BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c28476_g1_i1 len=661 path=[1:0-660]

Length=661
                                                                      Score     E

ref|XP_009339334.1|  PREDICTED: 60S ribosomal protein L18a-like p...  77.8    2e-14   
ref|XP_009797438.1|  PREDICTED: 60S ribosomal protein L18a-like p...  74.7    3e-13   
ref|XP_009602246.1|  PREDICTED: 60S ribosomal protein L18a-like p...  74.3    3e-13   
ref|XP_008366539.1|  PREDICTED: uncharacterized protein LOC103430181  72.4    1e-12   
ref|XP_008359377.1|  PREDICTED: 60S ribosomal protein L18a-like p...  71.6    1e-12   
gb|EPS69618.1|  hypothetical protein M569_05151                       72.0    2e-12   
ref|XP_008344840.1|  PREDICTED: 60S ribosomal protein L18a-like p...  72.0    2e-12   
ref|XP_006477943.1|  PREDICTED: 60S ribosomal protein L18a-like p...  72.4    3e-12   
ref|XP_002440256.1|  hypothetical protein SORBIDRAFT_09g028580        71.2    4e-12   Sorghum bicolor [broomcorn]
dbj|BAJ92800.1|  predicted protein                                    71.6    5e-12   
ref|XP_008452440.1|  PREDICTED: 60S ribosomal protein L18a-like p...  70.9    5e-12   
ref|XP_009611991.1|  PREDICTED: 60S ribosomal protein L18a-like p...  70.9    6e-12   
gb|KDO49360.1|  hypothetical protein CISIN_1g028338mg                 71.2    6e-12   
ref|XP_009602245.1|  PREDICTED: 60S ribosomal protein L18a-like p...  70.9    7e-12   
ref|XP_007212185.1|  hypothetical protein PRUPE_ppa012738mg           70.5    8e-12   
ref|XP_004300671.1|  PREDICTED: 60S ribosomal protein L18a-1-like     70.5    8e-12   
ref|XP_004146004.1|  PREDICTED: 60S ribosomal protein L18a-1-like     70.1    8e-12   
ref|XP_006349990.1|  PREDICTED: 60S ribosomal protein L18a-like p...  70.5    9e-12   
ref|NP_001148379.1|  60S ribosomal protein L18A                       70.1    1e-11   Zea mays [maize]
ref|XP_010552159.1|  PREDICTED: 60S ribosomal protein L18a-like p...  70.5    1e-11   
ref|XP_004251838.1|  PREDICTED: 60S ribosomal protein L18a-like p...  69.7    1e-11   
ref|XP_011082821.1|  PREDICTED: 60S ribosomal protein L18a-like p...  69.3    1e-11   
ref|XP_004961208.1|  PREDICTED: 60S ribosomal protein L18a-like       72.0    1e-11   
ref|XP_006442291.1|  hypothetical protein CICLE_v10022163mg           70.1    2e-11   
ref|XP_006442290.1|  hypothetical protein CICLE_v10022163mg           70.1    2e-11   
ref|XP_009786994.1|  PREDICTED: 60S ribosomal protein L18a-like p...  68.9    2e-11   
ref|XP_010916061.1|  PREDICTED: 60S ribosomal protein L18a-like p...  68.9    2e-11   
ref|XP_008784431.1|  PREDICTED: 60S ribosomal protein L18a-like p...  68.9    2e-11   
ref|XP_006442289.1|  hypothetical protein CICLE_v10022163mg           69.3    3e-11   
ref|NP_001141281.1|  uncharacterized protein LOC100273370             68.6    4e-11   Zea mays [maize]
ref|XP_008226221.1|  PREDICTED: 60S ribosomal protein L18a-like p...  68.6    4e-11   
emb|CDP06077.1|  unnamed protein product                              68.2    4e-11   
emb|CAN75635.1|  hypothetical protein VITISV_044171                   67.8    5e-11   Vitis vinifera
ref|XP_007022107.1|  60S ribosomal protein L18a, plant, putative      68.2    5e-11   
ref|XP_009404413.1|  PREDICTED: 60S ribosomal protein L18a-like p...  67.8    6e-11   
gb|ADR71269.1|  60S ribosomal protein L18aA                           67.4    8e-11   
gb|AAT77403.1|  unknown protein                                       65.5    8e-11   Oryza sativa Japonica Group [Japonica rice]
emb|CDM82498.1|  unnamed protein product                              67.4    8e-11   
ref|XP_002458280.1|  hypothetical protein SORBIDRAFT_03g030610        67.8    9e-11   Sorghum bicolor [broomcorn]
ref|XP_010324739.1|  PREDICTED: 60S ribosomal protein L18a-like p...  66.2    9e-11   
ref|XP_010542334.1|  PREDICTED: 60S ribosomal protein L18a-like p...  67.4    9e-11   
ref|XP_007212180.1|  hypothetical protein PRUPE_ppa012647mg           67.4    1e-10   
ref|XP_002268796.1|  PREDICTED: 60S ribosomal protein L18a-like p...  67.0    1e-10   Vitis vinifera
ref|XP_010316932.1|  PREDICTED: 60S ribosomal protein L18a-like p...  67.0    1e-10   
ref|XP_009421480.1|  PREDICTED: 60S ribosomal protein L18a-like p...  67.0    1e-10   
gb|KHG21168.1|  60S ribosomal L18a-1 -like protein                    67.0    1e-10   
gb|ADR71270.1|  60S ribosomal protein L18aB                           67.0    1e-10   
ref|XP_009631155.1|  PREDICTED: 60S ribosomal protein L18a-like p...  66.6    1e-10   
ref|XP_002530136.1|  60S ribosomal protein L18a, plant, putative      67.0    1e-10   Ricinus communis
ref|XP_008358616.1|  PREDICTED: 60S ribosomal protein L18a-like p...  67.0    1e-10   
ref|XP_008383488.1|  PREDICTED: 60S ribosomal protein L18a-like p...  67.0    1e-10   
ref|XP_010231018.1|  PREDICTED: 60S ribosomal protein L18a-like p...  67.0    1e-10   
ref|XP_010092747.1|  60S ribosomal protein L18a-1                     66.6    2e-10   
ref|XP_009147591.1|  PREDICTED: 60S ribosomal protein L18a-like p...  66.6    2e-10   
ref|NP_001150536.1|  60S ribosomal protein L18A                       66.2    2e-10   Zea mays [maize]
emb|CDY24088.1|  BnaA06g00860D                                        66.6    2e-10   
gb|ABR18279.1|  unknown                                               66.2    2e-10   Picea sitchensis
ref|XP_006365546.1|  PREDICTED: 60S ribosomal protein L18a-like p...  66.2    2e-10   
ref|XP_008371597.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...  68.6    2e-10   
gb|ABK23722.1|  unknown                                               66.2    2e-10   Picea sitchensis
ref|XP_002298923.1|  hypothetical protein POPTR_0001s38920g           66.2    2e-10   Populus trichocarpa [western balsam poplar]
emb|CDY45120.1|  BnaC06g06410D                                        66.2    2e-10   
ref|XP_011045581.1|  PREDICTED: 60S ribosomal protein L18a-like p...  66.2    2e-10   
gb|EAY99038.1|  hypothetical protein OsI_20996                        66.6    2e-10   Oryza sativa Indica Group [Indian rice]
emb|CAN82659.1|  hypothetical protein VITISV_011978                   65.9    2e-10   Vitis vinifera
ref|XP_007149347.1|  hypothetical protein PHAVU_005G062800g           66.2    2e-10   
ref|XP_008225468.1|  PREDICTED: 60S ribosomal protein L18a isofor...  68.2    2e-10   
ref|XP_008656728.1|  PREDICTED: 60S ribosomal protein L18a-like p...  66.6    2e-10   
ref|NP_001056334.2|  Os05g0564800                                     65.5    3e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010924381.1|  PREDICTED: 60S ribosomal protein L18a-like p...  65.9    3e-10   
gb|EEE64705.1|  hypothetical protein OsJ_19560                        66.2    3e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006416745.1|  hypothetical protein EUTSA_v10008982mg           65.9    3e-10   
ref|XP_009360876.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...  68.2    3e-10   
ref|XP_008798294.1|  PREDICTED: 60S ribosomal protein L18a-like p...  65.5    3e-10   
ref|XP_002894447.1|  hypothetical protein ARALYDRAFT_474484           65.5    3e-10   
gb|EAY73248.1|  hypothetical protein OsI_01125                        66.2    4e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_006366095.1|  PREDICTED: 60S ribosomal protein L18a-like p...  65.5    4e-10   
ref|XP_002276545.1|  PREDICTED: 60S ribosomal protein L18a isofor...  67.4    4e-10   Vitis vinifera
ref|XP_006449677.1|  hypothetical protein CICLE_v10017045mg           65.1    4e-10   
ref|XP_010542335.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...  67.4    5e-10   
ref|XP_010479925.1|  PREDICTED: 60S ribosomal protein L18a-like p...  65.1    5e-10   
ref|NP_564634.1|  ribosomal protein L18ae family                      65.1    5e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006366094.1|  PREDICTED: 60S ribosomal protein L18a-like p...  65.5    5e-10   
ref|XP_010324738.1|  PREDICTED: 60S ribosomal protein L18a-like p...  65.1    5e-10   
ref|XP_006449676.1|  hypothetical protein CICLE_v10017045mg           65.1    5e-10   
ref|NP_001042559.1|  Os01g0242900                                     65.1    5e-10   Oryza sativa Japonica Group [Japonica rice]
gb|AAM63092.1|  unknown                                               65.1    5e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009799851.1|  PREDICTED: 60S ribosomal protein L18a-like p...  65.9    6e-10   
gb|KCW67644.1|  hypothetical protein EUGRSUZ_F01391                   63.9    6e-10   
gb|KDP45083.1|  hypothetical protein JCGZ_20159                       64.7    6e-10   
ref|XP_010694550.1|  PREDICTED: 60S ribosomal protein L18a-like p...  64.7    7e-10   
ref|XP_010275122.1|  PREDICTED: 60S ribosomal protein L18a-like p...  64.7    7e-10   
gb|EYU38220.1|  hypothetical protein MIMGU_mgv1a0157612mg             64.3    7e-10   
ref|XP_008345152.1|  PREDICTED: uncharacterized protein LOC103408066  65.5    7e-10   
ref|XP_010064524.1|  PREDICTED: 60S ribosomal protein L18a-like p...  63.5    8e-10   
ref|XP_004293559.1|  PREDICTED: 60S ribosomal protein L18a-like       67.0    8e-10   
ref|XP_006655591.1|  PREDICTED: 60S ribosomal protein L18a-like p...  64.7    9e-10   
ref|XP_006841638.1|  hypothetical protein AMTR_s00003p00234550        64.7    1e-09   
