BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c28494_g1_i1 len=922 path=[900:0-921]

Length=922
                                                                      Score     E

ref|XP_009613326.1|  PREDICTED: probable peroxygenase 5 isoform X1      240   6e-75   
ref|XP_009613327.1|  PREDICTED: probable peroxygenase 4 isoform X2      231   2e-71   
ref|XP_006367607.1|  PREDICTED: probable peroxygenase 7-like            229   7e-71   
ref|XP_006367608.1|  PREDICTED: probable peroxygenase 4-like            228   2e-70   
ref|XP_004228705.1|  PREDICTED: probable peroxygenase 5                 227   5e-70   
ref|XP_009781229.1|  PREDICTED: probable peroxygenase 5 isoform X2      226   1e-69   
ref|XP_009781230.1|  PREDICTED: probable peroxygenase 5 isoform X3      226   1e-69   
ref|XP_009781228.1|  PREDICTED: probable peroxygenase 5 isoform X1      226   1e-69   
ref|XP_009606536.1|  PREDICTED: probable peroxygenase 5 isoform X1      226   2e-69   
ref|XP_009606537.1|  PREDICTED: probable peroxygenase 5 isoform X2      225   2e-69   
ref|XP_006344282.1|  PREDICTED: probable peroxygenase 5-like            223   2e-68   
ref|XP_009594391.1|  PREDICTED: probable peroxygenase 5                 221   1e-67   
ref|XP_009797131.1|  PREDICTED: probable peroxygenase 5                 218   1e-66   
ref|XP_004228703.1|  PREDICTED: probable peroxygenase 5                 218   3e-66   
ref|XP_006416108.1|  hypothetical protein EUTSA_v10008654mg             218   4e-66   
gb|KHG07259.1|  putative peroxygenase 4 -like protein                   216   2e-65   
ref|XP_004142371.1|  PREDICTED: probable peroxygenase 4-like            215   2e-65   
ref|XP_009793194.1|  PREDICTED: probable peroxygenase 5                 214   3e-65   
ref|XP_008464711.1|  PREDICTED: probable peroxygenase 5                 214   1e-64   
ref|XP_003637674.1|  hypothetical protein MTR_097s0017                  214   1e-64   
ref|XP_004237000.1|  PREDICTED: probable peroxygenase 5 isoform X1      213   1e-64   
ref|XP_010319388.1|  PREDICTED: probable peroxygenase 5                 213   2e-64   
ref|XP_010270303.1|  PREDICTED: probable peroxygenase 4                 213   2e-64   
gb|AFK41940.1|  unknown                                                 213   2e-64   
ref|XP_004491461.1|  PREDICTED: probable peroxygenase 4-like            213   3e-64   
ref|XP_007225858.1|  hypothetical protein PRUPE_ppa011722mg             212   3e-64   
ref|XP_003533958.1|  PREDICTED: probable peroxygenase 4                 212   4e-64   
ref|XP_007225859.1|  hypothetical protein PRUPE_ppa011722mg             212   5e-64   
ref|XP_004491460.1|  PREDICTED: probable peroxygenase 4-like            213   2e-63   
gb|KHN20817.1|  Putative peroxygenase 4                                 211   2e-63   
ref|XP_006448184.1|  hypothetical protein CICLE_v10016732mg             211   2e-63   
ref|XP_006448183.1|  hypothetical protein CICLE_v10016732mg             211   2e-63   
ref|XP_002887323.1|  hypothetical protein ARALYDRAFT_894885             210   2e-63   
ref|XP_002314792.1|  calcium binding family protein                     210   3e-63   Populus trichocarpa [western balsam poplar]
gb|EYU30114.1|  hypothetical protein MIMGU_mgv1a013937mg                210   3e-63   
ref|NP_001240160.1|  uncharacterized protein LOC100799842               210   3e-63   
ref|NP_564996.1|  Caleosin-related family protein                       209   3e-63   Arabidopsis thaliana [mouse-ear cress]
gb|EYU30113.1|  hypothetical protein MIMGU_mgv1a013937mg                210   5e-63   
ref|XP_006469238.1|  PREDICTED: probable peroxygenase 4-like isof...    209   9e-63   
ref|XP_006469237.1|  PREDICTED: probable peroxygenase 4-like isof...    209   9e-63   
ref|XP_011021792.1|  PREDICTED: probable peroxygenase 4 isoform X1      209   9e-63   
gb|AAM67011.1|  unknown                                                 208   9e-63   Arabidopsis thaliana [mouse-ear cress]
gb|KDP38105.1|  hypothetical protein JCGZ_04748                         209   1e-62   
emb|CDP16322.1|  unnamed protein product                                207   1e-62   
ref|XP_008381737.1|  PREDICTED: probable peroxygenase 4                 208   1e-62   
dbj|BAF00552.1|  hypothetical protein                                   208   2e-62   Arabidopsis thaliana [mouse-ear cress]
gb|EYU30112.1|  hypothetical protein MIMGU_mgv1a013937mg                207   2e-62   
ref|XP_011021794.1|  PREDICTED: probable peroxygenase 4 isoform X2      208   2e-62   
ref|NP_001238730.1|  uncharacterized protein LOC100306686               207   3e-62   
ref|XP_011070582.1|  PREDICTED: probable peroxygenase 4                 207   3e-62   
gb|KHG06008.1|  putative peroxygenase 4 -like protein                   206   4e-62   
gb|AFK43312.1|  unknown                                                 207   4e-62   
ref|XP_002525985.1|  calcium ion binding protein, putative              207   4e-62   Ricinus communis
ref|XP_006355066.1|  PREDICTED: probable peroxygenase 5-like            207   5e-62   
ref|XP_010271333.1|  PREDICTED: probable peroxygenase 4                 209   7e-62   
ref|XP_007045248.1|  Caleosin-related family protein                    208   7e-62   
ref|XP_010066577.1|  PREDICTED: probable peroxygenase 4                 207   8e-62   
ref|XP_007153263.1|  hypothetical protein PHAVU_003G020500g             206   1e-61   
ref|XP_003637676.1|  hypothetical protein MTR_097s0019                  205   2e-61   
ref|XP_002312455.2|  calcium binding family protein                     205   3e-61   Populus trichocarpa [western balsam poplar]
ref|XP_010270200.1|  PREDICTED: probable peroxygenase 4                 205   3e-61   
ref|XP_006826899.1|  hypothetical protein AMTR_s00010p00152350          205   3e-61   
gb|KEH40599.1|  calcium ion-binding protein                             205   6e-61   
ref|XP_009351532.1|  PREDICTED: probable peroxygenase 4                 204   7e-61   
ref|XP_002887322.1|  hypothetical protein ARALYDRAFT_894884             203   1e-60   
ref|XP_004297445.1|  PREDICTED: probable peroxygenase 4-like            203   2e-60   
ref|XP_008775946.1|  PREDICTED: probable peroxygenase 5                 204   2e-60   
ref|XP_008221453.1|  PREDICTED: probable peroxygenase 4                 202   2e-60   
ref|XP_010460114.1|  PREDICTED: probable peroxygenase 7                 202   3e-60   
ref|XP_006303774.1|  hypothetical protein CARUB_v10012010mg             202   3e-60   
ref|NP_564995.1|  probable peroxygenase 4                               201   7e-60   Arabidopsis thaliana [mouse-ear cress]
gb|KFK44413.1|  hypothetical protein AALP_AA1G253800                    201   1e-59   
ref|XP_009419119.1|  PREDICTED: probable peroxygenase 4                 200   1e-59   
ref|XP_010498834.1|  PREDICTED: LOW QUALITY PROTEIN: probable per...    201   2e-59   
ref|XP_010415752.1|  PREDICTED: probable peroxygenase 4                 200   2e-59   
ref|XP_004498264.1|  PREDICTED: probable peroxygenase 5-like            200   3e-59   
ref|XP_009105736.1|  PREDICTED: probable peroxygenase 4                 199   3e-59   
ref|XP_010427851.1|  PREDICTED: probable peroxygenase 4                 199   4e-59   
ref|XP_010477616.1|  PREDICTED: probable peroxygenase 7                 199   5e-59   
gb|AAM65818.1|  unknown                                                 199   5e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006300554.1|  hypothetical protein CARUB_v10020949mg             199   6e-59   
ref|XP_010427852.1|  PREDICTED: probable peroxygenase 4                 200   7e-59   
ref|XP_010471067.1|  PREDICTED: probable peroxygenase 4                 198   8e-59   
ref|XP_011024003.1|  PREDICTED: probable peroxygenase 4                 198   1e-58   
ref|XP_010474261.1|  PREDICTED: probable peroxygenase 4                 199   1e-58   
emb|CDY11562.1|  BnaC06g31770D                                          197   2e-58   
emb|CDY09468.1|  BnaC02g20100D                                          197   2e-58   
ref|XP_009127817.1|  PREDICTED: probable peroxygenase 4                 197   2e-58   
ref|XP_008366985.1|  PREDICTED: probable peroxygenase 4                 196   6e-58   
ref|XP_003533957.1|  PREDICTED: probable peroxygenase 4-like            196   8e-58   
ref|XP_010652627.1|  PREDICTED: probable peroxygenase 4 isoform X1      196   1e-57   
ref|XP_010687657.1|  PREDICTED: probable peroxygenase 4                 196   1e-57   
ref|XP_002284889.1|  PREDICTED: probable peroxygenase 4 isoform X2      196   1e-57   Vitis vinifera
ref|XP_010415753.1|  PREDICTED: probable peroxygenase 4                 195   2e-57   
ref|XP_010932570.1|  PREDICTED: probable peroxygenase 5                 195   8e-57   
ref|XP_010687656.1|  PREDICTED: probable peroxygenase 5                 194   8e-57   
ref|XP_007153267.1|  hypothetical protein PHAVU_003G020800g             193   1e-56   
ref|XP_002893270.1|  hypothetical protein ARALYDRAFT_472583             192   3e-56   
ref|NP_173738.2|  caleosin-7                                            192   3e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009103187.1|  PREDICTED: probable peroxygenase 7                 191   6e-56   
emb|CDX68336.1|  BnaA07g23760D                                          192   7e-56   
ref|XP_008803896.1|  PREDICTED: probable peroxygenase 5                 191   8e-56   
emb|CDY12477.1|  BnaC07g13170D                                          190   2e-55   
emb|CDY25777.1|  BnaA07g10050D                                          190   2e-55   
ref|XP_009104946.1|  PREDICTED: probable peroxygenase 4                 189   2e-55   
ref|NP_001117339.1|  caleosin-7                                         189   2e-55   Arabidopsis thaliana [mouse-ear cress]
gb|KFK41485.1|  hypothetical protein AALP_AA2G136700                    188   6e-55   
emb|CDY23488.1|  BnaC06g24570D                                          188   7e-55   
ref|XP_008658722.1|  PREDICTED: ABA-induced protein isoform X1          188   1e-54   
ref|NP_001151879.1|  ABA-induced protein                                188   2e-54   Zea mays [maize]
gb|KFK41480.1|  hypothetical protein AALP_AA2G136200                    187   2e-54   
gb|EPS70602.1|  hypothetical protein M569_04163                         186   3e-54   
ref|XP_006390855.1|  hypothetical protein EUTSA_v10019146mg             186   6e-54   
ref|XP_004498263.1|  PREDICTED: probable peroxygenase 4-like            186   7e-54   
ref|XP_010552682.1|  PREDICTED: probable peroxygenase 4                 185   1e-53   
gb|KFK41479.1|  hypothetical protein AALP_AA2G136100                    185   1e-53   
ref|XP_010917507.1|  PREDICTED: probable peroxygenase 4                 185   1e-53   
ref|XP_002438178.1|  hypothetical protein SORBIDRAFT_10g009170          186   1e-53   Sorghum bicolor [broomcorn]
gb|EAY89082.1|  hypothetical protein OsI_10569                          184   7e-53   Oryza sativa Indica Group [Indian rice]
ref|XP_004965152.1|  PREDICTED: probable peroxygenase 4-like            183   1e-52   
gb|AAN05334.1|  Putative abscisic acid-induced protein - rice           185   1e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004985162.1|  PREDICTED: peroxygenase-like isoform X2            183   3e-52   
ref|XP_008775947.1|  PREDICTED: probable peroxygenase 4                 181   4e-52   
ref|XP_004985161.1|  PREDICTED: peroxygenase-like isoform X1            183   5e-52   
tpg|DAA44135.1|  TPA: caleosin                                          181   1e-51   
ref|NP_001151906.1|  caleosin                                           181   2e-51   Zea mays [maize]
ref|XP_008680206.1|  PREDICTED: caleosin isoform X1                     182   3e-51   
gb|EMT24935.1|  hypothetical protein F775_30239                         178   7e-51   
ref|XP_004965154.1|  PREDICTED: probable peroxygenase 4-like            178   9e-51   
gb|AAS48644.1|  putative ABA-induced protein                            178   1e-50   Cynodon dactylon
gb|AHV78311.1|  caleosin                                                177   2e-50   
ref|XP_008647470.1|  PREDICTED: uncharacterized protein LOC100217...    176   2e-50   
ref|NP_001137036.1|  uncharacterized protein LOC100217206               177   2e-50   Zea mays [maize]
ref|XP_008647468.1|  PREDICTED: uncharacterized protein LOC100217...    177   3e-50   
ref|XP_003563994.1|  PREDICTED: probable peroxygenase 5                 176   5e-50   
ref|XP_003558469.2|  PREDICTED: probable peroxygenase 3                 179   5e-50   
ref|XP_008647467.1|  PREDICTED: uncharacterized protein LOC100217...    176   7e-50   
gb|ABK21149.1|  unknown                                                 175   7e-50   Picea sitchensis
ref|NP_001057304.1|  Os06g0254700                                       176   7e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002468253.1|  hypothetical protein SORBIDRAFT_01g042490          177   1e-49   Sorghum bicolor [broomcorn]
emb|CAE51349.1|  calcium binding protein                                175   1e-49   Fagus sylvatica
ref|XP_004965153.1|  PREDICTED: probable peroxygenase 4-like            177   2e-49   
gb|EMT26349.1|  hypothetical protein F775_05056                         174   5e-49   
ref|XP_006656852.1|  PREDICTED: probable peroxygenase 4-like            172   2e-48   
gb|EMS61046.1|  hypothetical protein TRIUR3_30363                       173   2e-48   
gb|ABK40508.1|  pollen caleosin                                         173   2e-48   Lilium longiflorum [Easter lily]
ref|NP_001168487.1|  uncharacterized protein LOC100382264               172   3e-48   Zea mays [maize]
ref|XP_002468254.1|  hypothetical protein SORBIDRAFT_01g042500          171   6e-48   Sorghum bicolor [broomcorn]
ref|XP_006649654.1|  PREDICTED: peroxygenase-like                       172   9e-48   
ref|XP_010917509.1|  PREDICTED: probable peroxygenase 5                 170   9e-48   
ref|XP_009613328.1|  PREDICTED: probable peroxygenase 5 isoform X3      168   1e-47   
gb|AAF87020.1|AC005292_29  F26F24.9                                     174   1e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010917508.1|  PREDICTED: probable peroxygenase 4                 168   2e-47   
ref|XP_010909571.1|  PREDICTED: probable peroxygenase 5                 169   3e-47   
ref|XP_010556916.1|  PREDICTED: probable peroxygenase 3                 169   4e-47   
gb|AHV78312.1|  caleosin                                                169   7e-47   
gb|ACJ70083.1|  caleosin                                                168   1e-46   Cycas revoluta
ref|XP_006420653.1|  hypothetical protein CICLE_v10007170mg             168   1e-46   
ref|XP_007147207.1|  hypothetical protein PHAVU_006G104600g             167   2e-46   
ref|XP_010319446.1|  PREDICTED: probable peroxygenase 5 isoform X2      165   2e-46   
gb|EMS68550.1|  hypothetical protein TRIUR3_33351                       166   2e-46   
ref|XP_007225860.1|  hypothetical protein PRUPE_ppa011722mg             164   3e-46   
gb|ABK26053.1|  unknown                                                 167   4e-46   Picea sitchensis
ref|XP_010264909.1|  PREDICTED: peroxygenase-like                       167   4e-46   
dbj|BAD16161.1|  putative caleosin                                      166   5e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010455214.1|  PREDICTED: probable peroxygenase 3 isoform X1      167   5e-46   
ref|XP_009334188.1|  PREDICTED: peroxygenase-like                       166   6e-46   
gb|EMT05409.1|  hypothetical protein F775_31641                         166   6e-46   
gb|KCW60248.1|  hypothetical protein EUGRSUZ_H02961                     165   8e-46   
ref|XP_003573004.2|  PREDICTED: probable peroxygenase 5                 165   8e-46   
gb|KFK29187.1|  hypothetical protein AALP_AA7G100900                    166   8e-46   
ref|XP_007035235.1|  Peroxygenase 2 isoform 1                           166   1e-45   
ref|XP_008460684.1|  PREDICTED: peroxygenase                            166   1e-45   
ref|XP_010023857.1|  PREDICTED: peroxygenase                            166   1e-45   
gb|EEE57759.1|  hypothetical protein OsJ_08287                          165   1e-45   Oryza sativa Japonica Group [Japonica rice]
gb|AHV78307.1|  caleosin                                                167   1e-45   
ref|XP_010421718.1|  PREDICTED: peroxygenase 2-like                     165   1e-45   
ref|XP_009614481.1|  PREDICTED: peroxygenase-like                       165   2e-45   
gb|EAZ00895.1|  hypothetical protein OsI_22926                          164   3e-45   Oryza sativa Indica Group [Indian rice]
gb|ABK23847.1|  unknown                                                 164   3e-45   Picea sitchensis
gb|KEH42680.1|  caleosin CLO1-1                                         164   4e-45   
ref|XP_008224170.1|  PREDICTED: peroxygenase                            164   5e-45   
ref|XP_009773909.1|  PREDICTED: peroxygenase-like                       164   5e-45   
gb|EMT15880.1|  hypothetical protein F775_27952                         169   6e-45   
gb|AAQ74237.1|  caleosin 1                                              166   7e-45   Hordeum vulgare [barley]
gb|AFW58822.1|  hypothetical protein ZEAMMB73_295093                    162   7e-45   
gb|KGN61567.1|  hypothetical protein Csa_2G171880                       163   7e-45   
ref|XP_004494730.1|  PREDICTED: peroxygenase 2-like isoform X1          164   8e-45   
ref|XP_006413144.1|  hypothetical protein EUTSA_v10027334mg             164   8e-45   
ref|XP_004147185.1|  PREDICTED: peroxygenase-like                       163   8e-45   
ref|XP_004953838.1|  PREDICTED: probable peroxygenase 4-like            162   9e-45   
gb|EAZ24529.1|  hypothetical protein OsJ_08290                          163   1e-44   Oryza sativa Japonica Group [Japonica rice]
gb|EMS57193.1|  hypothetical protein TRIUR3_05867                       165   1e-44   
ref|XP_002867544.1|  hypothetical protein ARALYDRAFT_329010             163   1e-44   
ref|NP_001150081.1|  ABA-induced protein precursor                      162   1e-44   Zea mays [maize]
ref|XP_009142734.1|  PREDICTED: peroxygenase 1                          163   1e-44   
gb|AAY40837.1|  caleosin                                                163   1e-44   Brassica napus [oilseed rape]
ref|XP_006285912.1|  hypothetical protein CARUB_v10007431mg             163   1e-44   
gb|EMT27637.1|  hypothetical protein F775_09950                         164   2e-44   
ref|NP_194404.1|  peroxygenase 1                                        163   2e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433448.1|  PREDICTED: peroxygenase 1 isoform X2               163   2e-44   
gb|KHN30721.1|  Peroxygenase                                            162   2e-44   
ref|XP_010494127.1|  PREDICTED: peroxygenase-like                       162   2e-44   
ref|XP_002872333.1|  predicted protein                                  162   2e-44   
ref|XP_010433447.1|  PREDICTED: peroxygenase 1 isoform X1               163   2e-44   
ref|NP_001237343.1|  Ca+2-binding EF hand protein                       162   2e-44   
dbj|BAJ87067.1|  predicted protein                                      162   2e-44   
gb|KFK22107.1|  hypothetical protein AALP_AAs51970U000300               162   2e-44   
gb|AHV78310.1|  caleosin                                                162   3e-44   
dbj|BAJ85662.1|  predicted protein                                      162   3e-44   
ref|XP_009334210.1|  PREDICTED: peroxygenase-like                       162   3e-44   
gb|AFW73291.1|  ABA-induced protein                                     161   3e-44   
ref|NP_001241768.1|  caleosin related protein                           161   3e-44   
gb|AFW73290.1|  ABA-induced protein                                     161   3e-44   
ref|XP_008340650.1|  PREDICTED: peroxygenase                            162   3e-44   
ref|XP_006301600.1|  hypothetical protein CARUB_v10022039mg             159   4e-44   
ref|XP_010482958.1|  PREDICTED: peroxygenase 2 isoform X2               161   4e-44   
ref|XP_007227560.1|  hypothetical protein PRUPE_ppa010705mg             161   4e-44   
ref|NP_001152407.1|  LOC100286047 precursor                             161   5e-44   Zea mays [maize]
gb|EMS65539.1|  hypothetical protein TRIUR3_09985                       161   5e-44   
ref|XP_010482957.1|  PREDICTED: peroxygenase 2 isoform X1               161   5e-44   
ref|XP_010438703.1|  PREDICTED: peroxygenase 1-like                     161   6e-44   
ref|XP_002864386.1|  hypothetical protein ARALYDRAFT_495609             161   6e-44   
ref|XP_010448216.1|  PREDICTED: peroxygenase 1-like                     161   6e-44   
ref|XP_004152813.1|  PREDICTED: peroxygenase-like                       161   6e-44   
gb|KHN31490.1|  Peroxygenase 2                                          161   6e-44   
emb|CDX85425.1|  BnaC07g27360D                                          161   7e-44   
ref|NP_180896.1|  caleosin 3                                            161   7e-44   Arabidopsis thaliana [mouse-ear cress]
emb|CAE03380.1|  OSJNBa0004N05.4                                        161   8e-44   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK07934.1|  predicted protein                                      162   8e-44   
gb|ACG69529.1|  caleosin CLO1-1                                         161   8e-44   Brassica napus [oilseed rape]
gb|AAL36241.1|  putative embryo-specific protein ATS1                   161   8e-44   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001048040.1|  Os02g0734600                                       164   9e-44   Oryza sativa Japonica Group [Japonica rice]
gb|EPS58841.1|  caleosin                                                160   9e-44   
gb|EYU32581.1|  hypothetical protein MIMGU_mgv1a012738mg                160   1e-43   
ref|XP_009357985.1|  PREDICTED: peroxygenase-like                       160   1e-43   
ref|XP_004247935.1|  PREDICTED: peroxygenase                            160   1e-43   
ref|XP_010449309.1|  PREDICTED: peroxygenase 2-like                     160   1e-43   
emb|CDX79524.1|  BnaC03g18600D                                          160   1e-43   
ref|XP_010675145.1|  PREDICTED: peroxygenase                            160   1e-43   
ref|XP_009129806.1|  PREDICTED: peroxygenase 2                          160   1e-43   
ref|XP_008218348.1|  PREDICTED: peroxygenase                            160   2e-43   
emb|CDY05610.1|  BnaC02g39270D                                          160   2e-43   
gb|ABK26902.1|  unknown                                                 160   2e-43   Picea sitchensis
ref|XP_002454327.1|  hypothetical protein SORBIDRAFT_04g028730          159   2e-43   Sorghum bicolor [broomcorn]
emb|CDX94289.1|  BnaC01g18950D                                          160   2e-43   
ref|XP_007205801.1|  hypothetical protein PRUPE_ppa010656mg             160   2e-43   
gb|ACG69531.1|  caleosin CLO1-7                                         160   2e-43   Brassica napus [oilseed rape]
ref|NP_001142815.1|  uncharacterized protein LOC100275194 precursor     159   3e-43   Zea mays [maize]
ref|NP_001174012.1|  Os04g0510900                                       161   3e-43   
ref|XP_002314502.2|  Ca+2-binding EF hand family protein                159   3e-43   Populus trichocarpa [western balsam poplar]
gb|ACG69536.1|  caleosin CLO1-4                                         159   3e-43   Brassica napus [oilseed rape]
ref|XP_002977061.1|  hypothetical protein SELMODRAFT_151702             159   3e-43   
gb|ACG69538.1|  caleosin CLO1-6                                         159   3e-43   Brassica napus [oilseed rape]
emb|CDY17168.1|  BnaA05g10200D                                          159   3e-43   
gb|EEC77624.1|  hypothetical protein OsI_16609                          160   3e-43   Oryza sativa Indica Group [Indian rice]
ref|XP_009143868.1|  PREDICTED: probable peroxygenase 3                 159   3e-43   
ref|XP_002528367.1|  calcium ion binding protein, putative              159   4e-43   Ricinus communis
gb|ACG69533.1|  caleosin CLO1-3                                         159   4e-43   Brassica napus [oilseed rape]
emb|CDY19488.1|  BnaC04g11110D                                          159   5e-43   
ref|NP_200335.1|  peroxygenase 2                                        159   5e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001136811.1|  uncharacterized protein LOC100216957               161   5e-43   Zea mays [maize]
ref|XP_011091249.1|  PREDICTED: peroxygenase-like                       159   5e-43   
ref|XP_011041431.1|  PREDICTED: peroxygenase 1-like                     159   6e-43   
ref|XP_008441793.1|  PREDICTED: peroxygenase-like                       159   6e-43   
gb|KFK31052.1|  hypothetical protein AALP_AA6G062100                    159   6e-43   
gb|ACG69530.1|  caleosin CLO1-2                                         159   7e-43   Brassica napus [oilseed rape]
ref|XP_006410477.1|  hypothetical protein EUTSA_v10017178mg             157   7e-43   
ref|XP_006342683.1|  PREDICTED: peroxygenase-like                       158   7e-43   
emb|CDO99286.1|  unnamed protein product                                158   8e-43   
ref|XP_006410478.1|  hypothetical protein EUTSA_v10017178mg             158   8e-43   
ref|XP_010545246.1|  PREDICTED: peroxygenase 1                          158   8e-43   
ref|XP_008643661.1|  PREDICTED: caleosin related protein isoform X1     158   9e-43   
ref|NP_001148700.1|  caleosin related protein                           158   9e-43   Zea mays [maize]
ref|XP_006489647.1|  PREDICTED: peroxygenase 1-like                     158   9e-43   
ref|XP_006354534.1|  PREDICTED: peroxygenase-like                       158   1e-42   
ref|XP_008643662.1|  PREDICTED: caleosin related protein isoform X2     157   1e-42   
ref|XP_004495300.1|  PREDICTED: peroxygenase-like isoform X1            158   1e-42   
gb|AAY87906.1|  caleosin B                                              158   1e-42   Sesamum indicum [beniseed]
ref|XP_007144127.1|  hypothetical protein PHAVU_007G130900g             158   1e-42   
ref|XP_007144128.1|  hypothetical protein PHAVU_007G130900g             157   1e-42   
ref|XP_002881279.1|  hypothetical protein ARALYDRAFT_482279             157   1e-42   
gb|KHN43167.1|  Peroxygenase 2                                          160   1e-42   
gb|KDO54114.1|  hypothetical protein CISIN_1g043673mg                   158   2e-42   
ref|XP_002448156.1|  hypothetical protein SORBIDRAFT_06g022280          159   2e-42   
ref|XP_010413880.1|  PREDICTED: probable peroxygenase 3                 157   2e-42   
ref|XP_009776077.1|  PREDICTED: peroxygenase-like                       157   2e-42   
ref|XP_008388736.1|  PREDICTED: peroxygenase                            157   2e-42   
ref|XP_010920301.1|  PREDICTED: peroxygenase-like                       157   2e-42   
ref|NP_973892.1|  caleosin-7                                            155   2e-42   
ref|XP_006294908.1|  hypothetical protein CARUB_v10023959mg             157   3e-42   
ref|XP_008364041.1|  PREDICTED: peroxygenase-like                       157   3e-42   
ref|XP_004976189.1|  PREDICTED: peroxygenase-like                       159   3e-42   
gb|KEH24578.1|  caleosin CLO1-1                                         157   3e-42   
ref|XP_009343778.1|  PREDICTED: peroxygenase-like                       157   3e-42   
ref|XP_006395040.1|  hypothetical protein EUTSA_v10004844mg             156   3e-42   
gb|AIC74541.1|  caleosin                                                157   4e-42   
emb|CDX84691.1|  BnaA03g15390D                                          156   4e-42   
ref|XP_004253022.1|  PREDICTED: peroxygenase-like                       156   4e-42   
ref|XP_009379738.1|  PREDICTED: peroxygenase-like                       156   5e-42   
ref|XP_011091251.1|  PREDICTED: peroxygenase                            156   6e-42   
gb|ACG69528.1|  caleosin CLO3-2                                         156   6e-42   
ref|XP_006401476.1|  hypothetical protein EUTSA_v10015338mg             156   7e-42   
gb|KDP40384.1|  hypothetical protein JCGZ_02382                         155   7e-42   
ref|XP_010469483.1|  PREDICTED: probable peroxygenase 3                 155   7e-42   
ref|XP_003573005.1|  PREDICTED: probable peroxygenase 5                 155   8e-42   
ref|XP_002964989.1|  hypothetical protein SELMODRAFT_167445             155   9e-42   
ref|XP_009141309.1|  PREDICTED: probable peroxygenase 3                 155   1e-41   
ref|XP_010413875.1|  PREDICTED: probable peroxygenase 3                 155   1e-41   
ref|XP_004296406.1|  PREDICTED: peroxygenase 2-like                     155   1e-41   
ref|XP_007035236.1|  Peroxygenase 2 isoform 2                           154   1e-41   
ref|XP_009412834.1|  PREDICTED: peroxygenase-like                       155   1e-41   
gb|AGT16357.1|  caleosin                                                156   1e-41   
ref|XP_008350784.1|  PREDICTED: peroxygenase-like                       155   1e-41   
emb|CDY17314.1|  BnaA10g09480D                                          155   2e-41   
gb|KHG10264.1|  putative peroxygenase 3 -like protein                   154   2e-41   
gb|ACG69527.1|  caleosin CLO3-1                                         155   2e-41   
ref|XP_008801250.1|  PREDICTED: peroxygenase-like                       154   2e-41   
ref|XP_004304777.1|  PREDICTED: peroxygenase 2-like                     154   3e-41   
gb|ABK26466.1|  unknown                                                 154   3e-41   
gb|ABK26654.1|  unknown                                                 154   4e-41   
ref|XP_001762757.1|  predicted protein                                  155   4e-41   
gb|ACP27620.1|  caleosin                                                156   4e-41   
ref|XP_009120047.1|  PREDICTED: peroxygenase 2                          154   5e-41   
ref|XP_009132922.1|  PREDICTED: probable peroxygenase 3                 154   5e-41   
ref|XP_002285439.1|  PREDICTED: peroxygenase                            153   6e-41   
ref|XP_001765592.1|  predicted protein                                  153   7e-41   
ref|XP_010509897.1|  PREDICTED: probable peroxygenase 3                 153   7e-41   
gb|KHG10747.1|  putative peroxygenase 3 -like protein                   152   1e-40   
ref|XP_003581417.2|  PREDICTED: peroxygenase-like                       154   1e-40   
ref|XP_004491463.1|  PREDICTED: probable peroxygenase 5-like            151   1e-40   
ref|XP_006470949.1|  PREDICTED: peroxygenase-like                       152   2e-40   
gb|EMT14817.1|  hypothetical protein F775_30519                         151   2e-40   
gb|KDO64544.1|  hypothetical protein CISIN_1g032767mg                   149   2e-40   
gb|EEC73952.1|  hypothetical protein OsI_08836                          151   2e-40   
gb|KDO64545.1|  hypothetical protein CISIN_1g032767mg                   149   2e-40   
ref|XP_010549654.1|  PREDICTED: peroxygenase                            152   2e-40   
ref|XP_007035239.1|  Caleosin-related family protein, putative          155   2e-40   
ref|XP_002974949.1|  hypothetical protein SELMODRAFT_36610              149   2e-40   
ref|XP_010089211.1|  hypothetical protein L484_005702                   151   3e-40   
gb|ABV72237.1|  caleosin                                                150   6e-40   
gb|EMS65282.1|  hypothetical protein TRIUR3_22156                       150   7e-40   
gb|KHG23970.1|  Peroxygenase 1 -like protein                            150   7e-40   
gb|EMT08488.1|  hypothetical protein F775_19008                         150   7e-40   
ref|XP_002977370.1|  hypothetical protein SELMODRAFT_106795             149   7e-40   
ref|XP_002454328.1|  hypothetical protein SORBIDRAFT_04g028740          150   1e-39   
gb|KHG04745.1|  putative peroxygenase 3 -like protein                   149   2e-39   
sp|G1JSL4.1|PXG1_AVESA  RecName: Full=Peroxygenase 1; Short=AsPXG1      150   2e-39   
ref|XP_004953837.1|  PREDICTED: probable peroxygenase 4-like            149   2e-39   
emb|CDY19900.1|  BnaC09g31660D                                          149   4e-39   
ref|XP_010089209.1|  hypothetical protein L484_005700                   148   6e-39   
gb|EMT15775.1|  hypothetical protein F775_32410                         148   7e-39   
ref|XP_006279752.1|  hypothetical protein CARUB_v10027687mg             148   8e-39   
ref|XP_005644305.1|  Caleosin-domain-containing protein                 148   9e-39   
dbj|BAJ94120.1|  predicted protein                                      147   9e-39   
ref|NP_001057303.1|  Os06g0254600                                       147   9e-39   
ref|XP_010509900.1|  PREDICTED: probable peroxygenase 3                 146   1e-38   
ref|XP_010240125.1|  PREDICTED: LOW QUALITY PROTEIN: peroxygenase...    147   1e-38   
ref|XP_006849376.1|  hypothetical protein AMTR_s00158p00077100          147   2e-38   
ref|XP_009594620.1|  PREDICTED: peroxygenase-like                       147   2e-38   
ref|XP_004491459.1|  PREDICTED: probable peroxygenase 4-like            145   2e-38   
ref|XP_004491458.1|  PREDICTED: probable peroxygenase 5-like            144   3e-38   
ref|XP_010670948.1|  PREDICTED: peroxygenase                            145   6e-38   
ref|XP_003563995.1|  PREDICTED: probable peroxygenase 4                 145   7e-38   
ref|XP_007776235.1|  hypothetical protein W97_00128                     144   1e-37   
ref|XP_005644306.1|  Caleosin-domain-containing protein                 145   2e-37   
dbj|BAD45228.1|  putative calcium binding protein                       144   2e-37   
gb|ABX10750.1|  RD20                                                    144   2e-37   
ref|XP_003581419.1|  PREDICTED: peroxygenase-like isoform X1            144   2e-37   
gb|EMT24881.1|  hypothetical protein F775_11236                         143   4e-37   
ref|XP_001776761.1|  predicted protein                                  143   4e-37   
gb|AAQ74239.1|  caleosin 2                                              143   4e-37   
gb|KHG03191.1|  putative peroxygenase 3 -like protein                   143   5e-37   
ref|XP_010105164.1|  hypothetical protein L484_002647                   145   7e-37   
gb|AHV78308.1|  caleosin                                                142   8e-37   
gb|EMS54213.1|  hypothetical protein TRIUR3_28453                       142   8e-37   
ref|XP_010443145.1|  PREDICTED: peroxygenase 2-like isoform X1          141   1e-36   
ref|XP_009763891.1|  PREDICTED: probable peroxygenase 4                 138   2e-36   
gb|EMS64839.1|  hypothetical protein TRIUR3_12951                       141   3e-36   
gb|ADG01891.1|  EF-hand calcium-binding protein                         139   6e-36   
ref|XP_002438174.1|  hypothetical protein SORBIDRAFT_10g009140          140   6e-36   
ref|NP_850891.2|  caleosin-related family protein                       139   6e-36   
ref|XP_003558519.1|  PREDICTED: probable peroxygenase 5                 139   7e-36   
ref|XP_002979311.1|  hypothetical protein SELMODRAFT_110494             138   7e-36   
ref|XP_010443146.1|  PREDICTED: peroxygenase 2-like isoform X2          139   8e-36   
gb|AEB77763.1|  caleosin                                                140   1e-35   
ref|XP_002988620.1|  hypothetical protein SELMODRAFT_128319             137   1e-35   
ref|XP_006652504.1|  PREDICTED: peroxygenase-like                       139   2e-35   
ref|XP_006673497.1|  caleosin domain containing protein                 141   3e-35   
gb|EMT08487.1|  hypothetical protein F775_31115                         137   3e-35   
ref|XP_007794328.1|  putative caleosin domain-containing protein        138   4e-35   
ref|XP_007153266.1|  hypothetical protein PHAVU_003G0207000g            134   4e-35   
gb|ADV39993.1|  EF-hand calcium bining protein                          137   5e-35   
emb|CCT69585.1|  related to calcium-binding protein caleosin            138   5e-35   
ref|NP_001053291.1|  Os04g0511200                                       137   6e-35   
ref|XP_008027164.1|  hypothetical protein SETTUDRAFT_136458             137   6e-35   
emb|CAB71337.1|  putative calcium binding EF-hand protein               136   1e-34   
ref|XP_001932418.1|  caleosin domain containing protein                 137   1e-34   
gb|ACU18512.1|  unknown                                                 136   1e-34   
emb|CCU77649.1|  caleosin domain-containing protein                     137   1e-34   
ref|XP_003303022.1|  hypothetical protein PTT_15044                     137   1e-34   
gb|EWZ38898.1|  hypothetical protein FOZG_08143                         137   2e-34   
gb|EWZ84140.1|  hypothetical protein FOWG_12959                         136   3e-34   
gb|EMT73813.1|  hypothetical protein FOC4_g10002846                     136   3e-34   
ref|XP_002438176.1|  hypothetical protein SORBIDRAFT_10g009160          135   3e-34   
gb|EPQ66680.1|  hypothetical protein BGT96224_A21385                    135   4e-34   
emb|CDO77693.1|  hypothetical protein BN946_scf184969.g44               135   5e-34   
gb|ABK24129.1|  unknown                                                 132   6e-34   
gb|KFM29325.1|  hypothetical protein F751_5763                          134   1e-33   
gb|EHK43225.1|  hypothetical protein TRIATDRAFT_35017                   134   1e-33   
gb|EXL69151.1|  hypothetical protein FOPG_14866                         134   2e-33   
ref|XP_008034583.1|  Caleosin-domain-containing protein                 134   2e-33   
ref|XP_008643881.1|  PREDICTED: uncharacterized protein LOC100382...    132   2e-33   
gb|EWG55153.1|  hypothetical protein FVEG_13198                         134   2e-33   
ref|XP_009604473.1|  PREDICTED: probable peroxygenase 4                 132   2e-33   
gb|EMS68766.1|  hypothetical protein TRIUR3_30394                       133   2e-33   
ref|XP_007685144.1|  hypothetical protein COCMIDRAFT_34201              134   2e-33   
gb|EHK22269.1|  hypothetical protein TRIVIDRAFT_29019                   134   3e-33   
ref|XP_007732176.1|  hypothetical protein A1O3_03851                    133   3e-33   
ref|XP_002958325.1|  hypothetical protein VOLCADRAFT_69295              133   3e-33   
ref|NP_001148328.1|  calcium binding EF-hand protein                    132   3e-33   
gb|EXK28111.1|  hypothetical protein FOMG_15562                         133   3e-33   
emb|CCF32576.1|  hypothetical protein CH063_04936                       133   3e-33   
ref|XP_007281904.1|  caleosin domain containing protein                 133   3e-33   
ref|NP_173739.4|  Caleosin-related family protein                       132   4e-33   
gb|EWY89570.1|  hypothetical protein FOYG_10391                         134   5e-33   
gb|KFA67324.1|  hypothetical protein S40285_03648                       131   9e-33   
gb|KHN01036.1|  Peroxygenase                                            130   9e-33   
gb|EQB51792.1|  hypothetical protein CGLO_08630                         132   1e-32   
ref|XP_002438175.1|  hypothetical protein SORBIDRAFT_10g009150          130   1e-32   
gb|EAY87427.1|  hypothetical protein OsI_08835                          130   2e-32   
gb|ACN27190.1|  unknown                                                 130   2e-32   
ref|XP_007589946.1|  hypothetical protein CFIO01_00081                  131   2e-32   
gb|KEY69579.1|  hypothetical protein S7711_06208                        130   3e-32   
emb|CAB42585.1|  putative Ca++ binding protein                          129   3e-32   
gb|ENH89180.1|  caleosin domain containing protein                      130   4e-32   
gb|KFA76104.1|  hypothetical protein S40288_00288                       129   4e-32   
ref|XP_006961944.1|  predicted protein                                  130   4e-32   
ref|XP_007703578.1|  hypothetical protein COCSADRAFT_39970              130   4e-32   
ref|XP_007717760.1|  hypothetical protein COCCADRAFT_41458              130   5e-32   
gb|EUN21251.1|  hypothetical protein COCVIDRAFT_114448                  130   5e-32   
ref|XP_003717404.1|  caleosin domain-containing protein                 130   6e-32   
gb|EFQ36012.1|  hypothetical protein GLRG_11156                         129   6e-32   
gb|EWZ39175.1|  hypothetical protein FOZG_08350                         130   7e-32   
gb|KFA66825.1|  hypothetical protein S40285_06823                       129   9e-32   
gb|EXA39984.1|  hypothetical protein FOVG_08961                         129   1e-31   
gb|KFA71461.1|  hypothetical protein S40288_08010                       129   1e-31   
gb|EST05437.1|  hypothetical protein PSEUBRA_SCAF5g02283                129   1e-31   
gb|EMD95174.1|  hypothetical protein COCHEDRAFT_1168834                 129   2e-31   
gb|ENH71098.1|  hypothetical protein FOC1_g10008471                     128   2e-31   
gb|EMT24974.1|  hypothetical protein F775_31159                         127   2e-31   
gb|AAK92225.1|  calcium-binding protein 1                               128   2e-31   
gb|EWZ83860.1|  hypothetical protein FOWG_12754                         128   3e-31   
gb|EMD94515.1|  hypothetical protein COCHEDRAFT_1170601                 127   4e-31   
gb|EXL84018.1|  hypothetical protein FOPG_03578                         128   4e-31   
ref|XP_007724118.1|  hypothetical protein A1O1_05040                    127   5e-31   
gb|EMS53209.1|  hypothetical protein TRIUR3_07592                       126   6e-31   
gb|EXK31425.1|  hypothetical protein FOMG_13107                         127   6e-31   
gb|KHJ32187.1|  putative caleosin domain containing protein             127   6e-31   
ref|XP_002470263.1|  predicted protein                                  127   6e-31   
dbj|GAB00047.1|  hypothetical protein E5Q_06749                         128   6e-31   
ref|XP_007717793.1|  hypothetical protein COCCADRAFT_41490              127   7e-31   
gb|KEF55152.1|  hypothetical protein A1O9_08806                         127   9e-31   
gb|EWY89292.1|  hypothetical protein FOYG_10183                         127   9e-31   
gb|EMT26352.1|  hypothetical protein F775_10504                         124   1e-30   
ref|XP_008600624.1|  calcium binding protein Caleosin                   126   1e-30   
ref|XP_004965151.1|  PREDICTED: probable peroxygenase 7-like            127   1e-30   
ref|XP_001888722.1|  predicted protein                                  126   2e-30   
ref|XP_008081073.1|  hypothetical protein GLAREA_12100                  127   2e-30   
ref|XP_001800396.1|  hypothetical protein SNOG_10114                    125   2e-30   
gb|EXL95488.1|  hypothetical protein FOIG_11994                         126   2e-30   
ref|XP_007696470.1|  hypothetical protein COCSADRAFT_33830              125   2e-30   
gb|KEY69278.1|  hypothetical protein S7711_01729                        125   3e-30   
gb|ENH71248.1|  hypothetical protein FOC1_g10006105                     125   3e-30   
gb|EUN26813.1|  hypothetical protein COCVIDRAFT_38075                   125   3e-30   
ref|XP_007693914.1|  hypothetical protein COCMIDRAFT_111202             125   4e-30   
ref|XP_003708880.1|  caleosin domain-containing protein                 125   4e-30   
gb|EAZ00389.1|  hypothetical protein OsI_22404                          125   5e-30   
ref|XP_007860338.1|  Caleosin-domain-containing protein                 125   5e-30   
gb|ELQ37745.1|  caleosin domain-containing protein                      125   6e-30   
ref|XP_003837175.1|  hypothetical protein LEMA_P034090.1                125   6e-30   
gb|KDQ30160.1|  hypothetical protein PLEOSDRAFT_1095851                 122   7e-30   
ref|XP_007785509.1|  hypothetical protein EPUS_08460                    124   8e-30   
emb|CCT69755.1|  related to calcium-binding protein caleosin            123   1e-29   
ref|XP_009154680.1|  hypothetical protein HMPREF1120_02391              124   1e-29   
gb|EMD37536.1|  hypothetical protein CERSUDRAFT_114166                  123   2e-29   
gb|KEQ85543.1|  Caleosin-domain-containing protein                      124   2e-29   
gb|AFW76957.1|  hypothetical protein ZEAMMB73_516673                    120   2e-29   
ref|XP_001397384.1|  calcium binding protein Caleosin                   124   2e-29   
dbj|GAA84711.1|  caleosin domain protein                                124   2e-29   
gb|EMF11182.1|  caleosin domain-containing protein                      123   4e-29   
gb|EWG39815.1|  hypothetical protein FVEG_02508                         122   4e-29   
ref|XP_758900.1|  hypothetical protein UM02753.1                        122   4e-29   
gb|EMS67936.1|  hypothetical protein TRIUR3_15923                       118   5e-29   
dbj|GAK64317.1|  caleosin domain containing protein                     122   5e-29   
gb|EGU88233.1|  hypothetical protein FOXB_01251                         121   7e-29   
gb|EPS65302.1|  hypothetical protein M569_09475                         117   8e-29   
ref|NP_001151675.1|  calcium binding EF-hand protein precursor          120   8e-29   
ref|XP_007813582.1|  caleosin domain containing protein                 119   9e-29   
emb|CDI53621.1|  conserved hypothetical protein                         121   1e-28   



