BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c28515_g1_i1 len=594 path=[595:0-593]

Length=594
                                                                      Score     E

ref|XP_009768914.1|  PREDICTED: defensin-like protein isoform X1      76.6    8e-15   
ref|XP_009768915.1|  PREDICTED: defensin-like protein isoform X2      75.5    2e-14   
gb|KHN23780.1|  Defensin SD2                                          74.3    6e-14   
ref|XP_006649329.1|  PREDICTED: defensin J1-2-like                    73.9    9e-14   
ref|XP_009802655.1|  PREDICTED: defensin-like protein                 72.4    2e-13   
ref|XP_009614667.1|  PREDICTED: defensin-like protein                 72.4    3e-13   
ref|XP_003628979.1|  Defensin                                         72.4    3e-13   
ref|XP_004509604.1|  PREDICTED: defensin-like protein P322-like       71.2    7e-13   
gb|EYU40734.1|  hypothetical protein MIMGU_mgv11b023365mg             70.5    1e-12   
ref|NP_001234987.1|  protease inhibitor precursor                     70.5    2e-12   
gb|KHN06998.1|  Defensin-like protein                                 70.1    2e-12   
gb|ACN93800.1|  defensin precursor                                    69.7    2e-12   Vigna unguiculata
ref|XP_006354086.1|  PREDICTED: defensin-like protein 6-like          70.9    3e-12   
ref|XP_009784025.1|  PREDICTED: defensin J1-2                         69.7    3e-12   
ref|XP_006367978.1|  PREDICTED: defensin-like protein P322-like       68.9    5e-12   
ref|XP_004242748.1|  PREDICTED: defensin-like protein                 68.6    6e-12   
ref|XP_007223891.1|  hypothetical protein PRUPE_ppa014246mg           68.6    6e-12   
sp|P82659.1|DFSD2_HELAN  RecName: Full=Defensin SD2; AltName: Ful...  68.2    9e-12   Helianthus annuus
ref|XP_007159919.1|  hypothetical protein PHAVU_002G278700g           67.8    1e-11   
gb|AFK44299.1|  unknown                                               67.8    1e-11   
ref|XP_007156391.1|  hypothetical protein PHAVU_003G282500g           67.8    1e-11   
ref|NP_178320.1|  defensin-like protein 4                             67.8    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010043884.1|  PREDICTED: defensin Ec-AMP-D2-like               67.4    1e-11   
ref|XP_009764927.1|  PREDICTED: defensin-like protein 1 isoform X1    67.4    2e-11   
ref|XP_004297787.1|  PREDICTED: defensin-like protein 2-like          67.4    2e-11   
emb|CDP10468.1|  unnamed protein product                              67.4    2e-11   
sp|Q40901.1|DEF_PETIN  RecName: Full=Defensin-like protein; AltNa...  67.4    2e-11   Petunia integrifolia [violet-flowered petunia]
ref|XP_003599384.1|  Defensin                                         67.4    2e-11   
ref|XP_006359486.1|  PREDICTED: defensin-like protein-like            67.4    2e-11   
ref|XP_009769844.1|  PREDICTED: defensin-like protein P322            67.4    2e-11   
ref|XP_004297786.1|  PREDICTED: defensin-like protein 2-like          67.0    2e-11   
ref|XP_010250779.1|  PREDICTED: defensin Ec-AMP-D2-like               67.0    2e-11   
ref|XP_009351646.1|  PREDICTED: defensin Ec-AMP-D2-like               66.6    3e-11   
gb|AAL35366.1|AF442388_1  defensin protein precursor                  66.6    4e-11   Capsicum annuum
ref|XP_006585876.1|  PREDICTED: defensin-like protein-like            67.4    4e-11   
ref|XP_009604566.1|  PREDICTED: defensin J1-2-like                    66.2    5e-11   
gb|AAL85480.1|  defensin protein 1                                    66.2    5e-11   Prunus persica
ref|XP_009614488.1|  PREDICTED: defensin J1-2-like                    65.9    6e-11   
ref|XP_006359487.1|  PREDICTED: defensin-like protein-like            65.9    6e-11   
ref|XP_006359485.1|  PREDICTED: defensin-like protein-like            65.9    6e-11   
gb|ADK87340.1|  defensin                                              65.9    6e-11   
ref|XP_009599356.1|  PREDICTED: defensin-like protein                 65.9    7e-11   
ref|XP_009413079.1|  PREDICTED: defensin Ec-AMP-D2 {ECO:0000303|P...  65.5    8e-11   
ref|XP_010671291.1|  PREDICTED: defensin Ec-AMP-D2-like               65.1    1e-10   
dbj|BAA95697.1|  thionin like protein                                 65.1    1e-10   Nicotiana tabacum [American tobacco]
ref|XP_009593292.1|  PREDICTED: defensin-like protein P322            64.7    1e-10   
ref|XP_009354384.1|  PREDICTED: defensin Ec-AMP-D2-like               64.7    2e-10   
ref|XP_008340514.1|  PREDICTED: defensin Ec-AMP-D2-like               64.7    2e-10   
ref|XP_011070576.1|  PREDICTED: defensin Ec-AMP-D1-like               64.7    2e-10   
ref|XP_003628977.1|  Defensin                                         63.9    3e-10   
ref|XP_009610211.1|  PREDICTED: defensin J1-2                         63.9    3e-10   
ref|XP_006395809.1|  hypothetical protein EUTSA_v10005228mg           63.9    3e-10   
ref|XP_009351645.1|  PREDICTED: defensin Ec-AMP-D2-like               63.9    3e-10   
ref|XP_009800136.1|  PREDICTED: defensin J1-2-like                    63.9    3e-10   
ref|XP_003629332.1|  Defensin                                         63.9    3e-10   
gb|ACB32234.1|  gamma-thionin/defensin                                63.5    4e-10   Solanum chacoense
ref|XP_004509606.1|  PREDICTED: defensin J1-2-like                    63.5    4e-10   
ref|XP_004242747.1|  PREDICTED: defensin-like protein                 63.2    5e-10   
ref|XP_007226630.1|  hypothetical protein PRUPE_ppa022845mg           63.5    5e-10   
ref|XP_009593293.1|  PREDICTED: defensin-like protein P322            63.2    5e-10   
ref|XP_004509603.1|  PREDICTED: defensin-like protein-like            63.2    6e-10   
gb|EMT03365.1|  Defensin-like protein 1                               63.2    6e-10   
ref|NP_001048853.1|  Os03g0130300                                     63.2    6e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008389119.1|  PREDICTED: defensin Ec-AMP-D2-like               62.8    7e-10   
gb|AIA67010.1|  defensin                                              63.2    7e-10   
ref|XP_007033927.1|  Scorpion toxin-like knottin superfamily protein  63.9    8e-10   
gb|AGT51229.1|  defensin                                              62.8    8e-10   
ref|NP_178319.1|  defensin-like protein 2                             62.8    8e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003630422.1|  Defensin                                         62.4    9e-10   
ref|NP_001234872.1|  gamma-thionin precursor                          62.4    9e-10   
emb|CDY48618.1|  BnaC09g20670D                                        62.4    1e-09   
gb|ABO36637.1|  defensin protein                                      62.4    1e-09   Solanum lycopersicum
ref|XP_009129168.1|  PREDICTED: defensin-like protein 1               62.4    1e-09   
gb|ABO36641.1|  defensin protein                                      62.4    1e-09   Solanum pimpinellifolium [currant tomato]
ref|XP_007159918.1|  hypothetical protein PHAVU_002G278600g           62.4    1e-09   
ref|XP_011084089.1|  PREDICTED: defensin Ec-AMP-D2-like               62.4    1e-09   
ref|XP_009101273.1|  PREDICTED: defensin-like protein 2               62.4    1e-09   
dbj|BAK07823.1|  predicted protein                                    62.8    1e-09   
ref|XP_006395808.1|  hypothetical protein EUTSA_v10005229mg           62.0    1e-09   
gb|AIT42148.1|  defensin-like protein                                 62.0    1e-09   
dbj|BAB64929.1|  defensin-like protein                                62.0    2e-09   Pyrus pyrifolia [sha li]
gb|AIT42149.1|  defensin-like protein                                 61.6    2e-09   
dbj|BAK07043.1|  predicted protein                                    62.0    2e-09   
ref|XP_002875115.1|  hypothetical protein ARALYDRAFT_484136           61.6    2e-09   
gb|AIT42147.1|  defensin-like protein                                 61.6    2e-09   
ref|XP_002459605.1|  hypothetical protein SORBIDRAFT_02g007410        61.2    2e-09   Sorghum bicolor [broomcorn]
ref|XP_004242750.1|  PREDICTED: defensin-like protein P322            61.2    2e-09   
ref|XP_009351647.1|  PREDICTED: defensin-like protein 1               61.6    2e-09   
ref|XP_004503912.1|  PREDICTED: defensin-like protein-like            61.2    3e-09   
ref|XP_009114206.1|  PREDICTED: defensin-like protein 1               61.2    3e-09   
ref|XP_010319372.1|  PREDICTED: defensin Ec-AMP-D2-like               60.8    3e-09   
gb|AFW90621.1|  protease inhibitor-related protein                    60.8    3e-09   
ref|XP_006292136.1|  hypothetical protein CARUB_v10018340mg           60.8    3e-09   
gb|AAA91049.1|  protease inhibitor II                                 60.8    4e-09   Brassica rapa
gb|ACJ26760.1|  protease inhibitor-related protein                    60.8    4e-09   Solanum tuberosum [potatoes]
ref|XP_003628978.1|  Defensin                                         60.8    4e-09   
ref|XP_007156390.1|  hypothetical protein PHAVU_003G282400g           60.8    4e-09   
gb|AIA67013.1|  defensin                                              60.5    4e-09   
gb|AGT51228.1|  defensin                                              60.5    4e-09   
gb|AIA67012.1|  defensin                                              60.8    4e-09   
gb|AIT42153.1|  defensin-like protein                                 60.5    5e-09   
ref|XP_010513973.1|  PREDICTED: defensin-like protein 1               60.5    5e-09   
ref|XP_010495961.1|  PREDICTED: defensin-like protein 1               60.5    6e-09   
ref|XP_008349481.1|  PREDICTED: defensin Ec-AMP-D2-like               60.1    6e-09   
gb|ADQ43196.1|  unknown                                               60.1    6e-09   
ref|XP_011070575.1|  PREDICTED: defensin Ec-AMP-D2-like               60.5    7e-09   
ref|XP_002274353.1|  PREDICTED: defensin Ec-AMP-D2                    60.1    7e-09   Vitis vinifera
sp|P20346.1|DF322_SOLTU  RecName: Full=Defensin-like protein P322...  59.7    8e-09   Solanum tuberosum [potatoes]
gb|AGT51227.1|  defensin                                              59.7    9e-09   
gb|EMS65298.1|  Defensin-like protein 1                               59.7    9e-09   
gb|AIT42152.1|  defensin-like protein                                 59.7    1e-08   
ref|XP_006367121.1|  PREDICTED: defensin J1-2-like                    59.3    1e-08   
gb|AFE88173.1|  g-thionin                                             59.3    1e-08   
ref|XP_006392063.1|  hypothetical protein EUTSA_v10023787mg           59.3    1e-08   
sp|O65740.1|DEF2_CAPAN  RecName: Full=Defensin J1-2; Flags: Precu...  58.9    1e-08   Capsicum annuum
ref|NP_001148158.1|  LOC100281766 precursor                           59.3    1e-08   Zea mays [maize]
ref|XP_006420697.1|  hypothetical protein CICLE_v10006362mg           58.9    2e-08   
ref|XP_002459604.1|  hypothetical protein SORBIDRAFT_02g007400        58.9    2e-08   Sorghum bicolor [broomcorn]
gb|KHG09995.1|  Defensin-like protein 1                               58.5    2e-08   
ref|XP_007226225.1|  hypothetical protein PRUPE_ppa016594mg           58.9    2e-08   
ref|XP_010910081.1|  PREDICTED: defensin Ec-AMP-D2-like               58.5    2e-08   
gb|KDP32807.1|  hypothetical protein JCGZ_12099                       58.5    2e-08   
ref|XP_008793609.1|  PREDICTED: defensin Ec-AMP-D1-like isoform X1    58.5    2e-08   
gb|AFJ04517.1|  low-molecular-weight cysteine-rich 69                 58.5    2e-08   
ref|NP_176302.2|  defensin-like protein                               58.2    3e-08   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28445.1|  unknown                                               58.2    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_178322.1|  defensin-like protein 10                            57.8    4e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006292846.1|  hypothetical protein CARUB_v10019106mg           57.8    4e-08   
ref|XP_009769843.1|  PREDICTED: defensin-like protein P322            57.8    4e-08   
ref|XP_010513972.1|  PREDICTED: defensin-like protein 2               57.8    5e-08   
gb|AAP80654.1|AF479035_1  proteinase inhibitor Rgpi9                  57.8    5e-08   Triticum aestivum [Canadian hard winter wheat]
gb|EMT03364.1|  Defensin SD2                                          57.8    5e-08   
gb|EMS65297.1|  Defensin SD2                                          57.4    5e-08   
gb|EYU30124.1|  hypothetical protein MIMGU_mgv1a017438mg              57.4    6e-08   
ref|NP_178321.1|  defensin-like protein 1                             57.4    7e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AAM62652.1|  protease inhibitor II                                 57.0    7e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006292781.1|  hypothetical protein CARUB_v10019030mg           57.0    8e-08   
ref|XP_010260874.1|  PREDICTED: defensin D2-like                      57.0    8e-08   
gb|KEH35661.1|  Defensin                                              57.0    8e-08   
gb|ADQ43197.1|  unknown                                               57.0    8e-08   
ref|XP_009792224.1|  PREDICTED: defensin-like protein P322            57.0    8e-08   
ref|XP_008340513.1|  PREDICTED: defensin-like protein 1               57.4    8e-08   
ref|XP_002875116.1|  hypothetical protein ARALYDRAFT_904442           56.6    9e-08   
gb|AIT42150.1|  defensin-like protein                                 56.2    1e-07   
gb|AAS65426.1|  Kunitz-type trypsin inhibitor                         56.6    1e-07   Ipomoea batatas [batate]
ref|XP_010502227.1|  PREDICTED: defensin-like protein 2               56.2    1e-07   
ref|XP_007033370.1|  Scorpion toxin-like knottin superfamily protein  56.2    1e-07   
gb|EMT30046.1|  Defensin-like protein P322                            56.2    2e-07   
gb|AIA67015.1|  defensin                                              56.2    2e-07   
ref|XP_003526900.1|  PREDICTED: defensin-like protein 6-like          55.8    2e-07   
ref|XP_007137817.1|  hypothetical protein PHAVU_009G158100g           57.0    2e-07   
ref|XP_008793610.1|  PREDICTED: defensin Ec-AMP-D1-like isoform X2    55.8    2e-07   
ref|XP_002459603.1|  hypothetical protein SORBIDRAFT_02g007390        55.8    2e-07   Sorghum bicolor [broomcorn]
ref|XP_004985852.1|  PREDICTED: defensin SD2-like                     55.8    2e-07   
gb|ACM90159.1|  low-molecular-weight cysteine-rich 69                 55.5    3e-07   Jatropha curcas
gb|AFK47422.1|  unknown                                               55.5    3e-07   
ref|XP_009101271.1|  PREDICTED: defensin-like protein 10              55.5    3e-07   
gb|ABS72000.1|  putative defensin protein 1                           54.7    4e-07   Olea europaea
sp|P82781.2|DEF03_ARATH  RecName: Full=Putative defensin-like pro...  54.7    4e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006367122.1|  PREDICTED: defensin J1-2-like                    54.7    4e-07   
gb|ADK91098.1|  PCP17C2                                               54.7    4e-07   
gb|AAL15885.1|AF417297_1  putative gamma-thionin                      55.1    5e-07   Castanea sativa
emb|CDY39856.1|  BnaC02g42620D                                        54.7    5e-07   
ref|XP_009351648.1|  PREDICTED: defensin-like protein 1               55.1    5e-07   
gb|ABA86586.1|  putative defensin 1                                   54.7    6e-07   Aquilegia formosa
gb|ACS96442.1|  defensin                                              54.7    6e-07   Jatropha curcas
gb|ABA86589.1|  putative defensin 1                                   54.3    7e-07   Aquilegia pyrenaica
gb|KFK33428.1|  hypothetical protein AALP_AA5G011900                  54.3    7e-07   
ref|XP_007203247.1|  hypothetical protein PRUPE_ppa019504mg           54.7    7e-07   
gb|ABK93231.1|  unknown                                               54.3    7e-07   Populus trichocarpa [western balsam poplar]
gb|EPS59162.1|  defensin                                              53.9    8e-07   
gb|ADB02899.1|  gamma-thionin PPT precursor defensin 1-like protein   54.3    9e-07   
emb|CDM85870.1|  unnamed protein product                              53.9    9e-07   
ref|XP_011070574.1|  PREDICTED: defensin J1-2-like                    53.9    9e-07   
gb|KGN49760.1|  hypothetical protein Csa_5G114570                     53.9    9e-07   
ref|XP_008466730.1|  PREDICTED: defensin J1-2-like                    53.9    9e-07   
gb|ABA81896.1|  putative defensin                                     53.9    1e-06   Aquilegia formosa
gb|EMT03363.1|  hypothetical protein F775_43918                       53.9    1e-06   
ref|XP_003630421.1|  Defensin                                         53.9    1e-06   
gb|AIA67014.1|  defensin                                              53.9    1e-06   
gb|AAS13434.1|  defensin                                              53.1    1e-06   Nicotiana attenuata
ref|XP_008389118.1|  PREDICTED: defensin-like protein 1               53.9    1e-06   
dbj|BAK06284.1|  predicted protein                                    54.3    1e-06   
ref|XP_004151187.1|  PREDICTED: defensin J1-2-like                    53.5    1e-06   
gb|KFK26328.1|  hypothetical protein AALP_AA8G233400                  53.5    1e-06   
ref|XP_004250637.1|  PREDICTED: defensin-like protein                 53.9    1e-06   
ref|XP_003573542.1|  PREDICTED: defensin-like protein 3               53.5    2e-06   
gb|AHA50471.1|  defensin-like protein 4                               53.5    2e-06   
emb|CAH58740.1|  defensin                                             53.1    2e-06   Plantago major [cart-track plant]
ref|XP_006647552.1|  PREDICTED: defensin-like protein P322-like       53.5    2e-06   
gb|KEH35658.1|  low-molecular-weight cysteine-rich protein            52.8    2e-06   
ref|XP_007202809.1|  hypothetical protein PRUPE_ppa014119mg           53.1    2e-06   
ref|XP_002325735.1|  hypothetical protein POPTR_0019s00770g           52.8    2e-06   Populus trichocarpa [western balsam poplar]
ref|XP_011099999.1|  PREDICTED: defensin Ec-AMP-D2-like               52.8    3e-06   
ref|XP_004250638.1|  PREDICTED: defensin-like protein                 53.1    3e-06   
ref|XP_011001251.1|  PREDICTED: defensin-like protein 1               52.8    3e-06   
ref|NP_001047493.1|  Os02g0629800                                     52.8    3e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003562142.1|  PREDICTED: defensin Ec-AMP-D1-like               52.8    3e-06   
ref|XP_002325734.2|  defensin-like family protein                     52.8    3e-06   Populus trichocarpa [western balsam poplar]
ref|XP_010270777.1|  PREDICTED: defensin-like protein                 52.4    4e-06   
ref|XP_006422269.1|  hypothetical protein CICLE_v10005867mg           54.7    4e-06   
gb|ADK91116.1|  PCP17C2                                               51.6    5e-06   
gb|AHA50470.1|  defensin-like protein 1                               52.0    5e-06   
ref|XP_010088525.1|  Defensin-like protein 2                          52.0    5e-06   
gb|KHG06821.1|  Defensin-like protein                                 52.0    5e-06   
gb|EEC76838.1|  hypothetical protein OsI_14993                        52.0    6e-06   Oryza sativa Indica Group [Indian rice]
gb|EMT26158.1|  Defensin-like protein                                 52.0    6e-06   
ref|XP_006395807.1|  hypothetical protein EUTSA_v10005233mg           52.0    6e-06   
dbj|BAD25504.1|  hypothetical protein                                 52.0    6e-06   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001149230.1|  LOC100282852 precursor                           51.6    7e-06   Zea mays [maize]
ref|XP_002513261.1|  8.4 kDa sulfur-rich protein precursor, putative  51.6    7e-06   Ricinus communis
ref|XP_011001252.1|  PREDICTED: defensin-like protein 1               51.6    8e-06   
ref|XP_007045353.1|  Defensin-like protein isoform 1                  51.6    8e-06   
ref|XP_010908980.1|  PREDICTED: defensin Ec-AMP-D1-like               51.6    8e-06   
ref|XP_002272913.2|  PREDICTED: defensin-like protein 1 isoform X1    51.6    9e-06   Vitis vinifera
ref|XP_010653029.1|  PREDICTED: defensin-like protein 1 isoform X2    51.2    9e-06   
gb|EMS54459.1|  Defensin Tk-AMP-D5                                    51.2    1e-05   
ref|XP_007045354.1|  Defensin-like protein isoform 2                  51.2    1e-05   
gb|ABA86587.1|  putative defensin 1                                   51.2    1e-05   Aquilegia chrysantha
gb|AFW58880.1|  low-molecular-weight cysteine-rich protein LCR70      51.2    1e-05   
dbj|BAK07467.1|  predicted protein                                    50.8    1e-05   
gb|KGN62247.1|  hypothetical protein Csa_2G340400                     51.6    1e-05   
ref|XP_006394251.1|  hypothetical protein EUTSA_v10005235mg           50.8    1e-05   
ref|XP_006339360.1|  PREDICTED: defensin-like protein-like            51.6    1e-05   
ref|XP_004972594.1|  PREDICTED: defensin-like protein 21-like         50.8    1e-05   
ref|NP_001147137.1|  LOC100280744 precursor                           50.8    2e-05   Zea mays [maize]
sp|Q43413.1|DEF1_CAPAN  RecName: Full=Defensin J1-1; Flags: Precu...  50.8    2e-05   Capsicum annuum
ref|XP_010228361.1|  PREDICTED: defensin Tk-AMP-D1.1-like             50.4    2e-05   
gb|EMS62517.1|  Defensin SD2                                          50.8    2e-05   
gb|EAY86781.1|  hypothetical protein OsI_08161                        53.9    2e-05   Oryza sativa Indica Group [Indian rice]
gb|AHA50473.1|  defensin-like protein 6                               50.4    2e-05   
ref|XP_004509602.1|  PREDICTED: defensin-1-like                       50.4    2e-05   
ref|XP_009598624.1|  PREDICTED: defensin-like protein                 50.8    2e-05   
ref|XP_009397593.1|  PREDICTED: defensin Ec-AMP-D1 {ECO:0000303|P...  50.4    2e-05   
ref|NP_001052199.1|  Os04g0189400                                     50.8    3e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EMT11359.1|  Defensin-like protein P322                            50.1    3e-05   
ref|NP_201171.1|  defensin-like protein 6                             50.1    3e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009780051.1|  PREDICTED: defensin-like protein 1               50.1    3e-05   
gb|AFD01290.1|  defensin 3                                            50.1    3e-05   
gb|EMS56168.1|  Defensin-like protein 6                               50.1    3e-05   
ref|XP_002886566.1|  protease inhibitor II                            50.1    3e-05   
emb|CAN69975.1|  hypothetical protein VITISV_020776                   49.7    4e-05   Vitis vinifera
gb|AHA50472.1|  defensin-like protein 5                               49.7    4e-05   
ref|XP_002468581.1|  hypothetical protein SORBIDRAFT_01g048380        49.7    4e-05   Sorghum bicolor [broomcorn]
dbj|BAH29762.1|  defensin-like cystein-rich peptide                   49.7    4e-05   Torenia fournieri [bluewings]
ref|XP_010064921.1|  PREDICTED: uncharacterized protein LOC104452094  50.8    4e-05   
gb|KCW70075.1|  hypothetical protein EUGRSUZ_F03380                   49.7    4e-05   
ref|XP_008340512.1|  PREDICTED: defensin-like protein 1               50.1    4e-05   
ref|XP_008437687.1|  PREDICTED: defensin J1-2-like                    49.7    4e-05   
ref|XP_008385108.1|  PREDICTED: defensin-like protein 2               49.7    4e-05   
ref|XP_009793542.1|  PREDICTED: defensin-like protein                 50.1    4e-05   
gb|ABU40984.1|  putative flower-specific thionin                      50.1    4e-05   Nicotiana tabacum [American tobacco]
gb|EMS53152.1|  Defensin-like protein 2                               49.7    4e-05   
gb|AAG17880.1|AF293407_1  Kunitz trypsin inhibitor protein            49.3    5e-05   Phaseolus coccineus [scarlet runner bean]
ref|XP_007137816.1|  hypothetical protein PHAVU_009G158000g           49.3    5e-05   
gb|EYU27577.1|  hypothetical protein MIMGU_mgv1a024490mg              49.3    5e-05   
ref|XP_007202863.1|  hypothetical protein PRUPE_ppa015550mg           49.7    5e-05   
ref|XP_009608875.1|  PREDICTED: defensin-like protein                 49.7    5e-05   
gb|ADK36631.1|  defensin-like protein                                 48.9    5e-05   
ref|XP_009383785.1|  PREDICTED: defensin-like protein 1               49.3    6e-05   
emb|CDP10467.1|  unnamed protein product                              49.7    6e-05   
dbj|BAK04559.1|  predicted protein                                    49.3    7e-05   
ref|XP_010675152.1|  PREDICTED: defensin-like protein 1 isoform X1    48.9    7e-05   
gb|KDO61571.1|  hypothetical protein CISIN_1g029977mg                 50.8    7e-05   
ref|XP_006301968.1|  hypothetical protein CARUB_v10022448mg           48.9    7e-05   
sp|Q8GTM0.1|DEF_NICAL  RecName: Full=Flower-specific defensin; Al...  49.3    8e-05   Nicotiana alata [Indian tobacco]
ref|XP_009353671.1|  PREDICTED: defensin-like protein 2               48.9    8e-05   
ref|XP_010675153.1|  PREDICTED: defensin-like protein 1 isoform X2    48.5    9e-05   
ref|XP_009353672.1|  PREDICTED: defensin-like protein 2               48.9    9e-05   
gb|EMS54457.1|  Defensin Tk-AMP-D4                                    48.5    1e-04   
ref|XP_006365640.1|  PREDICTED: defensin-like protein-like            48.9    1e-04   
ref|XP_007202934.1|  hypothetical protein PRUPE_ppa016748mg           48.5    1e-04   
ref|XP_009630513.1|  PREDICTED: defensin-like protein 1               48.9    1e-04   
ref|XP_009345992.1|  PREDICTED: defensin-like protein 2               48.5    1e-04   
ref|XP_007203287.1|  hypothetical protein PRUPE_ppa025677mg           48.1    2e-04   
gb|EMS52277.1|  Defensin Tk-AMP-D1.1                                  48.1    2e-04   
gb|AGT51230.1|  defensin                                              47.8    2e-04   
gb|KHN16909.1|  Defensin J1-2                                         48.1    2e-04   
ref|XP_006295860.1|  hypothetical protein CARUB_v10024990mg           48.1    2e-04   
emb|CAA65045.1|  defensin                                             47.8    2e-04   
gb|ACG41256.1|  low-molecular-weight cysteine-rich protein LCR70 ...  47.8    2e-04   
ref|XP_004509637.1|  PREDICTED: defensin J1-2-like                    47.4    2e-04   
ref|XP_009590912.1|  PREDICTED: defensin-like protein 1               47.8    2e-04   
ref|XP_008389117.1|  PREDICTED: defensin Tk-AMP-D1.1-like             47.8    2e-04   
gb|EMT11361.1|  Defensin Tk-AMP-D6                                    47.4    2e-04   
gb|KEH18169.1|  Defensin-like protein                                 47.8    3e-04   
gb|EPS67569.1|  gamma-thionin                                         47.0    3e-04   
gb|EMT02837.1|  Defensin J1-2                                         47.4    3e-04   
emb|CEJ09690.1|  Defensin protein                                     47.4    3e-04   
ref|XP_008240820.1|  PREDICTED: defensin Ec-AMP-D1-like               47.4    3e-04   
ref|XP_004503014.1|  PREDICTED: defensin-like protein 6-like isof...  47.4    3e-04   
gb|AGC82207.1|  defensin                                              47.4    3e-04   
ref|XP_004147317.1|  PREDICTED: defensin-like protein-like            47.4    3e-04   
ref|XP_009355482.1|  PREDICTED: defensin Tk-AMP-D1.1-like             47.4    3e-04   
ref|XP_009336049.1|  PREDICTED: defensin-like protein 19              47.4    3e-04   
ref|XP_008669654.1|  PREDICTED: defensin Ec-AMP-D1-like               47.0    3e-04   
ref|XP_006586320.1|  PREDICTED: defensin-like protein-like            47.0    4e-04   
ref|XP_003581053.1|  PREDICTED: defensin Tk-AMP-D5-like               47.0    4e-04   
ref|XP_009355481.1|  PREDICTED: defensin Tk-AMP-D1.1-like             47.4    4e-04   
ref|XP_004242654.1|  PREDICTED: defensin-like protein                 47.4    4e-04   
gb|AHA50468.1|  defensin-like protein 2                               47.0    4e-04   
gb|AIA67007.1|  defensin                                              47.0    4e-04   
gb|AAW33979.1|  proteinase inhibitor SE60-like protein                46.6    4e-04   
gb|KHN09675.1|  Defensin-like protein                                 46.6    4e-04   
ref|XP_004503015.1|  PREDICTED: defensin-like protein 6-like isof...  47.0    4e-04   
gb|AIA67009.1|  defensin                                              47.0    5e-04   
ref|XP_009345976.1|  PREDICTED: defensin-like protein 2               47.0    5e-04   
gb|AIA67011.1|  defensin                                              46.6    5e-04   
gb|AAL14240.1|  proteinase inhibitor                                  46.2    5e-04   
ref|XP_009357110.1|  PREDICTED: defensin Ec-AMP-D1-like               46.6    5e-04   
ref|XP_006292327.1|  hypothetical protein CARUB_v10018538mg           46.6    6e-04   
gb|ABF74600.1|  defensin precursor                                    46.6    6e-04   
ref|XP_004150109.1|  PREDICTED: defensin-like protein 19-like         46.6    7e-04   
ref|XP_004976261.1|  PREDICTED: defensin-like protein P322-like       46.6    7e-04   
ref|XP_009114204.1|  PREDICTED: defensin-like protein 2               46.2    7e-04   
dbj|BAB64931.1|  defensin-like protein                                46.2    7e-04   
ref|XP_006423327.1|  hypothetical protein CICLE_v10029828mg           46.2    7e-04   
ref|XP_008360020.1|  PREDICTED: defensin-like protein 2               46.6    8e-04   
ref|NP_001031462.1|  low-molecular-weight cysteine-rich 75            46.2    8e-04   
gb|ABK21016.1|  unknown                                               46.2    8e-04   
ref|XP_002864860.1|  predicted protein                                45.8    0.001   
gb|ABK23037.1|  unknown                                               46.2    0.001   
ref|XP_009338353.1|  PREDICTED: defensin-like protein 2               46.2    0.001   