ref|XP_009344639.1|  PREDICTED: 60S ribosomal protein L18a-like p...  64.3    1e-09   
ref|XP_009410943.1|  PREDICTED: 60S ribosomal protein L18a-like p...  64.3    1e-09   
ref|XP_010918896.1|  PREDICTED: 60S ribosomal protein L18a-like p...  64.3    1e-09   
ref|XP_004147407.1|  PREDICTED: 60S ribosomal protein L18a-1-like     63.9    1e-09   
gb|KDO78151.1|  hypothetical protein CISIN_1g045574mg                 63.9    1e-09   
ref|XP_010462252.1|  PREDICTED: 60S ribosomal protein L18a-like p...  63.9    1e-09   
ref|XP_008444018.1|  PREDICTED: 60S ribosomal protein L18a-like p...  63.9    1e-09   
gb|KFK35717.1|  hypothetical protein AALP_AA4G028000                  63.9    1e-09   
ref|XP_003569522.1|  PREDICTED: 60S ribosomal protein L18a-like p...  64.3    1e-09   
gb|EMS57717.1|  Hydroxyacylglutathione hydrolase 3, mitochondrial     66.2    2e-09   
dbj|BAK01175.1|  predicted protein                                    63.5    2e-09   
emb|CDX83927.1|  BnaC08g17180D                                        63.5    2e-09   
gb|EYU33349.1|  hypothetical protein MIMGU_mgv1a015356mg              63.5    2e-09   
ref|XP_010666371.1|  PREDICTED: 60S ribosomal protein L18a-like p...  63.5    2e-09   
ref|XP_011096542.1|  PREDICTED: 60S ribosomal protein L18a-like p...  63.2    2e-09   
ref|XP_009110429.1|  PREDICTED: 60S ribosomal protein L18a-like p...  63.2    2e-09   
ref|XP_010537685.1|  PREDICTED: 60S ribosomal protein L18a-like p...  63.2    2e-09   
ref|XP_006644489.1|  PREDICTED: 60S ribosomal protein L18a-like p...  63.5    2e-09   
ref|XP_009389940.1|  PREDICTED: 60S ribosomal protein L18a-like p...  63.2    2e-09   
ref|XP_006304250.1|  hypothetical protein CARUB_v10010472mg           63.5    2e-09   
gb|ABU98949.1|  unknown                                               63.2    3e-09   Lupinus albus
ref|XP_008784423.1|  PREDICTED: 60S ribosomal protein L18a-like p...  63.2    3e-09   
dbj|BAJ99681.1|  predicted protein                                    63.2    3e-09   
ref|NP_564013.1|  ribosomal protein L18ae family protein              62.8    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008811097.1|  PREDICTED: 60S ribosomal protein L18a-like p...  60.8    4e-09   
ref|XP_006467486.1|  PREDICTED: 60S ribosomal protein L18a-2-like...  64.7    4e-09   
gb|KFK35719.1|  hypothetical protein AALP_AA4G028100                  62.4    4e-09   
gb|KFK35718.1|  hypothetical protein AALP_AA4G028100                  62.4    5e-09   
ref|XP_010916066.1|  PREDICTED: 60S ribosomal protein L18a-like p...  62.4    5e-09   
ref|XP_002519698.1|  60S ribosomal protein L18a, putative             64.3    5e-09   Ricinus communis
ref|XP_010498049.1|  PREDICTED: 60S ribosomal protein L18a-like p...  62.0    5e-09   
ref|XP_010476841.1|  PREDICTED: 60S ribosomal protein L18a-like p...  62.0    5e-09   
ref|XP_010501008.1|  PREDICTED: 60S ribosomal protein L18a-like p...  62.0    6e-09   
ref|XP_006305734.1|  hypothetical protein CARUB_v10010518mg           62.0    7e-09   
gb|KHG29377.1|  60S ribosomal L18a-1 -like protein                    62.0    7e-09   
ref|XP_010549483.1|  PREDICTED: 60S ribosomal protein L18a-like p...  61.6    9e-09   
ref|XP_010064523.1|  PREDICTED: 60S ribosomal protein L18a-like p...  62.0    9e-09   
ref|XP_004969469.1|  PREDICTED: 60S ribosomal protein L18a-1-like     61.6    1e-08   
gb|KCW75928.1|  hypothetical protein EUGRSUZ_D00303                   60.8    1e-08   
ref|XP_010459270.1|  PREDICTED: 60S ribosomal protein L18a-like p...  60.8    1e-08   
ref|XP_009135389.1|  PREDICTED: 60S ribosomal protein L18a-like p...  60.5    1e-08   
ref|XP_009389994.1|  PREDICTED: 60S ribosomal protein L18a-like p...  60.8    2e-08   
ref|NP_001043806.1|  Os01g0667100                                     61.2    2e-08   Oryza sativa Japonica Group [Japonica rice]
gb|KDP37962.1|  hypothetical protein JCGZ_04605                       60.8    2e-08   
emb|CDX75777.1|  BnaC03g38600D                                        60.1    2e-08   
ref|XP_004967333.1|  PREDICTED: 60S ribosomal protein L18a-1-like...  60.8    2e-08   
ref|XP_010052072.1|  PREDICTED: 60S ribosomal protein L18a-2-like...  62.8    2e-08   
dbj|BAJ94702.1|  predicted protein                                    60.1    3e-08   
gb|KCW67650.1|  hypothetical protein EUGRSUZ_F013971                  59.3    3e-08   
ref|XP_004967334.1|  PREDICTED: 60S ribosomal protein L18a-1-like...  59.7    4e-08   
ref|XP_010549484.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...  61.6    4e-08   
gb|KFK44822.1|  hypothetical protein AALP_AA1G307300                  59.7    5e-08   
ref|XP_008386394.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...  58.9    5e-08   
ref|XP_010241284.1|  PREDICTED: 60S ribosomal protein L18a-like p...  59.3    8e-08   
ref|XP_006392780.1|  hypothetical protein EUTSA_v10011841mg           58.9    9e-08   
ref|XP_010062750.1|  PREDICTED: 60S ribosomal protein L18a-like p...  58.5    1e-07   
ref|XP_010501981.1|  PREDICTED: 60S ribosomal protein L18a-like p...  57.8    2e-07   
ref|XP_009118121.1|  PREDICTED: 60S ribosomal protein L18a-like p...  57.8    2e-07   
ref|XP_003568798.1|  PREDICTED: 60S ribosomal protein L18a-like p...  57.8    2e-07   
gb|KCW69886.1|  hypothetical protein EUGRSUZ_F03217                   58.5    2e-07   
ref|NP_564343.1|  60S ribosomal protein L18a-1                        57.8    2e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CDY21766.1|  BnaA09g45170D                                        57.4    2e-07   
gb|AFK49106.1|  unknown                                               57.4    2e-07   
emb|CDX81802.1|  BnaC08g37990D                                        57.4    3e-07   
ref|XP_001783148.1|  predicted protein                                57.0    3e-07   
gb|AAM65804.1|  60S ribosomal protein L18A, putative                  57.0    3e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001057602.2|  Os06g0359400                                     57.0    4e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010478372.1|  PREDICTED: 60S ribosomal protein L18a-like p...  57.0    4e-07   
ref|XP_010499516.1|  PREDICTED: 60S ribosomal protein L18a-like p...  57.0    4e-07   
ref|XP_006656069.1|  PREDICTED: 60S ribosomal protein L18a-like p...  56.6    5e-07   
ref|XP_010110993.1|  60S ribosomal protein L18a-1                     57.8    6e-07   
ref|XP_010460776.1|  PREDICTED: 60S ribosomal protein L18a-like p...  56.2    7e-07   
ref|XP_009115203.1|  PREDICTED: 60S ribosomal protein L18a-like p...  56.2    1e-06   
emb|CDY26303.1|  BnaA09g26540D                                        55.8    1e-06   
ref|XP_010487261.1|  PREDICTED: 60S ribosomal protein L18a-like p...  55.5    1e-06   
gb|AAG52055.1|AC022455_9  60S ribosomal protein L18A, putative; 2...  57.8    1e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CDX98477.1|  BnaC05g38980D                                        55.5    1e-06   
ref|XP_009146341.1|  PREDICTED: 60S ribosomal protein L18a-like p...  55.5    1e-06   
ref|XP_006407064.1|  hypothetical protein EUTSA_v10021729mg           55.5    1e-06   
ref|XP_002893593.1|  60S ribosomal protein L18A-1                     57.8    1e-06   
ref|NP_001077626.1|  60S ribosomal protein L18a-1                     57.4    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006645697.1|  PREDICTED: 60S ribosomal protein L18a-like p...  53.9    2e-06   
ref|XP_010465350.1|  PREDICTED: 60S ribosomal protein L18a-like p...  54.7    2e-06   
gb|KFK43899.1|  hypothetical protein AALP_AA1G188400                  54.7    2e-06   
ref|XP_006306031.1|  hypothetical protein CARUB_v10011327mg           56.6    3e-06   
ref|XP_002969760.1|  hypothetical protein SELMODRAFT_440940           54.3    4e-06   
ref|XP_006298504.1|  hypothetical protein CARUB_v10014581mg           55.5    4e-06   
ref|XP_006415527.1|  hypothetical protein EUTSA_v10009933mg           55.8    6e-06   
gb|EAY75299.1|  hypothetical protein OsI_03190                        55.8    6e-06   Oryza sativa Indica Group [Indian rice]
emb|CDX99868.1|  BnaC05g22900D                                        52.4    2e-05   
gb|KFK38817.1|  hypothetical protein AALP_AA3G164200                  52.4    2e-05   
ref|XP_007147892.1|  hypothetical protein PHAVU_006G163700g           52.4    2e-05   
ref|XP_006597529.1|  PREDICTED: 60S ribosomal protein L18a-like p...  52.0    2e-05   
ref|XP_001759098.1|  predicted protein                                52.0    3e-05   
ref|XP_006348354.1|  PREDICTED: 60S ribosomal protein L18a-like p...  50.1    1e-04   
ref|XP_006348353.1|  PREDICTED: 60S ribosomal protein L18a-like p...  50.1    2e-04   
ref|XP_006348352.1|  PREDICTED: 60S ribosomal protein L18a-like p...  50.1    3e-04   
ref|XP_008808927.1|  PREDICTED: 60S ribosomal protein L18a-like p...  47.4    6e-04   
ref|XP_008808931.1|  PREDICTED: 60S ribosomal protein L18a-like p...  47.4    6e-04   
ref|XP_004488664.1|  PREDICTED: 60S ribosomal protein L18a-1-like     48.1    7e-04   
gb|KEH38467.1|  transmembrane protein, putative                       48.1    8e-04   
ref|XP_004244309.1|  PREDICTED: 60S ribosomal protein L18a-like p...  48.5    8e-04   
gb|ABK23978.1|  unknown                                               47.0    8e-04   Picea sitchensis