>ref|XP_009613326.1| PREDICTED: probable peroxygenase 5 isoform X1 [Nicotiana tomentosiformis]
Length=194

 Score =   240 bits (612),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 142/193 (74%), Gaps = 2/193 (1%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            MASS+S +P   GM   DE TPL KHVMFFD N+DGIIYPWET+QG RK+G   F S+  
Sbjct  1    MASSSSLQP--DGMGNHDEPTPLGKHVMFFDINKDGIIYPWETYQGLRKLGHNIFRSLLA  58

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
            +  IH+VLS K+RPGK PS +FPIVI+NIK   HGSDS AYD EG FV  K EEIF KY 
Sbjct  59   AVLIHLVLSHKTRPGKWPSLLFPIVIKNIKYGKHGSDSDAYDAEGRFVPEKFEEIFKKYA  118

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
            H   N+LTS +V+ELL+  R+P DY GW+ A+ +WR+LY LAKD  G LTKE V  VYDG
Sbjct  119  HKNANSLTSNKVNELLKKNREPKDYFGWLNASTDWRILYDLAKDKNGELTKEAVRAVYDG  178

Query  604  SLFDQLAKEHAPK  642
            SLF+Q+A+E+A K
Sbjct  179  SLFEQMARENASK  191



>ref|XP_009613327.1| PREDICTED: probable peroxygenase 4 isoform X2 [Nicotiana tomentosiformis]
Length=183

 Score =   231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 133/180 (74%), Gaps = 0/180 (0%)
 Frame = +1

Query  103  MEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSR  282
            M   DE TPL KHVMFFD N+DGIIYPWET+QG RK+G   F S+  +  IH+VLS K+R
Sbjct  1    MGNHDEPTPLGKHVMFFDINKDGIIYPWETYQGLRKLGHNIFRSLLAAVLIHLVLSHKTR  60

Query  283  PGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVD  462
            PGK PS +FPIVI+NIK   HGSDS AYD EG FV  K EEIF KY H   N+LTS +V+
Sbjct  61   PGKWPSLLFPIVIKNIKYGKHGSDSDAYDAEGRFVPEKFEEIFKKYAHKNANSLTSNKVN  120

Query  463  ELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPK  642
            ELL+  R+P DY GW+ A+ +WR+LY LAKD  G LTKE V  VYDGSLF+Q+A+E+A K
Sbjct  121  ELLKKNREPKDYFGWLNASTDWRILYDLAKDKNGELTKEAVRAVYDGSLFEQMARENASK  180



>ref|XP_006367607.1| PREDICTED: probable peroxygenase 7-like [Solanum tuberosum]
Length=191

 Score =   229 bits (584),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 142/198 (72%), Gaps = 8/198 (4%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            MASST       G+  +DE TPL+KHVMFFD N+DGIIYPWET+QGFRK+G   F S+  
Sbjct  1    MASST-------GIGNNDELTPLQKHVMFFDINKDGIIYPWETYQGFRKLGRNVFRSLLA  53

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
            +  IHIV S K+RPGK PSP+FPIVI+NIK   HGSDS AYD EG FV  K EEIF KY 
Sbjct  54   AVLIHIVTSGKTRPGKWPSPLFPIVIKNIKFGKHGSDSDAYDSEGRFVPEKFEEIFKKYA  113

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
            H  + +LTS+EV+ELL+  R+P DY GW+ A  +WR+L+ + K+  G+LTKE V  VYDG
Sbjct  114  HKNSESLTSEEVNELLKKNREPKDYFGWLNAITDWRILFDVGKNKDGILTKEAVRDVYDG  173

Query  604  SLFDQLAKE-HAPKIKAN  654
            +LF+Q A+E  A K K N
Sbjct  174  TLFEQKAREVAAEKSKVN  191



>ref|XP_006367608.1| PREDICTED: probable peroxygenase 4-like [Solanum tuberosum]
Length=200

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 141/199 (71%), Gaps = 0/199 (0%)
 Frame = +1

Query  70   SSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALST  249
            +S+S     +G+EK +E TPL+KHVMFFD N+DG+IYPWET++GFRKIG G  LS   S 
Sbjct  2    ASSSNNIDEEGIEKKEEPTPLEKHVMFFDINKDGVIYPWETYKGFRKIGSGVLLSTVASI  61

Query  250  FIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHT  429
            FI+I LS K+RPGK PSP+FPI ++NIK   H SDS  YD EG FV  K EE+FNK+G T
Sbjct  62   FINIGLSGKTRPGKWPSPLFPIEVKNIKFAKHSSDSDIYDTEGRFVPEKFEELFNKHGRT  121

Query  430  YTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSL  609
              NALT +E+DELL+  + P D+ G + A  EW++LYLL KD  G+L KE +  VYDGSL
Sbjct  122  NDNALTGEELDELLKANKQPKDFAGHIAAKSEWKILYLLCKDENGMLPKETIRSVYDGSL  181

Query  610  FDQLAKEHAPKIKANNSTA  666
            F+Q+AKE   K     S++
Sbjct  182  FEQMAKEKQSKKHRGKSSS  200



>ref|XP_004228705.1| PREDICTED: probable peroxygenase 5 [Solanum lycopersicum]
Length=191

 Score =   227 bits (579),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 140/198 (71%), Gaps = 7/198 (4%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            MASS+       G+  +DE TPL+KHVMFFD N+DGIIYPWET+QGFRK+G   F S+  
Sbjct  1    MASSS-------GIGNNDELTPLQKHVMFFDINKDGIIYPWETYQGFRKLGRNVFRSLLA  53

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
            +  IH+V S K+RPGK PSP+FPI I+NIK   HGSDS AYD EG FV  K EEIF KY 
Sbjct  54   AVLIHVVTSGKTRPGKWPSPLFPIEIKNIKFGKHGSDSDAYDSEGRFVPEKFEEIFKKYA  113

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
            H  + +LTS+EV+ELL+  R+P DY GW+ A  +WR+L+ + K+  G+LTKE V  VYDG
Sbjct  114  HNNSESLTSEEVNELLKKNREPKDYFGWLNAMTDWRILFDVGKNKDGILTKEAVRDVYDG  173

Query  604  SLFDQLAKEHAPKIKANN  657
            +LF+Q A+E A K    N
Sbjct  174  TLFEQKAREVAAKKSKEN  191



>ref|XP_009781229.1| PREDICTED: probable peroxygenase 5 isoform X2 [Nicotiana sylvestris]
Length=195

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 140/193 (73%), Gaps = 3/193 (2%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            MAS  S   + +G+EK  E TPL+KHVMFFD N+DG+IYPWET+QGFRKIG G FLSV  
Sbjct  1    MASYNSI--HQEGIEKK-EPTPLEKHVMFFDINKDGVIYPWETYQGFRKIGSGIFLSVFA  57

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
            S FI+  LS K+RPGK PS +FPI ++NIKL  HGSDSG YD EG FV  K EEIF K+ 
Sbjct  58   SIFINAGLSRKTRPGKWPSLLFPIEVKNIKLAKHGSDSGVYDTEGRFVPEKFEEIFKKHA  117

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
             +  NALT++E+DE+L+    P D  G + A  EW++LY L KD  GLL KE+V GVYDG
Sbjct  118  RSNANALTAQELDEMLKANEQPKDSKGRIAALSEWKILYFLCKDKNGLLGKEKVRGVYDG  177

Query  604  SLFDQLAKEHAPK  642
            SLF+Q+AKE+  K
Sbjct  178  SLFEQMAKEYQSK  190



>ref|XP_009781230.1| PREDICTED: probable peroxygenase 5 isoform X3 [Nicotiana sylvestris]
Length=193

 Score =   226 bits (576),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 140/193 (73%), Gaps = 3/193 (2%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            MAS  S   + +G+EK  E TPL+KHVMFFD N+DG+IYPWET+QGFRKIG G FLSV  
Sbjct  1    MASYNSI--HQEGIEKK-EPTPLEKHVMFFDINKDGVIYPWETYQGFRKIGSGIFLSVFA  57

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
            S FI+  LS K+RPGK PS +FPI ++NIKL  HGSDSG YD EG FV  K EEIF K+ 
Sbjct  58   SIFINAGLSRKTRPGKWPSLLFPIEVKNIKLAKHGSDSGVYDTEGRFVPEKFEEIFKKHA  117

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
             +  NALT++E+DE+L+    P D  G + A  EW++LY L KD  GLL KE+V GVYDG
Sbjct  118  RSNANALTAQELDEMLKANEQPKDSKGRIAALSEWKILYFLCKDKNGLLGKEKVRGVYDG  177

Query  604  SLFDQLAKEHAPK  642
            SLF+Q+AKE+  K
Sbjct  178  SLFEQMAKEYQSK  190



>ref|XP_009781228.1| PREDICTED: probable peroxygenase 5 isoform X1 [Nicotiana sylvestris]
Length=197

 Score =   226 bits (576),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 140/193 (73%), Gaps = 3/193 (2%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            MAS  S   + +G+EK  E TPL+KHVMFFD N+DG+IYPWET+QGFRKIG G FLSV  
Sbjct  1    MASYNSI--HQEGIEKK-EPTPLEKHVMFFDINKDGVIYPWETYQGFRKIGSGIFLSVFA  57

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
            S FI+  LS K+RPGK PS +FPI ++NIKL  HGSDSG YD EG FV  K EEIF K+ 
Sbjct  58   SIFINAGLSRKTRPGKWPSLLFPIEVKNIKLAKHGSDSGVYDTEGRFVPEKFEEIFKKHA  117

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
             +  NALT++E+DE+L+    P D  G + A  EW++LY L KD  GLL KE+V GVYDG
Sbjct  118  RSNANALTAQELDEMLKANEQPKDSKGRIAALSEWKILYFLCKDKNGLLGKEKVRGVYDG  177

Query  604  SLFDQLAKEHAPK  642
            SLF+Q+AKE+  K
Sbjct  178  SLFEQMAKEYQSK  190



>ref|XP_009606536.1| PREDICTED: probable peroxygenase 5 isoform X1 [Nicotiana tomentosiformis]
Length=195

 Score =   226 bits (575),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 139/193 (72%), Gaps = 3/193 (2%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            MAS  S   + +G+EK  E TPL+KHVMFFD N+DG IYPWET+QGFRKIG G FLS+  
Sbjct  1    MASYNSI--HQEGIEKK-EPTPLEKHVMFFDINKDGTIYPWETYQGFRKIGSGIFLSIFA  57

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
            S FI+  LS K+RPGK PS +FPI ++NIKL  HGSDSG YD EG FV  K EEIF K+ 
Sbjct  58   SIFINAGLSRKTRPGKWPSLLFPIEVKNIKLAKHGSDSGVYDTEGRFVPEKFEEIFRKHA  117

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
             +  NALT++E+DE+L+    P D  G + A  EW++LY L KD  GLL KE+V GVYDG
Sbjct  118  RSNGNALTAQELDEMLKANEQPKDSKGRIAALSEWKILYFLCKDKHGLLGKEKVRGVYDG  177

Query  604  SLFDQLAKEHAPK  642
            SLF+Q+AKEH  K
Sbjct  178  SLFEQMAKEHQSK  190



>ref|XP_009606537.1| PREDICTED: probable peroxygenase 5 isoform X2 [Nicotiana tomentosiformis]
Length=193

 Score =   225 bits (574),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 139/193 (72%), Gaps = 3/193 (2%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            MAS  S   + +G+EK  E TPL+KHVMFFD N+DG IYPWET+QGFRKIG G FLS+  
Sbjct  1    MASYNSI--HQEGIEKK-EPTPLEKHVMFFDINKDGTIYPWETYQGFRKIGSGIFLSIFA  57

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
            S FI+  LS K+RPGK PS +FPI ++NIKL  HGSDSG YD EG FV  K EEIF K+ 
Sbjct  58   SIFINAGLSRKTRPGKWPSLLFPIEVKNIKLAKHGSDSGVYDTEGRFVPEKFEEIFRKHA  117

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
             +  NALT++E+DE+L+    P D  G + A  EW++LY L KD  GLL KE+V GVYDG
Sbjct  118  RSNGNALTAQELDEMLKANEQPKDSKGRIAALSEWKILYFLCKDKHGLLGKEKVRGVYDG  177

Query  604  SLFDQLAKEHAPK  642
            SLF+Q+AKEH  K
Sbjct  178  SLFEQMAKEHQSK  190



>ref|XP_006344282.1| PREDICTED: probable peroxygenase 5-like [Solanum tuberosum]
Length=193

 Score =   223 bits (569),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/193 (57%), Positives = 132/193 (68%), Gaps = 0/193 (0%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            MASSTS       +  + E TPL+KHVMFFD N DGIIYP ET+Q FRK+G G F S+  
Sbjct  1    MASSTSCSQADGIIANNHELTPLEKHVMFFDINNDGIIYPSETYQAFRKMGRGIFRSMFA  60

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
            +  IH  LS K+RPGK PS  FPIV+ENIK  +HGSDSGAYD EG FV  K EEIF K+ 
Sbjct  61   AVLIHFNLSHKTRPGKCPSLFFPIVVENIKYAIHGSDSGAYDSEGRFVPEKFEEIFKKHA  120

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
            +   ++LT  EV ELL+  R P DY GW  A+++W  LY L K+   +LTKE V  VYDG
Sbjct  121  NQNADSLTYNEVKELLKTNRKPKDYYGWANASVDWNSLYDLGKNKNEILTKETVKAVYDG  180

Query  604  SLFDQLAKEHAPK  642
            SLF+Q+AKEHA K
Sbjct  181  SLFEQIAKEHASK  193



>ref|XP_009594391.1| PREDICTED: probable peroxygenase 5 [Nicotiana tomentosiformis]
Length=181

 Score =   221 bits (562),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 127/180 (71%), Gaps = 0/180 (0%)
 Frame = +1

Query  103  MEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSR  282
            ME + E TPL+KHVMFFD N DGIIYP ETFQ FRK+G G F S+  +  IHI LS K+R
Sbjct  1    MENNHELTPLEKHVMFFDINNDGIIYPSETFQAFRKMGRGIFRSMFAAVLIHITLSHKTR  60

Query  283  PGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVD  462
            PGK PS  FPIV++NIK  +HGSDSGAYD EG FV  K EEIF ++ +    +LT  EV 
Sbjct  61   PGKCPSLFFPIVVKNIKYAIHGSDSGAYDSEGRFVAEKFEEIFKQHANQNAESLTHNEVK  120

Query  463  ELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPK  642
            ELL+ KR+P DY GW  A+++W  LY L K+  G+LTKE V  VYDGSLF+Q   EHA K
Sbjct  121  ELLKAKREPKDYFGWANASVDWNSLYDLGKNKDGILTKETVRAVYDGSLFEQKVGEHASK  180



>ref|XP_009797131.1| PREDICTED: probable peroxygenase 5 [Nicotiana sylvestris]
Length=199

 Score =   218 bits (556),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 140/200 (70%), Gaps = 2/200 (1%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            MASS+S+    +G+EK  E TPL+KHVMFFD N+DG+IYPWET++GFRKIG G  LS   
Sbjct  1    MASSSSSIDE-EGIEKQ-EPTPLEKHVMFFDINKDGVIYPWETYKGFRKIGSGVLLSTVA  58

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
            S FI+I LS K+RPGK PSP+FPI ++NIK   HGSDS  YD EG FV  K EE+F K+ 
Sbjct  59   SIFINIGLSGKTRPGKWPSPLFPIEVKNIKFAKHGSDSAIYDTEGRFVPEKFEELFKKHA  118

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
             T  NALT+ E+DELL+  + P D+ G + A  EW+VLYLL KD  GLL K+ V  VYDG
Sbjct  119  RTNGNALTAGELDELLKANKQPKDFAGHIAAKSEWKVLYLLCKDEHGLLPKDTVRSVYDG  178

Query  604  SLFDQLAKEHAPKIKANNST  663
            SLF+ +AK    K   + S+
Sbjct  179  SLFELMAKAKQSKKHGDKSS  198



>ref|XP_004228703.1| PREDICTED: probable peroxygenase 5 [Solanum lycopersicum]
Length=200

 Score =   218 bits (555),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 130/181 (72%), Gaps = 0/181 (0%)
 Frame = +1

Query  124  TPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSP  303
            TPL+KHVMFFD N+DG+IYPWET++GFRKIG G  LS   S FI++ LS K+RPGK PSP
Sbjct  20   TPLEKHVMFFDINKDGVIYPWETYKGFRKIGSGVLLSTVASIFINVGLSGKTRPGKWPSP  79

Query  304  VFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKR  483
            +FPI ++NIK   H SDS  YD EG FV  K EE+F+K+G T  NALT +E+DELL+  +
Sbjct  80   LFPIEVKNIKFAKHTSDSDIYDTEGRFVPEKFEELFHKHGRTNANALTGEELDELLKANK  139

Query  484  DPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPKIKANNST  663
             P D+ G + A  EW++LYLL KD  GLL KE +  VYDGSLF+Q+AKE   K     S+
Sbjct  140  QPKDFAGHIAAKSEWKILYLLCKDENGLLPKETIRSVYDGSLFEQMAKEKQSKKHRGKSS  199

Query  664  A  666
            +
Sbjct  200  S  200



>ref|XP_006416108.1| hypothetical protein EUTSA_v10008654mg [Eutrema salsugineum]
 gb|ESQ34461.1| hypothetical protein EUTSA_v10008654mg [Eutrema salsugineum]
Length=233

 Score =   218 bits (556),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 135/188 (72%), Gaps = 2/188 (1%)
 Frame = +1

Query  67   ASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALS  246
            +S +S    GK +++ D    L+KHV FFD N DG+IYPWET+QGFR IG G   S   +
Sbjct  15   SSGSSETKGGKSVQEGD--NALEKHVAFFDRNGDGVIYPWETYQGFRAIGAGRLQSAFGA  72

Query  247  TFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGH  426
             FI++ LS K+RPGK  SP+FPI ++N +L +HGSD+ AYD++G FVESK EEIF K+ H
Sbjct  73   VFINMGLSQKTRPGKGFSPLFPIEVKNSRLAIHGSDTDAYDKDGRFVESKFEEIFKKHAH  132

Query  427  TYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGS  606
            T+ NALT KE+ +LL+  RDP DY GW+ A  EW++L+ L +D  GLLTKE V GVYDGS
Sbjct  133  THQNALTYKEIQQLLKTNRDPKDYGGWISAYAEWKILHELCQDKNGLLTKETVRGVYDGS  192

Query  607  LFDQLAKE  630
            LF QL K+
Sbjct  193  LFKQLEKQ  200



>gb|KHG07259.1| putative peroxygenase 4 -like protein [Gossypium arboreum]
Length=202

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 136/208 (65%), Gaps = 6/208 (3%)
 Frame = +1

Query  25   IISNQPPKFPLYYMASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGF  204
            + S+ PP+  L  +  + + KP G       E + L+KHV FFD N DGI+YPWETF+GF
Sbjct  1    MASSMPPEAILEGVGDAGAAKPSG------SEQSVLEKHVAFFDRNHDGIVYPWETFEGF  54

Query  205  RKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNF  384
            R IG G+ LS+  +  IH  LSSK+RPGK PSP FPI ++NI L  HGSDSG YD +G F
Sbjct  55   RAIGAGYLLSMTGAFLIHFALSSKTRPGKYPSPFFPIEVKNIHLAKHGSDSGVYDSDGRF  114

Query  385  VESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKG  564
            V  K EEIF K+  T+ NALTS E+  +L+  R+P DY GW+ +  EW  LY L KD  G
Sbjct  115  VSLKFEEIFRKFARTHGNALTSGELMAMLKANREPQDYKGWIGSWTEWMTLYNLCKDNDG  174

Query  565  LLTKERVIGVYDGSLFDQLAKEHAPKIK  648
            LL KE V GVYDGSLF+++ ++  P  K
Sbjct  175  LLRKEIVKGVYDGSLFERMERDRKPHRK  202



>ref|XP_004142371.1| PREDICTED: probable peroxygenase 4-like [Cucumis sativus]
 ref|XP_004159081.1| PREDICTED: probable peroxygenase 4-like [Cucumis sativus]
 gb|KGN52357.1| hypothetical protein Csa_5G628130 [Cucumis sativus]
Length=198

 Score =   215 bits (548),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 127/183 (69%), Gaps = 0/183 (0%)
 Frame = +1

Query  100  GMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKS  279
            G E+ DE   L+KHV FFD ++DG++YPWETF+GFR IG   FLS   + FI+I LSSK+
Sbjct  15   GGERVDERNVLQKHVAFFDRDKDGVVYPWETFKGFRAIGANLFLSTLSAVFINIGLSSKT  74

Query  280  RPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEV  459
            RPGK P+ +FPI I+NI+L  HGSDSG YD EG FV  K EEIF K+  TY +ALT KE+
Sbjct  75   RPGKFPNFLFPIEIKNIQLAKHGSDSGVYDSEGRFVSKKFEEIFKKHALTYPDALTEKEL  134

Query  460  DELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAP  639
              LL+  R+P DY GWV A  EW  LY L KD  GLL KE V  VYDGSLF+ + K+ A 
Sbjct  135  KALLKSNREPKDYSGWVAAWTEWTTLYNLCKDDNGLLKKETVKAVYDGSLFEHMEKQRAS  194

Query  640  KIK  648
            K K
Sbjct  195  KKK  197



>ref|XP_009793194.1| PREDICTED: probable peroxygenase 5 [Nicotiana sylvestris]
Length=182

 Score =   214 bits (546),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 126/180 (70%), Gaps = 0/180 (0%)
 Frame = +1

Query  103  MEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSR  282
            ME +   T L+KHVMFFD N DGIIYP  TFQ FRK+G G F S+  +  IHI LS K+R
Sbjct  2    MENNHGLTHLEKHVMFFDINNDGIIYPSGTFQAFRKMGRGIFRSMFAAVLIHITLSHKTR  61

Query  283  PGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVD  462
            PGK PS  FPIV++NIK  +HGSDSGAYD EG FV  K EEIF ++ +    +LT  EV 
Sbjct  62   PGKCPSLFFPIVVKNIKYAIHGSDSGAYDSEGRFVPEKFEEIFKQHANQNAESLTHNEVK  121

Query  463  ELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPK  642
            ELL+ KR+P DY GW  A+++W  LY L K+  G+LTKE V  VYDGSLF+Q A+EHA K
Sbjct  122  ELLKAKREPKDYFGWANASVDWNSLYDLGKNKDGILTKETVRAVYDGSLFEQKAREHASK  181



>ref|XP_008464711.1| PREDICTED: probable peroxygenase 5 [Cucumis melo]
Length=200

 Score =   214 bits (544),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 124/179 (69%), Gaps = 0/179 (0%)
 Frame = +1

Query  112  DDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGK  291
            ++E   L+KHV FFD N+DG++YPWETF GFR IG   FLS   + FI++ LSSK+RPGK
Sbjct  21   EEEKNVLQKHVAFFDRNKDGVVYPWETFMGFRAIGANLFLSTVSAVFINLGLSSKTRPGK  80

Query  292  LPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELL  471
             P+ +FPI I+NI+L  HGSDSG YD EG FV  K EEIF K+  TY +ALT KE+  LL
Sbjct  81   FPNFLFPIEIKNIQLAKHGSDSGVYDSEGRFVSKKFEEIFKKHALTYPDALTEKELKALL  140

Query  472  RDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPKIK  648
            +  R+P DY GWV A  EW  LY L KD  GLL KE V  VYDGSLF+ + K+ A K K
Sbjct  141  KSNREPKDYKGWVAAWTEWTTLYNLCKDENGLLKKETVKAVYDGSLFEHMEKQRASKKK  199



>ref|XP_003637674.1| hypothetical protein MTR_097s0017 [Medicago truncatula]
 gb|ACJ84422.1| unknown [Medicago truncatula]
 gb|ACJ86194.1| unknown [Medicago truncatula]
 gb|AFK45999.1| unknown [Medicago truncatula]
 gb|KEH40598.1| caleosin [Medicago truncatula]
Length=209

 Score =   214 bits (545),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 127/175 (73%), Gaps = 0/175 (0%)
 Frame = +1

Query  130  LKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVF  309
            L+KH  FFD N DG+IYPWETFQ  R+IG G  LS A + FI++ LS  +RPGK PSP+F
Sbjct  35   LQKHAAFFDLNHDGVIYPWETFQAMREIGSGVLLSTAAAVFINVALSQTTRPGKFPSPLF  94

Query  310  PIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDP  489
            PI ++NI+   HGSD+GAYD EG FV SK EEIF K+ HT+ NALT  E++EL++  R+P
Sbjct  95   PIEVKNIQRGKHGSDTGAYDSEGRFVASKFEEIFVKHAHTHPNALTYDELNELIKTNREP  154

Query  490  NDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPKIKAN  654
             D  G + + +EW++LY LAKD  GLL KE + GVYDGSLF+ L KEH  +I ++
Sbjct  155  KDVKGRIGSFVEWKILYKLAKDKNGLLQKETIRGVYDGSLFEVLKKEHTKRITSS  209



>ref|XP_004237000.1| PREDICTED: probable peroxygenase 5 isoform X1 [Solanum lycopersicum]
Length=193

 Score =   213 bits (543),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 131/193 (68%), Gaps = 0/193 (0%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            MASSTS       +  + E TPL+KHVMFFD N DGIIYP ET++ FRK+G G F S+  
Sbjct  1    MASSTSCSQADGIIVNNHELTPLEKHVMFFDINNDGIIYPSETYKAFRKMGRGIFRSMFS  60

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
            +  IH  LS K+RPGK PS +FPIV+ENIK  +HGSDSGAYD EG FV  K EEIF K+ 
Sbjct  61   AVLIHFNLSYKTRPGKWPSLLFPIVVENIKYAIHGSDSGAYDSEGRFVPEKFEEIFKKHA  120

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
            +   ++LT  EV E+L+  R P DY GW  A ++W  LY L K+    LTKE V  +YDG
Sbjct  121  NENADSLTYNEVKEMLKTNRKPKDYYGWANAFVDWNSLYDLGKNKNEKLTKETVKALYDG  180

Query  604  SLFDQLAKEHAPK  642
            SLF+Q+AKEHA K
Sbjct  181  SLFEQIAKEHASK  193



>ref|XP_010319388.1| PREDICTED: probable peroxygenase 5 [Solanum lycopersicum]
Length=193

 Score =   213 bits (542),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 126/168 (75%), Gaps = 0/168 (0%)
 Frame = +1

Query  118  ETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLP  297
            E TPL+KHVMFFD N DGIIYPWET+QGFRKIG   FLS+  S FI+  LS K+RPGK P
Sbjct  16   EPTPLQKHVMFFDINNDGIIYPWETYQGFRKIGSNIFLSIFASFFINFGLSRKTRPGKGP  75

Query  298  SPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRD  477
            S +FPI ++NIKL  H SDSG YD EG FV+ K EEIF+K+  +  NALT++E+D++L+ 
Sbjct  76   SLLFPIEVKNIKLAKHTSDSGVYDSEGRFVQEKFEEIFSKHARSNGNALTAQELDDMLKA  135

Query  478  KRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQL  621
             + PND  G+V A  EW++LY L KD  GLL KE + GVYDGSLF+Q+
Sbjct  136  NKQPNDSKGYVAAQSEWKILYFLCKDEHGLLKKEIIRGVYDGSLFEQM  183



>ref|XP_010270303.1| PREDICTED: probable peroxygenase 4 [Nelumbo nucifera]
Length=207

 Score =   213 bits (543),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 123/170 (72%), Gaps = 0/170 (0%)
 Frame = +1

Query  124  TPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSP  303
            +PL+KH  FFD NQDG++YPWETFQGFR IG G  LS   + FI+  LSS++RPGKLPS 
Sbjct  31   SPLQKHAAFFDRNQDGLVYPWETFQGFRAIGSGIPLSTIAAIFINCFLSSQTRPGKLPSL  90

Query  304  VFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKR  483
            +FPI I+NIK   HGSD+G YD EG FV  K EEIF+K+ H   NALTSKEV E+L+  R
Sbjct  91   LFPIEIKNIKRAKHGSDTGVYDTEGRFVPEKFEEIFSKHAHVNPNALTSKEVSEMLKANR  150

Query  484  DPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEH  633
               D+ GW+ A  EW+VLY L KD  G L K+ + GVYDG+LF+Q+ +EH
Sbjct  151  VSQDFRGWIGAWTEWKVLYYLCKDKDGFLHKDTIRGVYDGTLFEQMEEEH  200



>gb|AFK41940.1| unknown [Medicago truncatula]
Length=209

 Score =   213 bits (542),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 127/175 (73%), Gaps = 0/175 (0%)
 Frame = +1

Query  130  LKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVF  309
            L+KH  FFD N DG+IYPWETFQ  R+IG G  LS A + FI++ LS  +RPGK PSP+F
Sbjct  35   LQKHAAFFDLNHDGVIYPWETFQAMREIGSGVLLSTAAAVFINVALSQTTRPGKFPSPLF  94

Query  310  PIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDP  489
            PI ++NI+   HGSD+GAYD EG FV SK EEIF ++ HT+ NALT  E++EL++  R+P
Sbjct  95   PIEVKNIQRGKHGSDTGAYDSEGRFVASKFEEIFVRHAHTHPNALTYDELNELIKTNREP  154

Query  490  NDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPKIKAN  654
             D  G + + +EW++LY LAKD  GLL KE + GVYDGSLF+ L KEH  +I ++
Sbjct  155  KDVKGRIGSFVEWKILYKLAKDKNGLLQKETIRGVYDGSLFEVLKKEHTKRITSS  209



>ref|XP_004491461.1| PREDICTED: probable peroxygenase 4-like [Cicer arietinum]
Length=210

 Score =   213 bits (542),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 135/205 (66%), Gaps = 7/205 (3%)
 Frame = +1

Query  40   PPKFPLYYMASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGG  219
            P     +Y+  + +T     G+      + L+KHV FFD N DGIIYP ETF+GFR IG 
Sbjct  12   PLLISFFYIFLAIATAQNSSGL------SVLQKHVSFFDRNHDGIIYPKETFEGFRAIGC  65

Query  220  GFFLSVALSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKI  399
            G  LS   S FIH  LS K+RPGK PSP+ PI I NIKL +HGSDSG YD EG FV SK 
Sbjct  66   GVALSTTASAFIHAGLSQKTRPGKAPSPLLPIEIVNIKLSIHGSDSGVYDSEGGFVASKF  125

Query  400  EEIFNKYGHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKE  579
            EEIF+K+   + NALTS E+ E+L   R+P D+ GW+ A  EW++LY L KD +GLL K+
Sbjct  126  EEIFSKHAKQHPNALTSDELKEMLTANREPKDFKGWLAAESEWKILYDLCKDKEGLLQKD  185

Query  580  RVIGVYDGSLFDQLAKEHAPKIKAN  654
             V  VYDGSLF++L KEH+ K K N
Sbjct  186  IVYSVYDGSLFERLEKEHS-KTKNN  209



>ref|XP_007225858.1| hypothetical protein PRUPE_ppa011722mg [Prunus persica]
 gb|EMJ27057.1| hypothetical protein PRUPE_ppa011722mg [Prunus persica]
Length=197

 Score =   212 bits (540),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 123/176 (70%), Gaps = 0/176 (0%)
 Frame = +1

Query  115  DETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKL  294
            +E   L++HV FFD N DGI+YPWETFQGFR IG G  LS A S  I+  LS K+RPGK 
Sbjct  15   NEQDVLQRHVAFFDRNHDGIVYPWETFQGFRAIGCGILLSTASSFLINAALSQKTRPGKF  74

Query  295  PSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLR  474
            PSP+ PI ++NI    HGSDSG YD  G FV SK EEIF K+ HT+ +ALTS E+  +LR
Sbjct  75   PSPLLPIEVKNIHKAKHGSDSGVYDSHGRFVPSKFEEIFCKHAHTHLDALTSDELMGMLR  134

Query  475  DKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPK  642
              R+P DY GWV +  EW++LY+L KD +GLL K+ V  VYDGSLF+++ KE   K
Sbjct  135  ANREPKDYAGWVASWTEWKILYVLCKDNRGLLHKDTVRAVYDGSLFERMEKERIEK  190



>ref|XP_003533958.1| PREDICTED: probable peroxygenase 4 [Glycine max]
 gb|KHN15012.1| Putative peroxygenase 4 [Glycine soja]
Length=201

 Score =   212 bits (540),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 135/200 (68%), Gaps = 5/200 (3%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPL-----KKHVMFFDSNQDGIIYPWETFQGFRKIGGGFF  228
            MASS STK  G      ++  PL     +KH  FFD N DG+IYPWETFQG R+IG G  
Sbjct  1    MASSESTKQEGVVGGIGEKLIPLHENVLQKHAAFFDKNHDGVIYPWETFQGLREIGNGIL  60

Query  229  LSVALSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEI  408
             SV LS FI++ LS  +RPGK PS +FPI I+NI+L  HGSD+GAYD EG FV SK E I
Sbjct  61   SSVGLSLFINLALSQTTRPGKFPSLLFPIEIKNIQLGKHGSDTGAYDTEGRFVPSKFEGI  120

Query  409  FNKYGHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVI  588
            F K+ HT+ NALT  E+ E+L+  R+P D+ G +   +EW+VLY LAKD  GLL KE + 
Sbjct  121  FTKHSHTHPNALTYDELKEMLKANREPKDFKGRIGGLVEWKVLYKLAKDKNGLLQKETIR  180

Query  589  GVYDGSLFDQLAKEHAPKIK  648
             VYDGSLF+ L KE++ + K
Sbjct  181  SVYDGSLFEMLKKENSARKK  200



>ref|XP_007225859.1| hypothetical protein PRUPE_ppa011722mg [Prunus persica]
 gb|EMJ27058.1| hypothetical protein PRUPE_ppa011722mg [Prunus persica]
Length=199

 Score =   212 bits (540),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 123/176 (70%), Gaps = 0/176 (0%)
 Frame = +1

Query  115  DETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKL  294
            +E   L++HV FFD N DGI+YPWETFQGFR IG G  LS A S  I+  LS K+RPGK 
Sbjct  15   NEQDVLQRHVAFFDRNHDGIVYPWETFQGFRAIGCGILLSTASSFLINAALSQKTRPGKF  74

Query  295  PSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLR  474
            PSP+ PI ++NI    HGSDSG YD  G FV SK EEIF K+ HT+ +ALTS E+  +LR
Sbjct  75   PSPLLPIEVKNIHKAKHGSDSGVYDSHGRFVPSKFEEIFCKHAHTHLDALTSDELMGMLR  134

Query  475  DKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPK  642
              R+P DY GWV +  EW++LY+L KD +GLL K+ V  VYDGSLF+++ KE   K
Sbjct  135  ANREPKDYAGWVASWTEWKILYVLCKDNRGLLHKDTVRAVYDGSLFERMEKERIEK  190



>ref|XP_004491460.1| PREDICTED: probable peroxygenase 4-like [Cicer arietinum]
Length=268

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 131/181 (72%), Gaps = 2/181 (1%)
 Frame = +1

Query  100  GMEKDDET--TPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSS  273
            G+ +D+ +  + L+KHV FFD N DGI+YP ETFQGFR IG G  LS A S FIH  LS 
Sbjct  82   GIREDNSSGFSALQKHVSFFDRNHDGIVYPKETFQGFRAIGCGVALSTAASAFIHAGLSQ  141

Query  274  KSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSK  453
            K+RPG+ PS + PIV+ NIKL +HGSDSGAY+ EG FV SK EEIF+K+   + NALTS 
Sbjct  142  KTRPGEPPSILLPIVVANIKLAIHGSDSGAYNAEGGFVASKFEEIFSKHAKQHPNALTSD  201

Query  454  EVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEH  633
            E+ E+L+  R+P D+ GW+ A  EW++L+ L KD  GLL K+ V  VYDGSLF++L KEH
Sbjct  202  ELKEMLKSNREPKDFKGWLAAESEWKILFDLCKDNNGLLQKDIVYSVYDGSLFERLEKEH  261

Query  634  A  636
            +
Sbjct  262  S  262



>gb|KHN20817.1| Putative peroxygenase 4 [Glycine soja]
Length=202

 Score =   211 bits (536),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 134/199 (67%), Gaps = 6/199 (3%)
 Frame = +1

Query  64   MAS-STSTKPYGKGMEKDDETTP-----LKKHVMFFDSNQDGIIYPWETFQGFRKIGGGF  225
            MAS S+STK      E D++  P     L+KHV FFD N DGIIYPWETFQGFR IG G+
Sbjct  1    MASLSSSTKQSNNNQEVDEKPIPHDQNVLQKHVAFFDRNHDGIIYPWETFQGFRAIGCGY  60

Query  226  FLSVALSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEE  405
             LS   + FI+  LS K+RPGK PS + PI ++NI    HGSDSG YD EG FV SK EE
Sbjct  61   LLSSVAAIFINGGLSQKTRPGKFPSILLPIEVQNIHRSKHGSDSGVYDSEGRFVLSKFEE  120

Query  406  IFNKYGHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERV  585
            IF+K+  T+ N+LTS E+  +L   R P DY GW+ +  EW++LY+L KD  GLL KE +
Sbjct  121  IFSKHARTHPNSLTSDELMGMLVANRVPKDYAGWLASYTEWKILYVLGKDKDGLLHKETI  180

Query  586  IGVYDGSLFDQLAKEHAPK  642
              VYDGSLF+++ KEH+ K
Sbjct  181  RAVYDGSLFEKMEKEHSDK  199



>ref|XP_006448184.1| hypothetical protein CICLE_v10016732mg [Citrus clementina]
 gb|ESR61424.1| hypothetical protein CICLE_v10016732mg [Citrus clementina]
Length=205

 Score =   211 bits (536),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 130/189 (69%), Gaps = 2/189 (1%)
 Frame = +1

Query  67   ASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALS  246
            +S T+ +  GK +  ++    L+KHV FFD N DGI+YPWETFQGFR IG G  LS   +
Sbjct  10   SSKTNQQEDGKFIPSNENV--LQKHVAFFDRNHDGIVYPWETFQGFRAIGCGIPLSTGAA  67

Query  247  TFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGH  426
             FI++ LSSK+RPGK PS +FPI I+NI    HGSDSG YD EG FV SK EEIF K+  
Sbjct  68   LFINMGLSSKTRPGKFPSLLFPIEIKNIHKSKHGSDSGVYDSEGRFVPSKFEEIFTKHAC  127

Query  427  TYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGS  606
            T  NALTS E+  +L+  R+P DY GWV A  EW++LY+L KD  GLL K+ V  VYDGS
Sbjct  128  TQPNALTSDELMGMLKANREPKDYGGWVAAYSEWKILYVLCKDKNGLLRKDTVKAVYDGS  187

Query  607  LFDQLAKEH  633
            LF+ + KEH
Sbjct  188  LFEHMEKEH  196



>ref|XP_006448183.1| hypothetical protein CICLE_v10016732mg [Citrus clementina]
 gb|ESR61423.1| hypothetical protein CICLE_v10016732mg [Citrus clementina]
Length=203

 Score =   211 bits (536),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 130/189 (69%), Gaps = 2/189 (1%)
 Frame = +1

Query  67   ASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALS  246
            +S T+ +  GK +  ++    L+KHV FFD N DGI+YPWETFQGFR IG G  LS   +
Sbjct  10   SSKTNQQEDGKFIPSNENV--LQKHVAFFDRNHDGIVYPWETFQGFRAIGCGIPLSTGAA  67

Query  247  TFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGH  426
             FI++ LSSK+RPGK PS +FPI I+NI    HGSDSG YD EG FV SK EEIF K+  
Sbjct  68   LFINMGLSSKTRPGKFPSLLFPIEIKNIHKSKHGSDSGVYDSEGRFVPSKFEEIFTKHAC  127

Query  427  TYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGS  606
            T  NALTS E+  +L+  R+P DY GWV A  EW++LY+L KD  GLL K+ V  VYDGS
Sbjct  128  TQPNALTSDELMGMLKANREPKDYGGWVAAYSEWKILYVLCKDKNGLLRKDTVKAVYDGS  187

Query  607  LFDQLAKEH  633
            LF+ + KEH
Sbjct  188  LFEHMEKEH  196



>ref|XP_002887323.1| hypothetical protein ARALYDRAFT_894885 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63582.1| hypothetical protein ARALYDRAFT_894885 [Arabidopsis lyrata subsp. 
lyrata]
Length=196

 Score =   210 bits (535),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 138/199 (69%), Gaps = 3/199 (2%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            MASS  T       EKD+    L++HV +FD N+DGI+YP ETFQGFR IG G+ LS   
Sbjct  1    MASSIPTAEVKVVPEKDN---FLQRHVAYFDRNKDGIVYPSETFQGFRAIGCGYLLSTFA  57

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
            + FI+I LSSK+RPGK  S  FPI ++NI L +H SDSG YD++G FV SK EEIF K+ 
Sbjct  58   AVFINISLSSKTRPGKGFSFSFPIEVKNINLGIHSSDSGVYDKDGRFVASKFEEIFAKHA  117

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
            HT+ +ALT+KE+ ELL+  R+PND  G +LA  EW+VLY L KD  GLL KE V  VYDG
Sbjct  118  HTHRDALTNKELKELLKANREPNDCRGGILAFGEWKVLYNLCKDKNGLLHKETVRAVYDG  177

Query  604  SLFDQLAKEHAPKIKANNS  660
            SLF+QL K+ + +   N+S
Sbjct  178  SLFEQLEKQRSSQTPKNHS  196



>ref|XP_002314792.1| calcium binding family protein [Populus trichocarpa]
 gb|EEF00963.1| calcium binding family protein [Populus trichocarpa]
Length=199

 Score =   210 bits (534),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 134/195 (69%), Gaps = 3/195 (2%)
 Frame = +1

Query  70   SSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALST  249
            SST  +  GK +  D     L+KHV FFD NQDGI+YPWETFQGFR IG G  LS A + 
Sbjct  7    SSTDKQQNGKFVPNDHNV--LQKHVFFFDRNQDGIVYPWETFQGFRSIGCGILLSTASAF  64

Query  250  FIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHT  429
             I+I LS K+RPGK PS +FPI ++NI+   HGSDSG YD EG FV +K EEIF+K+  +
Sbjct  65   LINIALSQKTRPGKFPSLLFPIEVKNIQRAKHGSDSGVYDSEGRFVPAKFEEIFSKHARS  124