>ref|XP_009768914.1| PREDICTED: defensin-like protein isoform X1 [Nicotiana sylvestris]
Length=80

 Score = 76.6 bits (187),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            M+ SM + L  VF+++M++ + +  GPIM  EAR C  +SQ+F GVCV    C S C ++
Sbjct  2    MRRSMRL-LSTVFLLLMVVFATEEMGPIMVAEARNCESQSQRFKGVCVSNRNCASVCNTE  60

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF  G C GLR  C+C +NC
Sbjct  61   GFPDGKCKGLRRRCFCLRNC  80



>ref|XP_009768915.1| PREDICTED: defensin-like protein isoform X2 [Nicotiana sylvestris]
Length=79

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 52/80 (65%), Gaps = 2/80 (3%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            M+ SM + L  VF+++M++ + +MG PIM  EAR C  +SQ+F GVCV    C S C ++
Sbjct  2    MRRSMRL-LSTVFLLLMVVFATEMG-PIMVAEARNCESQSQRFKGVCVSNRNCASVCNTE  59

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF  G C GLR  C+C +NC
Sbjct  60   GFPDGKCKGLRRRCFCLRNC  79



>gb|KHN23780.1| Defensin SD2 [Glycine soja]
Length=79

 Score = 74.3 bits (181),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 49/78 (63%), Gaps = 1/78 (1%)
 Frame = -1

Query  525  SMNVPLL-VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGF  349
            S +VPL+  +F++++LL + +M GP M  EAR C  +S +F G C+    C S C ++ F
Sbjct  2    SRSVPLVSTIFVLLLLLVATEMMGPTMVAEARTCESQSHRFKGPCLSDTNCGSVCRTERF  61

Query  348  AGGHCHGLRHLCYCYKNC  295
             GGHC G R  C+C K+C
Sbjct  62   TGGHCRGFRRRCFCTKHC  79



>ref|XP_006649329.1| PREDICTED: defensin J1-2-like [Oryza brachyantha]
Length=80

 Score = 73.9 bits (180),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            M+ S  V   ++ M+++L ++ +MGGP+M  EAR C  +S +F GVCV  + C S C ++
Sbjct  1    MEASRKVLSAMLLMVLLLAATGEMGGPVMVAEARTCESQSHRFNGVCVRSSNCASVCSTE  60

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF GGHC G R  C+C K C
Sbjct  61   GFTGGHCRGFRRRCFCTKPC  80



>ref|XP_009802655.1| PREDICTED: defensin-like protein [Nicotiana sylvestris]
Length=75

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = -1

Query  522  MNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAG  343
            M       F++ MLL + +MG P+   EAR C  +S +F G CV G+ C S C ++GF G
Sbjct  1    MGRLFATFFLVAMLLLATEMG-PMSSAEARTCESQSHRFHGTCVRGSNCASVCQTEGFIG  59

Query  342  GHCHGLRHLCYCYKNC  295
            G+C GLR  C+C +NC
Sbjct  60   GNCRGLRRRCFCTRNC  75



>ref|XP_009614667.1| PREDICTED: defensin-like protein [Nicotiana tomentosiformis]
Length=75

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = -1

Query  510  LLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCH  331
            L  VF+++M++ + +MG P+M  EAR C  +S++F GVCV    C S C ++GF  G C 
Sbjct  5    LSTVFLLLMVVFATEMG-PVMVAEARNCESQSERFKGVCVSNRNCASVCNTEGFPDGKCK  63

Query  330  GLRHLCYCYKNC  295
            GLR  C+C +NC
Sbjct  64   GLRRRCFCLRNC  75



>ref|XP_003628979.1| Defensin [Medicago truncatula]
 ref|XP_003636616.1| Defensin [Medicago truncatula]
 gb|AET03455.1| Defensin MtDef4.4 [Medicago truncatula]
Length=78

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = -1

Query  525  SMNVPLL-VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGF  349
            + ++PL+  +F+  +LL + +MG PIM  EAR C   S  F G+CV    C S C ++GF
Sbjct  2    ARSLPLVSTIFVFFLLLVATEMG-PIMVAEARTCETPSNNFKGLCVSDTNCASVCQTEGF  60

Query  348  AGGHCHGLRHLCYCYKNC  295
             GGHC G R  C+C K C
Sbjct  61   PGGHCEGFRQRCFCTKPC  78



>ref|XP_004509604.1| PREDICTED: defensin-like protein P322-like [Cicer arietinum]
Length=78

 Score = 71.2 bits (173),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 50/78 (64%), Gaps = 2/78 (3%)
 Frame = -1

Query  525  SMNVPLL-VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGF  349
            + ++P +  +F++ +LL + +MG PI   EAR+C+ +S  F G CV+ + C   C ++GF
Sbjct  2    ARSIPFISTIFVMFLLLVATEMG-PIKVAEARICDSQSNTFKGPCVIDHSCAIVCQTEGF  60

Query  348  AGGHCHGLRHLCYCYKNC  295
             GG C GLR +C+C K C
Sbjct  61   TGGQCEGLRRICFCTKPC  78



>gb|EYU40734.1| hypothetical protein MIMGU_mgv11b023365mg [Erythranthe guttata]
Length=80

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 50/80 (63%), Gaps = 8/80 (10%)
 Frame = -1

Query  510  LLVVFMIMMLL----SSNDMGGPI---MKVEAR-LCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            +  VFM+M+LL    + +++ G I   +K+E +  CNY S+KF G+C+  +KC   C  +
Sbjct  1    MTAVFMLMLLLINVSAQSNVDGEIADYLKIEEKKRCNYESKKFWGICLSDSKCGEVCTKE  60

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF GG C GLR  CYC+ NC
Sbjct  61   GFEGGDCKGLRRRCYCFNNC  80



>ref|NP_001234987.1| protease inhibitor precursor [Glycine max]
 gb|AAC97524.1| protease inhibitor [Glycine max]
Length=79

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 48/78 (62%), Gaps = 1/78 (1%)
 Frame = -1

Query  525  SMNVPLL-VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGF  349
            S +VPL+  + ++++LL + +M GP M  EAR C  +S +F G C+    C S C ++ F
Sbjct  2    SRSVPLVSTICVLLLLLVATEMMGPTMVAEARTCESQSHRFKGPCLSDTNCGSVCRTERF  61

Query  348  AGGHCHGLRHLCYCYKNC  295
             GGHC G R  C+C K+C
Sbjct  62   TGGHCRGFRRRCFCTKHC  79



>gb|KHN06998.1| Defensin-like protein [Glycine soja]
Length=84

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 49/78 (63%), Gaps = 2/78 (3%)
 Frame = -1

Query  525  SMNVPLL-VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGF  349
            + +VPL+  +F++++LL + +MG P M  EAR C  +S +F G C+    C S C ++GF
Sbjct  2    ARSVPLVSTIFVLLLLLIATEMG-PTMVAEARTCESQSHRFKGPCLSDTNCGSVCRTEGF  60

Query  348  AGGHCHGLRHLCYCYKNC  295
            +GGHC G    C+C K C
Sbjct  61   SGGHCRGFSRRCFCTKEC  78



>gb|ACN93800.1| defensin precursor [Vigna unguiculata]
Length=78

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (62%), Gaps = 2/78 (3%)
 Frame = -1

Query  525  SMNVPLL-VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGF  349
            + +VPL+  +F+ ++LL + +MG P M  EAR C  +S +F G CV    C S C ++ F
Sbjct  2    ARSVPLVSTIFVFLLLLVATEMG-PTMVAEARTCESQSHRFKGPCVSDTNCASVCRTERF  60

Query  348  AGGHCHGLRHLCYCYKNC  295
            +GGHC G R  C C K+C
Sbjct  61   SGGHCRGFRRRCLCTKHC  78



>ref|XP_006354086.1| PREDICTED: defensin-like protein 6-like [Solanum tuberosum]
Length=117

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = -1

Query  477  SSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHL-CYCYK  301
            ++ ++GG I K EA+LC Y S+ F G CV G+ C+  CL + F GG CHG+RH  C CY+
Sbjct  56   TNEEIGGGIRKTEAKLCQYHSETFHGACVTGHHCNQHCLKENFEGGRCHGVRHYRCVCYR  115

Query  300  NC  295
             C
Sbjct  116  TC  117



>ref|XP_009784025.1| PREDICTED: defensin J1-2 [Nicotiana sylvestris]
Length=77

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 48/72 (67%), Gaps = 2/72 (3%)
 Frame = -1

Query  510  LLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCH  331
            L +VF+++ML+ +N+MG   M  EAR C  +S +F G+C+  + C S C ++GF GGHC 
Sbjct  8    LAIVFLMLMLVFANEMG--PMVAEARTCESQSHRFKGLCISKSNCASVCHTEGFNGGHCR  65

Query  330  GLRHLCYCYKNC  295
            G R  C+C ++C
Sbjct  66   GFRRRCFCTRHC  77



>ref|XP_006367978.1| PREDICTED: defensin-like protein P322-like [Solanum tuberosum]
Length=79

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 46/80 (58%), Gaps = 2/80 (3%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            M  SM     V+F+ M+++ +    GP+  +EAR+C   SQ+F G C+    C S C ++
Sbjct  1    MAHSMRFFATVLFLAMLVMDTK--MGPMRIIEARICESPSQRFKGPCLTDRNCASVCETE  58

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF GG C GLR  C+C K C
Sbjct  59   GFTGGDCRGLRRRCFCTKEC  78



>ref|XP_004242748.1| PREDICTED: defensin-like protein [Solanum lycopersicum]
 gb|ABO36638.1| defensin protein [Solanum lycopersicum]
 gb|ABO36642.1| defensin protein [Solanum pimpinellifolium]
Length=79

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 45/77 (58%), Gaps = 3/77 (4%)
 Frame = -1

Query  519  NVPLLVVFMI--MMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFA  346
            ++ L   F +  M+LL S +MG PI   EAR C  +S  F G CV  + C + C ++GF 
Sbjct  4    SIRLFATFFLVAMLLLLSTEMG-PISSAEARTCESQSNSFKGTCVRDSNCATVCQTEGFI  62

Query  345  GGHCHGLRHLCYCYKNC  295
            GG+C G R  C+C +NC
Sbjct  63   GGNCRGFRRRCFCTRNC  79



>ref|XP_007223891.1| hypothetical protein PRUPE_ppa014246mg [Prunus persica]
 ref|XP_008220985.1| PREDICTED: defensin Ec-AMP-D2-like [Prunus mume]
 gb|EMJ25090.1| hypothetical protein PRUPE_ppa014246mg [Prunus persica]
Length=78

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 47/80 (59%), Gaps = 2/80 (3%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            M+ SM +     F+  +LL++  M GP M  EAR C  +S +F G CV  + C S C ++
Sbjct  1    MERSMRL-FSTAFVFFLLLAAAGMMGP-MVAEARTCESQSNRFKGTCVSTSNCASVCQTE  58

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF GGHC G R  C+C K+C
Sbjct  59   GFPGGHCRGFRRRCFCTKHC  78



>sp|P82659.1|DFSD2_HELAN RecName: Full=Defensin SD2; AltName: Full=Flower-specific gamma-thionin; 
Flags: Precursor [Helianthus annuus]
 gb|AAF66591.1|AF141131_1 defensin [Helianthus annuus]
 gb|AAF72042.1|AF178634_1 defensin SD2 [Helianthus annuus]
Length=78

 Score = 68.2 bits (165),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 50/80 (63%), Gaps = 2/80 (3%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            MK SM +   ++ ++M LL+ N+MGGP++ VEAR C  +S KF G C+    C + C S+
Sbjct  1    MKSSMKMFAALLLVVMCLLA-NEMGGPLV-VEARTCESQSHKFKGTCLSDTNCANVCHSE  58

Query  354  GFAGGHCHGLRHLCYCYKNC  295
             F+GG C G R  C+C  +C
Sbjct  59   RFSGGKCRGFRRRCFCTTHC  78



>ref|XP_007159919.1| hypothetical protein PHAVU_002G278700g [Phaseolus vulgaris]
 gb|ESW31913.1| hypothetical protein PHAVU_002G278700g [Phaseolus vulgaris]
Length=74

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 44/69 (64%), Gaps = 3/69 (4%)
 Frame = -1

Query  501  VFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLR  322
            +F++ ++L+++     + + EARLC   SQ F G+C   + C + CL++GF GG C GLR
Sbjct  9    IFLLFLVLAADV---AVKRAEARLCWSESQAFKGLCFSNDNCATVCLTEGFTGGKCEGLR  65

Query  321  HLCYCYKNC  295
              C+C KNC
Sbjct  66   RRCFCSKNC  74



>gb|AFK44299.1| unknown [Lotus japonicus]
Length=78

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 48/78 (62%), Gaps = 2/78 (3%)
 Frame = -1

Query  525  SMNVPLL-VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGF  349
            + ++PL+  +F+ ++LL + +MG P M  EAR C  +S +F G CV    C S C  + F
Sbjct  2    ARSLPLVSTIFVFLLLLVATEMG-PTMVAEARDCESQSHRFKGPCVSDTNCASVCHGEKF  60

Query  348  AGGHCHGLRHLCYCYKNC  295
            +GGHC G R  C+C K+C
Sbjct  61   SGGHCRGFRRRCFCTKHC  78



>ref|XP_007156391.1| hypothetical protein PHAVU_003G282500g [Phaseolus vulgaris]
 gb|ADR30067.1| defensin D2 [Phaseolus vulgaris]
 gb|ESW28385.1| hypothetical protein PHAVU_003G282500g [Phaseolus vulgaris]
Length=78

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
             +F+ ++LL + +MG P M  EAR C  +S +F G CV    C S C ++ F+GGHC G 
Sbjct  10   TIFVFLLLLLATEMG-PRMVAEARTCESQSHRFKGPCVSDTNCASVCRTERFSGGHCRGF  68