>ref|XP_009339334.1| PREDICTED: 60S ribosomal protein L18a-like protein [Pyrus x bretschneideri]
Length=159

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +R LPCCGCG GWC+F+ GFFL T+PWY+ AFIL+C R+  REKPGY
Sbjct  88   ERRLPCCGCGLGWCLFIIGFFLATVPWYVGAFILLCARIDPREKPGY  134



>ref|XP_009797438.1| PREDICTED: 60S ribosomal protein L18a-like protein [Nicotiana 
sylvestris]
Length=177

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 52/66 (79%), Gaps = 1/66 (2%)
 Frame = +3

Query  222  LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGR-VGRREKPGYiactiaavaataaLI  398
            LPCCG G GW +F++GFFL  IPWY+AAFIL+C R V  REKPGY+  TIAAV AT A++
Sbjct  112  LPCCGIGLGWFLFITGFFLAAIPWYVAAFILLCTRSVDHREKPGYVTSTIAAVLATIAIV  171

Query  399  YGLYRL  416
            +GL R+
Sbjct  172  FGLTRI  177



>ref|XP_009602246.1| PREDICTED: 60S ribosomal protein L18a-like protein isoform X3 
[Nicotiana tomentosiformis]
Length=158

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +3

Query  222  LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGR-VGRREKPGYiactiaavaataaLI  398
            LPCCG G GW +F++GFFLV IPWY+AAFIL+C R V  REKPGY+ CTIAAV AT A++
Sbjct  93   LPCCGIGLGWFLFITGFFLVAIPWYVAAFILLCTRSVDHREKPGYVTCTIAAVLATIAIV  152

Query  399  YGLYRL  416
            +GL R+
Sbjct  153  FGLTRI  158



>ref|XP_008366539.1| PREDICTED: uncharacterized protein LOC103430181 [Malus domestica]
Length=157

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +R LPCCG G GWC+F+ GF L T+PWY+ AFIL+C R+  REKPGY
Sbjct  86   ERRLPCCGFGLGWCLFIIGFVLATVPWYVGAFILLCARIDPREKPGY  132



>ref|XP_008359377.1| PREDICTED: 60S ribosomal protein L18a-like protein [Malus domestica]
Length=116

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +R LPCCG G GWC+F+ GF L T+PWY+ AFIL+C R+  REKPGY
Sbjct  45   ERRLPCCGFGLGWCLFIIGFVLATVPWYVGAFILLCARIDPREKPGY  91



>gb|EPS69618.1| hypothetical protein M569_05151 [Genlisea aurea]
Length=149

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGYiactiaavaataa  392
             R LPCCG G GW +F+ GFFL  IPWY+AA IL+C RV  REKPGYIAC+IAA  AT A
Sbjct  80   QRRLPCCGIGFGWFLFIIGFFLGAIPWYVAALILVCSRVDIREKPGYIACSIAAGLATIA  139

Query  393  LIYGLYRL  416
            +I+GL R+
Sbjct  140  IIFGLTRI  147



>ref|XP_008344840.1| PREDICTED: 60S ribosomal protein L18a-like protein [Malus domestica]
Length=159

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +R LPCCG G GWC+F+ GF L T+PWY+ AFIL+C R+  REKPGY
Sbjct  88   ERRLPCCGFGLGWCLFIIGFVLATVPWYVGAFILLCARIDPREKPGY  134



>ref|XP_006477943.1| PREDICTED: 60S ribosomal protein L18a-like protein-like [Citrus 
sinensis]
 gb|KDO49359.1| hypothetical protein CISIN_1g028338mg [Citrus sinensis]
Length=210

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGYiactiaavaataa  392
            +R LPCCG G GWC+F+ GFFL TIPWY+  F+L+C R+  REKPGYIACTIAAV AT A
Sbjct  139  ERRLPCCGLGVGWCLFILGFFLGTIPWYVGLFVLMCARIDIREKPGYIACTIAAVLATIA  198

Query  393  LIYGLYR  413
            +I G+ +
Sbjct  199  IILGVTK  205



>ref|XP_002440256.1| hypothetical protein SORBIDRAFT_09g028580 [Sorghum bicolor]
 gb|EES18686.1| hypothetical protein SORBIDRAFT_09g028580 [Sorghum bicolor]
Length=174

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 38/47 (81%), Gaps = 1/47 (2%)
 Frame = +3

Query  216  RPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRV-GRREKPGY  353
            R LPCCG G GWC+F++GFFL  IPWYI AFILIC RV  +REKPGY
Sbjct  103  RRLPCCGLGLGWCLFITGFFLAAIPWYIGAFILICVRVHDQREKPGY  149



>dbj|BAJ92800.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK01354.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=203

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 1/47 (2%)
 Frame = +3

Query  216  RPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRV-GRREKPGY  353
            RPLPCCG G GW +F++GFFL  IPWYI AFILIC RV   REKPGY
Sbjct  132  RPLPCCGLGMGWLLFIAGFFLAAIPWYIGAFILICVRVHDHREKPGY  178



>ref|XP_008452440.1| PREDICTED: 60S ribosomal protein L18a-like protein [Cucumis melo]
Length=153

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGYiactiaavaataa  392
            + PLPCCG G GW +F+ GFFL  IPWY  A +++CGRV  REKPGY+AC+IAAV AT A
Sbjct  82   EPPLPCCGIGIGWFLFIIGFFLAAIPWYAGAILILCGRVDYREKPGYVACSIAAVIATLA  141

Query  393  LIYGLYR  413
            +I+G  R
Sbjct  142  IIFGATR  148



>ref|XP_009611991.1| PREDICTED: 60S ribosomal protein L18a-like protein [Nicotiana 
tomentosiformis]
Length=160

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 54/74 (73%), Gaps = 5/74 (7%)
 Frame = +3

Query  207  PDDRP-----LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGYiactia  371
            P+ RP     LPCCG G GW +F+ GFFL  IPWY+AAF+L+C ++  REKPGYI CTIA
Sbjct  86   PEGRPEREHRLPCCGIGLGWFLFIIGFFLAGIPWYLAAFVLLCAQIDPREKPGYITCTIA  145

Query  372  avaataaLIYGLYR  413
            AV AT  LI+GL +
Sbjct  146  AVLATFVLIFGLSK  159



>gb|KDO49360.1| hypothetical protein CISIN_1g028338mg [Citrus sinensis]
Length=191

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +R LPCCG G GWC+F+ GFFL TIPWY+  F+L+C R+  REKPGY
Sbjct  139  ERRLPCCGLGVGWCLFILGFFLGTIPWYVGLFVLMCARIDIREKPGY  185



>ref|XP_009602245.1| PREDICTED: 60S ribosomal protein L18a-like protein isoform X2 
[Nicotiana tomentosiformis]
Length=176

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 37/45 (82%), Gaps = 1/45 (2%)
 Frame = +3

Query  222  LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGR-VGRREKPGY  353
            LPCCG G GW +F++GFFLV IPWY+AAFIL+C R V  REKPGY
Sbjct  93   LPCCGIGLGWFLFITGFFLVAIPWYVAAFILLCTRSVDHREKPGY  137



>ref|XP_007212185.1| hypothetical protein PRUPE_ppa012738mg [Prunus persica]
 gb|EMJ13384.1| hypothetical protein PRUPE_ppa012738mg [Prunus persica]
Length=157

 Score = 70.5 bits (171),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +R LPCCG G GW +F+ GFFL T+PWYI A I++C R+  REKPGY
Sbjct  86   ERRLPCCGIGCGWFLFIIGFFLATVPWYIGALIMLCARIDHREKPGY  132



>ref|XP_004300671.1| PREDICTED: 60S ribosomal protein L18a-1-like [Fragaria vesca 
subsp. vesca]
Length=161

 Score = 70.5 bits (171),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +R LPCCG G GWC+F+ GFFL  IPWY+   IL+C R+  REKPGY
Sbjct  90   ERRLPCCGLGLGWCLFIIGFFLAAIPWYVGVIILVCSRIDYREKPGY  136



>ref|XP_004146004.1| PREDICTED: 60S ribosomal protein L18a-1-like [Cucumis sativus]
 ref|XP_004169021.1| PREDICTED: 60S ribosomal protein L18a-1-like [Cucumis sativus]
 gb|KGN55009.1| hypothetical protein Csa_4G621210 [Cucumis sativus]
Length=153

 Score = 70.1 bits (170),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +3

Query  192  LLGGAPDDRP-LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGYiacti  368
            ++ G P   P LPCCG G GW +F+ GFFL  IPWY  A ++ICGRV  REKPGY+AC+I
Sbjct  74   IVEGRPVREPRLPCCGIGIGWFLFIIGFFLAAIPWYAGAILIICGRVDYREKPGYVACSI  133

Query  369  aavaataaLIYGLYR  413
            AAV AT A+I+G  R
Sbjct  134  AAVIATVAIIFGATR  148



>ref|XP_006349990.1| PREDICTED: 60S ribosomal protein L18a-like protein-like [Solanum 
tuberosum]
Length=164

 Score = 70.5 bits (171),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 53/74 (72%), Gaps = 5/74 (7%)
 Frame = +3

Query  207  PDDRP-----LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGYiactia  371
            P+ RP     LPCCG G GW +F+ GF L  IPWY+AAF+L+C ++  REKPGYIA TIA
Sbjct  90   PEGRPERHHHLPCCGIGLGWFLFIIGFLLAGIPWYLAAFVLLCAQIDPREKPGYIASTIA  149

Query  372  avaataaLIYGLYR  413
            AV AT  L++GL +
Sbjct  150  AVLATFVLVFGLSK  163



>ref|NP_001148379.1| 60S ribosomal protein L18A [Zea mays]
 gb|ACG31219.1| 60S ribosomal protein L18A [Zea mays]
 gb|ACN35761.1| unknown [Zea mays]
 gb|AFW81140.1| 60S ribosomal protein L18A [Zea mays]
Length=168

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 1/47 (2%)
 Frame = +3

Query  216  RPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVG-RREKPGY  353
            R LPCCG G GWC+F++GFFL  IPWYI AF+LIC RV   REKPGY
Sbjct  97   RRLPCCGLGLGWCLFIAGFFLAAIPWYIGAFVLICVRVHDHREKPGY  143



>ref|XP_010552159.1| PREDICTED: 60S ribosomal protein L18a-like protein [Tarenaya 
hassleriana]
Length=191

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = +3

Query  198  GGAPDDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGYiactiaav  377
            G  P +R LPCCG GTGW  F+ GF L  IPWYI +FIL+C R+  REKPGYIACTIAAV
Sbjct  115  GRPPRERRLPCCGIGTGWFCFIIGFILGAIPWYIGSFILLCARIDPREKPGYIACTIAAV  174

Query  378  aataaLIYGL  407
             AT A+I+G+
Sbjct  175  LATIAIIFGV  184



>ref|XP_004251838.1| PREDICTED: 60S ribosomal protein L18a-like protein [Solanum lycopersicum]
Length=164

