84%), Gaps = 0/284 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+   LLGEGGFG VYKG ++S   VAVKQLD+ GLQGN+EF+VEVLMLSLLHH N
Sbjct  82   ATKNFRPECLLGEGGFGRVYKGRLESGQAVAVKQLDRNGLQGNREFLVEVLMLSLLHHQN  141

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYC  GDQRLLVYE+MP GSLE+HL EL   KE L+W  R+KIAAGAA+GLEYLH
Sbjct  142  LVNLIGYCADGDQRLLVYEFMPLGSLEDHLHELPPDKEPLDWNTRMKIAAGAAKGLEYLH  201

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
              ANPPVIYRDLKSSNILLDE ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  202  DKANPPVIYRDLKSSNILLDEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEYA  261

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+G+LTLKSD+YSFGVV LELITGR+A D+   PGE NLV++ RP  KD+R+F +MADPL
Sbjct  262  MTGQLTLKSDVYSFGVVFLELITGRKAIDNTRGPGEHNLVAWARPLFKDRRKFPKMADPL  321

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            L+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  322  LQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQ  365



>gb|KHF97868.1| Serine/threonine-protein kinase PBS1 [Gossypium arboreum]
Length=515

 Score =   397 bits (1019),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 202/285 (71%), Positives = 241/285 (85%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  86   ATKNFRPECLLGEGGFGRVYKGRLESTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  145

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L + KE L+W  R++IAAGAA+GLEYL
Sbjct  146  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPSDKEPLDWNTRMRIAAGAAKGLEYL  205

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILLDE F+P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  206  HDKANPPVIYRDLKSSNILLDEGFHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  265

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+   PGEQNLV++ RP  +D+R+F +MADP
Sbjct  266  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNTRAPGEQNLVAWARPLFRDRRKFPKMADP  325

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  326  LLQGRYPIRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQ  370



>ref|XP_010024632.1| PREDICTED: serine/threonine-protein kinase PBS1 isoform X2 [Eucalyptus 
grandis]
 gb|KCW61080.1| hypothetical protein EUGRSUZ_H03856 [Eucalyptus grandis]
Length=509

 Score =   396 bits (1018),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 203/285 (71%), Positives = 240/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+  +LLGEGGFG VYKG ++S   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  83   ATKNFRPESLLGEGGFGRVYKGRLESTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  142

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KE L+W  R+KIAAGAA+GLEYL
Sbjct  143  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEPLDWNTRMKIAAGAAKGLEYL  202

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILLDE F+P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  203  HDKANPPVIYRDLKSSNILLDEGFHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  262

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+   PGE NLV++ RP  KD+R+F +MADP
Sbjct  263  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNSRAPGEHNLVAWARPLFKDRRKFPKMADP  322

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  323  LLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQ  367



>ref|XP_011012992.1| PREDICTED: serine/threonine-protein kinase CDL1-like [Populus 
euphratica]
Length=516

 Score =   396 bits (1018),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 204/285 (72%), Positives = 239/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NFK   LLGEGGFG VYKG ++S    VAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  86   ATKNFKPECLLGEGGFGRVYKGRLESTGQAVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  145

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KE L+W  R+KIAAGAA+GLEYL
Sbjct  146  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEPLDWNTRMKIAAGAAKGLEYL  205

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H TANPPVIYRDLKSSNILLDE F+P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  206  HDTANPPVIYRDLKSSNILLDEGFHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  265

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+   PGE NLV++ RP  KD+R+F +MADP
Sbjct  266  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNTRAPGEHNLVAWARPLFKDRRKFPKMADP  325

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  326  LLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQ  370



>ref|XP_009339847.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Pyrus x 
bretschneideri]
Length=518

 Score =   396 bits (1017),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 203/285 (71%), Positives = 240/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  87   ATKNFRPECLLGEGGFGRVYKGRLESTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHT  146

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L + KE L+W  R+KIAAGAA+GLEYL
Sbjct  147  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPSDKEPLDWNTRMKIAAGAAKGLEYL  206

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILLDE F+P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  207  HDKANPPVIYRDLKSSNILLDEGFHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  266

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+   PGE NLV++ RP  KD+R+F +MADP
Sbjct  267  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNSRGPGEHNLVAWARPLFKDRRKFPKMADP  326

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  327  LLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQ  371



>ref|XP_008340835.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Malus domestica]
Length=518

 Score =   396 bits (1017),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 203/285 (71%), Positives = 240/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  87   ATKNFRPECLLGEGGFGRVYKGRLESTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHT  146

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L + KE L+W  R+KIAAGAA+GLEYL
Sbjct  147  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPSDKEPLDWNTRMKIAAGAAKGLEYL  206

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILLDE F+P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  207  HDKANPPVIYRDLKSSNILLDEGFHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  266

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+   PGE NLV++ RP  KD+R+F +MADP
Sbjct  267  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNTRGPGEHNLVAWARPLFKDRRKFPKMADP  326

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  327  LLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQ  371



>ref|XP_010558477.1| PREDICTED: serine/threonine-protein kinase PBS1-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010558478.1| PREDICTED: serine/threonine-protein kinase PBS1-like isoform 
X2 [Tarenaya hassleriana]
Length=504

 Score =   395 bits (1015),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 202/285 (71%), Positives = 238/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            ATQNF+   LLGEGGFG VYKG +DS   +VAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  80   ATQNFRPECLLGEGGFGRVYKGRLDSTGQIVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  139

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL +L   +E L+W  R+KIAAGAA+GLEYL
Sbjct  140  NLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDLPPDREPLDWNTRMKIAAGAAKGLEYL  199

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILL E ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  200  HDKANPPVIYRDLKSSNILLGEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  259

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+   PGE NLV++ RP  KD+R+F +MADP
Sbjct  260  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNTRAPGEHNLVAWARPLFKDRRKFPKMADP  319

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  320  LLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQ  364



>ref|XP_009369116.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Pyrus x 
bretschneideri]
Length=518

 Score =   396 bits (1017),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 203/285 (71%), Positives = 240/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  87   ATKNFRPECLLGEGGFGRVYKGRLESTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHT  146

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L + KE L+W  R+KIAAGAA+GLEYL
Sbjct  147  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPSDKEPLDWNTRMKIAAGAAKGLEYL  206

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILLDE F+P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  207  HDKANPPVIYRDLKSSNILLDEGFHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  266

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+   PGE NLV++ RP  KD+R+F +MADP
Sbjct  267  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNTRGPGEHNLVAWARPLFKDRRKFPKMADP  326

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  327  LLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQ  371



>ref|XP_010037906.1| PREDICTED: serine/threonine-protein kinase PBS1 [Eucalyptus grandis]
 gb|KCW49683.1| hypothetical protein EUGRSUZ_K03195 [Eucalyptus grandis]
Length=397

 Score =   391 bits (1005),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 197/284 (69%), Positives = 238/284 (84%), Gaps = 0/284 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+   LLGEGGFG VY+G ++S  VVA+KQLD+ GLQGN+EF+VEVLMLSLLHH N
Sbjct  69   ATRNFRADCLLGEGGFGRVYRGRLESNQVVAIKQLDRNGLQGNREFLVEVLMLSLLHHPN  128

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYC  GDQRLLVYEYMP GSLE+HL +   GK+ L+W  R+K+AAGAA+GLEYLH
Sbjct  129  LVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDASPGKKQLDWNTRMKVAAGAAKGLEYLH  188

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
              A+PPVIYRDLK SNILLDE F+P+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  189  DRASPPVIYRDLKCSNILLDEGFHPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  248

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+G+LTLKSD+YSFGVVLLE+ITGR+A D+    GEQNLV++ RP  KD+R+F+ MADP 
Sbjct  249  MTGQLTLKSDVYSFGVVLLEIITGRKAIDNSRAAGEQNLVAWARPLFKDRRKFMLMADPT  308

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            L+ ++  R L+ A+AI AMC+QDQ + RP I+D+  AL YL +Q
Sbjct  309  LQGQYPSRGLYQALAIAAMCVQDQPNLRPVIADVVTALTYLASQ  352



>ref|XP_010558479.1| PREDICTED: serine/threonine-protein kinase PBS1-like isoform 
X3 [Tarenaya hassleriana]
Length=507

 Score =   395 bits (1015),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 202/285 (71%), Positives = 238/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            ATQNF+   LLGEGGFG VYKG +DS   +VAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  80   ATQNFRPECLLGEGGFGRVYKGRLDSTGQIVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  139

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL +L   +E L+W  R+KIAAGAA+GLEYL
Sbjct  140  NLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDLPPDREPLDWNTRMKIAAGAAKGLEYL  199

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILL E ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  200  HDKANPPVIYRDLKSSNILLGEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  259

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+   PGE NLV++ RP  KD+R+F +MADP
Sbjct  260  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNTRAPGEHNLVAWARPLFKDRRKFPKMADP  319

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  320  LLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQ  364



>ref|XP_008390725.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Malus domestica]
Length=518

 Score =   395 bits (1015),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 203/286 (71%), Positives = 240/286 (84%), Gaps = 1/286 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  87   ATKNFRPECLLGEGGFGHVYKGRLESTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  146

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L + KE L+W  R+KIAAGAA+GLEYL
Sbjct  147  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPSDKEPLDWNTRMKIAAGAAKGLEYL  206

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILLDE F+P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  207  HDRANPPVIYRDLKSSNILLDEGFHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  266

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+   PGE NLV++ RP  KD+R+F +MADP
Sbjct  267  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNTRGPGEHNLVAWARPLFKDRRKFPKMADP  326

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
            LL+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q 
Sbjct  327  LLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQT  372



>gb|KDP40013.1| hypothetical protein JCGZ_02011 [Jatropha curcas]
Length=516

 Score =   395 bits (1015),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 203/285 (71%), Positives = 240/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  87   ATKNFRPECLLGEGGFGRVYKGRLESTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  146

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L A KE L+W  R+KIAAGAA+GLEYL
Sbjct  147  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPADKEPLDWNTRMKIAAGAAKGLEYL  206

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILLDE ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  207  HDKANPPVIYRDLKSSNILLDEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  266

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+   PGE NLV++ RP  KD+R+F +MADP
Sbjct  267  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNTRAPGEHNLVAWARPLFKDRRKFPKMADP  326

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  327  LLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQ  371



>ref|XP_006419642.1| hypothetical protein CICLE_v10004734mg [Citrus clementina]
 ref|XP_006489132.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Citrus 
sinensis]
 gb|ESR32882.1| hypothetical protein CICLE_v10004734mg [Citrus clementina]
Length=522

 Score =   395 bits (1015),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 203/285 (71%), Positives = 240/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH+
Sbjct  91   ATKNFRPECLLGEGGFGRVYKGRLESTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHS  150

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KE L+W  R+KIAAGAA+GLEYL
Sbjct  151  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEPLDWNTRMKIAAGAAKGLEYL  210

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILLDE F+P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  211  HDKANPPVIYRDLKSSNILLDEGFHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  270

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+   PGE NLV++ RP  KD+R+F +MADP
Sbjct  271  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNTRPPGEHNLVAWARPLFKDRRKFPKMADP  330

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  331  LLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQ  375



>ref|XP_010243575.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Nelumbo 
nucifera]
Length=518

 Score =   395 bits (1014),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 202/285 (71%), Positives = 239/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF++  LLGEGGFG VYKG ++S   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  83   ATKNFRQECLLGEGGFGRVYKGRLESTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  142

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL +L   KE L+W  R+KIAAGAA+GLEYL
Sbjct  143  NLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDLPPDKEPLDWNTRMKIAAGAAKGLEYL  202

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRD KSSNILLDE ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  203  HDKANPPVIYRDFKSSNILLDEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  262

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+   PGE NLV++ RP  KD+R+F +MADP
Sbjct  263  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNTRAPGEHNLVAWARPLFKDRRKFPKMADP  322

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  323  LLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALSYLASQ  367



>gb|EPS73300.1| hypothetical protein M569_01455 [Genlisea aurea]
Length=357

 Score =   389 bits (999),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 200/286 (70%), Positives = 239/286 (84%), Gaps = 2/286 (1%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG +++ + VVA+KQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  48   ATKNFRADCLLGEGGFGRVYKGKLETTNQVVAIKQLDRNGLQGNREFLVEVLMLSLLHHP  107

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+M  GSLE+HL +L   K  L+W  R+KIAAGAA+GLEYL
Sbjct  108  NLVNLIGYCADGDQRLLVYEFMSLGSLEDHLHDLPPDKNRLDWNTRMKIAAGAAKGLEYL  167

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLK SNILLDEE+NP+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  168  HDKANPPVIYRDLKCSNILLDEEYNPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  227

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYD-SDAKPGEQNLVSYCRPFLKDKRRFVEMAD  715
            AM+G+LTLKSD+YSFGVVLLELITGR+A D S A  GE NLV++ RP  KD+R+F +MAD
Sbjct  228  AMTGQLTLKSDVYSFGVVLLELITGRKAIDNSRAAAGEHNLVAWARPLFKDRRKFAQMAD  287

Query  716  PLLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            P+LERR+  R L+ A+A+ AMC+Q+Q + RP I+D+  AL YL +Q
Sbjct  288  PMLERRYPARGLYQALAVAAMCVQEQPTMRPLIADVVTALTYLASQ  333



>ref|XP_006435369.1| hypothetical protein CICLE_v10001525mg [Citrus clementina]
 gb|ESR48609.1| hypothetical protein CICLE_v10001525mg [Citrus clementina]
 gb|KDO85109.1| hypothetical protein CISIN_1g017246mg [Citrus sinensis]
Length=311

 Score =   387 bits (994),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 196/256 (77%), Positives = 227/256 (89%), Gaps = 0/256 (0%)
 Frame = +2

Query  86   VVAVKQLDQEGLQGNQEFIVEvlmlsllhhnnlvnlmGYCTHGDQRLLVYEYMPNGSLEN  265
            +VA+KQL+ EGLQG+QEFIVEVLMLSLLHH+NLV L+GYCT GDQRLLVYEYMP GSLE+
Sbjct  22   LVAIKQLNHEGLQGHQEFIVEVLMLSLLHHDNLVTLIGYCTSGDQRLLVYEYMPMGSLED  81

Query  266  HLFELEAGKEALNWYNRLKIAAGAARGLEYLHCTANPPVIYRDLKSSNILLDEEFNPRLS  445
            HL++LE  +E L+W  R+KIA GAARGLEYLHC ANPPVIYRDLKS+NILLD +FNP+LS
Sbjct  82   HLYDLEPDQEPLSWNTRMKIAVGAARGLEYLHCKANPPVIYRDLKSANILLDNDFNPKLS  141

Query  446  DFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYAMSGKLTLKSDIYSFGVVLLELITGRRAY  625
            DFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYAMSGKLTLKSDIYSFGVVLLELITGR+A 
Sbjct  142  DFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYAMSGKLTLKSDIYSFGVVLLELITGRKAM  201

Query  626  DSDAKPGEQNLVSYCRPFLKDKRRFVEMADPLLERRFSVRSLHHAVAITAMCLQDQASFR  805
            D     GEQNLVS+ RPFLKD+++FV + DPLL  R+  R L++AVA+TAMCL ++A+FR
Sbjct  202  DLSKGQGEQNLVSWSRPFLKDQKKFVHLVDPLLHGRYPRRCLNYAVAVTAMCLNEEANFR  261

Query  806  PAISDIAMALDYLVAQ  853
            P I+DI +ALDYLV+Q
Sbjct  262  PLINDIVVALDYLVSQ  277



>ref|XP_009387655.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Musa acuminata 
subsp. malaccensis]
Length=358

 Score =   389 bits (999),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 190/289 (66%), Positives = 233/289 (81%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            ATQNFKE+NL+GEGGFG VYKG +DS  VVA+KQL+++GLQGN EF+VEVLML +L H N
Sbjct  63   ATQNFKEANLIGEGGFGRVYKGRLDSGQVVAIKQLNRDGLQGNNEFLVEVLMLIMLRHPN  122

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV+L GYC  GD+RLLVYEYMP GSLE+HLF     K  L W  R+KIA G ARGL YLH
Sbjct  123  LVSLFGYCADGDERLLVYEYMPKGSLEDHLFNPSPVKPPLEWNTRMKIALGVARGLTYLH  182

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
              ANPPVIYRD+K++N+LL  +F+P+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAP+YA
Sbjct  183  DVANPPVIYRDMKAANVLLSNDFDPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPDYA  242

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+GKLTLKSD+YSFGV+LLELITGRR +DS    GEQNL+ + RPFL D+R+F ++ADP 
Sbjct  243  MTGKLTLKSDVYSFGVLLLELITGRRVFDSSKCGGEQNLIIWARPFLNDRRKFHQLADPF  302

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L+ R+S R  H  V I +MCLQ+Q   RP I+D+ +AL+++ +Q   +E
Sbjct  303  LQGRYSPRGFHQLVVIASMCLQEQPHVRPIIADVVVALNHVTSQPYITE  351



>gb|EPS66443.1| hypothetical protein M569_08334, partial [Genlisea aurea]
Length=428

 Score =   391 bits (1004),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 203/287 (71%), Positives = 241/287 (84%), Gaps = 2/287 (1%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            ATQNFK   LLGEGGFG VYKG I S   VVAVK+LD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  81   ATQNFKPECLLGEGGFGRVYKGRIQSTGQVVAVKKLDRNGLQGNREFLVEVLMLSLLHHP  140

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL+++ A KE L+W  R+KIAAGAA+GLEYL
Sbjct  141  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLYDIAANKEPLDWNTRMKIAAGAAKGLEYL  200

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILLD+ + P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  201  HDKANPPVIYRDLKSSNILLDDGYFPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  260

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPG-EQNLVSYCRPFLKDKRRFVEMAD  715
            AM+G+LTLKSD+YSFGVVLLE+ITGRRA DS   PG EQNLV++ RP  KD+R+F +MAD
Sbjct  261  AMTGQLTLKSDVYSFGVVLLEIITGRRAIDSTRGPGEEQNLVAWARPLFKDRRKFPKMAD  320

Query  716  PLLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
            PLL+ ++ +R L+ A+A+ AMCLQ+ A+ RP I D+  AL++L +Q 
Sbjct  321  PLLQGQYPMRGLYQALAVAAMCLQEHAATRPLIGDVVTALNFLASQT  367



>ref|XP_010098328.1| Serine/threonine-protein kinase PBS1 [Morus notabilis]
 gb|EXB74832.1| Serine/threonine-protein kinase PBS1 [Morus notabilis]
Length=507

 Score =   394 bits (1011),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 202/285 (71%), Positives = 239/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  82   ATKNFRPECLLGEGGFGRVYKGRLESTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  141

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KE L+W  R+KIAAGAA+GLEYL
Sbjct  142  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEPLDWNTRMKIAAGAAKGLEYL  201

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILLDE ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  202  HDKANPPVIYRDLKSSNILLDEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  261

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+   PGE NLV++ RP  KD+R+F +MADP
Sbjct  262  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNTRAPGEHNLVAWARPLFKDRRKFPKMADP  321

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  322  LLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQ  366



>ref|XP_009386542.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Musa acuminata 
subsp. malaccensis]
Length=397

 Score =   389 bits (1000),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 198/286 (69%), Positives = 239/286 (84%), Gaps = 1/286 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVID-SQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++ S  +VA+KQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  68   ATKNFRADCLLGEGGFGRVYKGRLEGSNQIVAIKQLDRNGLQGNREFLVEVLMLSLLHHP  127

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL +    K+ L+W  R+KIAAGAA+GLEYL
Sbjct  128  NLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDPSPDKKWLDWNTRMKIAAGAAKGLEYL  187

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  A+PPVIYRDLK SNILLDEE+NP+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY
Sbjct  188  HDKASPPVIYRDLKCSNILLDEEYNPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  247

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLELITGRRA D+    GE NLV++ RP  +D+R+F +MADP
Sbjct  248  AMTGQLTLKSDVYSFGVVLLELITGRRAIDNSRAAGEHNLVAWARPLFRDRRKFSQMADP  307

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
            +L+ ++ VR L+ A+A+ AMC+Q+Q S RP I+D+  AL YL +Q 
Sbjct  308  MLQGQYPVRGLYQALAVAAMCVQEQPSMRPLIADVVTALAYLASQT  353



>ref|XP_006342769.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Solanum 
tuberosum]
Length=511

 Score =   394 bits (1011),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 202/285 (71%), Positives = 239/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+  +LLGEGGFG VYKG ++S   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  81   ATKNFRPESLLGEGGFGRVYKGRLESTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  140

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KE L+W  R+KIAAGAA+GLEYL
Sbjct  141  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPNKEPLDWNTRMKIAAGAAKGLEYL  200

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILLDE ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  201  HDKANPPVIYRDLKSSNILLDEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  260

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+    GE NLV++ RP  KD+R+F +MADP
Sbjct  261  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNTRSHGEHNLVAWARPLFKDRRKFPKMADP  320

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+ R+ +R L+ A+A+ AMCLQ+QAS RP I D+  AL YL +Q
Sbjct  321  LLQGRYPMRGLYQALAVAAMCLQEQASTRPLIGDVVTALSYLASQ  365



>ref|XP_004134473.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Cucumis 
sativus]
 ref|XP_004159852.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Cucumis 
sativus]
 gb|KGN57080.1| hypothetical protein Csa_3G152070 [Cucumis sativus]
Length=514

 Score =   394 bits (1011),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 202/285 (71%), Positives = 239/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  84   ATKNFRSECLLGEGGFGRVYKGRLESTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  143

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KE L+W  R+KIAAGAA+GLEYL
Sbjct  144  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEPLDWNTRMKIAAGAAKGLEYL  203

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILLDE ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  204  HDKANPPVIYRDLKSSNILLDEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  263

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+   PGE NLV++ RP  KD+R+F +MADP
Sbjct  264  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNTRGPGEHNLVAWARPLFKDRRKFPKMADP  323

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  324  LLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQ  368



>ref|XP_002516880.1| receptor serine-threonine protein kinase, putative [Ricinus communis]
 gb|EEF45494.1| receptor serine-threonine protein kinase, putative [Ricinus communis]
Length=516

 Score =   394 bits (1011),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 201/285 (71%), Positives = 240/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF++  LLGEGGFG VYKG ++S   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  86   ATKNFRQECLLGEGGFGRVYKGRLESTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  145

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +  + KE L+W  R+KIAAGAA+GLEYL
Sbjct  146  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDFPSDKEPLDWNTRMKIAAGAAKGLEYL  205

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILLDE ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  206  HDKANPPVIYRDLKSSNILLDEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  265

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+   PGE NLV++ RP  KD+R+F +MADP
Sbjct  266  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNTRAPGEHNLVAWARPLFKDRRKFPKMADP  325

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  326  LLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQ  370



>ref|XP_004229213.1| PREDICTED: serine/threonine-protein kinase PBS1 [Solanum lycopersicum]
Length=511

 Score =   393 bits (1010),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 202/285 (71%), Positives = 239/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+  +LLGEGGFG VYKG ++S   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  81   ATKNFRPESLLGEGGFGRVYKGRLESTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  140

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KE L+W  R+KIAAGAA+GLEYL
Sbjct  141  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEPLDWNTRMKIAAGAAKGLEYL  200

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILLDE ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  201  HDKANPPVIYRDLKSSNILLDEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  260

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+    GE NLV++ RP  KD+R+F +MADP
Sbjct  261  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNTRSHGEHNLVAWARPLFKDRRKFPKMADP  320

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+ R+ +R L+ A+A+ AMCLQ+QAS RP I D+  AL YL +Q
Sbjct  321  LLQGRYPMRGLYQALAVAAMCLQEQASTRPLIGDVVTALTYLASQ  365



>gb|EEC72116.1| hypothetical protein OsI_05101 [Oryza sativa Indica Group]
Length=491

 Score =   392 bits (1008),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 198/284 (70%), Positives = 238/284 (84%), Gaps = 0/284 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF++  LLGEGGFG VYKG +++  VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH N
Sbjct  79   ATKNFRQDCLLGEGGFGRVYKGRLETGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHTN  138

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KE L+W  R+KIAAGAA+GLEYLH
Sbjct  139  LVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEPLDWNTRMKIAAGAAKGLEYLH  198

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
              A+PPVIYRD KSSNILL E F+P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  199  DKASPPVIYRDFKSSNILLGEGFHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEYA  258

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+G+LT+KSD+YSFGVV LELITGR+A D+    GEQNLV++ RP  KD+R+F +MADP+
Sbjct  259  MTGQLTVKSDVYSFGVVFLELITGRKAIDNTKPQGEQNLVAWARPLFKDRRKFPKMADPM  318

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            L+ RF +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  319  LQGRFPMRGLYQALAVAAMCLQEQATTRPHIGDVVTALSYLASQ  362



>ref|XP_008438820.1| PREDICTED: serine/threonine-protein kinase PBS1 [Cucumis melo]
Length=513

 Score =   393 bits (1010),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 202/285 (71%), Positives = 239/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  83   ATKNFRSECLLGEGGFGRVYKGRLESTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  142

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KE L+W  R+KIAAGAA+GLEYL
Sbjct  143  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEPLDWNTRMKIAAGAAKGLEYL  202

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILLDE ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  203  HDKANPPVIYRDLKSSNILLDEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  262

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+   PGE NLV++ RP  KD+R+F +MADP
Sbjct  263  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNTRGPGEHNLVAWARPLFKDRRKFPKMADP  322

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  323  LLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQ  367