Query  324  RHLCYCYKNC  295
            R  C+C K+C
Sbjct  69   RRRCFCTKHC  78



>ref|NP_178320.1| defensin-like protein 4 [Arabidopsis thaliana]
 sp|Q41914.2|DEF04_ARATH RecName: Full=Defensin-like protein 4; AltName: Full=Low-molecular-weight 
cysteine-rich protein 70; Short=Protein LCR70; 
AltName: Full=Plant defensin 2.1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC97222.1| protease inhibitor II [Arabidopsis thaliana]
 dbj|BAC42603.1| putative protease inhibitor II [Arabidopsis thaliana]
 gb|AAO42893.1| At2g02120 [Arabidopsis thaliana]
 gb|AEC05548.1| defensin-like protein 4 [Arabidopsis thaliana]
Length=77

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 49/80 (61%), Gaps = 3/80 (4%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            MK SM +   V+F++M+ +++    GP+  VEAR C  +SQ+F G CV    C + C ++
Sbjct  1    MKFSMRLISAVLFLVMIFVATGM--GPVT-VEARTCASQSQRFKGKCVSDTNCENVCHNE  57

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF GG C G R  C+C +NC
Sbjct  58   GFPGGDCRGFRRRCFCTRNC  77



>ref|XP_010043884.1| PREDICTED: defensin Ec-AMP-D2-like [Eucalyptus grandis]
 gb|KCW85903.1| hypothetical protein EUGRSUZ_B02620 [Eucalyptus grandis]
Length=77

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 42/70 (60%), Gaps = 2/70 (3%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
               ++M+LL + +M    M VEAR C  +SQ+F G CV    C S C ++GF GGHC G 
Sbjct  10   AALIVMLLLVATEM--EPMVVEARTCESQSQRFKGACVSKTNCASVCQTEGFHGGHCRGF  67

Query  324  RHLCYCYKNC  295
            R  C+C K+C
Sbjct  68   RRRCFCTKHC  77



>ref|XP_009764927.1| PREDICTED: defensin-like protein 1 isoform X1 [Nicotiana sylvestris]
Length=76

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = -1

Query  513  PLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHC  334
            P + V + +MLL S +  GP  KVEA+LC Y+S+ F GVCV G+ C+  C  + F GG C
Sbjct  5    PTIAVLLFLMLLLSANEIGP-RKVEAKLCQYKSRTFFGVCVSGHTCNQKCQGEAFDGGRC  63

Query  333  HGLRHLCYCYKNC  295
            HG+R  C CY+ C
Sbjct  64   HGVRRQCCCYRTC  76



>ref|XP_004297787.1| PREDICTED: defensin-like protein 2-like [Fragaria vesca subsp. 
vesca]
Length=79

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 41/70 (59%), Gaps = 0/70 (0%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
             VF+ ++LL +  MG   M  EAR C   S KF G C+    C S C ++GF+GG C GL
Sbjct  10   AVFVALLLLVATGMGPNTMVAEARTCESLSHKFKGTCLSETNCASVCKTEGFSGGDCRGL  69

Query  324  RHLCYCYKNC  295
            R  C+C K+C
Sbjct  70   RRRCFCTKHC  79



>emb|CDP10468.1| unnamed protein product [Coffea canephora]
Length=78

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 41/70 (59%), Gaps = 1/70 (1%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
              F+++ML  S +M  P+   EAR C   S +F G CV G+ C + C ++GF GG C GL
Sbjct  10   TAFLLLMLFMSTEMD-PVRVAEARTCESLSHRFKGTCVRGSNCAAVCQTEGFPGGQCSGL  68

Query  324  RHLCYCYKNC  295
            R  C+C K C
Sbjct  69   RRRCFCSKPC  78



>sp|Q40901.1|DEF_PETIN RecName: Full=Defensin-like protein; AltName: Full=Gamma-thionin 
homolog PPT; Flags: Precursor [Petunia integrifolia]
 gb|AAA64740.1| gamma-thionin homolog [Petunia integrifolia subsp. inflata]
Length=78

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 41/72 (57%), Gaps = 1/72 (1%)
 Frame = -1

Query  510  LLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCH  331
                F+I ML  S +MG P+   EAR C  +S +F G CV  + C S C ++GF GG+C 
Sbjct  8    FATFFLIAMLFLSTEMG-PMTSAEARTCESQSHRFHGTCVRESNCASVCQTEGFIGGNCR  66

Query  330  GLRHLCYCYKNC  295
              R  C+C +NC
Sbjct  67   AFRRRCFCTRNC  78



>ref|XP_003599384.1| Defensin [Medicago truncatula]
 gb|AES69635.1| gamma-thionin/defensin [Medicago truncatula]
Length=80

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 46/80 (58%), Gaps = 0/80 (0%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            M  S+ +   + F + +L+S+      + + EAR C+ +S  F GVC + + C + C ++
Sbjct  1    MARSITLVCTIFFFLFLLVSTEMQPTHVEEPEARTCDSQSHSFKGVCWIKHNCANVCKTE  60

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF GGHCHG R  C+C K C
Sbjct  61   GFTGGHCHGFRRRCFCSKPC  80



>ref|XP_006359486.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=78

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
              F++ MLL S++MG  +   EAR C  +S +F G CV  + C + C ++GF GG+C G 
Sbjct  10   TFFLVAMLLLSSEMG-TMSSAEARTCESQSNRFKGTCVRDSNCATVCQTEGFIGGNCRGF  68

Query  324  RHLCYCYKNC  295
            R  C+C +NC
Sbjct  69   RRRCFCTRNC  78



>ref|XP_009769844.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
Length=78

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
             V ++ ML+ + +MG P+   EAR C  +SQ+F G CV    C + C ++GF+GG C GL
Sbjct  10   TVLLLAMLVMATEMG-PMTIAEARRCESKSQRFRGPCVREKNCAAVCETEGFSGGDCRGL  68

Query  324  RHLCYCYKNC  295
            R  C+C + C
Sbjct  69   RRRCFCTRPC  78



>ref|XP_004297786.1| PREDICTED: defensin-like protein 2-like [Fragaria vesca subsp. 
vesca]
Length=79

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 41/70 (59%), Gaps = 0/70 (0%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
             VF+ ++LL +  MG   M  EAR C   S KF G C+  + C S C ++GF GG C GL
Sbjct  10   AVFVALLLLVATGMGPNAMVAEARTCETLSHKFKGTCLRESNCASVCQTEGFTGGDCRGL  69

Query  324  RHLCYCYKNC  295
            R  C+C K+C
Sbjct  70   RRRCFCTKHC  79



>ref|XP_010250779.1| PREDICTED: defensin Ec-AMP-D2-like [Nelumbo nucifera]
Length=78

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 49/80 (61%), Gaps = 3/80 (4%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            M  SM +   ++F+++ LL++  MG  +   EAR C  +S +F G+CV  + C + C ++
Sbjct  1    MARSMRL-FSILFVVLFLLTATGMGPKV--AEARTCESQSHRFKGICVRKSNCAAVCQTE  57

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF GGHC G R  C+C K+C
Sbjct  58   GFHGGHCRGFRRRCFCTKHC  77



>ref|XP_009351646.1| PREDICTED: defensin Ec-AMP-D2-like [Pyrus x bretschneideri]
Length=78

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 2/80 (3%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            M+ SM +     F+ ++LL +  M GP++  E R C  +S+KF G C+  + C S C ++
Sbjct  1    MERSMRL-FSTAFVFVLLLVATGMMGPML-AEGRTCESQSRKFKGACLSRSNCASVCQTE  58

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF GGHC G R  C+C K+C
Sbjct  59   GFPGGHCRGFRRRCFCTKHC  78



>gb|AAL35366.1|AF442388_1 defensin protein precursor [Capsicum annuum]
 gb|AAR90845.1| defensin precursor [Capsicum annuum]
Length=78

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
            +V ++ ML+ + +MG P+  VEAR C  +S +F GVC     C S C ++GF+GG C G 
Sbjct  10   IVLLLAMLVMATEMG-PMRIVEARTCESQSHRFKGVCASETNCASVCQTEGFSGGDCRGF  68

Query  324  RHLCYCYKNC  295
            R  C+C + C
Sbjct  69   RRRCFCTRPC  78



>ref|XP_006585876.1| PREDICTED: defensin-like protein-like [Glycine max]
Length=127

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 48/77 (62%), Gaps = 2/77 (3%)
 Frame = -1

Query  525  SMNVPLL-VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGF  349
            + +VPL+  +F++++LL + +MG P M  EAR C  +S +F G C+    C S C ++GF
Sbjct  2    ARSVPLVSTIFVLLLLLIATEMG-PTMVAEARTCESQSHRFKGPCLSDTNCGSVCRTEGF  60

Query  348  AGGHCHGLRHLCYCYKN  298
            +GGHC G    C+C K 
Sbjct  61   SGGHCRGFSRRCFCTKE  77



>ref|XP_009604566.1| PREDICTED: defensin J1-2-like [Nicotiana tomentosiformis]
Length=77

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = -1

Query  510  LLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCH  331
               VF+++ML+ + +MG   M  EAR C  +S +F G CV  + C + C ++GF GGHC 
Sbjct  8    FATVFLMLMLIFATEMG--TMVAEARTCESQSHRFKGPCVRKSNCAAVCQTEGFHGGHCR  65

Query  330  GLRHLCYCYKNC  295
            G R  C+C K+C
Sbjct  66   GFRRRCFCTKHC  77



>gb|AAL85480.1| defensin protein 1 [Prunus persica]
Length=79

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 45/80 (56%), Gaps = 1/80 (1%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            M+ SM +        ++L ++  M GP M  EAR C  +S +F G CV  + C S C ++
Sbjct  1    MERSMRLFSTAFVFFLLLAAAGMMMGP-MVAEARTCESQSNRFKGTCVSTSNCASVCQTE  59

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF GGHC G R  C+C K+C
Sbjct  60   GFPGGHCRGFRRRCFCTKHC  79



>ref|XP_009614488.1| PREDICTED: defensin J1-2-like [Nicotiana tomentosiformis]
Length=77

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = -1

Query  510  LLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCH  331
               VF+++ML+ + +MG   M  EAR C  +S +F G CV  + C + C ++GF GGHC 
Sbjct  8    FATVFLMLMLVFATEMG--TMVAEARTCESQSHRFKGPCVRKSNCAAVCQTEGFHGGHCR  65

Query  330  GLRHLCYCYKNC  295
            G R  C+C K+C
Sbjct  66   GFRRRCFCTKHC  77



>ref|XP_006359487.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=76

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 41/70 (59%), Gaps = 3/70 (4%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
              F++ MLL +    GP  +VEAR C  +S  F G C+    C S C ++GF GG+C GL
Sbjct  10   TFFLVTMLLLAT---GPTTRVEARTCESKSHHFKGKCLSDTNCGSVCHTEGFTGGNCRGL  66

Query  324  RHLCYCYKNC  295
            R  C+C +NC
Sbjct  67   RQRCFCTRNC  76



>ref|XP_006359485.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=79

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 39/70 (56%), Gaps = 0/70 (0%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
              F++ MLL S +MG      EAR C  +S  F G CV    C S C ++GF GG C GL
Sbjct  10   TFFLVAMLLLSTEMGPMSGGAEARTCESQSHSFKGPCVGDTNCASVCQTEGFIGGDCRGL  69

Query  324  RHLCYCYKNC  295
            R  C+C +NC
Sbjct  70   RRQCFCTRNC  79



>gb|ADK87340.1| defensin [Pyrus pyrifolia]
 gb|AGC00408.1| defensin 1 [Pyrus pyrifolia]
Length=78

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
              F+ ++LL +  M GP++  E R C  +S+KF G C+  + C S C ++GF GGHC G 
Sbjct  10   TAFVFVLLLVATGMMGPML-AEGRTCESQSRKFKGACLSRSNCASVCQTEGFPGGHCRGF  68

Query  324  RHLCYCYKNC  295
            R  C+C K+C
Sbjct  69   RRRCFCTKHC  78



>ref|XP_009599356.1| PREDICTED: defensin-like protein [Nicotiana tomentosiformis]
Length=75

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 43/76 (57%), Gaps = 1/76 (1%)
 Frame = -1

Query  522  MNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAG  343
            M       F++ MLL + +MG  +   EAR C  +S +F G CV  + C S C ++GF G
Sbjct  1    MGRLFATFFLVAMLLLATEMG-QMSSAEARTCESQSHRFHGTCVRDSNCASICQTEGFIG  59

Query  342  GHCHGLRHLCYCYKNC  295
            G+C G R  C+C +NC
Sbjct  60   GNCRGFRRRCFCTRNC  75



>ref|XP_009413079.1| PREDICTED: defensin Ec-AMP-D2 {ECO:0000303|PubMed:18625284}-like 
[Musa acuminata subsp. malaccensis]
Length=81

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 49/80 (61%), Gaps = 3/80 (4%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            M+ S  +   +V + ++L++S DMG  +  VEAR C   S KF G+C   + C + C ++
Sbjct  1    MEDSRRMLPAIVLLFLLLITS-DMG--MTSVEARKCESASHKFKGLCFRASNCANVCKTE  57

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF GGHC GLR  C+C K+C
Sbjct  58   GFHGGHCRGLRRRCFCTKHC  77



>ref|XP_010671291.1| PREDICTED: defensin Ec-AMP-D2-like [Beta vulgaris subsp. vulgaris]
Length=78

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 41/70 (59%), Gaps = 1/70 (1%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
             + ++M+L SS    GP +  EAR C  RS +F G+C     C + C ++GF GGHC G 
Sbjct  10   ALLLVMLLFSSTAEVGPKV-AEARTCETRSHRFKGICGRKANCAAVCQAEGFQGGHCRGF  68

Query  324  RHLCYCYKNC  295
            R  C+C K+C
Sbjct  69   RRRCFCTKHC  78



>dbj|BAA95697.1| thionin like protein [Nicotiana tabacum]
Length=78

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
             V +I +L+++ +MG P+   EAR C  +S +F G C   + C + CL++GF+GG C G 
Sbjct  10   TVLLIALLVTATEMG-PMTIAEARTCESQSHRFKGPCSRDSNCATVCLTEGFSGGDCRGF  68

Query  324  RHLCYCYKNC  295
            R  C+C + C
Sbjct  69   RRRCFCTRPC  78



>ref|XP_009593292.1| PREDICTED: defensin-like protein P322 [Nicotiana tomentosiformis]
Length=78

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 46/80 (58%), Gaps = 2/80 (3%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            M  SM      V ++ +L  + +MG P+   EAR C  +SQ+F G+CV    C + C ++
Sbjct  1    MAKSMRF-FATVLLLAILFMATEMG-PMTIAEARHCESQSQRFRGLCVREKNCAAVCETE  58

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF+GG C GLR  C+C + C
Sbjct  59   GFSGGDCRGLRRRCFCTRPC  78



>ref|XP_009354384.1| PREDICTED: defensin Ec-AMP-D2-like [Pyrus x bretschneideri]
Length=78

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 47/80 (59%), Gaps = 2/80 (3%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            M+ SM +     F+ ++LL +  M GP++  E R C   S+KF G C+  + C S C ++
Sbjct  1    MERSMRL-FSTAFVFVLLLVATGMMGPML-AEGRTCEAHSRKFKGTCLGKSNCASVCQTE  58

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF GGHC G R  C+C K+C
Sbjct  59   GFHGGHCRGFRRRCFCTKHC  78



>ref|XP_008340514.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
Length=78

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 47/80 (59%), Gaps = 2/80 (3%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            M+ SM +     F+ ++LL +  M GP++  E R C  +S+KF G C+    C S C ++
Sbjct  1    MERSMRL-FSTAFVFVLLLVATGMMGPLL-AEGRTCESQSRKFKGTCLSKTNCASVCQTE  58

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF GG+C G R  C+C K+C
Sbjct  59   GFPGGNCRGFRRRCFCTKHC  78



>ref|XP_011070576.1| PREDICTED: defensin Ec-AMP-D1-like [Sesamum indicum]
Length=84

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 42/72 (58%), Gaps = 0/72 (0%)
 Frame = -1

Query  510  LLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCH  331
             +++ MI  +       G  ++ + + C Y+S+KF G+C+ G KC S C  +GF GG C 
Sbjct  13   FMLLLMIQGICPGAAAEGLRVEEKKKTCLYKSKKFGGICIAGAKCDSVCKREGFQGGKCR  72

Query  330  GLRHLCYCYKNC  295
            GLR  CYC+K C
Sbjct  73   GLRRRCYCFKPC  84



>ref|XP_003628977.1| Defensin [Medicago truncatula]
 ref|XP_003636614.1| Defensin [Medicago truncatula]
 gb|AET03453.1| Defensin MtDef4.2 [Medicago truncatula]
 gb|AFK35827.1| unknown [Medicago truncatula]
Length=76

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 46/78 (59%), Gaps = 4/78 (5%)
 Frame = -1

Query  525  SMNVPLL-VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGF  349
            + +VPL+  +F+ ++LL +    GP M  EAR C  +S KF G C   + C S C ++ F
Sbjct  2    ARSVPLVSTIFVFLLLLVAT---GPSMVAEARTCESQSHKFKGPCASDHNCASVCQTERF  58

Query  348  AGGHCHGLRHLCYCYKNC  295
            +GGHC G R  C+C  +C
Sbjct  59   SGGHCRGFRRRCFCTTHC  76



>ref|XP_009610211.1| PREDICTED: defensin J1-2 [Nicotiana tomentosiformis]
Length=77

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 45/72 (63%), Gaps = 2/72 (3%)
 Frame = -1

Query  510  LLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCH  331
            +  VF+++ML+ + +MG   M  EAR C  +S +F G+C   + C S C ++GF GGHC 
Sbjct  8    VATVFLMLMLVFATEMG--PMVAEARTCESQSHRFKGLCFSKSNCASVCHTEGFYGGHCR  65

Query  330  GLRHLCYCYKNC  295
            G R  C+C ++C
Sbjct  66   GFRRRCFCTRHC  77



>ref|XP_006395809.1| hypothetical protein EUTSA_v10005228mg [Eutrema salsugineum]
 gb|ACQ90606.1| defensin-like protein [Eutrema halophilum]
 gb|ESQ33095.1| hypothetical protein EUTSA_v10005228mg [Eutrema salsugineum]
Length=77

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 48/80 (60%), Gaps = 3/80 (4%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            MK SM +   V+ + M+ +++    GP+  VEAR C  +S +F G C+    C + C ++
Sbjct  1    MKLSMRLISTVILVFMIFVATGM--GPVT-VEARTCESKSHRFKGACLSETNCKNVCHNE  57

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF GG+C GLR  C+C +NC
Sbjct  58   GFRGGNCRGLRRRCFCTRNC  77



>ref|XP_009351645.1| PREDICTED: defensin Ec-AMP-D2-like [Pyrus x bretschneideri]
Length=78

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
              F+ ++LL +  M GP++  E R C   S+KF G C   + C + C ++GF GGHCHG+
Sbjct  10   TAFVFVLLLVATGMMGPML-AEGRTCEAHSRKFKGHCHSKSNCATVCQTEGFQGGHCHGI  68

Query  324  RHLCYCYKNC  295
            R  C+C K+C
Sbjct  69   RRRCFCTKHC  78



>ref|XP_009800136.1| PREDICTED: defensin J1-2-like [Nicotiana sylvestris]
Length=77

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = -1

Query  510  LLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCH  331
               VF+++ML+ + +MG   M  +AR C  +S +F G CV  + C + C ++GF  GHC 
Sbjct  8    FATVFLVLMLVFATEMG--TMVADARTCESQSHRFKGPCVRKSNCAAVCQTEGFHAGHCR  65

Query  330  GLRHLCYCYKNC  295
            G+R  C+C K+C
Sbjct  66   GIRRRCFCTKHC  77



>ref|XP_003629332.1| Defensin [Medicago truncatula]
 gb|AET03808.1| Defensin MtDef4.5 [Medicago truncatula]
Length=81

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = -1

Query  516  VPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGH  337
            + +  +F+ +++L + +MG  IM VEAR C  +S  F G+C+    C + CL++GF  G 
Sbjct  6    LSIRTIFLFLLVLVATEMG-SIMVVEARKCLSQSHSFKGLCLSDQNCATVCLTEGFTDGR  64

Query  336  CHGLRHLCYCYKNC  295
            C G R  C+C K C
Sbjct  65   CRGFRQRCFCSKPC  78



>gb|ACB32234.1| gamma-thionin/defensin [Solanum chacoense]
Length=76

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 46/80 (58%), Gaps = 4/80 (5%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            M  SM +   ++ + M+++++    GP   VEAR C  +S +F G CV    C S C ++
Sbjct  1    MANSMRLFATMLLLAMLVMAT----GPTRIVEARTCESQSHRFKGPCVSEKNCASVCETE  56

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF+GG C GLR  C+C + C
Sbjct  57   GFSGGDCRGLRRRCFCTRPC  76



>ref|XP_004509606.1| PREDICTED: defensin J1-2-like [Cicer arietinum]
Length=74

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 45/78 (58%), Gaps = 6/78 (8%)
 Frame = -1

Query  525  SMNVPLL-VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGF  349
            + ++P++  +F+ ++LL + +M       EAR C  +SQKF G CV    C S C ++ F
Sbjct  2    ARSIPMVSTIFVFLLLLVATEMVA-----EARTCESKSQKFKGACVSDRNCASVCQTERF  56

Query  348  AGGHCHGLRHLCYCYKNC  295
             GGHC G R  C+C  +C
Sbjct  57   PGGHCRGFRRRCFCTTHC  74



>ref|XP_004242747.1| PREDICTED: defensin-like protein [Solanum lycopersicum]
 gb|ABO36635.1| defensin protein [Solanum lycopersicum]
 gb|ABO36640.1| defensin protein [Solanum pimpinellifolium]
Length=76

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 39/70 (56%), Gaps = 3/70 (4%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
              F++ MLL +    GP   VEAR C  +S  F G C+    C S C ++GF GG+C G 
Sbjct  10   TFFLVAMLLLAT---GPTTSVEARTCESQSHHFKGNCLSDTNCGSVCRTEGFTGGNCRGF  66

Query  324  RHLCYCYKNC  295
            R  C+C +NC
Sbjct  67   RRRCFCTRNC  76



>ref|XP_007226630.1| hypothetical protein PRUPE_ppa022845mg [Prunus persica]
 gb|EMJ27829.1| hypothetical protein PRUPE_ppa022845mg [Prunus persica]
Length=87