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 52/74 (70%), Gaps = 5/74 (7%)
 Frame = +3

Query  207  PDDRP-----LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGYiactia  371
            P+ RP     LPCCG G GW +F+ GF L  IPWY+AAF+L+C ++  REKPGYI  TIA
Sbjct  90   PEGRPERHHRLPCCGIGLGWFLFIIGFLLAGIPWYLAAFVLLCAQIDPREKPGYIVSTIA  149

Query  372  avaataaLIYGLYR  413
            AV AT  L++GL +
Sbjct  150  AVLATFVLVFGLSK  163



>ref|XP_011082821.1| PREDICTED: 60S ribosomal protein L18a-like protein [Sesamum indicum]
Length=148

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGYiactiaavaataa  392
            +R LPCCG G GW +F+ GFFL  IPWY+   +L+C R+  REKPGY+ACTIAAV AT A
Sbjct  78   ERRLPCCGIGIGWFLFIIGFFLAAIPWYVGVLLLLCSRIDPREKPGYVACTIAAVLATIA  137

Query  393  LIYGLYRL  416
             I+GL R+
Sbjct  138  AIFGLTRI  145



>ref|XP_004961208.1| PREDICTED: 60S ribosomal protein L18a-like [Setaria italica]
Length=339

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 1/47 (2%)
 Frame = +3

Query  216  RPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRV-GRREKPGY  353
            R LPCCG G GWC+F++GFFL  IPWY+ AFI+IC RV   REKPGY
Sbjct  114  RRLPCCGLGLGWCLFITGFFLAAIPWYVGAFIMICVRVHDHREKPGY  160



>ref|XP_006442291.1| hypothetical protein CICLE_v10022163mg [Citrus clementina]
 gb|ESR55531.1| hypothetical protein CICLE_v10022163mg [Citrus clementina]
Length=210

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGYiactiaavaataa  392
            +R LPCCG G GWC+F+ GFFL  IPWY+  F+L+C R+  REKPGYIACTIAAV AT A
Sbjct  139  ERRLPCCGLGVGWCLFILGFFLGAIPWYVGLFVLMCARIDIREKPGYIACTIAAVLATIA  198

Query  393  LIYGLYR  413
            +I G+ +
Sbjct  199  IILGVTK  205



>ref|XP_006442290.1| hypothetical protein CICLE_v10022163mg [Citrus clementina]
 gb|ESR55530.1| hypothetical protein CICLE_v10022163mg [Citrus clementina]
Length=219

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +R LPCCG G GWC+F+ GFFL  IPWY+  F+L+C R+  REKPGY
Sbjct  139  ERRLPCCGLGVGWCLFILGFFLGAIPWYVGLFVLMCARIDIREKPGY  185



>ref|XP_009786994.1| PREDICTED: 60S ribosomal protein L18a-like protein [Nicotiana 
sylvestris]
Length=149

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 53/74 (72%), Gaps = 5/74 (7%)
 Frame = +3

Query  207  PDDRP-----LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGYiactia  371
            P+ RP     LPCCG G GW +F+ GFFL  IPWY+ AF+L+C ++  REKPGYI CTIA
Sbjct  75   PEGRPEREHRLPCCGIGLGWFLFIIGFFLAGIPWYLGAFVLLCAQIDPREKPGYITCTIA  134

Query  372  avaataaLIYGLYR  413
            AV AT  LI+GL +
Sbjct  135  AVLATFVLIFGLSK  148



>ref|XP_010916061.1| PREDICTED: 60S ribosomal protein L18a-like protein [Elaeis guineensis]
Length=157

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +3

Query  189  PLLGGAPDDRP-LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPG  350
            P++ G P   P LPCCGCG GW +F+ GFFL  IPWY+ AF+L+C R+  REKPG
Sbjct  77   PVVEGRPLREPRLPCCGCGIGWFLFIIGFFLAAIPWYVGAFLLLCARIDYREKPG  131



>ref|XP_008784431.1| PREDICTED: 60S ribosomal protein L18a-like protein [Phoenix dactylifera]
Length=156

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +3

Query  189  PLLGGAPDDRP-LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPG  350
            P++ G P   P LPCCGCG GW +F+ GFFL  IPWY+ AF+L+C R+  REKPG
Sbjct  76   PVVEGRPLREPRLPCCGCGIGWFLFIIGFFLAAIPWYVGAFLLLCARIDYREKPG  130



>ref|XP_006442289.1| hypothetical protein CICLE_v10022163mg [Citrus clementina]
 gb|ESR55529.1| hypothetical protein CICLE_v10022163mg [Citrus clementina]
Length=191

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +R LPCCG G GWC+F+ GFFL  IPWY+  F+L+C R+  REKPGY
Sbjct  139  ERRLPCCGLGVGWCLFILGFFLGAIPWYVGLFVLMCARIDIREKPGY  185



>ref|NP_001141281.1| uncharacterized protein LOC100273370 [Zea mays]
 gb|ACF85953.1| unknown [Zea mays]
 gb|AFW79176.1| hypothetical protein ZEAMMB73_076793 [Zea mays]
Length=169

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 1/47 (2%)
 Frame = +3

Query  216  RPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRV-GRREKPGY  353
            R LPCCG G GWC+F++GFFL  IPW+I AF+LIC RV  +REKPGY
Sbjct  98   RRLPCCGLGLGWCLFITGFFLAAIPWFIGAFVLICVRVHDQREKPGY  144



>ref|XP_008226221.1| PREDICTED: 60S ribosomal protein L18a-like protein [Prunus mume]
Length=161

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +R LPCCG G GW +F+ GF L TIPWYI A I++C R+  REKPGY
Sbjct  90   ERRLPCCGIGCGWFLFIIGFVLATIPWYIGALIMLCARIDHREKPGY  136



>emb|CDP06077.1| unnamed protein product [Coffea canephora]
Length=162

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
             R LPCCG G GW +F+ GFFL  IPWY AAFI++C +V  REKPGY
Sbjct  93   QRRLPCCGIGLGWFLFIIGFFLAAIPWYFAAFIILCAKVDPREKPGY  139



>emb|CAN75635.1| hypothetical protein VITISV_044171 [Vitis vinifera]
Length=141

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +R LPCCG G GW +F+ GFFL  +PWY+  F+L+C RV  REKPGY
Sbjct  73   ERRLPCCGIGLGWFLFIIGFFLAAVPWYVGFFLLLCARVDYREKPGY  119



>ref|XP_007022107.1| 60S ribosomal protein L18a, plant, putative [Theobroma cacao]
 gb|EOY13632.1| 60S ribosomal protein L18a, plant, putative [Theobroma cacao]
Length=163

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +R LPCCG G GW +F+ GFFL  IPWYI  FIL+C R+  REKPGY
Sbjct  92   ERRLPCCGIGIGWFLFIIGFFLGAIPWYIGLFILVCARIDYREKPGY  138



>ref|XP_009404413.1| PREDICTED: 60S ribosomal protein L18a-like protein [Musa acuminata 
subsp. malaccensis]
Length=148

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +3

Query  189  PLLGGAPDDRP-LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPG  350
            P++ G P   P LPCCG G GW +F+ GFFL  IPWY+ AFIL+C R+  REKPG
Sbjct  68   PVVEGRPLRLPRLPCCGLGIGWLLFIIGFFLAAIPWYVGAFILLCARIDYREKPG  122



>gb|ADR71269.1| 60S ribosomal protein L18aA [Hevea brasiliensis]
Length=151

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGYiactiaavaataa  392
            +R LPCCG G GW +F+ GFFL  IPWY+  F+L+C R+  REKPGYIACTIAAV AT A
Sbjct  81   ERRLPCCGIGVGWFLFIIGFFLGAIPWYVGLFVLLCARIDPREKPGYIACTIAAVLATVA  140

Query  393  LIYGLYR  413
            +I G+ +
Sbjct  141  IILGVTK  147



>gb|AAT77403.1| unknown protein [Oryza sativa Japonica Group]
Length=73

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 36/47 (77%), Gaps = 1/47 (2%)
 Frame = +3

Query  216  RPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGR-REKPGY  353
            R LPCCG G GW +F++GFFL  IPWY+ AFILIC RV   REKPGY
Sbjct  2    RRLPCCGLGLGWLLFIAGFFLAAIPWYVGAFILICVRVHDYREKPGY  48



>emb|CDM82498.1| unnamed protein product [Triticum aestivum]
Length=149

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 38/58 (66%), Gaps = 2/58 (3%)
 Frame = +3

Query  186  QPLLGGAPDDRP--LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            Q    GA   RP  LPCCG G GW +F+ GFFL  IPWY+ AF+L C RV  REKPGY
Sbjct  67   QDYEAGARGHRPDRLPCCGIGMGWFLFIIGFFLGAIPWYVGAFLLWCSRVDYREKPGY  124



>ref|XP_002458280.1| hypothetical protein SORBIDRAFT_03g030610 [Sorghum bicolor]
 gb|EES03400.1| hypothetical protein SORBIDRAFT_03g030610 [Sorghum bicolor]
Length=186

 Score = 67.8 bits (164),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 35/47 (74%), Gaps = 1/47 (2%)
 Frame = +3

Query  216  RPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGR-REKPGY  353
            RPLPCCG G GW +F+ GFF   IPWYI AF+LIC RV   REKPGY
Sbjct  115  RPLPCCGLGMGWFLFILGFFFAAIPWYIGAFVLICVRVHDYREKPGY  161



>ref|XP_010324739.1| PREDICTED: 60S ribosomal protein L18a-like protein isoform X2 
[Solanum lycopersicum]
Length=101

 Score = 66.2 bits (160),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +  LPCCG G GW +F+ GFFL  IPWYI AF+L+C R+  REKPG+
Sbjct  30   EHRLPCCGMGIGWFLFIIGFFLGAIPWYIGAFLLLCARLDYREKPGF  76



>ref|XP_010542334.1| PREDICTED: 60S ribosomal protein L18a-like protein isoform X2 
[Tarenaya hassleriana]
Length=162

 Score = 67.4 bits (163),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +3

Query  198  GGAPDDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGYiactiaav  377
            GG P +  LPCCG G GW +F+ G FL  IPWYI + +L+C R+  REKPGYIAC IAAV
Sbjct  86   GGPPREHRLPCCGIGCGWFLFIIGIFLGAIPWYIGSLVLLCSRIDPREKPGYIACAIAAV  145

Query  378  aataaLIYGL  407
             AT  +I+G+
Sbjct  146  LATIVIIFGV  155



>ref|XP_007212180.1| hypothetical protein PRUPE_ppa012647mg [Prunus persica]
 gb|EMJ13379.1| hypothetical protein PRUPE_ppa012647mg [Prunus persica]
Length=160

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  210  DDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
             +R LPCCG G GW +F+ GFFL  IPWY+  FIL+C RV  REKPGY
Sbjct  88   HERRLPCCGMGIGWLLFIIGFFLGGIPWYVGTFILLCVRVDYREKPGY  135