>ref|NP_177763.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAF16664.1|AC012394_13 putative protein kinase; 55222-56801 [Arabidopsis thaliana]
 gb|AEE35829.1| putative protein kinase [Arabidopsis thaliana]
Length=381

 Score =   388 bits (997),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 191/289 (66%), Positives = 240/289 (83%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+E N++G+GGFGSVYKG +DS  VVA+KQL+ +G QGNQEFIVEV MLS+ HH N
Sbjct  71   ATKNFREGNIIGKGGFGSVYKGRLDSGQVVAIKQLNPDGHQGNQEFIVEVCMLSVFHHPN  130

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT G QRLLVYEYMP GSLE+HLF+LE  +  L+WY R+KIA GAARG+EYLH
Sbjct  131  LVTLIGYCTSGAQRLLVYEYMPMGSLEDHLFDLEPDQTPLSWYTRMKIAVGAARGIEYLH  190

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C  +P VIYRDLKS+NILLD+EF+ +LSDFGLAK+GPVG+ THVSTRVMGTYGYCAPEYA
Sbjct  191  CKISPSVIYRDLKSANILLDKEFSVKLSDFGLAKVGPVGNRTHVSTRVMGTYGYCAPEYA  250

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSG+LT+KSDIYSFGVVLLELI+GR+A D     GEQ LV++ RP+LKD ++F  + DPL
Sbjct  251  MSGRLTIKSDIYSFGVVLLELISGRKAIDLSKPNGEQYLVAWARPYLKDPKKFGLLVDPL  310

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L  +FS R L++A++IT MCL D+A+ RP I D+ +A +Y+ +Q+++ E
Sbjct  311  LRGKFSKRCLNYAISITEMCLNDEANHRPKIGDVVVAFEYIASQSKSYE  359



>ref|XP_003593976.1| Protein kinase-like protein [Medicago truncatula]
 gb|AES64227.1| Serine/Threonine-kinase PBS1-like protein [Medicago truncatula]
Length=507

 Score =   393 bits (1009),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 203/286 (71%), Positives = 240/286 (84%), Gaps = 1/286 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDS-QSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S + VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  85   ATKNFRPECLLGEGGFGRVYKGCLESTKQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  144

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KE L+W  R+KIAAGAA+GLEYL
Sbjct  145  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPEKEPLDWNTRMKIAAGAAKGLEYL  204

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILLDE F+P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  205  HDKANPPVIYRDLKSSNILLDEGFHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  264

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+    GE NLV++ RP  KD+R+F +MADP
Sbjct  265  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNTRGHGEHNLVAWARPLFKDRRKFPKMADP  324

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
            LL+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +QA
Sbjct  325  LLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQA  370



>dbj|BAK02422.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=490

 Score =   392 bits (1007),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 199/285 (70%), Positives = 239/285 (84%), Gaps = 0/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF++  LLGEGGFG VY+G +D+   VAVKQLD+ GLQGN+EF+VEVLMLSLLHH+N
Sbjct  75   ATKNFRQDCLLGEGGFGRVYRGRLDNGQAVAVKQLDRNGLQGNREFLVEVLMLSLLHHDN  134

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYC  GDQRLLVYEYMP GSLE+HL ++   KE L+W  R+KIAAGAA+GLEYLH
Sbjct  135  LVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDIPPEKEPLDWNTRMKIAAGAAKGLEYLH  194

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
              A+PPVIYRD KSSNILL E F+P+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  195  DKASPPVIYRDFKSSNILLGEGFHPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  254

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+G+LT+KSD+YSFGVV LELITGR+A D+    GEQNLV++ RP  KD+R+F +MADP 
Sbjct  255  MTGQLTVKSDVYSFGVVFLELITGRKAIDNTKPHGEQNLVAWARPLFKDRRKFPKMADPS  314

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
            L+ RF +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +QA
Sbjct  315  LQGRFPMRGLYQALAVAAMCLQEQAATRPFIGDVVTALSYLASQA  359



>ref|XP_010231481.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Brachypodium 
distachyon]
Length=491

 Score =   392 bits (1007),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 200/285 (70%), Positives = 239/285 (84%), Gaps = 0/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF++  LLGEGGFG VYKG +D+  VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH+N
Sbjct  76   ATKNFRQDCLLGEGGFGRVYKGRLDNSQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHDN  135

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYC  GDQRLLVYEYMP GSLE+HL ++   KE L+W  R+KIAAGAA+GLEYLH
Sbjct  136  LVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDIPPEKEPLDWNTRMKIAAGAAKGLEYLH  195

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
              A+PPVIYRD KSSNILL E F+P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  196  DKASPPVIYRDFKSSNILLGEGFHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEYA  255

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+G+LT+KSD+YSFGVV LELITGR+A D+    GEQNLV++ RP  KD+R+F +MADP 
Sbjct  256  MTGQLTVKSDVYSFGVVFLELITGRKAIDNTKPHGEQNLVAWARPLFKDRRKFPKMADPS  315

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
            L+ RF +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +QA
Sbjct  316  LQGRFPMRGLYQALAVAAMCLQEQAATRPFIGDVVTALSYLASQA  360



>ref|XP_007035503.1| Serine/threonine-protein kinase PBS1 [Theobroma cacao]
 gb|EOY06429.1| Serine/threonine-protein kinase PBS1 [Theobroma cacao]
Length=514

 Score =   393 bits (1009),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 202/285 (71%), Positives = 238/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  86   ATKNFRPECLLGEGGFGRVYKGRLESTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  145

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KE L+W  R+KIAAGAA+GLEYL
Sbjct  146  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEPLDWNTRMKIAAGAAKGLEYL  205

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILLDE  +P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  206  HDKANPPVIYRDLKSSNILLDEGHHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  265

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+   PGE NLV++ RP  KD+R+F +MADP
Sbjct  266  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNTRAPGEHNLVAWARPLFKDRRKFPKMADP  325

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  326  LLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQ  370



>ref|XP_004971195.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Setaria 
italica]
Length=492

 Score =   392 bits (1007),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 199/285 (70%), Positives = 238/285 (84%), Gaps = 0/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF++  LLGEGGFG VYKG +++   VAVKQLD+ GLQGN+EF+VEVLMLSLLHH N
Sbjct  78   ATKNFRQDCLLGEGGFGRVYKGRLENGQAVAVKQLDRNGLQGNREFLVEVLMLSLLHHTN  137

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KEAL+W  R+KIAAGAA+GLEYLH
Sbjct  138  LVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPKDKEALDWNTRMKIAAGAAKGLEYLH  197

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
              A+PPVIYRD KSSNILL E F+P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  198  DKASPPVIYRDFKSSNILLGEGFHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEYA  257

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+G+LT+KSD+YSFGVV LELITGR+A D+    GEQNLV++ RP  KD+R+F +MADP 
Sbjct  258  MTGQLTVKSDVYSFGVVFLELITGRKAIDNSKPQGEQNLVAWARPLFKDRRKFPKMADPK  317

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
            L+ RF +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +QA
Sbjct  318  LQGRFPMRGLYQALAVAAMCLQEQAATRPHIGDVVTALSYLASQA  362



>ref|XP_010690217.1| PREDICTED: serine/threonine-protein kinase CDL1-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010690218.1| PREDICTED: serine/threonine-protein kinase CDL1-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010690219.1| PREDICTED: serine/threonine-protein kinase CDL1-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=384

 Score =   388 bits (996),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 190/289 (66%), Positives = 237/289 (82%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT  F  +N +GEGGFG V+KG +++  +VA+KQL+ EG+QG+QEFI+EVLMLSLLHH N
Sbjct  77   ATGMFNGANKIGEGGFGKVFKGRLETGEIVAIKQLNHEGVQGSQEFIIEVLMLSLLHHTN  136

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            L+ L GYCT GD++LLVYEYMP GSLE+HLF+L   K  L+W  R+KIA   ARGLEYLH
Sbjct  137  LMGLKGYCTDGDEKLLVYEYMPKGSLEDHLFDLSPEKVPLDWNTRIKIAVDTARGLEYLH  196

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C ANPPVI+RDLK +NILLD +F+ RLSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  197  CKANPPVIFRDLKPANILLDNDFHARLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEYA  256

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLT+KSDIYS GVVLLE+ITGR+A D +    EQNL+++ RP+ KD+R+F ++ADP 
Sbjct  257  MSGKLTVKSDIYSLGVVLLEIITGRKAIDPNRSRAEQNLINWSRPYFKDRRKFGQLADPA  316

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            ++ R+ +R LHHA+AITAMCLQ+Q ++RP ISD+ +AL+YL +Q    E
Sbjct  317  MQGRYPLRCLHHAIAITAMCLQEQPAYRPLISDVLVALEYLASQPYNPE  365



>gb|EYU45575.1| hypothetical protein MIMGU_mgv1a004753mg [Erythranthe guttata]
Length=511

 Score =   392 bits (1008),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 201/285 (71%), Positives = 239/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+  +LLGEGGFG VYKG ++S   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  87   ATKNFRPESLLGEGGFGRVYKGRLESTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  146

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL +    KE L+W  R+KIAAGAA+GLEYL
Sbjct  147  NLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDRPPDKEPLDWNTRMKIAAGAAKGLEYL  206

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILLDEE++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  207  HDKANPPVIYRDLKSSNILLDEEYSPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  266

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+  + GE NLV++ RP  KD+R+F +MADP
Sbjct  267  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNTREAGEHNLVAWARPLFKDRRKFPKMADP  326

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+  + +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  327  LLKGHYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALSYLASQ  371



>gb|KHG02623.1| Serine/threonine-protein kinase PBS1 [Gossypium arboreum]
Length=517

 Score =   392 bits (1008),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 201/285 (71%), Positives = 240/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  89   ATKNFRPECLLGEGGFGRVYKGRLESTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  148

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KE L+W  R+KIAAGAA+GLEYL
Sbjct  149  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEPLDWNTRMKIAAGAAKGLEYL  208

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  A+PPVIYRDLKSSNILLDE ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  209  HDEASPPVIYRDLKSSNILLDEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  268

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+   PGEQNLV++ RP  KD+R+F +MADP
Sbjct  269  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNMRAPGEQNLVAWARPLFKDRRKFPKMADP  328

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+ R+ +R L+ A+A+ AMCLQ+QA+ RP + D+  AL YL +Q
Sbjct  329  LLQGRYPIRGLYQALAVAAMCLQEQAATRPLMRDVVTALTYLASQ  373



>emb|CBI26102.3| unnamed protein product [Vitis vinifera]
Length=471

 Score =   391 bits (1004),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 200/285 (70%), Positives = 240/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+  +LLGEGGFG VYKG ++S   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  83   ATKNFRPESLLGEGGFGRVYKGRLESTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  142

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KE L+W  R+KIAAGAA+GLEYL
Sbjct  143  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEPLDWNTRMKIAAGAAKGLEYL  202

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  A+PPVIYRDLKSSNILLDE ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  203  HDKASPPVIYRDLKSSNILLDEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  262

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D++   GE NLV++ RP  KD+R+F +MADP
Sbjct  263  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNNRAAGEHNLVAWARPLFKDRRKFPKMADP  322

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  323  LLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQ  367



>gb|EMS62361.1| Serine/threonine-protein kinase PBS1 [Triticum urartu]
Length=484

 Score =   391 bits (1005),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 197/284 (69%), Positives = 238/284 (84%), Gaps = 0/284 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+E  +LGEGGFG VYKG ++S   VAVKQLD+ GLQGN+EF+VEVLMLSLLHH N
Sbjct  78   ATKNFREDCMLGEGGFGRVYKGRLESGQAVAVKQLDRNGLQGNREFLVEVLMLSLLHHTN  137

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYC  GDQRLLVYE+MP GSLE+HL ++   KE L+W  R+KIAAGAA+GLE+LH
Sbjct  138  LVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDVPPEKEPLDWNTRMKIAAGAAKGLEHLH  197

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
              A+PPVIYRD KSSNILL E F+P+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  198  DKASPPVIYRDFKSSNILLGEGFHPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  257

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+G+LT+KSD+YSFGVV LELITGR+A D+    GEQNLV++ RP  KD+R+F +MADP+
Sbjct  258  MTGQLTVKSDVYSFGVVFLELITGRKAIDNTKPQGEQNLVAWARPLFKDRRKFPKMADPM  317

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            L+ RF +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  318  LQGRFPMRGLYQALAVAAMCLQEQATTRPHIGDVVTALSYLASQ  361



>ref|XP_010918258.1| PREDICTED: serine/threonine-protein kinase CDL1-like [Elaeis 
guineensis]
Length=412

 Score =   389 bits (998),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 185/284 (65%), Positives = 236/284 (83%), Gaps = 0/284 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            ATQNFK +NL+GEGGFG V+KG I S  VVA+KQL+++GLQG++EF+VE+LML  L H N
Sbjct  88   ATQNFKTTNLIGEGGFGKVFKGRIHSGQVVAIKQLNRDGLQGSKEFLVEILMLITLRHEN  147

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV+L+GYC  GDQRLLVYEYMP GSLE+HLF+L  GK+ L+W  R++IA GAA+GL YLH
Sbjct  148  LVSLIGYCAEGDQRLLVYEYMPLGSLEDHLFDLSPGKQPLDWNTRIQIACGAAKGLTYLH  207

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
              ANPPVIYRD+K++N+LLD +FNP+LSDFGLAKLGPVGDNTHVSTRVMGTYGYC P+YA
Sbjct  208  DVANPPVIYRDMKAANVLLDNDFNPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCDPDYA  267

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLTLKSD+YSFG++LLELITGR+A+DS    G++NL+ + RPFL DK+RF ++ADPL
Sbjct  268  MSGKLTLKSDVYSFGMLLLELITGRKAFDSTKTGGDKNLMKWSRPFLNDKKRFGQLADPL  327

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            L+  +  R+ H  V + +MCLQ+QA  RP + D+ +AL ++ +Q
Sbjct  328  LQGCYPPRAFHQLVVVASMCLQEQAHVRPIMRDVVIALSHIASQ  371



>ref|XP_010241610.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Nelumbo 
nucifera]
Length=518

 Score =   392 bits (1007),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 201/286 (70%), Positives = 238/286 (83%), Gaps = 1/286 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF++  LLGEGGFG VYKG ++S   +VAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  82   ATKNFRQECLLGEGGFGRVYKGRLESTGQIVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  141

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL +L   KE L+W  R+KIAAGAA+GLEYL
Sbjct  142  NLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDLPPDKEPLDWNTRMKIAAGAAKGLEYL  201

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRD KSSNILLDE F P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  202  HDKANPPVIYRDFKSSNILLDEGFRPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  261

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+   PGE NLV++ RP  KD+R+F +MADP
Sbjct  262  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNTRAPGEHNLVAWARPLFKDRRKFPKMADP  321

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
            LL+  + +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q+
Sbjct  322  LLQGGYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALSYLASQS  367



>ref|XP_008781320.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Phoenix 
dactylifera]
Length=381

 Score =   387 bits (994),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 189/291 (65%), Positives = 234/291 (80%), Gaps = 0/291 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NFK SNLLGEGGFG V+KG ++S  VVA+KQL+  GLQG+ EF+VEVLML + HH N
Sbjct  62   ATRNFKLSNLLGEGGFGRVFKGFLESGQVVAIKQLNHNGLQGSNEFLVEVLMLIMFHHPN  121

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV+L GYC  G +RLLVYEYMP GSLE+HLF+L   KE L+W  R+KIA GAA+GL YLH
Sbjct  122  LVSLYGYCAEGSERLLVYEYMPQGSLEDHLFDLPPNKEPLDWNTRIKIAVGAAKGLTYLH  181

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
               NPPVIYRDLKS+NILLD +FNP+LSDFGLAKLGPVGD THVSTRVMGTYGYCAP+YA
Sbjct  182  DVVNPPVIYRDLKSANILLDNDFNPKLSDFGLAKLGPVGDRTHVSTRVMGTYGYCAPDYA  241

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLT+KSD+YSFGVV+LELITGRR +D   K GEQNL+S+ RP L D+RRF+++ADPL
Sbjct  242  MSGKLTVKSDVYSFGVVVLELITGRRVHDFSKKLGEQNLISWARPLLNDRRRFIQLADPL  301

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSERN  874
            L  ++ +R+ +    +T+MCL ++   RP + D A+ALD++ +Q   SE +
Sbjct  302  LCGQYPIRAFYQLAVVTSMCLHEKPHLRPTMHDAAVALDHVASQPYVSEND  352



>ref|XP_003565026.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Brachypodium 
distachyon]
Length=498

 Score =   391 bits (1005),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 196/284 (69%), Positives = 238/284 (84%), Gaps = 0/284 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF++ +LLGEGGFG VYKG +D+   VAVKQLD+ GLQGN+EF+VEVLMLSLLHH N
Sbjct  83   ATKNFRQDSLLGEGGFGRVYKGRLDNGQAVAVKQLDRNGLQGNREFLVEVLMLSLLHHTN  142

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYC  GDQRLLVYE+MP GSLE+HL ++   KE L+W  R+KIAAGAA+GLE+LH
Sbjct  143  LVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDVPPDKEPLDWNTRMKIAAGAAKGLEHLH  202

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
              A+PPVIYRD KSSNILL E F+P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  203  DKASPPVIYRDFKSSNILLGEGFHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEYA  262

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+G+LT+KSD+YSFGVV LELITGR+A D+    GEQNLV++ RP  KD+R+F +MADP+
Sbjct  263  MTGQLTVKSDVYSFGVVFLELITGRKAIDNTKPQGEQNLVAWARPLFKDRRKFPKMADPM  322

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            L+ RF +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  323  LQGRFPMRGLYQALAVAAMCLQEQATTRPHIGDVVTALSYLASQ  366



>ref|NP_001045326.1| Os01g0936100 [Oryza sativa Japonica Group]
 dbj|BAD87256.1| putative protein serine/threonine kinase BNK1 [Oryza sativa Japonica 
Group]
 dbj|BAF07240.1| Os01g0936100 [Oryza sativa Japonica Group]
 dbj|BAG95031.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55963.1| hypothetical protein OsJ_04686 [Oryza sativa Japonica Group]
Length=491

 Score =   391 bits (1004),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 197/284 (69%), Positives = 237/284 (83%), Gaps = 0/284 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF++  LLGEGGFG VYKG +++   VAVKQLD+ GLQGN+EF+VEVLMLSLLHH N
Sbjct  79   ATKNFRQDCLLGEGGFGRVYKGRLETGQAVAVKQLDRNGLQGNREFLVEVLMLSLLHHTN  138

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KE L+W  R+KIAAGAA+GLEYLH
Sbjct  139  LVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEPLDWNTRMKIAAGAAKGLEYLH  198

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
              A+PPVIYRD KSSNILL E F+P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  199  DKASPPVIYRDFKSSNILLGEGFHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEYA  258

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+G+LT+KSD+YSFGVV LELITGR+A D+    GEQNLV++ RP  KD+R+F +MADP+
Sbjct  259  MTGQLTVKSDVYSFGVVFLELITGRKAIDNTKPQGEQNLVAWARPLFKDRRKFPKMADPM  318

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            L+ RF +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  319  LQGRFPMRGLYQALAVAAMCLQEQATTRPHIGDVVTALSYLASQ  362



>ref|XP_008442622.1| PREDICTED: serine/threonine-protein kinase PBS1 [Cucumis melo]
Length=395

 Score =   387 bits (995),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 197/285 (69%), Positives = 238/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDS-QSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S   VVA+KQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  67   ATRNFRADCLLGEGGFGRVYKGKLESINQVVAIKQLDRNGLQGNREFLVEVLMLSLLHHP  126

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLL+YEYMP GSL++HL ++  G + L+W  R+KIAAGAARGLEYL
Sbjct  127  NLVNLIGYCADGDQRLLIYEYMPLGSLDDHLHDISPGTKVLDWNTRMKIAAGAARGLEYL  186

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  A+PPVIYRDLKSSNILLD+ ++P+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY
Sbjct  187  HDKASPPVIYRDLKSSNILLDKGYHPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  246

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLE+ITGR+A D     GEQNLVS+ RP  KD+ RF +MADP
Sbjct  247  AMTGQLTLKSDVYSFGVVLLEIITGRKAIDDSKAAGEQNLVSWARPLFKDRLRFAQMADP  306

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            +L  ++  RSL+ A+AI AMC+Q+Q + RP I+D+  AL YL +Q
Sbjct  307  MLRGQYPSRSLYQALAIAAMCVQEQPNMRPVIADVVTALSYLASQ  351



>ref|XP_004493931.1| PREDICTED: serine/threonine-protein kinase PBS1-like isoform 
X1 [Cicer arietinum]
Length=377

 Score =   387 bits (994),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 195/285 (68%), Positives = 240/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDS-QSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S   VVA+KQLD+ GLQGN+EF+VEVLMLSLLHH+
Sbjct  69   ATRNFRADCLLGEGGFGRVYKGRLESINQVVAIKQLDRNGLQGNREFLVEVLMLSLLHHH  128

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL ++  GK+ L+W  R+KIAAGAA+GLEYL
Sbjct  129  NLVNLIGYCADGDQRLLVYEYMPYGSLEDHLHDISPGKKRLDWNTRMKIAAGAAKGLEYL  188

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLK SNILL E ++P+LSDFGLAKLGPVG+NTHVSTRVMGTYGYCAPEY
Sbjct  189  HDQANPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGENTHVSTRVMGTYGYCAPEY  248

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLE+ITGR+A D+     EQNLV++ RP  KD+R+F +MADP
Sbjct  249  AMTGQLTLKSDVYSFGVVLLEIITGRKAIDNSKSTAEQNLVAWARPLFKDRRKFSQMADP  308

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            +L+ ++  R L+ A+A+ AMC+Q+QA+ RP I+D+  AL YL +Q
Sbjct  309  MLQGQYPSRGLYQALAVAAMCVQEQANMRPVIADVVTALSYLASQ  353



>ref|XP_006645297.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Oryza brachyantha]
Length=491

 Score =   391 bits (1004),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 197/284 (69%), Positives = 237/284 (83%), Gaps = 0/284 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF++  LLGEGGFG VYKG +++   VAVKQLD+ GLQGN+EF+VEVLMLSLLHH N
Sbjct  79   ATKNFRQDCLLGEGGFGRVYKGRLETGQAVAVKQLDRNGLQGNREFLVEVLMLSLLHHTN  138

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KE L+W  R+KIAAGAA+GLEYLH
Sbjct  139  LVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEPLDWNTRMKIAAGAAKGLEYLH  198

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
              A+PPVIYRD KSSNILL E F+P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  199  DKASPPVIYRDFKSSNILLGEGFHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEYA  258

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+G+LT+KSD+YSFGVV LELITGR+A D+    GEQNLV++ RP  KD+R+F +MADP+
Sbjct  259  MTGQLTVKSDVYSFGVVFLELITGRKAIDNTKPQGEQNLVAWARPLFKDRRKFPKMADPM  318

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            L+ RF +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  319  LQGRFPMRGLYQALAVAAMCLQEQATTRPHIGDVVTALSYLASQ  362



>gb|KHN47300.1| Serine/threonine-protein kinase PBS1 [Glycine soja]
Length=435

 Score =   389 bits (999),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 201/286 (70%), Positives = 238/286 (83%), Gaps = 1/286 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  89   ATKNFRPECLLGEGGFGRVYKGRLESTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  148

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KE L+W  R+KIAAGAA+GLEYL
Sbjct  149  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEPLDWNTRMKIAAGAAKGLEYL  208

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILLDE ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  209  HDKANPPVIYRDLKSSNILLDEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  268

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+    GE NLV++ RP  KD+R+F +MADP
Sbjct  269  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNTRAHGEHNLVAWARPLFKDRRKFPKMADP  328

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
            LL+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q 
Sbjct  329  LLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQT  374



>ref|XP_010546918.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Tarenaya 
hassleriana]
Length=424

 Score =   389 bits (998),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 198/286 (69%), Positives = 238/286 (83%), Gaps = 1/286 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT NF+   LLGEGGFG VYKG ++S   +VAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  80   ATNNFRPECLLGEGGFGRVYKGRLESPGRIVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  139

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLV+L+GYC  GDQRLLVYE+MP GSLE+HL +L   +E L+W  R+KIAAGAA+GLEYL
Sbjct  140  NLVSLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDREPLDWNTRMKIAAGAAKGLEYL  199

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILL E ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  200  HDKANPPVIYRDLKSSNILLGEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  259

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+   PGE NLV++ RP  KD+R+F +MADP
Sbjct  260  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNARDPGEHNLVAWARPLFKDRRKFPKMADP  319

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
            LL+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q+
Sbjct  320  LLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQS  365



>ref|XP_009763396.1| PREDICTED: serine/threonine-protein kinase PBS1 [Nicotiana sylvestris]
Length=514

 Score =   392 bits (1006),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 202/285 (71%), Positives = 238/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  83   ATKNFRPECLLGEGGFGRVYKGRLESTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  142

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KE L+W  R+KIAAGAA+GLEYL
Sbjct  143  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEPLDWNTRMKIAAGAAKGLEYL  202

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILLDE ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  203  HDKANPPVIYRDLKSSNILLDEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  262

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+    GE NLV++ RP  KD+R+F +MADP
Sbjct  263  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNARSHGEHNLVAWARPLFKDRRKFPKMADP  322

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+ R+ +R L+ A+A+ AMCLQ+QAS RP I D+  AL YL +Q
Sbjct  323  LLQGRYPMRGLYQALAVAAMCLQEQASTRPLIGDVVTALSYLASQ  367



>ref|XP_009412812.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Musa acuminata 
subsp. malaccensis]
Length=499