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 45/80 (56%), Gaps = 12/80 (15%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEAR----------LCNYRSQKFTGVCVVGNKCHSSCLSQ  355
              F++++LL + +MG   M VE R           C+ +SQKF G+C + + C  SC S+
Sbjct  10   AAFVLVLLLVAAEMG--PMAVEGRDAKKVEPKKKTCDSQSQKFKGMCFLTSSCVQSCKSE  67

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF GG C G R  C+C KNC
Sbjct  68   GFTGGQCRGFRRRCFCSKNC  87



>ref|XP_009593293.1| PREDICTED: defensin-like protein P322 [Nicotiana tomentosiformis]
Length=78

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
             V +I +L+ + +MG P+   EAR C  +S +F G C   + C + CL++GF+GG C G 
Sbjct  10   TVLLIALLVMATEMG-PMTIAEARTCESQSHRFKGPCSRDSNCATVCLTEGFSGGDCRGF  68

Query  324  RHLCYCYKNC  295
            R  C+C + C
Sbjct  69   RRRCFCTRPC  78



>ref|XP_004509603.1| PREDICTED: defensin-like protein-like [Cicer arietinum]
Length=78

 Score = 63.2 bits (152),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 45/78 (58%), Gaps = 2/78 (3%)
 Frame = -1

Query  525  SMNVPLL-VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGF  349
            + +VPL+  + +I +LL + +M  PIM  EAR C   S  F G+CV  + C   C ++GF
Sbjct  2    ARSVPLVSTIIVIFLLLVATEMR-PIMVAEARTCESLSYSFKGLCVRDHNCAVVCQTEGF  60

Query  348  AGGHCHGLRHLCYCYKNC  295
             GG C G R  C+C K C
Sbjct  61   TGGQCKGFRRRCFCNKPC  78



>gb|EMT03365.1| Defensin-like protein 1 [Aegilops tauschii]
Length=82

 Score = 63.2 bits (152),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 46/80 (58%), Gaps = 0/80 (0%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            M+ S  +    + ++++L  + +MGGP+   EAR C  +S +F G CV    C + C ++
Sbjct  1    MEASRKLLSAAILLVLLLAGTGEMGGPVAVAEARTCEAKSHRFRGPCVRHRNCANVCKTE  60

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF GG C G RH C+C  +C
Sbjct  61   GFPGGKCRGFRHRCFCTTHC  80



>ref|NP_001048853.1| Os03g0130300 [Oryza sativa Japonica Group]
 gb|AAB17095.1| proteinase inhibitor [Oryza sativa Indica Group]
 gb|AAC00503.1| proteinase inhibitor [Oryza sativa Indica Group]
 dbj|BAA85411.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ABF93798.1| Gamma-thionin PPT precursor, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF10767.1| Os03g0130300 [Oryza sativa Japonica Group]
 dbj|BAH00191.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74445.1| hypothetical protein OsI_09847 [Oryza sativa Indica Group]
 gb|EEE58270.1| hypothetical protein OsJ_09283 [Oryza sativa Japonica Group]
Length=81

 Score = 63.2 bits (152),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = -1

Query  474  SNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            + +MGGP+M  EAR C  +S +F G C     C S C ++GF  G+CHG+R  C C K C
Sbjct  21   TGEMGGPVMVAEARTCESQSHRFKGPCARKANCASVCNTEGFPDGYCHGVRRRCMCTKPC  80



>ref|XP_008389119.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
Length=77

 Score = 62.8 bits (151),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 45/80 (56%), Gaps = 3/80 (4%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            M+ SM   L     + +LL +  M GP M  E R C+ +S +F G CV  + C + C ++
Sbjct  1    MERSMR--LFSTAFLFLLLVATGMMGP-MVAEGRTCDSQSHRFKGSCVSKSNCATVCQTE  57

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF GGHC G R  C+C K+C
Sbjct  58   GFRGGHCRGFRRRCFCTKHC  77



>gb|AIA67010.1| defensin [Triticum aestivum]
Length=84

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            M+ S  +    + ++++L ++ +MGGP+   EAR C  +S +F G CV    C + C ++
Sbjct  3    MEASRKLLSAALLLVLLLAATGEMGGPVAVAEARTCEAKSHRFRGPCVRHRNCANVCKTE  62

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF GG C G RH C+C  +C
Sbjct  63   GFPGGKCRGFRHRCFCTTHC  82



>ref|XP_007033927.1| Scorpion toxin-like knottin superfamily protein [Theobroma cacao]
 gb|EOY04853.1| Scorpion toxin-like knottin superfamily protein [Theobroma cacao]
Length=141

 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 54/98 (55%), Gaps = 7/98 (7%)
 Frame = -1

Query  588  HTITALFPTFLYLSYIPKMKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQK  409
            H++T    + L++  I   K S+ +     F+++++L+S  +  P    E R+C  +S K
Sbjct  51   HSVTKAKVSRLFIEGIEMEKRSLGI----FFLLLIVLASQWVAQP---AEGRVCESKSHK  103

Query  408  FTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            F G C+  + C   C ++GF+GG C G RH C+C K C
Sbjct  104  FKGPCLGDHNCALVCRNEGFSGGRCRGFRHRCFCTKLC  141



>gb|AGT51229.1| defensin [Brassica napus]
 emb|CDY51475.1| BnaC02g47680D [Brassica napus]
Length=77

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 3/80 (4%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            MK SM +   V+ + M+ +++    GP+  VEAR C  +S +F G CV  N C + C ++
Sbjct  1    MKLSMRLISAVLLLFMIFVATGM--GPV-SVEARTCESQSHRFKGPCVSDNNCANVCHNE  57

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF GG C GLR  C+C ++C
Sbjct  58   GFGGGKCRGLRRRCFCTRHC  77



>ref|NP_178319.1| defensin-like protein 2 [Arabidopsis thaliana]
 sp|Q39182.1|DEF02_ARATH RecName: Full=Defensin-like protein 2; AltName: Full=Low-molecular-weight 
cysteine-rich protein 69; Short=Protein LCR69; 
AltName: Full=Plant defensin 2.2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK44170.1|AF370355_1 putative protease inhibitor II [Arabidopsis thaliana]
 emb|CAA48892.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAC97223.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAX39303.1| defensin-like protein [Arabidopsis thaliana]
 gb|AEC05546.1| defensin-like protein 2 [Arabidopsis thaliana]
Length=77

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 48/80 (60%), Gaps = 3/80 (4%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            MK SM +   V+ M M+ +++    GP+  VEAR C  +S +F G CV  + C + C ++
Sbjct  1    MKLSMRLISAVLIMFMIFVATGM--GPV-TVEARTCESQSHRFKGTCVSASNCANVCHNE  57

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF GG+C G R  C+C ++C
Sbjct  58   GFVGGNCRGFRRRCFCTRHC  77



>ref|XP_003630422.1| Defensin [Medicago truncatula]
 gb|AET04898.1| Defensin MtDef4.7 [Medicago truncatula]
Length=74

 Score = 62.4 bits (150),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 43/72 (60%), Gaps = 3/72 (4%)
 Frame = -1

Query  510  LLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCH  331
            L ++FM+ ++L+++     +   E R C  +S KF G CV  + C S C  +GF GG C 
Sbjct  6    LGILFMLFLVLAADV---AVKTAEGRRCESQSHKFKGPCVSDSNCGSVCRGEGFIGGDCR  62

Query  330  GLRHLCYCYKNC  295
            G+RH C+C +NC
Sbjct  63   GVRHRCFCTRNC  74



>ref|NP_001234872.1| gamma-thionin precursor [Solanum lycopersicum]
 emb|CAB42006.1| gamma-thionin [Solanum lycopersicum]
Length=72

 Score = 62.4 bits (150),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 42/72 (58%), Gaps = 1/72 (1%)
 Frame = -1

Query  507  LVVFMIMMLLSSNDMG-GPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCH  331
            + +F  M+LL+   M  GP+  VEAR C  +S +F G CV    C S C ++GF+GG C 
Sbjct  1    MRLFATMLLLAMLVMATGPMRIVEARTCESQSHRFKGPCVSEKNCASVCETEGFSGGDCR  60

Query  330  GLRHLCYCYKNC  295
            G R  C+C + C
Sbjct  61   GFRRRCFCTRPC  72



>emb|CDY48618.1| BnaC09g20670D [Brassica napus]
Length=77

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 48/80 (60%), Gaps = 3/80 (4%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            MK S+ +   V+ M M+ ++S    GP+  VEAR C  +S KF G+CV  + C + C ++
Sbjct  1    MKLSLRLISAVLLMFMIFVASGM--GPVT-VEARTCESKSHKFRGLCVSRHNCANVCHNE  57

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF GG C G R  CYC ++C
Sbjct  58   GFHGGKCRGFRRRCYCTRHC  77



>gb|ABO36637.1| defensin protein [Solanum lycopersicum]
Length=76

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 46/80 (58%), Gaps = 4/80 (5%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            M  SM +   ++ + M+++++    GP+  VEAR C  +S +F G CV    C S C ++
Sbjct  1    MANSMRLFATMLLLAMLVMAT----GPMRIVEARTCESQSHRFKGPCVSEKNCASVCETE  56

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF+GG C G R  C+C + C
Sbjct  57   GFSGGDCRGFRRRCFCTRPC  76



>ref|XP_009129168.1| PREDICTED: defensin-like protein 1 [Brassica rapa]
 emb|CDY09389.1| BnaA02g26210D [Brassica napus]
Length=77

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 3/80 (4%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            MK SM +   V+ + M+ +++    GP+  VEAR C  +S +F G CV  N C + C ++
Sbjct  1    MKLSMRLISAVLLLFMIFVATGM--GPV-SVEARTCESQSHRFKGPCVSENNCANVCHNE  57

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF GG C GLR  C+C ++C
Sbjct  58   GFGGGKCRGLRRRCFCTRHC  77



>gb|ABO36641.1| defensin protein [Solanum pimpinellifolium]
Length=76

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 46/80 (58%), Gaps = 4/80 (5%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            M  SM +   ++ + M+++++    GP+  VEAR C  +S +F G CV    C S C ++
Sbjct  1    MANSMRLFATMLLLAMLVMAT----GPMKIVEARTCESQSHRFKGPCVSEKNCASVCETE  56

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF+GG C G R  C+C + C
Sbjct  57   GFSGGDCRGFRRRCFCTRPC  76



>ref|XP_007159918.1| hypothetical protein PHAVU_002G278600g [Phaseolus vulgaris]
 gb|ESW31912.1| hypothetical protein PHAVU_002G278600g [Phaseolus vulgaris]
Length=75

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 2/63 (3%)
 Frame = -1

Query  495  MIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHL  316
            ++++++ ++DMG  +MK EARLC   S  F G+C     C + CL++GF GG C G RH 
Sbjct  11   LVLLVIFASDMG--VMKSEARLCESPSHSFKGLCFNDRNCANVCLTEGFTGGKCEGARHR  68

Query  315  CYC  307
            C+C
Sbjct  69   CFC  71



>ref|XP_011084089.1| PREDICTED: defensin Ec-AMP-D2-like [Sesamum indicum]
Length=74

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 42/72 (58%), Gaps = 1/72 (1%)
 Frame = -1

Query  510  LLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCH  331
            L  VF ++ML+  +   GP++  EAR C   S +F G CV    C S C ++GF GG+C 
Sbjct  4    LATVFFVLMLVVISTERGPMVG-EARTCESLSHRFKGACVSSTNCASVCHTEGFPGGNCR  62

Query  330  GLRHLCYCYKNC  295
            G R  C+C K+C
Sbjct  63   GFRRRCFCTKHC  74



>ref|XP_009101273.1| PREDICTED: defensin-like protein 2 [Brassica rapa]
 emb|CDY17613.1| BnaA06g34320D [Brassica napus]
Length=77

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 46/80 (58%), Gaps = 3/80 (4%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            MK SM +   V+ + M+ +++    GP+  VEAR C  +S +F G CV    C + C ++
Sbjct  1    MKLSMRLISAVLLLFMIFVATGM--GPVT-VEARTCESKSHRFKGTCVSSTNCGNVCHNE  57

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF GG C G R  CYC ++C
Sbjct  58   GFGGGKCRGFRRRCYCTRHC  77



>dbj|BAK07823.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=105

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 53/102 (52%), Gaps = 2/102 (2%)
 Frame = -1

Query  594  IIHTITALFPTFLYLSYI--PKMKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNY  421
              HT     P    L  +  P M+ S  +    + ++++L ++ ++GGP+M  EAR C  
Sbjct  2    ATHTPALSLPQHPDLRAVADPSMEASRRLLSAALLLVLLLAATGELGGPVMVAEARTCES  61

Query  420  RSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            RS +F G CV  + C + C ++GF  G C G R  C+C  +C
Sbjct  62   RSHRFRGPCVRRSNCANVCKTEGFPDGKCRGFRRRCFCTTHC  103



>ref|XP_006395808.1| hypothetical protein EUTSA_v10005229mg [Eutrema salsugineum]
 gb|ACQ90607.1| defensin-like protein [Eutrema halophilum]
 gb|ESQ33094.1| hypothetical protein EUTSA_v10005229mg [Eutrema salsugineum]
Length=77

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 7/82 (9%)
 Frame = -1

Query  534  MKPSMNV--PLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCL  361
            MK SM +   LL+VFMI +        GP+  VEAR C  +S +F G C+    C + C 
Sbjct  1    MKLSMRLISALLLVFMIFVATGM----GPVT-VEARKCESKSHRFKGKCLSETNCKNVCH  55

Query  360  SQGFAGGHCHGLRHLCYCYKNC  295
            ++GF GG+C G R  C+C +NC
Sbjct  56   NEGFTGGNCRGFRRRCFCTRNC  77



>gb|AIT42148.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 42/72 (58%), Gaps = 1/72 (1%)
 Frame = -1

Query  510  LLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCH  331
               VF++ M++ + +MG P+   EAR C   S +F G C   + C S C ++ F+GG+CH
Sbjct  8    FTTVFLLAMIVMATEMG-PMRIAEARNCESLSHRFKGPCTRDSNCASVCETERFSGGNCH  66

Query  330  GLRHLCYCYKNC  295
            G R  C+C K C
Sbjct  67   GFRRRCFCTKPC  78



>dbj|BAB64929.1| defensin-like protein [Pyrus pyrifolia]
Length=87

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 46/88 (52%), Gaps = 9/88 (10%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMG--------GPIMKVEARLCNYRSQKFTGVCVVGNK  379
            M+PSM + +   F++++LL++ +MG            +VE R C   S KF G+C   N 
Sbjct  1    MEPSMRL-ISAAFVLILLLATTEMGPMGVEAKSKSSKEVEKRTCEAASGKFKGMCFSSNN  59

Query  378  CHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            C ++C  + F GG C G R  C C K C
Sbjct  60   CANTCAREKFDGGKCKGFRRRCMCTKKC  87



>gb|AIT42149.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 41/70 (59%), Gaps = 1/70 (1%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
              F++ ML+ + +MG P+  VEAR C   S +F G C     C S C ++ F+GG+C G 
Sbjct  10   TFFLLAMLVMATEMG-PMRIVEARHCESLSHRFKGPCASDRNCASVCETERFSGGNCRGF  68

Query  324  RHLCYCYKNC  295
            R LC+C K C
Sbjct  69   RRLCFCTKPC  78



>dbj|BAK07043.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=104

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 56/98 (57%), Gaps = 1/98 (1%)
 Frame = -1

Query  585  TITALFPTFLYLSYIPK-MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQK  409
            T+T  +      S I + M+ S  +    +F++++L ++ +MGGP+   EAR C   S  
Sbjct  5    TLTHSYKLHTVQSRINRSMEASRKLLSAALFLVLLLAATGEMGGPVAVAEARRCESPSHM  64

Query  408  FTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            F G CV G+ C + C ++GF GG+C GLR  C+C  +C
Sbjct  65   FRGPCVRGHNCANVCRTEGFPGGNCRGLRRRCFCTTHC  102



>ref|XP_002875115.1| hypothetical protein ARALYDRAFT_484136 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51374.1| hypothetical protein ARALYDRAFT_484136 [Arabidopsis lyrata subsp. 
lyrata]
Length=77

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 47/80 (59%), Gaps = 3/80 (4%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            MK SM +   V+ M M+ +++    GP+  VEAR C  +S +F G CV  + C + C ++
Sbjct  1    MKLSMRLISAVLIMFMVFVATGM--GPVT-VEARTCESKSHRFKGPCVSTHNCANVCHNE  57

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF GG C G R  CYC ++C
Sbjct  58   GFGGGKCRGFRRRCYCTRHC  77



>gb|AIT42147.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 42/72 (58%), Gaps = 1/72 (1%)
 Frame = -1

Query  510  LLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCH  331
              +VF++ M++ + +MG P+  VEAR C   S +F G C     C S C ++ F+GG+C 
Sbjct  8    FTIVFLLAMIVMATEMG-PMRIVEARHCESLSHRFKGPCASDKNCASVCETERFSGGNCR  66

Query  330  GLRHLCYCYKNC  295
            G R  C+C K C
Sbjct  67   GFRRRCFCTKPC  78



>ref|XP_002459605.1| hypothetical protein SORBIDRAFT_02g007410 [Sorghum bicolor]
 gb|EER96126.1| hypothetical protein SORBIDRAFT_02g007410 [Sorghum bicolor]
Length=78

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = -1

Query  522  MNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAG  343
            ++  L  V +++++  + +  GPI    AR C   S KF G C     C S CL++GF G
Sbjct  3    LSAKLFAVLLLLLIGYNTETQGPITMALARKCESPSLKFRGPCSRDANCASVCLTEGFTG  62

Query  342  GHCHGLRHLCYCYKNC  295
            G C GLRH C+C ++C
Sbjct  63   GECKGLRHRCFCTRDC  78



>ref|XP_004242750.1| PREDICTED: defensin-like protein P322 [Solanum lycopersicum]
 gb|ABO36643.1| defensin protein [Solanum pimpinellifolium]
Length=78

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 41/70 (59%), Gaps = 1/70 (1%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
             +F++ ML+ + +MG P   VEAR C   S +F G CV    C S C ++ F+GG+C G 
Sbjct  10   TLFLLAMLVMATEMG-PTRIVEARHCESLSHRFKGPCVSDKNCASVCETERFSGGNCRGF  68

Query  324  RHLCYCYKNC  295
            R  C+C K C
Sbjct  69   RRRCFCTKPC  78



>ref|XP_009351647.1| PREDICTED: defensin-like protein 1 [Pyrus x bretschneideri]
Length=87

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 46/88 (52%), Gaps = 9/88 (10%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMG--------GPIMKVEARLCNYRSQKFTGVCVVGNK  379
            M+PSM + +   F++++LL++ +MG            +VE R C   S KF G+C   N 
Sbjct  1    MEPSMRL-VSAAFVLVLLLATTEMGPMGVEAKSKSSKEVEKRTCEAASGKFKGMCFSSNN  59

Query  378  CHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            C ++C  + F GG C G R  C C K C
Sbjct  60   CANTCAREKFDGGKCKGFRRRCMCTKKC  87



>ref|XP_004503912.1| PREDICTED: defensin-like protein-like [Cicer arietinum]
Length=76

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 3/74 (4%)
 Frame = -1

Query  513  PLLVVFMIMMLLSS-NDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGH  337
             L V+FM  +LL++  D+   +   EAR C  RS +F G C+    C  +C ++GF+GG 
Sbjct  5    TLGVLFMFFLLLTAVTDV--AVKTAEARTCESRSHRFKGTCLSDTTCAHACRNEGFSGGD  62

Query  336  CHGLRHLCYCYKNC  295
            C GLR  C+C + C
Sbjct  63   CRGLRRRCFCNRLC  76



>ref|XP_009114206.1| PREDICTED: defensin-like protein 1 [Brassica rapa]
 emb|CDY04121.1| BnaA09g18990D [Brassica napus]
Length=77

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 47/80 (59%), Gaps = 3/80 (4%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            MK S+ +   V+ M M+ ++S    GP+  VEAR C  +S KF G CV  + C + C ++
Sbjct  1    MKLSLRLISAVLLMFMIFVASGM--GPVT-VEARTCESKSHKFRGPCVSRHNCANVCHNE  57

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF GG C G R  CYC ++C
Sbjct  58   GFHGGKCRGFRRRCYCTRHC  77



>ref|XP_010319372.1| PREDICTED: defensin Ec-AMP-D2-like [Solanum lycopersicum]
Length=73

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 43/72 (60%), Gaps = 6/72 (8%)
 Frame = -1

Query  510  LLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCH  331
            L   F+++ML+ + ++       EAR C  +S ++ G CV  N C + C ++GF+GGHC 
Sbjct  8    LATFFLVLMLVFAAEL------TEARTCESQSHRYKGPCVRKNNCANVCKTEGFSGGHCR  61

Query  330  GLRHLCYCYKNC  295
            G R  C+C K+C
Sbjct  62   GFRRRCFCAKHC  73



>gb|AFW90621.1| protease inhibitor-related protein [Solanum tuberosum]
 gb|AIT42151.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 41/70 (59%), Gaps = 1/70 (1%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
              F++ ML+ + +MG P+   EAR C   S +F G C   + C S C ++ F+GG+CHG 
Sbjct  10   TFFLLAMLVMATEMG-PMRIAEARNCESLSHRFKGPCTRDSNCASVCETERFSGGNCHGF  68

Query  324  RHLCYCYKNC  295
            R  C+C K C
Sbjct  69   RRRCFCTKPC  78



>ref|XP_006292136.1| hypothetical protein CARUB_v10018340mg [Capsella rubella]
 gb|EOA25034.1| hypothetical protein CARUB_v10018340mg [Capsella rubella]
Length=77

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 48/80 (60%), Gaps = 3/80 (4%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            MK SM +   V+ M M+ +++    GP+  VEAR C  +S +F G C+  + C + C ++
Sbjct  1    MKLSMRLISAVLVMFMIFVATGM--GPVT-VEARTCESKSHRFKGTCLSESNCKNVCHNE  57

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF GG+C G R  C+C ++C
Sbjct  58   GFQGGNCRGFRRRCFCTRHC  77



>gb|AAA91049.1| protease inhibitor II [Brassica rapa]
Length=77

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 46/80 (58%), Gaps = 3/80 (4%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            MK SM +   V+ + M+ +++    GP+  VEAR C  +S +F G CV    C + C ++
Sbjct  1    MKLSMRLISAVLLLFMIFVATGM--GPVT-VEARTCESKSHRFKGTCVSSTNCGNVCHNE  57