Query  430  YTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSL  609
            + N+LTS E+  +L+  R+P D+ GWV +  EW++LY L KD  GLL K+ +  VYDGSL
Sbjct  125  HPNSLTSDELMGMLKANREPKDFKGWVASYTEWKILYTLCKDKDGLLHKDTIRAVYDGSL  184

Query  610  FDQLAKEHA-PKIKA  651
            F+++ KE A PK  A
Sbjct  185  FERMEKERASPKKTA  199



>gb|EYU30114.1| hypothetical protein MIMGU_mgv1a013937mg [Erythranthe guttata]
Length=201

 Score =   210 bits (534),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 132/190 (69%), Gaps = 1/190 (1%)
 Frame = +1

Query  73   STSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTF  252
            S +     + ME + ETT L+KHVMFFD N DGIIYP ETFQGFR IG G  LS   S F
Sbjct  10   SVTASSKAQAME-NCETTALQKHVMFFDRNNDGIIYPSETFQGFRAIGCGLLLSSVASVF  68

Query  253  IHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTY  432
            I++ LS K+RPGK  S  FPI ++NIK+  H SDSG YD+EG FV ++ EE+F K+  T+
Sbjct  69   INLGLSQKTRPGKPFSFKFPIEVKNIKMAKHTSDSGVYDKEGRFVPTRFEEVFAKHALTH  128

Query  433  TNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLF  612
             ++LTS E+  LL+  R+P DY GW+    EW++LY+L KD  GLL KE V  VYDGSLF
Sbjct  129  PHSLTSDELKNLLKSNREPKDYGGWLAGYTEWKILYILCKDKNGLLHKETVRAVYDGSLF  188

Query  613  DQLAKEHAPK  642
            +++AKE+A K
Sbjct  189  ERMAKENASK  198



>ref|NP_001240160.1| uncharacterized protein LOC100799842 [Glycine max]
 gb|ACU20544.1| unknown [Glycine max]
 gb|KHN41403.1| Putative peroxygenase 5 [Glycine soja]
Length=204

 Score =   210 bits (534),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 126/169 (75%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  LKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVF  309
            L+KH  FFD N+DG+IYPWETF+G R+IG G  LSV  + FI++ LS  +RPGK PS +F
Sbjct  31   LQKHAAFFDLNKDGVIYPWETFKGLREIGTGVLLSVGGAIFINVFLSQSTRPGKFPSILF  90

Query  310  PIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDP  489
            PI I+NI+   HGSD+G YD EG FV SK EEIFNK+ HT+ NALT  E+ E+++  R+P
Sbjct  91   PIEIKNIQRGKHGSDTGVYDTEGRFVPSKFEEIFNKHAHTHPNALTYDELTEMIKANREP  150

Query  490  NDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHA  636
             D+ G + + +EW++LY LAKD  GLL KE + GVYDGSLF+QL K+H+
Sbjct  151  KDFSGRIGSVVEWKILYKLAKDKSGLLQKETIRGVYDGSLFEQLKKQHS  199



>ref|NP_564996.1| Caleosin-related family protein [Arabidopsis thaliana]
 sp|Q9CAB8.1|PXG5_ARATH RecName: Full=Probable peroxygenase 5; Short=AtPXG5; AltName: 
Full=Caleosin-5 [Arabidopsis thaliana]
 gb|AAG52337.1|AC011663_16 unknown protein; 57248-56048 [Arabidopsis thaliana]
 gb|AEE35099.1| Caleosin-related family protein [Arabidopsis thaliana]
Length=192

 Score =   209 bits (533),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 129/176 (73%), Gaps = 0/176 (0%)
 Frame = +1

Query  115  DETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKL  294
            +E   L+KHV FFD N+DGI+YP ETFQGFR IG G+ LS   + FI+I LSSK+RPGK 
Sbjct  15   EEYNFLQKHVAFFDRNKDGIVYPSETFQGFRAIGCGYLLSTFAAVFINISLSSKTRPGKG  74

Query  295  PSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLR  474
             S  FPI ++N++L +H SDSG YD++G FV SK EEIF K+ HT+ +ALTSKE+ ELL+
Sbjct  75   FSFSFPIEVKNVRLGIHSSDSGVYDKDGRFVASKFEEIFAKHAHTHRDALTSKELKELLK  134

Query  475  DKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPK  642
              R+PND  G +LA  EW+VLY L KD  GLL KE V  VYDGSLF+QL K+ + K
Sbjct  135  ANREPNDCKGGILAFGEWKVLYNLCKDKSGLLHKEIVRAVYDGSLFEQLEKQRSSK  190



>gb|EYU30113.1| hypothetical protein MIMGU_mgv1a013937mg [Erythranthe guttata]
Length=206

 Score =   210 bits (534),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 132/190 (69%), Gaps = 1/190 (1%)
 Frame = +1

Query  73   STSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTF  252
            S +     + ME + ETT L+KHVMFFD N DGIIYP ETFQGFR IG G  LS   S F
Sbjct  10   SVTASSKAQAME-NCETTALQKHVMFFDRNNDGIIYPSETFQGFRAIGCGLLLSSVASVF  68

Query  253  IHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTY  432
            I++ LS K+RPGK  S  FPI ++NIK+  H SDSG YD+EG FV ++ EE+F K+  T+
Sbjct  69   INLGLSQKTRPGKPFSFKFPIEVKNIKMAKHTSDSGVYDKEGRFVPTRFEEVFAKHALTH  128

Query  433  TNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLF  612
             ++LTS E+  LL+  R+P DY GW+    EW++LY+L KD  GLL KE V  VYDGSLF
Sbjct  129  PHSLTSDELKNLLKSNREPKDYGGWLAGYTEWKILYILCKDKNGLLHKETVRAVYDGSLF  188

Query  613  DQLAKEHAPK  642
            +++AKE+A K
Sbjct  189  ERMAKENASK  198



>ref|XP_006469238.1| PREDICTED: probable peroxygenase 4-like isoform X2 [Citrus sinensis]
Length=205

 Score =   209 bits (532),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 130/189 (69%), Gaps = 2/189 (1%)
 Frame = +1

Query  67   ASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALS  246
            +S T+ +  GK +  ++    L+KHV FFD N DGI+YPWETF+GFR IG G  LS   +
Sbjct  10   SSKTNQQEDGKFIPSNENV--LQKHVAFFDRNHDGIVYPWETFKGFRAIGCGIPLSTGAA  67

Query  247  TFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGH  426
             FI++ LSSK+RPGK PS +FPI I+NI    HGSDSG YD EG FV SK EEIF K+  
Sbjct  68   LFINMGLSSKTRPGKFPSLLFPIEIKNIHKSKHGSDSGVYDSEGRFVPSKFEEIFTKHAC  127

Query  427  TYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGS  606
            T  NALTS E+  +L+  R+P DY GWV A  EW++LY+L KD  GLL K+ V  VYDGS
Sbjct  128  TQPNALTSDELMGMLKANREPKDYGGWVAAYSEWKILYVLCKDKNGLLRKDTVRAVYDGS  187

Query  607  LFDQLAKEH  633
            LF+ + KEH
Sbjct  188  LFEHMEKEH  196



>ref|XP_006469237.1| PREDICTED: probable peroxygenase 4-like isoform X1 [Citrus sinensis]
Length=206

 Score =   209 bits (532),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 130/189 (69%), Gaps = 2/189 (1%)
 Frame = +1

Query  67   ASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALS  246
            +S T+ +  GK +  ++    L+KHV FFD N DGI+YPWETF+GFR IG G  LS   +
Sbjct  10   SSKTNQQEDGKFIPSNENV--LQKHVAFFDRNHDGIVYPWETFKGFRAIGCGIPLSTGAA  67

Query  247  TFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGH  426
             FI++ LSSK+RPGK PS +FPI I+NI    HGSDSG YD EG FV SK EEIF K+  
Sbjct  68   LFINMGLSSKTRPGKFPSLLFPIEIKNIHKSKHGSDSGVYDSEGRFVPSKFEEIFTKHAC  127

Query  427  TYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGS  606
            T  NALTS E+  +L+  R+P DY GWV A  EW++LY+L KD  GLL K+ V  VYDGS
Sbjct  128  TQPNALTSDELMGMLKANREPKDYGGWVAAYSEWKILYVLCKDKNGLLRKDTVRAVYDGS  187

Query  607  LFDQLAKEH  633
            LF+ + KEH
Sbjct  188  LFEHMEKEH  196



>ref|XP_011021792.1| PREDICTED: probable peroxygenase 4 isoform X1 [Populus euphratica]
Length=211

 Score =   209 bits (532),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 135/198 (68%), Gaps = 3/198 (2%)
 Frame = +1

Query  70   SSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALST  249
            SST  +  GK +  D     L+KHV FFD NQDGI+YPWETFQGFR IG    LS A + 
Sbjct  7    SSTDKQQNGKFVPNDHNV--LQKHVFFFDRNQDGIVYPWETFQGFRSIGCSILLSTASAF  64

Query  250  FIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHT  429
             I+I LS K+RPGK PS +FPI ++NI+   HGSDSG YD EG FV +K EEIF+K+  +
Sbjct  65   LINIALSQKTRPGKFPSLLFPIEVKNIQRAKHGSDSGVYDSEGRFVPAKFEEIFSKHARS  124

Query  430  YTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSL  609
            + N+LTS E+  +L+  R+P D+ GWV +  EW++LY L KD  GLL K+ +  VYDGSL
Sbjct  125  HPNSLTSDELMGMLKANREPKDFKGWVASYTEWKILYTLCKDKDGLLHKDTIRAVYDGSL  184

Query  610  FDQLAKEHA-PKIKANNS  660
            F+++ KE A PK  A +S
Sbjct  185  FERMEKERASPKKTAKHS  202



>gb|AAM67011.1| unknown [Arabidopsis thaliana]
Length=192

 Score =   208 bits (530),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 128/176 (73%), Gaps = 0/176 (0%)
 Frame = +1

Query  115  DETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKL  294
            +E   L+KHV FFD N+DGI+YP ETFQGFR IG G+ LS   + FI+I LSSK+RPGK 
Sbjct  15   EEYNFLQKHVAFFDRNKDGIVYPSETFQGFRAIGCGYLLSTFAAVFINISLSSKTRPGKG  74

Query  295  PSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLR  474
             S  FPI ++N++L +H SDSG YD++G FV SK EEIF  + HT+ +ALTSKE+ ELL+
Sbjct  75   FSFSFPIEVKNVRLGIHSSDSGVYDKDGRFVASKFEEIFAXHAHTHRDALTSKELKELLK  134

Query  475  DKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPK  642
              R+PND  G +LA  EW+VLY L KD  GLL KE V  VYDGSLF+QL K+ + K
Sbjct  135  ANREPNDCKGGILAFGEWKVLYNLCKDKSGLLHKETVRAVYDGSLFEQLEKQRSSK  190



>gb|KDP38105.1| hypothetical protein JCGZ_04748 [Jatropha curcas]
Length=200

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 121/168 (72%), Gaps = 0/168 (0%)
 Frame = +1

Query  118  ETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLP  297
            E   L+KHV+FFD NQDG++YPWETFQGFR IG G   S+A + FI+I LS K+RPGK P
Sbjct  20   EHNVLQKHVLFFDRNQDGVVYPWETFQGFRAIGCGILFSLASAVFINIGLSQKTRPGKTP  79

Query  298  SPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRD  477
            S +FPI I+NI    HGSDSG Y REG+F+  K EEIF K+  ++ +ALTS E+  +LR+
Sbjct  80   SLLFPIEIKNIHKGKHGSDSGVYSREGSFINEKFEEIFRKHARSHKDALTSSELMRMLRE  139

Query  478  KRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQL  621
             R+P DY GW+ +  EW+ LY+L KD  GLL+KE +   YDGSLF+ L
Sbjct  140  NREPKDYAGWIASWTEWKTLYMLCKDSDGLLSKETIRAAYDGSLFEHL  187



>emb|CDP16322.1| unnamed protein product [Coffea canephora]
Length=177

 Score =   207 bits (528),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 121/166 (73%), Gaps = 0/166 (0%)
 Frame = +1

Query  145  MFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVFPIVIE  324
            MFFD+N+DG++YPWETFQGFR IG G  LS   S FI++ LS K+RPGK  SP FPI I+
Sbjct  1    MFFDTNKDGVVYPWETFQGFRAIGCGILLSTFASVFINVGLSRKTRPGKGFSPKFPIEIK  60

Query  325  NIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDPNDYMG  504
            NIK   HGSDSG YD EG FV SK EE+F K+  T  NALTS E+  LL+  R+P DY G
Sbjct  61   NIKRAKHGSDSGVYDTEGGFVPSKFEELFRKHAKTNANALTSDELKNLLKANREPKDYKG  120

Query  505  WVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPK  642
            W+ A  EW++LY+L KD +GLL K+ V  VYDG+LFD++AKE A K
Sbjct  121  WIAAYSEWKILYILCKDKQGLLHKDTVRAVYDGTLFDRMAKEKAGK  166



>ref|XP_008381737.1| PREDICTED: probable peroxygenase 4 [Malus domestica]
Length=205

 Score =   208 bits (530),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 122/174 (70%), Gaps = 0/174 (0%)
 Frame = +1

Query  115  DETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKL  294
            +E   L++HV FFD N DGI+YPWETFQGFR IG G  LS   +  I+  LS K+R GK 
Sbjct  23   NEEDVLQRHVAFFDRNHDGIVYPWETFQGFRAIGCGIMLSTVSAFLINAALSRKTRQGKF  82

Query  295  PSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLR  474
            PS +FP+ ++NI    HGSDSG YD EG FV SK EEIF K+ HTY NALTS E+  +L+
Sbjct  83   PSLLFPVEVKNIHKAKHGSDSGVYDNEGRFVPSKFEEIFEKHAHTYPNALTSDELMGMLK  142

Query  475  DKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHA  636
              RDP DY GW+ A  EW++LY+L KD  GLL K+ V  VYDGSLF+++ KE++
Sbjct  143  ANRDPKDYAGWLAAYTEWKILYVLCKDKNGLLQKDTVRAVYDGSLFERMEKENS  196



>dbj|BAF00552.1| hypothetical protein [Arabidopsis thaliana]
Length=192

 Score =   208 bits (529),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 129/176 (73%), Gaps = 0/176 (0%)
 Frame = +1

Query  115  DETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKL  294
            +E   L+KHV FFD N+DGI+YP ETFQGFR IG G+ LS   + FI+I LSSK+RPGK 
Sbjct  15   EEYNFLQKHVAFFDRNKDGIVYPSETFQGFRAIGCGYLLSTFAAVFINISLSSKTRPGKG  74

Query  295  PSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLR  474
             S  FPI ++N++L +H SDSG +D++G FV SK EEIF K+ HT+ +ALTSKE+ ELL+
Sbjct  75   FSFSFPIEVKNVRLGIHSSDSGVHDKDGRFVASKFEEIFAKHAHTHRDALTSKELKELLK  134

Query  475  DKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPK  642
              R+PND  G +LA  EW+VLY L KD  GLL KE V  VYDGSLF+QL K+ + K
Sbjct  135  ANREPNDCKGGILAFGEWKVLYNLCKDKSGLLHKEIVRAVYDGSLFEQLEKQRSSK  190



>gb|EYU30112.1| hypothetical protein MIMGU_mgv1a013937mg [Erythranthe guttata]
Length=187

 Score =   207 bits (527),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 126/175 (72%), Gaps = 0/175 (0%)
 Frame = +1

Query  118  ETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLP  297
            ETT L+KHVMFFD N DGIIYP ETFQGFR IG G  LS   S FI++ LS K+RPGK  
Sbjct  5    ETTALQKHVMFFDRNNDGIIYPSETFQGFRAIGCGLLLSSVASVFINLGLSQKTRPGKPF  64

Query  298  SPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRD  477
            S  FPI ++NIK+  H SDSG YD+EG FV ++ EE+F K+  T+ ++LTS E+  LL+ 
Sbjct  65   SFKFPIEVKNIKMAKHTSDSGVYDKEGRFVPTRFEEVFAKHALTHPHSLTSDELKNLLKS  124

Query  478  KRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPK  642
             R+P DY GW+    EW++LY+L KD  GLL KE V  VYDGSLF+++AKE+A K
Sbjct  125  NREPKDYGGWLAGYTEWKILYILCKDKNGLLHKETVRAVYDGSLFERMAKENASK  179



>ref|XP_011021794.1| PREDICTED: probable peroxygenase 4 isoform X2 [Populus euphratica]
Length=201

 Score =   208 bits (529),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 133/195 (68%), Gaps = 3/195 (2%)
 Frame = +1

Query  70   SSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALST  249
            SST  +  GK +  D     L+KHV FFD NQDGI+YPWETFQGFR IG    LS A + 
Sbjct  7    SSTDKQQNGKFVPNDHNV--LQKHVFFFDRNQDGIVYPWETFQGFRSIGCSILLSTASAF  64

Query  250  FIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHT  429
             I+I LS K+RPGK PS +FPI ++NI+   HGSDSG YD EG FV +K EEIF+K+  +
Sbjct  65   LINIALSQKTRPGKFPSLLFPIEVKNIQRAKHGSDSGVYDSEGRFVPAKFEEIFSKHARS  124

Query  430  YTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSL  609
            + N+LTS E+  +L+  R+P D+ GWV +  EW++LY L KD  GLL K+ +  VYDGSL
Sbjct  125  HPNSLTSDELMGMLKANREPKDFKGWVASYTEWKILYTLCKDKDGLLHKDTIRAVYDGSL  184

Query  610  FDQLAKEHA-PKIKA  651
            F+++ KE A PK  A
Sbjct  185  FERMEKERASPKKTA  199



>ref|NP_001238730.1| uncharacterized protein LOC100306686 [Glycine max]
 gb|ACU14982.1| unknown [Glycine max]
Length=202

 Score =   207 bits (528),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 133/199 (67%), Gaps = 6/199 (3%)
 Frame = +1

Query  64   MAS-STSTKPYGKGMEKDDETTP-----LKKHVMFFDSNQDGIIYPWETFQGFRKIGGGF  225
            MAS S+STK      E D++  P     L+KHV FF  N DGIIYPWETFQGFR IG G+
Sbjct  1    MASLSSSTKQSNNNQEVDEKPIPHDQNVLQKHVAFFGRNHDGIIYPWETFQGFRAIGCGY  60

Query  226  FLSVALSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEE  405
             LS   + FI+  LS K+RPGK PS + PI ++NI    HGSDSG YD EG FV SK EE
Sbjct  61   LLSSVAAIFINGGLSQKTRPGKFPSILLPIEVQNIHRSKHGSDSGVYDSEGRFVLSKFEE  120

Query  406  IFNKYGHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERV  585
            IF+K+  T+ N+LTS E+  +L   R P DY GW+ +  EW++LY+L KD  GLL KE +
Sbjct  121  IFSKHARTHPNSLTSDELMGMLVANRVPKDYAGWLASYTEWKILYVLGKDKDGLLHKETI  180

Query  586  IGVYDGSLFDQLAKEHAPK  642
              VYDGSLF+++ KEH+ K
Sbjct  181  RAVYDGSLFEKMEKEHSDK  199



>ref|XP_011070582.1| PREDICTED: probable peroxygenase 4 [Sesamum indicum]
Length=210

 Score =   207 bits (528),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 132/192 (69%), Gaps = 2/192 (1%)
 Frame = +1

Query  73   STSTKPYG-KGMEKD-DETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALS  246
            S STKP G +  + D D+T  L+KHVMFFD N DGIIYP ETF+GFR IG G  LS   +
Sbjct  11   SGSTKPQGTENHDHDHDQTNVLQKHVMFFDRNNDGIIYPSETFEGFRAIGCGVLLSSVAA  70

Query  247  TFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGH  426
             FI++ LS K+RPGK  S  FPI ++NI++  HGSDSG YD+EG F+ +K EEIF KY  
Sbjct  71   VFINMGLSRKTRPGKPFSLHFPIEVKNIQMAKHGSDSGVYDKEGRFLPTKFEEIFIKYAR  130

Query  427  TYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGS  606
            TY NALTS E+   ++  R+P DY GW+    EW++LY L KD  GLL KE V   YDGS
Sbjct  131  TYPNALTSDELKAFMKSNREPKDYGGWLAGYTEWKILYSLCKDDNGLLHKEIVRAAYDGS  190

Query  607  LFDQLAKEHAPK  642
            LF+++AKE A K
Sbjct  191  LFEKMAKEKASK  202



>gb|KHG06008.1| putative peroxygenase 4 -like protein [Gossypium arboreum]
 gb|KHG17503.1| putative peroxygenase 4 -like protein [Gossypium arboreum]
Length=184

 Score =   206 bits (525),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 120/164 (73%), Gaps = 0/164 (0%)
 Frame = +1

Query  130  LKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVF  309
            ++KH  FFD N DG++YPWETFQGFR IG G+ LS+A + FI++ LS  +RPGK PS +F
Sbjct  8    MQKHAAFFDRNHDGLVYPWETFQGFRAIGAGYLLSMAGAVFINLSLSGTTRPGKFPSLLF  67

Query  310  PIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDP  489
            PI ++NI++  HGSDSG YDREG FV SK +EIF+KY  T+ NALTS E+  +L+  R+P
Sbjct  68   PIEVKNIQMGKHGSDSGVYDREGRFVPSKFDEIFSKYARTHANALTSDELMAMLKSNREP  127

Query  490  NDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQL  621
             DY GW+ +  EW+ LY L KD  GLL +E +  VYDGSLF+ L
Sbjct  128  KDYKGWIGSWTEWKALYTLCKDENGLLRRETIKAVYDGSLFEHL  171



>gb|AFK43312.1| unknown [Lotus japonicus]
Length=189

 Score =   207 bits (526),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 122/169 (72%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  LKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVF  309
            L+KHV FFD NQDG+IYPWETF+G R IG G  LS ALS FI++  S  +RPGK PS +F
Sbjct  16   LQKHVAFFDLNQDGVIYPWETFKGLRLIGSGVLLSTALSFFINVGFSQSTRPGKFPSLLF  75

Query  310  PIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDP  489
            PI ++NIKL  H SD+G YD EG FV SK EEIFNK+ +T+ NALT  E+ E+ +  R+P
Sbjct  76   PIEVKNIKLAKHRSDTGVYDTEGRFVPSKFEEIFNKHANTHPNALTYGELKEMTKANREP  135

Query  490  NDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHA  636
             D  GW+ + +EW+VLY LAKD   L+ KE + GVYDGSLF+ L  EH+
Sbjct  136  KDLTGWIFSLVEWKVLYKLAKDKNDLVQKETIRGVYDGSLFEILKNEHS  184



>ref|XP_002525985.1| calcium ion binding protein, putative [Ricinus communis]
 gb|EEF36409.1| calcium ion binding protein, putative [Ricinus communis]
Length=198

 Score =   207 bits (526),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 128/187 (68%), Gaps = 1/187 (1%)
 Frame = +1

Query  64   MASSTSTK-PYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVA  240
            MAS+T T     KG    +E   L+KHV FFD N+DG++YPWETFQGFR IG G  LS A
Sbjct  1    MASTTITSDKQQKGKFVPNEDNVLQKHVFFFDRNKDGLVYPWETFQGFRAIGCGILLSTA  60

Query  241  LSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKY  420
             + FI+  LS K+RPGK PS +FPI ++NI+   HGSDSG YD EG FV  K EEIF K+
Sbjct  61   SAIFINAGLSQKTRPGKFPSLLFPIEVKNIQRSKHGSDSGVYDTEGRFVPEKFEEIFRKH  120

Query  421  GHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYD  600
              ++ +ALTS+E+ E+L+  R+P DY GW+ +  EWR LY L KD  GLL ++ V  VYD
Sbjct  121  AQSHPHALTSEELKEMLKANREPKDYAGWLASFAEWRTLYSLCKDKDGLLHEDTVRAVYD  180

Query  601  GSLFDQL  621
            GSLFD L
Sbjct  181  GSLFDHL  187



>ref|XP_006355066.1| PREDICTED: probable peroxygenase 5-like [Solanum tuberosum]
Length=198

 Score =   207 bits (526),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 133/186 (72%), Gaps = 3/186 (2%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            MAS  +   + +G+ K  E TPL+KHVMFFD + +GIIYPWET+QGFRKIG   FLS+  
Sbjct  1    MASCNNI--HQEGITKS-EPTPLQKHVMFFDIDNNGIIYPWETYQGFRKIGSNIFLSIFA  57

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
            S FI+  LS K+RPGK PS +FPI ++NIKL  H SDSG YD EG FV+ K EEIFNK+ 
Sbjct  58   SFFINFGLSRKTRPGKGPSLLFPIEVKNIKLAKHTSDSGVYDSEGRFVQEKFEEIFNKHA  117

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
             +  NALT++E+D++L+  + P D  G V A  EW++LY L KD  GLL K+ V GVYDG
Sbjct  118  RSNGNALTAQELDDMLKANKQPKDSKGHVAALSEWKILYFLCKDKDGLLKKDIVRGVYDG  177

Query  604  SLFDQL  621
            SLF+Q+
Sbjct  178  SLFEQM  183



>ref|XP_010271333.1| PREDICTED: probable peroxygenase 4 [Nelumbo nucifera]
Length=262

 Score =   209 bits (531),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 132/195 (68%), Gaps = 0/195 (0%)
 Frame = +1

Query  67   ASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALS  246
            A+S +T+    G   + + T L+KHV FFD N+DG+IYPWETF+GFR IG G  LSVA +
Sbjct  67   ANSANTRSVNGGEAINGDQTALQKHVAFFDRNKDGLIYPWETFEGFRAIGCGIPLSVAAA  126

Query  247  TFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGH  426
             FI+ VLS +SRPGK PS +FPI I NI    HGSDSG YD EG FV +K EEIF+K+  
Sbjct  127  IFINGVLSWQSRPGKFPSLLFPIEIRNIHRTKHGSDSGVYDTEGRFVPAKFEEIFHKHAP  186

Query  427  TYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGS  606
            + +NALTSKE+ ++L+  R P +Y GW+ A  EW +LY L KD  G L KE +   YDGS
Sbjct  187  SSSNALTSKELSQMLKSNRIPKNYYGWLAAWGEWTILYYLCKDKDGFLHKETIRSAYDGS  246

Query  607  LFDQLAKEHAPKIKA  651
            LF+++ KE     KA
Sbjct  247  LFEKMEKERRSSHKA  261



>ref|XP_007045248.1| Caleosin-related family protein [Theobroma cacao]
 gb|EOY01080.1| Caleosin-related family protein [Theobroma cacao]
Length=240

 Score =   208 bits (529),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 105/202 (52%), Positives = 135/202 (67%), Gaps = 11/202 (5%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTP-------LKKHVMFFDSNQDGIIYPWETFQGFRKIGGG  222
            MASS S+K + +G+   DE  P       L+KHV FFD N DG+IYPWETF+GFR IG G
Sbjct  1    MASSLSSKDFQEGV---DEGRPIPTDQNVLQKHVAFFDRNHDGLIYPWETFEGFRAIGAG  57

Query  223  FFLSVALSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIE  402
            + LS+A +  I+I LS K+R GK  S +FPI ++NI +  HGSDSG YD EG FV  K E
Sbjct  58   YMLSIASAILINIALSRKTRAGKF-SLLFPIEVKNIHMAKHGSDSGVYDSEGRFVPLKFE  116

Query  403  EIFNKYGHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKER  582
            EIF+K+  T++NALTS E+  +L+  R+P DY GW+ +  EWR LY L KD  GLL KE 
Sbjct  117  EIFSKFARTHSNALTSDELKAMLKANREPQDYKGWIGSWTEWRTLYSLCKDKHGLLRKET  176

Query  583  VIGVYDGSLFDQLAKEHAPKIK  648
            +  VYDGSLF+ + +E A   K
Sbjct  177  IRAVYDGSLFEHMERERAAAKK  198



>ref|XP_010066577.1| PREDICTED: probable peroxygenase 4 [Eucalyptus grandis]
 gb|KCW64503.1| hypothetical protein EUGRSUZ_G02110 [Eucalyptus grandis]
Length=213

 Score =   207 bits (526),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 122/176 (69%), Gaps = 0/176 (0%)
 Frame = +1

Query  130  LKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVF  309
            L+KHV FFD N DG++YPWETF+GFR IG    LS   +  I+I LS K+RPGK PS +F
Sbjct  34   LQKHVAFFDRNHDGLVYPWETFRGFRSIGASLPLSTISAILINIALSQKTRPGKFPSFLF  93

Query  310  PIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDP  489
            PI ++NI    HGSDSG YD EG FV  K EEIF K+  T+ +ALTS E+ E+L+  R P
Sbjct  94   PIEVKNIHKAKHGSDSGVYDSEGRFVPLKFEEIFRKHAQTHPDALTSNELQEMLKSNRQP  153

Query  490  NDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPKIKANN  657
             +Y GWV A  EW+VLY+L KD  GLL K+ +  VYDGSLF+ + KEH  K +A+N
Sbjct  154  KNYTGWVAAYTEWKVLYILCKDKDGLLHKDTIRAVYDGSLFEHMEKEHMEKGRASN  209



>ref|XP_007153263.1| hypothetical protein PHAVU_003G020500g [Phaseolus vulgaris]
 gb|ESW25257.1| hypothetical protein PHAVU_003G020500g [Phaseolus vulgaris]
Length=202

 Score =   206 bits (524),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 124/171 (73%), Gaps = 0/171 (0%)
 Frame = +1

Query  130  LKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVF  309
            L+KHV FFD N DGIIYPWETFQGFR IG G+ +S   + FI+  LS K+RPGK PS +F
Sbjct  29   LQKHVEFFDRNHDGIIYPWETFQGFRAIGCGYLISSVAALFINASLSRKTRPGKFPSLLF  88

Query  310  PIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDP  489
            PI ++NI+   HGSDS  YD EG FV SK EEIF K+  T+ +ALTS E+ E+L+  R+P
Sbjct  89   PIEVKNIQKAKHGSDSSVYDSEGRFVPSKFEEIFKKHARTHPDALTSDELMEMLKANREP  148

Query  490  NDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPK  642
             DY GW+ +  EW+ LY+L KD  GLL ++ + GVYDGSLF++L KEH+ K
Sbjct  149  KDYGGWLGSFSEWKFLYILCKDSDGLLHRDTIRGVYDGSLFEKLEKEHSQK  199



>ref|XP_003637676.1| hypothetical protein MTR_097s0019 [Medicago truncatula]
 gb|AFK34716.1| unknown [Medicago truncatula]
 gb|KEH40600.1| calcium ion-binding protein [Medicago truncatula]
Length=197

 Score =   205 bits (522),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 131/195 (67%), Gaps = 0/195 (0%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            MA+S+ST       + + +   L+KHV FFD N DGI+YPWETFQGFR IG G  LS   
Sbjct  1    MATSSSTTNNNGEKQIEHDQNVLQKHVAFFDRNHDGIVYPWETFQGFRAIGCGIILSSFA  60

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
            + FI+  LS K+RPGK PS   P+ I+NI    HGSDSG YD EG FV S  EEIF+K+ 
Sbjct  61   AIFINFGLSQKTRPGKFPSIFLPVEIKNITKAKHGSDSGVYDNEGRFVPSIFEEIFSKHA  120

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
              + +ALTS E+  LL+  R+P DY GW+ +  EW++L++L KD  GLL KE + GVYDG
Sbjct  121  RKHPSALTSDELMGLLKANREPKDYKGWLASYSEWKILHVLCKDKDGLLHKETIRGVYDG  180

Query  604  SLFDQLAKEHAPKIK  648
            SLF+++ KEH+ K K
Sbjct  181  SLFERMEKEHSEKKK  195



>ref|XP_002312455.2| calcium binding family protein [Populus trichocarpa]
 gb|EEE89822.2| calcium binding family protein [Populus trichocarpa]
Length=199

 Score =   205 bits (521),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 119/167 (71%), Gaps = 0/167 (0%)
 Frame = +1

Query  130  LKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVF  309
            L+KHV FFD NQDGI+YPWETFQGFR IG G  LS A +  I+I LS K+RPGK PSP+F
Sbjct  25   LQKHVFFFDRNQDGIVYPWETFQGFRAIGCGILLSTASALLINIALSQKTRPGKFPSPLF  84

Query  310  PIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDP  489
            PI ++NI    HGSDSG YD EG FV  K EEIF+K+  ++ N+LT+ E+  +L+  R+P
Sbjct  85   PIEVKNIHRTKHGSDSGVYDSEGRFVPGKFEEIFSKHARSHPNSLTADELMGMLKANREP  144

Query  490  NDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKE  630
             D+ GWV +  EW++LY L KD  GLL ++ +   YDGSLF+ + KE
Sbjct  145  KDFRGWVASYTEWKILYALCKDKNGLLHEDTIRAAYDGSLFEHMEKE  191



>ref|XP_010270200.1| PREDICTED: probable peroxygenase 4 [Nelumbo nucifera]
Length=210

 Score =   205 bits (522),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 133/193 (69%), Gaps = 0/193 (0%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            ++S+  +     G   D   +PL+KHV FFD N+DG++YP ETF+GFR IG G  LS   
Sbjct  11   VSSNDQSNSRNCGELVDGYLSPLQKHVAFFDRNKDGLVYPSETFKGFRAIGCGIPLSTIA  70

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
            + FI+  LSSK+RPGKLPS +FPI I+NIK   HGSD+G YD EG FV  K EEIF+K+ 
Sbjct  71   AIFINGGLSSKTRPGKLPSLLFPIEIKNIKRAKHGSDTGVYDTEGRFVPEKFEEIFHKHA  130

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
            HT  NALTSKEV E+L+D R P ++ GW+ A  EW++LY L KD  G L K+ + GVYDG
Sbjct  131  HTNPNALTSKEVSEMLKDNRVPKNFGGWIGAWTEWKILYYLCKDKDGFLPKDTIRGVYDG  190

Query  604  SLFDQLAKEHAPK  642
            +LF+Q+ +  + +
Sbjct  191  TLFEQMEEHRSSR  203



>ref|XP_006826899.1| hypothetical protein AMTR_s00010p00152350 [Amborella trichopoda]
 gb|ERM94136.1| hypothetical protein AMTR_s00010p00152350 [Amborella trichopoda]
Length=204

 Score =   205 bits (521),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 130/196 (66%), Gaps = 1/196 (1%)
 Frame = +1

Query  61   YMASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVA  240
            Y+ +S    P GK   + +E + L+KHV FFD N DGI+YPWET +GFR IG G  LS  
Sbjct  9    YLQTSGPRDP-GKEAHEPEEMSALQKHVGFFDRNNDGIVYPWETLKGFRAIGAGLLLSSV  67

Query  241  LSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKY  420
             + FI+  LS K+ PGK+PSP+ PI I+NI    H SDSG YD+EG FVESK EEIF KY
Sbjct  68   SALFINGGLSYKTLPGKIPSPLLPIYIKNIHKGKHPSDSGVYDKEGRFVESKFEEIFRKY  127

Query  421  GHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYD  600
              T+ +ALT  E+  +L+  R+PND  GW+ A  EW+ LY L KD +GLL KE +  VYD
Sbjct  128  ALTHPDALTYDELGAMLKGNREPNDTAGWIAAQTEWKTLYNLCKDERGLLPKETIRSVYD  187

Query  601  GSLFDQLAKEHAPKIK  648
            G LF ++ K+ A K+K
Sbjct  188  GGLFHRMEKQRASKVK  203



>gb|KEH40599.1| calcium ion-binding protein [Medicago truncatula]
Length=229

 Score =   205 bits (521),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 131/195 (67%), Gaps = 0/195 (0%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            MA+S+ST       + + +   L+KHV FFD N DGI+YPWETFQGFR IG G  LS   
Sbjct  33   MATSSSTTNNNGEKQIEHDQNVLQKHVAFFDRNHDGIVYPWETFQGFRAIGCGIILSSFA  92

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
            + FI+  LS K+RPGK PS   P+ I+NI    HGSDSG YD EG FV S  EEIF+K+ 
Sbjct  93   AIFINFGLSQKTRPGKFPSIFLPVEIKNITKAKHGSDSGVYDNEGRFVPSIFEEIFSKHA  152

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
              + +ALTS E+  LL+  R+P DY GW+ +  EW++L++L KD  GLL KE + GVYDG
Sbjct  153  RKHPSALTSDELMGLLKANREPKDYKGWLASYSEWKILHVLCKDKDGLLHKETIRGVYDG  212

Query  604  SLFDQLAKEHAPKIK  648
            SLF+++ KEH+ K K
Sbjct  213  SLFERMEKEHSEKKK  227



>ref|XP_009351532.1| PREDICTED: probable peroxygenase 4 [Pyrus x bretschneideri]
Length=205

 Score =   204 bits (519),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 119/169 (70%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  LKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVF  309
            L++HV FFD N DGI+YPWETFQGFR IG G  LS   +  I+  LS K+R GK PS +F
Sbjct  28   LQRHVAFFDRNHDGIVYPWETFQGFRAIGCGIMLSTVSAFLINAALSRKTRQGKFPSLLF  87

Query  310  PIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDP  489
            P+ ++NI    HGSDSG YD EG FV SK EEIF K+ HT+ NALTS E+  +L+  RDP
Sbjct  88   PVEVKNIHKAKHGSDSGVYDTEGRFVPSKFEEIFEKHAHTHPNALTSDELMGMLKANRDP  147

Query  490  NDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHA  636
             DY GW  A  EW++LY+L KD  GLL K+ V  VYDGSLF+++ KE++
Sbjct  148  KDYAGWFAAYTEWKILYVLCKDKNGLLHKDTVRAVYDGSLFERMEKENS  196



>ref|XP_002887322.1| hypothetical protein ARALYDRAFT_894884 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63581.1| hypothetical protein ARALYDRAFT_894884 [Arabidopsis lyrata subsp. 
lyrata]
Length=195

 Score =   203 bits (516),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 137/194 (71%), Gaps = 6/194 (3%)
 Frame = +1

Query  64   MASSTSTKPYGKGME-KDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVA  240
            MASS ST     G++   +E   L++HV FFD N+DGI+YP ETFQGFR IG G+ LS  
Sbjct  1    MASSIST-----GVKFVPEEDNFLQRHVAFFDRNKDGIVYPSETFQGFRAIGCGYLLSAV  55

Query  241  LSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKY  420
             S FI+I LSSK+RPGK  S +FPI ++NI L  HGSDSG YD++G FV SK EEIF K+
Sbjct  56   ASVFINIGLSSKTRPGKGFSILFPIEVKNIHLAKHGSDSGVYDKDGRFVASKFEEIFAKH  115

Query  421  GHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYD  600
             HT+ +ALT++E+ +LL+  ++PND +GW+    EW++L+ L KD  GLL K+ V   YD
Sbjct  116  AHTHRDALTNEELKQLLKANKEPNDRIGWIAGYTEWKILHYLCKDKNGLLHKDTVRASYD  175

Query  601  GSLFDQLAKEHAPK  642
            GSLF++L K+ + K
Sbjct  176  GSLFEKLEKQRSSK  189



>ref|XP_004297445.1| PREDICTED: probable peroxygenase 4-like [Fragaria vesca subsp. 
vesca]
Length=205

 Score =   203 bits (516),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 126/189 (67%), Gaps = 0/189 (0%)
 Frame = +1

Query  70   SSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALST  249
            S T+ K    G     E   L++HV FFD N DGI+YPWETFQGFR IG G  LS   + 
Sbjct  7    SDTNNKQEVGGRFVPKEHDSLQRHVAFFDRNHDGIVYPWETFQGFRAIGCGILLSSFSAI  66

Query  250  FIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHT  429
            FI+  LS ++RPGK  S +FPI + NI    HGSDSG YD EG FV SK EEIF K+ HT
Sbjct  67   FINFGLSRQTRPGKSFSLLFPIEVRNIHKAKHGSDSGVYDSEGRFVPSKFEEIFIKHAHT  126

Query  430  YTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSL  609
              NALTS+E+D LL+  R+PND  GW+ A  EW++LYLL KD  GLL K+ +  VYDGSL
Sbjct  127  NGNALTSEELDGLLKANREPNDRRGWLAAWTEWKILYLLCKDKNGLLHKDTIRAVYDGSL  186

Query  610  FDQLAKEHA  636
            F+++ KE +
Sbjct  187  FERMEKERS  195



>ref|XP_008775946.1| PREDICTED: probable peroxygenase 5 [Phoenix dactylifera]
Length=239

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 131/199 (66%), Gaps = 9/199 (5%)
 Frame = +1

Query  55   LYYMASSTSTKPYGKGMEKDDET------TPLKKHVMFFDSNQDGIIYPWETFQGFRKIG  216
            L  MASS+       G E+++E       TPL+KHV FFD N+DGII+PWETFQGFR IG
Sbjct  37   LSTMASSSLPS---NGSEREEEEINSGDLTPLQKHVAFFDRNKDGIIFPWETFQGFRAIG  93

Query  217  GGFFLSVALSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESK  396
             G  LS   +  I+  L  K+RPGK+PS + PI I NI+   HGSDSG YD +G FV +K
Sbjct  94   CGVALSTLSAVLINGFLGPKTRPGKIPSLLLPIYITNIEKGKHGSDSGVYDSDGRFVPAK  153

Query  397  IEEIFNKYGHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTK  576
             EEIF ++ HT  NALTSKE+DE+L+  R PNDY GW  +  EW++L+ L KD  GLL K
Sbjct  154  FEEIFKRHAHTNPNALTSKELDEMLQANRVPNDYKGWFASWTEWKILFTLCKDKDGLLHK  213

Query  577  ERVIGVYDGSLFDQLAKEH  633
            E V  VYDGSLF  + K+ 
Sbjct  214  ETVRAVYDGSLFLTMEKKR  232



>ref|XP_008221453.1| PREDICTED: probable peroxygenase 4 [Prunus mume]
Length=199

 Score =   202 bits (515),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 121/176 (69%), Gaps = 0/176 (0%)
 Frame = +1

Query  115  DETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKL  294
            +E   L++HV FFD N DGI+YPWETFQGFR IG G  LS   S  I+  LS K+R GK 
Sbjct  15   NEQDVLQRHVAFFDRNHDGIVYPWETFQGFRAIGCGILLSTVSSFLINAALSQKTREGKF  74

Query  295  PSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLR  474
            PSP+ PI ++NI    HGSDSG YD  G FV SK E+IF K+ HT+ +ALTS E+  +L+
Sbjct  75   PSPLLPIEVKNIHKAKHGSDSGVYDSHGRFVPSKFEDIFCKHAHTHPDALTSDELMGMLK  134

Query  475  DKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPK  642
              R+P DY GWV +  EW++LY+L KD +GLL K+ +  VYDGSLF+++ +E   K
Sbjct  135  ANREPKDYAGWVASWTEWKILYVLCKDSRGLLHKDTIRAVYDGSLFERMERERIEK  190



>ref|XP_010460114.1| PREDICTED: probable peroxygenase 7 [Camelina sativa]
Length=209

 Score =   202 bits (515),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 124/166 (75%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  TPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSP  303
            T L+KHV FFD N DG++YPWET+QGFR +G G   S  ++ F+++ LS K+RPGK  SP
Sbjct  27   TALEKHVAFFDRNGDGVVYPWETYQGFRALGTGRLTSAIVAIFVNMGLSGKTRPGKGFSP  86

Query  304  VFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKR  483
            +FPI ++N +  +HGSD+  YD++G FVESK EEIF K+   + +ALTSKE+ +LL+  R
Sbjct  87   LFPIEVKNSRFGIHGSDTNVYDKDGRFVESKFEEIFKKHARKHKDALTSKEIKQLLKTNR  146

Query  484  DPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQL  621
            +PND  GWV A +EW++L+ LAKD  GLLTK+ V GVYDGSLF QL
Sbjct  147  EPNDLNGWVSALLEWKLLHNLAKDKNGLLTKDAVRGVYDGSLFTQL  192



>ref|XP_006303774.1| hypothetical protein CARUB_v10012010mg, partial [Capsella rubella]
 gb|EOA36672.1| hypothetical protein CARUB_v10012010mg, partial [Capsella rubella]
Length=193