 Score =   391 bits (1004),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 197/284 (69%), Positives = 237/284 (83%), Gaps = 0/284 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            ATQNF++  LLGEGGFG VYKG +++  VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH +
Sbjct  84   ATQNFRQDCLLGEGGFGRVYKGRLENGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHPH  143

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYC  GDQRLLVYE+MP GSLE+HL ++ A KE L+W  R+KIAAGAA+GLEYLH
Sbjct  144  LVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDIPADKEPLDWNTRMKIAAGAAKGLEYLH  203

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
              ANPPVIYRD KSSNILL E ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  204  DKANPPVIYRDFKSSNILLGEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEYA  263

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+G+LT+KSD+YSFGVV LELITGR+A D+    GEQNLV++ RP  KD+R+F +MADPL
Sbjct  264  MTGQLTVKSDVYSFGVVFLELITGRKAIDNTRPAGEQNLVAWARPLFKDRRKFPQMADPL  323

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            L+  +  R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  324  LQGHYPARGLYQALAVAAMCLQEQAATRPLIGDVVTALSYLASQ  367



>ref|XP_002889078.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65337.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=381

 Score =   387 bits (993),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 191/289 (66%), Positives = 240/289 (83%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+E N++G+GGFGSVYKG +DS  VVA+KQL+ +G QGNQEFIVEV MLS+ HH N
Sbjct  71   ATKNFREVNMIGKGGFGSVYKGRLDSGQVVAIKQLNPDGHQGNQEFIVEVCMLSVFHHPN  130

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT G QRLLVYEYMP GSLE+HL++LE  +  L+WY R+KIA GAARG+EYLH
Sbjct  131  LVTLIGYCTSGAQRLLVYEYMPMGSLEDHLYDLEPDQIPLSWYTRMKIAVGAARGIEYLH  190

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C  +P VIYRDLKS+NILLD+EF+ +LSDFGLAK+GPVG+ THVSTRVMGTYGYCAPEYA
Sbjct  191  CKISPSVIYRDLKSANILLDKEFSVKLSDFGLAKVGPVGNRTHVSTRVMGTYGYCAPEYA  250

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSG+LT+KSDIYSFGVVLLELI+GR+A D     GEQ LV++ RP+LKD ++F  + DPL
Sbjct  251  MSGRLTIKSDIYSFGVVLLELISGRKAIDLSKPNGEQYLVAWARPYLKDPKKFGLLVDPL  310

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L  +FS R L++A+AIT MCL D+A+ RP I D+ +A +Y+ +Q+++ E
Sbjct  311  LRGKFSKRCLNYAIAITEMCLNDEANHRPKIGDVVVAFEYIASQSKSYE  359



>ref|XP_009606861.1| PREDICTED: serine/threonine-protein kinase PBS1 [Nicotiana tomentosiformis]
Length=506

 Score =   391 bits (1004),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 202/285 (71%), Positives = 238/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  83   ATKNFRPECLLGEGGFGRVYKGRLESTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  142

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KE L+W  R+KIAAGAA+GLEYL
Sbjct  143  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEPLDWNTRMKIAAGAAKGLEYL  202

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILLDE ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  203  HDKANPPVIYRDLKSSNILLDEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  262

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+    GE NLV++ RP  KD+R+F +MADP
Sbjct  263  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNARSHGEHNLVAWARPLFKDRRKFPKMADP  322

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+ R+ +R L+ A+A+ AMCLQ+QAS RP I D+  AL YL +Q
Sbjct  323  LLQGRYPMRGLYQALAVAAMCLQEQASTRPLIGDVVTALSYLASQ  367



>ref|XP_002439693.1| hypothetical protein SORBIDRAFT_09g018500 [Sorghum bicolor]
 gb|EES18123.1| hypothetical protein SORBIDRAFT_09g018500 [Sorghum bicolor]
Length=474

 Score =   390 bits (1002),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 198/284 (70%), Positives = 239/284 (84%), Gaps = 0/284 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF++  LLGEGGFG VYKG +++  VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH+N
Sbjct  74   ATKNFRQDCLLGEGGFGRVYKGRLENGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHDN  133

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYC  GDQRLLVYE+MP GSLE+HL ++   KE L+W  R+KIAAGAA+GLEYLH
Sbjct  134  LVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDIPPEKEPLDWNTRMKIAAGAAKGLEYLH  193

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
              A+PPVIYRD KSSNILL E F+P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  194  DKASPPVIYRDFKSSNILLGEGFHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEYA  253

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+G+LT+KSD+YSFGVV LELITGR+A D+    GEQNLV++ RP  KD+R+F +MADPL
Sbjct  254  MTGQLTVKSDVYSFGVVFLELITGRKAIDNTKPHGEQNLVAWARPLFKDRRKFPKMADPL  313

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            L+ RF +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  314  LQGRFPMRGLYQALAVAAMCLQEQAATRPFIGDVVTALSYLASQ  357



>ref|XP_004296802.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Fragaria 
vesca subsp. vesca]
Length=517

 Score =   391 bits (1005),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 202/285 (71%), Positives = 238/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  86   ATKNFRPECLLGEGGFGRVYKGHLESTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  145

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KE L+W  R+KIAAGAA+GLEYL
Sbjct  146  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPTEKEPLDWNTRMKIAAGAAKGLEYL  205

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILLDE F+P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  206  HDKANPPVIYRDLKSSNILLDEGFHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  265

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+   PGE NLV++ RP  KD+R+F +MADP
Sbjct  266  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNTRGPGEHNLVAWARPLFKDRRKFPKMADP  325

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+  + +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  326  LLQGHYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQ  370



>ref|XP_008226810.1| PREDICTED: serine/threonine-protein kinase PBS1 isoform X2 [Prunus 
mume]
Length=394

 Score =   387 bits (994),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 194/292 (66%), Positives = 237/292 (81%), Gaps = 1/292 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVI-DSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT NF   NLLGEGGFG VYKG + D+  VVAVKQLD+ G QGN+EF+VEVL+LSLLHH 
Sbjct  75   ATNNFHPDNLLGEGGFGRVYKGKLEDTDRVVAVKQLDRNGFQGNREFLVEVLILSLLHHP  134

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            +LVNL+GYC  GDQR+LVYEYM NGSLE+HL +L  GK+AL+W  R+KIAAGAA+GLEYL
Sbjct  135  HLVNLVGYCADGDQRILVYEYMANGSLEDHLLDLGPGKKALDWDTRMKIAAGAAKGLEYL  194

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRD K+SNILLDE F+P+LSDFGLAKLGP GD THVSTRVMGTYGYCAPEY
Sbjct  195  HEQANPPVIYRDFKASNILLDENFSPKLSDFGLAKLGPTGDKTHVSTRVMGTYGYCAPEY  254

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            A++G+LT KSDIYSFGVV LE++TGRR  D++    EQNLV++ +P  KD+R+F  MADP
Sbjct  255  ALTGQLTTKSDIYSFGVVFLEIVTGRRVIDNNRPTEEQNLVTWAQPLFKDRRKFTLMADP  314

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSERN  874
            LLE ++ ++ L+ A+A+ AMCLQ++A+ RP ISD+  AL+YL      S+ N
Sbjct  315  LLEDKYPIKGLYQALAVAAMCLQEEATTRPLISDVVTALEYLTVDCIESDEN  366



>ref|XP_002439692.1| hypothetical protein SORBIDRAFT_09g018490 [Sorghum bicolor]
 gb|EES18122.1| hypothetical protein SORBIDRAFT_09g018490 [Sorghum bicolor]
Length=474

 Score =   390 bits (1001),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 198/284 (70%), Positives = 239/284 (84%), Gaps = 0/284 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF++  LLGEGGFG VYKG +++  VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH+N
Sbjct  74   ATKNFRQDCLLGEGGFGRVYKGRLENGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHDN  133

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYC  GDQRLLVYE+MP GSLE+HL ++   KE L+W  R+KIAAGAA+GLEYLH
Sbjct  134  LVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDIPPEKEPLDWNTRMKIAAGAAKGLEYLH  193

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
              A+PPVIYRD KSSNILL E F+P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  194  DKASPPVIYRDFKSSNILLGEGFHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEYA  253

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+G+LT+KSD+YSFGVV LELITGR+A D+    GEQNLV++ RP  KD+R+F +MADPL
Sbjct  254  MTGQLTVKSDVYSFGVVFLELITGRKAIDNTKPHGEQNLVAWARPLFKDRRKFPKMADPL  313

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            L+ RF +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  314  LQGRFPMRGLYQALAVAAMCLQEQAATRPFIGDVVTALSYLASQ  357



>ref|XP_010692532.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Beta vulgaris 
subsp. vulgaris]
Length=384

 Score =   387 bits (993),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 192/286 (67%), Positives = 234/286 (82%), Gaps = 0/286 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+ F+E+ L+GEGGFG VYKG +D+  ++A K+L+ + LQGNQEFIVEVLMLSLLHH N
Sbjct  81   ATKYFRETQLIGEGGFGKVYKGRLDNGLIIATKRLNLDSLQGNQEFIVEVLMLSLLHHPN  140

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYC  GDQRLLVYEYM  GSL +HLF  E  K  L+W  R+KIAAG ARGLEYLH
Sbjct  141  LVTLIGYCAEGDQRLLVYEYMSKGSLADHLFGTENEKSVLDWSTRIKIAAGTARGLEYLH  200

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C A PPVIYRDLKS+NILLD E+NPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  201  CVAKPPVIYRDLKSANILLDNEYNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  260

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            +SGKLTLKSDI+SFGVVLLE++TGR+A+D   + GEQ+L ++ RP+LKD+R++ E+ DP 
Sbjct  261  LSGKLTLKSDIFSFGVVLLEIVTGRKAFDISKRHGEQSLAAWSRPYLKDRRKYFELVDPR  320

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQ  859
            L  +F  RS  H +AIT MCL ++ S RP IS+I +ALD++V + +
Sbjct  321  LRGKFPSRSARHLIAITTMCLNEEPSQRPPISEIVLALDFIVNECR  366



>ref|XP_004962284.1| PREDICTED: serine/threonine-protein kinase PBS1-like isoform 
X1 [Setaria italica]
Length=475

 Score =   390 bits (1001),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 198/284 (70%), Positives = 239/284 (84%), Gaps = 0/284 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF++  LLGEGGFG VYKG +++  VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH+N
Sbjct  74   ATKNFRQDCLLGEGGFGRVYKGRLENGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHDN  133

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYC  GDQRLLVYE+MP GSLE+HL ++   KE L+W  R+KIAAGAA+GLEYLH
Sbjct  134  LVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDIPPDKEPLDWNTRMKIAAGAAKGLEYLH  193

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
              A+PPVIYRD KSSNILL E F+P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  194  DKASPPVIYRDFKSSNILLGEGFHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEYA  253

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+G+LT+KSD+YSFGVV LELITGR+A D+    GEQNLV++ RP  KD+R+F +MADPL
Sbjct  254  MTGQLTVKSDVYSFGVVFLELITGRKAIDNGKPHGEQNLVAWARPLFKDRRKFPKMADPL  313

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            L+ RF +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  314  LQGRFPMRGLYQALAVAAMCLQEQAATRPFIGDVVTALSYLASQ  357



>ref|XP_006844582.1| hypothetical protein AMTR_s00016p00203440 [Amborella trichopoda]
 gb|ERN06257.1| hypothetical protein AMTR_s00016p00203440 [Amborella trichopoda]
Length=455

 Score =   389 bits (999),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 198/286 (69%), Positives = 239/286 (84%), Gaps = 1/286 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF++   LGEGGFG VYKG ++S   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  79   ATKNFRQECFLGEGGFGRVYKGRLESTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  138

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSL++HL +L   KE L+W  R+KIAAGAA+GLEYL
Sbjct  139  NLVNLIGYCADGDQRLLVYEFMPLGSLDDHLHDLPPDKEPLDWNTRMKIAAGAAKGLEYL  198

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRD KSSNILLDE ++P+LSDFGLAKLGPVGD +HVSTRVMGTYGYCAPEY
Sbjct  199  HDKANPPVIYRDFKSSNILLDEGYHPKLSDFGLAKLGPVGDKSHVSTRVMGTYGYCAPEY  258

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LT+KSD+YSFGVV LELITGR+A DS   PGEQNLV++ RP   D+R+F +MADP
Sbjct  259  AMTGQLTVKSDVYSFGVVFLELITGRKAIDSTRAPGEQNLVAWARPLFNDRRKFPKMADP  318

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
            LL+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q+
Sbjct  319  LLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALSYLASQS  364



>ref|XP_008807447.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Phoenix 
dactylifera]
Length=369

 Score =   386 bits (991),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 189/289 (65%), Positives = 235/289 (81%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NFKE+NL+GEGGFG VYKG ++S  VVA+KQL+  GLQG  EF+VEVLML +LHH N
Sbjct  47   ATKNFKETNLIGEGGFGKVYKGHLNSGQVVAIKQLNPNGLQGTHEFLVEVLMLIMLHHPN  106

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV+L+GYC   D+RLLVYEYM  GSLENHLF+L  GK  L+W  R+KIA GAA+GL YLH
Sbjct  107  LVSLIGYCHERDERLLVYEYMRQGSLENHLFDLPPGKAPLDWNTRIKIAVGAAKGLTYLH  166

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
               NPPVIYRDLKSSNILLD++FNP+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAP+YA
Sbjct  167  DVVNPPVIYRDLKSSNILLDDDFNPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPDYA  226

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
             SGKLT+K+D+YSFGVVLLELITG++A+D   + GEQNL+    PFL D+R+F ++ADPL
Sbjct  227  TSGKLTVKADVYSFGVVLLELITGQKAFDLSKESGEQNLIKRAHPFLSDRRKFTQLADPL  286

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L  R+ +R+ +    IT+MCL ++A  RP + D+A++LD++ +Q   SE
Sbjct  287  LRGRYPLRAFYQLAVITSMCLHERAHIRPTMHDVAVSLDHVASQPYISE  335



>ref|XP_010428694.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Camelina 
sativa]
Length=383

 Score =   386 bits (991),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 186/289 (64%), Positives = 241/289 (83%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+E+N++G+GGFGSVY+G +DS  VVA+KQL+  G QGNQEFIVEV MLS+ +H N
Sbjct  72   ATKNFREANMIGKGGFGSVYRGRLDSGQVVAIKQLNPGGHQGNQEFIVEVCMLSVFYHPN  131

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT G QRLLVYEYMP GSLE+HLF+LE  +  L+W  R+KIA GAARG+EYLH
Sbjct  132  LVTLIGYCTSGAQRLLVYEYMPMGSLEDHLFDLEPDQTPLSWNTRMKIAVGAARGIEYLH  191

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C  +P VIYRDLKS+NILLD++F+ +LSDFGLAK+GPVG+ THVSTR+MGTYGYCAPEYA
Sbjct  192  CKISPSVIYRDLKSANILLDKDFSVKLSDFGLAKVGPVGNRTHVSTRIMGTYGYCAPEYA  251

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSG+LT+KSDIYSFGVVLLELI+GR+A D     GEQ LV++ RP+LKD ++F ++ DPL
Sbjct  252  MSGRLTIKSDIYSFGVVLLELISGRKAIDLSKPNGEQYLVTWARPYLKDPKKFGQLVDPL  311

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L  ++S R L +A+AIT MCL+++A++RP I D+ +A +Y+ AQ+++ E
Sbjct  312  LRGKYSKRCLSYAIAITEMCLKEEANYRPKIGDVVVAFEYIAAQSKSHE  360



>gb|AFW62440.1| putative protein kinase superfamily protein [Zea mays]
Length=450

 Score =   388 bits (997),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 198/285 (69%), Positives = 238/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+    LGEGGFG VYKG ++S   VVA+KQL+++GLQGN+EF+VEVLMLSLLHH 
Sbjct  43   ATRNFRPECFLGEGGFGRVYKGRLESTGQVVAIKQLNRDGLQGNREFLVEVLMLSLLHHQ  102

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP+GSLE+HL +L   KEAL+W  R+KIAAGAA+GLEYL
Sbjct  103  NLVNLIGYCADGDQRLLVYEYMPSGSLEDHLHDLPLDKEALDWNTRMKIAAGAAKGLEYL  162

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRD KSSNILLDE F+P+LSDFGLAKLGPVGD +HVSTRVMGTYGYCAPEY
Sbjct  163  HDKANPPVIYRDFKSSNILLDESFHPKLSDFGLAKLGPVGDKSHVSTRVMGTYGYCAPEY  222

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LT+KSD+YSFGVVLLELITGRRA DS    GEQNLVS+ RP   D+R+  +MADP
Sbjct  223  AMTGQLTVKSDVYSFGVVLLELITGRRAIDSTRPHGEQNLVSWARPLFNDRRKLPKMADP  282

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
             LE R+ +R L+ A+A+ +MC+Q +A+ RP I+D+  AL YL +Q
Sbjct  283  RLEGRYPMRGLYQALAVASMCIQSEAASRPLIADVVTALSYLASQ  327



>ref|XP_002312759.2| hypothetical protein POPTR_0008s21040g [Populus trichocarpa]
 gb|EEE90126.2| hypothetical protein POPTR_0008s21040g [Populus trichocarpa]
Length=516

 Score =   390 bits (1003),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 202/285 (71%), Positives = 237/285 (83%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NFK   LLGEGGFG VYKG ++S    VAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  86   ATKNFKPECLLGEGGFGRVYKGRLESTGQAVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  145

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KE L+W  R+KIAAGAA+GLEYL
Sbjct  146  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEPLDWNTRMKIAAGAAKGLEYL  205

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILLDE F+P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  206  HDKANPPVIYRDLKSSNILLDEGFHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  265

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+   PGE NLV++ RP  KD+R+F +MADP
Sbjct  266  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNTRAPGEHNLVAWARPLFKDRRKFPKMADP  325

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+  + +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  326  LLQGCYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQ  370



>ref|XP_010471787.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Camelina 
sativa]
Length=382

 Score =   386 bits (991),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 187/289 (65%), Positives = 240/289 (83%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+E N++G+GGFGSVYKG +DS  VVA+KQL+  G QGNQEFIVEV MLS+ +H N
Sbjct  71   ATKNFREVNMIGKGGFGSVYKGRLDSGQVVAIKQLNPGGHQGNQEFIVEVCMLSVFYHPN  130

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT G QRLLVYEYMP GSLE+HLF+LE  +  L+W  R+KIA GAARG+EYLH
Sbjct  131  LVTLIGYCTSGAQRLLVYEYMPMGSLEDHLFDLEPDQTPLSWNTRMKIAVGAARGIEYLH  190

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C  +P VIYRDLKS+NILLD++F+ +LSDFGLAK+GPVG+ THVSTR+MGTYGYCAPEYA
Sbjct  191  CKISPSVIYRDLKSANILLDKDFSVKLSDFGLAKVGPVGNRTHVSTRIMGTYGYCAPEYA  250

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSG+LT+KSDIYSFGVVLLELI+GR+A D     GEQ LV++ RP+LKD ++F ++ DPL
Sbjct  251  MSGRLTIKSDIYSFGVVLLELISGRKAIDLSKPNGEQYLVTWARPYLKDPKKFGQLVDPL  310

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L  ++S R L +A+AIT MCL+++A++RP I D+ +A +Y+ AQ+++ E
Sbjct  311  LRGKYSKRCLSYAIAITEMCLKEEANYRPKIGDVVVAFEYIAAQSKSHE  359



>ref|XP_004486047.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Cicer arietinum]
Length=506

 Score =   390 bits (1002),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 205/297 (69%), Positives = 242/297 (81%), Gaps = 7/297 (2%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQ-SVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  83   ATKNFRPECLLGEGGFGRVYKGRLESTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  142

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KE L+W  R+KIAAGAA+GLEYL
Sbjct  143  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEPLDWNTRMKIAAGAAKGLEYL  202

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILLDE ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  203  HDKANPPVIYRDLKSSNILLDEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  262

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+    GE NLV++ RP  KD+R+F +MADP
Sbjct  263  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNTRGHGEHNLVAWARPLFKDRRKFPKMADP  322

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ------AQTSER  871
            LL+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q      A TS R
Sbjct  323  LLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQTYDPNAANTSNR  379



>ref|XP_008655202.1| PREDICTED: uncharacterized LOC100382129 isoform X1 [Zea mays]
 gb|AFW84021.1| putative protein kinase superfamily protein [Zea mays]
Length=492

 Score =   390 bits (1001),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 197/285 (69%), Positives = 237/285 (83%), Gaps = 0/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF++  LLGEGGFG VYKG +++   VAVKQLD+ GLQGN+EF+VEVLMLSLLHH N
Sbjct  78   ATKNFRQDCLLGEGGFGRVYKGRLENGQAVAVKQLDRNGLQGNREFLVEVLMLSLLHHTN  137

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KE L+W  R+KIAAGAA+GLEYLH
Sbjct  138  LVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEPLDWNTRMKIAAGAAKGLEYLH  197

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
               +PPVIYRD KSSNILL E F+P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  198  DKTSPPVIYRDFKSSNILLGEGFHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEYA  257

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+G+LT+KSD+YSFGVV LELITGR+A D+    GEQNLV++ RP  KD+R+F +MADP+
Sbjct  258  MTGQLTVKSDVYSFGVVFLELITGRKAIDNTKTQGEQNLVAWARPLFKDRRKFPKMADPM  317

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
            L+ RF +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +QA
Sbjct  318  LQGRFPMRGLYQALAVAAMCLQEQAATRPHIGDVVTALSYLASQA  362



>ref|XP_008672176.1| PREDICTED: uncharacterized protein LOC100193908 isoform X1 [Zea 
mays]
 gb|ACN34088.1| unknown [Zea mays]
 tpg|DAA55931.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=491

 Score =   389 bits (1000),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 197/285 (69%), Positives = 238/285 (84%), Gaps = 0/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF++  LLGEGGFG VYKG +++   VAVKQLD+ GLQGN+EF+VEVLMLSLLHH N
Sbjct  78   ATKNFRQDCLLGEGGFGRVYKGRLENGQAVAVKQLDRNGLQGNREFLVEVLMLSLLHHTN  137

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KE L+W  R+KIAAGAA+GLE+LH
Sbjct  138  LVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEPLDWNTRMKIAAGAAKGLEHLH  197

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
              A+PPVIYRD KSSNILL E F+P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  198  DKASPPVIYRDFKSSNILLGEGFHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEYA  257

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+G+LT+KSD+YSFGVV LELITGR+A D+    GEQNLV++ RP  KD+R+F +MADP+
Sbjct  258  MTGQLTVKSDVYSFGVVFLELITGRKAIDNTKTQGEQNLVAWARPLFKDRRKFPKMADPM  317

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
            L+ RF +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +QA
Sbjct  318  LQGRFPMRGLYQALAVAAMCLQEQAATRPHIGDVVTALSYLASQA  362



>ref|XP_002275431.1| PREDICTED: serine/threonine-protein kinase CDL1 [Vitis vinifera]
Length=528

 Score =   391 bits (1004),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 200/285 (70%), Positives = 240/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+  +LLGEGGFG VYKG ++S   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  83   ATKNFRPESLLGEGGFGRVYKGRLESTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  142

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KE L+W  R+KIAAGAA+GLEYL
Sbjct  143  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEPLDWNTRMKIAAGAAKGLEYL  202

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  A+PPVIYRDLKSSNILLDE ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  203  HDKASPPVIYRDLKSSNILLDEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  262

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D++   GE NLV++ RP  KD+R+F +MADP
Sbjct  263  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNNRAAGEHNLVAWARPLFKDRRKFPKMADP  322

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  323  LLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQ  367



>ref|XP_010922485.1| PREDICTED: serine/threonine-protein kinase CDL1-like [Elaeis 
guineensis]
Length=402

 Score =   386 bits (992),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 196/285 (69%), Positives = 237/285 (83%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDS-QSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S   +VA+KQLD  GLQGN+EF+VEVLMLSLLHH 
Sbjct  68   ATRNFRADYLLGEGGFGRVYKGRLESVNQIVAIKQLDHNGLQGNREFLVEVLMLSLLHHP  127

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYM  GSLE+HL +L + K+ L+W  R+KIAAGAA+GLEYL
Sbjct  128  NLVNLIGYCADGDQRLLVYEYMSLGSLEDHLHDLTSDKKQLDWNTRMKIAAGAAKGLEYL  187

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLK SNILL E F+P+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY
Sbjct  188  HDKANPPVIYRDLKCSNILLGEGFHPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  247

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLE+ITGR+A D+    GEQNLV++ RP  KD+R+F +MADP
Sbjct  248  AMTGQLTLKSDVYSFGVVLLEIITGRKAIDNSRAAGEQNLVAWARPLFKDRRKFTQMADP  307

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
             L+ ++ VR L+ A+A+ AMC+Q+Q + RP I+D+  AL YL +Q
Sbjct  308  KLQDQYPVRGLYQALAVAAMCVQEQPTLRPLIADVVTALTYLASQ  352



>ref|XP_002978708.1| hypothetical protein SELMODRAFT_13751, partial [Selaginella moellendorffii]
 gb|EFJ20155.1| hypothetical protein SELMODRAFT_13751, partial [Selaginella moellendorffii]
Length=348

 Score =   384 bits (986),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 198/285 (69%), Positives = 235/285 (82%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVID-SQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NFK   LLGEGGFG VYKG ++ S  VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  40   ATKNFKAECLLGEGGFGRVYKGRLENSGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  99