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF GG C G R  CYC ++C
Sbjct  58   GFGGGKCRGFRVRCYCTRHC  77



>gb|ACJ26760.1| protease inhibitor-related protein [Solanum tuberosum]
Length=78

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 41/70 (59%), Gaps = 1/70 (1%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
              F++ ML+ + +MG P+   EAR C   S +F G C   + C S C ++ F+GG+CHG 
Sbjct  10   TFFLLAMLVMATEMG-PMRIAEARHCESLSHRFKGPCTRDSNCASVCETERFSGGNCHGF  68

Query  324  RHLCYCYKNC  295
            R  C+C K C
Sbjct  69   RRRCFCTKPC  78



>ref|XP_003628978.1| Defensin [Medicago truncatula]
 ref|XP_003636615.1| Defensin [Medicago truncatula]
 gb|AET03454.1| Defensin MtDef4.3 [Medicago truncatula]
Length=77

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 38/70 (54%), Gaps = 2/70 (3%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
             +F+  +L+ + +MG P M V AR C   S  F G C     C S C ++GF GGHC G 
Sbjct  10   TIFVFFLLIVATEMG-PSM-VAARTCETPSNSFKGACFSDTNCASVCQTEGFPGGHCKGF  67

Query  324  RHLCYCYKNC  295
            R  C+C K C
Sbjct  68   RQRCFCTKPC  77



>ref|XP_007156390.1| hypothetical protein PHAVU_003G282400g [Phaseolus vulgaris]
 gb|ESW28384.1| hypothetical protein PHAVU_003G282400g [Phaseolus vulgaris]
Length=78

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 40/69 (58%), Gaps = 1/69 (1%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
             +F+ ++LL + +MG P M  EAR C  RS+   G C     C S+C ++ F+GGHC G 
Sbjct  10   TIFVFLLLLLATEMG-PRMVAEARGCESRSRHLRGKCESDENCASACRTERFSGGHCRGF  68

Query  324  RHLCYCYKN  298
            R  C+C K 
Sbjct  69   RCRCFCDKR  77



>gb|AIA67013.1| defensin [Triticum aestivum]
Length=76

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -1

Query  522  MNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAG  343
            M++ + VV ++++LL + +  GP+    AR C  +S KF G+CV  + C S CL +GF G
Sbjct  1    MDLSMKVVVVVLLLLVTTEDQGPVQLALARDCQSKSFKFKGMCVRDDNCASVCLLEGFTG  60

Query  342  GHCHGLRHLCYCYKNC  295
            G C G  H CYC K+C
Sbjct  61   GKCKGFWHRCYCTKDC  76



>gb|AGT51228.1| defensin [Brassica napus]
 emb|CDY03076.1| BnaC07g21510D [Brassica napus]
Length=76

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 45/77 (58%), Gaps = 2/77 (3%)
 Frame = -1

Query  525  SMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFA  346
            ++++ L+   ++ M+  +  MG P+  VEAR C  +S +F G CV    C + C ++GF 
Sbjct  2    NLSMRLISAVLLFMIFVATGMG-PVT-VEARTCESKSHRFKGTCVSSTNCGNVCHNEGFG  59

Query  345  GGHCHGLRHLCYCYKNC  295
            GG C G R  CYC ++C
Sbjct  60   GGKCRGFRRRCYCTRHC  76



>gb|AIA67012.1| defensin [Triticum aestivum]
Length=82

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = -1

Query  474  SNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            + ++GGP+M  EAR C  RS +F G CV  + C + C ++GF+ G C G R  C+C  +C
Sbjct  21   TGELGGPVMVAEARTCESRSHRFRGPCVRRSNCANVCRTEGFSDGKCRGFRRRCFCTTHC  80



>gb|AIT42153.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
              F++ ML+ S +MG P+  VEAR C   S +F G C     C S C ++ F+GG+C G 
Sbjct  10   TFFLLAMLVMSTEMG-PMRIVEARHCESLSHRFKGPCASDKNCASVCETERFSGGNCRGF  68

Query  324  RHLCYCYKNC  295
            R  C+C K C
Sbjct  69   RRRCFCTKPC  78



>ref|XP_010513973.1| PREDICTED: defensin-like protein 1 [Camelina sativa]
Length=77

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 48/80 (60%), Gaps = 3/80 (4%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            MK SM +   V+ M M+ +++    GP+  VEAR C  +S +F G CV  + C + C ++
Sbjct  1    MKLSMRLISAVLLMFMLFVATGM--GPVT-VEARTCESKSHRFRGPCVSRHNCGNVCHNE  57

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF+GG C G R  C+C ++C
Sbjct  58   GFSGGKCRGFRRRCFCTRHC  77



>ref|XP_010495961.1| PREDICTED: defensin-like protein 1 [Camelina sativa]
Length=77

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 48/80 (60%), Gaps = 3/80 (4%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            MK SM +   V+ M M+ +++    GP+  VEAR C  +S +F G CV  + C + C ++
Sbjct  1    MKLSMRLISAVLLMFMIFVATGM--GPVT-VEARTCESKSHRFRGPCVSRHNCGNVCHNE  57

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF+GG C G R  C+C ++C
Sbjct  58   GFSGGKCRGFRRRCFCTRHC  77



>ref|XP_008349481.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 ref|XP_008344620.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 ref|XP_008363304.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 gb|AFH74424.1| defensin [Malus domestica]
Length=75

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 46/81 (57%), Gaps = 7/81 (9%)
 Frame = -1

Query  534  MKPSMNV-PLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLS  358
            M+ SM + P   VF+++++ +        M  E R C  +S +F G CV  + C + C +
Sbjct  1    MERSMRLFPTAFVFLLLLVATG------TMVAEGRTCESQSNRFKGTCVSKSNCAAVCQT  54

Query  357  QGFAGGHCHGLRHLCYCYKNC  295
            +GF GG+C GLR  C+C K+C
Sbjct  55   EGFPGGNCRGLRRRCFCTKHC  75



>gb|ADQ43196.1| unknown [Eutrema parvulum]
Length=76

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 45/80 (56%), Gaps = 4/80 (5%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            MK SM +    + M M+ +++    GP+  VEAR C  +S +F G C+    C + C ++
Sbjct  1    MKLSMRLISAALLMFMIFVAAM---GPVT-VEARTCESQSHRFKGKCLSDGNCGNVCHNE  56

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF GG C G R  C+C +NC
Sbjct  57   GFGGGKCRGFRRRCFCTRNC  76



>ref|XP_011070575.1| PREDICTED: defensin Ec-AMP-D2-like [Sesamum indicum]
Length=88

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 35/61 (57%), Gaps = 2/61 (3%)
 Frame = -1

Query  477  SSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKN  298
            SS D G  +   E +LC Y+S+KF GVC+    C   C  +GF GG C G R  CYCY +
Sbjct  29   SSADAGVKVE--EKKLCTYKSEKFWGVCLSDISCADVCKREGFEGGDCQGFRRRCYCYNH  86

Query  297  C  295
            C
Sbjct  87   C  87



>ref|XP_002274353.1| PREDICTED: defensin Ec-AMP-D2 [Vitis vinifera]
 emb|CBI27507.3| unnamed protein product [Vitis vinifera]
Length=77

 Score = 60.1 bits (144),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 45/80 (56%), Gaps = 3/80 (4%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            MK S    L   F++++LL      GP M  EAR C  +S +F G CV  + C + C ++
Sbjct  1    MKGSQR--LFSAFLLVILLFMATEMGP-MVAEARTCESQSHRFKGTCVRQSNCAAVCQTE  57

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF GG+C G R  C+C K+C
Sbjct  58   GFHGGNCRGFRRRCFCTKHC  77



>sp|P20346.1|DF322_SOLTU RecName: Full=Defensin-like protein P322; AltName: Full=Probable 
protease inhibitor P322; Flags: Precursor [Solanum tuberosum]
 emb|CAA31577.1| unnamed protein product [Solanum tuberosum]
Length=74

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 1/72 (1%)
 Frame = -1

Query  510  LLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCH  331
                F++ ML+ +  MG P+   EAR C   S +F G C   + C S C ++ F+GG+CH
Sbjct  4    FATFFLLAMLVVATKMG-PMRIAEARHCESLSHRFKGPCTRDSNCASVCETERFSGGNCH  62

Query  330  GLRHLCYCYKNC  295
            G R  C+C K C
Sbjct  63   GFRRRCFCTKPC  74



>gb|AGT51227.1| defensin [Brassica napus]
Length=77

 Score = 59.7 bits (143),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 47/80 (59%), Gaps = 3/80 (4%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            MK S+ +   V+ MIM+ ++S    GP+  VEAR    +S KF G CV  + C + C ++
Sbjct  1    MKLSLRLISAVLLMIMIFVASGM--GPVT-VEARTSESKSHKFRGPCVSRHNCANVCHNE  57

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF GG C G R  CYC ++C
Sbjct  58   GFHGGKCRGFRRRCYCTRHC  77



>gb|EMS65298.1| Defensin-like protein 1 [Triticum urartu]
Length=82

 Score = 59.7 bits (143),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = -1

Query  474  SNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            + ++GGP+M  EAR C  RS +F G CV  + C + C ++GF  G C G R  C+C  +C
Sbjct  21   TGELGGPVMVAEARTCESRSHRFRGPCVRRSNCANVCKTEGFPDGKCRGFRRRCFCTTHC  80



>gb|AIT42152.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
              F++ ML+ + +MG P+  VEAR C   S +F G C     C S C ++ F+GG+C G 
Sbjct  10   TFFLLAMLVMATEMG-PMRIVEARHCESLSHRFKGPCASDRNCASVCETERFSGGNCRGF  68

Query  324  RHLCYCYKNC  295
            R  C+C K C
Sbjct  69   RRRCFCTKPC  78



>ref|XP_006367121.1| PREDICTED: defensin J1-2-like [Solanum tuberosum]
Length=74

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 43/70 (61%), Gaps = 6/70 (9%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
            ++ M+M++ S+       M  EAR C  +S++F G+C   + C S C ++GF+GGHC G 
Sbjct  11   ILLMLMLVFSTG------MIAEARTCESQSRRFKGLCFSKSNCGSVCHTEGFSGGHCRGF  64

Query  324  RHLCYCYKNC  295
            R  C+C ++C
Sbjct  65   RRRCFCTRHC  74



>gb|AFE88173.1| g-thionin [Panax ginseng]
Length=75

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 37/70 (53%), Gaps = 4/70 (6%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
             +FM++MLL    M   +   E R C  +S KF G C  G  C + C ++GF GG C G 
Sbjct  10   TIFMVLMLL----MATGLEPAEGRTCESQSHKFKGTCASGTNCANVCKTEGFPGGKCRGF  65

Query  324  RHLCYCYKNC  295
            R  C+C  +C
Sbjct  66   RRRCFCTTHC  75



>ref|XP_006392063.1| hypothetical protein EUTSA_v10023787mg [Eutrema salsugineum]
 gb|ESQ29349.1| hypothetical protein EUTSA_v10023787mg [Eutrema salsugineum]
Length=79

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 43/80 (54%), Gaps = 1/80 (1%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            MK  +++PL+    IM++L      GP+  VEAR+C   SQ F G C+    C + C ++
Sbjct  1    MKMKISLPLISAIAIMLMLLLATGMGPV-TVEARMCESSSQLFNGPCLSTTNCANICHNE  59

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF  G C G R  C C + C
Sbjct  60   GFTDGDCQGFRRRCICTRPC  79



>sp|O65740.1|DEF2_CAPAN RecName: Full=Defensin J1-2; Flags: Precursor [Capsicum annuum]
 emb|CAA65046.1| unnamed protein product [Capsicum annuum]
Length=74

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 42/72 (58%), Gaps = 5/72 (7%)
 Frame = -1

Query  510  LLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCH  331
            +  +F++MML+ +  M       EAR C  +S +F G+C   + C S C ++GF GGHC 
Sbjct  8    IATIFLMMMLVFATGM-----VAEARTCESQSHRFKGLCFSKSNCGSVCHTEGFNGGHCR  62

Query  330  GLRHLCYCYKNC  295
            G R  C+C ++C
Sbjct  63   GFRRRCFCTRHC  74



>ref|NP_001148158.1| LOC100281766 precursor [Zea mays]
 ref|NP_001152925.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACG25111.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACG29960.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACG46032.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACG49139.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACN27540.1| unknown [Zea mays]
 tpg|DAA60145.1| TPA: flower-specific gamma-thionin [Zea mays]
Length=78

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = -1

Query  474  SNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            +   GGP+  V AR C  +S +F G C     C + CL++GF GG C GLRH C+C ++C
Sbjct  19   TGTQGGPVTMVSARKCESQSFRFKGPCSRDANCANVCLTEGFTGGVCKGLRHRCFCTRDC  78



>ref|XP_006420697.1| hypothetical protein CICLE_v10006362mg [Citrus clementina]
 ref|XP_006470884.1| PREDICTED: defensin-like protein-like [Citrus sinensis]
 gb|ESR33937.1| hypothetical protein CICLE_v10006362mg [Citrus clementina]
 gb|KDO53542.1| hypothetical protein CISIN_1g034999mg [Citrus sinensis]
Length=76

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 46/77 (60%), Gaps = 2/77 (3%)
 Frame = -1

Query  525  SMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFA  346
              +V L    ++++LL +++MG  +   EAR+C  +S +F G CV  + C + C ++GF 
Sbjct  2    ERSVRLFSTVLLVLLLLASEMG--LRAAEARICESQSHRFKGPCVSKSNCAAVCQTEGFH  59

Query  345  GGHCHGLRHLCYCYKNC  295
            GGHC G R  C+C K C
Sbjct  60   GGHCRGFRRRCFCTKRC  76



>ref|XP_002459604.1| hypothetical protein SORBIDRAFT_02g007400 [Sorghum bicolor]
 gb|EER96125.1| hypothetical protein SORBIDRAFT_02g007400 [Sorghum bicolor]
Length=78

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 42/76 (55%), Gaps = 0/76 (0%)
 Frame = -1

Query  522  MNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAG  343
            ++  L  V +++++    +M GP+    AR C  +S KF G C     C + CL++GF  
Sbjct  3    LSTKLFAVLLLLLIGGYTEMQGPVTVALARKCQSKSFKFKGPCSRDENCATVCLTEGFTS  62

Query  342  GHCHGLRHLCYCYKNC  295
            G C GLR  C+C ++C
Sbjct  63   GKCRGLRRRCFCTRDC  78



>gb|KHG09995.1| Defensin-like protein 1 [Gossypium arboreum]
Length=75

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 43/70 (61%), Gaps = 3/70 (4%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
            ++FM+++L++    GG    VE R+C  +S +F GVC+  + C   C ++GF  G C G 
Sbjct  9    MMFMLLLLVALASHGGV---VEGRICESKSHRFKGVCLSDHNCGLVCRNEGFLDGWCRGF  65

Query  324  RHLCYCYKNC  295
            RH C+C +NC
Sbjct  66   RHRCFCTRNC  75



>ref|XP_007226225.1| hypothetical protein PRUPE_ppa016594mg [Prunus persica]
 gb|EMJ27424.1| hypothetical protein PRUPE_ppa016594mg [Prunus persica]
Length=87

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 2/58 (3%)
 Frame = -1

Query  462  GGPIMKVE--ARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            G    KVE   R C  +SQKF G+C + + C +SC ++GF GG C G R  C+C K C
Sbjct  30   GRSAKKVEPKKRTCESQSQKFKGICFLSSNCATSCTTEGFNGGQCRGFRRRCFCSKAC  87



>ref|XP_010910081.1| PREDICTED: defensin Ec-AMP-D2-like [Elaeis guineensis]
Length=77

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = -1

Query  510  LLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCH  331
            L  + ++++++ +++M    M VEAR C  +S KF G C+  + C + C ++GF GG C 
Sbjct  8    LPAILLLVLIVVASEMA--TMMVEARTCESQSHKFKGPCLRASNCANVCKTEGFHGGKCR  65

Query  330  GLRHLCYCYKNC  295
            G R  C+C K+C
Sbjct  66   GFRRRCFCTKHC  77



>gb|KDP32807.1| hypothetical protein JCGZ_12099 [Jatropha curcas]
Length=77

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -1

Query  459  GPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            GP M  EAR C   S +F G+CV  + C + C ++GF GGHC GLR  C+C K+C
Sbjct  24   GP-MVAEARTCESLSHRFKGICVRNSNCAAICQTEGFQGGHCRGLRRRCFCTKHC  77



>ref|XP_008793609.1| PREDICTED: defensin Ec-AMP-D1-like isoform X1 [Phoenix dactylifera]
Length=78

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 48/80 (60%), Gaps = 2/80 (3%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            M+ S  +   ++ ++ +L+SS +MG  +  VEAR C  +S +F G C+  + C + C ++
Sbjct  1    MEHSRRLLPAILLLLFLLISSEEMGTKV--VEARTCESQSHRFKGTCLRASNCANVCQTE  58

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF GG C GLR  C+C K C
Sbjct  59   GFQGGVCRGLRGRCFCTKRC  78



>gb|AFJ04517.1| low-molecular-weight cysteine-rich 69 [Vernicia fordii]
Length=73

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -1

Query  444  VEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
             EAR C  +S KF G C+    C S C ++GF GG C GLR  C+C +NC
Sbjct  24   TEARTCESQSHKFKGTCLSETNCASVCKTEGFTGGDCRGLRRRCFCTRNC  73



>ref|NP_176302.2| defensin-like protein [Arabidopsis thaliana]
 sp|Q9C947.2|DEF05_ARATH RecName: Full=Defensin-like protein 5; AltName: Full=Low-molecular-weight 
cysteine-rich protein 66; Short=Protein LCR66; 
AltName: Full=Plant defensin 2.4; Flags: Precursor [Arabidopsis 
thaliana]
 gb|ABE65729.1| plant defensin-fusion protein [Arabidopsis thaliana]
 gb|AEE33774.1| defensin-like protein [Arabidopsis thaliana]
Length=76

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 45/81 (56%), Gaps = 6/81 (7%)
 Frame = -1

Query  537  KMKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLS  358
            K+ P +N  LL++FMI+  +    MG  ++ VEAR C   S  F G C+  + C + C +
Sbjct  2    KVSPRLNSALLLLFMILATV----MG--LVTVEARTCETSSNLFNGPCLSSSNCANVCHN  55

Query  357  QGFAGGHCHGLRHLCYCYKNC  295
            +GF+ G C G R  C C + C
Sbjct  56   EGFSDGDCRGFRRRCLCTRPC  76



>gb|ABK28445.1| unknown [Arabidopsis thaliana]
Length=77

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 45/81 (56%), Gaps = 6/81 (7%)
 Frame = -1

Query  537  KMKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLS  358
            K+ P +N  LL++FMI+  +    MG  ++ VEAR C   S  F G C+  + C + C +
Sbjct  2    KVSPRLNSALLLLFMILATV----MG--LVTVEARTCETSSNLFNGPCLSSSNCANVCHN  55

Query  357  QGFAGGHCHGLRHLCYCYKNC  295
            +GF+ G C G R  C C + C
Sbjct  56   EGFSDGDCRGFRRRCLCTRPC  76



>ref|NP_178322.1| defensin-like protein 10 [Arabidopsis thaliana]
 sp|Q9ZUL8.1|DEF10_ARATH RecName: Full=Defensin-like protein 10; AltName: Full=Low-molecular-weight 
cysteine-rich protein 72; Short=Protein LCR72; 
AltName: Full=Plant defensin 2.6; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC97220.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAM64623.1| protease inhibitor II [Arabidopsis thaliana]
 gb|ABI49429.1| At2g02140 [Arabidopsis thaliana]
 gb|AEC05550.1| defensin-like protein 10 [Arabidopsis thaliana]
Length=73

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 45/80 (56%), Gaps = 7/80 (9%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            MK S+ + +  + M +MLL +  MG     VEAR C   S KF GVC+    C  +C S+
Sbjct  1    MKLSLRL-ISALLMSVMLLFATGMG----PVEARTCESPSNKFQGVCLNSQSCAKACPSE  55

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF+GG C  LR  CYC K C
Sbjct  56   GFSGGRCSSLR--CYCSKAC  73



>ref|XP_006292846.1| hypothetical protein CARUB_v10019106mg [Capsella rubella]
 gb|EOA25744.1| hypothetical protein CARUB_v10019106mg [Capsella rubella]
Length=73

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 40/70 (57%), Gaps = 6/70 (9%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
             + + +MLL +  MG     VEAR C   S KF+GVC+    C  +C S+GF GG C+ L
Sbjct  10   ALLLSIMLLFATGMG----PVEARTCESPSSKFSGVCLNSQTCAKACPSEGFTGGRCNSL  65

Query  324  RHLCYCYKNC  295
            R  CYC K C
Sbjct  66   R--CYCSKPC  73



>ref|XP_009769843.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
Length=78

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = -1

Query  459  GPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            GP+   EAR C  +S +F G C   + C + CL++GF+GG C G R  C+C + C
Sbjct  24   GPMTIAEARTCESQSHRFKGPCSRDSNCATVCLTEGFSGGDCRGFRRRCFCTRPC  78



>ref|XP_010513972.1| PREDICTED: defensin-like protein 2 [Camelina sativa]
 ref|XP_010495963.1| PREDICTED: defensin-like protein 2 [Camelina sativa]
Length=77

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 47/80 (59%), Gaps = 3/80 (4%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            MK S+ +   V+ + M+ +++    GP+  VEAR C  +S +F G C     C + C ++
Sbjct  1    MKLSIRLISAVLVLFMIFVATGM--GPVT-VEARTCESKSHRFKGKCFSETNCRNVCHNE  57

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF+GG+C G R  C+C ++C
Sbjct  58   GFSGGNCRGFRRRCFCTRHC  77



>gb|AAP80654.1|AF479035_1 proteinase inhibitor Rgpi9, partial [Triticum aestivum]
Length=90

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = -1

Query  474  SNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            + +MGGP+   EAR C   S +F G+C+ G+ C + C ++GF GG C G    C+C  +C
Sbjct  30   TGEMGGPVAVAEARKCESLSHRFAGLCLRGHNCANVCRTEGFPGGKCRGASRRCFCTTHC  89



>gb|EMT03364.1| Defensin SD2 [Aegilops tauschii]
 gb|AIA67006.1| defensin [Triticum aestivum]
Length=81

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = -1

Query  474  SNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            + +MGGP+   EAR C   S +F G+C+ G+ C + C ++GF GG C G    C+C  +C
Sbjct  21   TGEMGGPVAVAEARKCESLSHRFAGLCLRGHNCANVCRTEGFPGGKCRGASRRCFCTTHC  80