>ref|XP_002268796.1| PREDICTED: 60S ribosomal protein L18a-like protein [Vitis vinifera]
 emb|CBI22126.3| unnamed protein product [Vitis vinifera]
Length=143

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +R LPCCG G GW +F+ GFFL  +PWY+  F+L+C RV  REKPGY
Sbjct  73   ERRLPCCGIGLGWFLFIIGFFLAAVPWYVGFFLLLCARVDYREKPGY  119



>ref|XP_010316932.1| PREDICTED: 60S ribosomal protein L18a-like protein [Solanum lycopersicum]
Length=154

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPG  350
            +  LPCCG G GW +F+SGFFL TIPWY+ AF+L+C R+  REK G
Sbjct  83   EHRLPCCGVGIGWVLFISGFFLGTIPWYVGAFLLLCVRIDYREKAG  128



>ref|XP_009421480.1| PREDICTED: 60S ribosomal protein L18a-like protein [Musa acuminata 
subsp. malaccensis]
Length=158

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +3

Query  192  LLGGAPDDRP-LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPG  350
            ++ G P+  P LPCCG G GW +F+ GFFL  IPWY+  F L+C RV  REKPG
Sbjct  83   VVEGRPETLPSLPCCGLGIGWVLFIIGFFLAAIPWYVGVFFLLCARVDHREKPG  136



>gb|KHG21168.1| 60S ribosomal L18a-1 -like protein [Gossypium arboreum]
Length=153

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +R LPCCG G GW +F+ GFFL  IPWYI  F+L+C R+  REKPGY
Sbjct  83   ERRLPCCGIGFGWFLFIIGFFLGAIPWYIGLFVLLCARIDYREKPGY  129



>gb|ADR71270.1| 60S ribosomal protein L18aB [Hevea brasiliensis]
Length=158

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +3

Query  186  QPLLGGAPDDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGYiact  365
            Q + G    +R LPCCG G GW +F+ GFFL  IPW+I  F+L+C R+  REKPGYIACT
Sbjct  78   QTVTGRPVRERRLPCCGIGVGWFLFIIGFFLGAIPWFIGLFVLLCARIDPREKPGYIACT  137

Query  366  iaavaataaLIYGLYR  413
            IAAV AT A+I G  +
Sbjct  138  IAAVVATVAIILGATK  153



>ref|XP_009631155.1| PREDICTED: 60S ribosomal protein L18a-like protein [Nicotiana 
tomentosiformis]
Length=155

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  222  LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPG  350
            LPCCG G GW +F+SGFFL T+PWYI AF+L+C R+  REKPG
Sbjct  87   LPCCGMGIGWFLFISGFFLGTVPWYIGAFLLLCVRIDYREKPG  129



>ref|XP_002530136.1| 60S ribosomal protein L18a, plant, putative [Ricinus communis]
 gb|EEF32252.1| 60S ribosomal protein L18a, plant, putative [Ricinus communis]
Length=166

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +R LPCCG G GW +F+ GFFL  IPWY+  FIL+C R+  REKPGY
Sbjct  95   ERRLPCCGIGVGWFLFIIGFFLGAIPWYVGLFILLCARIDPREKPGY  141



>ref|XP_008358616.1| PREDICTED: 60S ribosomal protein L18a-like protein [Malus domestica]
Length=177

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +R LPCCG G GW +F++GFFL  IPWY+  FIL+C +V  REKPGY
Sbjct  102  ERRLPCCGIGIGWLLFIAGFFLGGIPWYVGTFILLCVQVDYREKPGY  148



>ref|XP_008383488.1| PREDICTED: 60S ribosomal protein L18a-like protein [Malus domestica]
Length=177

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +R LPCCG G GW +F++GFFL  IPWY+  FIL+C +V  REKPGY
Sbjct  102  ERRLPCCGIGIGWLLFIAGFFLGGIPWYVGTFILLCVQVDYREKPGY  148



>ref|XP_010231018.1| PREDICTED: 60S ribosomal protein L18a-like protein [Brachypodium 
distachyon]
Length=178

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 36/47 (77%), Gaps = 1/47 (2%)
 Frame = +3

Query  216  RPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGR-REKPGY  353
            R LPCCG G GW +F++GFFL  IPWYI AF+LIC RV   REKPGY
Sbjct  107  RRLPCCGLGMGWLLFIAGFFLAAIPWYIGAFVLICVRVHDYREKPGY  153



>ref|XP_010092747.1| 60S ribosomal protein L18a-1 [Morus notabilis]
 gb|EXB52092.1| 60S ribosomal protein L18a-1 [Morus notabilis]
Length=160

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +R LPCCG G GW +F+ GFFL  +PWY  A IL+C R+  REKPGY
Sbjct  89   ERRLPCCGIGIGWFLFIIGFFLAGVPWYAGALILLCSRIDYREKPGY  135



>ref|XP_009147591.1| PREDICTED: 60S ribosomal protein L18a-like protein [Brassica 
rapa]
Length=153

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +3

Query  222  LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGYiactiaavaataaLIY  401
            LPCCG G GW +F++GF L +IPWYI  FIL+C ++  REKPGYIAC IAAV AT A+++
Sbjct  84   LPCCGIGIGWFLFITGFLLGSIPWYIGVFILVCAKINPREKPGYIACAIAAVLATIAIVF  143

Query  402  GL  407
            G 
Sbjct  144  GF  145



>ref|NP_001150536.1| 60S ribosomal protein L18A [Zea mays]
 ref|XP_008672950.1| PREDICTED: 60S ribosomal protein L18A isoform X1 [Zea mays]
 gb|ACG39463.1| 60S ribosomal protein L18A [Zea mays]
 tpg|DAA53177.1| TPA: 60S ribosomal protein L18A [Zea mays]
Length=132

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 36/51 (71%), Gaps = 1/51 (2%)
 Frame = +3

Query  201  GAPDDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            G   DR LPCCG G GW +F+ GFFL  IPWY+ AF+L C RV  REKPGY
Sbjct  58   GRSHDR-LPCCGIGFGWFLFIVGFFLGAIPWYVGAFLLCCSRVDYREKPGY  107



>emb|CDY24088.1| BnaA06g00860D [Brassica napus]
Length=153

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +3

Query  222  LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGYiactiaavaataaLIY  401
            LPCCG G GW +F++GF L +IPWYI  FIL+C ++  REKPGYIAC IAAV AT A+++
Sbjct  84   LPCCGIGIGWFLFITGFLLGSIPWYIGVFILVCAKINPREKPGYIACAIAAVLATIAIVF  143

Query  402  GL  407
            G 
Sbjct  144  GF  145



>gb|ABR18279.1| unknown [Picea sitchensis]
Length=151

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPG  350
            +R LPCCG G GW +F+ GFFL +IPWY+ AF+L+C R   REKPG
Sbjct  80   ERRLPCCGIGLGWALFIIGFFLASIPWYVGAFLLLCVRQDYREKPG  125



>ref|XP_006365546.1| PREDICTED: 60S ribosomal protein L18a-like protein-like [Solanum 
tuberosum]
Length=154

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPG  350
            +  LPCCG G GW +F+SGFFL TIPWY+ AF+L+C R+  REK G
Sbjct  83   EHRLPCCGVGIGWFLFISGFFLGTIPWYVGAFLLLCVRIDYREKAG  128



>ref|XP_008371597.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X2 [Malus domestica]
Length=315

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +3

Query  192  LLGGAP-DDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            ++ G P  +R LPCCG G GW +F++GFFL  IPWY+  FIL+C +V  REKPGY
Sbjct  82   VVEGRPVSERRLPCCGIGIGWLLFITGFFLGGIPWYVGTFILLCVQVDYREKPGY  136



>gb|ABK23722.1| unknown [Picea sitchensis]
Length=153

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPG  350
            +R LPCCG G GW +F+ GFFL +IPWY+ AF+L+C R   REKPG
Sbjct  82   ERRLPCCGIGLGWALFIIGFFLASIPWYVGAFLLLCVRQDYREKPG  127



>ref|XP_002298923.1| hypothetical protein POPTR_0001s38920g [Populus trichocarpa]
 gb|ABK95219.1| unknown [Populus trichocarpa]
 gb|EEE83728.1| hypothetical protein POPTR_0001s38920g [Populus trichocarpa]
Length=156

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
             R LPCCGCG GW +F+ GFFL  IPWYI  FI+ C R+  REKPGY
Sbjct  85   QRRLPCCGCGVGWFLFIIGFFLGAIPWYIGLFIIACMRIDPREKPGY  131



>emb|CDY45120.1| BnaC06g06410D [Brassica napus]
Length=153

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +3

Query  222  LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGYiactiaavaataaLIY  401
            LPCCG G GW +F++GF L ++PWYI  FIL+C ++  REKPGYIAC IAAV AT A+++
Sbjct  84   LPCCGIGIGWFLFITGFLLGSVPWYIGVFILVCAKINPREKPGYIACAIAAVLATIAIVF  143

Query  402  GL  407
            G 
Sbjct  144  GF  145



>ref|XP_011045581.1| PREDICTED: 60S ribosomal protein L18a-like protein [Populus euphratica]
Length=156

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
             R LPCCGCG GW +F+ GFFL  IPWYI  FI+ C R+  REKPGY
Sbjct  85   QRRLPCCGCGVGWFLFIIGFFLGAIPWYIGLFIIACMRIDPREKPGY  131



>gb|EAY99038.1| hypothetical protein OsI_20996 [Oryza sativa Indica Group]
Length=189

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 36/47 (77%), Gaps = 1/47 (2%)
 Frame = +3

Query  216  RPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGR-REKPGY  353
            R LPCCG G GW +F++GFFL  IPWY+ AFILIC RV   REKPGY
Sbjct  118  RRLPCCGLGLGWLLFIAGFFLAAIPWYVGAFILICVRVHDYREKPGY  164



>emb|CAN82659.1| hypothetical protein VITISV_011978 [Vitis vinifera]
 emb|CBI30858.3| unnamed protein product [Vitis vinifera]
Length=145

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPG  350
            +R LPCCG G GW +F+ GFF   IPWYI AFIL+C RV  REKPG
Sbjct  74   ERRLPCCGIGIGWLLFIIGFFCAAIPWYIGAFILLCVRVDYREKPG  119



>ref|XP_007149347.1| hypothetical protein PHAVU_005G062800g [Phaseolus vulgaris]
 gb|ESW21341.1| hypothetical protein PHAVU_005G062800g [Phaseolus vulgaris]
Length=164

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGYiactiaavaataa  392
            +R L CCG G  WC+F+ GFFL  IPWY+ A I++C RV  REKPGY+AC +AAV  T A
Sbjct  93   ERRLGCCGLGCAWCLFILGFFLAGIPWYVGAIIMLCSRVDHREKPGYVACVVAAVLGTIA  152