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP G LE+HL ++   K  L+W  R+KIAAGAA GLEYL
Sbjct  100  NLVNLIGYCADGDQRLLVYEFMPLGCLEDHLHDIPPEKAPLDWNTRMKIAAGAAMGLEYL  159

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRD KSSNILLD  F+P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  160  HDKANPPVIYRDFKSSNILLDNNFHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  219

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLELITGR+A D+    GE NLV++ RP  KD+R+F  M+DP
Sbjct  220  AMTGQLTLKSDVYSFGVVLLELITGRKAIDNSRPAGEHNLVAWARPLFKDRRKFPSMSDP  279

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+ R+ +R L+ A+A+ AMCLQ+QA+ RP I+D+  AL+YL +Q
Sbjct  280  LLQGRYPMRGLYQALAVAAMCLQEQAATRPLIADVVTALNYLASQ  324



>ref|XP_002525053.1| receptor serine-threonine protein kinase, putative [Ricinus communis]
 gb|EEF37300.1| receptor serine-threonine protein kinase, putative [Ricinus communis]
Length=375

 Score =   385 bits (988),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 198/290 (68%), Positives = 239/290 (82%), Gaps = 1/290 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S S VVA+KQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  66   ATKNFRADCLLGEGGFGRVYKGRLESTSQVVAIKQLDRNGLQGNREFLVEVLMLSLLHHP  125

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL +L   K+ L+W  R+KIAAGAA+GLEYL
Sbjct  126  NLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDLPPDKKRLDWNTRMKIAAGAAKGLEYL  185

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLK SNILL E ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  186  HDKANPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  245

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLE+ITGR+A D+    GE NLV++ RP  KD+R+F +MADP
Sbjct  246  AMTGQLTLKSDVYSFGVVLLEIITGRKAIDNSRAAGEHNLVAWARPLFKDRRKFPQMADP  305

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            LL+ ++ VR L+ A+A+ AMC+Q+Q + RP I+D+  AL YL +Q    E
Sbjct  306  LLQGQYPVRGLYQALAVAAMCVQEQPNMRPLIADVVTALTYLASQKYDPE  355



>ref|XP_009591503.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Nicotiana 
tomentosiformis]
Length=370

 Score =   385 bits (988),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 198/289 (69%), Positives = 239/289 (83%), Gaps = 1/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+   LLGEGGFG VYKGVIDS  VVA+KQLD+ GLQGN+EF+VEVLMLSLLHH N
Sbjct  63   ATKNFRGDYLLGEGGFGRVYKGVIDSNQVVAIKQLDRNGLQGNREFLVEVLMLSLLHHPN  122

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYC  GDQRLLVYEYMP GSLE+HL +   GKE L+W  R+KIAAGAA+GLEYLH
Sbjct  123  LVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDPTPGKERLDWNTRMKIAAGAAKGLEYLH  182

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
             +A+PPVIYRDLK SNILL E ++ +LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  183  -SASPPVIYRDLKCSNILLGEGYHAKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  241

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+G+LTLKSD+YSFGVVLLE+ITGR+A +S    G+ NLV + RP  KD+R+F +MADP+
Sbjct  242  MTGQLTLKSDVYSFGVVLLEIITGRKAIESSKTGGDFNLVIWARPLFKDRRKFSQMADPM  301

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L+  + VR L+ A+A+ AMC+Q+Q + RP I+D+  AL YL +Q   +E
Sbjct  302  LQGHYPVRGLYQALAVAAMCVQEQPNMRPVIADVVTALTYLASQKFDTE  350



>ref|XP_008792563.1| PREDICTED: serine/threonine-protein kinase PBS1-like isoform 
X1 [Phoenix dactylifera]
Length=397

 Score =   385 bits (990),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 197/290 (68%), Positives = 238/290 (82%), Gaps = 1/290 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDS-QSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG +DS   +VA+KQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  68   ATKNFRPDCLLGEGGFGRVYKGKLDSINQIVAIKQLDRNGLQGNREFLVEVLMLSLLHHP  127

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL +    K+ L+W  R+KIAAGAA+GLEYL
Sbjct  128  NLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDPSPDKKRLDWNTRMKIAAGAAKGLEYL  187

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLK SNILL E ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  188  HDKANPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  247

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLELITGRRA D+    GE NLV++ RP  KD+R+F +MADP
Sbjct  248  AMTGQLTLKSDVYSFGVVLLELITGRRAIDNSRASGEHNLVAWARPLFKDRRKFPQMADP  307

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            +L+ ++ VR L+ A+A+ AMC+Q+Q + RP I+D+  AL YL +Q  + E
Sbjct  308  MLQGQYPVRGLYQALAVAAMCVQEQPTMRPLIADVVTALTYLASQIYSPE  357



>ref|XP_010911042.1| PREDICTED: serine/threonine-protein kinase CDL1-like [Elaeis 
guineensis]
Length=397

 Score =   385 bits (990),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 198/290 (68%), Positives = 237/290 (82%), Gaps = 1/290 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDS-QSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG +DS   VVA+KQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  68   ATKNFRADCLLGEGGFGRVYKGKLDSINQVVAIKQLDRNGLQGNREFLVEVLMLSLLHHP  127

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL +    K+ L+W  R+KIAAGAA+GLEYL
Sbjct  128  NLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDPSPDKKRLDWNTRMKIAAGAAKGLEYL  187

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLK SNILL E ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  188  HDKANPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  247

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLELITGRRA D+    GE NLV++ RP  KD+R+F +MADP
Sbjct  248  AMTGQLTLKSDVYSFGVVLLELITGRRAIDNSRAAGEHNLVAWARPLFKDRRKFSQMADP  307

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            +L+ ++ VR L+ A+A+ AMC+Q+Q + RP I+D+  AL YL +Q    E
Sbjct  308  MLQGQYPVRGLYQALAVAAMCVQEQPTMRPLIADVVTALTYLASQTYDPE  357



>ref|XP_010937771.1| PREDICTED: serine/threonine-protein kinase CDL1 isoform X1 [Elaeis 
guineensis]
Length=398

 Score =   385 bits (990),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 197/290 (68%), Positives = 237/290 (82%), Gaps = 1/290 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDS-QSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG +DS   +VA+KQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  69   ATKNFRADCLLGEGGFGRVYKGRLDSINQIVAIKQLDRNGLQGNREFLVEVLMLSLLHHP  128

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL +    K+ L+W  R+KIAAGAA+GLEYL
Sbjct  129  NLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDPSPDKKRLDWNTRMKIAAGAAKGLEYL  188

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLK SNILL E ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  189  HDKANPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  248

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLELITGRRA D+    GE NLV++ RP  KD+R+F +MADP
Sbjct  249  AMTGQLTLKSDVYSFGVVLLELITGRRAIDNSRAAGEHNLVAWARPLFKDRRKFPQMADP  308

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            +L+ ++ VR L+ A+A+ AMC+Q+Q + RP I+D+  AL YL +Q    E
Sbjct  309  MLQGQYPVRGLYQALAVAAMCVQEQPTMRPLIADVVTALTYLASQTYNPE  358



>ref|XP_003542923.1| PREDICTED: serine/threonine-protein kinase PBS1-like isoform 
X1 [Glycine max]
 ref|XP_006594492.1| PREDICTED: serine/threonine-protein kinase PBS1-like isoform 
X2 [Glycine max]
Length=513

 Score =   390 bits (1001),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 201/285 (71%), Positives = 238/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  89   ATKNFRPECLLGEGGFGRVYKGRLESTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  148

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KE L+W  R+KIAAGAA+GLEYL
Sbjct  149  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEPLDWNTRMKIAAGAAKGLEYL  208

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILLDE ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  209  HDKANPPVIYRDLKSSNILLDEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  268

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+    GE NLV++ RP  KD+R+F +MADP
Sbjct  269  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNTRAHGEHNLVAWARPLFKDRRKFPKMADP  328

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  329  LLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQ  373



>ref|XP_001769582.1| predicted protein [Physcomitrella patens]
 gb|EDQ65575.1| predicted protein [Physcomitrella patens]
Length=393

 Score =   385 bits (990),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 199/294 (68%), Positives = 236/294 (80%), Gaps = 10/294 (3%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS----------VVAVKQLDQEGLQGNQEFIVEv  151
            AT+NF+   LLGEGGFG VYKG +++            VVAVKQLD+ GLQGN+EF+VEV
Sbjct  14   ATKNFRPECLLGEGGFGRVYKGRLENTGQARVLSGWLQVVAVKQLDRNGLQGNREFLVEV  73

Query  152  lmlsllhhnnlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAA  331
            LMLSLLHH NLV+L+GYC  GDQRLLVYE+MP G LE+HL +L   KE L+W  R+KIAA
Sbjct  74   LMLSLLHHPNLVSLIGYCADGDQRLLVYEFMPLGCLEDHLHDLPQDKECLDWNTRMKIAA  133

Query  332  GAARGLEYLHCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMG  511
            GAARGLEYLH TA PPVIYRD KSSNILLDE F+P+LSDFGLAKLGPVGD THVSTRVMG
Sbjct  134  GAARGLEYLHDTAKPPVIYRDFKSSNILLDEGFHPKLSDFGLAKLGPVGDKTHVSTRVMG  193

Query  512  TYGYCAPEYAMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDK  691
            TYGYCAPEYAM+G+LTLKSD+YSFGVVLLELITGR+A D+    GE NLV++ RP  KD+
Sbjct  194  TYGYCAPEYAMTGQLTLKSDVYSFGVVLLELITGRKAIDNSRSAGEHNLVAWARPLFKDR  253

Query  692  RRFVEMADPLLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            R+F  MADP+L+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  254  RKFPSMADPMLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALSYLASQ  307



>ref|XP_009420286.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Musa acuminata 
subsp. malaccensis]
Length=507

 Score =   389 bits (1000),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 197/283 (70%), Positives = 237/283 (84%), Gaps = 0/283 (0%)
 Frame = +2

Query  5    TQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnnl  184
            T+NF+    LGEGGFG VYKG +++  VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH NL
Sbjct  91   TKNFRRDCFLGEGGFGRVYKGRLETGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHPNL  150

Query  185  vnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLHC  364
            VNL+GYC  GDQRLLVYE+MP GSLE+HL  + A KE L+W +R+KIAAGAA+GLEYLH 
Sbjct  151  VNLIGYCADGDQRLLVYEFMPLGSLEDHLHYIPANKEPLDWNSRMKIAAGAAKGLEYLHD  210

Query  365  TANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYAM  544
             ANPPVIYRD KSSNILL E ++P+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYAM
Sbjct  211  KANPPVIYRDFKSSNILLGEGYHPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYAM  270

Query  545  SGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPLL  724
            +G+LT+KSD+YSFGVV LELITGR+A D+    GEQNLV++ RP  KD+R+F +MADPLL
Sbjct  271  TGQLTVKSDVYSFGVVFLELITGRKAIDNARPTGEQNLVAWARPLFKDRRKFPKMADPLL  330

Query  725  ERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            + R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  331  QGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALSYLASQ  373



>ref|XP_009417937.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Musa acuminata 
subsp. malaccensis]
Length=500

 Score =   389 bits (999),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 198/284 (70%), Positives = 238/284 (84%), Gaps = 0/284 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF++  LLGEGGFG VYKG +++  VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH N
Sbjct  83   ATKNFRQECLLGEGGFGRVYKGRLENGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHPN  142

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYC  GDQRLLVYE+MP GSLE+HL ++ A KE L+W  R+KIAAGAA+GLEYLH
Sbjct  143  LVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDIPADKEPLDWNIRMKIAAGAAKGLEYLH  202

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
              ANPPVIYRD KSSNILL E ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  203  DKANPPVIYRDFKSSNILLGEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEYA  262

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+G+LT+KSD+YSFGVV LELITGR+A D+    GEQNLV++ RP  KD+R+F  MADPL
Sbjct  263  MTGQLTVKSDVYSFGVVFLELITGRKAIDNTRPSGEQNLVAWARPLFKDRRKFPNMADPL  322

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            L+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  323  LQGRYPMRGLYQALAVAAMCLQEQAATRPFIGDVVTALSYLASQ  366



>ref|XP_008242015.1| PREDICTED: serine/threonine-protein kinase PBS1 [Prunus mume]
Length=391

 Score =   385 bits (989),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 195/290 (67%), Positives = 239/290 (82%), Gaps = 1/290 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDS-QSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S   VVA+KQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  74   ATRNFRAECLLGEGGFGRVYKGRLESTHQVVAIKQLDRNGLQGNREFLVEVLMLSLLHHP  133

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL ++  GK  L+W  R+KIAAGAA+GLEYL
Sbjct  134  NLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDISPGKRRLDWNTRMKIAAGAAKGLEYL  193

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  A+PPVIYRDLK SNILL E ++P+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY
Sbjct  194  HDKASPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  253

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLE+ITGR+A D+    GEQNLV++ RP  KD+++F +MADP
Sbjct  254  AMTGQLTLKSDVYSFGVVLLEIITGRKAIDNSRATGEQNLVAWARPLFKDRKKFSQMADP  313

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            +L+ ++  R L+ A+A+ AMC+Q+Q + RP I+D+  AL YL +Q    E
Sbjct  314  MLQGQYPQRGLYQALAVAAMCVQEQPNMRPVIADVVTALTYLASQKHDQE  363



>ref|XP_008223116.1| PREDICTED: serine/threonine-protein kinase PBS1 [Prunus mume]
Length=508

 Score =   389 bits (1000),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 201/285 (71%), Positives = 238/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  81   ATKNFRPECLLGEGGFGRVYKGRLESTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  140

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +  + KE L+W  R+KIAAGAA+GLEYL
Sbjct  141  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDFPSDKEPLDWNTRMKIAAGAAKGLEYL  200

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILLDE F+P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  201  HDKANPPVIYRDLKSSNILLDEGFHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  260

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+    GE NLV++ RP  KD+R+F +MADP
Sbjct  261  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNTRGHGEHNLVAWARPLFKDRRKFPKMADP  320

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  321  LLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQ  365



>ref|XP_007205320.1| hypothetical protein PRUPE_ppa006902mg [Prunus persica]
 gb|EMJ06519.1| hypothetical protein PRUPE_ppa006902mg [Prunus persica]
Length=391

 Score =   385 bits (989),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 195/290 (67%), Positives = 240/290 (83%), Gaps = 1/290 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S + VVA+KQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  74   ATRNFRAECLLGEGGFGRVYKGRLESTNQVVAIKQLDRNGLQGNREFLVEVLMLSLLHHP  133

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL ++  GK  L+W  R+KIAAGAA+GLEYL
Sbjct  134  NLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDISPGKRRLDWNTRMKIAAGAAKGLEYL  193

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  A+PPVIYRDLK SNILL E ++P+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY
Sbjct  194  HDKASPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  253

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLE+ITGR+A D+    GEQNLV++ RP  KD+++F +MADP
Sbjct  254  AMTGQLTLKSDVYSFGVVLLEIITGRKAIDNSRATGEQNLVAWARPLFKDRKKFSQMADP  313

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            +L+ ++  R L+ A+A+ AMC+Q+Q + RP I+D+  AL YL +Q    E
Sbjct  314  MLQGQYPQRGLYQALAVAAMCVQEQPNMRPVIADVVTALTYLASQKHDQE  363



>ref|XP_008226809.1| PREDICTED: serine/threonine-protein kinase PBS1 isoform X1 [Prunus 
mume]
Length=415

 Score =   386 bits (991),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 194/292 (66%), Positives = 237/292 (81%), Gaps = 1/292 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVI-DSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT NF   NLLGEGGFG VYKG + D+  VVAVKQLD+ G QGN+EF+VEVL+LSLLHH 
Sbjct  96   ATNNFHPDNLLGEGGFGRVYKGKLEDTDRVVAVKQLDRNGFQGNREFLVEVLILSLLHHP  155

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            +LVNL+GYC  GDQR+LVYEYM NGSLE+HL +L  GK+AL+W  R+KIAAGAA+GLEYL
Sbjct  156  HLVNLVGYCADGDQRILVYEYMANGSLEDHLLDLGPGKKALDWDTRMKIAAGAAKGLEYL  215

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRD K+SNILLDE F+P+LSDFGLAKLGP GD THVSTRVMGTYGYCAPEY
Sbjct  216  HEQANPPVIYRDFKASNILLDENFSPKLSDFGLAKLGPTGDKTHVSTRVMGTYGYCAPEY  275

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            A++G+LT KSDIYSFGVV LE++TGRR  D++    EQNLV++ +P  KD+R+F  MADP
Sbjct  276  ALTGQLTTKSDIYSFGVVFLEIVTGRRVIDNNRPTEEQNLVTWAQPLFKDRRKFTLMADP  335

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSERN  874
            LLE ++ ++ L+ A+A+ AMCLQ++A+ RP ISD+  AL+YL      S+ N
Sbjct  336  LLEDKYPIKGLYQALAVAAMCLQEEATTRPLISDVVTALEYLTVDCIESDEN  387



>ref|XP_008784546.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Phoenix 
dactylifera]
Length=422

 Score =   386 bits (991),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 195/284 (69%), Positives = 234/284 (82%), Gaps = 1/284 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVI-DSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NFK   LLGEGGFG VYKG + D+   +AVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  75   ATKNFKAECLLGEGGFGRVYKGHLEDTNQDIAVKQLDRNGLQGNREFLVEVLMLSLLHHP  134

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYCT GD R+LVYEYMPNGSLE+HL +L   K+ L+W  R+KIA GAA+GLEYL
Sbjct  135  NLVNLIGYCTDGDHRILVYEYMPNGSLEDHLLDLAPNKKPLDWNTRMKIAEGAAKGLEYL  194

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRD K+SNILLDE++NP+LSDFGLAK+GPVGD +HVSTRVMGTYGYCAPEY
Sbjct  195  HDIANPPVIYRDFKASNILLDEDYNPKLSDFGLAKVGPVGDKSHVSTRVMGTYGYCAPEY  254

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            A++G+LT  SD+YSFGVV LE+ITGRRA D+     EQNLV +  P  KDK+RFVEMADP
Sbjct  255  ALTGQLTTMSDVYSFGVVFLEIITGRRAIDTSRPSNEQNLVQWAEPLFKDKKRFVEMADP  314

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVA  850
            LLE  + ++ L+ A+A+ AMCLQ++AS RP ISD+  AL+YLV 
Sbjct  315  LLEGNYPLKGLYQALAVAAMCLQEEASSRPLISDVVTALEYLVV  358



>ref|XP_002276042.1| PREDICTED: serine/threonine-protein kinase CDL1 [Vitis vinifera]
 emb|CBI32634.3| unnamed protein product [Vitis vinifera]
Length=396

 Score =   385 bits (989),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 195/285 (68%), Positives = 238/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVI-DSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG I ++   VA+KQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  67   ATKNFRGECLLGEGGFGRVYKGRIANTNQAVAIKQLDRNGLQGNREFLVEVLMLSLLHHP  126

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL ++  GK+ L+W  R+KIAAGAA+GLEYL
Sbjct  127  NLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDVSLGKKRLDWNTRMKIAAGAAKGLEYL  186

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  A+PPVIYRDLK SNILL E+F+P+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY
Sbjct  187  HDKASPPVIYRDLKCSNILLGEDFHPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  246

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLE+ITGR+A D+    GE NLV++ RP  KD+R+F+ MADP
Sbjct  247  AMTGQLTLKSDVYSFGVVLLEIITGRKAIDNSKAAGEHNLVAWARPLFKDRRKFLHMADP  306

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            +L+ ++ +R L+ A+A+ AMC+Q+Q + RP I D+  AL YL AQ
Sbjct  307  MLQGQYPLRGLYQALAVAAMCVQEQPNLRPLIVDVVTALTYLAAQ  351



>ref|XP_010937772.1| PREDICTED: serine/threonine-protein kinase CDL1 isoform X2 [Elaeis 
guineensis]
Length=397

 Score =   385 bits (989),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 197/290 (68%), Positives = 237/290 (82%), Gaps = 1/290 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDS-QSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG +DS   +VA+KQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  68   ATKNFRADCLLGEGGFGRVYKGRLDSINQIVAIKQLDRNGLQGNREFLVEVLMLSLLHHP  127

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL +    K+ L+W  R+KIAAGAA+GLEYL
Sbjct  128  NLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDPSPDKKRLDWNTRMKIAAGAAKGLEYL  187

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLK SNILL E ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  188  HDKANPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  247

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLELITGRRA D+    GE NLV++ RP  KD+R+F +MADP
Sbjct  248  AMTGQLTLKSDVYSFGVVLLELITGRRAIDNSRAAGEHNLVAWARPLFKDRRKFPQMADP  307

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            +L+ ++ VR L+ A+A+ AMC+Q+Q + RP I+D+  AL YL +Q    E
Sbjct  308  MLQGQYPVRGLYQALAVAAMCVQEQPTMRPLIADVVTALTYLASQTYNPE  357



>ref|XP_003521368.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Glycine 
max]
Length=379

 Score =   384 bits (987),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 195/285 (68%), Positives = 237/285 (83%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDS-QSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S   VVA+KQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  69   ATRNFRNDCLLGEGGFGRVYKGRLESINQVVAIKQLDRNGLQGNREFLVEVLMLSLLHHP  128

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP G LE+HL ++  GK+ L+W  R+KIAAGAA+GLEYL
Sbjct  129  NLVNLIGYCADGDQRLLVYEYMPLGCLEDHLHDIPPGKKRLDWNTRMKIAAGAAKGLEYL  188

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLK SNILL E ++P+LSDFGLAKLGPVG+NTHVSTRVMGTYGYCAPEY
Sbjct  189  HDKANPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGENTHVSTRVMGTYGYCAPEY  248

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLE+ITGR+A D+    GEQNLV++ RP  KD+R+F +MADP
Sbjct  249  AMTGQLTLKSDVYSFGVVLLEIITGRKAIDNSKSAGEQNLVAWARPLFKDRRKFSQMADP  308

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
             L  ++  R L+ A+A+ AMC+Q+QA+ RP I+D+  AL YL +Q
Sbjct  309  TLHGQYPPRGLYQALAVAAMCVQEQANLRPVIADVVTALSYLASQ  353



>ref|XP_010921748.1| PREDICTED: serine/threonine-protein kinase CDL1 isoform X2 [Elaeis 
guineensis]
Length=456

 Score =   387 bits (994),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 197/284 (69%), Positives = 235/284 (83%), Gaps = 0/284 (0%)
 Frame = +2

Query  5    TQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnnl  184
            TQNF+    LGEGGFG VYKG +++  VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH NL
Sbjct  35   TQNFRADCFLGEGGFGRVYKGRLENGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHPNL  94

Query  185  vnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLHC  364
            VNL+GYC  GDQRLLVYE+MP GSLE+HL +L + KE L+W  R+KIAAGAA+GLEYLH 
Sbjct  95   VNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPSDKEPLDWNTRMKIAAGAAKGLEYLHD  154

Query  365  TANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYAM  544
             ANPPVIYRD KSSNILL E ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYAM
Sbjct  155  KANPPVIYRDFKSSNILLGEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEYAM  214

Query  545  SGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPLL  724
            +G+LT+KSD+YSFGVV LELITGR+A D+    GEQNLV++ RP  KD+R+F +MADPLL
Sbjct  215  TGQLTVKSDVYSFGVVFLELITGRKAIDNTRPAGEQNLVAWARPLFKDRRKFPKMADPLL  274

Query  725  ERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
            +  + VR L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q 
Sbjct  275  QGHYPVRGLYQALAVAAMCLQEQAATRPLIGDVVTALSYLASQG  318



>gb|KHN09461.1| Serine/threonine-protein kinase PBS1 [Glycine soja]
Length=379

 Score =   384 bits (987),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 195/285 (68%), Positives = 237/285 (83%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDS-QSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S   VVA+KQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  69   ATRNFRNDCLLGEGGFGRVYKGRLESINQVVAIKQLDRNGLQGNREFLVEVLMLSLLHHP  128

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP G LE+HL ++  GK+ L+W  R+KIAAGAA+GLEYL
Sbjct  129  NLVNLIGYCADGDQRLLVYEYMPLGCLEDHLHDIPPGKKRLDWNTRMKIAAGAAKGLEYL  188

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLK SNILL E ++P+LSDFGLAKLGPVG+NTHVSTRVMGTYGYCAPEY
Sbjct  189  HDKANPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGENTHVSTRVMGTYGYCAPEY  248

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLE+ITGR+A D+    GEQNLV++ RP  KD+R+F +MADP
Sbjct  249  AMTGQLTLKSDVYSFGVVLLEIITGRKAIDNSKSAGEQNLVAWARPLFKDRRKFSQMADP  308

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
             L  ++  R L+ A+A+ AMC+Q+QA+ RP I+D+  AL YL +Q
Sbjct  309  TLHGQYPPRGLYQALAVAAMCVQEQANLRPVIADVVTALSYLASQ  353



>ref|XP_008792570.1| PREDICTED: serine/threonine-protein kinase PBS1-like isoform 
X2 [Phoenix dactylifera]
Length=396

 Score =   385 bits (988),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 197/290 (68%), Positives = 238/290 (82%), Gaps = 1/290 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDS-QSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG +DS   +VA+KQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  67   ATKNFRPDCLLGEGGFGRVYKGKLDSINQIVAIKQLDRNGLQGNREFLVEVLMLSLLHHP  126

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL +    K+ L+W  R+KIAAGAA+GLEYL
Sbjct  127  NLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDPSPDKKRLDWNTRMKIAAGAAKGLEYL  186

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLK SNILL E ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  187  HDKANPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  246