 Score =   202 bits (514),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 124/169 (73%), Gaps = 0/169 (0%)
 Frame = +1

Query  124  TPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSP  303
            T L+KHV FFD N DG++YPWET+QGFR +G G   S   + FI++ LS K+RPGK  SP
Sbjct  9    TALEKHVAFFDRNGDGVVYPWETYQGFRALGTGRLASAFAAIFINMGLSRKTRPGKGFSP  68

Query  304  VFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKR  483
            +FPI ++N +  +HGSD+  YD++G FVESK EEIF K+ H + +ALT KE+ +LL+  R
Sbjct  69   LFPIEVKNSRFGIHGSDTNVYDKDGRFVESKFEEIFKKHAHKHKDALTEKEIKQLLKTNR  128

Query  484  DPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKE  630
            +P D+ GW+ A  EW++L+ LAKD  GLLTK+ V GVYDGSLF QL K+
Sbjct  129  EPRDFEGWISAFSEWKILHNLAKDKNGLLTKDAVRGVYDGSLFLQLEKQ  177



>ref|NP_564995.1| probable peroxygenase 4 [Arabidopsis thaliana]
 sp|Q9CAB7.1|PXG4_ARATH RecName: Full=Probable peroxygenase 4; Short=AtPXG4; AltName: 
Full=Caleosin-4 [Arabidopsis thaliana]
 gb|AAG52340.1|AC011663_19 unknown protein; 59759-58619 [Arabidopsis thaliana]
 gb|AAL06990.1| At1g70670/F5A18_15 [Arabidopsis thaliana]
 gb|AAN28754.1| At1g70670/F5A18_15 [Arabidopsis thaliana]
 gb|AEE35098.1| probable peroxygenase 4 [Arabidopsis thaliana]
Length=195

 Score =   201 bits (511),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 135/194 (70%), Gaps = 6/194 (3%)
 Frame = +1

Query  64   MASSTSTKPYGKGME-KDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVA  240
            MASS ST     G++   +E   L++HV FFD N+DGI+YP ETFQGFR IG G+ LS  
Sbjct  1    MASSIST-----GVKFVPEEDNFLQRHVAFFDRNKDGIVYPSETFQGFRAIGCGYLLSAV  55

Query  241  LSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKY  420
             S FI+I LSSK+RPGK  S  FPI ++NI L  HGSDSG YD++G FV SK EEIF K+
Sbjct  56   ASVFINIGLSSKTRPGKGFSIWFPIEVKNIHLAKHGSDSGVYDKDGRFVASKFEEIFTKH  115

Query  421  GHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYD  600
             HT+ +ALT++E+ +LL+  ++PND  GW+    EW+VL+ L KD  GLL K+ V   YD
Sbjct  116  AHTHRDALTNEELKQLLKANKEPNDRKGWLAGYTEWKVLHYLCKDKNGLLHKDTVRAAYD  175

Query  601  GSLFDQLAKEHAPK  642
            GSLF++L K+ + K
Sbjct  176  GSLFEKLEKQRSSK  189



>gb|KFK44413.1| hypothetical protein AALP_AA1G253800 [Arabis alpina]
Length=214

 Score =   201 bits (511),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 130/178 (73%), Gaps = 0/178 (0%)
 Frame = +1

Query  97   KGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSK  276
            K  +K++  T L+KHV FFD N DGIIYPWET+QGFR +G G   S     FI++ LS  
Sbjct  29   KQSDKEEGYTALEKHVAFFDRNGDGIIYPWETYQGFRALGIGRLGSALSGLFINMGLSQI  88

Query  277  SRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKE  456
            +RPGK+ SP+FPI ++NIK  +HGSD+ AYD++G FVESK EEIF K+ HT+ +ALT KE
Sbjct  89   TRPGKIFSPLFPIEVKNIKFSIHGSDTNAYDKDGRFVESKFEEIFKKHAHTHDDALTYKE  148

Query  457  VDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKE  630
            + ++L+  R+P D +GW+ A  EW++++ L KD KGL+TKE V  +YDGSLF ++ KE
Sbjct  149  IKQMLKTNREPKDIVGWIAAYGEWKLVHQLYKDKKGLVTKEDVRDIYDGSLFKKVEKE  206



>ref|XP_009419119.1| PREDICTED: probable peroxygenase 4 [Musa acuminata subsp. malaccensis]
Length=195

 Score =   200 bits (509),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 120/172 (70%), Gaps = 0/172 (0%)
 Frame = +1

Query  118  ETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLP  297
            + TPL+KHV FFD N DG+IYP ET++GFR IG G  LS   + FI+  LS K+ PGK+P
Sbjct  17   QMTPLQKHVAFFDRNNDGVIYPSETYRGFRAIGSGVALSAVSALFINGFLSPKTSPGKIP  76

Query  298  SPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRD  477
            SP+ PI ++NI    HGSDSG YD EG FV SK EEIF K+  +  NALTSKE+ E+LR 
Sbjct  77   SPLLPIYVKNIYKGKHGSDSGVYDSEGRFVASKFEEIFQKHAKSNPNALTSKELMEMLRA  136

Query  478  KRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEH  633
             RDP DY GW+ +  EW+V Y+L KD +GLL KE +  +YDGS+F ++  E 
Sbjct  137  NRDPKDYSGWLASWTEWKVFYMLCKDKEGLLQKETIRALYDGSIFLKMEAER  188



>ref|XP_010498834.1| PREDICTED: LOW QUALITY PROTEIN: probable peroxygenase 7 [Camelina 
sativa]
Length=209

 Score =   201 bits (510),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 123/166 (74%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  TPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSP  303
            T L+KHV FFD N DG++YPWET+QGFR +G G   S  ++ F+++ LS K+RPGK  SP
Sbjct  27   TALEKHVAFFDRNGDGVVYPWETYQGFRALGTGRLTSAIVAIFVNMGLSGKTRPGKGFSP  86

Query  304  VFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKR  483
            +FPI ++N +  +HGSDS  YD++G FVESK EEIF K+   + +ALTSKE+ +LL+  R
Sbjct  87   LFPIEVKNSRFGIHGSDSNVYDKDGRFVESKFEEIFKKHARKHKDALTSKEIKQLLKTNR  146

Query  484  DPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQL  621
            +P D  GWV A +EW++L+ LAKD  GLLTK+ V GVYDGSLF QL
Sbjct  147  EPXDLNGWVSALLEWQLLHNLAKDKNGLLTKDAVRGVYDGSLFTQL  192



>ref|XP_010415752.1| PREDICTED: probable peroxygenase 4 [Camelina sativa]
Length=195

 Score =   200 bits (509),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 135/194 (70%), Gaps = 6/194 (3%)
 Frame = +1

Query  64   MASSTSTKPYGKGME-KDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVA  240
            MASS ST     G++   +E   L++HV FFD N+DGI+YP ETFQGFR IG G+ LS  
Sbjct  1    MASSIST-----GVKFVPEEDNFLQRHVAFFDRNKDGIVYPSETFQGFRAIGCGYLLSAV  55

Query  241  LSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKY  420
             S FI+I LSSK+RPGK  S +FPI ++NI L  HGSDSG YD++G FV SK EEIF K+
Sbjct  56   ASVFINIGLSSKTRPGKGFSILFPIEVKNIHLAKHGSDSGVYDKDGRFVASKFEEIFAKH  115

Query  421  GHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYD  600
             HT+ +ALT++E+ ELL   ++PND  G + A  EW++L+ L KD  GLL K+ V   YD
Sbjct  116  AHTHRDALTNEELKELLNANKEPNDRKGSIAAYTEWKILHYLCKDKNGLLHKDTVRAAYD  175

Query  601  GSLFDQLAKEHAPK  642
            GSLF++L K+ + K
Sbjct  176  GSLFEKLEKQRSSK  189



>ref|XP_004498264.1| PREDICTED: probable peroxygenase 5-like [Cicer arietinum]
Length=209

 Score =   200 bits (509),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 121/178 (68%), Gaps = 1/178 (1%)
 Frame = +1

Query  115  DETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKL  294
            D    L+KH  FFD N+DG+IYPWETFQ  R+IG G  LS A + FI++ LS  +RP   
Sbjct  30   DHENVLQKHAGFFDLNKDGVIYPWETFQAMREIGSGLLLSTAAAVFINVSLSHSTRPVCS  89

Query  295  PSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLR  474
             S  FPI ++NIK   HGSDSG YD EG FV SK EEIF K+ HTY NALT  E+ E+++
Sbjct  90   ISFFFPIEVKNIKFGKHGSDSGVYDSEGRFVASKFEEIFIKHAHTYPNALTHDELKEMIK  149

Query  475  DKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPKIK  648
              R+PND+ G +   +EW VLY LAKD  GLL KE + GVYDG+LF+ L KEH  KIK
Sbjct  150  TNREPNDFKGRIGGFVEWEVLYKLAKDKNGLLQKETIRGVYDGTLFEALKKEHT-KIK  206



>ref|XP_009105736.1| PREDICTED: probable peroxygenase 4 [Brassica rapa]
 emb|CDX96268.1| BnaA07g28790D [Brassica napus]
Length=192

 Score =   199 bits (507),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 135/193 (70%), Gaps = 4/193 (2%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            MASS ST+   K + ++D    L++HV FFD N+DGI+YP ET+QGFR IG G+ LS   
Sbjct  1    MASSESTEV--KFVPEEDNF--LQRHVAFFDRNKDGIVYPSETYQGFRAIGCGYLLSAFA  56

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
            S FI++ LSSK+RPGK  S  FPI ++NI L  HGSDSG YD++G FVESK EEIF K+ 
Sbjct  57   SLFINMGLSSKTRPGKGFSLSFPIEVKNIHLAKHGSDSGVYDKDGRFVESKFEEIFAKHS  116

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
            HT+ NALT KE+ ELL   ++ ND  G + A  EW++L+ L KD  GLL K+ V  VYDG
Sbjct  117  HTHPNALTGKELQELLDSNKEANDRKGAIAAYTEWKILHYLCKDKNGLLHKDTVRAVYDG  176

Query  604  SLFDQLAKEHAPK  642
            SLF++L K+ A K
Sbjct  177  SLFEKLEKQTASK  189



>ref|XP_010427851.1| PREDICTED: probable peroxygenase 4 [Camelina sativa]
Length=195

 Score =   199 bits (506),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 134/194 (69%), Gaps = 6/194 (3%)
 Frame = +1

Query  64   MASSTSTKPYGKGME-KDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVA  240
            MASS ST     G++   +E   L++HV FFD N+DGI+YP ETFQGFR IG G+ LS  
Sbjct  1    MASSIST-----GVKFVPEEDNFLQRHVAFFDRNKDGIVYPSETFQGFRAIGCGYLLSAV  55

Query  241  LSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKY  420
             S FI+I LSSK+RPGK  S  FPI ++NI L  HGSDSG YD++G FV SK EEIF K+
Sbjct  56   ASVFINIGLSSKTRPGKGFSISFPIEVKNIHLAKHGSDSGVYDKDGRFVASKFEEIFAKH  115

Query  421  GHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYD  600
             HT+ +ALT++E+ ELL   ++PND  G + A  EW++L+ L KD  GLL K+ V   YD
Sbjct  116  AHTHRDALTNEELKELLNANKEPNDRKGSIAAYTEWKILHYLCKDKNGLLHKDTVRAAYD  175

Query  601  GSLFDQLAKEHAPK  642
            GSLF++L K+ + K
Sbjct  176  GSLFEKLEKQRSSK  189



>ref|XP_010477616.1| PREDICTED: probable peroxygenase 7 [Camelina sativa]
Length=209

 Score =   199 bits (507),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 123/166 (74%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  TPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSP  303
            T L+KHV FFD N DG++YPWET+QGFR +G G   S  ++ F+++ LS K+RPGK  SP
Sbjct  27   TALEKHVAFFDRNGDGVVYPWETYQGFRALGTGRLTSAIVAIFVNMGLSGKTRPGKGFSP  86

Query  304  VFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKR  483
            + PI ++N +  +HGSD+  YD++G FVESK EE+F K+   + +ALTSKE+ +LL+  R
Sbjct  87   LLPIEVKNSRFGIHGSDTNVYDKDGRFVESKFEEMFKKHARKHKDALTSKEIKQLLKTNR  146

Query  484  DPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQL  621
            +PND+ GWV A +EW++L  LAKD  GLLTK+ V GVYDGSLF QL
Sbjct  147  EPNDFNGWVSALLEWKLLQNLAKDKNGLLTKDVVRGVYDGSLFTQL  192



>gb|AAM65818.1| unknown [Arabidopsis thaliana]
Length=195

 Score =   199 bits (505),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 134/194 (69%), Gaps = 6/194 (3%)
 Frame = +1

Query  64   MASSTSTKPYGKGME-KDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVA  240
            MASS ST     G++   +E   L++HV FFD N+DGI+YP ETFQGFR IG G+ LS  
Sbjct  1    MASSIST-----GVKFVPEEDNFLQRHVAFFDRNKDGIVYPSETFQGFRAIGCGYLLSAV  55

Query  241  LSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKY  420
             S FI+I LSSK+RPGK  S  FPI ++NI L  HGSDS  YD++G FV SK EEIF K+
Sbjct  56   ASVFINIGLSSKTRPGKGFSIWFPIEVKNIHLAKHGSDSCVYDKDGRFVASKFEEIFTKH  115

Query  421  GHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYD  600
             HT+ +ALT++E+ +LL+  ++PND  GW+    EW+VL+ L KD  GLL K+ V   YD
Sbjct  116  AHTHRDALTNEELKQLLKANKEPNDRKGWLAGYTEWKVLHYLCKDKNGLLHKDTVRAAYD  175

Query  601  GSLFDQLAKEHAPK  642
            GSLF++L K+ + K
Sbjct  176  GSLFEKLEKQRSSK  189



>ref|XP_006300554.1| hypothetical protein CARUB_v10020949mg, partial [Capsella rubella]
 gb|EOA33452.1| hypothetical protein CARUB_v10020949mg, partial [Capsella rubella]
Length=210

 Score =   199 bits (506),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 133/190 (70%), Gaps = 6/190 (3%)
 Frame = +1

Query  64   MASSTSTKPYGKGME-KDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVA  240
            MASS ST     G++   +E   L++HV FFD N+DGI+YP ETFQGFR IG G+ LS  
Sbjct  15   MASSVST-----GVKFVPEEDNFLQRHVAFFDRNKDGIVYPSETFQGFRAIGCGYLLSTV  69

Query  241  LSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKY  420
             S FI++ LS K+RPGK  S +FPI ++NI L  HGSDSG YD++G FV SK EEIF K+
Sbjct  70   ASVFINLGLSRKTRPGKGFSFMFPIEVKNIHLAKHGSDSGVYDKDGRFVASKFEEIFAKH  129

Query  421  GHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYD  600
             HT+ +ALT++E+ ELL   ++PND  GW+ A  EW++L+ L KD  GLL K+ V   YD
Sbjct  130  AHTHRDALTNQELKELLNANKEPNDRKGWLAAYTEWKILHYLCKDKNGLLHKDTVRAAYD  189

Query  601  GSLFDQLAKE  630
            GSLF++L ++
Sbjct  190  GSLFEKLEQQ  199



>ref|XP_010427852.1| PREDICTED: probable peroxygenase 4 [Camelina sativa]
Length=231

 Score =   200 bits (508),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 126/174 (72%), Gaps = 0/174 (0%)
 Frame = +1

Query  115  DETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKL  294
            +E   L++HV FFD N+DGI+YP ETF+GFR IG G+ +S   S FI++ LSS++RPGK 
Sbjct  54   EEDNFLQRHVAFFDRNKDGIVYPSETFEGFRAIGCGYAMSTFASMFINMGLSSQTRPGKG  113

Query  295  PSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLR  474
             S  FPI ++NI L  HGSDSG YD++G FV SK EEIF K+ HT+++ALT +E+ ELL 
Sbjct  114  FSLSFPIEVKNIHLAKHGSDSGVYDKDGRFVASKFEEIFTKHAHTHSDALTKEELKELLN  173

Query  475  DKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHA  636
              ++PND  G +LA  EW+VLY L KD  GLL KE V  VYDGSLF++L K+ A
Sbjct  174  ANKEPNDRKGGILAYAEWKVLYDLCKDKNGLLQKETVRAVYDGSLFEKLEKQRA  227



>ref|XP_010471067.1| PREDICTED: probable peroxygenase 4 [Camelina sativa]
Length=195

 Score =   198 bits (504),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 134/194 (69%), Gaps = 6/194 (3%)
 Frame = +1

Query  64   MASSTSTKPYGKGME-KDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVA  240
            MASS ST     G++   +E   L++HV FFD N+DGI+YP ETFQGFR IG G+ LS  
Sbjct  1    MASSIST-----GVKFVPEEDNFLQRHVAFFDRNKDGIVYPSETFQGFRAIGCGYLLSAV  55

Query  241  LSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKY  420
             S FI+I LSSK+RPGK  S +FPI ++NI L  HGSDSG YD++G FV SK EEIF K+
Sbjct  56   ASVFINIDLSSKTRPGKGFSILFPIEVKNIHLAKHGSDSGVYDKDGRFVASKFEEIFAKH  115

Query  421  GHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYD  600
             HT+ +ALT++E+ ELL   ++PND  G + A  EW++L+ L KD  GLL K  V   YD
Sbjct  116  AHTHRDALTNEELKELLNANKEPNDRKGSIAAYTEWKILHYLCKDKNGLLHKYTVRAAYD  175

Query  601  GSLFDQLAKEHAPK  642
            GSLF++L K+ + K
Sbjct  176  GSLFEKLEKQRSSK  189



>ref|XP_011024003.1| PREDICTED: probable peroxygenase 4 [Populus euphratica]
Length=201

 Score =   198 bits (504),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 117/167 (70%), Gaps = 0/167 (0%)
 Frame = +1

Query  130  LKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVF  309
            L+KHV FFD NQDGI+YPWETFQGFR IG G  LS A +  I+I LS K+RPGK PS +F
Sbjct  27   LQKHVFFFDRNQDGIVYPWETFQGFRAIGCGILLSTASAFLINIALSQKTRPGKFPSLLF  86

Query  310  PIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDP  489
            PI ++NI    HGSDSG YD EG FV  K EEI +K+  ++ N+LT +E+  +L+  R+P
Sbjct  87   PIEVKNIHRAKHGSDSGVYDSEGRFVPGKFEEILSKHARSHPNSLTGEELMGMLKANREP  146

Query  490  NDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKE  630
             D+ GWV +  EW++LY L KD  GLL K+ +   YDGSLF+ + KE
Sbjct  147  KDFRGWVASYTEWKILYDLCKDKNGLLHKDTIRAAYDGSLFEHMEKE  193



>ref|XP_010474261.1| PREDICTED: probable peroxygenase 4 [Camelina sativa]
Length=231

 Score =   199 bits (506),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 125/174 (72%), Gaps = 0/174 (0%)
 Frame = +1

Query  115  DETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKL  294
            +E   L++HV FFD N+DGI+YP ETFQGFR IG G+ LS   S FI++ LS ++RPGK 
Sbjct  54   EEENFLQRHVAFFDRNKDGIVYPSETFQGFRAIGCGYALSTFGSMFINMGLSRQTRPGKG  113

Query  295  PSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLR  474
             S  FPI ++NI L  HGSDSG YD++G FV SK EEIF K+ HT+++ALT +E+ ELL 
Sbjct  114  FSLSFPIEVKNIHLAKHGSDSGVYDKDGRFVASKFEEIFTKHAHTHSDALTKEELKELLN  173

Query  475  DKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHA  636
              ++PND  G +LA  EW+VLY L KD  GLL KE V  VYDGSLF++L K+ A
Sbjct  174  ANKEPNDRKGGILAYAEWKVLYDLCKDKNGLLQKETVRAVYDGSLFEKLEKQRA  227



>emb|CDY11562.1| BnaC06g31770D [Brassica napus]
Length=192

 Score =   197 bits (502),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 135/193 (70%), Gaps = 4/193 (2%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            MASS ST+   K + ++D    L++HV FFD N+DGI+YP ET+QGFR IG G+ LS   
Sbjct  1    MASSESTEV--KFVPEEDNF--LQRHVAFFDRNKDGIVYPSETYQGFRAIGCGYLLSAFA  56

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
            S FI++ LSSK+RPGK  S  FPI ++NI L  HGSDSG YD++G FVESK EEIF K+ 
Sbjct  57   SLFINMGLSSKTRPGKGFSLSFPIEVKNIHLAKHGSDSGVYDKDGRFVESKFEEIFAKHS  116

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
            HT+ +ALT KE+ ELL   ++ ND  G + A  EW++L+ L KD  GLL K+ V  VYDG
Sbjct  117  HTHPDALTGKELQELLDSNKEANDRKGAIAAYTEWKILHYLCKDKNGLLHKDTVRAVYDG  176

Query  604  SLFDQLAKEHAPK  642
            SLF++L K+ A K
Sbjct  177  SLFEKLEKQTASK  189



>emb|CDY09468.1| BnaC02g20100D [Brassica napus]
Length=192

 Score =   197 bits (502),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 126/179 (70%), Gaps = 0/179 (0%)
 Frame = +1

Query  115  DETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKL  294
            +E   L++HV FFD N+DGI+YP ETFQGFR IG G+ LS   S FI++ LSSK+RPGK 
Sbjct  14   EEDNFLQRHVAFFDRNKDGIVYPSETFQGFRAIGCGYLLSAFASLFINMGLSSKTRPGKG  73

Query  295  PSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLR  474
             S  FPI ++NI L  HGSDSG YD++G FVESK EEIF K+  T+ +ALT+KE+ +LL 
Sbjct  74   FSISFPIEVKNIHLAKHGSDSGVYDKKGRFVESKFEEIFAKHSKTHPDALTNKELKQLLN  133

Query  475  DKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPKIKA  651
              ++ ND  G + A  EW++LY L KD  GLL K+ V  VYDGSLF++L K+ A K  A
Sbjct  134  SNKEANDRKGAIAAFTEWKILYYLCKDKNGLLHKDTVRAVYDGSLFEKLEKQKASKKHA  192



>ref|XP_009127817.1| PREDICTED: probable peroxygenase 4 [Brassica rapa]
 emb|CDY03728.1| BnaA02g15090D [Brassica napus]
Length=192

 Score =   197 bits (501),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 125/179 (70%), Gaps = 0/179 (0%)
 Frame = +1

Query  115  DETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKL  294
            +E   L++HV FFD N+DGI+YP ETFQGFR IG G+ LS   S FI++ LSSK+RPGK 
Sbjct  14   EEDNFLQRHVAFFDRNKDGIVYPSETFQGFRAIGCGYLLSAFASLFINMGLSSKTRPGKG  73

Query  295  PSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLR  474
             S  FPI ++NI L  HGSDSG YD+ G FVESK EEIF K+  T+ +ALT+KE+ +LL 
Sbjct  74   FSISFPIEVKNIHLAKHGSDSGVYDKNGRFVESKFEEIFAKHSKTHPDALTNKELKQLLN  133

Query  475  DKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPKIKA  651
              ++ ND  G + A  EW++LY L KD  GLL K+ V  VYDGSLF++L K+ A K  A
Sbjct  134  SNKEANDRKGAIAAFTEWKILYYLCKDKNGLLHKDTVRAVYDGSLFEKLEKQKASKKHA  192



>ref|XP_008366985.1| PREDICTED: probable peroxygenase 4 [Malus domestica]
Length=205

 Score =   196 bits (499),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 118/172 (69%), Gaps = 0/172 (0%)
 Frame = +1

Query  115  DETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKL  294
            +E   L++HV FFD N+DGI+YPWETFQGFR IG G  LS   +  I+  LS K+R GK 
Sbjct  23   NEQDVLQRHVAFFDRNRDGIVYPWETFQGFRAIGCGILLSTTSAFLINAALSQKTRQGKF  82

Query  295  PSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLR  474
            PS +FPI ++ I    HGSDSG YD EG FV  K EEIF K+ HT+ N+LTS E+  +L+
Sbjct  83   PSLLFPIEVKXIHKAKHGSDSGVYDTEGRFVPLKFEEIFAKHAHTHPNSLTSDELMGMLK  142

Query  475  DKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKE  630
              R P DY GWV A  EW++LY+L KD  GLL K+ V  VYDG+LF+++ KE
Sbjct  143  XNRVPKDYAGWVAAYTEWKILYVLCKDKNGLLHKDTVRAVYDGTLFERMEKE  194



>ref|XP_003533957.1| PREDICTED: probable peroxygenase 4-like [Glycine max]
 gb|KHN01902.1| Putative peroxygenase 4 [Glycine soja]
Length=204

 Score =   196 bits (498),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 115/164 (70%), Gaps = 0/164 (0%)
 Frame = +1

Query  130  LKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVF  309
            L+KH  FFD N DG+IYPWETFQG R+IG G   S  LS FI++ LS  +RPGK PS +F
Sbjct  31   LQKHAAFFDKNHDGVIYPWETFQGLREIGNGILASFGLSLFINLALSQSTRPGKFPSFLF  90

Query  310  PIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDP  489
            PI I+NI+L  HGSD+G YD EG FV SK EEIF K+ HT+ NALT  E+ E+L+  R+ 
Sbjct  91   PIEIKNIQLGKHGSDTGVYDTEGRFVPSKFEEIFTKHAHTHPNALTYDELKEMLKANRET  150

Query  490  NDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQL  621
             D  G +   +EW+ LY LAKD  GLL KE + GVYDGS+F+ L
Sbjct  151  KDLKGRIGGEVEWKFLYKLAKDKNGLLQKETIRGVYDGSVFELL  194



>ref|XP_010652627.1| PREDICTED: probable peroxygenase 4 isoform X1 [Vitis vinifera]
Length=211

 Score =   196 bits (498),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 120/177 (68%), Gaps = 0/177 (0%)
 Frame = +1

Query  118  ETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLP  297
            + + L+KHV FFD N+DG +YPWET++GFR IG G FLS   +  I++ LS K+RPGK P
Sbjct  29   DLSALQKHVAFFDQNKDGTVYPWETYRGFRAIGCGIFLSAGSAFLINLALSRKTRPGKFP  88

Query  298  SPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRD  477
            S + PI I+NI +  HGSDSG YD EG FV SK EEIF K+    +NALTS E+  +L+ 
Sbjct  89   SLLLPIEIKNIHMAKHGSDSGVYDSEGRFVPSKFEEIFTKHAGANSNALTSDELLAMLKY  148

Query  478  KRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPKIK  648
             R P DY GW+ +  EW++LY L KD  GLL KE +  VYDGSLF+++ +  A   K
Sbjct  149  NRVPKDYSGWLASWTEWKILYFLCKDKNGLLHKETIRAVYDGSLFERMQEHRASARK  205



>ref|XP_010687657.1| PREDICTED: probable peroxygenase 4 [Beta vulgaris subsp. vulgaris]
Length=202

 Score =   196 bits (497),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 115/168 (68%), Gaps = 0/168 (0%)
 Frame = +1

Query  130  LKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVF  309
            L KHV FFD N DGI+YPWETF+GFR IG G  LS   +  I++ LS K+RPG+ PS +F
Sbjct  20   LAKHVAFFDRNHDGIVYPWETFKGFRAIGSGLLLSTVAAFVINMGLSHKTRPGRFPSLLF  79

Query  310  PIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDP  489
            PI I+NI    HGSDSG YD EG FV+ K E IFNKY  +  NALT+KE+DE+L+  R+P
Sbjct  80   PIEIKNIAKAKHGSDSGVYDTEGRFVQPKFEAIFNKYARSNANALTAKELDEMLKANREP  139

Query  490  NDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEH  633
             D  G   A IEW++ + L KD  GLL ++ + GVYDGS+F+ +  E 
Sbjct  140  KDLAGRFAAYIEWKIFFSLCKDKNGLLQRDTIRGVYDGSIFEMMENER  187



>ref|XP_002284889.1| PREDICTED: probable peroxygenase 4 isoform X2 [Vitis vinifera]
 emb|CBI26842.3| unnamed protein product [Vitis vinifera]
Length=205

 Score =   196 bits (498),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 120/177 (68%), Gaps = 0/177 (0%)
 Frame = +1

Query  118  ETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLP  297
            + + L+KHV FFD N+DG +YPWET++GFR IG G FLS   +  I++ LS K+RPGK P
Sbjct  23   DLSALQKHVAFFDQNKDGTVYPWETYRGFRAIGCGIFLSAGSAFLINLALSRKTRPGKFP  82

Query  298  SPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRD  477
            S + PI I+NI +  HGSDSG YD EG FV SK EEIF K+    +NALTS E+  +L+ 
Sbjct  83   SLLLPIEIKNIHMAKHGSDSGVYDSEGRFVPSKFEEIFTKHAGANSNALTSDELLAMLKY  142

Query  478  KRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPKIK  648
             R P DY GW+ +  EW++LY L KD  GLL KE +  VYDGSLF+++ +  A   K
Sbjct  143  NRVPKDYSGWLASWTEWKILYFLCKDKNGLLHKETIRAVYDGSLFERMQEHRASARK  199



>ref|XP_010415753.1| PREDICTED: probable peroxygenase 4 [Camelina sativa]
Length=190

 Score =   195 bits (495),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 124/176 (70%), Gaps = 0/176 (0%)
 Frame = +1

Query  115  DETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKL  294
            +E   L++HV FFD N+DGI+YP ETFQGFR IG G+ LS   S FI++ LS ++RPGK 
Sbjct  14   EEDNFLQRHVSFFDRNKDGIVYPSETFQGFRAIGCGYALSTFASMFINMGLSRQTRPGKG  73

Query  295  PSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLR  474
             S  FPI ++NI L  HGSDSG YD++G FV SK EEIF K+ HT+++ALT +E+ ELL 
Sbjct  74   FSLSFPIEVKNIHLAKHGSDSGVYDKDGRFVASKFEEIFTKHAHTHSDALTKEELKELLN  133

Query  475  DKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPK  642
              ++P D  G +LA  EW+ LY L KD  GLL KE V  VYDGSLF++L K+ A K
Sbjct  134  ANKEPIDRKGGILAYAEWKGLYDLCKDKNGLLQKETVRAVYDGSLFEKLEKQRANK  189



>ref|XP_010932570.1| PREDICTED: probable peroxygenase 5 [Elaeis guineensis]
Length=237

 Score =   195 bits (495),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 117/170 (69%), Gaps = 0/170 (0%)
 Frame = +1

Query  118  ETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLP  297
            + T L+KHV+FFD N+DGIIYPWETF+GFR IG G  LS   +  I+  +  K+R GK+P
Sbjct  56   DLTALQKHVVFFDRNKDGIIYPWETFRGFRAIGCGVALSTVSAVVINGFIGPKTRTGKIP  115

Query  298  SPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRD  477
            SP+ PI ++NI    HGSDSG YD EG FV  K EEIF K+ HT  NALTSKE+ E+L+ 
Sbjct  116  SPLLPIHVKNIHKGKHGSDSGVYDNEGRFVPEKFEEIFKKHAHTNPNALTSKELKEMLQA  175

Query  478  KRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAK  627
             R P D  GW+ +  EW++LY L KD  GLL K+ +  VYDGSLF Q+ K
Sbjct  176  NRVPKDCGGWIASWAEWKILYALCKDKDGLLHKDTMRAVYDGSLFLQMEK  225



>ref|XP_010687656.1| PREDICTED: probable peroxygenase 5 [Beta vulgaris subsp. vulgaris]
Length=206

 Score =   194 bits (492),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 116/168 (69%), Gaps = 0/168 (0%)
 Frame = +1

Query  130  LKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVF  309
            L KHV FFD N DGIIYPWETF+GFR IG G  LS   +  I+I +S K+RPG+ PS +F
Sbjct  20   LAKHVAFFDRNHDGIIYPWETFKGFRAIGSGLLLSTVAAFVINIGISHKTRPGRFPSLLF  79

Query  310  PIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDP  489
            PI I+NI    HGSDSG YD EG FV+ K E IF+KY  +  NALT+KE+DE+L+  R+P
Sbjct  80   PIEIKNIAKVKHGSDSGVYDTEGRFVQPKFEAIFSKYARSNANALTAKELDEMLKANREP  139

Query  490  NDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEH  633
             D+ G   A +EW+V + L KD  GLL ++ + GVYDGS+F+ +  E 
Sbjct  140  KDFAGRFGAYLEWKVCFSLCKDKNGLLQRDTIRGVYDGSIFEMMENER  187



>ref|XP_007153267.1| hypothetical protein PHAVU_003G020800g [Phaseolus vulgaris]
 gb|ESW25261.1| hypothetical protein PHAVU_003G020800g [Phaseolus vulgaris]
Length=205

 Score =   193 bits (490),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 120/173 (69%), Gaps = 0/173 (0%)
 Frame = +1

Query  118  ETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLP  297
            E   L+KH  FFD N+DG+IYPWETFQG R+IG G  L+   + FI++ LS  +RPGK P
Sbjct  28   EENVLQKHAAFFDRNKDGLIYPWETFQGMREIGSGILLATGGAIFINVFLSGSTRPGKFP  87

Query  298  SPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRD  477
            S +FPI I+NI+   HGSD+GAYD EG FV SK E IF+K+ HT  N LT  E+ E+++ 
Sbjct  88   SLLFPIEIKNIQRGKHGSDTGAYDTEGRFVPSKFEAIFSKHAHTNPNYLTYDELKEMIKA  147

Query  478  KRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHA  636
             R+P D  G + + +EW VLY +AKD  GLL K+ +  VYDG+LF+QL K+ +
Sbjct  148  NREPKDLAGRIGSFVEWSVLYKVAKDKNGLLQKDAIRAVYDGTLFEQLKKQRS  200



>ref|XP_002893270.1| hypothetical protein ARALYDRAFT_472583 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69529.1| hypothetical protein ARALYDRAFT_472583 [Arabidopsis lyrata subsp. 
lyrata]
Length=209

 Score =   192 bits (489),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 126/173 (73%), Gaps = 0/173 (0%)
 Frame = +1

Query  118  ETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLP  297
            E T L+KHV FFD N+DG +YPWET+QGFR +G G  L+  ++ FI++ LS K+RPGK  
Sbjct  26   ELTALEKHVSFFDRNKDGTVYPWETYQGFRALGTGRLLAAFVAIFINMGLSQKTRPGKRF  85

Query  298  SPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRD  477
            SP+FPI ++N  L +HGSD+  YD +G FVESK EEIF K+  T+  ALT++E+ ++L+ 
Sbjct  86   SPLFPIDVKNSHLCMHGSDTDVYDDDGRFVESKFEEIFKKHARTHKGALTAEEIQKMLKT  145

Query  478  KRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHA  636
             RDP D  GW+    EW++L+ LAKD  GLL+K+ V  +YDGSLF++L K+++
Sbjct  146  NRDPFDITGWLSDYGEWKILHNLAKDKNGLLSKDSVRDIYDGSLFEKLEKKNS  198



>ref|NP_173738.2| caleosin-7 [Arabidopsis thaliana]
 sp|B3H7A9.1|PXG7_ARATH RecName: Full=Probable peroxygenase 7; Short=AtPXG7; AltName: 
Full=Caleosin-7 [Arabidopsis thaliana]
 gb|AEE30361.1| probable peroxygenase 5 [Arabidopsis thaliana]
Length=210

 Score =   192 bits (489),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 130/186 (70%), Gaps = 0/186 (0%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            +AS   +    +G    ++ T L+KHV FFD N+DG +YPWET+QGFR +G G  L+  +
Sbjct  8    LASKAKSPKPKRGKLDKEKMTALEKHVSFFDRNKDGTVYPWETYQGFRALGTGRLLAAFV  67

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
            + FI++ LS K+RPGK  SP+FPI ++N  L +HGSD+  YD +G FVESK EEIFNK+ 
Sbjct  68   AIFINMGLSKKTRPGKGFSPLFPIDVKNSHLCMHGSDTDVYDDDGRFVESKFEEIFNKHA  127

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
             T+ +ALT++E+ ++L+  RDP D  GW+    EW++L+ LA+D  GLL+++ V  +YDG
Sbjct  128  RTHKDALTAEEIQKMLKTNRDPFDITGWLSDYGEWKILHTLAQDKNGLLSEKSVRAIYDG  187

Query  604  SLFDQL  621
            SLF QL
Sbjct  188  SLFHQL  193



>ref|XP_009103187.1| PREDICTED: probable peroxygenase 7 [Brassica rapa]
Length=203

 Score =   191 bits (485),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 127/189 (67%), Gaps = 0/189 (0%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            MA S ++    +G   ++  T L+KHV FFD N DG+IYPWET+ GFR +G G   S   
Sbjct  1    MAPSAASSNNKEGESGEEGYTALEKHVAFFDRNGDGVIYPWETYHGFRALGLGRLPSAIA  60

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
              FI++ LS K+RPGK  S +FPI ++N +  +HGS + AYD+ G FVESK EEIF K+ 
Sbjct  61   GLFINMGLSKKTRPGKGFSLLFPIEVKNSRFCIHGSVTEAYDKNGRFVESKFEEIFKKHA  120

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
             ++ NALT KE+ +LL+  RDP D+ GW+ A  EW++LY L KD  GLLT+E V G +DG
Sbjct  121  RSHRNALTYKELLQLLKSNRDPGDFGGWIAAYGEWKLLYELCKDEDGLLTREAVKGAFDG  180

Query  604  SLFDQLAKE  630
            S+F +L KE
Sbjct  181  SIFRKLEKE  189



>emb|CDX68336.1| BnaA07g23760D [Brassica napus]
Length=231

 Score =   192 bits (487),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 132/198 (67%), Gaps = 2/198 (1%)
 Frame = +1

Query  49   FPLYYMASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFF  228
            FP   +  ++S  P  K + ++D    L++HV FFD N+DGI+YP ET+QGFR IG G+ 
Sbjct  33   FPCLSLIMASSASPGVKFVPEEDNF--LQRHVAFFDRNKDGIVYPSETYQGFRAIGCGYL  90

Query  229  LSVALSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEI  408
            LS   S FI++ LSSK+RPGK  S  FPI ++NI L  HGSDSG YD++G FV SK EEI
Sbjct  91   LSAFASLFINMGLSSKTRPGKGFSFSFPIEVKNIHLAKHGSDSGVYDKDGRFVASKFEEI  150

Query  409  FNKYGHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVI  588
            F K+  T+ +ALT +E+ +LL   ++PND  G +    EW++L+ L KD  GLL KE V 
Sbjct  151  FAKHSKTHPDALTGEELKQLLNANKEPNDRKGAIAGYTEWKMLHYLCKDKNGLLHKETVR  210

Query  589  GVYDGSLFDQLAKEHAPK  642
              YDGSLF+QL K+ A K
Sbjct  211  AAYDGSLFEQLEKQTASK  228



>ref|XP_008803896.1| PREDICTED: probable peroxygenase 5 [Phoenix dactylifera]
Length=202

 Score =   191 bits (485),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 114/168 (68%), Gaps = 0/168 (0%)
 Frame = +1

Query  124  TPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSP  303
            T L+KHV FFD N+DG+IYPWETFQGFR IG G  LS   +  I+  +  K+RPGK+PSP
Sbjct  26   TALQKHVAFFDRNKDGVIYPWETFQGFRAIGCGVALSTVSAVLINGFIGPKTRPGKVPSP  85

Query  304  VFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKR  483
            + PI ++NI    HGSDSG YD EG FV  K E+IF K+  T  NALTSKE+ E+L+  R
Sbjct  86   LLPIYVKNIHKGKHGSDSGVYDSEGRFVPEKFEQIFKKHARTNPNALTSKELKEMLQTNR  145

Query  484  DPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAK  627
             P D MG + +  EW++L+ L KD  GLL K+    VYDGSLF ++ K
Sbjct  146  TPKDCMGRIASWTEWKILFTLCKDKDGLLHKDTTRAVYDGSLFLEMEK  193



>emb|CDY12477.1| BnaC07g13170D [Brassica napus]
Length=203

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 125/189 (66%), Gaps = 0/189 (0%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            MA S ++    +G   ++  T L+KHV FFD N DG+IYPWET+QGFR IG G   S   
Sbjct  1    MAPSAASSNTKEGESGEEGYTALEKHVAFFDRNGDGVIYPWETYQGFRAIGVGRLPSAIA  60

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
              FI++ LS K+RPGK  S +FPI ++N    +HGS +  YD+ G FVESK EEIF K+ 
Sbjct  61   GLFINMGLSQKTRPGKGFSLLFPIEVKNSHFCIHGSVTEVYDKNGRFVESKFEEIFKKHA  120

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
             ++ NALT KE+ + L+  RDP D+ GW+ A  EW++LY L KD  GLLT+E V G +DG
Sbjct  121  RSHRNALTYKELLQFLKSNRDPGDFGGWIAAYGEWKLLYELCKDEDGLLTREAVKGAFDG  180

Query  604  SLFDQLAKE  630
            S+F +L KE
Sbjct  181  SIFRKLEKE  189



>emb|CDY25777.1| BnaA07g10050D [Brassica napus]
Length=203

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 126/189 (67%), Gaps = 0/189 (0%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            MA S ++    +G   ++  T L+KHV FFD N DG+IYPWET+ GFR +G G   S   
Sbjct  1    MAPSAASSNNKEGESGEEGYTALEKHVAFFDRNGDGVIYPWETYHGFRALGLGRLPSAIA  60

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
              FI++ LS K+RPGK  S +FPI ++N    +HGS + AYD+ G FVESK EEIF K+ 
Sbjct  61   GLFINMGLSKKTRPGKGFSLLFPIEVKNSHFCIHGSVTEAYDKNGRFVESKFEEIFKKHA  120

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
             ++ NALT KE+ +LL+  RDP D+ GW+ A  EW++LY L KD  GLLT+E V G +DG
Sbjct  121  RSHRNALTYKELLQLLKSNRDPGDFGGWIAAYGEWKLLYELCKDEDGLLTREAVKGAFDG  180

Query  604  SLFDQLAKE  630
            S+F +L KE
Sbjct  181  SIFRKLEKE  189



>ref|XP_009104946.1| PREDICTED: probable peroxygenase 4 [Brassica rapa]
Length=192

 Score =   189 bits (481),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 131/193 (68%), Gaps = 4/193 (2%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            MASS S  P  K + ++D    L++HV FFD N+DGI+YP ET+QGFR IG G+ LS   
Sbjct  1    MASSAS--PGVKFVPEEDNF--LQRHVAFFDRNKDGIVYPSETYQGFRAIGCGYLLSAFA  56

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
            S FI++ LSSK+RPGK  +  FPI ++NI L  HGSDSG YD++G FV SK EEIF K+ 
Sbjct  57   SMFINMGLSSKTRPGKGFTFSFPIEVKNIHLAKHGSDSGVYDKDGRFVASKFEEIFAKHS  116

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
             T+ +ALT +E+ +LL   ++PND  G +    EW++L+ L KD  GLL KE V   YDG
Sbjct  117  KTHPDALTGEELKQLLNANKEPNDRKGAIAGYTEWKMLHYLCKDKNGLLHKETVRAAYDG  176

Query  604  SLFDQLAKEHAPK  642
            SLF+QL K+ A K
Sbjct  177  SLFEQLEKQTASK  189



>ref|NP_001117339.1| caleosin-7 [Arabidopsis thaliana]
 gb|AAM62877.1| unknown [Arabidopsis thaliana]
 gb|AEE30363.1| probable peroxygenase 5 [Arabidopsis thaliana]
Length=184

 Score =   189 bits (480),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 122/166 (73%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  TPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSP  303
            T L+KHV FFD N+DG +YPWET+QGFR +G G  L+  ++ FI++ LS K+RPGK  SP
Sbjct  2    TALEKHVSFFDRNKDGTVYPWETYQGFRALGTGRLLAAFVAIFINMGLSKKTRPGKGFSP  61

Query  304  VFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKR  483
            +FPI ++N  L +HGSD+  YD +G FVESK EEIFNK+  T+ +ALT++E+ ++L+  R
Sbjct  62   LFPIDVKNSHLCMHGSDTDVYDDDGRFVESKFEEIFNKHARTHKDALTAEEIQKMLKTNR  121

Query  484  DPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQL  621
            DP D  GW+    EW++L+ LA+D  GLL+++ V  +YDGSLF QL
Sbjct  122  DPFDITGWLSDYGEWKILHTLAQDKNGLLSEKSVRAIYDGSLFHQL  167