Query  393  LIYGLYR  413
            +I G+ +
Sbjct  153  IIVGVTK  159



>ref|XP_008225468.1| PREDICTED: 60S ribosomal protein L18a isoform X2 [Prunus mume]
Length=320

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +3

Query  192  LLGGAP-DDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            ++ G P  +R LPCCG G GW +F+ GFFL  IPWY+  FIL+C RV  REKPGY
Sbjct  87   VVEGRPVHERRLPCCGMGIGWLLFIIGFFLGGIPWYVGTFILLCVRVDYREKPGY  141



>ref|XP_008656728.1| PREDICTED: 60S ribosomal protein L18a-like protein [Zea mays]
 gb|AFW83500.1| hypothetical protein ZEAMMB73_680171 [Zea mays]
Length=183

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 35/47 (74%), Gaps = 1/47 (2%)
 Frame = +3

Query  216  RPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRV-GRREKPGY  353
            RPLPCCG G GW +F+ GFF   IPWY+ AF+LIC RV   REKPGY
Sbjct  112  RPLPCCGLGMGWFLFIIGFFFAAIPWYLGAFVLICVRVRDYREKPGY  158



>ref|NP_001056334.2| Os05g0564800 [Oryza sativa Japonica Group]
 dbj|BAF18248.2| Os05g0564800, partial [Oryza sativa Japonica Group]
Length=127

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 36/47 (77%), Gaps = 1/47 (2%)
 Frame = +3

Query  216  RPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGR-REKPGY  353
            R LPCCG G GW +F++GFFL  IPWY+ AFILIC RV   REKPGY
Sbjct  56   RRLPCCGLGLGWLLFIAGFFLAAIPWYVGAFILICVRVHDYREKPGY  102



>ref|XP_010924381.1| PREDICTED: 60S ribosomal protein L18a-like protein [Elaeis guineensis]
Length=163

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +3

Query  222  LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            LPCCG G GW +F+ GFFL  IPWY+ AFIL+C RV  REKPG+
Sbjct  95   LPCCGIGIGWFLFIIGFFLAAIPWYVGAFILLCVRVDYREKPGF  138



>gb|EEE64705.1| hypothetical protein OsJ_19560 [Oryza sativa Japonica Group]
Length=192

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 36/47 (77%), Gaps = 1/47 (2%)
 Frame = +3

Query  216  RPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGR-REKPGY  353
            R LPCCG G GW +F++GFFL  IPWY+ AFILIC RV   REKPGY
Sbjct  121  RRLPCCGLGLGWLLFIAGFFLAAIPWYVGAFILICVRVHDYREKPGY  167



>ref|XP_006416745.1| hypothetical protein EUTSA_v10008982mg [Eutrema salsugineum]
 gb|ESQ35098.1| hypothetical protein EUTSA_v10008982mg [Eutrema salsugineum]
Length=158

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 40/63 (63%), Gaps = 8/63 (13%)
 Frame = +3

Query  189  PLLGGAPDDRP-------LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICG-RVGRREK  344
            P+ GG  + RP       LPCCG G GW +F+ GFFL  IPWYI  FI+I G R+  REK
Sbjct  71   PVYGGVAEGRPVTVRQRRLPCCGIGLGWFLFIVGFFLGAIPWYIGMFIMIVGRRIDHREK  130

Query  345  PGY  353
            PGY
Sbjct  131  PGY  133



>ref|XP_009360876.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X2 [Pyrus x bretschneideri]
Length=321

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +R LPCCG G GW +F++GFFL  IPWY+  FIL+C +V  REKPGY
Sbjct  96   ERRLPCCGIGIGWLLFIAGFFLGGIPWYVGTFILLCVQVDYREKPGY  142



>ref|XP_008798294.1| PREDICTED: 60S ribosomal protein L18a-like protein isoform X1 
[Phoenix dactylifera]
Length=152

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +3

Query  222  LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            LPCCG G GW +F+ GFFL  IPWY+ AFIL+C R+  REKPG+
Sbjct  95   LPCCGIGIGWFLFIIGFFLAAIPWYVGAFILLCVRIDYREKPGF  138



>ref|XP_002894447.1| hypothetical protein ARALYDRAFT_474484 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70706.1| hypothetical protein ARALYDRAFT_474484 [Arabidopsis lyrata subsp. 
lyrata]
Length=153

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 52/74 (70%), Gaps = 1/74 (1%)
 Frame = +3

Query  189  PLLGGAP-DDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGYiact  365
            P+  G P     LPCCG G GW +F+ GF L  IPWYI  FIL+C R+  REKPGYIACT
Sbjct  72   PVSEGRPARQNRLPCCGLGLGWFLFIIGFLLGAIPWYIGVFILVCARIDTREKPGYIACT  131

Query  366  iaavaataaLIYGL  407
            IAAV AT A+++G+
Sbjct  132  IAAVVATIAIVFGV  145



>gb|EAY73248.1| hypothetical protein OsI_01125 [Oryza sativa Indica Group]
Length=217

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 36/51 (71%), Gaps = 1/51 (2%)
 Frame = +3

Query  201  GAPDDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            G   DR LPCCG G GW +F+ GFFL  IPWY+ AF+L C RV  REKPGY
Sbjct  84   GHGHDR-LPCCGIGIGWFLFIVGFFLGAIPWYVGAFLLWCSRVDYREKPGY  133



>ref|XP_006366095.1| PREDICTED: 60S ribosomal protein L18a-like protein-like isoform 
X2 [Solanum tuberosum]
Length=157

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +  LPCCG G GW +F+ GFFL  IPWYI AF+L+C R+  REKPG+
Sbjct  88   EHRLPCCGMGIGWFLFIIGFFLGAIPWYIGAFLLLCARLDYREKPGF  134



>ref|XP_002276545.1| PREDICTED: 60S ribosomal protein L18a isoform X2 [Vitis vinifera]
Length=299

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPG  350
            +R LPCCG G GW +F+ GFF   IPWYI AFIL+C RV  REKPG
Sbjct  74   ERRLPCCGIGIGWLLFIIGFFCAAIPWYIGAFILLCVRVDYREKPG  119



>ref|XP_006449677.1| hypothetical protein CICLE_v10017045mg [Citrus clementina]
 gb|ESR62917.1| hypothetical protein CICLE_v10017045mg [Citrus clementina]
Length=138

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +  LPCCG G GW +F+ GFFL  IPWY+ AFI +C +V  REKPGY
Sbjct  65   EHRLPCCGIGMGWFLFIIGFFLGGIPWYVGAFIALCAQVDYREKPGY  111



>ref|XP_010542335.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X3 [Tarenaya 
hassleriana]
Length=316

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +3

Query  198  GGAPDDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            GG P +  LPCCG G GW +F+ G FL  IPWYI + +L+C R+  REKPGY
Sbjct  86   GGPPREHRLPCCGIGCGWFLFIIGIFLGAIPWYIGSLVLLCSRIDPREKPGY  137



>ref|XP_010479925.1| PREDICTED: 60S ribosomal protein L18a-like protein [Camelina 
sativa]
Length=153

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = +3

Query  189  PLLGGAP-DDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            P+  G P  +  LPCCG G GW +F+ GF L  IPWYI  FIL+C R+  REKPGY
Sbjct  72   PVSEGRPARENHLPCCGLGLGWFLFIIGFLLGAIPWYIGVFILVCARIDPREKPGY  127



>ref|NP_564634.1| ribosomal protein L18ae family [Arabidopsis thaliana]
 gb|AAF78434.1|AC018748_13 Contains similarity to swi4 protein from Schizosaccharomyces 
pombe gi|1076927 [Arabidopsis thaliana]
 gb|AAG51969.1|AC024260_7 hypothetical protein; 86225-87277 [Arabidopsis thaliana]
 gb|AAM20650.1| unknown protein [Arabidopsis thaliana]
 gb|AAP21354.1| At1g53560 [Arabidopsis thaliana]
 gb|AEE32959.1| ribosomal protein L18ae family [Arabidopsis thaliana]
Length=153

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 52/74 (70%), Gaps = 1/74 (1%)
 Frame = +3

Query  189  PLLGGAPDDRP-LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGYiact  365
            P+  G P  +  LPCCG G GW +F+ GF L  IPWY+  FIL+C R+  REKPGY+ACT
Sbjct  72   PVSQGRPARQNRLPCCGLGLGWFLFIIGFLLGAIPWYVGVFILVCARIDPREKPGYVACT  131

Query  366  iaavaataaLIYGL  407
            IAAV AT  +++G+
Sbjct  132  IAAVVATITIVFGV  145



>ref|XP_006366094.1| PREDICTED: 60S ribosomal protein L18a-like protein-like isoform 
X1 [Solanum tuberosum]
Length=174

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +  LPCCG G GW +F+ GFFL  IPWYI AF+L+C R+  REKPG+
Sbjct  88   EHRLPCCGMGIGWFLFIIGFFLGAIPWYIGAFLLLCARLDYREKPGF  134



>ref|XP_010324738.1| PREDICTED: 60S ribosomal protein L18a-like protein isoform X1 
[Solanum lycopersicum]
Length=159

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +  LPCCG G GW +F+ GFFL  IPWYI AF+L+C R+  REKPG+
Sbjct  88   EHRLPCCGMGIGWFLFIIGFFLGAIPWYIGAFLLLCARLDYREKPGF  134



>ref|XP_006449676.1| hypothetical protein CICLE_v10017045mg [Citrus clementina]
 gb|ESR62916.1| hypothetical protein CICLE_v10017045mg [Citrus clementina]
Length=155

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +  LPCCG G GW +F+ GFFL  IPWY+ AFI +C +V  REKPGY
Sbjct  82   EHRLPCCGIGMGWFLFIIGFFLGGIPWYVGAFIALCAQVDYREKPGY  128



>ref|NP_001042559.1| Os01g0242900 [Oryza sativa Japonica Group]
 dbj|BAD81631.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF04473.1| Os01g0242900 [Oryza sativa Japonica Group]
 dbj|BAG92612.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE54216.1| hypothetical protein OsJ_01071 [Oryza sativa Japonica Group]
Length=156

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 36/51 (71%), Gaps = 1/51 (2%)
 Frame = +3

Query  201  GAPDDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            G   DR LPCCG G GW +F+ GFFL  IPWY+ AF+L C RV  REKPGY
Sbjct  84   GHGHDR-LPCCGIGIGWFLFIVGFFLGAIPWYVGAFLLWCSRVDYREKPGY  133



>gb|AAM63092.1| unknown [Arabidopsis thaliana]
Length=153

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = +3

Query  189  PLLGGAPDDRP-LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGYiact  365
            P+  G P  +  LPCCG G GW +F+ GF L  IPWY+  FIL+C R+  REKPGY+ACT
Sbjct  72   PVSQGRPARQNRLPCCGLGLGWFLFIIGFLLGAIPWYVGVFILVCARIDPREKPGYVACT  131