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLELITGRRA D+    GE NLV++ RP  KD+R+F +MADP
Sbjct  247  AMTGQLTLKSDVYSFGVVLLELITGRRAIDNSRASGEHNLVAWARPLFKDRRKFPQMADP  306

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            +L+ ++ VR L+ A+A+ AMC+Q+Q + RP I+D+  AL YL +Q  + E
Sbjct  307  MLQGQYPVRGLYQALAVAAMCVQEQPTMRPLIADVVTALTYLASQIYSPE  356



>gb|AFW71565.1| putative protein kinase superfamily protein [Zea mays]
Length=448

 Score =   387 bits (993),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 197/285 (69%), Positives = 237/285 (83%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+    LGEGGFG VYKG ++S   VVA+KQL+++GLQGN+EF+VEVLMLSLLHH 
Sbjct  43   ATRNFRPECFLGEGGFGRVYKGRLESTGQVVAIKQLNRDGLQGNREFLVEVLMLSLLHHQ  102

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP+GSLE+HL ++   KEAL+W  R+KIAAGAA+GLEYL
Sbjct  103  NLVNLIGYCADGDQRLLVYEYMPSGSLEDHLHDIPLDKEALDWNTRMKIAAGAAKGLEYL  162

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRD KSSNILLDE F+P+LSDFGLAKLGPVGD +HVSTRVMGTYGYCAPEY
Sbjct  163  HDKANPPVIYRDFKSSNILLDESFHPKLSDFGLAKLGPVGDKSHVSTRVMGTYGYCAPEY  222

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LT+KSD+YSFGVVLLELITGRRA DS    GEQNLVS+ RP   D+R+  +MADP
Sbjct  223  AMTGQLTVKSDVYSFGVVLLELITGRRAIDSTRPHGEQNLVSWARPLFNDRRKLPKMADP  282

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
             LE R+ +R L+ A+A+ +MC Q +A+ RP I+D+  AL YL +Q
Sbjct  283  RLEGRYPMRGLYQALAVASMCTQSEAASRPLIADVVTALSYLASQ  327



>ref|XP_001785516.1| predicted protein [Physcomitrella patens]
 gb|EDQ49671.1| predicted protein [Physcomitrella patens]
Length=374

 Score =   384 bits (986),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 199/286 (70%), Positives = 234/286 (82%), Gaps = 2/286 (1%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDS--QSVVAVKQLDQEGLQGNQEFIVEvlmlsllhh  175
            AT+NF+   LLGEGGFG VYKG +++  Q+ VAVKQLD+ GLQGN+EF+VEVLMLSLLHH
Sbjct  14   ATKNFRPECLLGEGGFGRVYKGRLENTGQARVAVKQLDRRGLQGNREFLVEVLMLSLLHH  73

Query  176  nnlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEY  355
             NLVNL+GYC  G QRLLVYE+MP G LE+HL  L   KE L+W  R+KIA GAARGLEY
Sbjct  74   TNLVNLIGYCADGQQRLLVYEFMPLGCLEDHLHGLPQNKECLDWNTRMKIAVGAARGLEY  133

Query  356  LHCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPE  535
            LH  A PPVIYRDLKSSNILL E F+P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPE
Sbjct  134  LHDKAEPPVIYRDLKSSNILLGEGFHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPE  193

Query  536  YAMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMAD  715
            YAM+G+LTLKSD+YSFGVVLLELITGR+A D    PGE NLV++ RP  KDKR+F  MAD
Sbjct  194  YAMTGQLTLKSDVYSFGVVLLELITGRKAIDESRGPGEHNLVAWARPMFKDKRKFQSMAD  253

Query  716  PLLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            P+L+ R+ +R L+ A+A+ AMCLQ+QA+ RP I+D+  AL YL +Q
Sbjct  254  PMLQGRYPIRGLNQALAVAAMCLQEQAATRPLIADVVTALSYLASQ  299



>ref|XP_004295806.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Fragaria 
vesca subsp. vesca]
Length=382

 Score =   384 bits (987),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 192/282 (68%), Positives = 232/282 (82%), Gaps = 1/282 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVID-SQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            ATQNF   NLLGEGGFG VYKG +D +  VVAVKQLD+ G QGN+EF+VEVL+LSL+H  
Sbjct  75   ATQNFHPDNLLGEGGFGRVYKGHLDCTNQVVAVKQLDRNGFQGNREFLVEVLILSLIHAP  134

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQR+LVYEYM NGSLE+HL E+   K+ L+W  R+KIAAGAA+GLEYL
Sbjct  135  NLVNLVGYCADGDQRILVYEYMANGSLEDHLLEIPPDKKPLDWETRIKIAAGAAKGLEYL  194

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRD K+SNILLDE FNP+LSDFGLAKLGP GD THVSTRVMGTYGYCAPEY
Sbjct  195  HEQANPPVIYRDFKASNILLDENFNPKLSDFGLAKLGPTGDKTHVSTRVMGTYGYCAPEY  254

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            A++G+LT KSDIYSFGVV LE+ITGRR  D+     EQNLV++ +P  KD+R+FV MADP
Sbjct  255  ALTGQLTTKSDIYSFGVVFLEIITGRRVIDNSRPTEEQNLVTWAQPLFKDRRKFVLMADP  314

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYL  844
            LLE ++ ++ L+ A+A+ AMCLQ++A+ RP ISD+  AL++L
Sbjct  315  LLEGKYPIKGLYQALAVAAMCLQEEAATRPLISDVVTALEFL  356



>emb|CDX97232.1| BnaC09g43930D [Brassica napus]
Length=455

 Score =   387 bits (993),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 197/286 (69%), Positives = 236/286 (83%), Gaps = 1/286 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT NF     LGEGGFG VYKG +DS   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  81   ATMNFHPDTFLGEGGFGRVYKGRLDSTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  140

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KEAL+W  R+KIAAGAA+GLE+L
Sbjct  141  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEALDWNMRMKIAAGAAKGLEFL  200

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRD KSSNILLDE F+P+LSDFGLAKLGP GD +HVSTRVMGTYGYCAPEY
Sbjct  201  HDKANPPVIYRDFKSSNILLDEGFHPKLSDFGLAKLGPTGDKSHVSTRVMGTYGYCAPEY  260

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LT+KSD+YSFGVV LELITGR+A D+D   GEQNLV++ RP   D+R+F+++ADP
Sbjct  261  AMTGQLTVKSDVYSFGVVFLELITGRKAIDTDMPHGEQNLVAWARPLFNDRRKFIKLADP  320

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
             L+ RF  R+L+ A+A+ +MC+Q+QA+ RP I+D+  AL YL  QA
Sbjct  321  RLKGRFPTRALYQALAVASMCIQEQAATRPLIADVVTALSYLANQA  366



>ref|XP_006597536.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Glycine 
max]
Length=514

 Score =   389 bits (998),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 200/285 (70%), Positives = 238/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG +++   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  89   ATKNFRPECLLGEGGFGRVYKGRLETTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  148

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KE L+W  R+KIAAGAA+GLEYL
Sbjct  149  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEPLDWNTRMKIAAGAAKGLEYL  208

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILLDE ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  209  HDKANPPVIYRDLKSSNILLDEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  268

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+    GE NLV++ RP  KD+R+F +MADP
Sbjct  269  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNTRAHGEHNLVAWARPLFKDRRKFPKMADP  328

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  329  LLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQ  373



>ref|XP_003554350.1| PREDICTED: serine/threonine-protein kinase PBS1 [Glycine max]
 gb|KHN02380.1| Serine/threonine-protein kinase PBS1 [Glycine soja]
Length=380

 Score =   384 bits (986),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 194/285 (68%), Positives = 237/285 (83%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDS-QSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S   VVA+KQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  69   ATRNFRAECLLGEGGFGRVYKGRLESINQVVAIKQLDRNGLQGNREFLVEVLMLSLLHHP  128

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP G LE+HL ++  GK+ L+W  R+KIAAGAA+GLEYL
Sbjct  129  NLVNLIGYCADGDQRLLVYEYMPLGCLEDHLHDIPPGKKQLDWNTRMKIAAGAAKGLEYL  188

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLK SNILL E ++P+LSDFGLAKLGPVG+NTHVSTRVMGTYGYCAPEY
Sbjct  189  HDKANPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGENTHVSTRVMGTYGYCAPEY  248

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLE+ITGR+A D+    GEQNLV++ RP  KD+R+F +MADP
Sbjct  249  AMTGQLTLKSDVYSFGVVLLEIITGRKAIDNSKSAGEQNLVAWARPLFKDRRKFSQMADP  308

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
             L+ ++  R L+  +A+ AMC+Q+QA+ RP I+D+  AL YL +Q
Sbjct  309  TLQGQYPPRGLYQVIAVAAMCVQEQANMRPVIADVVTALSYLASQ  353



>ref|XP_009121792.1| PREDICTED: serine/threonine-protein kinase PBS1 [Brassica rapa]
 ref|XP_009121793.1| PREDICTED: serine/threonine-protein kinase PBS1 [Brassica rapa]
 emb|CDX69664.1| BnaA10g20130D [Brassica napus]
Length=455

 Score =   387 bits (993),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 197/286 (69%), Positives = 236/286 (83%), Gaps = 1/286 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT NF     LGEGGFG VYKG +DS   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  81   ATMNFHPDTFLGEGGFGRVYKGRLDSTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  140

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KEAL+W  R+KIAAGAA+GLE+L
Sbjct  141  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEALDWNMRMKIAAGAAKGLEFL  200

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRD KSSNILLDE F+P+LSDFGLAKLGP GD +HVSTRVMGTYGYCAPEY
Sbjct  201  HDKANPPVIYRDFKSSNILLDEGFHPKLSDFGLAKLGPTGDKSHVSTRVMGTYGYCAPEY  260

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LT+KSD+YSFGVV LELITGR+A D+D   GEQNLV++ RP   D+R+F+++ADP
Sbjct  261  AMTGQLTVKSDVYSFGVVFLELITGRKAIDTDMPHGEQNLVAWARPLFNDRRKFIKLADP  320

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
             L+ RF  R+L+ A+A+ +MC+Q+QA+ RP I+D+  AL YL  QA
Sbjct  321  RLKGRFPTRALYQALAVASMCIQEQAATRPLIADVVTALSYLANQA  366



>gb|KHN33127.1| Serine/threonine-protein kinase PBS1 [Glycine soja]
Length=514

 Score =   389 bits (998),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 200/285 (70%), Positives = 238/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG +++   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  89   ATKNFRPECLLGEGGFGRVYKGRLETTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  148

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KE L+W  R+KIAAGAA+GLEYL
Sbjct  149  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEPLDWNTRMKIAAGAAKGLEYL  208

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILLDE ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  209  HDKANPPVIYRDLKSSNILLDEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  268

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+    GE NLV++ RP  KD+R+F +MADP
Sbjct  269  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNTRAHGEHNLVAWARPLFKDRRKFPKMADP  328

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  329  LLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQ  373



>ref|XP_010935291.1| PREDICTED: serine/threonine-protein kinase CDL1-like [Elaeis 
guineensis]
Length=407

 Score =   385 bits (988),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 190/291 (65%), Positives = 233/291 (80%), Gaps = 0/291 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NFK SNLLGEGGFG V+KG ++S  VVA+KQL+Q GLQG+ EF+VEVLML +LHH N
Sbjct  62   ATRNFKLSNLLGEGGFGRVFKGFLESGQVVAIKQLNQNGLQGSNEFLVEVLMLIMLHHPN  121

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV+L GYC  G +RLLVYEYMP GSLE+HLF+L   KE L+W  R+KIA GAA+GL YLH
Sbjct  122  LVSLYGYCAEGSERLLVYEYMPQGSLEDHLFDLPPNKEPLDWNTRIKIAVGAAKGLTYLH  181

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
               +PPVIYRDLKS+NILLD +FNP+LSDFGLAKLGPVGD THVSTRVMGTYGYCAP+YA
Sbjct  182  DVVHPPVIYRDLKSANILLDNDFNPKLSDFGLAKLGPVGDRTHVSTRVMGTYGYCAPDYA  241

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLT+K D+YSFGVVLLELITGRRAYD   K GEQ+L+S+  P L D+RRF ++ADPL
Sbjct  242  MSGKLTVKCDVYSFGVVLLELITGRRAYDFSKKAGEQSLISWAHPLLNDRRRFTQLADPL  301

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSERN  874
            L  R+ +R+L+    +T+ CL ++   RP++ D+ +ALD + +Q    E N
Sbjct  302  LRGRYPIRALYQLAVVTSTCLHEKPHLRPSMLDVVVALDLVASQPYILENN  352



>ref|XP_006301389.1| hypothetical protein CARUB_v10021802mg [Capsella rubella]
 gb|EOA34287.1| hypothetical protein CARUB_v10021802mg [Capsella rubella]
Length=381

 Score =   384 bits (986),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 188/289 (65%), Positives = 239/289 (83%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+E N++G+GGFGSVY+G +DS  VVA+KQL+ +G QGNQEFIVEV MLS+ HH N
Sbjct  71   ATKNFREVNMIGKGGFGSVYRGRLDSGQVVAIKQLNPDGHQGNQEFIVEVCMLSVFHHPN  130

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT G QRLLVYEYMP GSLE+HLF+LE  +  L+W  R+KIA GAARG+EYLH
Sbjct  131  LVTLIGYCTSGAQRLLVYEYMPMGSLEDHLFDLEPDQTPLSWNTRMKIAVGAARGIEYLH  190

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C  +P VIYRDLKS+NILLD++F+ +LSDFGLAK+GPVG+ THVSTRVMGTYGYCAPEYA
Sbjct  191  CKISPSVIYRDLKSANILLDKDFSVKLSDFGLAKVGPVGNRTHVSTRVMGTYGYCAPEYA  250

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSG+LT+KSDIYSFGVVLLELI+GR+A D     GEQ LV++ RP+LKD ++F  + DPL
Sbjct  251  MSGRLTIKSDIYSFGVVLLELISGRKAIDLSKPNGEQYLVAWARPYLKDPKKFGHLVDPL  310

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L  ++S R L +A+AIT MCL ++A++RP I D+ +A +Y+ AQ+++ E
Sbjct  311  LRGKYSKRCLSYAIAITEMCLNEEANYRPKIGDVVVAFEYIAAQSKSHE  359



>ref|XP_011090918.1| PREDICTED: serine/threonine-protein kinase CDL1 [Sesamum indicum]
Length=513

 Score =   389 bits (998),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 201/286 (70%), Positives = 237/286 (83%), Gaps = 1/286 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  82   ATKNFRPECLLGEGGFGRVYKGRLESTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  141

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL +L   KE L+W  R+KIAAGAA+GLEYL
Sbjct  142  NLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDLPPDKEPLDWNTRMKIAAGAAKGLEYL  201

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILLDE + P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  202  HDKANPPVIYRDLKSSNILLDEGYFPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  261

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LE+ITGR+A D+    GE NLV++ RP  KD+R+F +MADP
Sbjct  262  AMTGQLTLKSDVYSFGVVFLEIITGRKAIDNTRGAGEHNLVAWARPLFKDRRKFPKMADP  321

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
            LL+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q 
Sbjct  322  LLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQT  367



>ref|XP_008776230.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Phoenix 
dactylifera]
Length=505

 Score =   388 bits (997),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 198/284 (70%), Positives = 237/284 (83%), Gaps = 0/284 (0%)
 Frame = +2

Query  5    TQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnnl  184
            T+NF+   LLGEGGFG VYKG +++  VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH NL
Sbjct  84   TKNFRPDCLLGEGGFGRVYKGRLENGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHPNL  143

Query  185  vnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLHC  364
            VNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KE L+W  R+KIAAGAA+GLEYLH 
Sbjct  144  VNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEPLDWNTRMKIAAGAAKGLEYLHD  203

Query  365  TANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYAM  544
             ANPPVIYRD KSSNILLDE ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYAM
Sbjct  204  KANPPVIYRDFKSSNILLDEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEYAM  263

Query  545  SGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPLL  724
            +G+LT+KSD+YSFGVV LELITGR+A D+    GEQNLV++ RP  KD+R+F +MADPLL
Sbjct  264  TGQLTVKSDVYSFGVVFLELITGRKAIDNTRPAGEQNLVAWARPLFKDRRKFPKMADPLL  323

Query  725  ERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
            +  + +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +QA
Sbjct  324  QGCYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALSYLASQA  367



>ref|XP_006858117.1| hypothetical protein AMTR_s00062p00107880 [Amborella trichopoda]
 gb|ERN19584.1| hypothetical protein AMTR_s00062p00107880 [Amborella trichopoda]
Length=404

 Score =   385 bits (988),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 196/286 (69%), Positives = 235/286 (82%), Gaps = 1/286 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQ-SVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            ATQNF+   LLGEGGFG VYKG +DS   VVAVKQLD+ GLQGN+EF+VEV MLSLLHH 
Sbjct  64   ATQNFRPDFLLGEGGFGRVYKGFLDSSGQVVAVKQLDRNGLQGNREFLVEVFMLSLLHHP  123

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL +L   K+ L W  R+KIA GAA+GLEYL
Sbjct  124  NLVNLIGYCADGDQRLLVYEYMPLGSLEDHLLDLSPNKKPLEWNIRMKIAEGAAKGLEYL  183

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H TANPP+IYRD KSSNILLDE++NP+LSDFGLAK+GPVGD +HVSTRVMGTYGYCAPEY
Sbjct  184  HDTANPPIIYRDFKSSNILLDEDYNPKLSDFGLAKVGPVGDKSHVSTRVMGTYGYCAPEY  243

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            A +G+LT KSD+YSFGVVLLE+ITGRRA D+     EQNLV++ +P  KD+R+F ++ADP
Sbjct  244  ASTGRLTTKSDVYSFGVVLLEIITGRRAIDNAKPSSEQNLVTWVQPLFKDRRKFPQIADP  303

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
            +L+ R+  R+L+ A+A+ AMCLQ +AS RP ISD+  AL YL +Q 
Sbjct  304  MLQGRYPPRALYQALAVAAMCLQAEASTRPLISDVVTALYYLASQT  349



>ref|XP_008789020.1| PREDICTED: serine/threonine-protein kinase PBS1-like isoform 
X1 [Phoenix dactylifera]
Length=397

 Score =   384 bits (987),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 197/290 (68%), Positives = 237/290 (82%), Gaps = 1/290 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDS-QSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG +DS   VVA+KQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  68   ATKNFRVDCLLGEGGFGRVYKGRLDSINQVVAIKQLDRNGLQGNREFLVEVLMLSLLHHP  127

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL +    K+ L+W  R+KIAAGAA+GLEYL
Sbjct  128  NLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDPSPDKKRLDWNTRMKIAAGAAKGLEYL  187

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLK SNILL E ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  188  HDKANPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  247

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLELITGRRA D+    GE NLV++ RP  KD+R+F +MADP
Sbjct  248  AMTGQLTLKSDVYSFGVVLLELITGRRAIDNSRAAGEHNLVAWARPLFKDRRKFPQMADP  307

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            +L+ ++ VR L+ A+A+ AMC+Q+Q + RP I+D+  A+ YL +Q    E
Sbjct  308  MLQGQYPVRGLYQALAVAAMCVQEQPTMRPLIADVVTAITYLASQTYNPE  357



>ref|XP_006367263.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Solanum 
tuberosum]
Length=390

 Score =   384 bits (986),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 193/289 (67%), Positives = 239/289 (83%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+   LLGEGGFG VYKG +DS  +VA+KQLD+ GLQGN+EF+VEVLMLSLLHH N
Sbjct  68   ATRNFRGDCLLGEGGFGRVYKGQLDSNQIVAIKQLDRNGLQGNREFLVEVLMLSLLHHPN  127

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL GYC  GDQRLLVYEYMP GSL++HL +L  GK+ L+W  R+KIAAGAA+GLEYLH
Sbjct  128  LVNLTGYCADGDQRLLVYEYMPLGSLDDHLHDLTPGKKVLDWNMRMKIAAGAAKGLEYLH  187

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
              A+PPVIYRDLK SNILL E ++P+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  188  DRASPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  247

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+G+LTLKSD+YSFGVVLLE+ITGR+A ++    GE NLV++ +P  +D+R+F +MADP+
Sbjct  248  MTGQLTLKSDVYSFGVVLLEIITGRKAIENSKTGGEHNLVAWAKPLFRDRRKFSQMADPM  307

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L+ ++  R L+ A+A+ AMC+Q+Q + RP I+D+  AL YL AQ   S+
Sbjct  308  LQGQYPERGLYQALAVAAMCVQEQPNMRPVIADVVTALSYLAAQKFDSD  356



>ref|XP_010492062.1| PREDICTED: serine/threonine-protein kinase PBS1 [Camelina sativa]
Length=456

 Score =   386 bits (992),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 197/286 (69%), Positives = 236/286 (83%), Gaps = 1/286 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT NF     LGEGGFG VYKG +DS   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  82   ATMNFHPDTFLGEGGFGRVYKGRLDSTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  141

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KEAL+W  R+KIAAGAA+GLE+L
Sbjct  142  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEALDWNMRMKIAAGAAKGLEFL  201

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRD KSSNILLDE F+P+LSDFGLAKLGP GD +HVSTRVMGTYGYCAPEY
Sbjct  202  HDKANPPVIYRDFKSSNILLDEGFHPKLSDFGLAKLGPTGDKSHVSTRVMGTYGYCAPEY  261

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LT+KSD+YSFGVV LELITGR+A DS+   GEQNLV++ RP   D+R+F+++ADP
Sbjct  262  AMTGQLTVKSDVYSFGVVFLELITGRKAIDSEMPHGEQNLVAWARPLFNDRRKFIKLADP  321

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
             L+ RF  R+L+ A+A+ +MC+Q+QA+ RP I+D+  AL YL  QA
Sbjct  322  KLKGRFPTRALYQALAVASMCIQEQAATRPLIADVVTALSYLANQA  367



>ref|XP_009404641.1| PREDICTED: serine/threonine-protein kinase PBS1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=386

 Score =   384 bits (985),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 195/286 (68%), Positives = 239/286 (84%), Gaps = 1/286 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S + +VA+KQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  68   ATKNFRADCLLGEGGFGRVYKGRLESSNQIVAIKQLDRNGLQGNREFLVEVLMLSLLHHP  127

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLV+L+GYC  GDQRLLVYEYMP GSLE+HL +L   K+ L+W  R+KIAAGAA+GLEYL
Sbjct  128  NLVSLIGYCADGDQRLLVYEYMPLGSLEDHLHDLSPDKKRLDWNTRMKIAAGAAKGLEYL  187

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  A+PPVIYRDLK SNILLDE ++P+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY
Sbjct  188  HDKASPPVIYRDLKCSNILLDEGYHPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  247

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSDIYSFGVVLLELITGRRA D+    GE NLV++ RP  KD+R+F ++ADP
Sbjct  248  AMTGQLTLKSDIYSFGVVLLELITGRRAIDNSRAAGEHNLVAWARPLFKDRRKFSQVADP  307

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
            +L+ ++  R L+ A+A+ AMC+Q+Q + RP I+D+  AL YL +Q 
Sbjct  308  VLQGQYPPRGLYQALAVAAMCVQEQPAMRPLIADVVTALTYLASQT  353



>ref|XP_006828265.1| hypothetical protein AMTR_s00023p00210090 [Amborella trichopoda]
 gb|ERM95681.1| hypothetical protein AMTR_s00023p00210090 [Amborella trichopoda]
Length=402

 Score =   384 bits (987),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 197/290 (68%), Positives = 239/290 (82%), Gaps = 1/290 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S + VVA+KQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  65   ATKNFRVECLLGEGGFGRVYKGRLESTNQVVAIKQLDRNGLQGNREFLVEVLMLSLLHHE  124

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL +L + K+ L+W  R+KIAAGAA+GLEYL
Sbjct  125  NLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDLPSDKKQLDWNTRMKIAAGAAKGLEYL  184

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLK SNILL E ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  185  HDKANPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  244

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLELITGR+A D+    GE NLV++ RP  KD+R+F +MADP
Sbjct  245  AMTGQLTLKSDVYSFGVVLLELITGRKAIDNSRAAGEHNLVAWARPLFKDRRKFSQMADP  304

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
             L+ +F +R L+ A+A+ AMC+Q+Q + RP I+D+  AL YL +Q    E
Sbjct  305  TLQGQFPMRGLYQALAVAAMCVQEQPTMRPLIADVVTALTYLASQTYDPE  354



>ref|XP_008789021.1| PREDICTED: serine/threonine-protein kinase PBS1-like isoform 
X2 [Phoenix dactylifera]
Length=396

 Score =   384 bits (986),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 197/290 (68%), Positives = 237/290 (82%), Gaps = 1/290 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDS-QSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG +DS   VVA+KQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  67   ATKNFRVDCLLGEGGFGRVYKGRLDSINQVVAIKQLDRNGLQGNREFLVEVLMLSLLHHP  126

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL +    K+ L+W  R+KIAAGAA+GLEYL
Sbjct  127  NLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDPSPDKKRLDWNTRMKIAAGAAKGLEYL  186

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLK SNILL E ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  187  HDKANPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  246

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLELITGRRA D+    GE NLV++ RP  KD+R+F +MADP
Sbjct  247  AMTGQLTLKSDVYSFGVVLLELITGRRAIDNSRAAGEHNLVAWARPLFKDRRKFPQMADP  306

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            +L+ ++ VR L+ A+A+ AMC+Q+Q + RP I+D+  A+ YL +Q    E
Sbjct  307  MLQGQYPVRGLYQALAVAAMCVQEQPTMRPLIADVVTAITYLASQTYNPE  356