>gb|KFK41485.1| hypothetical protein AALP_AA2G136700 [Arabis alpina]
Length=194

 Score =   188 bits (478),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 128/190 (67%), Gaps = 0/190 (0%)
 Frame = +1

Query  73   STSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTF  252
            S+S    G  +   +E   LKKHV FFD N+DGIIYP ETF+G R IG G+ +S   S F
Sbjct  2    SSSVSSTGGEVVLSEEENFLKKHVAFFDRNKDGIIYPSETFEGLRAIGCGYLVSTFASLF  61

Query  253  IHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTY  432
            I+I  SS+SRPGK  S   PI ++N+ L  HGSDSGAYD +G FV SK EEIF  Y  T+
Sbjct  62   INIGFSSRSRPGKGFSWSLPIDVKNVHLARHGSDSGAYDHQGRFVPSKFEEIFANYAKTH  121

Query  433  TNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLF  612
             +ALT++E+ +LL  K++PND +G + A  EW++L  L +D  GLL K+ V GVYDG+LF
Sbjct  122  PDALTNEELKQLLNAKKEPNDRIGALSAYFEWKLLQHLCQDKNGLLQKDTVRGVYDGTLF  181

Query  613  DQLAKEHAPK  642
            +Q+ K++  K
Sbjct  182  EQMEKQNDSK  191



>emb|CDY23488.1| BnaC06g24570D [Brassica napus]
Length=198

 Score =   188 bits (478),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 122/176 (69%), Gaps = 0/176 (0%)
 Frame = +1

Query  115  DETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKL  294
            +E   L++HV FFD N+DGI+YP ET+QGFR IG G+ LS   S FI++ LSSK+RPGK 
Sbjct  20   EEDNFLQRHVAFFDRNKDGIVYPSETYQGFRAIGCGYLLSAFASLFINMGLSSKTRPGKG  79

Query  295  PSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLR  474
             S  FPI ++NI L  HGSDSG YD++G FV SK EE+F K+  T+ +ALT +E+ +LL 
Sbjct  80   FSFSFPIEVKNIHLAKHGSDSGVYDKDGRFVASKFEEMFAKHSKTHPDALTGEELKQLLN  139

Query  475  DKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPK  642
              ++PND  G +    EW++L+ L KD  GLL KE V   YDGSLF+QL K+ A K
Sbjct  140  ANKEPNDRKGAIAGYTEWKMLHYLCKDKNGLLHKETVRAAYDGSLFEQLEKQTASK  195



>ref|XP_008658722.1| PREDICTED: ABA-induced protein isoform X1 [Zea mays]
Length=217

 Score =   188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 117/177 (66%), Gaps = 2/177 (1%)
 Frame = +1

Query  118  ETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLP  297
            E TPL++HV FFD N+DG+IYP ET+QGFR IG G  LS   S FI+ +L  K+ P    
Sbjct  35   ELTPLQRHVAFFDRNKDGVIYPAETYQGFRAIGAGVTLSAFSSVFINGLLGPKTIPENEK  94

Query  298  SPVF--PIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELL  471
            +P F  PI ++NI+   HGSDSG YD  G FV  K EEIF K+ HT  +ALT KE+ ELL
Sbjct  95   APAFKLPIYVKNIQKGKHGSDSGVYDANGRFVAEKFEEIFKKHAHTRPDALTGKELKELL  154

Query  472  RDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPK  642
            +  R+PND+ GW+    EW++LY L KD KG L K+ V  VYDGSLF+ L +E   K
Sbjct  155  KANREPNDFKGWLGGFTEWKMLYSLCKDEKGFLHKDTVRAVYDGSLFEMLERERNAK  211



>ref|NP_001151879.1| ABA-induced protein [Zea mays]
 gb|ACG44737.1| ABA-induced protein [Zea mays]
 gb|AFW85158.1| ABA-induced protein [Zea mays]
Length=216

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 117/177 (66%), Gaps = 2/177 (1%)
 Frame = +1

Query  118  ETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLP  297
            E TPL++HV FFD N+DG+IYP ET+QGFR IG G  LS   S FI+ +L  K+ P    
Sbjct  34   ELTPLQRHVAFFDRNKDGVIYPAETYQGFRAIGAGVTLSAFSSVFINGLLGPKTIPENEK  93

Query  298  SPVF--PIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELL  471
            +P F  PI ++NI+   HGSDSG YD  G FV  K EEIF K+ HT  +ALT KE+ ELL
Sbjct  94   APAFKLPIYVKNIQKGKHGSDSGVYDANGRFVAEKFEEIFKKHAHTRPDALTGKELKELL  153

Query  472  RDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPK  642
            +  R+PND+ GW+    EW++LY L KD KG L K+ V  VYDGSLF+ L +E   K
Sbjct  154  KANREPNDFKGWLGGFTEWKMLYSLCKDEKGFLHKDTVRAVYDGSLFEMLERERNAK  210



>gb|KFK41480.1| hypothetical protein AALP_AA2G136200 [Arabis alpina]
Length=190

 Score =   187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 127/191 (66%), Gaps = 2/191 (1%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            MASS S+   G    ++D    L++H  FFD N DGIIYP ET+QG R IG G+  S   
Sbjct  1    MASSISSASTGVKFVQEDNI--LQRHAAFFDRNNDGIIYPSETYQGLRAIGCGYVFSAVA  58

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
            S  I+I LSSK+RPGK  S  FPI I+NI L  HGSD+ AYD++G FV SK EEIF K+ 
Sbjct  59   SVIINIGLSSKTRPGKGFSWSFPIEIKNIHLAKHGSDTDAYDKDGRFVASKFEEIFAKHA  118

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
             T+ +ALT++E+ +LL+  ++PND  G   A  EW++LY L KD  GLL K+ +  VYDG
Sbjct  119  KTHPDALTNEELKQLLKANKEPNDPRGAFAACTEWKLLYHLCKDKNGLLHKDSMRAVYDG  178

Query  604  SLFDQLAKEHA  636
            S+F++L K+ A
Sbjct  179  SIFEKLEKQRA  189



>gb|EPS70602.1| hypothetical protein M569_04163, partial [Genlisea aurea]
Length=171

 Score =   186 bits (472),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 115/173 (66%), Gaps = 3/173 (2%)
 Frame = +1

Query  124  TPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSP  303
            + L+KHV+FFD + DGIIYP ETF+GFR IG G  LS   + FIH+ LS K+RPGK  SP
Sbjct  1    SALQKHVLFFDRDGDGIIYPSETFRGFRAIGSGVLLSSVAAAFIHLALSRKTRPGKGFSP  60

Query  304  VFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKR  483
             FPI + NI +  H SDSG YD  G     K EEIF ++  T+ +ALT  EV+  ++  R
Sbjct  61   SFPIEVSNITMGKHSSDSGVYDEHGR---QKFEEIFARHARTHRDALTGSEVEGFMKSNR  117

Query  484  DPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPK  642
            +P+DY GWV A  EW++LYLL KD  GLL K +V G  DG+LF ++ KE + K
Sbjct  118  EPSDYGGWVAALAEWKILYLLCKDENGLLHKHKVRGALDGTLFQEMEKEVSAK  170



>ref|XP_006390855.1| hypothetical protein EUTSA_v10019146mg [Eutrema salsugineum]
 gb|ESQ28141.1| hypothetical protein EUTSA_v10019146mg [Eutrema salsugineum]
Length=203

 Score =   186 bits (472),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 120/171 (70%), Gaps = 0/171 (0%)
 Frame = +1

Query  115  DETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKL  294
            +E   L++HV FFD N+DGI+YP ETFQGFR IG G+ LS A S FI++ LSSK+RPGK 
Sbjct  22   EEDNFLQRHVAFFDRNKDGIVYPSETFQGFRAIGCGYLLSGAASLFINMGLSSKTRPGKG  81

Query  295  PSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLR  474
             S  FPI ++NI L  H SDSG YD +G FVESK EEIF K+  T+ +ALT++E+ ELL 
Sbjct  82   FSFSFPIEVKNIHLAKHTSDSGVYDTDGRFVESKFEEIFAKHSKTHPDALTNEELKELLN  141

Query  475  DKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAK  627
              ++ ND  G   A  EW++L+ L KD  GLL K+ V  VYDGSLF++L K
Sbjct  142  ANKEANDRKGAFAAFTEWKILHYLCKDKNGLLHKDTVRAVYDGSLFEKLEK  192



>ref|XP_004498263.1| PREDICTED: probable peroxygenase 4-like [Cicer arietinum]
Length=200

 Score =   186 bits (471),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 125/201 (62%), Gaps = 12/201 (6%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            MA S+S        +++ +   L+KHV FFD N DGI+YPWETFQGFR IG G  LS   
Sbjct  1    MAPSSSRN----NKQEEQDQNVLRKHVAFFDMNNDGIVYPWETFQGFRAIGCGLILSSVA  56

Query  244  STFIHIVLSSKSRPGKLPSPVFPIV--------IENIKLDLHGSDSGAYDREGNFVESKI  399
            + FI++ LS K+RP  + S              ++NI+   HGSDSG YD EG FV SK 
Sbjct  57   AIFINLGLSQKTRPVFITSLFIIFFPFIFLIIEVKNIQKAKHGSDSGVYDSEGRFVPSKF  116

Query  400  EEIFNKYGHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKE  579
            EEIF K+   + NALTS E+  +L+  R+P DY GW+ +  EW++LY+L KD  GLL KE
Sbjct  117  EEIFKKHAKKHPNALTSDELMGMLKANREPKDYKGWLASYTEWKILYVLCKDKDGLLHKE  176

Query  580  RVIGVYDGSLFDQLAKEHAPK  642
             +  VYDGSLF+ + KEH+ K
Sbjct  177  TIRAVYDGSLFEHMEKEHSQK  197



>ref|XP_010552682.1| PREDICTED: probable peroxygenase 4 [Tarenaya hassleriana]
Length=198

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 126/195 (65%), Gaps = 0/195 (0%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            MAS +S    G G    ++   L++HV FFD N DG++YP ET++GFR IG G  LS   
Sbjct  1    MASDSSPSNGGGGRFVPEKDNFLQRHVAFFDLNGDGVVYPSETYKGFRSIGCGVPLSAFA  60

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
            + FI++ LS K+RPGK  S  FPI ++NI L  HGSDSG YD++G FVE K EEIF K+ 
Sbjct  61   AVFINVGLSRKTRPGKKFSLKFPIEVKNIHLAKHGSDSGVYDKDGRFVEPKFEEIFEKHA  120

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
             T+ +ALTS E+ +LL+  R+P D  GW+    EW++LY L KD  GLL K+ V  VYDG
Sbjct  121  RTHPDALTSDELKQLLKANREPKDRAGWLAGFTEWKILYSLGKDKNGLLHKDTVRSVYDG  180

Query  604  SLFDQLAKEHAPKIK  648
            S F+ L +  +  +K
Sbjct  181  SFFEHLKERRSSSLK  195



>gb|KFK41479.1| hypothetical protein AALP_AA2G136100 [Arabis alpina]
Length=200

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 118/166 (71%), Gaps = 0/166 (0%)
 Frame = +1

Query  115  DETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKL  294
            +E   L++HV FFD N+DGI+YP ET+QGFR IG G+ LS   S FI++ LSSK+RPGK 
Sbjct  17   EEDNFLQRHVAFFDRNKDGIVYPSETYQGFRAIGCGYLLSAFASVFINMGLSSKTRPGKG  76

Query  295  PSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLR  474
             S  FPI ++NI L  HGSDSG YD++G FV SK EEIF K+  T+ +ALT+ E+ +LL 
Sbjct  77   FSWSFPIEVKNIHLAKHGSDSGVYDKDGRFVASKFEEIFAKHAKTHHDALTNDELKQLLN  136

Query  475  DKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLF  612
             +++PND  G + A  EW+VL+ L KD  GLL K+ V  VYDGSLF
Sbjct  137  SRKEPNDRKGAIAAYSEWKVLHYLCKDKNGLLHKDTVRAVYDGSLF  182



>ref|XP_010917507.1| PREDICTED: probable peroxygenase 4 [Elaeis guineensis]
Length=204

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 120/184 (65%), Gaps = 1/184 (1%)
 Frame = +1

Query  94   GKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSS  273
             +G     + TPL+KHV FFD N+DG+IYP ET++GFR IG G  LS   S  IH  LS 
Sbjct  21   AQGENNGTDMTPLQKHVSFFDRNKDGVIYPKETYEGFRAIGFGVTLSSLSSVLIHGFLSP  80

Query  274  KSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSK  453
            K+  G +P+ + PI++ NI+   HGSD+GAYD  G FV  K EEIF K+ HT  NALTS 
Sbjct  81   KTNNGTIPATLLPILVANIQNGKHGSDTGAYDTTGRFVPEKFEEIFQKHAHTNPNALTSD  140

Query  454  EVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQL-AKE  630
            E+ E+L+  + PND  GWV +  EW +L+ L KD  GLL K+ V  VYDGSLF +L A+ 
Sbjct  141  ELKEMLKANQQPNDTQGWVASQTEWEILFSLVKDKDGLLQKDTVRLVYDGSLFYKLEAER  200

Query  631  HAPK  642
             +PK
Sbjct  201  KSPK  204



>ref|XP_002438178.1| hypothetical protein SORBIDRAFT_10g009170 [Sorghum bicolor]
 gb|EER89545.1| hypothetical protein SORBIDRAFT_10g009170 [Sorghum bicolor]
Length=213

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 116/173 (67%), Gaps = 2/173 (1%)
 Frame = +1

Query  118  ETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLP  297
            E TPL++HV FFD N+DGIIYP ET+QGFR IG G  LS   S FI+ +L  K+ P    
Sbjct  30   ELTPLQRHVAFFDRNKDGIIYPSETYQGFRAIGAGVPLSAFSSVFINGLLGPKTVPENEK  89

Query  298  SPVF--PIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELL  471
            +P F  PI ++NI+   HGSDSG YD  G FV  K EEIF K+ HT  +ALT KE+ ELL
Sbjct  90   APAFKLPIYVKNIQKGKHGSDSGVYDANGRFVPEKFEEIFKKHAHTRPDALTGKELKELL  149

Query  472  RDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKE  630
            +  R+PND+ GW+    EW+VLY L KD KG L K+ V  VYDGSLF++L  E
Sbjct  150  KANREPNDFKGWLGGFTEWKVLYSLCKDEKGFLHKDTVRAVYDGSLFEKLEHE  202



>gb|EAY89082.1| hypothetical protein OsI_10569 [Oryza sativa Indica Group]
 dbj|BAH01599.1| unnamed protein product [Oryza sativa Japonica Group]
Length=240

 Score =   184 bits (468),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 92/205 (45%), Positives = 134/205 (65%), Gaps = 4/205 (2%)
 Frame = +1

Query  19   KEIISNQPPKFPLYYMASSTS----TKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPW  186
            +++  N   + P  Y+A + +    + P G         + L++H  FFD N DGIIYPW
Sbjct  29   RKLNPNLQEQLPKPYLARALAAVDPSHPQGTRGRDARGMSVLQQHAAFFDRNGDGIIYPW  88

Query  187  ETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAY  366
            ETFQG R IG G+ +S+A +  I++VLS  ++PG +PSP+F I I+NI    HGSDS AY
Sbjct  89   ETFQGLRAIGCGYPVSIAGAILINLVLSYPTQPGWMPSPLFSIHIKNIHKGKHGSDSEAY  148

Query  367  DREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLL  546
            D EG F  SK + IF+KYG T+ NALT  E++ +++  R+  D++GW+ +A EW +LY +
Sbjct  149  DTEGRFDPSKFDAIFSKYGRTHPNALTKDELNSMIKANRNMYDFIGWITSAGEWMLLYSV  208

Query  547  AKDGKGLLTKERVIGVYDGSLFDQL  621
            AKD +GLL +E V G +DGSLF++L
Sbjct  209  AKDKEGLLQRETVRGAFDGSLFERL  233



>ref|XP_004965152.1| PREDICTED: probable peroxygenase 4-like [Setaria italica]
Length=205

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 117/177 (66%), Gaps = 2/177 (1%)
 Frame = +1

Query  118  ETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLP  297
            E TPL++HV FFD ++DG+IYP ET+QGFR IG G  LS   + FI+ +L  K+ P    
Sbjct  23   ELTPLQRHVAFFDRDKDGVIYPSETYQGFRAIGAGVPLSAFSALFINGLLGPKTIPENDK  82

Query  298  SPVF--PIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELL  471
            +P F  PI ++NI+   HGSDSG YD  G FV  K EEIF K+ HT  +ALT KE+ ELL
Sbjct  83   APAFKLPIYVKNIQKGKHGSDSGVYDANGRFVPEKFEEIFKKHAHTRPDALTGKELQELL  142

Query  472  RDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPK  642
            +  R+P D+ GW+    EW+VLY L KD KG L K+ V  VYDGSLF++L KE   K
Sbjct  143  KANREPKDFKGWLGGFTEWKVLYSLCKDEKGFLHKDTVRAVYDGSLFERLEKERKSK  199



>gb|AAN05334.1| Putative abscisic acid-induced protein - rice [Oryza sativa Japonica 
Group]
 gb|ABF94710.1| caleosin, putative, expressed [Oryza sativa Japonica Group]
Length=271

 Score =   185 bits (469),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 126/186 (68%), Gaps = 0/186 (0%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            +A+   + P G         + L++H  FFD N DGIIYPWETFQG R IG G+ +S+A 
Sbjct  79   LAAVDPSHPQGTRGRDARGMSVLQQHAAFFDRNGDGIIYPWETFQGLRAIGCGYPVSIAG  138

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
            +  I++VLS  ++PG +PSP+F I I+NI    HGSDS AYD EG F  SK + IF+KYG
Sbjct  139  AILINLVLSYPTQPGWMPSPLFSIHIKNIHKGKHGSDSEAYDTEGRFDPSKFDAIFSKYG  198

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
             T+ NALT  E++ +++  R+  D++GW+ +A EW +LY +AKD +GLL +E V G +DG
Sbjct  199  RTHPNALTKDELNSMIKANRNMYDFIGWITSAGEWMLLYSVAKDKEGLLQRETVRGAFDG  258

Query  604  SLFDQL  621
            SLF++L
Sbjct  259  SLFERL  264



>ref|XP_004985162.1| PREDICTED: peroxygenase-like isoform X2 [Setaria italica]
Length=239

 Score =   183 bits (464),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 124/196 (63%), Gaps = 4/196 (2%)
 Frame = +1

Query  46   KFPLYYMASSTS----TKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKI  213
            + P  Y+A +      + P G         + L++H  FFD N DGIIYPWETFQG R I
Sbjct  37   QLPKPYLARALEAVDPSHPQGTKGRDSRGLSVLQQHAAFFDRNGDGIIYPWETFQGLRAI  96

Query  214  GGGFFLSVALSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVES  393
            G G  +SV  S  I++VLS  ++PG LPSP+F I I+NI    HGSDS AYD EG F  S
Sbjct  97   GCGLPVSVVGSILINLVLSYPTQPGWLPSPLFSIHIKNIHKGKHGSDSEAYDTEGRFDPS  156

Query  394  KIEEIFNKYGHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLT  573
            K + IF+KYG T+ NALT  E++ +L   R+  D++GW  AA EW +LY +AKD  GLL 
Sbjct  157  KFDAIFSKYGRTHPNALTKDELNSMLEGNRNMYDFLGWATAAGEWLLLYSVAKDKDGLLQ  216

Query  574  KERVIGVYDGSLFDQL  621
            +E V G +DGSLF++L
Sbjct  217  RETVRGAFDGSLFERL  232



>ref|XP_008775947.1| PREDICTED: probable peroxygenase 4 [Phoenix dactylifera]
Length=175

 Score =   181 bits (458),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 112/170 (66%), Gaps = 0/170 (0%)
 Frame = +1

Query  124  TPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSP  303
            TPL+KHV FFD N+DG+IYP ET++GFR IG    LS   +  IH  LS K+  G LP+ 
Sbjct  2    TPLQKHVSFFDRNKDGVIYPTETYEGFRAIGCSVALSAVSAPLIHAFLSPKTNNGSLPAI  61

Query  304  VFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKR  483
              PI++  I    HGSDSGAYD EG FV  K EEIF K+ HT  +ALTS E+ E+L+  +
Sbjct  62   TLPIIVAIIAKGKHGSDSGAYDTEGMFVPEKFEEIFQKHAHTNPDALTSDELKEMLKANQ  121

Query  484  DPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEH  633
             PND  GW+ +  EW +L L+AKD  GLL K+ V  V+DGSLF +L  ++
Sbjct  122  QPNDRQGWIASRTEWEILLLVAKDKDGLLQKDTVRSVFDGSLFYKLEADN  171



>ref|XP_004985161.1| PREDICTED: peroxygenase-like isoform X1 [Setaria italica]
Length=271

 Score =   183 bits (465),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 123/193 (64%), Gaps = 14/193 (7%)
 Frame = +1

Query  85   KPY-GKGMEKDDETTP-------------LKKHVMFFDSNQDGIIYPWETFQGFRKIGGG  222
            KPY  + +E  D + P             L++H  FFD N DGIIYPWETFQG R IG G
Sbjct  72   KPYLARALEAVDPSHPQGTKGRDSRGLSVLQQHAAFFDRNGDGIIYPWETFQGLRAIGCG  131

Query  223  FFLSVALSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIE  402
              +SV  S  I++VLS  ++PG LPSP+F I I+NI    HGSDS AYD EG F  SK +
Sbjct  132  LPVSVVGSILINLVLSYPTQPGWLPSPLFSIHIKNIHKGKHGSDSEAYDTEGRFDPSKFD  191

Query  403  EIFNKYGHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKER  582
             IF+KYG T+ NALT  E++ +L   R+  D++GW  AA EW +LY +AKD  GLL +E 
Sbjct  192  AIFSKYGRTHPNALTKDELNSMLEGNRNMYDFLGWATAAGEWLLLYSVAKDKDGLLQRET  251

Query  583  VIGVYDGSLFDQL  621
            V G +DGSLF++L
Sbjct  252  VRGAFDGSLFERL  264



>tpg|DAA44135.1| TPA: caleosin [Zea mays]
Length=243

 Score =   181 bits (460),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 116/171 (68%), Gaps = 0/171 (0%)
 Frame = +1

Query  130  LKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVF  309
            L++H  FFD N DG+IYPWETFQG R IG G  +S A S  I++ LS  ++PG LPSP+ 
Sbjct  70   LQQHAAFFDRNGDGVIYPWETFQGLRAIGCGLTVSFAFSILINLFLSYPTQPGWLPSPLL  129

Query  310  PIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDP  489
             I I+NI    HGSDS  YD EG F  SK + +F+KYG T+ NALT  E+  +L+  R+ 
Sbjct  130  SIRIDNIHKGKHGSDSETYDTEGRFDPSKFDAVFSKYGRTHPNALTKDELSSMLQGNRNT  189

Query  490  NDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPK  642
             D++GW+ AA EW +LY LAKD  GLL +E V G++DGSLF++L  ++  K
Sbjct  190  YDFLGWLAAAGEWLLLYSLAKDKDGLLQRETVRGLFDGSLFERLEDDNNKK  240



>ref|NP_001151906.1| caleosin [Zea mays]
 gb|ACG44892.1| caleosin [Zea mays]
Length=243

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 116/171 (68%), Gaps = 0/171 (0%)
 Frame = +1

Query  130  LKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVF  309
            L++H  FFD N DG+IYPWETFQG R IG G  +S A S  I++ LS  ++PG LPSP+ 
Sbjct  70   LQQHAAFFDRNGDGVIYPWETFQGLRAIGCGLTVSFAFSILINLFLSYPTQPGWLPSPLL  129

Query  310  PIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDP  489
             I I+NI    HGSDS  YD EG F  SK + IF+KYG T+ NA+T  E+  +L+  R+ 
Sbjct  130  SIRIDNIHKGKHGSDSETYDTEGRFDPSKFDAIFSKYGRTHPNAITRDELSSMLQGNRNT  189

Query  490  NDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPK  642
             D++GW+ AA EW +LY LAKD  GLL +E V G++DGSLF++L  ++  K
Sbjct  190  YDFLGWLAAAGEWLLLYSLAKDKDGLLQRETVRGLFDGSLFERLEDDNNKK  240



>ref|XP_008680206.1| PREDICTED: caleosin isoform X1 [Zea mays]
Length=278

 Score =   182 bits (461),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 125/200 (63%), Gaps = 14/200 (7%)
 Frame = +1

Query  85   KPY-GKGMEKDDETTP-------------LKKHVMFFDSNQDGIIYPWETFQGFRKIGGG  222
            KPY  + +E  D + P             L++H  FFD N DG+IYPWETFQG R IG G
Sbjct  76   KPYLARALEAVDPSHPQGTKGRDPRGMSVLQQHAAFFDRNGDGVIYPWETFQGLRAIGCG  135

Query  223  FFLSVALSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIE  402
              +S A S  I++ LS  ++PG LPSP+  I I+NI    HGSDS  YD EG F  SK +
Sbjct  136  LTVSFAFSILINLFLSYPTQPGWLPSPLLSIRIDNIHKGKHGSDSETYDTEGRFDPSKFD  195

Query  403  EIFNKYGHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKER  582
             +F+KYG T+ NALT  E+  +L+  R+  D++GW+ AA EW +LY LAKD  GLL +E 
Sbjct  196  AVFSKYGRTHPNALTKDELSSMLQGNRNTYDFLGWLAAAGEWLLLYSLAKDKDGLLQRET  255

Query  583  VIGVYDGSLFDQLAKEHAPK  642
            V G++DGSLF++L  ++  K
Sbjct  256  VRGLFDGSLFERLEDDNNKK  275



>gb|EMT24935.1| hypothetical protein F775_30239 [Aegilops tauschii]
Length=211

 Score =   178 bits (452),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 116/172 (67%), Gaps = 2/172 (1%)
 Frame = +1

Query  118  ETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLP  297
            E TPL+KH  FFD+N+DGIIYP ET++G R IG G  +S A S FI+  L+SK+ P  + 
Sbjct  28   ELTPLQKHAAFFDTNRDGIIYPSETYRGLRAIGCGVLVSAAGSVFINGFLASKTVPANVK  87

Query  298  SPVF--PIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELL  471
             P F  PI ++ I+   HGSD+  YD +G FV  K EEIF K+ HT  +ALT KE+ E+L
Sbjct  88   PPAFKFPIYVKTIQQGKHGSDTDVYDIQGRFVPEKFEEIFKKHAHTRPDALTDKELGEML  147

Query  472  RDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAK  627
            +  RDP D+ G V A +EW++LY L KD +G L KE V  VYDGS+F++L +
Sbjct  148  KANRDPKDFSGRVGAFVEWKLLYALCKDKEGFLHKETVKAVYDGSVFEKLER  199



>ref|XP_004965154.1| PREDICTED: probable peroxygenase 4-like [Setaria italica]
Length=213

 Score =   178 bits (452),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 114/173 (66%), Gaps = 2/173 (1%)
 Frame = +1

Query  118  ETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRP--GK  291
            E TPL++HV FFD ++DG+IYP ET+QGFR IG G  LS A + FI+  L   ++P   K
Sbjct  30   ELTPLQRHVAFFDRDKDGVIYPSETYQGFRAIGCGVALSAASAVFINAGLGPSTKPENQK  89

Query  292  LPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELL  471
             P   FPI ++NI    HGSDSG YD  G +V  K EEIF K+ HT  +ALT KE+ E+L
Sbjct  90   TPPFKFPIYVKNIHKGKHGSDSGVYDANGRWVPEKFEEIFKKHAHTKPDALTGKELQEML  149

Query  472  RDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKE  630
            +  R+P D+ GW+    EW+VLY L KD  G L K+ V  VYDGSLF++L +E
Sbjct  150  QANREPKDFKGWLGGLTEWKVLYSLCKDKDGFLHKDTVRAVYDGSLFERLEQE  202



>gb|AAS48644.1| putative ABA-induced protein [Cynodon dactylon]
Length=208

 Score =   178 bits (451),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 122/197 (62%), Gaps = 8/197 (4%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKD------DETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGF  225
            MA+ +S K    G E         E TPL++HV FFD N+DG+IYP ET++GFR IG G 
Sbjct  1    MAAKSSEKGSNNGKESSMADVYRGELTPLQRHVAFFDRNKDGVIYPAETYEGFRAIGAGV  60

Query  226  FLSVALSTFIHIVLSSKSRPG--KLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKI  399
             LS   + F++  L  K+ P   K+    FPI ++NI    HGSDSG YD  G FV  K 
Sbjct  61   PLSAVGAAFVNGFLGPKTIPENEKVGPFKFPIYVKNILKGKHGSDSGVYDAHGRFVPEKF  120

Query  400  EEIFNKYGHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKE  579
            EEIF K+ HT  +ALT+KE+ ELL+  R+P D+ GW+    EW+VLY L KD  G L K+
Sbjct  121  EEIFKKHAHTRPDALTAKELQELLQANREPKDFRGWLGGFTEWKVLYALCKDKDGFLHKD  180

Query  580  RVIGVYDGSLFDQLAKE  630
             V  VYDGSLFD++ +E
Sbjct  181  TVKAVYDGSLFDKMEQE  197



>gb|AHV78311.1| caleosin [Triticum aestivum]
Length=212

 Score =   177 bits (449),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 126/201 (63%), Gaps = 12/201 (6%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDD----------ETTPLKKHVMFFDSNQDGIIYPWETFQGFRKI  213
            MAS ++    G+  EK++          E TPL+KHV FFD N+DG+I+P ET++GFR I
Sbjct  1    MASKSAVTAGGQPKEKEEPSSMADVYNHELTPLQKHVAFFDRNKDGVIHPSETYEGFRAI  60

Query  214  GGGFFLSVALSTFIHIVLSSKSRPG--KLPSPVFPIVIENIKLDLHGSDSGAYDREGNFV  387
            G G  LS   + FI+ +L  K+ P   K+ +  FPI ++NI    HGSDSG YD  G FV
Sbjct  61   GCGVALSAFSAVFINGLLGPKTIPENMKVGAFKFPIYVKNIHKGKHGSDSGVYDANGRFV  120

Query  388  ESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGL  567
              K EEIF K+ HT  +ALT KE++ELL+  R+PND  G V    EW+VLY L KD +G 
Sbjct  121  PEKFEEIFKKHAHTRPDALTGKELNELLQANREPNDLKGRVGGFTEWKVLYSLCKDKEGF  180

Query  568  LTKERVIGVYDGSLFDQLAKE  630
            L KE V  VYDGSLF +L +E
Sbjct  181  LHKETVRAVYDGSLFVKLEQE  201



>ref|XP_008647470.1| PREDICTED: uncharacterized protein LOC100217206 isoform X3 [Zea 
mays]
 gb|ACR37856.1| unknown [Zea mays]
 gb|AFW76956.1| hypothetical protein ZEAMMB73_516673 [Zea mays]
Length=191

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 114/173 (66%), Gaps = 2/173 (1%)
 Frame = +1

Query  118  ETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKS-RPGKL  294
            E TPL++HV FFD N+DG+IYP ET+QGFR IG G  LS A + F++  L  K+    + 
Sbjct  8    ELTPLQRHVSFFDRNKDGVIYPSETYQGFRAIGCGVALSAAAAVFVNGGLGPKTVLENEK  67

Query  295  PSPV-FPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELL  471
            P+P  FPI ++NI    HGSDSG YD  G FV  K EEIF KY HT  +ALT KE+ E++
Sbjct  68   PAPFKFPIYVKNIHRGKHGSDSGVYDSNGRFVPEKFEEIFKKYAHTRPDALTGKELQEMM  127

Query  472  RDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKE  630
            +  R+P D  GW+    EW+VLY L KD  G L K+ V  VYDGSLF++L +E
Sbjct  128  KANREPKDLKGWLGGFTEWKVLYSLCKDKDGFLHKDTVRAVYDGSLFERLEQE  180



>ref|NP_001137036.1| uncharacterized protein LOC100217206 [Zea mays]
 gb|ACF83129.1| unknown [Zea mays]
Length=216

 Score =   177 bits (449),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 114/174 (66%), Gaps = 2/174 (1%)
 Frame = +1

Query  118  ETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKS-RPGKL  294
            E TPL++HV FFD N+DG+IYP ET+QGFR IG G  LS A + F++  L  K+    + 
Sbjct  33   ELTPLQRHVSFFDRNKDGVIYPSETYQGFRAIGCGVALSAAAAVFVNGGLGPKTVLENEK  92

Query  295  PSPV-FPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELL  471
            P+P  FPI ++NI    HGSDSG YD  G FV  K EEIF KY HT  +ALT KE+ E++
Sbjct  93   PAPFKFPIYVKNIHRGKHGSDSGVYDSNGRFVPEKFEEIFKKYAHTRPDALTGKELQEMM  152

Query  472  RDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEH  633
            +  R+P D  GW+    EW+VLY L KD  G L K+ V  VYDGSLF++L +E 
Sbjct  153  KANREPKDLKGWLGGFTEWKVLYSLCKDKDGFLHKDTVRAVYDGSLFERLEQER  206



>ref|XP_008647468.1| PREDICTED: uncharacterized protein LOC100217206 isoform X1 [Zea 
mays]
 ref|XP_008647469.1| PREDICTED: uncharacterized protein LOC100217206 isoform X1 [Zea 
mays]
 gb|ACG37810.1| ABA-induced protein [Zea mays]
 gb|AFW76953.1| ABA-induced protein isoform 1 [Zea mays]
 gb|AFW76954.1| ABA-induced protein isoform 2 [Zea mays]
Length=216

 Score =   177 bits (449),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 114/174 (66%), Gaps = 2/174 (1%)
 Frame = +1

Query  118  ETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKS-RPGKL  294
            E TPL++HV FFD N+DG+IYP ET+QGFR IG G  LS A + F++  L  K+    + 
Sbjct  33   ELTPLQRHVSFFDRNKDGVIYPSETYQGFRAIGCGVALSAAAAVFVNGGLGPKTVLENEK  92

Query  295  PSPV-FPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELL  471
            P+P  FPI ++NI    HGSDSG YD  G FV  K EEIF KY HT  +ALT KE+ E++
Sbjct  93   PAPFKFPIYVKNIHRGKHGSDSGVYDSNGRFVPEKFEEIFKKYAHTRPDALTGKELQEMM  152

Query  472  RDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEH  633
            +  R+P D  GW+    EW+VLY L KD  G L K+ V  VYDGSLF++L +E 
Sbjct  153  KANREPKDLKGWLGGFTEWKVLYSLCKDKDGFLHKDTVRAVYDGSLFERLEQER  206



>ref|XP_003563994.1| PREDICTED: probable peroxygenase 5 [Brachypodium distachyon]
Length=206

 Score =   176 bits (446),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 123/195 (63%), Gaps = 6/195 (3%)
 Frame = +1

Query  64   MAS-STSTKPYGKGMEKD---DETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFL  231
            MAS S +T+   K  E D    E TPL++HV FFD N+DGIIYP ET++GFR IG G  L
Sbjct  1    MASKSANTEGIKKESEADVYNSELTPLQRHVAFFDRNKDGIIYPSETYEGFRAIGCGVAL  60

Query  232  SVALSTFIHIVLSSKSRPG--KLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEE  405
            S   + FI+ +L  K+ P   K  +  FPI ++NI    HGSDSG YD  G FV  K EE
Sbjct  61   SAFSAVFINGLLGPKTIPENEKAAAFKFPIYVKNIHKGKHGSDSGVYDSHGRFVPEKFEE  120

Query  406  IFNKYGHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERV  585
            IF K+ HT  +ALT KE+ ELL+  R+PND  G V    EW+VLY L KD +G L KE V
Sbjct  121  IFKKHAHTRPDALTGKELQELLQANREPNDLKGRVGGFTEWKVLYSLCKDKEGYLHKETV  180

Query  586  IGVYDGSLFDQLAKE  630
              VYDGSLF +L +E
Sbjct  181  RAVYDGSLFVKLEQE  195



>ref|XP_003558469.2| PREDICTED: probable peroxygenase 3 [Brachypodium distachyon]
Length=293

 Score =   179 bits (453),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 113/164 (69%), Gaps = 0/164 (0%)
 Frame = +1

Query  130  LKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVF  309
            L++H  FFD N DG+IYPWETFQG R IG G+  SV  +  +H+VL+  ++PG +PSPV 
Sbjct  123  LQQHAAFFDRNGDGVIYPWETFQGLRAIGLGYASSVGTAMLLHLVLTYPTQPGWIPSPVL  182

Query  310  PIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDP  489
             I I+N+    HGSDS  YD EG F  SK + IF+K+G T  NALT  E++ +L+  R+ 
Sbjct  183  SIHIKNMHKGKHGSDSETYDTEGRFDPSKFDAIFSKFGQTRPNALTEDEINTMLKHNRNM  242

Query  490  NDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQL  621
             D++GW  A +EW+ LY +AKD +GLL +E V G +DGSLF++L
Sbjct  243  YDFLGWSAAILEWKTLYKVAKDKEGLLQREVVRGAFDGSLFERL  286



>ref|XP_008647467.1| PREDICTED: uncharacterized protein LOC100217206 isoform X2 [Zea 
mays]
 gb|ACR34618.1| unknown [Zea mays]
 gb|AFW76955.1| hypothetical protein ZEAMMB73_516673 [Zea mays]
Length=232

 Score =   176 bits (447),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 114/173 (66%), Gaps = 2/173 (1%)
 Frame = +1

Query  118  ETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKS-RPGKL  294
            E TPL++HV FFD N+DG+IYP ET+QGFR IG G  LS A + F++  L  K+    + 
Sbjct  49   ELTPLQRHVSFFDRNKDGVIYPSETYQGFRAIGCGVALSAAAAVFVNGGLGPKTVLENEK  108

Query  295  PSPV-FPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELL  471
            P+P  FPI ++NI    HGSDSG YD  G FV  K EEIF KY HT  +ALT KE+ E++
Sbjct  109  PAPFKFPIYVKNIHRGKHGSDSGVYDSNGRFVPEKFEEIFKKYAHTRPDALTGKELQEMM  168

Query  472  RDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKE  630
            +  R+P D  GW+    EW+VLY L KD  G L K+ V  VYDGSLF++L +E
Sbjct  169  KANREPKDLKGWLGGFTEWKVLYSLCKDKDGFLHKDTVRAVYDGSLFERLEQE  221



>gb|ABK21149.1| unknown [Picea sitchensis]
Length=188

 Score =   175 bits (444),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 115/176 (65%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  TPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSP  303
            T L++HV FFD N+DGIIYPWET+QGF+ IG    +S+  ++FI++ LS  +    +PSP
Sbjct  10   TALQQHVAFFDRNKDGIIYPWETYQGFQAIGFNMTISLLAASFINMALSYATSHSWIPSP  69

Query  304  VFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKR  483
             FPI ++NI+   HGSDS  YD EG FV +K + IF KY  TY + L+  E+  +L+  R
Sbjct  70   SFPIYVDNIQKGKHGSDSEVYDSEGGFVPAKFDAIFTKYACTYPDRLSYAEMQAMLKGNR  129

Query  484  DPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPKIKA  651
            D ND  G + A  EW  LY LAK+ +G L KE + G+YDGSLF+   K+H+   +A
Sbjct  130  DVNDTSGGIAAKTEWNFLYDLAKNKEGFLEKEAIRGLYDGSLFEYFEKQHSASAQA  185



>ref|NP_001057304.1| Os06g0254700 [Oryza sativa Japonica Group]
 dbj|BAD45232.1| putative calcium binding protein [Oryza sativa Japonica Group]
 dbj|BAD46173.1| putative calcium binding protein [Oryza sativa Japonica Group]
 dbj|BAF19218.1| Os06g0254700 [Oryza sativa Japonica Group]
 dbj|BAG93609.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96820.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80338.1| hypothetical protein OsI_22405 [Oryza sativa Indica Group]
Length=215

 Score =   176 bits (446),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 111/172 (65%), Gaps = 1/172 (1%)
 Frame = +1

Query  118  ETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLP  297
            E TPL+KHV FFD N+DGIIYP ET+QGFR IG G  LS   + FI+  L  K+ P    
Sbjct  37   ELTPLQKHVAFFDRNKDGIIYPSETYQGFRAIGAGVVLSAVGAVFINGGLGPKTIPENTK  96

Query  298  SPV-FPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLR  474
            + +  PI ++NI    HGSDSG YD  G FV  K EEIF K+ HT  +ALT KE+ ELL+
Sbjct  97   TGLKLPIYVKNIHKGKHGSDSGVYDANGRFVPEKFEEIFKKHAHTRPDALTDKELKELLQ  156

Query  475  DKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKE  630
              R+P D+ GW+    EW+VLY L KD  G L K+ V  VYDGSLF ++ +E
Sbjct  157  SNREPKDFKGWLGGFTEWKVLYYLCKDKDGFLHKDTVRAVYDGSLFAKMEQE  208



>ref|XP_002468253.1| hypothetical protein SORBIDRAFT_01g042490 [Sorghum bicolor]
 gb|EER95251.1| hypothetical protein SORBIDRAFT_01g042490 [Sorghum bicolor]
Length=274

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 120/193 (62%), Gaps = 14/193 (7%)
 Frame = +1

Query  85   KPY-GKGMEKDDETTP-------------LKKHVMFFDSNQDGIIYPWETFQGFRKIGGG  222
            KPY  + +E  D + P             L++H  FFD N DG+IYPWETFQG R IG G
Sbjct  74   KPYLARALEAVDPSHPQGTKGRDPRGMSVLQQHAAFFDRNGDGVIYPWETFQGLRAIGCG  133

Query  223  FFLSVALSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIE  402
            F LS   S  I++ LS  ++PG LPSP+  I I NI    HGSDS  YD EG F  SK +
Sbjct  134  FPLSFVGSILINLFLSYPTQPGWLPSPLLSIHINNIHKGKHGSDSETYDTEGRFDPSKFD  193

Query  403  EIFNKYGHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKER  582
             IF+KYG T+ NALT  E+  +L+  R+  D+ GW+ AA EW +LY LAKD  GLL +E 
Sbjct  194  AIFSKYGRTHPNALTRDELGSMLQGNRNTYDFPGWLAAAGEWLLLYSLAKDKDGLLQRET  253

Query  583  VIGVYDGSLFDQL  621
            V G++DGSLF++L
Sbjct  254  VRGLFDGSLFERL  266



>emb|CAE51349.1| calcium binding protein [Fagus sylvatica]
Length=204

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 107/149 (72%), Gaps = 0/149 (0%)
 Frame = +1

Query  130  LKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVF  309
            L+KHV FFD NQDGI+YP ETF+GFR IG G F S   + FI+  LS K+RPGK PS +F
Sbjct  27   LQKHVAFFDRNQDGIVYPSETFKGFRAIGCGIFFSAISAIFINFGLSQKTRPGKFPSLLF  86

Query  310  PIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDP  489
            PI ++NI+   HGSDSG YD EG FV SK EEIF+K+  +Y +ALTS E+ ++L++ R P
Sbjct  87   PIEVKNIQKAKHGSDSGVYDTEGRFVPSKFEEIFSKHALSYPSALTSDELMKMLKENRVP  146

Query  490  NDYMGWVLAAIEWRVLYLLAKDGKGLLTK  576
             DY GW+ +  EW+ LY+L KD K + T+
Sbjct  147  KDYRGWLASWAEWKTLYILCKDKKWVTTE  175



>ref|XP_004965153.1| PREDICTED: probable peroxygenase 4-like [Setaria italica]
Length=272

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 111/173 (64%), Gaps = 2/173 (1%)
 Frame = +1

Query  118  ETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRP--GK  291
            E TPL+ HV FFD ++DG+IYP ET+QGFR IG G  LS   + FI+  L  K+ P  GK
Sbjct  90   ELTPLQGHVAFFDRDKDGVIYPAETYQGFRAIGAGVALSAVAAVFINGGLGPKTIPENGK  149

Query  292  LPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELL  471
             P    PI ++NI    HGSDSG YD  G FV  K E +F K+ HT  +ALT  E+ ELL
Sbjct  150  TPRLKLPIYVKNIHKGKHGSDSGVYDANGRFVPEKFEAVFKKHAHTRPDALTGMELQELL  209