Query  366  iaavaataaLIYGL  407
            IAAV AT A+++G+
Sbjct  132  IAAVVATIAIVFGV  145



>ref|XP_009799851.1| PREDICTED: 60S ribosomal protein L18a-like protein [Nicotiana 
sylvestris]
Length=233

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPG  350
            +  LPCCG G GW +F+SGFFL T+PWYI AF+L+C R+  REKPG
Sbjct  84   EYRLPCCGMGIGWFLFISGFFLGTVPWYIGAFLLLCVRIDYREKPG  129


 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPG  350
            +  LPCCG G GW +F+SGFFL T+PWYI AF+L+C R+  REKPG
Sbjct  162  EYRLPCCGMGIGWFLFISGFFLGTVPWYIGAFLLLCVRIDYREKPG  207



>gb|KCW67644.1| hypothetical protein EUGRSUZ_F01391, partial [Eucalyptus grandis]
Length=112

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +  LPCCG G GW +F+ GFFL  IPWYI   +L+CGR+  REKPGY
Sbjct  41   ESRLPCCGIGVGWFLFILGFFLGAIPWYIGLLLLVCGRIEYREKPGY  87



>gb|KDP45083.1| hypothetical protein JCGZ_20159 [Jatropha curcas]
Length=153

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 52/73 (71%), Gaps = 5/73 (7%)
 Frame = +3

Query  210  DDRP-----LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGYiactiaa  374
            D RP     LPCCG G GW +F+ GFFL  IPWY+  FI++C R+  REKPGYIACTIAA
Sbjct  76   DGRPVREHRLPCCGIGLGWFLFIIGFFLGAIPWYVGLFIILCARIDPREKPGYIACTIAA  135

Query  375  vaataaLIYGLYR  413
            V AT A+I G+ +
Sbjct  136  VLATVAIILGVTK  148



>ref|XP_010694550.1| PREDICTED: 60S ribosomal protein L18a-like protein [Beta vulgaris 
subsp. vulgaris]
Length=156

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = +3

Query  210  DDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILI-CGRVGRREKPGYiactiaavaat  386
             +  LPCCG G GW +F+ GFFL   PWY AA ILI CG V +REKP YI CTIAAV A 
Sbjct  87   SEHRLPCCGIGYGWLLFIMGFFLAGFPWYFAAIILIFCGNVDQREKPAYILCTIAAVLAA  146

Query  387  aaLIYGLYRL  416
             A I+G+ R+
Sbjct  147  IATIFGVTRI  156



>ref|XP_010275122.1| PREDICTED: 60S ribosomal protein L18a-like protein [Nelumbo nucifera]
Length=146

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILIC-GRVGRREKPGY  353
            +R LPCCG G GW +F+ GFFL  IPWY+ AF+L+C  R+  REKPGY
Sbjct  74   ERRLPCCGIGVGWFLFIIGFFLAAIPWYVGAFVLLCVRRMDYREKPGY  121



>gb|EYU38220.1| hypothetical protein MIMGU_mgv1a0157612mg, partial [Erythranthe 
guttata]
Length=129

 Score = 64.3 bits (155),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +3

Query  222  LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            LPCCG G GW +F+ GFF V IPWY+AA +L+C R+  REKPGY
Sbjct  80   LPCCGIGFGWFLFIIGFFTVGIPWYLAALLLVCSRLDPREKPGY  123



>ref|XP_008345152.1| PREDICTED: uncharacterized protein LOC103408066 [Malus domestica]
Length=196

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 2/49 (4%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILIC--GRVGRREKPGY  353
            +  L CCGCG GWC+F+ GFFL T+PWY+ A IL+C   R+  REKPGY
Sbjct  123  EHRLRCCGCGLGWCLFIIGFFLATVPWYVGAIILLCARNRMDPREKPGY  171



>ref|XP_010064524.1| PREDICTED: 60S ribosomal protein L18a-like protein, partial [Eucalyptus 
grandis]
Length=104

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +  LPCCG G GW +F+ GFFL  IPWYI   +L+CGR+  REKPGY
Sbjct  33   ESRLPCCGIGVGWFLFILGFFLGAIPWYIGLLLLVCGRIDYREKPGY  79



>ref|XP_004293559.1| PREDICTED: 60S ribosomal protein L18a-like [Fragaria vesca subsp. 
vesca]
Length=318

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Frame = +3

Query  213  DRPLPCC-GCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +R LPCC G G+GW +F+ GFFL  IPWYI AFIL+C RV  REKPGY
Sbjct  92   ERRLPCCCGLGSGWVLFIMGFFLGGIPWYIGAFILLCVRVDYREKPGY  139



>ref|XP_006655591.1| PREDICTED: 60S ribosomal protein L18a-like protein-like [Oryza 
brachyantha]
Length=186

 Score = 64.7 bits (156),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 36/47 (77%), Gaps = 1/47 (2%)
 Frame = +3

Query  216  RPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGR-REKPGY  353
            R LPCCG G GW +F++GFFL  IPWY+ AFILIC RV   REKPG+
Sbjct  115  RRLPCCGLGLGWLLFIAGFFLAAIPWYVGAFILICVRVHDYREKPGF  161



>ref|XP_006841638.1| hypothetical protein AMTR_s00003p00234550 [Amborella trichopoda]
 gb|ERN03313.1| hypothetical protein AMTR_s00003p00234550 [Amborella trichopoda]
Length=187

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +3

Query  201  GAPDDRP-LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPG  350
            G P   P LPCCG G GW +F++GFFL TIPWYI AF+L+C R+  REK G
Sbjct  61   GQPIREPRLPCCGIGLGWFLFIAGFFLATIPWYIGAFLLLCVRLDYREKAG  111



>ref|XP_009344639.1| PREDICTED: 60S ribosomal protein L18a-like protein [Pyrus x bretschneideri]
Length=156

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 36/49 (73%), Gaps = 2/49 (4%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICG--RVGRREKPGY  353
            +  L CCGCG GWC+F+ GFFL T+PWY+ A ILIC   R+  REKPGY
Sbjct  83   EHRLRCCGCGLGWCLFIIGFFLGTVPWYVGAIILICARHRMDPREKPGY  131



>ref|XP_009410943.1| PREDICTED: 60S ribosomal protein L18a-like protein [Musa acuminata 
subsp. malaccensis]
Length=177

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +3

Query  216  RPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGYiactiaavaataaL  395
            R LPCCG G GW +F++GFFL  +PWYI AF L+  RV  REKPG++ACTIAAV    A+
Sbjct  107  RRLPCCGLGLGWFLFITGFFLAAVPWYIGAFFLLFVRVDYREKPGFVACTIAAVVFAIAV  166

Query  396  IYGLYR  413
            I GL +
Sbjct  167  ILGLTK  172



>ref|XP_010918896.1| PREDICTED: 60S ribosomal protein L18a-like protein [Elaeis guineensis]
Length=164

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  222  LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPG  350
            LPCCG G GW +F+ GFFL  IPWY+ AFIL+C R+  REKPG
Sbjct  96   LPCCGIGIGWFLFVVGFFLAAIPWYVGAFILLCVRIDYREKPG  138



>ref|XP_004147407.1| PREDICTED: 60S ribosomal protein L18a-1-like [Cucumis sativus]
 ref|XP_004165529.1| PREDICTED: 60S ribosomal protein L18a-1-like [Cucumis sativus]
 gb|KGN65566.1| hypothetical protein Csa_1G448970 [Cucumis sativus]
Length=159

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +3

Query  192  LLGGAP-DDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +L G P  +  LPCCG G GW +FM GFFL  IPWY+ AFI++  RV  REKPGY
Sbjct  80   ILEGRPFQEARLPCCGIGMGWFLFMIGFFLGGIPWYVGAFIVLFVRVDYREKPGY  134



>gb|KDO78151.1| hypothetical protein CISIN_1g045574mg [Citrus sinensis]
Length=155

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +  LPCCG G GW +F+ GFFL  IPWY+ AFI +C +V  REKPGY
Sbjct  82   EYRLPCCGIGMGWFLFIIGFFLGGIPWYVGAFIALCAQVDYREKPGY  128



>ref|XP_010462252.1| PREDICTED: 60S ribosomal protein L18a-like protein [Camelina 
sativa]
Length=153

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = +3

Query  189  PLLGGAP-DDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            P+  G P  +  LPCCG G GW +F+ GF L  IPWYI  FIL+C R+  REKPGY
Sbjct  72   PVSEGIPARENRLPCCGLGLGWFLFIIGFLLGAIPWYIGVFILVCARIDPREKPGY  127



>ref|XP_008444018.1| PREDICTED: 60S ribosomal protein L18a-like protein [Cucumis melo]
Length=159

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +3

Query  192  LLGGAP-DDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +L G P  +  LPCCG G GW +FM GFFL  IPWY+ AFI++  RV  REKPGY
Sbjct  80   ILEGRPFQEARLPCCGIGMGWFLFMIGFFLGGIPWYVGAFIVLFVRVDYREKPGY  134



>gb|KFK35717.1| hypothetical protein AALP_AA4G028000 [Arabis alpina]
Length=156

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +3

Query  210  DDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGYiactiaavaata  389
             +  LPCCG G GW +F +GF L  +PWYIA F+ +C ++  +EKPGYIAC IAAV AT 
Sbjct  83   QEHRLPCCGIGIGWFLFFTGFLLGAVPWYIAVFLFVCTKISPQEKPGYIACAIAAVLATI  142

Query  390  aLIYGL  407
            A+++G+
Sbjct  143  AIVFGV  148



>ref|XP_003569522.1| PREDICTED: 60S ribosomal protein L18a-like protein [Brachypodium 
distachyon]
Length=187

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 39/57 (68%), Gaps = 2/57 (4%)
 Frame = +3

Query  189  PLLGGAPDD-RPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGR-REKPGY  353
            P++ G P   R LPCCG G GW +F+ GFF   IPWYI AF+LIC RV   REKPGY
Sbjct  106  PVVEGRPVRMRRLPCCGLGMGWFLFIVGFFFAAIPWYIGAFVLICVRVHDYREKPGY  162



>gb|EMS57717.1| Hydroxyacylglutathione hydrolase 3, mitochondrial [Triticum urartu]
Length=349

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 39/57 (68%), Gaps = 2/57 (4%)
 Frame = +3

Query  189  PLLGGAPDD-RPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGR-REKPGY  353
            P++ G P   R LPCCG G GW +F+ GFF   IPWY+ AF+LIC RV   REKPGY
Sbjct  268  PVVEGRPVRMRRLPCCGLGMGWFLFIIGFFFAAIPWYVGAFVLICVRVHDYREKPGY  324



>dbj|BAK01175.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=159

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 35/51 (69%), Gaps = 1/51 (2%)
 Frame = +3