>gb|EMS65297.1| Defensin SD2 [Triticum urartu]
 gb|AIA67005.1| defensin [Triticum aestivum]
Length=78

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = -1

Query  474  SNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            + +MGGP+   EAR C   S +F G+C+ G+ C + C ++GF  G C G R  C+C  +C
Sbjct  18   TGEMGGPVAVAEARRCESLSHRFAGLCLRGHNCANVCRTEGFPDGKCRGARRRCFCTTHC  77



>gb|EYU30124.1| hypothetical protein MIMGU_mgv1a017438mg [Erythranthe guttata]
Length=75

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 43/81 (53%), Gaps = 7/81 (9%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEA-RLCNYRSQKFTGVCVVGNKCHSSCLS  358
            M   + +    +FM+M++ S+       M  EA R C  +S +F G+C     C + C +
Sbjct  1    MASFLRLFATALFMVMLVFSTG------MVAEATRTCEAKSHRFKGICARKANCAAVCQT  54

Query  357  QGFAGGHCHGLRHLCYCYKNC  295
            +GF GGHC G R  C+C K+C
Sbjct  55   EGFHGGHCRGFRRRCFCTKHC  75



>ref|NP_178321.1| defensin-like protein 1 [Arabidopsis thaliana]
 sp|Q9ZUL7.1|DEF01_ARATH RecName: Full=Defensin-like protein 1; AltName: Full=Low-molecular-weight 
cysteine-rich protein 68; Short=Protein LCR68; 
AltName: Full=Plant defensin 2.3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC97221.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAK93656.1| putative protease inhibitor II [Arabidopsis thaliana]
 gb|AAL85136.1| putative protease inhibitor II [Arabidopsis thaliana]
 gb|AEC05549.1| defensin-like protein 1 [Arabidopsis thaliana]
Length=77

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 45/80 (56%), Gaps = 3/80 (4%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            MK S+      + + M+ +++    GP+  VEAR C  +S +F G CV  + C + C ++
Sbjct  1    MKLSVRFISAALLLFMVFIATGM--GPVT-VEARTCESKSHRFKGPCVSTHNCANVCHNE  57

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF GG C G R  CYC ++C
Sbjct  58   GFGGGKCRGFRRRCYCTRHC  77



>gb|AAM62652.1| protease inhibitor II [Arabidopsis thaliana]
Length=76

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 44/81 (54%), Gaps = 6/81 (7%)
 Frame = -1

Query  537  KMKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLS  358
            K+ P +   LL++FMI+  +      GP+ +VEAR C   S  F G C+  + C + C +
Sbjct  2    KVSPRLKSALLLLFMILATVM-----GPV-RVEARTCETSSNLFNGPCLSSSNCANVCHN  55

Query  357  QGFAGGHCHGLRHLCYCYKNC  295
            +GF+ G C G R  C C + C
Sbjct  56   EGFSDGDCRGFRRRCLCTRPC  76



>ref|XP_006292781.1| hypothetical protein CARUB_v10019030mg [Capsella rubella]
 gb|EOA25679.1| hypothetical protein CARUB_v10019030mg [Capsella rubella]
Length=77

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 46/80 (58%), Gaps = 3/80 (4%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            MK S+ +   V+ + M+ +++    GP+  VEAR C  +S +F G C     C + C ++
Sbjct  1    MKLSIRLISAVLVLFMIFVATGM--GPVT-VEARTCESKSHRFKGKCFSETNCKNVCHNE  57

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF GG+C G R  C+C ++C
Sbjct  58   GFTGGNCRGFRRRCFCTRHC  77



>ref|XP_010260874.1| PREDICTED: defensin D2-like [Nelumbo nucifera]
Length=72

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 44/72 (61%), Gaps = 4/72 (6%)
 Frame = -1

Query  510  LLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCH  331
            +L V++++  ++       ++ V+AR+C+  S+ F G+C++   C ++C  +GF  GHC 
Sbjct  3    ILTVYVLLWFVAEE----MVVHVDARMCDTPSRLFRGLCLINRNCDNTCRVEGFPDGHCK  58

Query  330  GLRHLCYCYKNC  295
            GLR  C+C + C
Sbjct  59   GLRRRCFCSRPC  70



>gb|KEH35661.1| Defensin [Medicago truncatula]
Length=73

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 43/76 (57%), Gaps = 3/76 (4%)
 Frame = -1

Query  522  MNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAG  343
            MN      F I+++L ++ M   +++ E R C  +S +F G+C+  + C S C  +GF G
Sbjct  1    MNKTRFGFFFILLILLASQM---MVQTEGRHCESKSHRFKGMCMSDHNCASVCHVEGFPG  57

Query  342  GHCHGLRHLCYCYKNC  295
            G+C G R  C+C K C
Sbjct  58   GNCRGFRRRCFCKKRC  73



>gb|ADQ43197.1| unknown [Eutrema parvulum]
Length=72

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 46/80 (58%), Gaps = 8/80 (10%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            MK S+ +   ++   M+LL++  MG    +VEA+ C   S K+ GVC+    C S C S+
Sbjct  1    MKLSLRLASSILLSFMLLLAA--MG----QVEAKTCESPSGKYHGVCLNAKNCASVCPSE  54

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF GGHC  LR  CYC K C
Sbjct  55   GFTGGHCKSLR--CYCIKTC  72



>ref|XP_009792224.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
Length=78

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 32/55 (58%), Gaps = 0/55 (0%)
 Frame = -1

Query  459  GPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            GP+   EAR C  +  +F G C     C + CL++GF+GG C GLR  C+C + C
Sbjct  24   GPMTIAEARTCESQRHRFKGPCSRDGNCATVCLTEGFSGGDCRGLRRRCFCTRPC  78



>ref|XP_008340513.1| PREDICTED: defensin-like protein 1 [Malus domestica]
 gb|AFH74425.1| defensin [Malus domestica]
Length=87

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 45/88 (51%), Gaps = 9/88 (10%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMG--------GPIMKVEARLCNYRSQKFTGVCVVGNK  379
            M+ SM + +   F++++LL++ +MG            +VE R C   S KF G+C   N 
Sbjct  1    MEHSMRL-VSAAFVLVLLLATTEMGPMGVEAKSKSSKEVEKRTCEAASGKFKGMCFSSNN  59

Query  378  CHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            C ++C  + F GG C G R  C C K C
Sbjct  60   CANTCAREKFDGGKCKGFRRRCMCTKKC  87



>ref|XP_002875116.1| hypothetical protein ARALYDRAFT_904442 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51375.1| hypothetical protein ARALYDRAFT_904442 [Arabidopsis lyrata subsp. 
lyrata]
Length=73

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 45/80 (56%), Gaps = 7/80 (9%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            MK S+ + +  + + +MLL +  MG     VEAR C   S KF GVC+    C  +C S+
Sbjct  1    MKLSLRL-ISALLLSVMLLFATGMG----PVEARTCESPSNKFQGVCLNSQSCAKACPSE  55

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF+GG C  LR  CYC K C
Sbjct  56   GFSGGRCSSLR--CYCSKAC  73



>gb|AIT42150.1| defensin-like protein [Solanum tuberosum]
Length=63

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 37/64 (58%), Gaps = 1/64 (2%)
 Frame = -1

Query  486  MLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYC  307
            ML+ S +MG P+  VEAR C   S +F G C     C S C ++ F+GG+C G R  C+C
Sbjct  1    MLVMSTEMG-PMRIVEARHCESLSHRFKGPCASDKNCASVCETERFSGGNCRGFRRRCFC  59

Query  306  YKNC  295
             K C
Sbjct  60   TKPC  63



>gb|AAS65426.1| Kunitz-type trypsin inhibitor [Ipomoea batatas]
Length=80

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 37/67 (55%), Gaps = 1/67 (1%)
 Frame = -1

Query  492  IMMLLSSNDMG-GPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHL  316
             +ML  + ++G   IM  EAR+C   S KF G C   + C + C ++GF GG C G R  
Sbjct  14   FVMLFMATELGTNRIMVAEARMCESASSKFKGPCSRDSNCATVCHTEGFTGGDCKGFRRR  73

Query  315  CYCYKNC  295
            C+C K C
Sbjct  74   CFCTKPC  80



>ref|XP_010502227.1| PREDICTED: defensin-like protein 2 [Camelina sativa]
Length=77

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 46/80 (58%), Gaps = 3/80 (4%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            MK S+ +   V+ + M+ +++    GP+  VEAR C  +S +F G C     C + C ++
Sbjct  1    MKLSIRLISAVLVLFMIFVATGM--GPVT-VEARTCESQSHRFKGKCFSETNCRNVCHNE  57

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF+GG+C G R  C+C + C
Sbjct  58   GFSGGNCRGFRRRCFCTRYC  77



>ref|XP_007033370.1| Scorpion toxin-like knottin superfamily protein [Theobroma cacao]
 gb|EOY04296.1| Scorpion toxin-like knottin superfamily protein [Theobroma cacao]
Length=76

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 42/68 (62%), Gaps = 3/68 (4%)
 Frame = -1

Query  498  FMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRH  319
             +++++L+S +M   ++  +ARLC  +S  F G C+  + C   C ++GF+GG C G RH
Sbjct  12   LLLLIVLASQEM---VVPSKARLCESKSHGFKGACLSDHNCGMVCSNEGFSGGRCRGFRH  68

Query  318  LCYCYKNC  295
             C+C + C
Sbjct  69   RCFCTRRC  76



>gb|EMT30046.1| Defensin-like protein P322 [Aegilops tauschii]
Length=78

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 31/55 (56%), Gaps = 0/55 (0%)
 Frame = -1

Query  459  GPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
             P    E R+C   S +F G+C+VG  C + CL++GF  G C GL+  C C K C
Sbjct  24   APAQAEEPRVCETDSTRFKGICMVGTNCANICLTEGFTSGKCSGLKRKCICTKPC  78



>gb|AIA67015.1| defensin [Triticum aestivum]
Length=78

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 31/55 (56%), Gaps = 0/55 (0%)
 Frame = -1

Query  459  GPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
             P    E R+C   S +F G+C+VG  C + CL++GF  G C GL+  C C K C
Sbjct  24   APAQAEEGRVCETDSTRFKGICMVGTNCANICLTEGFTSGKCSGLKRKCICTKPC  78



>ref|XP_003526900.1| PREDICTED: defensin-like protein 6-like [Glycine max]
 gb|ACU20671.1| unknown [Glycine max]
 gb|KHN09676.1| Defensin-like protein 6 [Glycine soja]
Length=73

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 41/68 (60%), Gaps = 4/68 (6%)
 Frame = -1

Query  498  FMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRH  319
            FM+++LLSS      +++ E R C  +S +F G+C+  + C S C  +GF GG C G R 
Sbjct  10   FMLLILLSSQ----MVVQTEGRHCESKSHRFKGMCLSKHNCASVCHLEGFTGGKCRGFRR  65

Query  318  LCYCYKNC  295
             C+C ++C
Sbjct  66   RCFCTRHC  73



>ref|XP_007137817.1| hypothetical protein PHAVU_009G158100g [Phaseolus vulgaris]
 gb|ESW09811.1| hypothetical protein PHAVU_009G158100g [Phaseolus vulgaris]
Length=145

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 50/97 (52%), Gaps = 12/97 (12%)
 Frame = -1

Query  561  FLYLSYIPKMKPSMNVPLLVV--------FMIMMLLSSNDMGGPIMKVEARLCNYRSQKF  406
            FL   + P+ + S     L +        FM+++LL+S  M    ++ E R C  +S +F
Sbjct  53   FLNQHFTPRTQHSEAGTYLAMDKARFGFFFMLLILLASQMM----VQTEGRHCESKSHRF  108

Query  405  TGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
             G+C+    C S C  +GF GG+C G R  C+C ++C
Sbjct  109  KGMCLSDRNCASVCHLEGFTGGNCRGFRRRCFCTRHC  145



>ref|XP_008793610.1| PREDICTED: defensin Ec-AMP-D1-like isoform X2 [Phoenix dactylifera]
Length=77

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 37/60 (62%), Gaps = 2/60 (3%)
 Frame = -1

Query  474  SNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            S++MG  +  VEAR C  +S +F G C+  + C + C ++GF GG C GLR  C+C K C
Sbjct  20   SSEMGTKV--VEARTCESQSHRFKGTCLRASNCANVCQTEGFQGGVCRGLRGRCFCTKRC  77



>ref|XP_002459603.1| hypothetical protein SORBIDRAFT_02g007390 [Sorghum bicolor]
 gb|EER96124.1| hypothetical protein SORBIDRAFT_02g007390 [Sorghum bicolor]
Length=79

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 31/55 (56%), Gaps = 0/55 (0%)
 Frame = -1

Query  459  GPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            GP+    AR C   S +F G C     C + C ++GF GG C GLRH C+C K+C
Sbjct  25   GPVTMALARKCESPSHRFQGPCSRDANCATVCRTEGFTGGKCKGLRHRCFCTKDC  79



>ref|XP_004985852.1| PREDICTED: defensin SD2-like [Setaria italica]
Length=81

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = -1

Query  474  SNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            + ++GGP+   EAR C  +S KF G CV    C + C ++GF  G C GLR  C+C  +C
Sbjct  20   ATEVGGPVGVAEARTCLSQSHKFRGPCVRRANCANVCRTEGFPDGKCRGLRRRCFCTTHC  79



>gb|ACM90159.1| low-molecular-weight cysteine-rich 69 [Jatropha curcas]
 gb|KDP32806.1| hypothetical protein JCGZ_12098 [Jatropha curcas]
Length=77

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 42/73 (58%), Gaps = 2/73 (3%)
 Frame = -1

Query  513  PLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHC  334
            P   V  +++LL + ++G  +   EAR C  +S KF G C+    C + C ++GF GG C
Sbjct  7    PFSAVLFLLLLLVATEIGSKM--AEARTCESQSHKFKGTCLSETNCANVCKTEGFTGGDC  64

Query  333  HGLRHLCYCYKNC  295
             GLR  C+C ++C
Sbjct  65   RGLRRRCFCTRHC  77



>gb|AFK47422.1| unknown [Lotus japonicus]
Length=74

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 42/70 (60%), Gaps = 3/70 (4%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
            + F++ +LL+S+ M   +++ E R C  +S +F G+C+  + C S C  +GF GG C G 
Sbjct  8    LFFVLFILLASHQM---VVQTEGRHCESKSHRFHGLCLSHHNCASVCHLEGFTGGKCRGF  64

Query  324  RHLCYCYKNC  295
            R  C+C K C
Sbjct  65   RKRCFCKKRC  74



>ref|XP_009101271.1| PREDICTED: defensin-like protein 10 [Brassica rapa]
 emb|CDY17612.1| BnaA06g34310D [Brassica napus]
 emb|CDY03075.1| BnaC07g21520D [Brassica napus]
Length=73

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 42/80 (53%), Gaps = 7/80 (9%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            MK S+ +   ++   M+LL++      ++ VEAR C   S KF GVC+    C   C  +
Sbjct  1    MKLSLRLVSTILLSFMLLLAAG-----MIPVEARTCESPSTKFQGVCLNAKNCAGVCTGE  55

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF GG C  L+  CYC K C
Sbjct  56   GFTGGQCSSLK--CYCTKTC  73



>gb|ABS72000.1| putative defensin protein 1 [Olea europaea]
Length=56

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/55 (42%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  459  GPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            GP+M  +AR C  +S +F G CV  + C + C ++GF  G+C G R  C+C K+C
Sbjct  2    GPLMVADARTCESQSHRFKGSCVSKSNCAAVCQTEGFPDGYCRGFRRRCFCSKHC  56



>sp|P82781.2|DEF03_ARATH RecName: Full=Putative defensin-like protein 3; AltName: Full=Putative 
low-molecular-weight cysteine-rich protein 71; Short=Protein 
LCR71; Flags: Precursor [Arabidopsis thaliana]
Length=62

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = -1

Query  450  MKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            + VEAR+C  RSQKF G CV  + C + C ++GF  G C GL   CYC  +C
Sbjct  11   VTVEARICKSRSQKFKGPCVSEDNCANVCHTEGFPDGDCDGLLRRCYCNTHC  62



>ref|XP_006367122.1| PREDICTED: defensin J1-2-like [Solanum tuberosum]
Length=71

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 41/75 (55%), Gaps = 9/75 (12%)
 Frame = -1

Query  519  NVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGG  340
             V   ++ M+M++ S+         VEA+ C   S++F G+C    KC   C ++ F+ G
Sbjct  6    KVVATILLMLMLIFST---------VEAKTCESPSRRFKGLCFNTWKCRFVCSTERFSSG  56

Query  339  HCHGLRHLCYCYKNC  295
            HC+GLRH C C K C
Sbjct  57   HCNGLRHRCICTKQC  71



>gb|ADK91098.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91099.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91100.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91101.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91102.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91103.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91104.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91105.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91106.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91107.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91108.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91109.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91110.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91111.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91112.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91113.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91114.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91115.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91117.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91118.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91119.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91120.1| PCP17C2 [Arabidopsis halleri]
Length=55

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -1

Query  459  GPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            GP+  VEAR C  +S +F G CV  + C + C ++GF GG+C G R  C+C +NC
Sbjct  2    GPVT-VEARTCESQSHRFKGTCVSASNCANVCHNEGFIGGNCRGFRRRCFCTRNC  55



>gb|AAL15885.1|AF417297_1 putative gamma-thionin [Castanea sativa]
Length=78

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = -1

Query  459  GPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            GP++  EAR C  +S +F G CV  + C S C ++GF GG C G R  C+C K+C
Sbjct  25   GPMV-AEARTCESQSHRFKGPCVRKSNCASVCQTEGFHGGQCRGFRRRCFCTKHC  78



>emb|CDY39856.1| BnaC02g42620D [Brassica napus]
 emb|CDY31356.1| BnaA02g33850D [Brassica napus]
Length=73

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 40/75 (53%), Gaps = 4/75 (5%)
 Frame = -1

Query  519  NVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGG  340
            N      F+ ++L SS +    ++ +E R+C  RS  F  +C+  + C + C  + F+GG
Sbjct  3    NKVFAAFFLFLVLFSSQE----VIGIEGRMCQSRSHHFRSICLSNHNCANICRGERFSGG  58

Query  339  HCHGLRHLCYCYKNC  295
             CHGL   CYC + C
Sbjct  59   RCHGLHRKCYCTRLC  73



>ref|XP_009351648.1| PREDICTED: defensin-like protein 1 [Pyrus x bretschneideri]
Length=90

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 48/91 (53%), Gaps = 12/91 (13%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMK----------VEARLCN-YRSQKFTGVCVV  388
            M+PSM   +   F++++LL++ +MG   ++           E + C+ + S KF GVC  
Sbjct  1    MEPSMRF-VSAAFILILLLATTEMGPMAVEGRSGMTSKGAAEKKTCDSHPSSKFKGVCFF  59

Query  387  GNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
             N C  +C  +G +GG C G R +C C K C
Sbjct  60   TNNCVDTCKLEGSSGGQCRGFRRICICTKQC  90



>gb|ABA86586.1| putative defensin 1 [Aquilegia formosa]
Length=70

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 32/55 (58%), Gaps = 1/55 (2%)
 Frame = -1

Query  459  GPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            GP +  EAR C  +S KF G C+  + C S C S+GF GGHC G+   CYC   C
Sbjct  15   GPKV-AEARDCESQSHKFKGTCIRKSNCASVCQSEGFNGGHCRGVTRRCYCTAKC  68



>gb|ACS96442.1| defensin [Jatropha curcas]
Length=77

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 42/73 (58%), Gaps = 2/73 (3%)
 Frame = -1

Query  513  PLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHC  334
            P   V  +++LL + ++G  +   EAR C  ++ KF G C+    C + C ++GF GG C
Sbjct  7    PFSAVLFLLLLLVATEIGSKM--AEARTCESQTHKFKGTCLSETNCANVCKTEGFTGGDC  64

Query  333  HGLRHLCYCYKNC  295
             GLR  C+C ++C
Sbjct  65   RGLRRRCFCTRHC  77



>gb|ABA86589.1| putative defensin 1 [Aquilegia pyrenaica]
 gb|ABA86590.1| putative defensin 1 [Aquilegia olympica]
Length=70

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 31/55 (56%), Gaps = 1/55 (2%)
 Frame = -1

Query  459  GPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            GP    EAR C  +S KF G C+  + C S C S+GF GGHC G+   CYC   C
Sbjct  15   GPKA-AEARDCESQSHKFKGTCIRKSNCASVCQSEGFNGGHCRGVTRRCYCTAKC  68



>gb|KFK33428.1| hypothetical protein AALP_AA5G011900 [Arabis alpina]
Length=73

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 45/80 (56%), Gaps = 7/80 (9%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            MK S+ +  + +   M+LL+S    GP   VEAR C   S KF+GVC+    C   C ++
Sbjct  1    MKLSLRLVSVFLLSFMLLLASGK--GP---VEARTCESVSGKFSGVCLNSANCAKICPTE  55

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            GF+ G C  LR  CYC K+C
Sbjct  56   GFSSGRCSSLR--CYCSKSC  73



>ref|XP_007203247.1| hypothetical protein PRUPE_ppa019504mg [Prunus persica]
 gb|EMJ04446.1| hypothetical protein PRUPE_ppa019504mg [Prunus persica]
Length=85

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 41/76 (54%), Gaps = 6/76 (8%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMG-----GPI-MKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAG  343
             VF++++LL + + G     G +  K E+R C   S KF G C+  ++C  +C  +GF G
Sbjct  10   TVFILILLLVAIETGPMVAEGKVATKEESRTCESLSTKFKGFCLRSSRCAEACQKEGFMG  69

Query  342  GHCHGLRHLCYCYKNC  295
            G C G R  C C K C
Sbjct  70   GKCPGFRLRCTCTKKC  85



>gb|ABK93231.1| unknown [Populus trichocarpa]
Length=75

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 42/70 (60%), Gaps = 3/70 (4%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
            + F+++++L+S ++   ++  EAR+C  +S  F G C   + C   C ++GF+GG C G 
Sbjct  9    LFFLLLIVLASQEV---VVPTEARVCQSQSHYFKGPCARDHNCAWVCRNEGFSGGRCKGF  65

Query  324  RHLCYCYKNC  295
            R  C+C K C
Sbjct  66   RRRCFCTKLC  75



>gb|EPS59162.1| defensin, partial [Genlisea aurea]
Length=70

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (58%), Gaps = 0/52 (0%)
 Frame = -1