Query  472  RDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKE  630
            +  R+P D+ GW+    EW+VLY L KD +G L K+ V  VYDGSLF++L KE
Sbjct  210  QANREPKDFKGWLGGFTEWKVLYYLCKDKEGFLHKDTVRAVYDGSLFERLEKE  262



>gb|EMT26349.1| hypothetical protein F775_05056 [Aegilops tauschii]
Length=232

 Score =   174 bits (441),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 116/175 (66%), Gaps = 2/175 (1%)
 Frame = +1

Query  112  DDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPG-  288
            + E TPL+KHV FFD N+DG+I+P ET++GFR IG G  LS   + FI+ +L  K+ P  
Sbjct  47   NHELTPLQKHVAFFDRNKDGVIHPSETYEGFRAIGCGVALSAFSAVFINGLLGPKTIPEN  106

Query  289  -KLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDE  465
             K+ +  FPI ++NI    HGSDSG YD  G FV  K EEIF K+ HT  +ALT KE++E
Sbjct  107  MKVGAFKFPIYVKNIHKGKHGSDSGVYDANGRFVPEKFEEIFKKHAHTRPDALTGKELNE  166

Query  466  LLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKE  630
            LL+  R+PND  G V    EW+VLY L KD +G L KE V  VYDGSLF +L +E
Sbjct  167  LLQANREPNDLKGRVGGFTEWKVLYSLCKDKEGFLHKETVRAVYDGSLFVKLEQE  221



>ref|XP_006656852.1| PREDICTED: probable peroxygenase 4-like [Oryza brachyantha]
Length=219

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 111/172 (65%), Gaps = 1/172 (1%)
 Frame = +1

Query  118  ETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLP  297
            E TPL+KHV FFD N+DG+IYP ET++GFR IG G  LS   + FI+  L  K+ P    
Sbjct  41   EMTPLQKHVAFFDRNKDGVIYPSETYEGFRAIGAGVVLSAVSAVFINGGLGPKTIPENTK  100

Query  298  SPV-FPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLR  474
            + +  PI ++NI    HGSDSG YD  G F+  K EEIF K+ HT  +ALT KE+ ELL+
Sbjct  101  TGLKLPIYVKNIHKGKHGSDSGVYDESGRFIPEKFEEIFKKHAHTRPDALTDKELKELLQ  160

Query  475  DKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKE  630
              R+P D+ GW+    EW+VLY L KD  G L K+ V  VYDGSLF ++ +E
Sbjct  161  SNREPKDFKGWLGGFTEWKVLYYLCKDKDGFLHKDTVRAVYDGSLFVKMEQE  212



>gb|EMS61046.1| hypothetical protein TRIUR3_30363 [Triticum urartu]
Length=233

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 116/175 (66%), Gaps = 2/175 (1%)
 Frame = +1

Query  112  DDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPG-  288
            + E TPL+KHV FFD N+DG+I+P ET++GFR IG G  LS   + FI+ +L  K+ P  
Sbjct  48   NHELTPLQKHVAFFDRNKDGVIHPSETYEGFRAIGCGVALSAFSAVFINGLLGPKTIPEN  107

Query  289  -KLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDE  465
             K+ +  FPI ++NI    HGSDSG YD  G FV  K EEIF K+ HT  ++LT KE++E
Sbjct  108  MKVGAFKFPIYVKNIHKGKHGSDSGVYDANGRFVPEKFEEIFKKHAHTRPDSLTGKELNE  167

Query  466  LLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKE  630
            LL+  R+PND  G V    EW+VLY L KD +G L KE V  VYDGSLF +L +E
Sbjct  168  LLQANREPNDLKGRVGGFTEWKVLYSLCKDKEGFLHKETVRAVYDGSLFVKLEQE  222



>gb|ABK40508.1| pollen caleosin [Lilium longiflorum]
Length=239

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/195 (44%), Positives = 122/195 (63%), Gaps = 0/195 (0%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            +A+     P G    +    + L++   FFD N DGI+YPWET+QGFR +G G   S+  
Sbjct  43   LAAVDPAHPNGTEGHEHHNMSVLQQRAAFFDRNNDGIVYPWETYQGFRAVGFGVLTSILG  102

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
               I++ LS +S+P  +PSPV  I I+NI    HGSD+ +YD EG F  SK + IF+KY 
Sbjct  103  GFLINLGLSYRSQPSWIPSPVLSIHIKNIHRCKHGSDTESYDTEGRFEPSKFDAIFSKYA  162

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
             T  +ALTS+E+  +L+  R+  D++GWV +  EWR+LY + KD  GLL KE + G +DG
Sbjct  163  LTQPDALTSEEISTMLQVNRNLLDFIGWVASIAEWRLLYQIGKDEDGLLHKETIRGAFDG  222

Query  604  SLFDQLAKEHAPKIK  648
            SLF++L K+ A + K
Sbjct  223  SLFERLEKDRASRTK  237



>ref|NP_001168487.1| uncharacterized protein LOC100382264 [Zea mays]
 gb|ACN28384.1| unknown [Zea mays]
 tpg|DAA44133.1| TPA: hypothetical protein ZEAMMB73_982708 [Zea mays]
Length=235

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 115/164 (70%), Gaps = 0/164 (0%)
 Frame = +1

Query  130  LKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVF  309
            L++HV FFD N DG++YPWETF+G R IG GFF S+ +S  I++V+S  ++PG LPS + 
Sbjct  65   LQQHVAFFDRNGDGVVYPWETFKGMRAIGCGFFTSLVISFLINLVMSYPTQPGWLPSLLL  124

Query  310  PIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDP  489
             + ++NI    HGSDS  YD EG F  SK + IF+KYG T+ +ALT  E++ +L+  R+ 
Sbjct  125  SVHVKNIHKAKHGSDSETYDTEGRFDPSKFDAIFSKYGRTHPDALTKDEMNSMLKANRNI  184

Query  490  NDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQL  621
             D++GW+ A  EW +LY +AKD  GLL +E V G++D SLF++L
Sbjct  185  YDFLGWIAAIGEWHLLYSVAKDKDGLLQREIVRGLFDASLFERL  228



>ref|XP_002468254.1| hypothetical protein SORBIDRAFT_01g042500 [Sorghum bicolor]
 gb|EER95252.1| hypothetical protein SORBIDRAFT_01g042500 [Sorghum bicolor]
Length=232

 Score =   171 bits (434),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 118/186 (63%), Gaps = 0/186 (0%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            M +  +  P G         + L++HV FFD N DGI+YPWETF+G R IG GFF S+ +
Sbjct  40   MVAVDADHPNGTEGRDPRGMSVLQQHVAFFDRNGDGIVYPWETFKGMRAIGCGFFTSLVV  99

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
               I++V+S  ++PG LPS +  I I NI    HGSDS  YD EG F  SK + IF+KYG
Sbjct  100  GFLINLVMSYPTQPGWLPSLLLSIHIRNIHKAKHGSDSETYDTEGRFDPSKFDAIFSKYG  159

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
             T+ +ALT  E++ +L+  R+  D++GW+ A  EW +LY +AKD   LL +E V GV+D 
Sbjct  160  RTHPDALTKDEINLMLKANRNIYDFLGWIAAIAEWHLLYSVAKDKDDLLQREIVRGVFDA  219

Query  604  SLFDQL  621
            SLF++L
Sbjct  220  SLFERL  225



>ref|XP_006649654.1| PREDICTED: peroxygenase-like [Oryza brachyantha]
Length=268

 Score =   172 bits (436),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 115/164 (70%), Gaps = 0/164 (0%)
 Frame = +1

Query  130  LKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVF  309
            L++H  FFD + DG+I+PWETFQG R IG G+ +S A +  I++VLS  ++PG +PSP+ 
Sbjct  98   LQQHASFFDRDGDGVIHPWETFQGLRAIGCGYPVSFAGAILINLVLSYPTQPGWMPSPLL  157

Query  310  PIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDP  489
             I I+NI    HGSDS  YD EG F  SK + IF+KYG T  NALT  E++ +L+  R+ 
Sbjct  158  SIHIKNIHKGKHGSDSETYDTEGRFDPSKFDAIFSKYGRTQPNALTKDELNSMLKANRNM  217

Query  490  NDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQL  621
             D++GW+ +  EW +LY +AKD +GLL +E V GV+DGSLF++L
Sbjct  218  YDFIGWITSFGEWMLLYSVAKDKEGLLQREAVRGVFDGSLFERL  261



>ref|XP_010917509.1| PREDICTED: probable peroxygenase 5 [Elaeis guineensis]
Length=206

 Score =   170 bits (431),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 88/185 (48%), Positives = 118/185 (64%), Gaps = 3/185 (2%)
 Frame = +1

Query  97   KGMEKDDET--TPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLS  270
            KG ++++ T  T L+KHV FFD ++DG+IYP ETFQGFR IG    LS   +  IH  LS
Sbjct  22   KGQDQNNGTDMTALQKHVSFFDRDKDGVIYPIETFQGFRAIGCSIPLSTVSAPLIHAFLS  81

Query  271  SKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTS  450
             K+  G +P+   PI++ NI    HGSDSGAYD +G FV  K EEIF K+ H + +ALTS
Sbjct  82   PKTNNGSIPAIKLPIIVANIAKGKHGSDSGAYDTDGKFVPEKFEEIFQKHAHAHPDALTS  141

Query  451  KEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKE  630
             E+ E+L+  + P D  G   +  EW +L+ L KD  GLL KE +  V+DGSLF +L  E
Sbjct  142  DELKEMLKANQQPGDLPGSFASRTEWEILFSLVKDKDGLLQKETLRSVFDGSLFYKLEAE  201

Query  631  H-APK  642
            + +PK
Sbjct  202  NKSPK  206



>ref|XP_009613328.1| PREDICTED: probable peroxygenase 5 isoform X3 [Nicotiana tomentosiformis]
Length=152

 Score =   168 bits (426),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 112/193 (58%), Gaps = 44/193 (23%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            MASS+S +P   GM   DE TPL KHVMFFD N+DGIIYPWET+QG RK+G   F S+  
Sbjct  1    MASSSSLQP--DGMGNHDEPTPLGKHVMFFDINKDGIIYPWETYQGLRKLGHNIFRSLLA  58

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
            +  IH+VLS K+RPGK PS +FPIVI+NIK   HGSDS AYD EG               
Sbjct  59   AVLIHLVLSHKTRPGKWPSLLFPIVIKNIKYGKHGSDSDAYDAEGRLN------------  106

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
                                          A+ +WR+LY LAKD  G LTKE V  VYDG
Sbjct  107  ------------------------------ASTDWRILYDLAKDKNGELTKEAVRAVYDG  136

Query  604  SLFDQLAKEHAPK  642
            SLF+Q+A+E+A K
Sbjct  137  SLFEQMARENASK  149



>gb|AAF87020.1|AC005292_29 F26F24.9 [Arabidopsis thaliana]
Length=353

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 121/177 (68%), Gaps = 7/177 (4%)
 Frame = +1

Query  91   YGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLS  270
            Y  G    ++ T L+KHV FFD N+DG +YPWET+QG         L+  ++ FI++ LS
Sbjct  167  YDGGKLDKEKMTALEKHVSFFDRNKDGTVYPWETYQGR-------LLAAFVAIFINMGLS  219

Query  271  SKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTS  450
             K+RPGK  SP+FPI ++N  L +HGSD+  YD +G FVESK EEIFNK+  T+ +ALT+
Sbjct  220  KKTRPGKGFSPLFPIDVKNSHLCMHGSDTDVYDDDGRFVESKFEEIFNKHARTHKDALTA  279

Query  451  KEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQL  621
            +E+ ++L+  RDP D  GW+    EW++L+ LA+D  GLL+++ V  +YDGSLF QL
Sbjct  280  EEIQKMLKTNRDPFDITGWLSDYGEWKILHTLAQDKNGLLSEKSVRAIYDGSLFHQL  336


 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 100/185 (54%), Gaps = 42/185 (23%)
 Frame = +1

Query  124  TPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSP  303
            T L+KHV FFD N                   G F+S  ++ F ++ LS K+RP +L   
Sbjct  12   TALEKHVSFFDRN-------------------GRFMSAFVAVFFNMGLSQKTRPVQLFGY  52

Query  304  VFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKR  483
            + P+ ++     +  +D   YD++G FVESK EEIFNK+  T+ +ALT+KE+ ++L+  R
Sbjct  53   ILPLFLKPFVCTVVTTD--VYDKDGRFVESKFEEIFNKHARTHKDALTAKEIKQMLKTNR  110

Query  484  DPNDYMGWVLAA--------------------IEWRVLYLLAKDGKGLLTKERVIGVYDG  603
            +P D++GW +                      IEW++L+ LA+D  GLLT++ V GVYDG
Sbjct  111  EPYDFIGWFVVYKLNKLNYNHNVTYHSDFHYFIEWKILHTLAQDN-GLLTEDAVRGVYDG  169

Query  604  SLFDQ  618
               D+
Sbjct  170  GKLDK  174



>ref|XP_010917508.1| PREDICTED: probable peroxygenase 4 [Elaeis guineensis]
Length=173

 Score =   168 bits (425),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 105/171 (61%), Gaps = 24/171 (14%)
 Frame = +1

Query  118  ETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLP  297
            + TPL+KHV FFD N DG+IYPWETFQG                            GKLP
Sbjct  19   DLTPLQKHVAFFDRNNDGVIYPWETFQGI------------------------DFKGKLP  54

Query  298  SPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRD  477
            SP+ PI I+NI+   HGSDSG YD +G FV +K EE+F ++ HT  NALTSKE+DE+ + 
Sbjct  55   SPLLPIYIKNIQKGKHGSDSGVYDSDGRFVPAKFEEMFKRHAHTNPNALTSKELDEMRQA  114

Query  478  KRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKE  630
             R P DY GW  +  EW++L++L KD  GLL KE +  VYDGSLF  + KE
Sbjct  115  NRVPKDYKGWFASWTEWKILFVLCKDKDGLLHKETIRAVYDGSLFLTMEKE  165



>ref|XP_010909571.1| PREDICTED: probable peroxygenase 5 [Elaeis guineensis]
Length=205

 Score =   169 bits (427),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 112/169 (66%), Gaps = 0/169 (0%)
 Frame = +1

Query  124  TPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSP  303
            T L+KHV FFD ++DG+IY  ET++GFR +G G   S A S  I+  LS K+  G + S 
Sbjct  27   TALQKHVSFFDRDKDGVIYLQETYEGFRALGFGVAFSSAASVLINGFLSPKTNDGSISSF  86

Query  304  VFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKR  483
              P++++NI+  +HGSD+GAYD EG FV  K EEIF K+ HT  NALTS E++E+L   +
Sbjct  87   SLPVLVDNIQKGIHGSDTGAYDTEGRFVSEKFEEIFQKHAHTNPNALTSDELNEMLEANQ  146

Query  484  DPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKE  630
             PND+ G V +  EW  L+ LAKD  GLL ++ +  VYDGSLF +L  E
Sbjct  147  QPNDFQGRVASHSEWDSLFSLAKDNNGLLQRDTIRSVYDGSLFYKLEGE  195



>ref|XP_010556916.1| PREDICTED: probable peroxygenase 3 [Tarenaya hassleriana]
Length=237

 Score =   169 bits (429),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 88/193 (46%), Positives = 117/193 (61%), Gaps = 0/193 (0%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            + ++ +  P G    ++   + L++HV FFD + DGI+YPWETF GFR++G    +SV  
Sbjct  40   LVAADTDNPEGAKEHENKGMSVLQQHVAFFDQDGDGIVYPWETFSGFRQLGFNVVISVLA  99

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
            + FI++ LS  + PG LPS + PI I NI    HGSDSG+YD EG F+    E +F+KY 
Sbjct  100  AIFINLTLSYPTSPGWLPSLMLPIYISNIHKAKHGSDSGSYDTEGRFMAMNHENMFSKYS  159

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
                + LT KEV  L    R   D  GWV A  EW  LYLLAKD +G L+KE V GV+DG
Sbjct  160  RVIPDKLTFKEVWNLTEGNRVAYDIFGWVAAKGEWIFLYLLAKDEEGFLSKEAVRGVFDG  219

Query  604  SLFDQLAKEHAPK  642
            SLF+  AK +  K
Sbjct  220  SLFEFCAKRNKAK  232



>gb|AHV78312.1| caleosin [Triticum aestivum]
Length=232

 Score =   169 bits (427),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 117/186 (63%), Gaps = 0/186 (0%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            MA+   + P G         + L++H  FFD N DG+IYPWETFQ  R IG G   +   
Sbjct  40   MAAVDPSHPEGSKGRDTKGMSVLQQHAAFFDRNGDGVIYPWETFQSLRAIGLGSPSAFGT  99

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
            S  +H+VL+  ++PG +PSP+  I I+NI    HGSDS  YD EG F  +K + IF+K+G
Sbjct  100  SILLHLVLTYPTQPGWMPSPLLSIHIKNIHRGKHGSDSETYDTEGRFEPAKFDAIFSKFG  159

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
             T  NAL+  E++ +L+  R+  D++GW  A +EW++L+ +AKD +G L +E V G +DG
Sbjct  160  KTRPNALSEDEINAMLKHNRNMYDFLGWAAANLEWKLLHKVAKDKEGFLQREIVRGAFDG  219

Query  604  SLFDQL  621
            SLF++L
Sbjct  220  SLFERL  225



>gb|ACJ70083.1| caleosin [Cycas revoluta]
Length=235

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 121/201 (60%), Gaps = 2/201 (1%)
 Frame = +1

Query  43   PKFPLYYMASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGG  222
            P  P   +A  T       G + ++ +  L++HV FFD N DGI+YPWET++GFR IG  
Sbjct  33   PFLPRALVAVDTEHLDGSPGHQHNNMSV-LQQHVAFFDRNHDGIVYPWETYEGFRAIGFN  91

Query  223  FFLSVALSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIE  402
              +S+  + FI+I LS  + PG +PS +FPI I  I    HGSDS  YD EG FV SK E
Sbjct  92   IVISLMSALFINIALSYLTLPGWIPSLLFPIHINRIHRAKHGSDSEVYDTEGRFVPSKFE  151

Query  403  EIFNKYGHTYTNALTSKEVDELLRD-KRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKE  579
            EIF KY     + LT  E+   L +  R+ ND  GW+ +  +W +LYLLAKD +G L KE
Sbjct  152  EIFTKYARVRPDRLTFSEILLALTEANRNANDPFGWLTSKAKWGLLYLLAKDDQGFLPKE  211

Query  580  RVIGVYDGSLFDQLAKEHAPK  642
             V GVYDGSLF+ L K+ + +
Sbjct  212  AVRGVYDGSLFELLEKQRSSR  232



>ref|XP_006420653.1| hypothetical protein CICLE_v10007170mg [Citrus clementina]
 gb|ESR33893.1| hypothetical protein CICLE_v10007170mg [Citrus clementina]
 gb|KDO57798.1| hypothetical protein CISIN_1g042070mg [Citrus sinensis]
Length=236

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 114/197 (58%), Gaps = 1/197 (1%)
 Frame = +1

Query  43   PKFPLYYMASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGG  222
            P  P   +A  T       G E ++ +  L++H  FFD + DGIIYPWETF+GFR IG  
Sbjct  33   PYVPRAVVAPDTENVKGTWGHEHNNMSV-LQQHAAFFDQDGDGIIYPWETFRGFRLIGFN  91

Query  223  FFLSVALSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIE  402
               S   S  +H+ +S  + P  LPSP FPI ++NI    HGSD+G YD EG +V    E
Sbjct  92   PIASFVFSFLVHMAMSYATSPTWLPSPFFPIYVQNIHKAKHGSDTGTYDTEGRYVPVNFE  151

Query  403  EIFNKYGHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKER  582
             IF+KY  T  + LT  E+  + +  R+  D  GW+ + +EW  LY+LAKD +G L+KE 
Sbjct  152  NIFSKYARTVPDKLTRAEIWHMTQSSRNAFDIFGWIASKLEWGALYILAKDDEGYLSKEA  211

Query  583  VIGVYDGSLFDQLAKEH  633
            V   +DGSLFD  AK H
Sbjct  212  VRRCFDGSLFDYCAKVH  228



>ref|XP_007147207.1| hypothetical protein PHAVU_006G104600g [Phaseolus vulgaris]
 gb|ESW19201.1| hypothetical protein PHAVU_006G104600g [Phaseolus vulgaris]
Length=240

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 108/174 (62%), Gaps = 0/174 (0%)
 Frame = +1

Query  109  KDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPG  288
            K ++ + L++HV FFD N DG++YPWET++GFR +G    LS   S  IH+ LS  + P 
Sbjct  58   KHNDMSVLQQHVSFFDLNNDGVVYPWETYKGFRALGFNMILSFVFSIVIHVALSYPTLPT  117

Query  289  KLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDEL  468
             LPSP FPI I NI    HGSDSG YD EG F  + +E IF+KY     + L+ +E+  +
Sbjct  118  WLPSPFFPIHIINIHKAKHGSDSGGYDTEGRFTPANLEFIFSKYARDVPDKLSLRELWHM  177

Query  469  LRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKE  630
                R   D+ GWV +  EW VLY+LAKD +G LTKE V   +DGSLF+  AK 
Sbjct  178  TEANRVAFDFFGWVASKFEWGVLYILAKDEQGYLTKEAVRRCFDGSLFEYCAKH  231



>ref|XP_010319446.1| PREDICTED: probable peroxygenase 5 isoform X2 [Solanum lycopersicum]
Length=159

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 100/148 (68%), Gaps = 0/148 (0%)
 Frame = +1

Query  199  GFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREG  378
             FRK+G G F S+  +  IH  LS K+RPGK PS +FPIV+ENIK  +HGSDSGAYD EG
Sbjct  12   AFRKMGRGIFRSMFSAVLIHFNLSYKTRPGKWPSLLFPIVVENIKYAIHGSDSGAYDSEG  71

Query  379  NFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDG  558
             FV  K EEIF K+ +   ++LT  EV E+L+  R P DY GW  A ++W  LY L K+ 
Sbjct  72   RFVPEKFEEIFKKHANENADSLTYNEVKEMLKTNRKPKDYYGWANAFVDWNSLYDLGKNK  131

Query  559  KGLLTKERVIGVYDGSLFDQLAKEHAPK  642
               LTKE V  +YDGSLF+Q+AKEHA K
Sbjct  132  NEKLTKETVKALYDGSLFEQIAKEHASK  159



>gb|EMS68550.1| hypothetical protein TRIUR3_33351 [Triticum urartu]
Length=193

 Score =   166 bits (420),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 116/186 (62%), Gaps = 0/186 (0%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            M++   + P G         + L++H  FFD N DG+IYPWETFQ  R IG G   +   
Sbjct  1    MSAVDPSHPEGSKGRDSKGMSVLQQHAAFFDRNGDGVIYPWETFQSLRAIGLGSPSAFGT  60

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
            S  +H+VL+  ++PG +PSP+  I I+NI    HGSDS  YD EG F  +K + IF+K+G
Sbjct  61   SILLHLVLTYPTQPGWMPSPLLSIHIKNIHRGKHGSDSETYDTEGRFEPAKFDAIFSKFG  120

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
             T  NAL+  E+  +L+  R+  D++GW  A +EW++L+ +AKD +G L +E V G +DG
Sbjct  121  KTRPNALSEDEIKAMLKHNRNMYDFLGWAAANLEWKLLHKVAKDKEGFLQREIVRGAFDG  180

Query  604  SLFDQL  621
            SLF++L
Sbjct  181  SLFERL  186



>ref|XP_007225860.1| hypothetical protein PRUPE_ppa011722mg [Prunus persica]
 gb|EMJ27059.1| hypothetical protein PRUPE_ppa011722mg [Prunus persica]
Length=145

 Score =   164 bits (415),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 91/131 (69%), Gaps = 0/131 (0%)
 Frame = +1

Query  115  DETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKL  294
            +E   L++HV FFD N DGI+YPWETFQGFR IG G  LS A S  I+  LS K+RPGK 
Sbjct  15   NEQDVLQRHVAFFDRNHDGIVYPWETFQGFRAIGCGILLSTASSFLINAALSQKTRPGKF  74

Query  295  PSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLR  474
            PSP+ PI ++NI    HGSDSG YD  G FV SK EEIF K+ HT+ +ALTS E+  +LR
Sbjct  75   PSPLLPIEVKNIHKAKHGSDSGVYDSHGRFVPSKFEEIFCKHAHTHLDALTSDELMGMLR  134

Query  475  DKRDPNDYMGW  507
              R+P DY GW
Sbjct  135  ANREPKDYAGW  145



>gb|ABK26053.1| unknown [Picea sitchensis]
Length=236

 Score =   167 bits (422),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 110/171 (64%), Gaps = 0/171 (0%)
 Frame = +1

Query  130  LKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVF  309
            L++HV FFD N+DGIIYPWET+QGFR IG    +S+    FI++ LS  +    +PS + 
Sbjct  63   LQQHVAFFDRNKDGIIYPWETYQGFRAIGFNIPISLVAGLFINLTLSYPTSSSWIPSLLL  122

Query  310  PIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDP  489
            PI I+NI    HGSDS  YD EG FV +K + IF+KY  T+ + LT  E+  +L+  R+ 
Sbjct  123  PIHIDNIHKGKHGSDSEVYDTEGRFVPAKFDAIFSKYACTFPDKLTYSELQAMLKANRNV  182

Query  490  NDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPK  642
            ND  GWV A  EW  LY LAK+ +G L KE +  +YDGSLF+   K++A +
Sbjct  183  NDLFGWVAARAEWSFLYNLAKNKEGFLEKEAMRALYDGSLFEYFEKQYASR  233



>ref|XP_010264909.1| PREDICTED: peroxygenase-like [Nelumbo nucifera]
Length=238

 Score =   167 bits (422),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/224 (39%), Positives = 125/224 (56%), Gaps = 17/224 (8%)
 Frame = +1

Query  7    SQNSKEIISNQPP-------------KFPLYYMASSTST----KPYGKGMEKDDETTPLK  135
            S ++   ++NQ P               P  YMA + +      P G    K +  + L+
Sbjct  5    SNDAMATVANQAPVTLERRVRDDLETSLPKPYMARALAAPDKEHPEGTLGHKHNSMSVLQ  64

Query  136  KHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVFPI  315
            +H  FFD + DGIIYPWET+ G R +G     S  ++  +++ LS  + PG +PS  FPI
Sbjct  65   QHAAFFDQDGDGIIYPWETYAGLRAVGFNAIASFIMAIVVNLSLSYNTLPGWMPSFRFPI  124

Query  316  VIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDPND  495
             I NI    HGSDSGAYD EG FV + +E +F+KY  T+ + LT +E+ ++    R+  D
Sbjct  125  YIRNIHKSKHGSDSGAYDTEGRFVPANLENMFSKYARTHPDKLTLRELWDMTEANRNAFD  184

Query  496  YMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAK  627
            + GWV + +EW VLY+LA+D  G LTKE     +DGSLF+  AK
Sbjct  185  FFGWVASKLEWGVLYVLARDDDGFLTKEAARRCFDGSLFEYCAK  228



>dbj|BAD16161.1| putative caleosin [Oryza sativa Japonica Group]
Length=217

 Score =   166 bits (420),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 106/167 (63%), Gaps = 0/167 (0%)
 Frame = +1

Query  124  TPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSP  303
            T L+KHV FFDSN DGII   ET++GFR +G G   S   +T I+  L +K+RP    + 
Sbjct  40   TELQKHVAFFDSNHDGIISFSETYEGFRALGFGVVTSRFSATVINGALGTKTRPENATAS  99

Query  304  VFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKR  483
             F I IENI   +HGSD+GA+D EG FV  K +EIF K+  T  + LT+ E+DE+LR  R
Sbjct  100  RFSIYIENIHKGVHGSDTGAFDSEGRFVNEKFDEIFTKHAKTVPDGLTAAELDEMLRANR  159

Query  484  DPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLA  624
            +P DY GWV A+ EW   + L KD  G L K+ V  VYDGS F ++A
Sbjct  160  EPKDYKGWVGASTEWETTFKLGKDKDGFLRKDTVRTVYDGSFFSKVA  206



>ref|XP_010455214.1| PREDICTED: probable peroxygenase 3 isoform X1 [Camelina sativa]
Length=247

 Score =   167 bits (422),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 112/185 (61%), Gaps = 0/185 (0%)
 Frame = +1

Query  94   GKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSS  273
            G    K  + + L++HV FFD + DGIIYPWETF+GFR +G     S+ L+  +H+ +S 
Sbjct  52   GTTGHKHQDMSVLQQHVAFFDQDGDGIIYPWETFRGFRALGFNVVSSLFLTLIVHLTMSY  111

Query  274  KSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSK  453
             + P  +PS  FPI I+NI    HGSD+  YD EG ++ S +E +F+KY  T  + LT  
Sbjct  112  ATMPTWMPSYTFPIYIKNIHRAKHGSDTSTYDTEGRYIPSNLENMFSKYARTVPDKLTRF  171

Query  454  EVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEH  633
            E+ ++    R+  D+ GW  + +EW VLYLLAKD  G L+KE V   +DGSLFD  AK  
Sbjct  172  ELWQMTEANRNAFDFFGWAASTMEWGVLYLLAKDENGYLSKEAVRRCFDGSLFDYCAKAR  231

Query  634  APKIK  648
            A   K
Sbjct  232  ASAKK  236



>ref|XP_009334188.1| PREDICTED: peroxygenase-like [Pyrus x bretschneideri]
Length=241

 Score =   166 bits (421),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 84/210 (40%), Positives = 123/210 (59%), Gaps = 4/210 (2%)
 Frame = +1

Query  19   KEIISNQPPKFPLYYM----ASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPW  186
            + + S+   K P  YM     +  +  P G    +    + L++H+ FFD + +GI+YPW
Sbjct  25   RRVRSDLETKLPKPYMPRALVAPDTNHPTGTVGHQHRNMSVLQQHIAFFDQDDNGIVYPW  84

Query  187  ETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAY  366
            ETF G R IG    ++V ++  I+  +S  + PG +PSP FPI I NI    HGSDSG Y
Sbjct  85   ETFTGCRAIGFNPIVAVFMAVLINGAMSYPTLPGWIPSPFFPIYIYNIHKAKHGSDSGTY  144

Query  367  DREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLL  546
            D EG +  + IE +F+KY HT  +  T  E+  +    R P D+ GW+ + +EW +LY+L
Sbjct  145  DTEGRYSPANIENMFSKYAHTVPDKFTLGELWAMTEGNRVPLDFFGWITSKLEWGLLYVL  204

Query  547  AKDGKGLLTKERVIGVYDGSLFDQLAKEHA  636
            A+D +GLL+KE V   +DGSLFD  AK +A
Sbjct  205  ARDEEGLLSKEAVRRCFDGSLFDYCAKMNA  234



>gb|EMT05409.1| hypothetical protein F775_31641 [Aegilops tauschii]
Length=221

 Score =   166 bits (420),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 83/170 (49%), Positives = 110/170 (65%), Gaps = 1/170 (1%)
 Frame = +1

Query  124  TPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSP  303
            T L+KH  FFD ++DG++   ET+  FR +G GF  S   +TFI+ VL  ++RP +  + 
Sbjct  43   TALQKHAAFFDGDKDGVVTFSETYAAFRALGFGFAASTLSATFINGVLGPQTRP-ENDTA  101

Query  304  VFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKR  483
               I IENI   +HGSDSGAYD +G FV  K+E  F K+G T  +ALTS EVDEL+   R
Sbjct  102  RMSIYIENIHKGIHGSDSGAYDSQGRFVPDKLEAAFAKHGKTVPDALTSAEVDELITANR  161

Query  484  DPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEH  633
             P+DY GW  A+ EW++LY + KD  GLL KE   GVYDGSLF ++ +E 
Sbjct  162  QPSDYAGWAGASAEWKLLYSIGKDKDGLLRKEDARGVYDGSLFARVVQER  211



>gb|KCW60248.1| hypothetical protein EUGRSUZ_H02961, partial [Eucalyptus grandis]
Length=202

 Score =   165 bits (417),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 115/188 (61%), Gaps = 0/188 (0%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            + +  +  P+G    + +  T L++H  FFD + +GI+YPWET+ G R IG     S+ +
Sbjct  5    LKAPDTDHPHGTPGHRSNNLTVLQQHCAFFDQDGNGIVYPWETYVGLRAIGFNMIASLIM  64

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
            +  I++ LS  + PG  PSP FPI I+NI  D HGSD+G YD EG +V + +E +F+KY 
Sbjct  65   AIGINVGLSYPTLPGWFPSPFFPIYIDNIHKDKHGSDTGTYDTEGRYVPAHLENMFSKYA  124

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
             T  + +T  E+ ++    R+  D  GWV +  EW +LY+LA+D  G+L+KE V   YDG
Sbjct  125  RTVPDKMTLGELWDMTEGNRNTFDIFGWVASKFEWGILYILARDEDGMLSKEAVRRCYDG  184

Query  604  SLFDQLAK  627
            SLFD  AK
Sbjct  185  SLFDYCAK  192



>ref|XP_003573004.2| PREDICTED: probable peroxygenase 5 [Brachypodium distachyon]
Length=215

 Score =   165 bits (418),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 110/169 (65%), Gaps = 1/169 (1%)
 Frame = +1

Query  124  TPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSP  303
            T L+KH  FFDS++DG++   ET+  FR  G G   S   +TFI+  L  K+RP    S 
Sbjct  44   TELQKHAAFFDSDKDGVVSFSETYNAFRDFGFGITASTVSATFINGFLGPKTRPENETSR  103

Query  304  VFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKR  483
            +  + IENI   +HGSDSGAYD +G FV  K + IF+K+G T  +ALTS EVDEL+   R
Sbjct  104  L-SVYIENIHKGIHGSDSGAYDAQGRFVPEKFDAIFSKHGKTVPDALTSAEVDELISANR  162

Query  484  DPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKE  630
            +P+DY GW  A+ EW++LY + KD  GLL KE   GVYDGSLF +L +E
Sbjct  163  EPSDYAGWAGASAEWKILYSIGKDKDGLLRKEDARGVYDGSLFAKLVQE  211



>gb|KFK29187.1| hypothetical protein AALP_AA7G100900 [Arabis alpina]
Length=245

 Score =   166 bits (421),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 113/183 (62%), Gaps = 0/183 (0%)
 Frame = +1

Query  88   PYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVL  267
            PYG    K+   + L++HV FFD + +GIIYPWET+ G R +G     S+ ++ FI++ L
Sbjct  53   PYGTPGHKNYGLSVLQQHVAFFDIDDNGIIYPWETYSGLRMLGFNIIGSIIIAAFINLAL  112

Query  268  SSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALT  447
            S  + PG LPSP FPI I NI    HGSDS  YD EG F+   +E IF+KY  T  + L+
Sbjct  113  SYATLPGWLPSPFFPIYIHNIHKSKHGSDSKTYDNEGRFMPVNLELIFSKYAKTLPDKLS  172

Query  448  SKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAK  627
              E+ E+    RD  D  GW+   +EW +LYLLA+D +G L+KE +   +DGSLF+  AK
Sbjct  173  LGELWEMTEGNRDAFDIFGWIAGKVEWGLLYLLARDEEGFLSKEAIRRCFDGSLFEYCAK  232

Query  628  EHA  636
             +A
Sbjct  233  IYA  235



>ref|XP_007035235.1| Peroxygenase 2 isoform 1 [Theobroma cacao]
 gb|EOY06161.1| Peroxygenase 2 isoform 1 [Theobroma cacao]
Length=239

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 117/195 (60%), Gaps = 1/195 (1%)
 Frame = +1

Query  43   PKFPLYYMASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGG  222
            P  P   +AS T   P G    + ++ + L++HV FFD + +GI+YPWETF G R +G  
Sbjct  36   PYMPRALVASDTE-HPNGTPGHRHNQLSVLQQHVAFFDQDDNGIVYPWETFTGLRAMGFN  94

Query  223  FFLSVALSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIE  402
               S+ ++  I++ LS  + PG LPSP FP+ I NI    HGSDSG YD EG F    IE
Sbjct  95   PLASLVIAAVINVALSYVTLPGWLPSPFFPVYIHNIHRAKHGSDSGTYDTEGRFTPVYIE  154

Query  403  EIFNKYGHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKER  582
             +F+KY  T  +  T +E+  +    R   D+ GW+ + +EW +LY+LA+D +G+L+KE 
Sbjct  155  NMFSKYARTVPDKFTLREIWNMTEGNRQAFDFFGWIASKLEWGLLYVLARDEEGMLSKEA  214

Query  583  VIGVYDGSLFDQLAK  627
            V   +DGSLF+  A+
Sbjct  215  VRRCFDGSLFEYCAQ  229



>ref|XP_008460684.1| PREDICTED: peroxygenase [Cucumis melo]
Length=239

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 115/188 (61%), Gaps = 0/188 (0%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            + ++ S  P G    K    T L++HV FFD + +GI+YPWET+ G R IG    +S+A+
Sbjct  42   LVAADSNHPTGTVGHKHYGMTVLQQHVAFFDQDDNGIVYPWETYVGLRAIGFNMIMSLAM  101

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
            +  I+  +S +++ G +PSP FPI I NI  D HGSD+G YD EG ++ +  E IF+KY 
Sbjct  102  AVIINFAMSYRTQQGWIPSPFFPIYIHNIHRDKHGSDTGTYDTEGRYIAANFENIFSKYA  161

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
             T  + L+  E+ ++    R   D  GW+ + +EW +LY+LA+D  G L+KE V   YDG
Sbjct  162  RTQPDKLSLGEIWDMTEANRLAFDPYGWIASKLEWFILYVLARDEDGYLSKEAVRRCYDG  221

Query  604  SLFDQLAK  627
            SLF+  AK
Sbjct  222  SLFEYCAK  229



>ref|XP_010023857.1| PREDICTED: peroxygenase [Eucalyptus grandis]
Length=244

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 116/195 (59%), Gaps = 1/195 (1%)
 Frame = +1

Query  43   PKFPLYYMASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGG  222
            P  P    A  T   P+G    + +  T L++H  FFD + +GI+YPWET+ G R IG  
Sbjct  41   PYLPRALKAPDTD-HPHGTPGHRSNNLTVLQQHCAFFDQDGNGIVYPWETYVGLRAIGFN  99

Query  223  FFLSVALSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIE  402
               S+ ++  I++ LS  + PG  PSP FPI I+NI  D HGSD+G YD EG +V + +E
Sbjct  100  MIASLIMAIGINVGLSYPTLPGWFPSPFFPIYIDNIHKDKHGSDTGTYDTEGRYVPAHLE  159

Query  403  EIFNKYGHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKER  582
             +F+KY  T  + +T  E+ ++    R+  D  GWV +  EW +LY+LA+D  G+L+KE 
Sbjct  160  NMFSKYARTVPDKMTLGELWDMTEGNRNTFDIFGWVASKFEWGILYILARDEDGMLSKEA  219

Query  583  VIGVYDGSLFDQLAK  627
            V   YDGSLFD  AK
Sbjct  220  VRRCYDGSLFDYCAK  234



>gb|EEE57759.1| hypothetical protein OsJ_08287 [Oryza sativa Japonica Group]
Length=212

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 106/167 (63%), Gaps = 0/167 (0%)
 Frame = +1

Query  124  TPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSP  303
            T L+KHV FFDSN DGII   ET++GFR +G G   S   +T I+  L +K+RP    + 
Sbjct  35   TELQKHVAFFDSNHDGIISFSETYEGFRALGFGVVTSRFSATVINGALGTKTRPENATAS  94

Query  304  VFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKR  483
             F I IENI   +HGSD+GA+D EG FV  K +EIF K+  T  + LT+ E+DE+LR  R
Sbjct  95   RFSIYIENIHKGVHGSDTGAFDSEGRFVNEKFDEIFTKHAKTVPDGLTAAELDEMLRANR  154

Query  484  DPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLA  624
            +P DY GWV A+ EW   + L KD  G L K+ V  VYDGS F ++A
Sbjct  155  EPKDYKGWVGASTEWETTFKLGKDKDGFLRKDTVRTVYDGSFFSKVA  201



>gb|AHV78307.1| caleosin [Triticum aestivum]
Length=300

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 115/173 (66%), Gaps = 0/173 (0%)
 Frame = +1

Query  130  LKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVF  309
            L++HV FFD + +GIIYPWET++G R +G   F+S  ++  +++V+S  + PG LP+P+F
Sbjct  126  LQQHVAFFDRDNNGIIYPWETYEGCRAVGFNVFMSAFIAFLVNLVMSYPTLPGWLPNPLF  185

Query  310  PIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDP  489
            PI + NI    HGSDSG YD+EG F+    E IF+KY  TY + L+ +E+  +    R+ 
Sbjct  186  PIYVHNIHKSKHGSDSGTYDKEGRFMPVNFENIFSKYARTYPDRLSYRELWRMTEGSREV  245

Query  490  NDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPKIK  648
             D+ GWV   +EW +LY+LA+D +G L++E +  +YDGSLF+ + ++    +K
Sbjct  246  FDFFGWVAMKLEWSILYVLARDDEGYLSREAIRRMYDGSLFEYMERQRMEHVK  298



>ref|XP_010421718.1| PREDICTED: peroxygenase 2-like [Camelina sativa]
Length=238

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 112/185 (61%), Gaps = 0/185 (0%)
 Frame = +1

Query  94   GKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSS  273
            G    K  + + L++HV FFD + DGIIYPWETF+GFR +G     S+ L+  +H+ +S 
Sbjct  52   GTTGHKHQDMSVLQQHVAFFDQDGDGIIYPWETFRGFRALGFNVVSSLFLTLIVHLTMSY  111

Query  274  KSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSK  453
             + P  +PS  FPI I+NI    HGSD+  YD EG ++ + +E +F+KY  T  + LT  
Sbjct  112  ATMPTWMPSYTFPIYIKNIHRAKHGSDTSTYDTEGRYIPANLENMFSKYARTVPDKLTRF  171

Query  454  EVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEH  633
            E+ ++    R+  D+ GW  + +EW VLYLLAKD  G L+KE V   +DGSLFD  AK  
Sbjct  172  ELWQMTEANRNAFDFFGWAASKMEWGVLYLLAKDENGYLSKEAVRRCFDGSLFDYCAKAR  231

Query  634  APKIK  648
            A   K
Sbjct  232  ASAKK  236



>ref|XP_009614481.1| PREDICTED: peroxygenase-like [Nicotiana tomentosiformis]
Length=247

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 109/180 (61%), Gaps = 0/180 (0%)
 Frame = +1

Query  88   PYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVL  267
            P G    + +  + L++H  FFD + DGIIYPWET+ GFR++G     S  ++  IH  +
Sbjct  57   PNGTPGHRHNGMSVLQQHATFFDQDDDGIIYPWETYSGFRQLGFNMIGSFIMAIVIHSAM  116

Query  268  SSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALT  447
            S  + PG  PSP+ PI I NI    HGSDSG YDREG ++    E IF+KY  T  + LT
Sbjct  117  SYPTLPGWFPSPLLPIYIHNIHKCKHGSDSGTYDREGRYLPMHFENIFSKYARTVPDKLT  176

Query  448  SKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAK  627
              E+ ++ +  R+  D+ GW+   +EW +LYLLAKD  G L+KE +   +DGSLFD  AK
Sbjct  177  LGELWDMTQANREVFDFFGWIATKMEWGILYLLAKDEDGFLSKEAIRRCFDGSLFDYCAK  236



>gb|EAZ00895.1| hypothetical protein OsI_22926 [Oryza sativa Indica Group]
Length=222

 Score =   164 bits (415),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 120/192 (63%), Gaps = 2/192 (1%)
 Frame = +1

Query  52   PLYYMASS-TSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFF  228
            P+++ + +  +   YG+ +  D   T L+KH  FFD + DGI+   ET+ G R +G G  
Sbjct  22   PMFFGSHTPAAAAAYGE-VSGDAGVTALQKHAAFFDKDGDGIVSLSETYDGLRALGLGSG  80

Query  229  LSVALSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEI  408
            LS   + FI+ VLS K+RP    +P   I IENI   +HGSDS AYD EG FV  K EEI
Sbjct  81   LSSLSAAFINGVLSPKTRPDNGTAPRLSIYIENIYKGIHGSDSSAYDSEGRFVAEKFEEI  140