>ref|XP_009404642.1| PREDICTED: serine/threonine-protein kinase PBS1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=385

 Score =   384 bits (985),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 195/286 (68%), Positives = 239/286 (84%), Gaps = 1/286 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S + +VA+KQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  67   ATKNFRADCLLGEGGFGRVYKGRLESSNQIVAIKQLDRNGLQGNREFLVEVLMLSLLHHP  126

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLV+L+GYC  GDQRLLVYEYMP GSLE+HL +L   K+ L+W  R+KIAAGAA+GLEYL
Sbjct  127  NLVSLIGYCADGDQRLLVYEYMPLGSLEDHLHDLSPDKKRLDWNTRMKIAAGAAKGLEYL  186

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  A+PPVIYRDLK SNILLDE ++P+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY
Sbjct  187  HDKASPPVIYRDLKCSNILLDEGYHPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  246

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSDIYSFGVVLLELITGRRA D+    GE NLV++ RP  KD+R+F ++ADP
Sbjct  247  AMTGQLTLKSDIYSFGVVLLELITGRRAIDNSRAAGEHNLVAWARPLFKDRRKFSQVADP  306

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
            +L+ ++  R L+ A+A+ AMC+Q+Q + RP I+D+  AL YL +Q 
Sbjct  307  VLQGQYPPRGLYQALAVAAMCVQEQPAMRPLIADVVTALTYLASQT  352



>ref|XP_002452162.1| hypothetical protein SORBIDRAFT_04g020990 [Sorghum bicolor]
 gb|EES05138.1| hypothetical protein SORBIDRAFT_04g020990 [Sorghum bicolor]
Length=512

 Score =   388 bits (996),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 198/285 (69%), Positives = 238/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQ-SVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+    LGEGGFG VYKG ++S   VVA+KQL+++GLQGN+EF+VEVLMLSLLHH 
Sbjct  111  ATRNFRPECFLGEGGFGRVYKGRLESTGQVVAIKQLNRDGLQGNREFLVEVLMLSLLHHQ  170

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP+GSLE+HL +L   KEAL+W  R+KIAAGAA+GLEYL
Sbjct  171  NLVNLIGYCADGDQRLLVYEYMPSGSLEDHLHDLPLDKEALDWNTRMKIAAGAAKGLEYL  230

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRD KSSNILLDE F+P+LSDFGLAKLGPVGD +HVSTRVMGTYGYCAPEY
Sbjct  231  HDKANPPVIYRDFKSSNILLDESFHPKLSDFGLAKLGPVGDKSHVSTRVMGTYGYCAPEY  290

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LT+KSD+YSFGVVLLELITGRRA DS    GEQNLVS+ RP   D+R+  +MADP
Sbjct  291  AMTGQLTVKSDVYSFGVVLLELITGRRAIDSTRPHGEQNLVSWARPLFNDRRKLPKMADP  350

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
             LE R+ +R L+ A+A+ +MC+Q +A+ RP I+D+  AL YL +Q
Sbjct  351  RLEGRYPMRGLYQALAVASMCIQSEAASRPLIADVVTALSYLASQ  395



>ref|XP_006381520.1| kinase family protein [Populus trichocarpa]
 gb|ERP59317.1| kinase family protein [Populus trichocarpa]
Length=393

 Score =   384 bits (985),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 196/297 (66%), Positives = 246/297 (83%), Gaps = 6/297 (2%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S + VVA+KQL++ GLQGN+EF+VEVLMLSLLHH 
Sbjct  78   ATKNFRAECLLGEGGFGRVYKGYLESTNQVVAIKQLNRNGLQGNREFLVEVLMLSLLHHP  137

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL E+  GK  L+W  R+KIAAGAA+GLE+L
Sbjct  138  NLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHEVPPGKNWLDWNTRMKIAAGAAKGLEHL  197

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  A+PPVIYRDLK SNILLDE ++P+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY
Sbjct  198  HDKASPPVIYRDLKCSNILLDESYHPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  257

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLE+ITGR+A D+    GEQNLV++ RP  KD+++F ++ADP
Sbjct  258  AMTGQLTLKSDVYSFGVVLLEIITGRKAIDNSKATGEQNLVAWARPLFKDRKKFSDIADP  317

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ-----AQTSERN  874
            +L+ ++  R L+ A+A+ AMC+Q+Q + RP I+D+  AL YL +Q     A+T +R+
Sbjct  318  MLQGQYPPRGLYQALAVAAMCVQEQPNMRPVIADVVTALTYLASQKYDPDAETGQRS  374



>ref|NP_196820.1| serine/threonine-protein kinase PBS1 [Arabidopsis thaliana]
 sp|Q9FE20.1|PBS1_ARATH RecName: Full=Serine/threonine-protein kinase PBS1; AltName: 
Full=AvrPphB susceptible protein 1 [Arabidopsis thaliana]
 gb|AAG38109.1|AF314176_1 protein serine/threonine kinase PBS1 [Arabidopsis thaliana]
 gb|AAK50067.1|AF372927_1 AT5g13160/T19L5_120 [Arabidopsis thaliana]
 emb|CAC05444.1| protein kinase-like [Arabidopsis thaliana]
 gb|AAL77738.1| AT5g13160/T19L5_120 [Arabidopsis thaliana]
 gb|ABR46066.1| avrPphB susceptible 1 [Arabidopsis thaliana]
 gb|ABR46068.1| avrPphB susceptible 1 [Arabidopsis thaliana]
 gb|ABR46069.1| avrPphB susceptible 1 [Arabidopsis thaliana]
 gb|ABR46070.1| avrPphB susceptible 1 [Arabidopsis thaliana]
 gb|ABR46071.1| avrPphB susceptible 1 [Arabidopsis thaliana]
 gb|ABR46072.1| avrPphB susceptible 1 [Arabidopsis thaliana]
 gb|ABR46073.1| avrPphB susceptible 1 [Arabidopsis thaliana]
 gb|ABR46074.1| avrPphB susceptible 1 [Arabidopsis thaliana]
 gb|ABR46075.1| avrPphB susceptible 1 [Arabidopsis thaliana]
 gb|ABR46076.1| avrPphB susceptible 1 [Arabidopsis thaliana]
 gb|ABR46077.1| avrPphB susceptible 1 [Arabidopsis thaliana]
 gb|ABR46078.1| avrPphB susceptible 1 [Arabidopsis thaliana]
 gb|ABR46079.1| avrPphB susceptible 1 [Arabidopsis thaliana]
 gb|ABR46080.1| avrPphB susceptible 1 [Arabidopsis thaliana]
 gb|ABR46081.1| avrPphB susceptible 1 [Arabidopsis thaliana]
 gb|ABR46082.1| avrPphB susceptible 1 [Arabidopsis thaliana]
 gb|ABR46084.1| avrPphB susceptible 1 [Arabidopsis thaliana]
 gb|ABR46085.1| avrPphB susceptible 1 [Arabidopsis thaliana]
 gb|AED91858.1| serine/threonine-protein kinase PBS1 [Arabidopsis thaliana]
Length=456

 Score =   386 bits (991),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 197/286 (69%), Positives = 236/286 (83%), Gaps = 1/286 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT NF     LGEGGFG VYKG +DS   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  82   ATMNFHPDTFLGEGGFGRVYKGRLDSTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  141

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KEAL+W  R+KIAAGAA+GLE+L
Sbjct  142  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEALDWNMRMKIAAGAAKGLEFL  201

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRD KSSNILLDE F+P+LSDFGLAKLGP GD +HVSTRVMGTYGYCAPEY
Sbjct  202  HDKANPPVIYRDFKSSNILLDEGFHPKLSDFGLAKLGPTGDKSHVSTRVMGTYGYCAPEY  261

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LT+KSD+YSFGVV LELITGR+A DS+   GEQNLV++ RP   D+R+F+++ADP
Sbjct  262  AMTGQLTVKSDVYSFGVVFLELITGRKAIDSEMPHGEQNLVAWARPLFNDRRKFIKLADP  321

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
             L+ RF  R+L+ A+A+ +MC+Q+QA+ RP I+D+  AL YL  QA
Sbjct  322  RLKGRFPTRALYQALAVASMCIQEQAATRPLIADVVTALSYLANQA  367



>ref|XP_009779569.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Nicotiana 
sylvestris]
Length=370

 Score =   383 bits (983),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 197/289 (68%), Positives = 239/289 (83%), Gaps = 1/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+   LLGEGGFG VYKGVI+S  VVA+KQLD+ GLQGN+EF+VEVLMLSLLHH N
Sbjct  63   ATKNFRGDYLLGEGGFGRVYKGVIESNQVVAIKQLDRNGLQGNREFLVEVLMLSLLHHPN  122

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYC  GDQRLLVYEYMP GSLE+HL +   GKE L+W  R+KIAAGAA+GLEYLH
Sbjct  123  LVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDPTPGKERLDWNTRMKIAAGAAKGLEYLH  182

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
             +A+PPVIYRDLK SNILL E ++ +LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  183  -SASPPVIYRDLKCSNILLGEGYHAKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  241

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+G+LTLKSD+YSFGVVLLE+ITGR+A +S    G+ NLV + RP  KD+R+F +MADP+
Sbjct  242  MTGQLTLKSDVYSFGVVLLEIITGRKAIESSKTGGDFNLVIWARPLFKDRRKFSQMADPM  301

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L+  + VR L+ A+A+ AMC+Q+Q + RP I+D+  AL YL +Q   +E
Sbjct  302  LQGHYPVRGLYQALAVAAMCVQEQPNMRPVIADVVTALTYLASQKFDTE  350



>gb|ABR46067.1| avrPphB susceptible 1 [Arabidopsis thaliana]
 gb|ABR46083.1| avrPphB susceptible 1 [Arabidopsis thaliana]
Length=456

 Score =   386 bits (991),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 197/286 (69%), Positives = 236/286 (83%), Gaps = 1/286 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT NF     LGEGGFG VYKG +DS   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  82   ATMNFHPDTFLGEGGFGRVYKGRLDSTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  141

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KEAL+W  R+KIAAGAA+GLE+L
Sbjct  142  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEALDWNMRMKIAAGAAKGLEFL  201

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRD KSSNILLDE F+P+LSDFGLAKLGP GD +HVSTRVMGTYGYCAPEY
Sbjct  202  HDKANPPVIYRDFKSSNILLDEGFHPKLSDFGLAKLGPTGDKSHVSTRVMGTYGYCAPEY  261

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LT+KSD+YSFGVV LELITGR+A DS+   GEQNLV++ RP   D+R+F+++ADP
Sbjct  262  AMTGQLTVKSDVYSFGVVFLELITGRKAIDSEMPHGEQNLVAWARPLFNDRRKFIKLADP  321

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
             L+ RF  R+L+ A+A+ +MC+Q+QA+ RP I+D+  AL YL  QA
Sbjct  322  RLKGRFPTRALYQALAVASMCIQEQAATRPLIADVVTALSYLANQA  367



>ref|XP_007162707.1| hypothetical protein PHAVU_001G173600g [Phaseolus vulgaris]
 gb|ESW34701.1| hypothetical protein PHAVU_001G173600g [Phaseolus vulgaris]
Length=355

 Score =   382 bits (981),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 194/285 (68%), Positives = 237/285 (83%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDS-QSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S   VVA+KQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  45   ATRNFRTECLLGEGGFGRVYKGRLESINQVVAIKQLDRNGLQGNREFLVEVLMLSLLHHP  104

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL ++  GK+ L W  R++IAAGAA+GLEYL
Sbjct  105  NLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDIPLGKKQLEWNTRMRIAAGAAKGLEYL  164

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLK SNILL E ++P+LSDFGLAKLGPVG+NTHVSTRVMGTYGYCAPEY
Sbjct  165  HDKANPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGENTHVSTRVMGTYGYCAPEY  224

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLE+ITGR+A D+    GEQNLV++ RP  +D+R+F +MADP
Sbjct  225  AMTGQLTLKSDVYSFGVVLLEIITGRKAIDNSKSAGEQNLVAWARPLFRDRRKFSQMADP  284

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
             L+ ++  R L+ A+A+ AMC+Q+QA+ RP I+D+  AL YL  Q
Sbjct  285  TLQGQYPPRGLYQALAVAAMCVQEQANMRPVIADVVTALSYLAKQ  329



>ref|XP_010907662.1| PREDICTED: serine/threonine-protein kinase PBS1-like isoform 
X2 [Elaeis guineensis]
Length=406

 Score =   384 bits (986),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 199/289 (69%), Positives = 238/289 (82%), Gaps = 1/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+    LGEGGFG VYKG ++S   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  24   ATKNFRPECFLGEGGFGRVYKGHLESTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  83

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL +L  GKE L+W  R+KIAAGAA+GLEYL
Sbjct  84   NLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDLPPGKEPLDWNTRMKIAAGAAKGLEYL  143

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRD KSSNILLDE F+P+LSDFGLAKLGPVGD +HVSTRVMGTYGYCAPEY
Sbjct  144  HDKANPPVIYRDFKSSNILLDEGFHPKLSDFGLAKLGPVGDKSHVSTRVMGTYGYCAPEY  203

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LT+KSD+YSFGVVLLELITGR+A DS    GEQNLVS+ RP   D+R+  ++ADP
Sbjct  204  AMTGQLTVKSDVYSFGVVLLELITGRKAIDSTRAHGEQNLVSWARPMFNDRRKLPKVADP  263

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTS  865
             L+ R+  R L+ A+A+ +MC+Q++A+ RP I+D+  AL YL +QA  S
Sbjct  264  KLQGRYPTRGLYQALAVASMCIQEEAASRPLIADVVTALAYLASQAYDS  312



>ref|XP_009342001.1| PREDICTED: serine/threonine-protein kinase PBS1 isoform X2 [Pyrus 
x bretschneideri]
Length=389

 Score =   383 bits (984),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 195/290 (67%), Positives = 239/290 (82%), Gaps = 1/290 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S + VVA+KQLD++GLQGN+EF+VEVLMLSLLHH 
Sbjct  72   ATRNFRSECLLGEGGFGRVYKGRLESTNQVVAIKQLDRDGLQGNREFLVEVLMLSLLHHP  131

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL GYC  GDQRLLVYEYMP GSL++HL ++  GK  L+W  R+KIAAGAA+GLEYL
Sbjct  132  NLVNLTGYCADGDQRLLVYEYMPLGSLDDHLHDVSPGKRRLDWNTRMKIAAGAAKGLEYL  191

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  A+PPVIYRDLK SNILL E ++P+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY
Sbjct  192  HDKASPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  251

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLE+ITGRRA D+    GEQNLV++ RP  KD+++F +MADP
Sbjct  252  AMTGQLTLKSDVYSFGVVLLEIITGRRAIDNTRGTGEQNLVAWARPLFKDRKKFSQMADP  311

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
             L+ ++  R L+ A+A+ AMC+Q+Q + RP I+D+  AL YL +Q    E
Sbjct  312  TLQGQYPPRGLYQALAVAAMCVQEQPNMRPVIADVVTALTYLASQKYDPE  361



>ref|NP_001237717.1| protein kinase-like protein [Glycine max]
 gb|ACM89575.1| protein kinase-like protein [Glycine max]
 gb|KHN39121.1| Serine/threonine-protein kinase PBS1 [Glycine soja]
Length=383

 Score =   383 bits (984),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 194/285 (68%), Positives = 238/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDS-QSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NFK   LLGEGGFG VYKG +++   +VA+KQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  73   ATRNFKAECLLGEGGFGRVYKGRLENINQIVAIKQLDRNGLQGNREFLVEVLMLSLLHHP  132

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+M  GSLE+HL ++  GK+ L+W  R+KIAAGAARGLEYL
Sbjct  133  NLVNLIGYCADGDQRLLVYEFMSLGSLEDHLHDISPGKKELDWNTRMKIAAGAARGLEYL  192

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLK SNILL E ++P+LSDFGLAKLGPVG+NTHVSTRVMGTYGYCAPEY
Sbjct  193  HDKANPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGENTHVSTRVMGTYGYCAPEY  252

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLE+ITGR+A D+    GEQNLV++ RP  KD+R+F +MADP
Sbjct  253  AMTGQLTLKSDVYSFGVVLLEIITGRKAIDNSKAAGEQNLVAWARPLFKDRRKFSQMADP  312

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            +L+ ++  R L+ A+A+ AMC+Q+QA+ RP I+D+  AL YL  Q
Sbjct  313  MLQGQYPSRGLYQALAVAAMCVQEQANMRPVIADVVTALSYLALQ  357



>ref|XP_007144514.1| hypothetical protein PHAVU_007G162300g [Phaseolus vulgaris]
 gb|ESW16508.1| hypothetical protein PHAVU_007G162300g [Phaseolus vulgaris]
Length=382

 Score =   383 bits (983),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 194/285 (68%), Positives = 239/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDS-QSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S   +VA+KQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  73   ATRNFRAECLLGEGGFGRVYKGRLESINQIVAIKQLDRNGLQGNREFLVEVLMLSLLHHP  132

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+M  GSLE+HL ++  GK+ L+W  R+KIAAGAARGLEYL
Sbjct  133  NLVNLIGYCADGDQRLLVYEFMSLGSLEDHLHDISPGKKQLDWNIRMKIAAGAARGLEYL  192

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLK SNILL E ++P+LSDFGLAKLGPVG+NTHVSTRVMGTYGYCAPEY
Sbjct  193  HDKANPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGENTHVSTRVMGTYGYCAPEY  252

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLE+ITGR+A D+    GEQNLV++ RP  KD+R+F +MADP
Sbjct  253  AMTGQLTLKSDVYSFGVVLLEIITGRKAIDNSRSAGEQNLVAWARPLFKDRRKFSQMADP  312

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            +L+ ++  R L+ A+A+ AMC+Q+QA+ RP I+D+  AL YL +Q
Sbjct  313  MLQGQYPSRGLYQALAVAAMCVQEQANMRPVIADVVTALSYLASQ  357



>ref|XP_006399804.1| hypothetical protein EUTSA_v10013511mg [Eutrema salsugineum]
 gb|ESQ41257.1| hypothetical protein EUTSA_v10013511mg [Eutrema salsugineum]
Length=454

 Score =   385 bits (990),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 197/286 (69%), Positives = 236/286 (83%), Gaps = 1/286 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT NF     LGEGGFG VYKG +DS   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  80   ATMNFHPDTFLGEGGFGRVYKGRLDSTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  139

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KEAL+W  R+KIAAGAA+GLE+L
Sbjct  140  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEALDWNMRMKIAAGAAKGLEFL  199

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRD KSSNILLDE F+P+LSDFGLAKLGP GD +HVSTRVMGTYGYCAPEY
Sbjct  200  HDKANPPVIYRDFKSSNILLDEGFHPKLSDFGLAKLGPTGDKSHVSTRVMGTYGYCAPEY  259

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LT+KSD+YSFGVV LELITGR+A DS+   GEQNLV++ RP   D+R+F+++ADP
Sbjct  260  AMTGQLTVKSDVYSFGVVFLELITGRKAIDSEMPHGEQNLVAWARPLFNDRRKFIKLADP  319

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
             L+ RF  R+L+ A+A+ +MC+Q+QA+ RP I+D+  AL YL  QA
Sbjct  320  KLKGRFPTRALYQALAVASMCIQEQAATRPLIADVVTALSYLANQA  365



>ref|NP_001149465.1| LOC100283091 [Zea mays]
 gb|ACG35533.1| protein kinase APK1A [Zea mays]
 gb|ACN28494.1| unknown [Zea mays]
 gb|AFW62443.1| putative protein kinase superfamily protein [Zea mays]
Length=518

 Score =   388 bits (996),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 198/285 (69%), Positives = 238/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+    LGEGGFG VYKG ++S   VVA+KQL+++GLQGN+EF+VEVLMLSLLHH 
Sbjct  111  ATRNFRPECFLGEGGFGRVYKGRLESTGQVVAIKQLNRDGLQGNREFLVEVLMLSLLHHQ  170

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP+GSLE+HL +L   KEAL+W  R+KIAAGAA+GLEYL
Sbjct  171  NLVNLIGYCADGDQRLLVYEYMPSGSLEDHLHDLPLDKEALDWNTRMKIAAGAAKGLEYL  230

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRD KSSNILLDE F+P+LSDFGLAKLGPVGD +HVSTRVMGTYGYCAPEY
Sbjct  231  HDKANPPVIYRDFKSSNILLDESFHPKLSDFGLAKLGPVGDKSHVSTRVMGTYGYCAPEY  290

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LT+KSD+YSFGVVLLELITGRRA DS    GEQNLVS+ RP   D+R+  +MADP
Sbjct  291  AMTGQLTVKSDVYSFGVVLLELITGRRAIDSTRPHGEQNLVSWARPLFNDRRKLPKMADP  350

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
             LE R+ +R L+ A+A+ +MC+Q +A+ RP I+D+  AL YL +Q
Sbjct  351  RLEGRYPMRGLYQALAVASMCIQSEAASRPLIADVVTALSYLASQ  395



>gb|KHN48337.1| Serine/threonine-protein kinase PBS1-like protein [Glycine soja]
Length=379

 Score =   383 bits (983),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 194/285 (68%), Positives = 238/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDS-QSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG +++   +VA+KQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  69   ATRNFRAECLLGEGGFGRVYKGRLENINQIVAIKQLDRNGLQGNREFLVEVLMLSLLHHP  128

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+M  GSLE+HL ++  GK+ L+W  R+KIAAGAARGLEYL
Sbjct  129  NLVNLIGYCADGDQRLLVYEFMSLGSLEDHLHDISPGKKRLDWNTRMKIAAGAARGLEYL  188

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLK SNILL E ++P+LSDFGLAKLGPVG+NTHVSTRVMGTYGYCAPEY
Sbjct  189  HDKANPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGENTHVSTRVMGTYGYCAPEY  248

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLE+ITGR+A D+    GEQNLV++ RP  KD+R+F +MADP
Sbjct  249  AMTGQLTLKSDVYSFGVVLLEIITGRKAIDNSKAAGEQNLVAWARPLFKDRRKFSQMADP  308

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            +L+ ++  R L  A+A+ AMC+Q+QAS RP I+D+  AL YL +Q
Sbjct  309  MLQGQYPPRGLFQALAVAAMCVQEQASMRPVIADVVTALSYLASQ  353



>ref|XP_007009661.1| Kinase superfamily protein [Theobroma cacao]
 gb|EOY18471.1| Kinase superfamily protein [Theobroma cacao]
Length=383

 Score =   383 bits (983),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 196/285 (69%), Positives = 238/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S + VVA+KQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  75   ATKNFRADCLLGEGGFGRVYKGRLESTNQVVAIKQLDRNGLQGNREFLVEVLMLSLLHHP  134

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL +L   K  L+W  R+KIAAGAA+GLEYL
Sbjct  135  NLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDLPPDKRQLDWNTRMKIAAGAAKGLEYL  194

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  A+PPVIYRDLK SNILL E ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  195  HDKASPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  254

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLE+ITGR+A D+    GEQNLV++ RP  KD+R+F +MADP
Sbjct  255  AMTGQLTLKSDVYSFGVVLLEIITGRKAIDNSRAGGEQNLVAWARPLFKDRRKFAQMADP  314

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+ ++ VR L+ A+A+ AMC+Q+Q + RP I+D+  AL YL +Q
Sbjct  315  LLQGQYPVRGLYQALAVAAMCVQEQPNMRPLIADVVTALTYLASQ  359



>ref|XP_004246710.1| PREDICTED: serine/threonine-protein kinase PBS1 [Solanum lycopersicum]
Length=391

 Score =   383 bits (984),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 193/289 (67%), Positives = 238/289 (82%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+   LLGEGGFG VYKG +DS  +VA+KQLD+ GLQGN+EF+VEVLMLSLLHH N
Sbjct  69   ATRNFRGDCLLGEGGFGRVYKGRLDSNQIVAIKQLDRNGLQGNREFLVEVLMLSLLHHPN  128

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL GYC  GDQRLLVYEYMP GSL++HL +L  GK+ L+W  R+KIAAGAA+GLEYLH
Sbjct  129  LVNLTGYCADGDQRLLVYEYMPLGSLDDHLHDLTPGKKVLDWNTRMKIAAGAAKGLEYLH  188

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
              A+PPVIYRDLK SNILL E ++P+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  189  DRASPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  248

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+G+LTLKSD+YSFGVVLLE+ITGR+A +     GE NLV++ +P  +D+R+F +MADP+
Sbjct  249  MTGQLTLKSDVYSFGVVLLEIITGRKAIEFSKTGGEHNLVAWAKPLFRDRRKFSQMADPM  308

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L+ ++  R L+ A+A+ AMC+Q+Q + RP I+D+  AL YL AQ   S+
Sbjct  309  LQGQYPERGLYQALAVAAMCVQEQPNMRPVIADVVTALSYLAAQKFDSD  357



>ref|XP_010682694.1| PREDICTED: serine/threonine-protein kinase PBS1 [Beta vulgaris 
subsp. vulgaris]
Length=494

 Score =   387 bits (993),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 195/291 (67%), Positives = 235/291 (81%), Gaps = 0/291 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF++   LGEGGFG VYKG +++  VVAVKQLD+ GLQGN+EF+VEVLMLSLLH  N
Sbjct  82   ATKNFRDECFLGEGGFGRVYKGRLETGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHQPN  141