Query  450  MKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            ++ E + C YRS+K  GVC    +C  +C  +GF  G C GLR  C+C+  C
Sbjct  19   VEEEKKACKYRSEKSWGVCFSDLRCSETCKKEGFENGDCKGLRRRCFCFNRC  70



>gb|ADB02899.1| gamma-thionin PPT precursor defensin 1-like protein [Jatropha 
curcas]
Length=92

 Score = 54.3 bits (129),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 1/51 (2%)
 Frame = -1

Query  459  GPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYC  307
            GP M  EAR C   S +F G+CV  + C + C ++GF GGHC GLR  C+C
Sbjct  24   GP-MVAEARTCESLSHRFKGICVRNSNCAAICQTEGFQGGHCRGLRRRCFC  73



>emb|CDM85870.1| unnamed protein product [Triticum aestivum]
 emb|CDM85874.1| unnamed protein product [Triticum aestivum]
Length=74

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 45/76 (59%), Gaps = 2/76 (3%)
 Frame = -1

Query  522  MNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAG  343
            M++ + V  ++++LL + +  GP+    AR C  +S KF G+CV  + C S CL++GF  
Sbjct  1    MDLSMKVFVVVLLLLVATEDQGPVQVALARDCKSQSYKFKGMCVRDDNCASVCLTEGFPR  60

Query  342  GHCHGLRHLCYCYKNC  295
            G C G    C CYK+C
Sbjct  61   GKCKGF--ACSCYKDC  74



>ref|XP_011070574.1| PREDICTED: defensin J1-2-like [Sesamum indicum]
Length=74

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 39/70 (56%), Gaps = 5/70 (7%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
              F+++ML+ S  M       EAR C  +S +F G+C+    C + C ++GF  GHC G 
Sbjct  10   TAFVMLMLVFSTGM-----VAEARKCESQSHRFKGICLRKANCAAVCQTEGFHSGHCRGF  64

Query  324  RHLCYCYKNC  295
            R  C+C K+C
Sbjct  65   RGRCFCTKHC  74



>gb|KGN49760.1| hypothetical protein Csa_5G114570 [Cucumis sativus]
Length=74

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 32/55 (58%), Gaps = 1/55 (2%)
 Frame = -1

Query  459  GPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            GP M  EAR C   S +F G+C   N C   C ++GF GGHC G R  C+C K+C
Sbjct  20   GP-MVTEARTCESPSHRFKGLCFSKNNCGHVCKTEGFHGGHCRGFRRRCFCTKHC  73



>ref|XP_008466730.1| PREDICTED: defensin J1-2-like [Cucumis melo]
Length=74

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 32/55 (58%), Gaps = 1/55 (2%)
 Frame = -1

Query  459  GPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            GP M  EAR C   S +F G+C   N C   C ++GF GGHC G R  C+C K+C
Sbjct  20   GP-MVTEARTCESPSHRFKGLCFSKNNCGHVCKTEGFHGGHCRGFRRRCFCTKHC  73



>gb|ABA81896.1| putative defensin [Aquilegia formosa]
 gb|ABA86588.1| putative defensin 1 [Aquilegia brevistyla]
Length=70

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = -1

Query  444  VEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
             EAR C  +S KF G C+  + C S C S+GF GGHC G+   CYC   C
Sbjct  19   AEARDCESQSHKFKGTCIRKSNCASVCQSEGFNGGHCRGVTRRCYCTAKC  68



>gb|EMT03363.1| hypothetical protein F775_43918 [Aegilops tauschii]
Length=82

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = -1

Query  474  SNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            + ++GGP+M  EAR C  RS +F G CV  + C + C ++GF+ G C G     +C  +C
Sbjct  21   TGELGGPVMVAEARTCESRSHRFRGPCVRRSNCANVCRTEGFSDGECRGFPPPPFCTTHC  80



>ref|XP_003630421.1| Defensin [Medicago truncatula]
 gb|AET04897.1| Defensin MtDef4.6 [Medicago truncatula]
Length=74

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 28/54 (52%), Gaps = 0/54 (0%)
 Frame = -1

Query  456  PIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
             +   E R C  +S KF G C   + C S C  +GF GG C G R  C+C +NC
Sbjct  21   AVKTAEGRRCESKSHKFKGPCSRDSNCASVCRGEGFTGGDCRGFRRRCFCTRNC  74



>gb|AIA67014.1| defensin [Triticum aestivum]
Length=75

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 39/73 (53%), Gaps = 6/73 (8%)
 Frame = -1

Query  513  PLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHC  334
            P + + +++++ +       ++  +AR C   S++F G+C V   C   C ++GF GG C
Sbjct  9    PAVAILLLLVVATE------VVPAQARECETESERFNGLCFVSANCAGVCNAEGFTGGKC  62

Query  333  HGLRHLCYCYKNC  295
             GL+  C C K C
Sbjct  63   SGLKRSCMCTKEC  75



>gb|AAS13434.1| defensin [Nicotiana attenuata]
Length=52

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/52 (44%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -1

Query  450  MKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            M  EAR C  +S++F G+C   + C S C ++GF GGHC G R  C+C ++C
Sbjct  1    MVAEARTCESQSRRFRGLCFSKSNCGSVCHTEGFNGGHCRGFRRRCFCTRHC  52



>ref|XP_008389118.1| PREDICTED: defensin-like protein 1 [Malus domestica]
Length=87

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 44/88 (50%), Gaps = 9/88 (10%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMK--------VEARLCNYRSQKFTGVCVVGNK  379
            M+ SM + +   F++++LL + +MG   ++        VE R C   S KF G+C   N 
Sbjct  1    MERSMRL-VSASFVLVLLLVATEMGTMGVEARSKSSKVVEERTCEAASGKFKGLCFSSNN  59

Query  378  CHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            C  +C  + F GG C G R  C C K C
Sbjct  60   CKHTCKREQFTGGKCRGFRRRCMCNKKC  87



>dbj|BAK06284.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=100

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/81 (30%), Positives = 43/81 (53%), Gaps = 5/81 (6%)
 Frame = -1

Query  537  KMKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLS  358
            +M+ S  +   V  ++++++++      +   +AR C   S++F G+C V   C   C +
Sbjct  25   RMESSHKLFSAVAILLLLVVATE-----VAPAQARECEVESERFNGLCFVSANCAGVCGA  79

Query  357  QGFAGGHCHGLRHLCYCYKNC  295
            +GF GG C GL+  C C K C
Sbjct  80   EGFTGGKCSGLKRSCMCTKQC  100



>ref|XP_004151187.1| PREDICTED: defensin J1-2-like [Cucumis sativus]
 ref|XP_004171498.1| PREDICTED: defensin J1-2-like [Cucumis sativus]
Length=74

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 39/69 (57%), Gaps = 3/69 (4%)
 Frame = -1

Query  501  VFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLR  322
            +F+++++  S   G   M  EAR+C   S  F G+C     C + C ++GF+GG C G R
Sbjct  8    IFLLLLIFGS---GMAPMVAEARVCESPSHNFKGLCFSDTNCGNICKTEGFSGGVCRGFR  64

Query  321  HLCYCYKNC  295
              C+C K+C
Sbjct  65   RRCFCTKHC  73



>gb|KFK26328.1| hypothetical protein AALP_AA8G233400 [Arabis alpina]
Length=78

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 42/81 (52%), Gaps = 4/81 (5%)
 Frame = -1

Query  537  KMKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLS  358
            K+ P +   + V+FM+++  +     GP+  VEAR C   SQ F G C+    C + C +
Sbjct  2    KLSPRLISTIPVLFMLLVATTGI---GPVT-VEARTCETSSQLFNGPCLSTTNCANVCHN  57

Query  357  QGFAGGHCHGLRHLCYCYKNC  295
            +GF  G C G R  C C + C
Sbjct  58   EGFPDGDCRGFRRRCLCSRPC  78



>ref|XP_004250637.1| PREDICTED: defensin-like protein [Solanum lycopersicum]
Length=105

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 38/60 (63%), Gaps = 1/60 (2%)
 Frame = -1

Query  447  KVEAR-LCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC*LQREANK  271
            +V+A+ +C   SQ F G+C   + C  +C+++ F GGHC  L+  C C K C L++++N+
Sbjct  22   EVQAQYMCKSTSQTFKGLCFTDSSCRKACVTEEFTGGHCSKLQRKCLCTKVCVLEKDSNE  81



>ref|XP_003573542.1| PREDICTED: defensin-like protein 3 [Brachypodium distachyon]
Length=77

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/80 (33%), Positives = 44/80 (55%), Gaps = 3/80 (4%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            M    NV L  V M++++L++ + GG  +  EA++C  RS  + G+C+    C   C ++
Sbjct  1    MWTKKNVAL--VLMLLIILAAQEEGGSNV-AEAKICRKRSAGYHGMCMSDRNCAQVCQAE  57

Query  354  GFAGGHCHGLRHLCYCYKNC  295
            G+ GG+C G    C C + C
Sbjct  58   GWGGGNCDGAVRRCKCSREC  77



>gb|AHA50471.1| defensin-like protein 4 [Citrullus lanatus]
Length=75

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 1/54 (2%)
 Frame = -1

Query  456  PIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            PI+ VEAR+C   S  F G+C     C + C ++GF GGHC G R  C+C K+C
Sbjct  22   PIV-VEARVCESLSHSFKGLCFSSTNCGNICKTEGFTGGHCRGFRRRCFCTKHC  74



>emb|CAH58740.1| defensin [Plantago major]
Length=72

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 40/72 (56%), Gaps = 7/72 (10%)
 Frame = -1

Query  510  LLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCH  331
            L  +F+++++       GP++  EAR C   S +F G C+    C S C ++GF GG C 
Sbjct  8    LFALFLVLVIT------GPMVG-EARKCRSASHRFKGTCLSDTNCASVCKTEGFPGGDCK  60

Query  330  GLRHLCYCYKNC  295
            GLR  C+C  +C
Sbjct  61   GLRRRCFCETHC  72



>ref|XP_006647552.1| PREDICTED: defensin-like protein P322-like [Oryza brachyantha]
Length=80

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 4/82 (5%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            M PS  + +  VF+++ +L + +MG   +  EAR C  +S +F G+CV  N C + C ++
Sbjct  1    MAPSRRM-VASVFLLLAILVATEMGTTQV-AEARHCLSQSHRFKGMCVSSNNCANVCKTE  58

Query  354  GFAGGHC--HGLRHLCYCYKNC  295
             F  G C  HGL   C+C K C
Sbjct  59   NFPDGECKSHGLERKCFCKKLC  80



>gb|KEH35658.1| low-molecular-weight cysteine-rich protein [Medicago truncatula]
Length=52

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/52 (46%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = -1

Query  450  MKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            M  EAR+C  +S  F G CV  + C   C ++GF+GG C GLRH C+C + C
Sbjct  1    MHAEARMCESQSHGFKGACVGDHNCALVCRNEGFSGGRCQGLRHRCFCTRLC  52



>ref|XP_007202809.1| hypothetical protein PRUPE_ppa014119mg [Prunus persica]
 gb|EMJ04008.1| hypothetical protein PRUPE_ppa014119mg [Prunus persica]
Length=85

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 40/76 (53%), Gaps = 6/76 (8%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMG-----GPI-MKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAG  343
             VF++++LL +   G     G +  K E+R C   S KF G C+  ++C  +C  +GF G
Sbjct  10   TVFILVLLLGAIGTGPMVAEGKVATKEESRTCESLSTKFKGFCLRSSRCAEACQKEGFMG  69

Query  342  GHCHGLRHLCYCYKNC  295
            G C G R  C C K C
Sbjct  70   GKCPGFRLRCTCTKKC  85



>ref|XP_002325735.1| hypothetical protein POPTR_0019s00770g [Populus trichocarpa]
 gb|ABK93028.1| unknown [Populus trichocarpa]
 gb|ABK93041.1| unknown [Populus trichocarpa]
 gb|ABK93536.1| unknown [Populus trichocarpa]
 gb|ABK93961.1| unknown [Populus trichocarpa]
 gb|ABK94429.1| unknown [Populus trichocarpa]
 gb|ABK94555.1| unknown [Populus trichocarpa]
 gb|EEF00117.1| hypothetical protein POPTR_0019s00770g [Populus trichocarpa]
Length=74

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = -1

Query  453  IMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            ++  EAR+C  +S  F G CV G+ C S C ++GF GG C G R  C+C K C
Sbjct  22   MVPAEARVCLSQSHSFKGPCVRGHNCASVCKTEGFPGGECKGFRRRCFCAKPC  74



>ref|XP_011099999.1| PREDICTED: defensin Ec-AMP-D2-like [Sesamum indicum]
Length=82

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = -1

Query  504  VVFMIMMLLSSN-DMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHG  328
            V FM+++++ ++  +     K E +LC  +S KF G C+   KC S C ++GF GG C G
Sbjct  9    VFFMLLIIMIAHVTIPHVEAKAEPKLCIAKSNKFKGFCLKDPKCVSVCKTEGFTGGRCRG  68

Query  327  LRHLCYCYKN  298
             R  CYC K 
Sbjct  69   FRLRCYCTKT  78



>ref|XP_004250638.1| PREDICTED: defensin-like protein [Solanum lycopersicum]
Length=105

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 44/78 (56%), Gaps = 1/78 (1%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
            + FM +M+L+        ++ + ++C   SQ F G+C   + C  +C+++ F GGHC  L
Sbjct  5    ICFMALMVLAMVLFVSSEVQAQ-QMCKSTSQTFKGLCFTDSSCRKACVTEEFTGGHCSKL  63

Query  324  RHLCYCYKNC*LQREANK  271
            +  C C K C  ++++N+
Sbjct  64   QRKCLCTKVCVFEKDSNE  81



>ref|XP_011001251.1| PREDICTED: defensin-like protein 1 [Populus euphratica]
Length=75

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 42/70 (60%), Gaps = 3/70 (4%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
            + F+++++L+S ++   ++  EAR+C  +S  F G C   + C   C ++GF+GG C G 
Sbjct  9    LFFLLLIVLASQEV---VVPTEARVCLSQSHYFKGPCARDHNCAWVCRNEGFSGGRCKGF  65

Query  324  RHLCYCYKNC  295
            R  C+C K C
Sbjct  66   RRRCFCTKLC  75



>ref|NP_001047493.1| Os02g0629800 [Oryza sativa Japonica Group]
 dbj|BAD23741.1| putative defensin [Oryza sativa Japonica Group]
 dbj|BAF09407.1| Os02g0629800 [Oryza sativa Japonica Group]
 gb|EEE57415.1| hypothetical protein OsJ_07607 [Oryza sativa Japonica Group]
Length=80

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 45/82 (55%), Gaps = 4/82 (5%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            M PS  + +   F+++ +L + +MG   +  EAR C  +S +F G+CV  N C + C ++
Sbjct  1    MAPSRRM-VASAFLLLAILVATEMGTTKV-AEARHCLSQSHRFKGMCVSSNNCANVCRTE  58

Query  354  GFAGGHC--HGLRHLCYCYKNC  295
             F  G C  HGL   C+C K C
Sbjct  59   SFPDGECKSHGLERKCFCKKVC  80



>ref|XP_003562142.1| PREDICTED: defensin Ec-AMP-D1-like [Brachypodium distachyon]
Length=81

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 30/56 (54%), Gaps = 0/56 (0%)
 Frame = -1

Query  462  GGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            G  +M  EAR C  RS +F G C+  + C + C ++GF  G C G R  C+C   C
Sbjct  24   GDQMMVAEARTCESRSHRFRGPCMRASNCRNVCKTEGFQDGKCRGFRRRCFCVSQC  79



>ref|XP_002325734.2| defensin-like family protein [Populus trichocarpa]
 gb|EEF00116.2| defensin-like family protein [Populus trichocarpa]
Length=76

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 41/70 (59%), Gaps = 2/70 (3%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
            + F+++++L+S +    ++  EAR+C  +S  F G C   + C   C ++GF+GG C G 
Sbjct  9    LFFLLLIVLASPEE--VVVPTEARVCQSQSHYFKGPCARDHNCAWVCRNEGFSGGRCKGF  66

Query  324  RHLCYCYKNC  295
            R  C+C K C
Sbjct  67   RRRCFCTKLC  76



>ref|XP_010270777.1| PREDICTED: defensin-like protein [Nelumbo nucifera]
 sp|A3FPF2.1|DEF_NELNU RecName: Full=Defensin-like protein; AltName: Full=Gamma-thionin 
homolog; Flags: Precursor [Nelumbo nucifera]
 gb|ABN46979.1| defensin [Nelumbo nucifera]
Length=77

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 33/61 (54%), Gaps = 2/61 (3%)
 Frame = -1

Query  477  SSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKN  298
            ++ +MG  +   EAR C  +S +F G C+    C S C ++GF  G C G R  C+C K 
Sbjct  19   TATEMGPKV--AEARTCESQSHRFKGACLSDTNCASVCQTEGFPAGDCKGARRRCFCVKP  76

Query  297  C  295
            C
Sbjct  77   C  77



>ref|XP_006422269.1| hypothetical protein CICLE_v10005867mg [Citrus clementina]
 gb|ESR35509.1| hypothetical protein CICLE_v10005867mg [Citrus clementina]
Length=216

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 47/90 (52%), Gaps = 5/90 (6%)
 Frame = -1

Query  561  FLYLSYIPKMKPSMNVPLLV-VFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVG  385
            FL     P+  PSM        F++ ++  S +M    +++ AR+C   S+ FTG+C   
Sbjct  15   FLVDRNYPQQYPSMETKDFASAFLLFIVFISAEM----VEIHARMCRTHSRAFTGLCYRN  70

Query  384  NKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            + C  +C+S+GF  G+C  L+ +C C   C
Sbjct  71   DNCAMACMSEGFDYGYCTALQRICMCANPC  100



>gb|ADK91116.1| PCP17C2 [Arabidopsis halleri]
Length=55

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = -1

Query  459  GPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            GP+  VEAR    +S +F G CV  + C + C ++GF GG+C G R  C+C +NC
Sbjct  2    GPVT-VEARTRESQSHRFKGTCVSASNCANVCHNEGFIGGNCRGFRRRCFCTRNC  55



>gb|AHA50470.1| defensin-like protein 1 [Citrullus lanatus]
Length=74

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 32/55 (58%), Gaps = 1/55 (2%)
 Frame = -1

Query  459  GPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            GP M  +AR C   S+ F G+C   N C   C ++GF GGHC G R  C+C K+C
Sbjct  20   GP-MVTDARTCESPSRHFKGLCFSKNNCGHVCKTEGFHGGHCRGFRRRCFCTKHC  73



>ref|XP_010088525.1| Defensin-like protein 2 [Morus notabilis]
 gb|EXB36442.1| Defensin-like protein 2 [Morus notabilis]
Length=76

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 33/55 (60%), Gaps = 1/55 (2%)
 Frame = -1

Query  459  GPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            GP +  +AR C   S +F G CV  + C + C ++GF GG+C G R  C+C K+C
Sbjct  23   GPKV-ADARTCQSASHRFKGTCVRNSNCANICRTEGFQGGNCQGFRRRCFCTKHC  76



>gb|KHG06821.1| Defensin-like protein [Gossypium arboreum]
Length=78

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 32/56 (57%), Gaps = 2/56 (4%)
 Frame = -1

Query  459  GPIMKVEARLCNYRSQKFTGVCVVGNKCHSSC-LSQGFAGGHCHGLRHLCYCYKNC  295
            GP M VE R C  +S ++ G+C+    C S C +  GF GGHCHG    CYC K C
Sbjct  24   GP-MAVEGRTCETKSSEYKGICLFDANCDSICKVEPGFDGGHCHGFFRRCYCTKPC  78



>gb|EEC76838.1| hypothetical protein OsI_14993 [Oryza sativa Indica Group]
 gb|EEE60570.1| hypothetical protein OsJ_13935 [Oryza sativa Japonica Group]
Length=72

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -1

Query  444  VEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
             +AR C   S +F G+C++   C + CL++GF+GG C G R  C C K+C
Sbjct  23   AQARECETPSNEFKGICMMVANCANVCLTEGFSGGKCSGFRRRCMCTKDC  72



>gb|EMT26158.1| Defensin-like protein [Aegilops tauschii]
Length=74

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 45/76 (59%), Gaps = 2/76 (3%)
 Frame = -1

Query  522  MNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAG  343
            M++ + V  ++++LL + +  GP+    AR C  +S KF G+CV  + C S CL++GF  
Sbjct  1    MDLSMKVFVVVLLLLVATEDQGPVQVALARDCKSQSYKFKGMCVRDDNCASVCLTEGFPR  60

Query  342  GHCHGLRHLCYCYKNC  295
            G C G    C C+K+C
Sbjct  61   GKCKGF--ACSCHKDC  74



>ref|XP_006395807.1| hypothetical protein EUTSA_v10005233mg [Eutrema salsugineum]
 gb|ACQ90608.1| defensin-like protein [Eutrema halophilum]
 gb|ESQ33093.1| hypothetical protein EUTSA_v10005233mg [Eutrema salsugineum]
Length=74

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 32/51 (63%), Gaps = 3/51 (6%)
 Frame = -1

Query  444  VEARLCNYRSQKFTGVCVVGNKCHSSCLS-QGFAGGHCHGLRHLCYCYKNC  295
            VEAR C   S KF GVC+    C S C S +GF+GGHC+ LR  CYC K C
Sbjct  26   VEARTCESASGKFQGVCLNSKSCASVCQSNEGFSGGHCNSLR--CYCTKTC  74



>dbj|BAD25504.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAZ21909.1| hypothetical protein OsJ_05562 [Oryza sativa Japonica Group]
Length=85

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 34/56 (61%), Gaps = 2/56 (4%)
 Frame = -1

Query  462  GGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            GG +    A++C+ RSQ F G+C   + C++SC ++G+ GGHC   R  C C K C
Sbjct  18   GGEV--AAAKMCHDRSQTFKGMCFRTSNCNTSCTNEGYTGGHCTTFRRRCVCTKEC  71



>ref|NP_001149230.1| LOC100282852 precursor [Zea mays]
 gb|ACG34648.1| low-molecular-weight cysteine-rich protein LCR70 precursor [Zea 
mays]
Length=82

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 44/76 (58%), Gaps = 4/76 (5%)
 Frame = -1

Query  516  VPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGH  337
            V   +VF++M LL++++MG      EAR C  +S +F G C+  + C + C ++GF  G 
Sbjct  9    VASALVFLLM-LLAASEMG-TTRXAEARHCTSQSHRFVGACMSKSNCENVCRTEGFPWGE  66