Query  409  FNKYGHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVI  588
            F K+  T  +ALTS E+DELL+  R P DY GWV A+ EW++LY + KD  GLL KE V 
Sbjct  141  FAKHAKTVPDALTSDEIDELLQANRKPGDYTGWVAASSEWKILYKIGKDKDGLLRKEAVR  200

Query  589  GVYDGSLFDQLA  624
             VYDGSLF +LA
Sbjct  201  EVYDGSLFTKLA  212



>gb|ABK23847.1| unknown [Picea sitchensis]
Length=236

 Score =   164 bits (416),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 110/176 (63%), Gaps = 0/176 (0%)
 Frame = +1

Query  115  DETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKL  294
            +  + L++HV FFD N+DGIIYPWET+QGFR IG    +S+    FI++ LS  +    +
Sbjct  58   NNMSVLQQHVAFFDRNKDGIIYPWETYQGFRAIGFNIPISLVAGLFINLTLSYPTSSSWI  117

Query  295  PSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLR  474
            PS + PI I+NI    HG DS  YD EG FV +K + IF KY  T+ + LT  E+  +L+
Sbjct  118  PSLLLPIHIDNIHKGKHGRDSEVYDTEGRFVPAKFDAIFGKYACTFPDKLTYSELQAMLK  177

Query  475  DKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPK  642
              R+ ND  GWV A  EW  LY LAK+ +G L KE +  +YDGSLF+   K++A +
Sbjct  178  ANRNVNDLFGWVAARAEWSFLYNLAKNKEGFLEKEAMRALYDGSLFEYFEKQYASR  233



>gb|KEH42680.1| caleosin CLO1-1 [Medicago truncatula]
Length=241

 Score =   164 bits (416),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 90/223 (40%), Positives = 123/223 (55%), Gaps = 8/223 (4%)
 Frame = +1

Query  19   KEIISNQPPKFPLYYMASSTST----KPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPW  186
            + + S+     P  YMA + +T     P G    K +  + L++H  FFD + +GIIYPW
Sbjct  23   RRVRSDLETSIPKPYMARALTTPDTSHPQGTPGNKHNNLSVLQQHCAFFDQDGNGIIYPW  82

Query  187  ETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAY  366
            ET+ GFR +G    +SV ++ FI++ LS  + P   PSP+FPI I NI    HGSDSG Y
Sbjct  83   ETYTGFRALGFNVIVSVFMAIFINLGLSYPTLPYWFPSPLFPIYIHNIHRAKHGSDSGVY  142

Query  367  DREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLL  546
            D EG FV +  E IF+KY  T  + LT KE+  +    R+  D  GW    +EW  LY+L
Sbjct  143  DTEGRFVPANFENIFSKYALTVPDKLTLKEIWNMTEGNRNALDPFGWAAGKLEWGFLYVL  202

Query  547  AKDGKGLLTKERVIGVYDGSLFDQLAKEHAPKIKANNSTA*KG  675
            A+D  G + KE V   YDG++F+  AK     I AN   A  G
Sbjct  203  ARDEDGFVPKEAVRRCYDGTIFEYCAK----TIAANKDEAKMG  241



>ref|XP_008224170.1| PREDICTED: peroxygenase [Prunus mume]
Length=239

 Score =   164 bits (415),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 117/198 (59%), Gaps = 1/198 (1%)
 Frame = +1

Query  43   PKFPLYYMASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGG  222
            P  P   +A  T+  P G    +    + L++HV FFD + +GI+YPWETF G R +G  
Sbjct  36   PYMPRALVAPDTN-HPTGTLGHQHRNMSVLQQHVAFFDQDDNGIVYPWETFTGLRAVGFN  94

Query  223  FFLSVALSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIE  402
               +V +S FI+  LS  + PG +PSP FPI I NI    HGSDSG YD EG F    IE
Sbjct  95   LIAAVVISVFINGALSYATLPGWIPSPFFPIYIYNIHKSKHGSDSGTYDTEGRFSPVSIE  154

Query  403  EIFNKYGHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKER  582
             +F+KY +T  +  T  E+ ++    R   D+ GW+ + +EW +LY+LA+D  GLL+KE 
Sbjct  155  NMFSKYANTVPDKFTLGELWDMTEGNRVAFDFFGWIASKLEWGLLYVLARDEDGLLSKEA  214

Query  583  VIGVYDGSLFDQLAKEHA  636
            V   +DGSLF+  AK +A
Sbjct  215  VRRCFDGSLFEYCAKINA  232



>ref|XP_009773909.1| PREDICTED: peroxygenase-like [Nicotiana sylvestris]
Length=247

 Score =   164 bits (415),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 109/180 (61%), Gaps = 0/180 (0%)
 Frame = +1

Query  88   PYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVL  267
            P G    + +  + L++H  FFD + DGIIYPWET+ GFR++G     S  ++  IH  +
Sbjct  57   PNGTPGHRHNGMSVLQQHAAFFDQDDDGIIYPWETYIGFRQLGFNMIGSFIMAIVIHSAM  116

Query  268  SSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALT  447
            S  + PG  PSP+ PI I NI    HGSDSG YDREG ++    E IF+KY  T  + LT
Sbjct  117  SYPTLPGWFPSPLLPIYIHNIHKCKHGSDSGTYDREGRYLPVNFENIFSKYARTLPDKLT  176

Query  448  SKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAK  627
              E+ ++ +  R+  D+ GW+   +EW +LYLLAKD  G L+KE +   +DGSLFD  AK
Sbjct  177  LGELWDMTQANREVFDFFGWIATKMEWGILYLLAKDEDGFLSKEAIRRCFDGSLFDYCAK  236



>gb|EMT15880.1| hypothetical protein F775_27952 [Aegilops tauschii]
Length=422

 Score =   169 bits (427),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 117/186 (63%), Gaps = 0/186 (0%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            MA+   + P G         + L++H  FFD N DG+IYPWETFQ  R IG G   +   
Sbjct  230  MAAVDPSHPEGSKGRDTKGMSVLQQHAAFFDRNGDGVIYPWETFQSLRAIGLGSPSAFGT  289

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
            S  +H+VL+  ++PG +PSP+  I I+NI    HGSDS  YD EG F  +K + IF+K+G
Sbjct  290  SILLHLVLTYPTQPGWMPSPLLSIHIKNIHRGKHGSDSETYDTEGRFEPAKFDAIFSKFG  349

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
             T  NAL+  E++ +L+  R+  D++GW  A +EW++L+ +AKD +G L +E V G +DG
Sbjct  350  KTRPNALSEDEINAMLKHNRNMYDFLGWAAANLEWKLLHKVAKDKEGFLQREIVRGAFDG  409

Query  604  SLFDQL  621
            SLF++L
Sbjct  410  SLFERL  415



>gb|AAQ74237.1| caleosin 1 [Hordeum vulgare]
 gb|AAQ74238.1| caleosin 1 [Hordeum vulgare]
Length=301

 Score =   166 bits (419),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 113/173 (65%), Gaps = 0/173 (0%)
 Frame = +1

Query  130  LKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVF  309
            L++HV FFD + +GIIYPWET+ G R +G   F+S  ++  +++V+S  + PG LP+P+F
Sbjct  127  LQQHVAFFDRDNNGIIYPWETYDGCRAVGFNVFMSAFIAFLVNLVMSYPTLPGWLPNPLF  186

Query  310  PIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDP  489
            PI + NI    HGSDSG YD+EG F+    E IF+KY  TY + L+ +E+  +    R+ 
Sbjct  187  PIYVHNIHKSKHGSDSGTYDKEGRFMPVNFENIFSKYARTYPDRLSYREMWRMTEGCREV  246

Query  490  NDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPKIK  648
             D+ GWV   +EW +LY LA+D +G L++E +  +YDGSLF+ + ++    +K
Sbjct  247  FDFFGWVAMKLEWSILYALARDDEGYLSREAIRRMYDGSLFEYMERQRMEHVK  299



>gb|AFW58822.1| hypothetical protein ZEAMMB73_295093 [Zea mays]
Length=178

 Score =   162 bits (409),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 110/173 (64%), Gaps = 0/173 (0%)
 Frame = +1

Query  130  LKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVF  309
            L++HV FFD + +GIIYPWET+ G R +G    LS+ ++  ++  +S  + PG LPSP+F
Sbjct  4    LQQHVAFFDRDDNGIIYPWETYSGCRALGFNMILSLLIALVVNGTMSYATLPGWLPSPLF  63

Query  310  PIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDP  489
            PI + NI    HGSDSG YD EG F+    E +F+KY  T  + LT +E+  +    RD 
Sbjct  64   PIYVHNIHKSKHGSDSGTYDNEGRFMPVNFENLFSKYARTSPDRLTYRELWSMTEGFRDA  123

Query  490  NDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPKIK  648
             D  GW+ A +EW +LY+LA+D +G L++E +  VYDGSLF+ + ++ A   K
Sbjct  124  FDLYGWIAAKLEWTILYVLARDDEGYLSREAMRRVYDGSLFEYVERQRAQHAK  176



>gb|KGN61567.1| hypothetical protein Csa_2G171880 [Cucumis sativus]
Length=235

 Score =   163 bits (413),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 77/188 (41%), Positives = 114/188 (61%), Gaps = 0/188 (0%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            + ++ S  P G    K    T L++HV FFD + +GI+YPWET+ G R IG    +S+ +
Sbjct  38   LVAADSNHPTGTVGHKHYGMTVLQQHVAFFDQDDNGIVYPWETYVGLRAIGFNMIMSLVM  97

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
            +  I+  +S +++ G +PSP FPI I NI  D HGSD+G YD EG ++ +  E +F+KY 
Sbjct  98   AVIINFAMSYRTQQGWIPSPFFPIYIYNIHRDKHGSDTGTYDTEGRYIAANFENMFSKYA  157

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
             T  + L+  E+ ++    R   D  GW+ A +EW +LY+LA+D  G L+KE V   YDG
Sbjct  158  RTQPDKLSLGEIWDMTEANRLAFDPYGWIAAKLEWFILYVLARDEDGYLSKEAVRRCYDG  217

Query  604  SLFDQLAK  627
            SLF+  AK
Sbjct  218  SLFEYCAK  225



>ref|XP_004494730.1| PREDICTED: peroxygenase 2-like isoform X1 [Cicer arietinum]
 ref|XP_004494731.1| PREDICTED: peroxygenase 2-like isoform X2 [Cicer arietinum]
Length=251

 Score =   164 bits (415),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 78/179 (44%), Positives = 110/179 (61%), Gaps = 0/179 (0%)
 Frame = +1

Query  94   GKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSS  273
            G    K ++ + L++H  FFD + DGIIYPWETF+GFR +G     S   +  +H  LS 
Sbjct  64   GTWGHKHNDMSVLQQHAAFFDIDNDGIIYPWETFKGFRALGFNVVSSFIFTIILHAALSY  123

Query  274  KSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSK  453
             + P  LPSP+ PI I+NI    HGSDSG+YD EG F+ + +E +F+KY H   + LT +
Sbjct  124  STLPTWLPSPMLPIHIQNIHRAKHGSDSGSYDTEGRFIPANLEIMFSKYAHEVPDKLTFR  183

Query  454  EVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKE  630
            E+  + +      D+ GW  + +EW VLY+LAKD +G L+KE V   +DGSLF+  AK 
Sbjct  184  ELWHMTQANSVAYDFFGWAASKLEWGVLYILAKDEQGFLSKEAVRRCFDGSLFEYCAKR  242



>ref|XP_006413144.1| hypothetical protein EUTSA_v10027334mg [Eutrema salsugineum]
 gb|ESQ54597.1| hypothetical protein EUTSA_v10027334mg [Eutrema salsugineum]
Length=245

 Score =   164 bits (414),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 113/183 (62%), Gaps = 0/183 (0%)
 Frame = +1

Query  88   PYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVL  267
            PYG    K+   + L++HV FFD + +GIIYPWET+ G R +G     S+ ++  I++ L
Sbjct  53   PYGTPGHKNYGLSVLQQHVAFFDLDDNGIIYPWETYSGLRMLGFNIIGSLIIAAIINLAL  112

Query  268  SSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALT  447
            S  + PG LPSP FPI I NI    HGSDS  YD EG F+   +E IF+KY  T  + L+
Sbjct  113  SYATLPGWLPSPFFPIYIHNIHKSKHGSDSRTYDNEGRFMPVNLELIFSKYAKTLPDKLS  172

Query  448  SKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAK  627
              E+ ++   +RD  D  GWV   IEW +LYLLA+D +G L+KE +   +DGSLF+  AK
Sbjct  173  LGELWDMTEGQRDAWDIFGWVACKIEWGLLYLLARDEEGFLSKEAIRRCFDGSLFEYCAK  232

Query  628  EHA  636
             +A
Sbjct  233  IYA  235



>ref|XP_004147185.1| PREDICTED: peroxygenase-like [Cucumis sativus]
 ref|XP_004160591.1| PREDICTED: peroxygenase-like [Cucumis sativus]
 gb|ABY56103.1| caleosin [Cucumis sativus]
Length=239

 Score =   163 bits (413),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 77/188 (41%), Positives = 114/188 (61%), Gaps = 0/188 (0%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            + ++ S  P G    K    T L++HV FFD + +GI+YPWET+ G R IG    +S+ +
Sbjct  42   LVAADSNHPTGTVGHKHYGMTVLQQHVAFFDQDDNGIVYPWETYVGLRAIGFNMIMSLVM  101

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
            +  I+  +S +++ G +PSP FPI I NI  D HGSD+G YD EG ++ +  E +F+KY 
Sbjct  102  AVIINFAMSYRTQQGWIPSPFFPIYIYNIHRDKHGSDTGTYDTEGRYIAANFENMFSKYA  161

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
             T  + L+  E+ ++    R   D  GW+ A +EW +LY+LA+D  G L+KE V   YDG
Sbjct  162  RTQPDKLSLGEIWDMTEANRLAFDPYGWIAAKLEWFILYVLARDEDGYLSKEAVRRCYDG  221

Query  604  SLFDQLAK  627
            SLF+  AK
Sbjct  222  SLFEYCAK  229



>ref|XP_004953838.1| PREDICTED: probable peroxygenase 4-like [Setaria italica]
Length=218

 Score =   162 bits (411),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 106/177 (60%), Gaps = 0/177 (0%)
 Frame = +1

Query  94   GKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSS  273
            G+     D  T L +H  FFD + DG++   ET+  FR +G GF LS   + FI+  L S
Sbjct  27   GRAAAYGDGATALHRHAAFFDRDGDGVVTLSETYGAFRALGFGFGLSSVSAAFINGALGS  86

Query  274  KSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSK  453
            K RP    S    I IE+I+   HGSD+G+YD EG F+  K EEIF K+  T  +ALTS 
Sbjct  87   KCRPENATSSKLDIYIEDIQNGKHGSDTGSYDTEGRFIPEKFEEIFAKHAKTVPDALTSD  146

Query  454  EVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLA  624
            E+D+LL+  R P DY GW  A  EW++LY L KD  GLL K+    VYDGSLF +LA
Sbjct  147  EIDQLLQANRQPGDYAGWAGAEAEWKILYSLGKDKDGLLHKDVARSVYDGSLFHRLA  203



>gb|EAZ24529.1| hypothetical protein OsJ_08290 [Oryza sativa Japonica Group]
Length=222

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 113/184 (61%), Gaps = 3/184 (2%)
 Frame = +1

Query  112  DDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGK  291
            D   T L+KH  FFD + DGI+   ET+ G R +G G  LS   + FI+ VLS K+RP  
Sbjct  42   DAGVTALQKHAAFFDKDGDGIVSLSETYDGLRALGLGSGLSSLSAAFINGVLSPKTRPDN  101

Query  292  LPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELL  471
              +P   I IENI   +HGSDS AYD EG FV  K EEIF K+  T  +ALTS E+DELL
Sbjct  102  GTAPRLSIYIENIYKGIHGSDSSAYDSEGRFVAEKFEEIFAKHAKTVPDALTSDEIDELL  161

Query  472  RDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPKIKA  651
            +  R P DY GWV A+ EW++LY + KD  GLL KE V  VYDGSLF +LA   A +I  
Sbjct  162  QANRKPGDYTGWVAASSEWKILYKIGKDKDGLLRKEAVREVYDGSLFTKLA---AARIND  218

Query  652  NNST  663
             N  
Sbjct  219  ENQA  222



>gb|EMS57193.1| hypothetical protein TRIUR3_05867 [Triticum urartu]
Length=301

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 113/173 (65%), Gaps = 0/173 (0%)
 Frame = +1

Query  130  LKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVF  309
            L++HV FFD + +GIIYPWET+ G R +G   F+S  ++  +++V+S  + PG LP+P+F
Sbjct  127  LQQHVAFFDRDNNGIIYPWETYDGCRAVGFNVFMSAFIAFLVNLVMSYPTLPGWLPNPLF  186

Query  310  PIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDP  489
            PI + NI    HGSDSG YD+EG F+    E IF+KY  TY + L+ +E+  +    R+ 
Sbjct  187  PIYVHNIHKSKHGSDSGTYDKEGRFMPVNFENIFSKYARTYPDRLSYRELWRMTEGSREV  246

Query  490  NDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPKIK  648
             D+ GWV   +EW  LY+LA+D +G L++E +  +YDGSLF+ + ++    +K
Sbjct  247  FDFFGWVAMKLEWSFLYVLARDDEGYLSREAIRRMYDGSLFEYMERQRMEHVK  299



>ref|XP_002867544.1| hypothetical protein ARALYDRAFT_329010 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43803.1| hypothetical protein ARALYDRAFT_329010 [Arabidopsis lyrata subsp. 
lyrata]
Length=245

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 112/183 (61%), Gaps = 0/183 (0%)
 Frame = +1

Query  88   PYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVL  267
            PYG    K+   + L++HV FFD + +GIIYPWET+ G R +G     S+ ++  I++ L
Sbjct  53   PYGTPGHKNYGLSVLQQHVSFFDMDDNGIIYPWETYSGLRMLGFNIIGSLIIAAVINLTL  112

Query  268  SSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALT  447
            S  + PG LPSP FPI I NI    HGSDS  YD EG F+   +E IF+KY  T  + L+
Sbjct  113  SYATLPGWLPSPFFPIYIHNIHKSKHGSDSKTYDNEGRFMPVNLELIFSKYAKTLPDKLS  172

Query  448  SKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAK  627
              E+ E+    RD  D  GW+   IEW +LYLLA+D +G L+KE +   +DGSLF+  AK
Sbjct  173  LGELWEMTEGNRDAWDIFGWIAGKIEWGLLYLLARDEEGFLSKEAIRRCFDGSLFEYCAK  232

Query  628  EHA  636
             +A
Sbjct  233  IYA  235



>ref|NP_001150081.1| ABA-induced protein precursor [Zea mays]
 gb|ACG37724.1| ABA-induced protein [Zea mays]
Length=225

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 108/169 (64%), Gaps = 0/169 (0%)
 Frame = +1

Query  124  TPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSP  303
            T L+KHV FFD N DGII   ET+QG R +G G   + A + FI+  L  K+RP    S 
Sbjct  53   TELQKHVAFFDRNHDGIITFDETYQGLRDVGVGDVTAKASAAFINGALGPKTRPDNSNSS  112

Query  304  VFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKR  483
               I +ENI+   HGSD+GAYD +G FV +K++E+F K+  T  NALT  E+DE+L+D R
Sbjct  113  SMDIYVENIQKGKHGSDTGAYDAQGRFVPAKLDEMFTKHAKTVPNALTKDELDEMLKDNR  172

Query  484  DPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKE  630
            +  D  GW+ A  EW +LY LAKD  G L K+ V  VYDGSLF QLA +
Sbjct  173  EKMDVAGWLGAKSEWEMLYKLAKDKDGRLPKDTVRTVYDGSLFYQLAAQ  221



>ref|XP_009142734.1| PREDICTED: peroxygenase 1 [Brassica rapa]
 gb|ACG69537.1| caleosin CLO1-5 [Brassica napus]
 emb|CDX89307.1| BnaA01g15860D [Brassica napus]
Length=245

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 113/183 (62%), Gaps = 0/183 (0%)
 Frame = +1

Query  88   PYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVL  267
            PYG    K+   + L++HV FFD + +GIIYPWET+ G R +G    +S+  +  I++ L
Sbjct  53   PYGTPGHKNYGLSVLQQHVAFFDLDDNGIIYPWETYSGLRMLGFNIIVSLIAAAVINLAL  112

Query  268  SSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALT  447
            S  + PG  PSP FPI I NI    HGSDS  YD EG F+   +E IF+KY  T  + L+
Sbjct  113  SYATLPGWFPSPFFPIYIHNIHKSKHGSDSRTYDNEGRFMPVNLELIFSKYAKTLPDKLS  172

Query  448  SKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAK  627
              E+ E+ + +RD  D  GW  + IEW +LYLLA+D +G L+KE +   +DGSLF+  AK
Sbjct  173  LGELWEMTQGQRDAWDIFGWFASKIEWGLLYLLARDEEGFLSKEAIRRCFDGSLFEYCAK  232

Query  628  EHA  636
             +A
Sbjct  233  IYA  235



>gb|AAY40837.1| caleosin [Brassica napus]
 gb|ABB05052.1| caleosin [Brassica napus]
Length=245

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 113/183 (62%), Gaps = 0/183 (0%)
 Frame = +1

Query  88   PYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVL  267
            PYG    K+   + L++HV FFD + +GIIYPWET+ G R +G    +S+  +  I++ L
Sbjct  53   PYGTPGHKNYGLSVLQQHVAFFDLDDNGIIYPWETYSGLRMLGFNIIVSLIAAAVINLAL  112

Query  268  SSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALT  447
            S  + PG  PSP FPI I NI    HGSDS  YD EG F+   +E IF+KY  T  + L+
Sbjct  113  SYATLPGWFPSPFFPIYIHNIHKSKHGSDSRTYDNEGRFMPVNLELIFSKYAKTLPDKLS  172

Query  448  SKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAK  627
              E+ E+ + +RD  D  GW  + IEW +LYLLA+D +G L+KE +   +DGSLF+  AK
Sbjct  173  LGELWEMTQGQRDAWDIFGWFASKIEWGLLYLLARDEEGFLSKEAIRRCFDGSLFEYCAK  232

Query  628  EHA  636
             +A
Sbjct  233  IYA  235



>ref|XP_006285912.1| hypothetical protein CARUB_v10007431mg [Capsella rubella]
 gb|EOA18810.1| hypothetical protein CARUB_v10007431mg [Capsella rubella]
Length=245

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 112/183 (61%), Gaps = 0/183 (0%)
 Frame = +1

Query  88   PYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVL  267
            PYG    K+   + L++HV FFD + +GIIYPWET+ G R +G     S+ ++  I++ L
Sbjct  53   PYGTPGHKNYGLSVLQQHVAFFDIDDNGIIYPWETYSGLRMLGFNIIGSLIIAAVINLAL  112

Query  268  SSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALT  447
            S  + PG LPSP FPI I NI    HGSDS  YD EG F+   +E IF+KY  T  + L+
Sbjct  113  SYATLPGWLPSPFFPIYIHNIHKSKHGSDSQTYDNEGRFMPVNLELIFSKYAKTLPDKLS  172

Query  448  SKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAK  627
              E+ E+    RD  D  GW+   +EW +LYLLA+D +G L+KE +   +DGSLF+  AK
Sbjct  173  LGELWEMTEGNRDAWDIFGWIAGKVEWGLLYLLARDEEGFLSKEAIRRCFDGSLFEYCAK  232

Query  628  EHA  636
             +A
Sbjct  233  IYA  235



>gb|EMT27637.1| hypothetical protein F775_09950 [Aegilops tauschii]
Length=301

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 113/173 (65%), Gaps = 0/173 (0%)
 Frame = +1

Query  130  LKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVF  309
            L++HV FFD + +GIIYPWET+ G R +G   F+S  ++  +++V+S  + PG LP+P+F
Sbjct  127  LQQHVAFFDRDNNGIIYPWETYDGCRAVGFNVFMSAFIAFLVNLVMSYPTLPGWLPNPLF  186

Query  310  PIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDP  489
            PI + NI    HGSDSG YD+EG F+    E IF+KY  TY + L+ +E+  +    R+ 
Sbjct  187  PIYVHNIHKSKHGSDSGTYDKEGRFMPVNFENIFSKYARTYPDRLSYRELWRMTEGCREV  246

Query  490  NDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPKIK  648
             D+ GWV   +EW  LY+LA+D +G L++E +  +YDGSLF+ + ++    +K
Sbjct  247  FDFFGWVAMKLEWSFLYVLARDDEGYLSREAIRRMYDGSLFEYMERQRMEHVK  299



>ref|NP_194404.1| peroxygenase 1 [Arabidopsis thaliana]
 sp|O81270.1|PXG1_ARATH RecName: Full=Peroxygenase 1; Short=AtPXG1; AltName: Full=Caleosin-1; 
AltName: Full=Embryo-specific protein 1 (ATS1) [Arabidopsis 
thaliana]
 gb|AAC27072.1| embryo-specific protein 1 [Arabidopsis thaliana]
 emb|CAB36520.1| embryo-specific protein 1 (ATS1) [Arabidopsis thaliana]
 emb|CAB79529.1| embryo-specific protein 1 (ATS1) [Arabidopsis thaliana]
 gb|AEE85247.1| peroxygenase 1 [Arabidopsis thaliana]
Length=245

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 112/183 (61%), Gaps = 0/183 (0%)
 Frame = +1

Query  88   PYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVL  267
            PYG    K+   + L++HV FFD + +GIIYPWET+ G R +G     S+ ++  I++ L
Sbjct  53   PYGTPGHKNYGLSVLQQHVSFFDIDDNGIIYPWETYSGLRMLGFNIIGSLIIAAVINLTL  112

Query  268  SSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALT  447
            S  + PG LPSP FPI I NI    HGSDS  YD EG F+   +E IF+KY  T  + L+
Sbjct  113  SYATLPGWLPSPFFPIYIHNIHKSKHGSDSKTYDNEGRFMPVNLELIFSKYAKTLPDKLS  172

Query  448  SKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAK  627
              E+ E+    RD  D  GW+   IEW +LYLLA+D +G L+KE +   +DGSLF+  AK
Sbjct  173  LGELWEMTEGNRDAWDIFGWIAGKIEWGLLYLLARDEEGFLSKEAIRRCFDGSLFEYCAK  232

Query  628  EHA  636
             +A
Sbjct  233  IYA  235



>ref|XP_010433448.1| PREDICTED: peroxygenase 1 isoform X2 [Camelina sativa]
Length=245

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 112/183 (61%), Gaps = 0/183 (0%)
 Frame = +1

Query  88   PYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVL  267
            PYG    K+   + L++HV FFD + +GIIYPWET+ G R +G     S+ ++  I++ L
Sbjct  53   PYGTPGHKNYGLSVLQQHVAFFDIDDNGIIYPWETYSGLRMLGFNIIGSLIIAAVINLAL  112

Query  268  SSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALT  447
            S  + PG LPSP FPI I NI    HGSDS  YD EG F+   +E IF+KY  T  + L+
Sbjct  113  SYATLPGWLPSPFFPIYIHNIHKSKHGSDSQTYDNEGRFMPVNLELIFSKYAKTLPDKLS  172

Query  448  SKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAK  627
              E+ E+    RD  D  GW+   +EW +LYLLA+D +G L+KE +   +DGSLF+  AK
Sbjct  173  LGELWEMTEGNRDAWDIFGWIAGKVEWGLLYLLARDEEGFLSKEAIRRCFDGSLFEYCAK  232

Query  628  EHA  636
             +A
Sbjct  233  IYA  235



>gb|KHN30721.1| Peroxygenase [Glycine soja]
Length=235

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 112/197 (57%), Gaps = 1/197 (1%)
 Frame = +1

Query  43   PKFPLYYMASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGG  222
            P  P    A  T   P G    +    + L++H  FFD + +GIIYPWET+ G R IG  
Sbjct  32   PYLPRALKAPDTG-HPNGTAGHRHHNLSVLQQHCAFFDQDDNGIIYPWETYMGLRSIGFN  90

Query  223  FFLSVALSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIE  402
               SV ++  I++ LS  + P   PS +FPI I NI    HGSDSG YD EG +V + IE
Sbjct  91   VVASVIMAIVINVGLSYPTLPNWFPSLLFPIYIHNIHKAKHGSDSGVYDTEGRYVPANIE  150

Query  403  EIFNKYGHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKER  582
             IF+KY  T  + LT  E+ +L    R+  D  GW+ A  EW VLY+LA+D +G L+KE 
Sbjct  151  NIFSKYARTVPDKLTLGELWDLTEGNRNAFDIFGWLAAKFEWGVLYILARDEEGFLSKEA  210

Query  583  VIGVYDGSLFDQLAKEH  633
            V   +DGSLF+  AK H
Sbjct  211  VRRCFDGSLFEYCAKMH  227



>ref|XP_010494127.1| PREDICTED: peroxygenase-like [Camelina sativa]
Length=238

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 111/185 (60%), Gaps = 0/185 (0%)
 Frame = +1

Query  94   GKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSS  273
            G    K  + + L++HV FFD + DGIIYPWETF+GFR +G     S  L+  +H+ +S 
Sbjct  52   GTRGHKHQDMSVLQQHVAFFDQDGDGIIYPWETFRGFRALGFNVVSSFFLTLIVHLTMSY  111

Query  274  KSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSK  453
             + P  +PS  FPI I+NI    HGSD+  YD EG ++ + +E +F+KY  +  + LT  
Sbjct  112  ATMPTWVPSYTFPIYIKNIHRAKHGSDTSTYDTEGRYIPANLENMFSKYARSVPDKLTRF  171

Query  454  EVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEH  633
            E+ ++    R+  D+ GW  + +EW VLYLLAKD  G L+KE V   +DGSLFD  AK  
Sbjct  172  ELWQMTEANRNAFDFFGWAASKMEWGVLYLLAKDENGYLSKEAVRRCFDGSLFDYCAKAR  231

Query  634  APKIK  648
            A   K
Sbjct  232  ASAKK  236



>ref|XP_002872333.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48592.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=238

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 110/181 (61%), Gaps = 0/181 (0%)
 Frame = +1

Query  94   GKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSS  273
            G    K  + + L++HV FFD + DGIIYP ETF+GFR +G     S  L+  +H+ +S 
Sbjct  52   GTRGHKHQDMSVLQQHVAFFDQDGDGIIYPSETFRGFRALGFNVISSFFLTIIVHLTMSY  111

Query  274  KSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSK  453
             + P  +PSP FPI I+NI    HGSD+  YD EG ++ + +E +F+KY  T  + LT  
Sbjct  112  ATLPTWMPSPTFPIYIKNIHRAKHGSDTSTYDTEGRYIPANLENMFSKYARTVPDKLTRY  171

Query  454  EVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEH  633
            E+ ++    R+  D+ GW  + +EW VLYLLAKD  G L+KE V   +DGSLFD  AK  
Sbjct  172  ELWQMTEANRNAFDFFGWAASKMEWGVLYLLAKDENGHLSKEAVRRCFDGSLFDYCAKAR  231

Query  634  A  636
            A
Sbjct  232  A  232



>ref|XP_010433447.1| PREDICTED: peroxygenase 1 isoform X1 [Camelina sativa]
Length=259

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 112/183 (61%), Gaps = 0/183 (0%)
 Frame = +1

Query  88   PYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVL  267
            PYG    K+   + L++HV FFD + +GIIYPWET+ G R +G     S+ ++  I++ L
Sbjct  67   PYGTPGHKNYGLSVLQQHVAFFDIDDNGIIYPWETYSGLRMLGFNIIGSLIIAAVINLAL  126

Query  268  SSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALT  447
            S  + PG LPSP FPI I NI    HGSDS  YD EG F+   +E IF+KY  T  + L+
Sbjct  127  SYATLPGWLPSPFFPIYIHNIHKSKHGSDSQTYDNEGRFMPVNLELIFSKYAKTLPDKLS  186

Query  448  SKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAK  627
              E+ E+    RD  D  GW+   +EW +LYLLA+D +G L+KE +   +DGSLF+  AK
Sbjct  187  LGELWEMTEGNRDAWDIFGWIAGKVEWGLLYLLARDEEGFLSKEAIRRCFDGSLFEYCAK  246

Query  628  EHA  636
             +A
Sbjct  247  IYA  249



>ref|NP_001237343.1| Ca+2-binding EF hand protein [Glycine max]
 gb|AAB71227.1| Ca+2-binding EF hand protein [Glycine max]
 gb|ACU13304.1| unknown [Glycine max]
Length=239

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 112/197 (57%), Gaps = 1/197 (1%)
 Frame = +1

Query  43   PKFPLYYMASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGG  222
            P  P    A  T   P G    +    + L++H  FFD + +GIIYPWET+ G R IG  
Sbjct  36   PYLPRALKAPDTG-HPNGTAGHRHHNLSVLQQHCAFFDQDDNGIIYPWETYMGLRSIGFN  94

Query  223  FFLSVALSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIE  402
               SV ++  I++ LS  + P   PS +FPI I NI    HGSDSG YD EG +V + IE
Sbjct  95   VVASVIMAIVINVGLSYPTLPNWFPSLLFPIYIHNIHKAKHGSDSGVYDTEGRYVPANIE  154

Query  403  EIFNKYGHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKER  582
             IF+KY  T  + LT  E+ +L    R+  D  GW+ A  EW VLY+LA+D +G L+KE 
Sbjct  155  NIFSKYARTVPDKLTLGELWDLTEGNRNAFDIFGWLAAKFEWGVLYILARDEEGFLSKEA  214

Query  583  VIGVYDGSLFDQLAKEH  633
            V   +DGSLF+  AK H
Sbjct  215  VRRCFDGSLFEYCAKMH  231



>dbj|BAJ87067.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=245

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 109/170 (64%), Gaps = 1/170 (1%)
 Frame = +1

Query  124  TPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSP  303
            T L+KH  FFD ++DG++   ET+  FR +G G+  S   +TFI+ VL  ++RP +  + 
Sbjct  67   TALQKHAAFFDGDKDGVVTFSETYAAFRALGFGYAASTLSATFINGVLGPQTRP-ENETA  125

Query  304  VFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKR  483
             + I IENI   +HGSDSGAYD +G FV  K E  F K+  T  +ALTS EVDEL+   R
Sbjct  126  RYSIYIENIHKGIHGSDSGAYDSQGRFVPDKFEAAFAKHAKTAPDALTSAEVDELITANR  185

Query  484  DPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEH  633
             P+DY GW  A+ EW++LY + KD  GLL K+   GVYDGSLF ++ +E 
Sbjct  186  QPSDYAGWAGASAEWKMLYSIGKDKDGLLRKDAARGVYDGSLFARVVQER  235



>gb|KFK22107.1| hypothetical protein AALP_AAs51970U000300 [Arabis alpina]
Length=238

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 111/187 (59%), Gaps = 0/187 (0%)
 Frame = +1

Query  94   GKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSS  273
            G    K  + + L++HV FFD + DGIIYP ETF+GFR +G     S  L+  +H+ +S 
Sbjct  52   GTRGHKHQDMSVLQQHVAFFDQDGDGIIYPGETFRGFRALGFNVISSFFLTIIVHLTMSY  111

Query  274  KSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSK  453
             + P  +PS  FPI I NI    HGSD+  YD EG ++ + +E +F+KY  T  + LT  
Sbjct  112  ATLPTWMPSFSFPIYIRNIHRAKHGSDTSTYDTEGRYIPANMENMFSKYARTVPDKLTRH  171

Query  454  EVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEH  633
            E+ ++    RD  D+ GW  + +EW VLYLLAKD  G L+KE V   +DGSLFD  AK  
Sbjct  172  ELWQMTEANRDAFDFFGWAASKMEWGVLYLLAKDENGYLSKEAVRRCFDGSLFDYCAKSR  231

Query  634  APKIKAN  654
            A   KA+
Sbjct  232  ASPKKAD  238



>gb|AHV78310.1| caleosin [Triticum aestivum]
Length=223

 Score =   162 bits (409),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 110/174 (63%), Gaps = 1/174 (1%)
 Frame = +1

Query  124  TPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSP  303
            T L+KH  FFD ++DG++   ET+  FR +G G+  S   +TFI+ VL  ++RP +  + 
Sbjct  46   TALQKHAAFFDGDKDGVVTFSETYAAFRALGFGYAASTLSATFINGVLGPQTRP-ENDTA  104

Query  304  VFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKR  483
               I IENI   +HGSDSGAYD +G FV  K E  F K+  T  +ALTS EVDEL+   R
Sbjct  105  RMSIYIENIHKGIHGSDSGAYDSQGRFVPEKFEAAFAKHAKTVPDALTSAEVDELITANR  164

Query  484  DPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPKI  645
            +P+DY GW  A+ EW++LY + KD  GLL K+   GVYDGSLF ++ +E    I
Sbjct  165  EPSDYAGWAGASAEWKLLYSIGKDKDGLLRKDAARGVYDGSLFARVVQERRTSI  218



>dbj|BAJ85662.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=245

 Score =   162 bits (410),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 109/170 (64%), Gaps = 1/170 (1%)
 Frame = +1

Query  124  TPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSP  303
            T L+KH  FFD ++DG++   ET+  FR +G G+  S   +TFI+ VL  ++RP +  + 
Sbjct  67   TALQKHAAFFDGDKDGVVTFSETYAAFRALGFGYAASTLSATFINGVLGPQTRP-ENETA  125

Query  304  VFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKR  483
             + I IENI   +HGSDSGAYD +G FV  K E  F K+  T  +ALTS EVDEL+   R
Sbjct  126  RYSIYIENIHKGIHGSDSGAYDSQGRFVPDKFEAAFAKHAKTVPDALTSAEVDELITANR  185

Query  484  DPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEH  633
             P+DY GW  A+ EW++LY + KD  GLL K+   GVYDGSLF ++ +E 
Sbjct  186  QPSDYAGWAGASAEWKMLYSIGKDKDGLLRKDAARGVYDGSLFARVVQER  235



>ref|XP_009334210.1| PREDICTED: peroxygenase-like [Pyrus x bretschneideri]
Length=241

 Score =   162 bits (410),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/210 (39%), Positives = 122/210 (58%), Gaps = 4/210 (2%)
 Frame = +1

Query  19   KEIISNQPPKFPLYYM----ASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPW  186
            + + S+   K P  YM     +  +  P G    +    + L++H+ FFD + +GI+YPW
Sbjct  25   RRVRSDLETKLPKPYMPRALVAPDTNHPTGTVGHQHRNMSVLQQHIAFFDQDDNGIVYPW  84

Query  187  ETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAY  366
            ETF G R IG    +++ ++  I+  +S  + PG +PSP FPI I NI    HGSDSG Y
Sbjct  85   ETFTGCRAIGFNPIVALFMAVLINGAMSYPTLPGWIPSPFFPIYIYNIHKAKHGSDSGTY  144

Query  367  DREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLL  546
            D EG +  + IE +F+KY HT  +  T  E+  +    R   D+ GW+ + +EW +LY+L
Sbjct  145  DTEGRYSPANIENMFSKYAHTVPDKFTLGELWAMTEGNRVALDFFGWITSKLEWGLLYVL  204

Query  547  AKDGKGLLTKERVIGVYDGSLFDQLAKEHA  636
            A+D +GLL+KE V   +DGSLFD  AK +A
Sbjct  205  ARDEEGLLSKEAVRRCFDGSLFDYCAKMNA  234



>gb|AFW73291.1| ABA-induced protein [Zea mays]
Length=225

 Score =   161 bits (408),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 108/169 (64%), Gaps = 0/169 (0%)
 Frame = +1

Query  124  TPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSP  303
            T L+KHV FFD N DGII   ET+QG + +G G   + A + FI+  L  K+RP    S 
Sbjct  53   TELQKHVAFFDRNHDGIITFDETYQGLQDVGVGDVTAKASAAFINGALGPKTRPDNSNSS  112

Query  304  VFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKR  483
               I +ENI+   HGSD+GAYD +G FV +K++E+F K+  T  NALT  E+DE+L+D R
Sbjct  113  RMDIYVENIQKGKHGSDTGAYDAQGRFVPAKLDEMFTKHAKTVPNALTKDELDEMLKDNR  172

Query  484  DPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKE  630
            +  D  GW+ A  EW +LY LAKD  G L K+ V  VYDGSLF QLA +
Sbjct  173  EKMDVAGWLGAKSEWEMLYKLAKDKDGRLPKDTVRAVYDGSLFYQLAAQ  221



>ref|NP_001241768.1| caleosin related protein [Zea mays]
 ref|XP_008676910.1| PREDICTED: uncharacterized protein LOC100275194 isoform X1 [Zea 
mays]
 gb|ACG36841.1| caleosin related protein [Zea mays]
 gb|AFW63831.1| caleosin protein [Zea mays]
Length=226

 Score =   161 bits (408),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 110/177 (62%), Gaps = 4/177 (2%)
 Frame = +1

Query  130  LKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVF  309
            L KH  FFD + DG++   ET+  FR +G G  LS A + FI+  L SK RP    S   
Sbjct  49   LYKHASFFDRDGDGVVSFAETYGAFRALGFGLGLSSASAAFINGALGSKCRPQNATSSKL  108

Query  310  PIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDP  489
             I IE+I+   HGSDSG+YD +G FV  K EEIF ++  T  +ALTS E+D+LL+  R+P
Sbjct  109  DIYIEDIRRGKHGSDSGSYDAQGRFVPEKFEEIFARHARTVPDALTSDEIDQLLQANREP  168

Query  490  NDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPKIKANNS  660
             DY GW  A  EW++LY L KDG GLL K+    VYDG+LF +L    AP+ K+ +S
Sbjct  169  GDYSGWAGAEAEWKILYSLGKDGDGLLRKDVARSVYDGTLFHRL----APRWKSPDS  221



>gb|AFW73290.1| ABA-induced protein [Zea mays]
Length=226

 Score =   161 bits (408),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 108/169 (64%), Gaps = 0/169 (0%)
 Frame = +1

Query  124  TPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSP  303
            T L+KHV FFD N DGII   ET+QG + +G G   + A + FI+  L  K+RP    S 
Sbjct  54   TELQKHVAFFDRNHDGIITFDETYQGLQDVGVGDVTAKASAAFINGALGPKTRPDNSNSS  113

Query  304  VFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKR  483
               I +ENI+   HGSD+GAYD +G FV +K++E+F K+  T  NALT  E+DE+L+D R
Sbjct  114  RMDIYVENIQKGKHGSDTGAYDAQGRFVPAKLDEMFTKHAKTVPNALTKDELDEMLKDNR  173

Query  484  DPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKE  630
            +  D  GW+ A  EW +LY LAKD  G L K+ V  VYDGSLF QLA +
Sbjct  174  EKMDVAGWLGAKSEWEMLYKLAKDKDGRLPKDTVRAVYDGSLFYQLAAQ  222



>ref|XP_008340650.1| PREDICTED: peroxygenase [Malus domestica]
Length=241

 Score =   162 bits (409),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/206 (40%), Positives = 118/206 (57%), Gaps = 4/206 (2%)
 Frame = +1

Query  19   KEIISNQPPKFPLYYM----ASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPW  186
            + + SN   K P  YM     +  +  P G    +  + + L++HV FFD + +GI+YPW
Sbjct  25   RRVRSNLETKLPKPYMPRALVAPDTDHPTGTVGHQHRDMSVLQQHVAFFDXDYNGIVYPW  84

Query  187  ETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAY  366
            ETF G R IG     SV ++  I+  LS  + PG +PSP FPI I NI    HGSDSG Y
Sbjct  85   ETFAGLRAIGFNLIASVVMTVLINGALSYPTLPGWIPSPFFPIHIYNIHKAKHGSDSGTY  144

Query  367  DREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLL  546
            D EG F  + +E +F+KY HT  +  T  E+  +    R   D+ GW+   +EW +LY+L
Sbjct  145  DTEGRFSPANLENMFSKYAHTAPDKFTLGELWNMTEGNRLGYDFXGWIANKLEWGLLYVL  204