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYC  GDQRLLVYEYM  GSLE+HL +L   KE L+W  R+KIAAGAA+GLEYLH
Sbjct  142  LVNLIGYCADGDQRLLVYEYMALGSLEDHLHDLPPDKEPLDWNTRMKIAAGAAKGLEYLH  201

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
              ANPPVIYRD KSSNILLDE F P+LSDFGLAKLGP GD +HVSTRVMGTYGYCAPEYA
Sbjct  202  DKANPPVIYRDFKSSNILLDEGFQPKLSDFGLAKLGPTGDKSHVSTRVMGTYGYCAPEYA  261

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+G+LT+KSD+YSFGVV LELITGRRA DSD   GEQNLV++ RP   D+R+F+++ADP 
Sbjct  262  MTGQLTVKSDVYSFGVVFLELITGRRAIDSDRPHGEQNLVAWARPLFNDRRKFLKLADPR  321

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSERN  874
            L+ +F  R L+ A+A+ +MC+Q+ A+ RP I D+  AL YL  QA   +R+
Sbjct  322  LQGKFPTRGLYQALAVASMCIQENAAARPLIGDVVTALSYLANQAYDKDRS  372



>ref|XP_009774239.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Nicotiana 
sylvestris]
Length=390

 Score =   383 bits (984),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 192/284 (68%), Positives = 236/284 (83%), Gaps = 0/284 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            A +NF+   LLGEGGFG VYKG +DS  +VA+KQLD+ GLQGN+EF+VEVLMLSLLHH N
Sbjct  67   AARNFRGDCLLGEGGFGRVYKGRLDSNQIVAIKQLDRNGLQGNREFLVEVLMLSLLHHPN  126

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYC  GDQRLLVYEYMP GSL++HL +L   K+ L+W  R+KIAAGAA+GLEYLH
Sbjct  127  LVNLIGYCADGDQRLLVYEYMPLGSLDDHLHDLTPAKKVLDWNTRMKIAAGAAKGLEYLH  186

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
              A+PPVIYRDLK SNILL E ++P+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  187  DKASPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  246

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+G+LTLKSD+YSFGVVLLE+ITGR+A +S    GE NLV++ RP  K++R+F +MADP+
Sbjct  247  MTGQLTLKSDVYSFGVVLLEIITGRKAIESSKTGGEHNLVAWARPLFKERRKFSQMADPV  306

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            L+ ++ VR L+ A+A+ AMC+ +Q + RP I+D+  AL YL AQ
Sbjct  307  LQGQYPVRGLYQALAVAAMCVHEQPNMRPVIADVVTALSYLAAQ  350



>ref|XP_002975807.1| hypothetical protein SELMODRAFT_103605 [Selaginella moellendorffii]
 gb|EFJ23436.1| hypothetical protein SELMODRAFT_103605 [Selaginella moellendorffii]
Length=478

 Score =   386 bits (992),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 199/284 (70%), Positives = 234/284 (82%), Gaps = 0/284 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+   +LGEGGFG VYKG +DS  VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH N
Sbjct  70   ATKNFRPECMLGEGGFGRVYKGRLDSGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHPN  129

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYC  GDQRLLVYE+M  GSLE+HL ++ A KE L W  R+KIAAGAARGLEYLH
Sbjct  130  LVNLIGYCADGDQRLLVYEFMQLGSLEDHLHDVPADKEPLGWNTRMKIAAGAARGLEYLH  189

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
              ANPPVIYRD KSSNILL E  +P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  190  DKANPPVIYRDFKSSNILLGEGHHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEYA  249

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+G+LTLKSD+YSFGVVLLELITGR+A D+    GE NLV++ RP  KD+R+F  MADPL
Sbjct  250  MTGQLTLKSDVYSFGVVLLELITGRKAIDNARPAGEHNLVAWARPLFKDRRKFPSMADPL  309

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            L+  + +R L+ A+A+ AMCLQ+QA+ RP I D+  AL+YL +Q
Sbjct  310  LQGHYPMRGLYQALAVAAMCLQEQATTRPHIGDVVTALNYLASQ  353



>ref|XP_003575029.2| PREDICTED: serine/threonine-protein kinase PBS1-like [Brachypodium 
distachyon]
Length=527

 Score =   388 bits (996),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 197/286 (69%), Positives = 240/286 (84%), Gaps = 1/286 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF++   LGEGGFG VYKG ++S   VVA+KQL+++GLQGN+EF+VEVLMLSLLHH 
Sbjct  119  ATRNFRQECFLGEGGFGRVYKGRMESTGQVVAIKQLNRDGLQGNREFLVEVLMLSLLHHQ  178

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLV+L+GYC  GDQRLLVYEYMP GSLE+HL +L   KEAL+W +R+KIAAGAA+GLEYL
Sbjct  179  NLVSLIGYCADGDQRLLVYEYMPFGSLEDHLHDLPIDKEALDWSSRMKIAAGAAKGLEYL  238

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRD KSSNILLDE F+P+LSDFGLAKLGPVGD +HVSTRVMGTYGYCAPEY
Sbjct  239  HDKANPPVIYRDFKSSNILLDESFHPKLSDFGLAKLGPVGDKSHVSTRVMGTYGYCAPEY  298

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LT+KSD+YSFGVVLLELITGRRA DS    GEQNLVS+ RP   D+R+  +MADP
Sbjct  299  AMTGQLTVKSDVYSFGVVLLELITGRRAIDSTRPHGEQNLVSWARPLFNDRRKLPKMADP  358

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
             LE R+ +R L+ A+A+ +MC+Q +A+ RP I+D+  AL YL +Q+
Sbjct  359  RLEGRYPMRGLYQALAVASMCIQSEAASRPLIADVVTALSYLASQS  404



>gb|KFK42057.1| hypothetical protein AALP_AA2G205800 [Arabis alpina]
Length=386

 Score =   383 bits (983),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 192/289 (66%), Positives = 237/289 (82%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF++ N++G+GGFGSVYKG + S  VVA+KQL+ +G QGNQEFIVEVLMLS+ HH N
Sbjct  76   ATKNFRDGNMIGKGGFGSVYKGRLYSGQVVAIKQLNPDGHQGNQEFIVEVLMLSVFHHPN  135

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYCT G QRLLVYEYMP GSLE+HLF+LE  +  LNW  R+KIA GAARG+EYLH
Sbjct  136  LVNLIGYCTSGAQRLLVYEYMPMGSLEDHLFDLEPDQSPLNWNTRMKIAVGAARGIEYLH  195

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C  +P VIYRDLK +NILLD +F+P+LSDFGLAK+GP+G+ THVSTRVMGTYGYCAPEYA
Sbjct  196  CKISPSVIYRDLKPANILLDRDFHPKLSDFGLAKVGPIGNRTHVSTRVMGTYGYCAPEYA  255

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSGKLT+KSDIYSFGVVLLELITGR+A D     GEQ LV++ RP++KD ++F  +ADPL
Sbjct  256  MSGKLTIKSDIYSFGVVLLELITGRKAIDLSKPNGEQYLVAWARPYIKDPKKFGLLADPL  315

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L  +FS R L +A+AI  MCL ++A+ RP I D+ +A +YL AQ++  E
Sbjct  316  LGGKFSKRCLSYAIAIIEMCLNEEANRRPKIGDVVVAFEYLAAQSKVRE  364



>ref|XP_010921747.1| PREDICTED: serine/threonine-protein kinase CDL1 isoform X1 [Elaeis 
guineensis]
Length=505

 Score =   387 bits (994),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 197/284 (69%), Positives = 235/284 (83%), Gaps = 0/284 (0%)
 Frame = +2

Query  5    TQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnnl  184
            TQNF+    LGEGGFG VYKG +++  VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH NL
Sbjct  84   TQNFRADCFLGEGGFGRVYKGRLENGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHPNL  143

Query  185  vnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLHC  364
            VNL+GYC  GDQRLLVYE+MP GSLE+HL +L + KE L+W  R+KIAAGAA+GLEYLH 
Sbjct  144  VNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPSDKEPLDWNTRMKIAAGAAKGLEYLHD  203

Query  365  TANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYAM  544
             ANPPVIYRD KSSNILL E ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYAM
Sbjct  204  KANPPVIYRDFKSSNILLGEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEYAM  263

Query  545  SGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPLL  724
            +G+LT+KSD+YSFGVV LELITGR+A D+    GEQNLV++ RP  KD+R+F +MADPLL
Sbjct  264  TGQLTVKSDVYSFGVVFLELITGRKAIDNTRPAGEQNLVAWARPLFKDRRKFPKMADPLL  323

Query  725  ERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
            +  + VR L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q 
Sbjct  324  QGHYPVRGLYQALAVAAMCLQEQAATRPLIGDVVTALSYLASQG  367



>ref|XP_008796224.1| PREDICTED: serine/threonine-protein kinase PBS1-like isoform 
X2 [Phoenix dactylifera]
Length=486

 Score =   386 bits (992),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 195/284 (69%), Positives = 237/284 (83%), Gaps = 0/284 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+   L+GEGGFG VYKG +++  VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH N
Sbjct  62   ATKNFRADCLVGEGGFGRVYKGRLENGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHPN  121

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYC  GDQRLLVYE+MP GSLE+HL ++   KE L+W  R+KIAAGAA+GLEYLH
Sbjct  122  LVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDIPPDKEPLDWNTRMKIAAGAAKGLEYLH  181

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
              ANPPVIYRD KSSNILL E ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  182  DKANPPVIYRDFKSSNILLGEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEYA  241

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+G+LT+KSD+YSFGVV LELITGR+A D+    GEQNLV++ RP  +D+R+F +MADPL
Sbjct  242  MTGQLTVKSDVYSFGVVFLELITGRKAIDNTRPDGEQNLVAWARPLFRDRRKFPKMADPL  301

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            L+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  302  LQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALSYLASQ  345



>ref|XP_007160596.1| hypothetical protein PHAVU_001G000900g [Phaseolus vulgaris]
 gb|ESW32590.1| hypothetical protein PHAVU_001G000900g [Phaseolus vulgaris]
Length=351

 Score =   381 bits (979),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 198/293 (68%), Positives = 234/293 (80%), Gaps = 6/293 (2%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQL--DQEGLQGNQEFIVEvlmlsllhh  175
            A + FKE NL+GEGGFG VYK  I +  +VA+KQL  D E  QGN+EF+ EVLMLSLLHH
Sbjct  42   AARGFKEENLIGEGGFGKVYKARISTSQLVAIKQLRLDGESHQGNREFVTEVLMLSLLHH  101

Query  176  nnlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEY  355
            +NLV L GYCTHGDQRLLVYEYM  GSLE +L +    K  L W NRLKI  GAARGL+Y
Sbjct  102  SNLVKLFGYCTHGDQRLLVYEYMAMGSLEQYLSQ----KNPLGWRNRLKIGVGAARGLQY  157

Query  356  LHCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPE  535
            LHC ANPPVIYRDLKS+NILLD   +P+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPE
Sbjct  158  LHCVANPPVIYRDLKSANILLDNNLHPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPE  217

Query  536  YAMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMAD  715
            YAMSGKLTLKSDIY FGVVLLELITGR+A D   K  EQ+LV++ RP+L D+R+  ++ D
Sbjct  218  YAMSGKLTLKSDIYCFGVVLLELITGRKAMDVTRKQREQSLVAWARPYLSDRRKVSQIVD  277

Query  716  PLLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSERN  874
            PLLE R+ +R L +AVAITAMCLQ+Q + RP+I+DI +AL+YL +++    R+
Sbjct  278  PLLEGRYPLRCLQNAVAITAMCLQEQPNLRPSITDIVVALEYLASESSEVVRH  330



>dbj|BAK00146.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=486

 Score =   386 bits (992),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 194/284 (68%), Positives = 237/284 (83%), Gaps = 0/284 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF++  +LGEGGFG VYKG +++   VAVKQLD+ GLQGN+EF+VEVLMLSLLHH N
Sbjct  78   ATKNFRQDCMLGEGGFGRVYKGRLENGQAVAVKQLDRNGLQGNREFLVEVLMLSLLHHTN  137

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYC  GDQRLLVYE+MP GSLE+HL ++   KE L+W  R+KIAAGAA+GLE+LH
Sbjct  138  LVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDVPPEKEPLDWNTRMKIAAGAAKGLEHLH  197

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
              A+PPVIYRD KSSNILL E F+P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  198  DKASPPVIYRDFKSSNILLGEGFHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEYA  257

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+G+LT+KSD+YSFGVV LELITGR+A D+    GEQNLV++ RP  KD+R+F +MADP+
Sbjct  258  MTGQLTVKSDVYSFGVVFLELITGRKAIDNTKPQGEQNLVAWARPLFKDRRKFPKMADPM  317

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            L+ RF +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  318  LQGRFPMRGLYQALAVAAMCLQEQATTRPHIGDVVTALSYLASQ  361



>ref|XP_007223158.1| hypothetical protein PRUPE_ppa004394mg [Prunus persica]
 gb|EMJ24357.1| hypothetical protein PRUPE_ppa004394mg [Prunus persica]
Length=512

 Score =   387 bits (994),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 200/285 (70%), Positives = 237/285 (83%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  81   ATKNFRAECLLGEGGFGRVYKGRLESTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  140

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +  +  E L+W  R+KIAAGAA+GLEYL
Sbjct  141  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDFPSDNEPLDWNTRMKIAAGAAKGLEYL  200

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILLDE F+P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  201  HDKANPPVIYRDLKSSNILLDEGFHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  260

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+    GE NLV++ RP  KD+R+F +MADP
Sbjct  261  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNTRGHGEHNLVAWARPLFKDRRKFPKMADP  320

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  321  LLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQ  365



>emb|CDX88927.1| BnaA03g07220D [Brassica napus]
Length=444

 Score =   385 bits (988),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 198/285 (69%), Positives = 236/285 (83%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S   +VAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  81   ATKNFRPECLLGEGGFGRVYKGRLESTGQIVAVKQLDRNGLQGNREFLVEVLMLSLLHHT  140

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYM  GSLE+HL +L  GKE L+W  R+ IAAGAA+GLEYL
Sbjct  141  NLVNLIGYCADGDQRLLVYEYMALGSLEDHLHDLPPGKEPLDWNTRMTIAAGAAKGLEYL  200

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILL + ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  201  HDKANPPVIYRDLKSSNILLGDGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  260

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+   PGE NLV++ RP  KD+R+F +MADP
Sbjct  261  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNARAPGEHNLVAWARPLFKDRRKFPKMADP  320

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
             L+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  321  SLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQ  365



>gb|AAT58829.1| putative serine/threonine protein kinase [Oryza sativa Japonica 
Group]
Length=491

 Score =   386 bits (992),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 196/284 (69%), Positives = 237/284 (83%), Gaps = 0/284 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF++  LLGEGGFG VYKG +++   VAVKQLD+ GLQGN+EF+VEVLMLSLLHH+N
Sbjct  76   ATKNFRQDCLLGEGGFGRVYKGHLENGQAVAVKQLDRNGLQGNREFLVEVLMLSLLHHDN  135

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYC  GDQRLLVYE+MP GSLE+HL ++   KE L+W  R+KIAAGAA+GLE+LH
Sbjct  136  LVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDIPPDKEPLDWNTRMKIAAGAAKGLEFLH  195

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
              ANPPVIYRD KSSNILL E ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  196  DKANPPVIYRDFKSSNILLGEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEYA  255

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+G+LT+KSD+YSFGVV LELITGR+A D+    GEQNLV++ RP  KD+R+F +MADPL
Sbjct  256  MTGQLTVKSDVYSFGVVFLELITGRKAIDNTKPLGEQNLVAWARPLFKDRRKFPKMADPL  315

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            L  RF +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  316  LAGRFPMRGLYQALAVAAMCLQEQAATRPFIGDVVTALSYLASQ  359



>ref|XP_002316332.2| hypothetical protein POPTR_0010s22220g [Populus trichocarpa]
 gb|EEF02503.2| hypothetical protein POPTR_0010s22220g [Populus trichocarpa]
Length=372

 Score =   382 bits (981),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 194/285 (68%), Positives = 238/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S + VVA+KQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  63   ATKNFRADCLLGEGGFGRVYKGRLESTNQVVAIKQLDRNGLQGNREFLVEVLMLSLLHHP  122

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL +L   K+ L+W  R+K+AAGAA+GLEYL
Sbjct  123  NLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDLPPDKKRLDWNTRMKVAAGAAKGLEYL  182

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H +ANPPVIYRDLK SNILL E ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  183  HDSANPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGDETHVSTRVMGTYGYCAPEY  242

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLE+ITGR+A D+    GE NLV++ RP  KD+R+F +MADP
Sbjct  243  AMTGQLTLKSDVYSFGVVLLEIITGRKAIDNSRAAGEHNLVAWARPLFKDRRKFAQMADP  302

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+  + +R L+ A+A+ AMC+Q+Q + RP I+D+  AL YL +Q
Sbjct  303  LLQGHYPMRGLYQALAVAAMCVQEQPNMRPLIADVVTALSYLASQ  347



>ref|XP_011027057.1| PREDICTED: serine/threonine-protein kinase CDL1-like isoform 
X2 [Populus euphratica]
Length=338

 Score =   380 bits (977),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 194/290 (67%), Positives = 239/290 (82%), Gaps = 1/290 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S + VVA+KQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  30   ATKNFRADCLLGEGGFGRVYKGRLESTNQVVAIKQLDRNGLQGNREFLVEVLMLSLLHHP  89

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL +L   K+ L+W  R+K+AAGAA+GLE+L
Sbjct  90   NLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDLPPDKKRLDWNTRMKVAAGAAKGLEHL  149

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H +ANPPVIYRDLK SNILL E ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  150  HDSANPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  209

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLE+ITGR+A D+    GE NLV++ RP  KD+R+F +MADP
Sbjct  210  AMTGQLTLKSDVYSFGVVLLEIITGRKAIDNSRAAGEHNLVAWARPLFKDRRKFAQMADP  269

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            LL+  + +R L+ A+A+ AMC+Q+Q + RP I+D+  AL YL +Q    E
Sbjct  270  LLQGHYPMRGLYQALAVAAMCVQEQPNMRPLIADVVTALSYLASQKYDPE  319



>ref|XP_007147876.1| hypothetical protein PHAVU_006G162400g [Phaseolus vulgaris]
 gb|ESW19870.1| hypothetical protein PHAVU_006G162400g [Phaseolus vulgaris]
Length=513

 Score =   387 bits (993),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 199/285 (70%), Positives = 237/285 (83%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VY+G ++S    VAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  89   ATKNFRPECLLGEGGFGRVYRGRLESTGQAVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  148

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KE L+W  R+KIAAGAA+GLEYL
Sbjct  149  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEPLDWNTRMKIAAGAAKGLEYL  208

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILLDE ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  209  HDKANPPVIYRDLKSSNILLDEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  268

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+    GE NLV++ RP  KD+R+F +MADP
Sbjct  269  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNTRAHGEHNLVAWARPLFKDRRKFPKMADP  328

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            LL+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  329  LLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQ  373



>ref|XP_009341993.1| PREDICTED: serine/threonine-protein kinase PBS1 isoform X1 [Pyrus 
x bretschneideri]
Length=393

 Score =   382 bits (982),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 195/290 (67%), Positives = 239/290 (82%), Gaps = 1/290 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S + VVA+KQLD++GLQGN+EF+VEVLMLSLLHH 
Sbjct  76   ATRNFRSECLLGEGGFGRVYKGRLESTNQVVAIKQLDRDGLQGNREFLVEVLMLSLLHHP  135

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL GYC  GDQRLLVYEYMP GSL++HL ++  GK  L+W  R+KIAAGAA+GLEYL
Sbjct  136  NLVNLTGYCADGDQRLLVYEYMPLGSLDDHLHDVSPGKRRLDWNTRMKIAAGAAKGLEYL  195

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  A+PPVIYRDLK SNILL E ++P+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY
Sbjct  196  HDKASPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  255

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLE+ITGRRA D+    GEQNLV++ RP  KD+++F +MADP
Sbjct  256  AMTGQLTLKSDVYSFGVVLLEIITGRRAIDNTRGTGEQNLVAWARPLFKDRKKFSQMADP  315

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
             L+ ++  R L+ A+A+ AMC+Q+Q + RP I+D+  AL YL +Q    E
Sbjct  316  TLQGQYPPRGLYQALAVAAMCVQEQPNMRPVIADVVTALTYLASQKYDPE  365



>ref|XP_002973759.1| hypothetical protein SELMODRAFT_99936 [Selaginella moellendorffii]
 gb|EFJ25419.1| hypothetical protein SELMODRAFT_99936 [Selaginella moellendorffii]
Length=480

 Score =   385 bits (990),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 199/284 (70%), Positives = 234/284 (82%), Gaps = 0/284 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+   +LGEGGFG VYKG +DS  VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH N
Sbjct  72   ATKNFRPECMLGEGGFGRVYKGRLDSGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHPN  131

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYC  GDQRLLVYE+M  GSLE+HL ++ A KE L W  R+KIAAGAARGLEYLH
Sbjct  132  LVNLIGYCADGDQRLLVYEFMQLGSLEDHLHDVPADKEPLGWNTRMKIAAGAARGLEYLH  191

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
              ANPPVIYRD KSSNILL E  +P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEYA
Sbjct  192  DKANPPVIYRDFKSSNILLGEGHHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEYA  251

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+G+LTLKSD+YSFGVVLLELITGR+A D+    GE NLV++ RP  KD+R+F  MADPL
Sbjct  252  MTGQLTLKSDVYSFGVVLLELITGRKAIDNARPAGEHNLVAWARPLFKDRRKFPSMADPL  311

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            L+  + +R L+ A+A+ AMCLQ+QA+ RP I D+  AL+YL +Q
Sbjct  312  LQGHYPMRGLYQALAVAAMCLQEQANTRPLIGDVVTALNYLASQ  355



>ref|XP_004163074.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein kinase 
PBS1-like [Cucumis sativus]
Length=362

 Score =   381 bits (979),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 196/290 (68%), Positives = 238/290 (82%), Gaps = 1/290 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDS-QSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+ F+   LLGEGGFG VYKG ++S   VVA+KQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  52   ATKYFRADCLLGEGGFGQVYKGRLESINQVVAIKQLDRNGLQGNREFLVEVLMLSLLHHP  111

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL +L   K+ L+W  R+KIAAGAA+GLEYL
Sbjct  112  NLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDLPPDKKRLDWNTRMKIAAGAAKGLEYL  171

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLK SNILL E+++P+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY
Sbjct  172  HDKANPPVIYRDLKCSNILLGEDYHPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  231

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLE+ITGR+A D+    GE NLV++ +P  KD+R+F +MADP
Sbjct  232  AMTGQLTLKSDVYSFGVVLLEIITGRKAIDNSRAAGEHNLVAWAQPLFKDRRKFSQMADP  291

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            LL+ ++ VR L+ A+A+ AMC+Q+Q   RP I+D+  AL YL +Q    E
Sbjct  292  LLQGQYPVRGLYQALAVAAMCVQEQPHMRPLIADVVTALTYLASQKYDPE  341



>ref|XP_010931807.1| PREDICTED: serine/threonine-protein kinase CDL1 [Elaeis guineensis]
Length=420

 Score =   384 bits (985),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 193/283 (68%), Positives = 233/283 (82%), Gaps = 1/283 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVI-DSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NFK   LLGEGGFG VYKG + D+   +AVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  75   ATKNFKAECLLGEGGFGRVYKGHLEDTNQDIAVKQLDRNGLQGNREFLVEVLMLSLLHHP  134

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYCT GD R+LVYEYMPNGSLE+HL +L   K+ L+W  R+KIA GAA+GLEYL
Sbjct  135  NLVNLIGYCTDGDHRILVYEYMPNGSLEDHLLDLAPNKKPLDWNTRMKIAEGAAKGLEYL  194

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRD K+SNILLDE ++P+LSDFGLAK+GP+GD +HVSTRVMGTYGYCAPEY
Sbjct  195  HDIANPPVIYRDFKASNILLDENYSPKLSDFGLAKVGPIGDKSHVSTRVMGTYGYCAPEY  254

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            A++G+LT  SD+YSFGVV LE+ITGRRA D+     EQNLV +  P  KDK+RFVEMADP
Sbjct  255  ALTGQLTTMSDVYSFGVVFLEIITGRRAIDTSRPSNEQNLVQWAEPLFKDKKRFVEMADP  314

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLV  847
            LLE  + V+ L+ A+A+ AMCLQ++AS RP I+D+  AL+YLV
Sbjct  315  LLEGNYPVKGLYQALAVAAMCLQEEASSRPLITDVVTALEYLV  357



>ref|XP_004137797.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Cucumis 
sativus]
 ref|XP_004166605.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Cucumis 
sativus]
Length=395

 Score =   382 bits (982),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 194/285 (68%), Positives = 237/285 (83%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDS-QSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S   VVA+KQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  67   ATRNFRADCLLGEGGFGRVYKGKLESINQVVAIKQLDRNGLQGNREFLVEVLMLSLLHHP  126

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLL+YEYMP GSL++HL ++  G + ++W  R++IAAGAARGLEYL
Sbjct  127  NLVNLIGYCADGDQRLLIYEYMPLGSLDDHLHDISPGTKFIDWNTRMRIAAGAARGLEYL  186

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  A+PPVIYRDLKSSNILLD+ ++P+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY
Sbjct  187  HDKASPPVIYRDLKSSNILLDKGYHPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  246

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLE+ITGR+A D     GEQNLVS+ RP  KD+ RF +MADP
Sbjct  247  AMTGQLTLKSDVYSFGVVLLEIITGRKAIDDSKAAGEQNLVSWARPLFKDRLRFAQMADP  306