Query  336  C--HGLRHLCYCYKNC  295
            C  HG+   C+C + C
Sbjct  67   CRWHGIERKCHCKRIC  82



>ref|XP_002513261.1| 8.4 kDa sulfur-rich protein precursor, putative [Ricinus communis]
 gb|EEF49129.1| 8.4 kDa sulfur-rich protein precursor, putative [Ricinus communis]
Length=74

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 41/70 (59%), Gaps = 3/70 (4%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
            V  +++++L+S +    I+  EAR+C  +S  F G C+  + C   C ++ F+GG C G+
Sbjct  8    VFLLLLIVLASQE---AIVPTEARVCESQSHYFKGPCLRDHNCAMVCRNEAFSGGRCKGV  64

Query  324  RHLCYCYKNC  295
            R  C+C K C
Sbjct  65   RRRCFCTKLC  74



>ref|XP_011001252.1| PREDICTED: defensin-like protein 1 [Populus euphratica]
Length=74

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = -1

Query  453  IMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            ++  EAR+C  +S  F G CV G+ C + C ++GF GG C G R  C+C K C
Sbjct  22   MVPTEARVCLSQSHNFKGPCVRGHNCANVCKTEGFPGGECKGFRRRCFCAKPC  74



>ref|XP_007045353.1| Defensin-like protein isoform 1 [Theobroma cacao]
 gb|EOY01185.1| Defensin-like protein isoform 1 [Theobroma cacao]
Length=78

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 41/70 (59%), Gaps = 1/70 (1%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
              F++++LL + +  GP    EAR C  +S +F G+C+  + C + C ++GF  GHC G 
Sbjct  10   AAFVLLLLLLATEEMGPKA-AEARTCQSQSHRFKGMCMRKSNCAAVCQTEGFHSGHCRGF  68

Query  324  RHLCYCYKNC  295
               C+C K+C
Sbjct  69   HRRCFCTKHC  78



>ref|XP_010908980.1| PREDICTED: defensin Ec-AMP-D1-like [Elaeis guineensis]
 gb|AAN52490.1|AF322914_1 defensin EGAD1 [Elaeis guineensis]
Length=77

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 35/59 (59%), Gaps = 2/59 (3%)
 Frame = -1

Query  471  NDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            ++MG  +   EAR C  +S KF G C+  + C + C ++GF GG C G+R  C+C + C
Sbjct  21   SEMGTKV--AEARTCESQSHKFQGTCLRESNCANVCQTEGFQGGVCRGVRRRCFCTRLC  77



>ref|XP_002272913.2| PREDICTED: defensin-like protein 1 isoform X1 [Vitis vinifera]
 emb|CBI27688.3| unnamed protein product [Vitis vinifera]
Length=75

 Score = 51.6 bits (122),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = -1

Query  453  IMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            ++  EAR+C  +S KF G C+  + C   C ++GF+GG C GLR  C+C K C
Sbjct  23   VVPSEARVCESQSHKFEGACMGDHNCALVCRNEGFSGGKCKGLRRRCFCTKLC  75



>ref|XP_010653029.1| PREDICTED: defensin-like protein 1 isoform X2 [Vitis vinifera]
Length=74

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = -1

Query  453  IMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            ++  EAR+C  +S KF G C+  + C   C ++GF+GG C GLR  C+C K C
Sbjct  22   VVPSEARVCESQSHKFEGACMGDHNCALVCRNEGFSGGKCKGLRRRCFCTKLC  74



>gb|EMS54459.1| Defensin Tk-AMP-D5 [Triticum urartu]
Length=75

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 32/55 (58%), Gaps = 1/55 (2%)
 Frame = -1

Query  459  GPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            G +  + AR C   S+KF G+CV    C S CL++ F GG C G R  C+C K+C
Sbjct  22   GAVQVILARECRSESKKFVGLCVSDTNCASVCLTERFPGGKCDGYRR-CFCTKDC  75



>ref|XP_007045354.1| Defensin-like protein isoform 2 [Theobroma cacao]
 gb|EOY01186.1| Defensin-like protein isoform 2 [Theobroma cacao]
Length=77

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 41/70 (59%), Gaps = 2/70 (3%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
              F++++LL + +MG      EAR C  +S +F G+C+  + C + C ++GF  GHC G 
Sbjct  10   AAFVLLLLLLATEMGPKA--AEARTCQSQSHRFKGMCMRKSNCAAVCQTEGFHSGHCRGF  67

Query  324  RHLCYCYKNC  295
               C+C K+C
Sbjct  68   HRRCFCTKHC  77



>gb|ABA86587.1| putative defensin 1 [Aquilegia chrysantha]
Length=70

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 28/48 (58%), Gaps = 0/48 (0%)
 Frame = -1

Query  438  ARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            AR C  +S KF G C+  + C S C S+GF GGHC G+   CYC   C
Sbjct  21   ARDCESQSHKFKGTCIRXSNCASVCXSEGFNGGHCRGVTRRCYCTAKC  68



>gb|AFW58880.1| low-molecular-weight cysteine-rich protein LCR70 [Zea mays]
Length=82

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 45/76 (59%), Gaps = 4/76 (5%)
 Frame = -1

Query  516  VPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGH  337
            V   +VF++M LL++++MG   +  EAR C  +S +F G C+  + C + C ++GF  G 
Sbjct  9    VASALVFLLM-LLAASEMGTTRV-AEARHCTSQSHRFVGACMSKSNCENVCRTEGFPWGE  66

Query  336  C--HGLRHLCYCYKNC  295
            C  HG+   C+C + C
Sbjct  67   CRWHGIERKCHCKRIC  82



>dbj|BAK07467.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=76

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 28/47 (60%), Gaps = 0/47 (0%)
 Frame = -1

Query  435  RLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            R+C   S +F G+C+VG  C + CL++GF  G C G +  C C K C
Sbjct  30   RVCETDSTQFKGICMVGTNCANVCLTEGFTSGKCSGFKRKCMCTKPC  76



>gb|KGN62247.1| hypothetical protein Csa_2G340400 [Cucumis sativus]
Length=107

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 51/100 (51%), Gaps = 5/100 (5%)
 Frame = -1

Query  588  HTITALFPTFLYLSYIPKMKPSMNVPLLVVFMIMMLLSSND--MGGPIMKVEARLCNYRS  415
            HT   L   F Y S I +M       +  + +++++ S+++  MGG     EAR+C  +S
Sbjct  11   HTALVLELNFNYYSNIIRMMMMNKSLVPTLLVLLLIFSASEEMMGGG---AEARMCQSQS  67

Query  414  QKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
              F G CV  + C   C ++GF+GG C G R  C+C   C
Sbjct  68   HHFHGPCVRDHNCALVCRTEGFSGGECIGFRRRCFCTHRC  107



>ref|XP_006394251.1| hypothetical protein EUTSA_v10005235mg [Eutrema salsugineum]
 gb|ESQ31537.1| hypothetical protein EUTSA_v10005235mg [Eutrema salsugineum]
Length=73

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 38/75 (51%), Gaps = 4/75 (5%)
 Frame = -1

Query  519  NVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGG  340
            N     +F+ ++L SS      I+ +E R+C  +S  F  +C   + C   C ++GF+GG
Sbjct  3    NKTFAAIFLFLVLFSSQ----KIIGIEGRMCQSKSHHFKHMCWSDHNCAIICRNEGFSGG  58

Query  339  HCHGLRHLCYCYKNC  295
             C G    CYC + C
Sbjct  59   RCRGFHRRCYCTRLC  73



>ref|XP_006339360.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=102

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 36/60 (60%), Gaps = 1/60 (2%)
 Frame = -1

Query  447  KVEAR-LCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC*LQREANK  271
            +V+A+ +C   SQ F G+C   + C  +CL++ F GGHC  L+  C C K C  ++ +N+
Sbjct  19   EVQAQHMCKSTSQTFKGLCFTDSSCRKACLTEEFTGGHCSKLQRKCLCTKICVFEKNSNE  78



>ref|XP_004972594.1| PREDICTED: defensin-like protein 21-like [Setaria italica]
Length=79

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 0/50 (0%)
 Frame = -1

Query  444  VEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
             EAR+C  RS  F G C   + C   CL +G+ GG+C G R  C C + C
Sbjct  30   AEARVCRQRSAGFRGACFSDHNCAQVCLQEGWGGGNCEGFRRRCKCSRQC  79



>ref|NP_001147137.1| LOC100280744 precursor [Zea mays]
 gb|ACG25630.1| low-molecular-weight cysteine-rich protein LCR68 precursor [Zea 
mays]
 gb|ACG25762.1| low-molecular-weight cysteine-rich protein LCR68 precursor [Zea 
mays]
 gb|AFW56985.1| defensin-like protein 1 [Zea mays]
Length=79

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = -1

Query  444  VEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
             EAR+C  RS  F GVC+  + C   CL +G+ GG+C G+   C C + C
Sbjct  30   AEARVCRRRSAGFKGVCMSDHNCAQVCLQEGYGGGNCDGIMRQCKCIREC  79



>sp|Q43413.1|DEF1_CAPAN RecName: Full=Defensin J1-1; Flags: Precursor [Capsicum annuum]
 gb|AAM09502.1|AF488780_1 gamma thionin [Capsicum annuum]
 emb|CAA64653.1| gamma-thionin [Capsicum annuum]
 gb|ACB30365.1| defensin [Capsicum annuum]
Length=75

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 37/70 (53%), Gaps = 5/70 (7%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
             +F++M+L+ + DM       EA++C   S  F G+C+    C + C  +GF  G C G 
Sbjct  10   TIFLMMLLVFATDM-----MAEAKICEALSGNFKGLCLSSRDCGNVCRREGFTDGSCIGF  64

Query  324  RHLCYCYKNC  295
            R  C+C K C
Sbjct  65   RLQCFCTKPC  74



>ref|XP_010228361.1| PREDICTED: defensin Tk-AMP-D1.1-like [Brachypodium distachyon]
Length=76

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = -1

Query  438  ARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            AR C   S KF G+C   + C +  L++GF  G C G+RH C+CYKNC
Sbjct  29   ARECGSPSHKFHGMCTRDSNCANIWLTEGFKTGKCVGIRHRCFCYKNC  76



>gb|EMS62517.1| Defensin SD2 [Triticum urartu]
Length=84

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 28/46 (61%), Gaps = 0/46 (0%)
 Frame = -1

Query  456  PIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRH  319
            P    EAR+C   S +F G+C+VG  C + CL++GF  G C GL+ 
Sbjct  24   PAYAEEARVCETDSTRFKGICMVGTNCANICLTEGFTSGKCSGLKR  69



>gb|EAY86781.1| hypothetical protein OsI_08161 [Oryza sativa Indica Group]
Length=487

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 45/82 (55%), Gaps = 4/82 (5%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQ  355
            M PS  + +   F+++ +L + +MG   +  EAR C  +S +F G+CV  N C + C ++
Sbjct  1    MAPSRRM-VASAFLLLAILVATEMGTTKV-AEARHCLSQSHRFKGMCVSSNNCANVCRTE  58

Query  354  GFAGGHC--HGLRHLCYCYKNC  295
             F  G C  HGL   C+C K C
Sbjct  59   SFPDGECKSHGLERKCFCKKPC  80



>gb|AHA50473.1| defensin-like protein 6 [Citrullus lanatus]
Length=74

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 32/54 (59%), Gaps = 1/54 (2%)
 Frame = -1

Query  456  PIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            PI+ VEAR+C   S  F G+C     C + C ++GF GG C G R  C+C K+C
Sbjct  21   PIV-VEARVCESLSHSFKGLCFSSTNCGNICKTEGFTGGVCRGFRRRCFCTKHC  73



>ref|XP_004509602.1| PREDICTED: defensin-1-like [Cicer arietinum]
Length=80

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 39/72 (54%), Gaps = 3/72 (4%)
 Frame = -1

Query  504  VVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGL  325
             +F++ +LL   +MG   M  EAR C  +S  + G+CV    C + C ++GF  GHC G 
Sbjct  10   TIFVMFLLLVVTEMGAN-MVAEARSCISKSFTYKGLCVHDRNCANVCRTEGFVEGHCRGF  68

Query  324  R--HLCYCYKNC  295
                 C+CYK C
Sbjct  69   AFGSRCFCYKPC  80



>ref|XP_009598624.1| PREDICTED: defensin-like protein [Nicotiana tomentosiformis]
Length=105

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 32/64 (50%), Gaps = 0/64 (0%)
 Frame = -1

Query  447  KVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC*LQREANKE  268
            +V+AR C   S  F G+C+    C  +C+S+GF  GHC  +   C C K C    +  K 
Sbjct  22   EVQARECKTESNTFPGLCITKPPCRKACISEGFTDGHCSKILRRCLCTKPCVFDEKMIKT  81

Query  267  INET  256
              ET
Sbjct  82   GAET  85



>ref|XP_009397593.1| PREDICTED: defensin Ec-AMP-D1 {ECO:0000303|PubMed:18625284}-like 
[Musa acuminata subsp. malaccensis]
Length=77

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 28/53 (53%), Gaps = 0/53 (0%)
 Frame = -1

Query  453  IMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            ++ VE R C   S +F G CV  + C S C  +GF  G C G+R  C C K C
Sbjct  25   MVAVEGRTCESASTRFKGTCVRSSNCASVCQGEGFPDGKCEGVRRRCMCRKPC  77



>ref|NP_001052199.1| Os04g0189400 [Oryza sativa Japonica Group]
 dbj|BAF14113.1| Os04g0189400 [Oryza sativa Japonica Group]
 dbj|BAG92412.1| unnamed protein product [Oryza sativa Japonica Group]
Length=111

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -1

Query  444  VEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
             +AR C   S +F G+C++   C + CL++GF+GG C G R  C C K+C
Sbjct  62   AQARECETPSNEFKGICMMVANCANVCLTEGFSGGKCSGFRRRCMCTKDC  111



>gb|EMT11359.1| Defensin-like protein P322 [Aegilops tauschii]
Length=76

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 29/55 (53%), Gaps = 0/55 (0%)
 Frame = -1

Query  459  GPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            G +    AR C   S KF G+CV    C S CL++ F GG C G+R  C C + C
Sbjct  22   GAVQVALARECTSPSHKFKGLCVSDTNCASVCLTERFPGGKCDGIRQRCLCTEKC  76



>ref|NP_201171.1| defensin-like protein 6 [Arabidopsis thaliana]
 sp|Q9FFP8.1|DEF06_ARATH RecName: Full=Defensin-like protein 6; AltName: Full=Low-molecular-weight 
cysteine-rich protein 74; Short=Protein LCR74; 
AltName: Full=Plant defensin 2.5; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB10459.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED97782.1| defensin-like protein 6 [Arabidopsis thaliana]
Length=73

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 38/75 (51%), Gaps = 4/75 (5%)
 Frame = -1

Query  519  NVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGG  340
            N      F++++L SS +    I+  E R C  +S  F  +C   + C   C ++GF+GG
Sbjct  3    NKFFAAFFLLLVLFSSQE----IIGGEGRTCQSKSHHFKYMCTSNHNCAIVCRNEGFSGG  58

Query  339  HCHGLRHLCYCYKNC  295
             CHG    CYC + C
Sbjct  59   RCHGFHRRCYCTRLC  73



>ref|XP_009780051.1| PREDICTED: defensin-like protein 1 [Nicotiana sylvestris]
Length=74

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 42/76 (55%), Gaps = 2/76 (3%)
 Frame = -1

Query  522  MNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAG  343
            M      +F +++++ ++ M   I +VE R+C  +S  + G CV  + C   C ++GF+G
Sbjct  1    MERKTFGLFFLLLIVFASQM--AISRVEGRVCISQSHGYHGTCVHDHNCALVCRNEGFSG  58

Query  342  GHCHGLRHLCYCYKNC  295
            G C G R  C+C K C
Sbjct  59   GDCIGWRRRCFCTKLC  74



>gb|AFD01290.1| defensin 3 [Pinus sylvestris]
Length=83

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 39/75 (52%), Gaps = 3/75 (4%)
 Frame = -1

Query  513  PLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHC  334
            PL  +F++++L+ +  M   +   E R+C   S KF G CV    C + C ++GF  G C
Sbjct  9    PLNAIFLLVLLVITIGMMA-VQVAEGRMCKTPSGKFKGYCVSSTNCKNVCRTEGFPSGSC  67

Query  333  --HGLRHLCYCYKNC  295
              H     CYCYK C
Sbjct  68   DFHVTSRKCYCYKPC  82



>gb|EMS56168.1| Defensin-like protein 6 [Triticum urartu]
Length=86

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 43/78 (55%), Gaps = 11/78 (14%)
 Frame = -1

Query  522  MNVPLLVVFMIMMLLSSNDMGGPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAG  343
            M   +  + ++++ L+   +GG     EA LC  RS+ F G C   + C + CL++ F G
Sbjct  1    MEAKVAAIALVLLFLT---LGG-----EAELCKQRSRTFKGRCTHNDNCFAICLTENFTG  52

Query  342  GHCHGL--RHLCYCYKNC  295
            G+CHG+  RH C C K C
Sbjct  53   GYCHGVVERH-CMCTKKC  69



>ref|XP_002886566.1| protease inhibitor II [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62825.1| protease inhibitor II [Arabidopsis lyrata subsp. lyrata]
Length=76

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 42/82 (51%), Gaps = 8/82 (10%)
 Frame = -1

Query  537  KMKPSMNVPLLVVFMIMMLLSSNDMG-GPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCL  361
            K+   +   LL++FMI+        G GP+  VEAR C   S  F G C+  + C + C 
Sbjct  2    KVSSRLISALLLLFMILA------TGIGPVT-VEARTCETSSNLFNGPCLSSSNCANVCH  54

Query  360  SQGFAGGHCHGLRHLCYCYKNC  295
            ++GF+ G C G R  C C + C
Sbjct  55   NEGFSDGDCRGFRRRCLCTRPC  76



>emb|CAN69975.1| hypothetical protein VITISV_020776 [Vitis vinifera]
Length=74

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = -1

Query  453  IMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            ++  EAR+C  +S KF G C+  + C   C ++GF+GG C G R  C+C K C
Sbjct  22   VVPSEARVCESQSHKFEGACMGDHNCALVCRNEGFSGGKCKGXRRRCFCTKLC  74



>gb|AHA50472.1| defensin-like protein 5 [Citrullus lanatus]
Length=74

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 31/54 (57%), Gaps = 1/54 (2%)
 Frame = -1

Query  456  PIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            PI+ VEAR+C   S  F G+C     C + C ++GF GG C G R  C+C K C
Sbjct  21   PIV-VEARVCESLSHSFKGLCFSSTNCGNICKTEGFTGGVCRGFRRRCFCTKPC  73



>ref|XP_002468581.1| hypothetical protein SORBIDRAFT_01g048380 [Sorghum bicolor]
 gb|EER95579.1| hypothetical protein SORBIDRAFT_01g048380 [Sorghum bicolor]
Length=80

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (53%), Gaps = 0/55 (0%)
 Frame = -1

Query  459  GPIMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            G +   EAR C  +S +F G CV    C + C ++GF  G C G R  C+C  +C
Sbjct  24   GAVAVAEARTCQSQSHRFRGPCVRRENCANVCRTEGFPDGKCRGFRRRCFCLTHC  78



>dbj|BAH29762.1| defensin-like cystein-rich peptide [Torenia fournieri]
Length=71

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 25/51 (49%), Gaps = 0/51 (0%)
 Frame = -1

Query  447  KVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
                 LC   SQKF G C   + C S C  +GF GG C G R  C+C K C
Sbjct  21   DANGSLCRSPSQKFKGPCFSDSNCQSVCEGEGFTGGECEGFRRRCFCSKPC  71



>ref|XP_010064921.1| PREDICTED: uncharacterized protein LOC104452094 [Eucalyptus grandis]
Length=135

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 29/53 (55%), Gaps = 0/53 (0%)
 Frame = -1

Query  453  IMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            + ++E R+C  +S KF G+C+    C   C  + F  G C G RH C+C K C
Sbjct  83   VWRIEGRMCESQSHKFHGLCMSDRTCVVVCKEEDFDDGKCRGFRHRCFCRKPC  135



>gb|KCW70075.1| hypothetical protein EUGRSUZ_F03380 [Eucalyptus grandis]
Length=74

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 29/53 (55%), Gaps = 0/53 (0%)
 Frame = -1

Query  453  IMKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            + ++E R+C  +S KF G+C+    C   C  + F  G C G RH C+C K C
Sbjct  22   VWRIEGRMCESQSHKFHGLCMSDRTCVVVCKEEDFDDGKCRGFRHRCFCRKPC  74



>ref|XP_008340512.1| PREDICTED: defensin-like protein 1 [Malus domestica]
Length=90

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 45/91 (49%), Gaps = 12/91 (13%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMG--------GPIMK--VEARLCN-YRSQKFTGVCVV  388
            M+PSM   +   F++++LL +  MG        G   K   E + C+ + S KF GVC  
Sbjct  1    MEPSMRF-VSAAFVLILLLVTTGMGPMAAEGRSGMTSKGAAEKKKCDSHPSSKFKGVCFF  59

Query  387  GNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
             N C  +C  +G +GG C G R  C C K C
Sbjct  60   TNNCVDTCKLEGSSGGQCRGFRRRCICTKQC  90



>ref|XP_008437687.1| PREDICTED: defensin J1-2-like [Cucumis melo]
Length=77

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 30/52 (58%), Gaps = 0/52 (0%)
 Frame = -1

Query  450  MKVEARLCNYRSQKFTGVCVVGNKCHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            M  EAR+C   S  F G+C     C + C ++GF+GG C G R  C+C K+C
Sbjct  25   MVAEARVCESPSHNFKGLCFSDTNCGNICKTEGFSGGLCRGFRRRCFCTKHC  76



>ref|XP_008385108.1| PREDICTED: defensin-like protein 2 [Malus domestica]
Length=87

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 42/88 (48%), Gaps = 9/88 (10%)
 Frame = -1

Query  534  MKPSMNVPLLVVFMIMMLLSSNDMG--------GPIMKVEARLCNYRSQKFTGVCVVGNK  379
            M+ SM + +   F+I++LL++ +MG             VE ++C   S  F G+C+  N 
Sbjct  1    MERSMRL-VSAAFVIVLLLATTEMGPMGVEARTESSKAVEGKICEVPSTLFKGLCISSNN  59

Query  378  CHSSCLSQGFAGGHCHGLRHLCYCYKNC  295
            C  +C  + F  GHC      C C K C
Sbjct  60   CKHTCRKEQFTRGHCSVFTRACVCTKKC  87



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 734258132967