Query  547  AKDGKGLLTKERVIGVYDGSLFDQLA  624
            A+D +G+L+KE V   +DGSLF+  A
Sbjct  205  ARDEEGMLSKEAVRRCFDGSLFEYCA  230



>ref|XP_006301600.1| hypothetical protein CARUB_v10022039mg, partial [Capsella rubella]
 gb|EOA34498.1| hypothetical protein CARUB_v10022039mg, partial [Capsella rubella]
Length=155

 Score =   159 bits (402),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 104/153 (68%), Gaps = 5/153 (3%)
 Frame = +1

Query  202  FRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGN  381
            FR IG G+ LS   S FI++ LSS++RPGK  S  FPI ++NI L  HGSDSG YD++G 
Sbjct  1    FRAIGCGYALSTFASVFINMALSSQTRPGKGFSLSFPIEVKNIHLAKHGSDSGVYDKDGR  60

Query  382  FVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGK  561
            FV SK EEIF K+ HT+++ALT +E+ +LL   ++PND MG + A  EW VLY L KD  
Sbjct  61   FVASKFEEIFTKHAHTHSDALTKEELKQLLNANKEPNDRMGGLAAYAEWTVLYDLCKDKN  120

Query  562  GLLTKERVIGVYDGSLFDQLAKEH-----APKI  645
            GLL KE V  VYDGSLF++L ++       PKI
Sbjct  121  GLLQKETVRAVYDGSLFEKLEQQQKSSSKTPKI  153



>ref|XP_010482958.1| PREDICTED: peroxygenase 2 isoform X2 [Camelina sativa]
Length=233

 Score =   161 bits (408),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 113/183 (62%), Gaps = 0/183 (0%)
 Frame = +1

Query  88   PYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVL  267
            P G    + +  + +++HV FFD + +GIIYP+ETF GF+ +G     S+ L+  IH+ L
Sbjct  42   PLGTPEHRHNGLSVMQQHVAFFDLDDNGIIYPYETFSGFQLLGFNLLASLILTACIHLAL  101

Query  268  SSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALT  447
            S  + PG LPSP FPI I NI    HGSDS  YD EG +  + +E +F+KY  T  + L+
Sbjct  102  SYATLPGWLPSPFFPIYIHNIHKAKHGSDSKTYDNEGRYTPANLELMFSKYARTVPDKLS  161

Query  448  SKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAK  627
              E+ ++    RD  D+ GW+ + +EW VLY+LA D +G L+KE +   +DGSLF+  AK
Sbjct  162  LGELWDMTEGNRDAFDFFGWLASKVEWGVLYVLASDEEGFLSKEAIRRCFDGSLFEYCAK  221

Query  628  EHA  636
             +A
Sbjct  222  NYA  224



>ref|XP_007227560.1| hypothetical protein PRUPE_ppa010705mg [Prunus persica]
 gb|EMJ28759.1| hypothetical protein PRUPE_ppa010705mg [Prunus persica]
Length=239

 Score =   161 bits (408),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 81/198 (41%), Positives = 117/198 (59%), Gaps = 1/198 (1%)
 Frame = +1

Query  43   PKFPLYYMASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGG  222
            P  P   +A  T+  P G    +  + + L++HV FFD + +GI+YPWETF G R +G  
Sbjct  36   PYMPRALVAPDTN-HPTGTPGHQHRDMSVLQQHVAFFDQDDNGIVYPWETFTGLRAVGFN  94

Query  223  FFLSVALSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIE  402
               ++ ++  I+  LS  + PG +PSP FPI I NI    HGSDSG YD EG F    IE
Sbjct  95   LIAAIVMTVLINGALSYATLPGWIPSPFFPIYIYNIHKSKHGSDSGTYDTEGRFSPVSIE  154

Query  403  EIFNKYGHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKER  582
             +F+KY +T  +  T  E+ ++    R   D+ GW+ + +EW +LY+LA+D  GLL+KE 
Sbjct  155  NMFSKYANTVPDKFTLGELWDMTEGNRVAFDFFGWIASKLEWGLLYVLARDEDGLLSKEA  214

Query  583  VIGVYDGSLFDQLAKEHA  636
            V   +DGSLF+  AK +A
Sbjct  215  VRRCFDGSLFEYCAKINA  232



>ref|NP_001152407.1| LOC100286047 precursor [Zea mays]
 gb|ACG47436.1| ABA-induced protein [Zea mays]
Length=227

 Score =   161 bits (407),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 108/169 (64%), Gaps = 0/169 (0%)
 Frame = +1

Query  124  TPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSP  303
            T L+KHV FFD N DG+I   ET+QG + +G G   + A + +I+  L  K+RP    S 
Sbjct  55   TELQKHVAFFDRNHDGVITFDETYQGLQDVGVGAVTAKASAAYINGALGPKTRPDNSNSS  114

Query  304  VFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKR  483
               I +ENI+   HGSD+GAYD +G FV +K++E+F K+  T  NALT  E+DE+L+D R
Sbjct  115  TLDIYVENIQKGKHGSDTGAYDAQGRFVPAKLDEMFTKHAKTVPNALTKDELDEMLKDNR  174

Query  484  DPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKE  630
            +  D  GW+ A  EW +LY LAKD  G L K+ V  VYDGSLF QLA +
Sbjct  175  EKMDVAGWLGAKSEWEMLYKLAKDKDGRLPKDTVRAVYDGSLFYQLAAQ  223



>gb|EMS65539.1| hypothetical protein TRIUR3_09985 [Triticum urartu]
Length=229

 Score =   161 bits (407),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 109/170 (64%), Gaps = 1/170 (1%)
 Frame = +1

Query  124  TPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSP  303
            T L+KH  FFD ++DG++   ET+  FR +G GF  S   +TFI+ VL  ++RP +  + 
Sbjct  51   TALQKHAAFFDRDKDGVVTFSETYAAFRALGFGFASSTLSATFINGVLGPQTRP-ENDTA  109

Query  304  VFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKR  483
               I IENI   +HGSDSGAYD +G FV  K +  F K+G T  +ALTS EVDEL+   R
Sbjct  110  RMSIYIENIHKGIHGSDSGAYDSQGRFVPDKFDAAFAKHGKTVPDALTSAEVDELIAANR  169

Query  484  DPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEH  633
             P+DY GW  A+ EW++LY + KD  GLL K+   GVYDGSLF ++ +E 
Sbjct  170  QPSDYAGWAGASAEWKLLYSIGKDEDGLLRKDAARGVYDGSLFARVVQER  219



>ref|XP_010482957.1| PREDICTED: peroxygenase 2 isoform X1 [Camelina sativa]
Length=243

 Score =   161 bits (408),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 113/183 (62%), Gaps = 0/183 (0%)
 Frame = +1

Query  88   PYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVL  267
            P G    + +  + +++HV FFD + +GIIYP+ETF GF+ +G     S+ L+  IH+ L
Sbjct  52   PLGTPEHRHNGLSVMQQHVAFFDLDDNGIIYPYETFSGFQLLGFNLLASLILTACIHLAL  111

Query  268  SSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALT  447
            S  + PG LPSP FPI I NI    HGSDS  YD EG +  + +E +F+KY  T  + L+
Sbjct  112  SYATLPGWLPSPFFPIYIHNIHKAKHGSDSKTYDNEGRYTPANLELMFSKYARTVPDKLS  171

Query  448  SKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAK  627
              E+ ++    RD  D+ GW+ + +EW VLY+LA D +G L+KE +   +DGSLF+  AK
Sbjct  172  LGELWDMTEGNRDAFDFFGWLASKVEWGVLYVLASDEEGFLSKEAIRRCFDGSLFEYCAK  231

Query  628  EHA  636
             +A
Sbjct  232  NYA  234



>ref|XP_010438703.1| PREDICTED: peroxygenase 1-like [Camelina sativa]
Length=245

 Score =   161 bits (408),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 112/183 (61%), Gaps = 0/183 (0%)
 Frame = +1

Query  88   PYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVL  267
            PYG    K+   + L++HV FFD + +GIIYPWET+ G R +G     S+ ++  I++ L
Sbjct  53   PYGTPGHKNYGLSVLQQHVAFFDIDDNGIIYPWETYSGLRMLGFNIIGSLIIAAVINLAL  112

Query  268  SSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALT  447
            S  + PG LPSP FPI I NI    HGSDS  YD EG F+   +E IF+KY  T  + L+
Sbjct  113  SYATLPGWLPSPFFPIYIHNIHKSKHGSDSQTYDNEGRFMPVNLELIFSKYAKTLPDKLS  172

Query  448  SKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAK  627
              E+ ++    RD  D  GW+   +EW +LYLLA+D +G L+KE +   +DGSLF+  AK
Sbjct  173  LGELWDMTEGNRDAWDIFGWIAGKVEWGLLYLLARDEEGFLSKEAIRRCFDGSLFEYCAK  232

Query  628  EHA  636
             +A
Sbjct  233  IYA  235



>ref|XP_002864386.1| hypothetical protein ARALYDRAFT_495609 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40645.1| hypothetical protein ARALYDRAFT_495609 [Arabidopsis lyrata subsp. 
lyrata]
Length=243

 Score =   161 bits (408),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 114/183 (62%), Gaps = 0/183 (0%)
 Frame = +1

Query  88   PYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVL  267
            P G    + +  + L++HV FFD + +GIIYP+ETF GFR +G     S+ L+  I+I L
Sbjct  52   PQGTPEHRHNGLSVLQQHVAFFDLDDNGIIYPFETFTGFRLLGFNLLASLVLAAGINIAL  111

Query  268  SSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALT  447
            S  + PG LPSP+FPI I NI    HGSDS  YD EG +  + +E +F+KY  T ++ L+
Sbjct  112  SYATLPGWLPSPLFPIYIHNIHKAKHGSDSKTYDNEGRYTPANLELMFSKYARTVSDKLS  171

Query  448  SKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAK  627
              E+ ++    RD  D+ GW+ + +EW VLY LA D +G L+KE +   +DGSLF+  AK
Sbjct  172  LGELWDMTEGNRDAFDFFGWLASKVEWGVLYALASDEEGFLSKEAIRRCFDGSLFEYCAK  231

Query  628  EHA  636
             +A
Sbjct  232  NYA  234



>ref|XP_010448216.1| PREDICTED: peroxygenase 1-like [Camelina sativa]
Length=245

 Score =   161 bits (408),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 112/183 (61%), Gaps = 0/183 (0%)
 Frame = +1

Query  88   PYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVL  267
            PYG    K+   + L++HV FFD + +GIIYPWET+ G R +G     S+ ++  I++ L
Sbjct  53   PYGTPGHKNYGLSVLQQHVAFFDIDDNGIIYPWETYSGLRMLGFNIIGSLIIAAVINLAL  112

Query  268  SSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALT  447
            S  + PG LPSP FPI I NI    HGSDS  YD EG F+   +E IF+KY  T  + L+
Sbjct  113  SYATLPGWLPSPFFPIYIHNIHKSKHGSDSQTYDNEGRFMPVNLELIFSKYAKTLPDKLS  172

Query  448  SKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAK  627
              E+ ++    RD  D  GW+   +EW +LYLLA+D +G L+KE +   +DGSLF+  AK
Sbjct  173  LGELWDMTEGNRDAWDIFGWIAGKVEWGLLYLLARDEEGFLSKEAIRRCFDGSLFEYCAK  232

Query  628  EHA  636
             +A
Sbjct  233  IYA  235



>ref|XP_004152813.1| PREDICTED: peroxygenase-like [Cucumis sativus]
 ref|XP_004155108.1| PREDICTED: peroxygenase-like [Cucumis sativus]
 gb|KGN61288.1| hypothetical protein Csa_2G075960 [Cucumis sativus]
Length=239

 Score =   161 bits (408),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 116/198 (59%), Gaps = 4/198 (2%)
 Frame = +1

Query  46   KFPLYYMASSTSTKPY----GKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKI  213
            K P  Y+A + +        G    K +  + L++HV FFD + DGII P  T+ GFR +
Sbjct  32   KLPKPYLARALTAPDLENVNGTWNHKHNGMSVLQQHVSFFDQDGDGIIRPSHTYTGFRTL  91

Query  214  GGGFFLSVALSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVES  393
            G    +S     FIH  LS  + P  +PSP FPI ++NI    HGSDSG YD EG F+ +
Sbjct  92   GFNAIVSFFFMIFIHAALSYATLPTWIPSPFFPIHVKNIHRAKHGSDSGTYDTEGRFIPA  151

Query  394  KIEEIFNKYGHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLT  573
            ++E +F+KY  T  + LT +E+  + +  RD  D+ GWV + +EW  LY+LAKD  GLL+
Sbjct  152  QLENMFSKYARTRPDKLTLREIWHMTQANRDIFDFFGWVASKLEWGALYVLAKDENGLLS  211

Query  574  KERVIGVYDGSLFDQLAK  627
            KE V   +DGSLFD  AK
Sbjct  212  KEAVRRCFDGSLFDYCAK  229



>gb|KHN31490.1| Peroxygenase 2 [Glycine soja]
Length=240

 Score =   161 bits (407),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 109/178 (61%), Gaps = 0/178 (0%)
 Frame = +1

Query  94   GKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSS  273
            G    K ++ + L++HV FFD N DG++YP ET++GFR +G    LS   S  IH+ LS 
Sbjct  53   GTRGHKHNDMSVLQQHVSFFDLNNDGVVYPLETYKGFRALGFNVILSFIFSIGIHVTLSY  112

Query  274  KSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSK  453
             + P  LPSP FPI I+NI    HGSD+G YD EG F+ + +E IF+KY     + LT K
Sbjct  113  PTLPTWLPSPFFPIYIKNIHRAKHGSDTGTYDTEGRFMPANLEFIFSKYAREVPDKLTLK  172

Query  454  EVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAK  627
            E+  +    R   D+ GW  +  EW VLY+LA+D +G L+KE V   +DGSLF+  AK
Sbjct  173  ELWHMTEGNRVAYDFFGWAASKFEWGVLYVLARDEQGYLSKEAVRRCFDGSLFEYCAK  230



>emb|CDX85425.1| BnaC07g27360D [Brassica napus]
Length=238

 Score =   161 bits (407),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 112/187 (60%), Gaps = 0/187 (0%)
 Frame = +1

Query  94   GKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSS  273
            G    K ++ + L++HV FFD + DGIIYP ETF+GFR +G        L+  +H+ +S 
Sbjct  52   GTRGHKHNDMSVLQQHVAFFDQDGDGIIYPSETFRGFRALGFNVIFCFFLTFIVHLTMSY  111

Query  274  KSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSK  453
             + P  +P+  FPI I+NI    HGSD+  YD EG ++ + +E +F+KY  T  + LT  
Sbjct  112  ATSPTWMPTFTFPIYIKNIHRAKHGSDTSTYDTEGRYIPANLENMFSKYARTVPDKLTRY  171

Query  454  EVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEH  633
            E+ ++    R+  D+ GW  + +EW VLYLLAKD  G L+KE V   +DGSLFD  AK  
Sbjct  172  ELWQMTEANRNAFDFFGWAASKMEWGVLYLLAKDENGYLSKEAVRRCFDGSLFDYCAKSR  231

Query  634  APKIKAN  654
            A   KA+
Sbjct  232  AAPRKAD  238



>ref|NP_180896.1| caleosin 3 [Arabidopsis thaliana]
 sp|O22788.1|PXG3_ARATH RecName: Full=Probable peroxygenase 3; Short=AtPXG3; AltName: 
Full=Caleosin-3; AltName: Full=Protein RESPONSIVE TO DESICCATION 
20 [Arabidopsis thaliana]
 gb|AAB80656.1| RD20 protein [Arabidopsis thaliana]
 dbj|BAB16823.1| RD20 protein [Arabidopsis thaliana]
 gb|AAL32739.1| putative Ca2+-binding EF-hand protein [Arabidopsis thaliana]
 gb|AAL36320.1| putative calcium-binding EF-hand protein [Arabidopsis thaliana]
 gb|AAM13320.1| putative Ca2+-binding EF-hand protein [Arabidopsis thaliana]
 gb|AAM20045.1| putative calcium-binding EF-hand protein [Arabidopsis thaliana]
 gb|AEC08825.1| caleosin 3 [Arabidopsis thaliana]
Length=236

 Score =   161 bits (407),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 114/191 (60%), Gaps = 0/191 (0%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            +A+  +  P G         + +++HV FFD N DGI+YPWET++GFR +G     S+  
Sbjct  40   LAAPDTEHPNGTEGHDSKGMSVMQQHVAFFDQNDDGIVYPWETYKGFRDLGFNPISSIFW  99

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
            +  I++  S  + P  +PSP+ P+ I+NI    HGSDS  YD EG +V   +E IF+KY 
Sbjct  100  TLLINLAFSYVTLPSWVPSPLLPVYIDNIHKAKHGSDSSTYDTEGRYVPVNLENIFSKYA  159

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
             T  + L+ KEV  +    R   D  GW+   +EW +LY+LAKD  G L+KE V G +DG
Sbjct  160  LTVKDKLSFKEVWNVTEGNRMAIDPFGWLSNKVEWILLYILAKDEDGFLSKEAVRGCFDG  219

Query  604  SLFDQLAKEHA  636
            SLF+Q+AKE A
Sbjct  220  SLFEQIAKERA  230



>emb|CAE03380.1| OSJNBa0004N05.4 [Oryza sativa Japonica Group]
 emb|CAH68002.1| OSIGBa0157K09-H0214G12.13 [Oryza sativa Indica Group]
Length=243

 Score =   161 bits (407),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 107/167 (64%), Gaps = 0/167 (0%)
 Frame = +1

Query  130  LKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVF  309
            L++HV FFD + +GIIYPWET++G R +G    +S  ++  +++ +S  + PG LPSP F
Sbjct  69   LQQHVAFFDRDDNGIIYPWETYEGCRALGFNMIMSFLIALVVNVSMSYPTLPGWLPSPFF  128

Query  310  PIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDP  489
            PI I NI    HGSDSG YD EG F+    E IF+KY  T  + LT +EV ++    R+ 
Sbjct  129  PIYIHNIHRSKHGSDSGTYDNEGRFMPVNFENIFSKYARTSPDRLTYREVWQMTEGNREV  188

Query  490  NDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKE  630
             D  GW  A +EW +LY+LA+D +G L +E +  +YDGSLF+ +A +
Sbjct  189  LDLFGWFAAKLEWTILYVLARDEEGYLAREAIRRMYDGSLFEYVAMQ  235



>dbj|BAK07934.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=301

 Score =   162 bits (411),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 112/173 (65%), Gaps = 0/173 (0%)
 Frame = +1

Query  130  LKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVF  309
            L++HV FFD + +GIIYPWET+ G R +G   F+S  ++  +++V+S  + PG LP+P+F
Sbjct  127  LQQHVAFFDRDNNGIIYPWETYDGCRAVGFNVFMSAFIAFLVNLVMSYPTLPGWLPNPLF  186

Query  310  PIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDP  489
            PI + NI    HGSDSG  D+EG F+    E IF+KY  TY + L+ +E+  +    R+ 
Sbjct  187  PIYVHNIHKSKHGSDSGTCDKEGRFMPVNFENIFSKYARTYPDRLSYREMWRMTEGCREV  246

Query  490  NDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPKIK  648
             D+ GWV   +EW +LY LA+D +G L++E +  +YDGSLF+ + ++    +K
Sbjct  247  FDFFGWVAMKLEWSILYALARDDEGYLSREAIRRMYDGSLFEYMERQRMEHVK  299



>gb|ACG69529.1| caleosin CLO1-1 [Brassica napus]
 emb|CDX97363.1| BnaC08g12280D [Brassica napus]
Length=245

 Score =   161 bits (407),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 111/180 (62%), Gaps = 0/180 (0%)
 Frame = +1

Query  88   PYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVL  267
            PYG    K+   + L++HV FFD + +GIIYPWET+ G R IG     S+ ++  I++ L
Sbjct  53   PYGTPGHKNYGLSVLQQHVAFFDIDDNGIIYPWETYSGLRMIGFNIIGSLIIAAVINLAL  112

Query  268  SSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALT  447
            S  + PG LPSP FPI I NI    HGSDS  YD EG F+   +E IF+KY  T  + L+
Sbjct  113  SYATLPGWLPSPFFPIYIHNIHKSKHGSDSRTYDNEGRFMPVNLELIFSKYAKTLPDKLS  172

Query  448  SKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAK  627
              E+ ++   +RD  D  GW  + IEW +LYLLA+D +G L+KE +   +DGSLF+  AK
Sbjct  173  LGELWDMTEGQRDAWDIFGWFASKIEWGLLYLLARDEEGFLSKEAIRRCFDGSLFEYCAK  232



>gb|AAL36241.1| putative embryo-specific protein ATS1 [Arabidopsis thaliana]
Length=245

 Score =   161 bits (407),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 112/183 (61%), Gaps = 0/183 (0%)
 Frame = +1

Query  88   PYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVL  267
            PYG    K+   + L++HV FFD + +GIIYPWET+ G R +G     S+ ++  I++ L
Sbjct  53   PYGTPGHKNYGLSVLQQHVSFFDIDDNGIIYPWETYSGLRMLGFNIIGSLIIAAVINLTL  112

Query  268  SSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALT  447
            S  + PG LPSP FPI I NI    HGSDS  +D EG F+   +E IF+KY  T  + L+
Sbjct  113  SYATLPGWLPSPFFPIYIHNIHKSKHGSDSKTHDNEGRFMPVNLELIFSKYAKTLPDKLS  172

Query  448  SKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAK  627
              E+ E+    RD  D  GW+   IEW +LYLLA+D +G L+KE +   +DGSLF+  AK
Sbjct  173  LGELWEMTEGNRDAWDIFGWIAGKIEWGLLYLLARDEEGFLSKEAIRRCFDGSLFEYCAK  232

Query  628  EHA  636
             +A
Sbjct  233  IYA  235



>ref|NP_001048040.1| Os02g0734600 [Oryza sativa Japonica Group]
 dbj|BAD15887.1| putative calcium binding protein [Oryza sativa Japonica Group]
 dbj|BAD16163.1| putative calcium binding protein [Oryza sativa Japonica Group]
 dbj|BAF09954.1| Os02g0734600 [Oryza sativa Japonica Group]
Length=373

 Score =   164 bits (416),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 113/182 (62%), Gaps = 3/182 (2%)
 Frame = +1

Query  112  DDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGK  291
            D   T L+KH  FFD + DGI+   ET+ G R +G G  LS   + FI+ VLS K+RP  
Sbjct  193  DAGVTALQKHAAFFDKDGDGIVSLSETYDGLRALGLGSGLSSLSAAFINGVLSPKTRPDN  252

Query  292  LPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELL  471
              +P   I IENI   +HGSDS AYD EG FV  K EEIF K+  T  +ALTS E+DELL
Sbjct  253  GTAPRLSIYIENIYKGIHGSDSSAYDSEGRFVAEKFEEIFAKHAKTVPDALTSDEIDELL  312

Query  472  RDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPKIKA  651
            +  R P DY GWV A+ EW++LY + KD  GLL KE V  VYDGSLF +LA   A +I  
Sbjct  313  QANRKPGDYTGWVAASSEWKILYKIGKDKDGLLRKEAVREVYDGSLFTKLA---AARIND  369

Query  652  NN  657
             N
Sbjct  370  EN  371


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +1

Query  124  TPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRP  285
            T L+KH  FFD + DG + P ET+ G R +G G   S+  +  I+ VLS K+RP
Sbjct  54   TALQKHAAFFDKDNDGFVSPTETYDGLRALGLGAGFSILSAALINGVLSLKTRP  107



>gb|EPS58841.1| caleosin [Genlisea aurea]
Length=240

 Score =   160 bits (406),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 111/187 (59%), Gaps = 0/187 (0%)
 Frame = +1

Query  88   PYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVL  267
            P G    + D  + L++H  FFD + +GIIYPWET+ GFR+IG     S+ ++  I++ L
Sbjct  52   PNGTPGHRHDNLSVLQQHCAFFDQDDNGIIYPWETYAGFRQIGFNVIASLVMAAVINVAL  111

Query  268  SSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALT  447
            S  + PG +PSP FPI + NI    HGSD+  YD EG +  +  E IF+K+  T+ + LT
Sbjct  112  SYPTLPGWIPSPFFPIHLANIHRSKHGSDTKTYDNEGRYNPASFENIFSKHARTFPDKLT  171

Query  448  SKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAK  627
              E+  +    R+  D  GWV + +EW +L++LA+D  G L+KE +   YDGSLFD  A 
Sbjct  172  FGEMWGMTEANREAFDLFGWVASKMEWTILFVLARDRDGFLSKEAIRRCYDGSLFDYCAN  231

Query  628  EHAPKIK  648
             H  + K
Sbjct  232  LHQDQRK  238



>gb|EYU32581.1| hypothetical protein MIMGU_mgv1a012738mg [Erythranthe guttata]
Length=241

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 109/188 (58%), Gaps = 0/188 (0%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            M +  +  P G         + L++H  FFD + +GIIYPWET+ GFR+IG     S+ +
Sbjct  44   MVAPDTEHPNGTPGHMHHNMSVLQQHCAFFDQDNNGIIYPWETYTGFRQIGFNVIASLIM  103

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
            +  I++ LS  + PG  PSP FPI + NI    HGSDSG YD EG ++    E +F+KYG
Sbjct  104  AILINVGLSYPTLPGWFPSPFFPIYLCNIHRAKHGSDSGTYDTEGRYMPVNFENMFSKYG  163

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
              + + LT +E+  +    R+  D+ GWV    EW +LY+LA+D  G L+KE +   +DG
Sbjct  164  RAFPDKLTLRELWNMTEGNREAYDFFGWVANKFEWALLYILARDPDGFLSKEAIRRCFDG  223

Query  604  SLFDQLAK  627
            SLF+  A 
Sbjct  224  SLFEYCAN  231



>ref|XP_009357985.1| PREDICTED: peroxygenase-like [Pyrus x bretschneideri]
Length=241

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 119/207 (57%), Gaps = 4/207 (2%)
 Frame = +1

Query  19   KEIISNQPPKFPLYYM----ASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPW  186
            + + S+   K P  YM     +  +  P G    +  + + L++HV FFD + +GI+YPW
Sbjct  25   RRVRSDLETKLPKPYMPRALVAPDTDHPTGTVGHQHRDMSVLQQHVAFFDQDYNGIVYPW  84

Query  187  ETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAY  366
            ETF G R IG     SV ++  I+  LS  + PG +PSP FPI I NI    HGSDSG Y
Sbjct  85   ETFAGLRAIGFNLIASVVMTVLINGALSYPTLPGWIPSPFFPIHIYNIHKAKHGSDSGTY  144

Query  367  DREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLL  546
            D EG F    +E +F+KY HT  +  T  E+ ++    R   D+ GW+   +EW +LY+L
Sbjct  145  DTEGRFSPVNLENMFSKYAHTVPDRFTLGELWKMTEGNRLGYDFFGWIANKLEWGLLYVL  204

Query  547  AKDGKGLLTKERVIGVYDGSLFDQLAK  627
            A+D +G+L+KE V   +DGSLF+  A+
Sbjct  205  ARDEEGMLSKEAVRRCFDGSLFEYCAR  231



>ref|XP_004247935.1| PREDICTED: peroxygenase [Solanum lycopersicum]
Length=246

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 108/176 (61%), Gaps = 0/176 (0%)
 Frame = +1

Query  88   PYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVL  267
            P G      +  + L++H  FFD + +GI+YPWET+ G R+IG    +S  ++  I+ VL
Sbjct  57   PNGTSGHSHNGMSVLQQHAAFFDQDDNGIVYPWETYSGLRQIGFNVIVSFIVAIMINSVL  116

Query  268  SSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALT  447
            S  + PG  PSP+ PI I NI    HGSDSG YDREG F+    E IF+KY  T  + L+
Sbjct  117  SYPTIPGWFPSPLLPIYIHNIHKGKHGSDSGTYDREGRFLPVHFENIFSKYARTVPDKLS  176

Query  448  SKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFD  615
              E+  + +  RD  D++GW+ + +EW +LYLLA+D  G L+KE +   +DGSLFD
Sbjct  177  FGELWNMTQANRDTYDFLGWIASKLEWGLLYLLARDEDGFLSKEAIRRCFDGSLFD  232



>ref|XP_010449309.1| PREDICTED: peroxygenase 2-like [Camelina sativa]
Length=243

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 113/183 (62%), Gaps = 0/183 (0%)
 Frame = +1

Query  88   PYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVL  267
            P G    + +  + +++HV FFD + +GIIYP+ETF GF+ +G     S+ L+  IHI L
Sbjct  52   PLGTPEHRHNGLSVMQQHVAFFDLDDNGIIYPYETFSGFQLLGFNLLASLILTACIHIAL  111

Query  268  SSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALT  447
            S  + PG LPSP FPI + NI    HGSDS  YD EG +  + +E +F+KY  T  + L+
Sbjct  112  SYATLPGWLPSPFFPIYMHNIHKAKHGSDSKTYDNEGRYTPANLELMFSKYARTVPDKLS  171

Query  448  SKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAK  627
              E+ ++    RD  D+ GW+ + +EW VLY+LA D +G L+KE +   +DGSLF+  A+
Sbjct  172  LGELWDMTEGNRDAFDFFGWLASKVEWGVLYVLASDEEGFLSKEAIRRCFDGSLFEYCAR  231

Query  628  EHA  636
             +A
Sbjct  232  NYA  234



>emb|CDX79524.1| BnaC03g18600D [Brassica napus]
Length=239

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/198 (42%), Positives = 117/198 (59%), Gaps = 2/198 (1%)
 Frame = +1

Query  64   MASSTSTKPYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVAL  243
            +A+  +  P G         + +++HV FFD N DGI+YPWET+ G R +G      +  
Sbjct  40   LAAPDTEHPNGTEGHDSKGMSVMQQHVAFFDQNGDGIVYPWETYAGLRDLGFNPISCIFW  99

Query  244  STFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYG  423
            S  +++  S  + P  LPSP+ P+ I+NI    HGSDS  YD EG FV + +E IF+KY 
Sbjct  100  SLIVNLAFSYVTLPSWLPSPLLPVYIDNIHKAKHGSDSSTYDTEGRFVPANLENIFSKYA  159

Query  424  HTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDG  603
             T ++ L+ KE+  L    R   D  GWV   +EW +LYLLAKD +G ++KE V G +DG
Sbjct  160  LTVSDKLSFKELWNLTEGNRMAIDPFGWVSNKVEWLLLYLLAKDEEGFVSKEAVRGCFDG  219

Query  604  SLFDQLAKEHAPKIKANN  657
            SLFD  AK++  K KAN+
Sbjct  220  SLFDYCAKQN--KEKANS  235



>ref|XP_010675145.1| PREDICTED: peroxygenase [Beta vulgaris subsp. vulgaris]
Length=239

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 114/198 (58%), Gaps = 4/198 (2%)
 Frame = +1

Query  46   KFPLYYMASSTSTKPY----GKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKI  213
            K P  Y+A +T         G    K  + + L++HV FFD N DGI+YP ETF+GFR +
Sbjct  32   KLPKPYLARATVAADIDNVNGTLNHKHHDMSVLQQHVAFFDQNGDGILYPIETFKGFRSL  91

Query  214  GGGFFLSVALSTFIHIVLSSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVES  393
            G     S      +H+ +S  + P  +PS +FPI I+NI    HGSDS  YD EG F+  
Sbjct  92   GFNVVASFFNMLLVHLTMSYATSPSWMPSLLFPIYIQNIHKAKHGSDSATYDTEGRFIPV  151

Query  394  KIEEIFNKYGHTYTNALTSKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLT  573
             IE IF+KY HT  + LT KE+ ++    R+  D+ GW+ +  EW  LY LAKD +G L+
Sbjct  152  NIENIFSKYSHTVPDKLTFKEIWKMTEANRNAFDFFGWMASKAEWVGLYYLAKDDEGFLS  211

Query  574  KERVIGVYDGSLFDQLAK  627
            KE V   +DGSLF+  AK
Sbjct  212  KESVRRCFDGSLFEYCAK  229



>ref|XP_009129806.1| PREDICTED: peroxygenase 2 [Brassica rapa]
 emb|CDY33890.1| BnaA02g30970D [Brassica napus]
Length=238

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 111/187 (59%), Gaps = 0/187 (0%)
 Frame = +1

Query  94   GKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSS  273
            G    K  + + L++HV FFD + DGIIYP ETF+GFR +G     S  L+  +H+ +S 
Sbjct  52   GTRGHKHQDMSVLQQHVAFFDQDGDGIIYPSETFRGFRALGFNVIFSFFLTFIVHLTMSY  111

Query  274  KSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSK  453
             + P  +PS  FPI I+NI    HGSD+  YD EG ++ + +E +F+KY  T  + LT  
Sbjct  112  ATLPSWIPSFSFPIYIKNIHRAKHGSDTSTYDTEGRYIPANLENMFSKYARTVPDKLTRY  171

Query  454  EVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEH  633
            E+ ++    R+  D+ GW  + +EW VLYLLAKD  G L+KE V   +DGSLFD  AK  
Sbjct  172  ELWQMTEANRNAFDFFGWAASKMEWGVLYLLAKDENGYLSKEAVRRCFDGSLFDYCAKSR  231

Query  634  APKIKAN  654
            A   K +
Sbjct  232  ASSKKTD  238



>ref|XP_008218348.1| PREDICTED: peroxygenase [Prunus mume]
Length=241

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 107/178 (60%), Gaps = 0/178 (0%)
 Frame = +1

Query  94   GKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSS  273
            G    K    + L++H  FFD ++DGIIYP ET++GFR +G     S      +H  +S 
Sbjct  54   GTWGHKHCNMSVLQQHAAFFDQDKDGIIYPSETYRGFRALGFNVVASFIFMVLVHAAMSY  113

Query  274  KSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSK  453
             + P  +PSP F I IENI    HGSDSGAYD EG ++ + +E +F+KY  T  + LT K
Sbjct  114  ATLPTWMPSPYFAIHIENIHRAKHGSDSGAYDTEGRYIPANLENLFSKYACTVPDKLTFK  173

Query  454  EVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAK  627
            E+  + +  RD  D+ GW+ + +EW VLY+LAKD  G L KE V   +DGSLF+  AK
Sbjct  174  ELWHMTQANRDAFDFFGWIASKLEWGVLYVLAKDEHGYLAKEAVRRCFDGSLFEYCAK  231



>emb|CDY05610.1| BnaC02g39270D [Brassica napus]
Length=238

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 111/187 (59%), Gaps = 0/187 (0%)
 Frame = +1

Query  94   GKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSS  273
            G    K  + + L++HV FFD + DGIIYP ETF+GFR +G     S  L+  +H+ +S 
Sbjct  52   GTRGHKHQDMSVLQQHVAFFDQDGDGIIYPSETFKGFRALGFNVIFSFFLTFIVHLTMSY  111

Query  274  KSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSK  453
             + P  +PS  FPI I+NI    HGSD+  YD EG ++ + +E +F+KY  T  + LT  
Sbjct  112  ATLPSWIPSFSFPIYIKNIHRAKHGSDTSTYDTEGRYIPANLENMFSKYARTVPDKLTRY  171

Query  454  EVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEH  633
            E+ ++    R+  D+ GW  + +EW VLYLLAKD  G L+KE V   +DGSLFD  AK  
Sbjct  172  ELWQMTEANRNAFDFFGWAASKMEWGVLYLLAKDENGYLSKEAVRRCFDGSLFDYCAKSR  231

Query  634  APKIKAN  654
            A   K +
Sbjct  232  ASSKKTD  238



>gb|ABK26902.1| unknown [Picea sitchensis]
Length=236

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 107/171 (63%), Gaps = 0/171 (0%)
 Frame = +1

Query  130  LKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVF  309
            L++HV FFD N+DGIIYPWET+QGFR IG    +S+     I++ LS  +    +PS + 
Sbjct  63   LQQHVAFFDRNKDGIIYPWETYQGFRAIGFNIPISLVAGLLINLTLSYPTSSSWIPSLLL  122

Query  310  PIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDP  489
            PI I+NI    HGSDS  YD EG FV +K + IF+KY  T+ +  T  E+  +L+  R+ 
Sbjct  123  PIHIDNIHKGKHGSDSEVYDTEGRFVPAKFDAIFSKYACTFPDKFTYSELQAMLKANRNV  182

Query  490  NDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPK  642
            ND  GW  A  EW  LY LAK+ +G L KE +  +YDGSLF+   K++A +
Sbjct  183  NDLFGWGAARAEWSFLYNLAKNKEGFLDKETLRALYDGSLFEYFEKQYASR  233



>ref|XP_002454327.1| hypothetical protein SORBIDRAFT_04g028730 [Sorghum bicolor]
 gb|EES07303.1| hypothetical protein SORBIDRAFT_04g028730 [Sorghum bicolor]
Length=222

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 106/182 (58%), Gaps = 0/182 (0%)
 Frame = +1

Query  94   GKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSS  273
            G+   +    TPL KH  FFD N DG++   ET+  FR +G GF +S   + FI+  L S
Sbjct  31   GRATAQGPGATPLSKHASFFDRNGDGVVSFEETYGAFRALGFGFGMSGVSAAFINGALGS  90

Query  274  KSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSK  453
            K RP    S    I IE+I    HGSDSG+YD EG FV  K E IF  +  T  +ALTS 
Sbjct  91   KCRPQNATSSKLDIYIEDIYKGKHGSDSGSYDTEGRFVPDKFEAIFANHAKTVPDALTSD  150

Query  454  EVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEH  633
            E+D+LL+  R+P DY GW  A  EW++LY L K+  GLL K+    VYDG+LF +LA   
Sbjct  151  EIDQLLQANREPGDYTGWAGAEAEWKILYSLGKNQNGLLHKDVARSVYDGTLFHRLAPNW  210

Query  634  AP  639
             P
Sbjct  211  KP  212



>emb|CDX94289.1| BnaC01g18950D [Brassica napus]
Length=245

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 112/183 (61%), Gaps = 0/183 (0%)
 Frame = +1

Query  88   PYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVL  267
            PYG    K+   + L++HV FFD + +GIIYPWET+ G R +G    +S+  +  I++ L
Sbjct  53   PYGTPGHKNYGLSVLQQHVAFFDLDDNGIIYPWETYSGLRMLGFNIIVSLIAAAVINLAL  112

Query  268  SSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALT  447
            S  +  G  PSP FPI I NI    HGSDS  YD EG F+   +E IF+KY  T  + L+
Sbjct  113  SYATLTGWFPSPFFPIYIHNIHKSKHGSDSRTYDNEGRFMPVNLELIFSKYAKTLPDKLS  172

Query  448  SKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAK  627
              E+ E+ + +RD  D  GW  + IEW +LYLLA+D +G L+KE +   +DGSLF+  AK
Sbjct  173  LGELWEMTQGQRDAWDIFGWFASKIEWGLLYLLARDEEGFLSKEAIRRCFDGSLFEYCAK  232

Query  628  EHA  636
             +A
Sbjct  233  IYA  235



>ref|XP_007205801.1| hypothetical protein PRUPE_ppa010656mg [Prunus persica]
 gb|EMJ07000.1| hypothetical protein PRUPE_ppa010656mg [Prunus persica]
Length=241

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 106/174 (61%), Gaps = 0/174 (0%)
 Frame = +1

Query  106  EKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRP  285
             K    + L++H  FFD ++DGIIYP ET++GFR +G     S      +H  +S  + P
Sbjct  58   HKHCNMSVLQQHAAFFDQDKDGIIYPSETYRGFRALGFNVVASFIFMVLVHAAMSYATLP  117

Query  286  GKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDE  465
              +PSP F I IENI    HGSDSGAYD EG ++ + +E +F+KY  T  + LT KE+  
Sbjct  118  TWMPSPYFAIHIENIHRAKHGSDSGAYDTEGRYIPANLENLFSKYACTVPDKLTFKELWH  177

Query  466  LLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAK  627
            + +  RD  D+ GW+ + +EW VLY+LAKD  G L KE V   +DGSLF+  AK
Sbjct  178  MTQANRDAFDFFGWIASKLEWGVLYVLAKDEHGHLAKEAVRRCFDGSLFEYCAK  231



>gb|ACG69531.1| caleosin CLO1-7 [Brassica napus]
 gb|ACG69532.1| caleosin CLO1-8 [Brassica napus]
 gb|ACG69534.1| caleosin CLO1-9 [Brassica napus]
 gb|ACG69535.1| caleosin CLO1-10 [Brassica napus]
Length=245

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 112/183 (61%), Gaps = 0/183 (0%)
 Frame = +1

Query  88   PYGKGMEKDDETTPLKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVL  267
            PYG    K+   + L++HV FFD + +GIIYPWET+ G R +G    +S+  +  I++ L
Sbjct  53   PYGTPGHKNYGLSVLQQHVAFFDLDDNGIIYPWETYSGLRMLGFNIIVSLIAAAVINLAL  112

Query  268  SSKSRPGKLPSPVFPIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALT  447
            S  +  G  PSP FPI I NI    HGSDS  YD EG F+   +E IF+KY  T  + L+
Sbjct  113  SYATLTGWFPSPFFPIYIHNIHKSKHGSDSRTYDNEGRFMPVNLELIFSKYAKTLPDKLS  172

Query  448  SKEVDELLRDKRDPNDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAK  627
              E+ E+ + +RD  D  GW  + IEW +LYLLA+D +G L+KE +   +DGSLF+  AK
Sbjct  173  LGELWEMTQGQRDAWDIFGWFASKIEWGLLYLLARDEEGFLSKEAIRRCFDGSLFEYCAK  232

Query  628  EHA  636
             +A
Sbjct  233  IYA  235



>ref|NP_001142815.1| uncharacterized protein LOC100275194 precursor [Zea mays]
 gb|ACG26909.1| hypothetical protein [Zea mays]
Length=219

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 108/175 (62%), Gaps = 4/175 (2%)
 Frame = +1

Query  136  KHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVFPI  315
            KH  FFD + DG++   ET+  FR +G G  LS   + FI+  L SK RP    S    I
Sbjct  44   KHASFFDRDGDGVVSFAETYGAFRALGFGLGLSSVSAAFINGALGSKCRPQNATSSKLDI  103

Query  316  VIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDPND  495
             IE+I+   HGSDSG+YD +G FV  K EEIF ++  T  +ALTS E+D+LL+  R+P D
Sbjct  104  YIEDIRRGKHGSDSGSYDAQGRFVPEKFEEIFARHARTVPDALTSDEIDQLLQANREPGD  163

Query  496  YMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKEHAPKIKANNS  660
            Y GW  A  EW++LY L KDG GLL K+    VYDG+LF +L    AP+ K+ +S
Sbjct  164  YSGWAGAEAEWKILYSLGKDGDGLLRKDVARSVYDGTLFHRL----APRWKSPDS  214



>ref|NP_001174012.1| Os04g0510900 [Oryza sativa Japonica Group]
 dbj|BAH92740.1| Os04g0510900, partial [Oryza sativa Japonica Group]
Length=310

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 107/167 (64%), Gaps = 0/167 (0%)
 Frame = +1

Query  130  LKKHVMFFDSNQDGIIYPWETFQGFRKIGGGFFLSVALSTFIHIVLSSKSRPGKLPSPVF  309
            L++HV FFD + +GIIYPWET++G R +G    +S  ++  +++ +S  + PG LPSP F
Sbjct  136  LQQHVAFFDRDDNGIIYPWETYEGCRALGFNMIMSFLIALVVNVSMSYPTLPGWLPSPFF  195

Query  310  PIVIENIKLDLHGSDSGAYDREGNFVESKIEEIFNKYGHTYTNALTSKEVDELLRDKRDP  489
            PI I NI    HGSDSG YD EG F+    E IF+KY  T  + LT +EV ++    R+ 
Sbjct  196  PIYIHNIHRSKHGSDSGTYDNEGRFMPVNFENIFSKYARTSPDRLTYREVWQMTEGNREV  255

Query  490  NDYMGWVLAAIEWRVLYLLAKDGKGLLTKERVIGVYDGSLFDQLAKE  630
             D  GW  A +EW +LY+LA+D +G L +E +  +YDGSLF+ +A +
Sbjct  256  LDLFGWFAAKLEWTILYVLARDEEGYLAREAIRRMYDGSLFEYVAMQ  302



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1936310281356