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            +L  ++  R L+ A+AI AMC+Q+Q + RP I+D+  AL YL +Q
Sbjct  307  MLRGQYPSRGLYQALAIAAMCVQEQPNMRPVIADVVTALSYLASQ  351



>ref|XP_010645824.1| PREDICTED: serine/threonine-protein kinase CDL1-like isoform 
X2 [Vitis vinifera]
Length=292

 Score =   379 bits (972),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 191/276 (69%), Positives = 225/276 (82%), Gaps = 0/276 (0%)
 Frame = +2

Query  41   GGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnnlvnlmGYCTHGDQ  220
            G FGS  +       +VA+K L+ EG+QG+QEFI+EVL+LSLL H+NLV L+GYCT GDQ
Sbjct  2    GLFGSQERMKGKEGKIVAIKWLNHEGIQGSQEFIMEVLLLSLLRHSNLVCLIGYCTDGDQ  61

Query  221  RLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLHCTANPPVIYRDLK  400
            RLLVYEYMP GSLE+HLF++   K  L W  R+KIA G ARGLEYLHC ANPPVIYRDLK
Sbjct  62   RLLVYEYMPMGSLEDHLFDVGPNKAPLEWNTRMKIAVGTARGLEYLHCKANPPVIYRDLK  121

Query  401  SSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYAMSGKLTLKSDIYS  580
            S+NILLD +F+P+LSDFGLAK GPVGDNTHV+TRVMGT+GYCAPEYAMSGKLTLKSD+YS
Sbjct  122  SANILLDNDFHPKLSDFGLAKFGPVGDNTHVTTRVMGTHGYCAPEYAMSGKLTLKSDVYS  181

Query  581  FGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPLLERRFSVRSLHHA  760
            FGVVLLELITGR A DS    GEQNLV++ RP  KD+RRF ++ DPLL  RF VR LHHA
Sbjct  182  FGVVLLELITGRMAIDSTRLQGEQNLVNWARPLFKDRRRFSQLVDPLLRGRFPVRCLHHA  241

Query  761  VAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            +AITAMCLQ+QA++RP ISD+ +AL+YL +Q    E
Sbjct  242  IAITAMCLQEQATYRPLISDVLVALEYLASQPYNPE  277



>ref|XP_004249609.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Solanum 
lycopersicum]
Length=371

 Score =   381 bits (979),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 195/284 (69%), Positives = 237/284 (83%), Gaps = 1/284 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+   LLGEGGFG VYKGVI+S  VVA+KQLD+ GLQGN+EF+VEVLMLSLLHH N
Sbjct  63   ATKNFRGDYLLGEGGFGRVYKGVIESNQVVAIKQLDRNGLQGNREFLVEVLMLSLLHHPN  122

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYC  GDQRLLVYEYMP GSLE+HL +   GKE L+W  R+KIAAGAA+GLEYLH
Sbjct  123  LVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDPTPGKERLDWNTRMKIAAGAAKGLEYLH  182

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
             +A+PPVIYRDLK SNILL E ++ +LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  183  -SASPPVIYRDLKCSNILLGEGYHAKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  241

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+G+LTLKSD+YSFGVVLLE+ITGR+A +S    G+ NLV + RP  KD+R+F +MADP+
Sbjct  242  MTGQLTLKSDVYSFGVVLLEIITGRKAIESSKTGGDFNLVIWARPLFKDRRKFSQMADPM  301

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            L+  + VR ++ A+A+ AMC+Q+Q + RP I+D+  AL YL +Q
Sbjct  302  LQGHYPVRGMYQALAVAAMCVQEQPNMRPVIADVVTALTYLASQ  345



>ref|XP_001769585.1| predicted protein [Physcomitrella patens]
 gb|EDQ65578.1| predicted protein [Physcomitrella patens]
Length=441

 Score =   384 bits (986),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 199/294 (68%), Positives = 236/294 (80%), Gaps = 10/294 (3%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS----------VVAVKQLDQEGLQGNQEFIVEv  151
            AT+NF+   LLGEGGFG VYKG +++            VVAVKQLD+ GLQGN+EF+VEV
Sbjct  84   ATKNFRPECLLGEGGFGRVYKGRLENTGQARVLSGWLQVVAVKQLDRNGLQGNREFLVEV  143

Query  152  lmlsllhhnnlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAA  331
            LMLSLLHH NLV+L+GYC  GDQRLLVYE+MP G LE+HL +L   KE L+W  R+KIAA
Sbjct  144  LMLSLLHHPNLVSLIGYCADGDQRLLVYEFMPLGCLEDHLHDLPQDKECLDWNTRMKIAA  203

Query  332  GAARGLEYLHCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMG  511
            GAARGLEYLH  ANPPVIYRD KSSNILLDE F+P+LSDFGLAKLGPVGD THVSTRVMG
Sbjct  204  GAARGLEYLHDKANPPVIYRDFKSSNILLDEGFHPKLSDFGLAKLGPVGDKTHVSTRVMG  263

Query  512  TYGYCAPEYAMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDK  691
            TYGYCAPEYAM+G+LTLKSD+YSFGVVLLELITGR+A D+    GE NLV++ RP  KD+
Sbjct  264  TYGYCAPEYAMTGQLTLKSDVYSFGVVLLELITGRKAIDNSRAAGEHNLVAWARPLFKDR  323

Query  692  RRFVEMADPLLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            R+F  MADP+L+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  324  RKFPSMADPMLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALSYLASQ  377



>ref|XP_011010693.1| PREDICTED: serine/threonine-protein kinase CDL1-like isoform 
X2 [Populus euphratica]
Length=372

 Score =   381 bits (979),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 196/290 (68%), Positives = 237/290 (82%), Gaps = 1/290 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S S VVA+KQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  63   ATKNFRADCLLGEGGFGRVYKGRLESTSQVVAIKQLDRNGLQGNREFLVEVLMLSLLHHP  122

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL++L   K+ L+W  R+KIAAGAA+GLE+L
Sbjct  123  NLVNLIGYCADGDQRLLVYEYMPLGSLEDHLYDLPPDKKRLDWNTRMKIAAGAAKGLEHL  182

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLK SNILL E ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  183  HDKANPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  242

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLE+ITGR+A D+    GE NLV++ RP  KD+R+F +MADP
Sbjct  243  AMTGQLTLKSDVYSFGVVLLEIITGRKAIDNSRAAGEHNLVAWARPLFKDRRKFAQMADP  302

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            LL  ++  R L+ A+A+ AMC+Q+Q + RP I+D+  AL YL  Q    E
Sbjct  303  LLHGQYPARGLYQALAVAAMCVQEQPNMRPLIADVVTALSYLALQKYDPE  352



>ref|XP_010253451.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Nelumbo 
nucifera]
Length=399

 Score =   382 bits (982),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 195/290 (67%), Positives = 238/290 (82%), Gaps = 1/290 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+    LGEGGFG VYKG ++S + +VA+KQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  63   ATKNFRADCFLGEGGFGRVYKGRLESTNQIVAIKQLDRNGLQGNREFLVEVLMLSLLHHR  122

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL +L   K+ L+W  R+KIAAGAA+GLEYL
Sbjct  123  NLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDLPPDKKRLDWNTRMKIAAGAAKGLEYL  182

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLK SNILL E + P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  183  HDKANPPVIYRDLKCSNILLGEGYYPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  242

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLE+ITGR+A D+    GEQNLV++ RP  KD+R+F +MADP
Sbjct  243  AMTGQLTLKSDVYSFGVVLLEIITGRKAIDNSKAAGEQNLVAWARPLFKDRRKFAQMADP  302

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            +L+ ++ VR L+ A+A+ AMC+Q+Q + RP I+D+  AL YL +Q    E
Sbjct  303  MLQGQYPVRGLYQALAVAAMCVQEQPTMRPLIADVVTALSYLASQKYDPE  352



>ref|XP_010260133.1| PREDICTED: serine/threonine-protein kinase PBS1-like isoform 
X2 [Nelumbo nucifera]
Length=393

 Score =   382 bits (981),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 194/286 (68%), Positives = 237/286 (83%), Gaps = 1/286 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDS-QSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S   +VA+KQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  64   ATKNFRADCLLGEGGFGRVYKGRLESINQIVAIKQLDRNGLQGNREFLVEVLMLSLLHHP  123

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL +L   K+ L+W  R+KIAAGAA+GLEYL
Sbjct  124  NLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDLPPDKKRLDWNTRMKIAAGAAKGLEYL  183

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLK SNILL E ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  184  HDKANPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  243

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLE+ITGR+A D+    GE NLV++ RP  KD+R+F +MADP
Sbjct  244  AMTGQLTLKSDVYSFGVVLLEIITGRKAIDNSKAAGEHNLVAWARPLFKDRRKFSQMADP  303

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
            +L+ ++ VR L+ A+A+ AMC+Q+Q + RP I+D+  AL YL +Q 
Sbjct  304  MLQGQYPVRGLYQALAVAAMCVQEQPTMRPLIADVVTALTYLASQT  349



>ref|XP_008371260.1| PREDICTED: serine/threonine-protein kinase PBS1 [Malus domestica]
 ref|XP_008364125.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Malus domestica]
Length=382

 Score =   382 bits (980),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 191/292 (65%), Positives = 235/292 (80%), Gaps = 1/292 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVID-SQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT NF   NLLGEGGFG VYKG  + ++ VVAVKQLD+ G QGN+EF+VEVL+LSLLHH 
Sbjct  74   ATNNFHPDNLLGEGGFGRVYKGKFEGTEQVVAVKQLDRNGFQGNREFLVEVLILSLLHHA  133

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            +LVNL+GYC  GDQR+L YEYM NGSLE+HL +L  GK+AL+W  R+KIAAGAA+GLEYL
Sbjct  134  HLVNLVGYCADGDQRILAYEYMANGSLEDHLLDLAPGKKALDWNTRMKIAAGAAKGLEYL  193

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRD K+SNILLDE FNP+LSDFGLAKLGP GD THVSTRVMGTYGYCAPEY
Sbjct  194  HEQANPPVIYRDFKASNILLDENFNPKLSDFGLAKLGPTGDMTHVSTRVMGTYGYCAPEY  253

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            A++G+LT KSD+YSFGVV LE+ITGRR  D++    EQNLV++ +P  KD+R+F  MADP
Sbjct  254  ALTGQLTTKSDLYSFGVVFLEIITGRRVIDNNRPTEEQNLVTWAQPLFKDRRKFTLMADP  313

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSERN  874
            LLE ++ ++ L+ A+A+ AMCLQ++A+ RP ISD+  AL YL    +  + +
Sbjct  314  LLEGKYPIKGLYQALAVAAMCLQEEAATRPLISDVVTALAYLTLDGEAGDTD  365



>ref|XP_010250600.1| PREDICTED: serine/threonine-protein kinase PBS1 [Nelumbo nucifera]
 ref|XP_010250601.1| PREDICTED: serine/threonine-protein kinase PBS1 [Nelumbo nucifera]
Length=468

 Score =   385 bits (988),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 197/285 (69%), Positives = 238/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF++  LLGEGGFG VYKG ++S   VVAVKQLD++GLQGN+EF+VEVLMLSLLHH 
Sbjct  81   ATRNFRQECLLGEGGFGRVYKGRLESTGQVVAVKQLDRDGLQGNREFLVEVLMLSLLHHP  140

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL +L   KE L+W  R+KIAAGAA+GLEYL
Sbjct  141  NLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDLPPDKEPLDWNTRMKIAAGAAKGLEYL  200

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRD KSSNILLDE F+P+LSDFGLAKLGPVGD +HVSTRVMGTYGYCAPEY
Sbjct  201  HDKANPPVIYRDFKSSNILLDEGFHPKLSDFGLAKLGPVGDKSHVSTRVMGTYGYCAPEY  260

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LT+KSD+YSFGVV LELITGR+A DS    GEQNLV++ RP   D+R+F ++ADP
Sbjct  261  AMTGQLTVKSDVYSFGVVFLELITGRKAIDSTRAHGEQNLVTWARPMFNDRRKFSKLADP  320

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
             L+ R+ +R L+ A+A+ +MC Q+QA+ RP I+D+  AL YL +Q
Sbjct  321  RLQGRYPMRGLYQALAVASMCTQEQAATRPLIADVVTALSYLASQ  365



>ref|XP_011027056.1| PREDICTED: serine/threonine-protein kinase CDL1-like isoform 
X1 [Populus euphratica]
Length=371

 Score =   381 bits (979),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 194/290 (67%), Positives = 239/290 (82%), Gaps = 1/290 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S + VVA+KQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  63   ATKNFRADCLLGEGGFGRVYKGRLESTNQVVAIKQLDRNGLQGNREFLVEVLMLSLLHHP  122

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL +L   K+ L+W  R+K+AAGAA+GLE+L
Sbjct  123  NLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDLPPDKKRLDWNTRMKVAAGAAKGLEHL  182

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H +ANPPVIYRDLK SNILL E ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  183  HDSANPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  242

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLE+ITGR+A D+    GE NLV++ RP  KD+R+F +MADP
Sbjct  243  AMTGQLTLKSDVYSFGVVLLEIITGRKAIDNSRAAGEHNLVAWARPLFKDRRKFAQMADP  302

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            LL+  + +R L+ A+A+ AMC+Q+Q + RP I+D+  AL YL +Q    E
Sbjct  303  LLQGHYPMRGLYQALAVAAMCVQEQPNMRPLIADVVTALSYLASQKYDPE  352



>ref|XP_006363681.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Solanum 
tuberosum]
Length=371

 Score =   381 bits (979),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 195/284 (69%), Positives = 237/284 (83%), Gaps = 1/284 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+   LLGEGGFG VYKGVI+S  VVA+KQLD+ GLQGN+EF+VEVLMLSLLHH N
Sbjct  63   ATKNFRGDFLLGEGGFGRVYKGVIESNQVVAIKQLDRNGLQGNREFLVEVLMLSLLHHPN  122

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYC  GDQRLLVYEYMP GSLE+HL +   GKE L+W  R+KIAAGAA+GLEYLH
Sbjct  123  LVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDPTPGKERLDWNTRMKIAAGAAKGLEYLH  182

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
             +A+PPVIYRDLK SNILL E ++ +LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  183  -SASPPVIYRDLKCSNILLGEGYHAKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  241

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+G+LTLKSD+YSFGVVLLE+ITGR+A +S    G+ NLV + RP  KD+R+F +MADP+
Sbjct  242  MTGQLTLKSDVYSFGVVLLEIITGRKAIESSKTGGDFNLVIWARPLFKDRRKFSQMADPM  301

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            L+  + VR ++ A+A+ AMC+Q+Q + RP I+D+  AL YL +Q
Sbjct  302  LQGHYPVRGMYQALAVAAMCVQEQPNMRPVIADVVTALTYLASQ  345



>ref|XP_011004127.1| PREDICTED: serine/threonine-protein kinase CDL1 [Populus euphratica]
 ref|XP_011005041.1| PREDICTED: serine/threonine-protein kinase CDL1-like [Populus 
euphratica]
Length=391

 Score =   382 bits (981),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 193/285 (68%), Positives = 240/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S + VVA+KQL++ GLQGN+EF+VEVLMLSLLHH 
Sbjct  77   ATKNFRAECLLGEGGFGRVYKGYLESTNQVVAIKQLNRNGLQGNREFLVEVLMLSLLHHP  136

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL E+  GK  L+W  R+KIAAGAA+GLE+L
Sbjct  137  NLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHEVPPGKNWLDWNTRMKIAAGAAKGLEHL  196

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  A+PPVIYRDLK SNILLDE ++P+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY
Sbjct  197  HDKASPPVIYRDLKCSNILLDEGYHPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  256

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLE+ITGR+A D+    GEQNLV++ RP  KD+++F ++ADP
Sbjct  257  AMTGQLTLKSDVYSFGVVLLEIITGRKAIDNSKATGEQNLVAWARPLFKDRKKFSDIADP  316

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            +L+ ++  R L+ A+A+ AMC+Q+Q + RP I+D+  AL YL +Q
Sbjct  317  MLQGQYPPRGLYQALAVAAMCVQEQPNMRPVIADVVTALTYLASQ  361



>gb|KFK26099.1| hypothetical protein AALP_AA8G202700 [Arabis alpina]
Length=513

 Score =   386 bits (992),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 198/285 (69%), Positives = 236/285 (83%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   LLGEGGFG VYKG ++S   +VAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  79   ATKNFRPECLLGEGGFGRVYKGRLESTGQIVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  138

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL +L   KE L+W  R+ IAAGAA+GLEYL
Sbjct  139  NLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDLPPDKEPLDWNTRMTIAAGAAKGLEYL  198

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLKSSNILL + ++P+LSDFGLAKLGPVGD THVSTRVMGTYGYCAPEY
Sbjct  199  HDKANPPVIYRDLKSSNILLGDGYHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEY  258

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVV LELITGR+A D+   PGE NLV++ RP  KD+R+F +MADP
Sbjct  259  AMTGQLTLKSDVYSFGVVFLELITGRKAIDNARAPGEHNLVAWARPLFKDRRKFPKMADP  318

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
             L+ R+ +R L+ A+A+ AMCLQ+QA+ RP I D+  AL YL +Q
Sbjct  319  SLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQ  363



>ref|XP_010926780.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Elaeis 
guineensis]
 ref|XP_010926781.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Elaeis 
guineensis]
Length=461

 Score =   384 bits (987),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 197/286 (69%), Positives = 237/286 (83%), Gaps = 1/286 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQ-SVVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT NF+   L+GEGGFG VYKG ++S   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  81   ATGNFRPKCLIGEGGFGRVYKGYLESTGKVVAVKQLDKNGLQGNREFLVEVLMLSLLHHP  140

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KE L+W  R++IA GAA+GLEYL
Sbjct  141  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLLDLPPDKEPLDWNTRMRIATGAAKGLEYL  200

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRD K+SNILLDE F+P+LSDFGLAKLGPVGD +HVSTRVMGTYGYCAPEY
Sbjct  201  HHKANPPVIYRDFKASNILLDEGFDPKLSDFGLAKLGPVGDKSHVSTRVMGTYGYCAPEY  260

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LT+KSD+YSFGVVLLELITGRRA D+    GEQNLVS+ RP L D+R+  ++ADP
Sbjct  261  AMTGQLTVKSDVYSFGVVLLELITGRRAVDNSRPQGEQNLVSWVRPILNDRRKLPKLADP  320

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
             L+ RF +R L+ A+A+ +MC+QDQA+ RP I+D+  AL YL +QA
Sbjct  321  KLQGRFPMRGLYQALAVASMCVQDQAASRPLIADVVTALSYLASQA  366



>ref|XP_009600576.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Nicotiana 
tomentosiformis]
Length=390

 Score =   382 bits (980),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 191/284 (67%), Positives = 236/284 (83%), Gaps = 0/284 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            A +NF+   LLGEGGFG VYKG +DS  +VA+KQLD+ GLQGN+EF+VEVLMLSLLHH N
Sbjct  67   AARNFRGDCLLGEGGFGRVYKGRLDSNQIVAIKQLDRNGLQGNREFLVEVLMLSLLHHPN  126

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LVNL+GYC  GDQRLLVYEYMP GSL++HL +L   K+ L+W  R+KIAAGAA+GLEYLH
Sbjct  127  LVNLIGYCADGDQRLLVYEYMPLGSLDDHLHDLTPAKKVLDWNTRMKIAAGAAKGLEYLH  186

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
              A+PPVIYRDLK SNILL E ++P+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA
Sbjct  187  DKASPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  246

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            M+G+LTLKSD+YSFGVVLLE+ITGR+A ++    GE NLV++ RP  K++R+F +MADP+
Sbjct  247  MTGQLTLKSDVYSFGVVLLEIITGRKAIENSKTGGEHNLVAWARPLFKERRKFSQMADPV  306

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQ  853
            L+ ++ VR L+ A+A+ AMC+ +Q + RP I+D+  AL YL AQ
Sbjct  307  LQGQYPVRGLYQALAVAAMCVHEQPNMRPVIADVVTALSYLAAQ  350



>ref|XP_008233392.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Prunus 
mume]
Length=375

 Score =   381 bits (979),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 194/290 (67%), Positives = 239/290 (82%), Gaps = 1/290 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT+NF+   +LGEGGFG VYKG ++S + VVA+KQLD  GLQGN+EF+VEVLMLSLLHH 
Sbjct  66   ATKNFRADCILGEGGFGQVYKGRLESTNKVVAIKQLDSNGLQGNREFLVEVLMLSLLHHP  125

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYEYMP GSLE+HL +L   ++ L+W  R+KIAAGAA+GLEYL
Sbjct  126  NLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDLPPDRKQLDWNTRMKIAAGAAKGLEYL  185

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRDLK SNILL E ++P+LSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY
Sbjct  186  HDKANPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  245

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LTLKSD+YSFGVVLLE+ITGR+A D+    GE NLV++ RP  KD+R+F ++ADP
Sbjct  246  AMTGQLTLKSDVYSFGVVLLEIITGRKAIDNSRAAGEHNLVAWARPLFKDRRKFWQIADP  305

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            LL+ ++ VR ++ A+A+ AMC+Q+Q + RP I+D+  AL YL +Q    E
Sbjct  306  LLQGQYPVRGMYQALAVAAMCVQEQPNMRPLIADVVTALTYLASQKYDPE  355



>ref|XP_002871549.1| avrPphB susceptible 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47808.1| avrPphB susceptible 1 [Arabidopsis lyrata subsp. lyrata]
Length=456

 Score =   384 bits (986),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 196/286 (69%), Positives = 235/286 (82%), Gaps = 1/286 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQS-VVAVKQLDQEGLQGNQEFIVEvlmlsllhhn  178
            AT NF     LGEGGFG VYKG +DS   VVAVKQLD+ GLQGN+EF+VEVLMLSLLHH 
Sbjct  82   ATMNFHPDTFLGEGGFGRVYKGRLDSTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHP  141

Query  179  nlvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYL  358
            NLVNL+GYC  GDQRLLVYE+MP GSLE+HL +L   KEAL+W  R+KIAAGAA+GLE+L
Sbjct  142  NLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEALDWNMRMKIAAGAAKGLEFL  201

Query  359  HCTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEY  538
            H  ANPPVIYRD KSSNILLDE F+P+LSDFGLAKLGP GD +HVSTRVMGTYGYCAPEY
Sbjct  202  HDKANPPVIYRDFKSSNILLDEGFHPKLSDFGLAKLGPTGDKSHVSTRVMGTYGYCAPEY  261

Query  539  AMSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADP  718
            AM+G+LT+KSD+YSFGVV LELITGR+A DS+   GEQNLV++ RP   D+R+F+++ADP
Sbjct  262  AMTGQLTVKSDVYSFGVVFLELITGRKAIDSEMPHGEQNLVAWARPLFNDRRKFIKLADP  321

Query  719  LLERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQA  856
             L+ RF  R+L+ A+A+ +MC+Q+QA+ RP I+D+  AL YL  Q 
Sbjct  322  RLKGRFPTRALYQALAVASMCIQEQAATRPLIADVVTALSYLANQG  367



>ref|XP_010416553.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Camelina 
sativa]
Length=381

 Score =   381 bits (979),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 185/289 (64%), Positives = 239/289 (83%), Gaps = 0/289 (0%)
 Frame = +2

Query  2    ATQNFKESNLLGEGGFGSVYKGVIDSQSVVAVKQLDQEGLQGNQEFIVEvlmlsllhhnn  181
            AT+NF+E N++G+GGFGSVY+G +DS  VVA+KQL+  G QGNQEFIVEV MLS+ +H N
Sbjct  71   ATKNFREVNMIGKGGFGSVYRGRLDSGQVVAIKQLNPGGHQGNQEFIVEVCMLSVFYHPN  130

Query  182  lvnlmGYCTHGDQRLLVYEYMPNGSLENHLFELEAGKEALNWYNRLKIAAGAARGLEYLH  361
            LV L+GYCT G QRLLVYEYMP GSLE+HLF+LE  +  L+W  R+KIA GAARG+EYLH
Sbjct  131  LVTLIGYCTSGAQRLLVYEYMPMGSLEDHLFDLEPDQTPLSWNTRMKIAVGAARGIEYLH  190

Query  362  CTANPPVIYRDLKSSNILLDEEFNPRLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYA  541
            C  +P VIYRDLKS+NILLD++F+ +LSDFGLAK+GPVG+ THVSTR+MGTYGYCAPEYA
Sbjct  191  CKISPSVIYRDLKSANILLDKDFSVKLSDFGLAKVGPVGNRTHVSTRIMGTYGYCAPEYA  250

Query  542  MSGKLTLKSDIYSFGVVLLELITGRRAYDSDAKPGEQNLVSYCRPFLKDKRRFVEMADPL  721
            MSG+LT+KSDIYSFGVVLLELI+GR+A D     GEQ LV++ RP+LKD ++F ++ DPL
Sbjct  251  MSGRLTIKSDIYSFGVVLLELISGRKAIDLSKPNGEQYLVTWARPYLKDPKKFGQLVDPL  310

Query  722  LERRFSVRSLHHAVAITAMCLQDQASFRPAISDIAMALDYLVAQAQTSE  868
            L  ++S R L +A+AIT MCL+++A++RP I D+ +A + + AQ+++ E
Sbjct  311  LRGKYSKRCLSYAIAITEMCLKEEANYRPKIGDVVVAFENIAAQSKSHE  359



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2557218196608