Query  201  GAPDDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            G   DR LPCCG G GW +F+ GF L  IPWY+ AF+L C RV  REKPGY
Sbjct  85   GHRHDR-LPCCGIGMGWFLFIIGFLLGAIPWYVGAFLLWCSRVDYREKPGY  134



>emb|CDX83927.1| BnaC08g17180D [Brassica napus]
Length=160

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 34/48 (71%), Gaps = 1/48 (2%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICG-RVGRREKPGY  353
             R LPCCG G GW +F+ GFFL  IPWY+  FI+I G R+  REKPGY
Sbjct  88   QRRLPCCGIGLGWFLFIVGFFLGAIPWYVGMFIMIVGRRIDHREKPGY  135



>gb|EYU33349.1| hypothetical protein MIMGU_mgv1a015356mg [Erythranthe guttata]
Length=160

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPG  350
            +  LPCCG G GW +F+ GFF+  IPWYI AF+L+C R+  REKPG
Sbjct  89   EERLPCCGVGLGWFLFIVGFFMGAIPWYIGAFLLLCARLDYREKPG  134



>ref|XP_010666371.1| PREDICTED: 60S ribosomal protein L18a-like protein [Beta vulgaris 
subsp. vulgaris]
Length=163

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +3

Query  228  CCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGYiactiaavaataaLIYGL  407
            CCG G GW +F++GFFL  IPWY+ A IL+CGR+  REK GY+AC +A + A  A+++GL
Sbjct  97   CCGIGIGWVLFIAGFFLAGIPWYVGALILVCGRLDYREKAGYVACMVATILAMLAILFGL  156



>ref|XP_011096542.1| PREDICTED: 60S ribosomal protein L18a-like protein [Sesamum indicum]
Length=160

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  222  LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPG  350
            LPCCG G GW +F+ GFF+ +IPWYI AF+L+C R+  REKPG
Sbjct  92   LPCCGLGIGWSLFIIGFFMGSIPWYIGAFLLLCVRLDYREKPG  134



>ref|XP_009110429.1| PREDICTED: 60S ribosomal protein L18a-like protein [Brassica 
rapa]
 ref|XP_009124501.1| PREDICTED: 60S ribosomal protein L18a-like protein [Brassica 
rapa]
 emb|CDX96793.1| BnaA08g23360D [Brassica napus]
Length=156

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 34/48 (71%), Gaps = 1/48 (2%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICG-RVGRREKPGY  353
             R LPCCG G GW +F+ GFFL  IPWY+  FI+I G R+  REKPGY
Sbjct  84   QRRLPCCGIGLGWFLFIVGFFLGAIPWYVGMFIMIVGRRIDHREKPGY  131



>ref|XP_010537685.1| PREDICTED: 60S ribosomal protein L18a-like protein [Tarenaya 
hassleriana]
Length=150

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICG-RVGRREKPGY  353
             R LPCCG G GW +F+ GFFL  IPWY+  FI++CG R+  REKPGY
Sbjct  78   QRRLPCCGIGLGWFLFIIGFFLGAIPWYVGLFIMMCGRRIDYREKPGY  125



>ref|XP_006644489.1| PREDICTED: 60S ribosomal protein L18a-like protein-like [Oryza 
brachyantha]
Length=181

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 34/45 (76%), Gaps = 1/45 (2%)
 Frame = +3

Query  222  LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGR-REKPGY  353
            LPCCG G GW +F+ GFFL  IPWY+ AF+LIC RV   REKPGY
Sbjct  112  LPCCGLGMGWFLFIIGFFLAAIPWYVGAFVLICVRVHDYREKPGY  156



>ref|XP_009389940.1| PREDICTED: 60S ribosomal protein L18a-like protein [Musa acuminata 
subsp. malaccensis]
Length=152

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 1/54 (2%)
 Frame = +3

Query  192  LLGGAPDDRP-LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPG  350
            ++ G P  +P L CCG G GW +F+ GFFL  IPWY+ AFIL+C RV  REKPG
Sbjct  73   VVEGTPLRQPRLACCGLGIGWLLFIVGFFLPAIPWYVGAFILLCVRVDYREKPG  126



>ref|XP_006304250.1| hypothetical protein CARUB_v10010472mg, partial [Capsella rubella]
 gb|EOA37148.1| hypothetical protein CARUB_v10010472mg, partial [Capsella rubella]
Length=171

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = +3

Query  189  PLLGGAP-DDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            P+  G P  +  LPCCG G GW +F+ GF L  +PWYI  FIL+C R+  REKPGY
Sbjct  90   PVSEGRPARENRLPCCGLGLGWFLFIIGFLLGALPWYIGVFILVCARIDPREKPGY  145



>gb|ABU98949.1| unknown [Lupinus albus]
Length=163

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = +3

Query  210  DDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGYiactiaavaata  389
             +R LP CG G GW +FM GF L  IPWY+ A +++C RV  REKPGY+AC +AAV    
Sbjct  92   SERRLPFCGLGCGWFLFMFGFLLAGIPWYVGAILMLCSRVDYREKPGYVACIVAAVLYAI  151

Query  390  aLIYGLYR  413
            A+I+G+ +
Sbjct  152  AIIFGVTK  159



>ref|XP_008784423.1| PREDICTED: 60S ribosomal protein L18a-like protein [Phoenix dactylifera]
Length=155

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = +3

Query  186  QPLLGGAP-DDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPG  350
            Q L+ G P  + PLP CG G GW +F+SGFFL  IPWY+  FIL+   +  REKPG
Sbjct  74   QALVDGIPMREPPLPFCGIGIGWALFLSGFFLAAIPWYVGVFILLFVALDYREKPG  129



>dbj|BAJ99681.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93509.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=186

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 39/57 (68%), Gaps = 2/57 (4%)
 Frame = +3

Query  189  PLLGGAPDD-RPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGR-REKPGY  353
            P++ G P   R LPCCG G GW +F+ GFF   IPWY+ AF+LIC RV   REKPGY
Sbjct  105  PVVEGRPVRMRRLPCCGLGMGWFLFIIGFFFAAIPWYVGAFVLICVRVHDYREKPGY  161



>ref|NP_564013.1| ribosomal protein L18ae family protein [Arabidopsis thaliana]
 gb|AAD50022.1|AC007651_17 Unknown protein [Arabidopsis thaliana]
 gb|AAK73953.1| F6I1.24/F6I1.24 [Arabidopsis thaliana]
 gb|AAM19900.1| At1g17080/F6I1.24 [Arabidopsis thaliana]
 gb|AEE29538.1| ribosomal protein L18ae family protein [Arabidopsis thaliana]
Length=154

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 40/61 (66%), Gaps = 6/61 (10%)
 Frame = +3

Query  189  PLLGGAPDDRP-----LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICG-RVGRREKPG  350
            P+ GG  + RP     LPCCG G GW +F+ GFFL  IPWY+  FI++ G R+  REKPG
Sbjct  69   PVHGGVAEGRPVRQRRLPCCGIGLGWFLFIVGFFLGAIPWYVGLFIMMFGRRIDYREKPG  128

Query  351  Y  353
            Y
Sbjct  129  Y  129



>ref|XP_008811097.1| PREDICTED: 60S ribosomal protein L18a-like protein [Phoenix dactylifera]
Length=72

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  222  LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            LPCCG G GW +F+ GFFL  IPWY+ AFIL+  R+  REKPG+
Sbjct  4    LPCCGIGIGWFLFIIGFFLAAIPWYVGAFILLWVRIDYREKPGF  47



>ref|XP_006467486.1| PREDICTED: 60S ribosomal protein L18a-2-like isoform X2 [Citrus 
sinensis]
Length=307

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  222  LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            LPCCG G GW +F+ GFFL  IPWY+ AFI +C +V  REKPGY
Sbjct  85   LPCCGIGMGWFLFIIGFFLGGIPWYVGAFIALCAQVDYREKPGY  128



>gb|KFK35719.1| hypothetical protein AALP_AA4G028100 [Arabis alpina]
Length=152

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGYiactiaavaataa  392
            + PLPC G G GW +F+ GF   +IPWYIA ++++C ++  REKPGYIAC++AAV AT  
Sbjct  80   EEPLPCFGIGIGWFLFIIGFPFGSIPWYIALYLIVCAKINPREKPGYIACSLAAVLATMV  139

Query  393  LIYGLYR  413
            ++YG  +
Sbjct  140  IVYGAIK  146



>gb|KFK35718.1| hypothetical protein AALP_AA4G028100 [Arabis alpina]
Length=159

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGYiactiaavaataa  392
            + PLPC G G GW +F+ GF   +IPWYIA ++++C ++  REKPGYIAC++AAV AT  
Sbjct  87   EEPLPCFGIGIGWFLFIIGFPFGSIPWYIALYLIVCAKINPREKPGYIACSLAAVLATMV  146

Query  393  LIYGLYR  413
            ++YG  +
Sbjct  147  IVYGAIK  153



>ref|XP_010916066.1| PREDICTED: 60S ribosomal protein L18a-like protein [Elaeis guineensis]
Length=155

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 37/58 (64%), Gaps = 3/58 (5%)
 Frame = +3

Query  186  QPLLGGAP---DDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPG  350
            Q L+ G P    + PLP CG G GW +F+SGFFL  IPWY+  FIL+   +  REKPG
Sbjct  72   QALVDGIPMTMREPPLPICGIGIGWALFLSGFFLAAIPWYVGVFILLFVALDYREKPG  129



>ref|XP_002519698.1| 60S ribosomal protein L18a, putative [Ricinus communis]
 gb|EEF42671.1| 60S ribosomal protein L18a, putative [Ricinus communis]
Length=303

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +  LPCCG G GW +F+ GFFL  IPWY+  FIL+C +V  REKPGY
Sbjct  78   EHRLPCCGLGMGWFLFIVGFFLGGIPWYVGTFILLCVQVDYREKPGY  124



>ref|XP_010498049.1| PREDICTED: 60S ribosomal protein L18a-like protein [Camelina 
sativa]
Length=158

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 40/63 (63%), Gaps = 8/63 (13%)
 Frame = +3

Query  189  PLLGGAPDDRP-------LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICG-RVGRREK  344
            P+ GG  + RP       LPCCG G GW +F+ GFFL  IPWY+  FI++ G R+  REK
Sbjct  71   PVHGGVAEGRPVTGRQRRLPCCGIGLGWFLFIVGFFLGAIPWYVGLFIMMFGRRIDYREK  130

Query  345  PGY  353
            PGY
Sbjct  131  PGY  133



>ref|XP_010476841.1| PREDICTED: 60S ribosomal protein L18a-like protein [Camelina 
sativa]
Length=160

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 40/63 (63%), Gaps = 8/63 (13%)
 Frame = +3

Query  189  PLLGGAPDDRP-------LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICG-RVGRREK  344
            P+ GG  + RP       LPCCG G GW +F+ GFFL  IPWY+  FI++ G R+  REK
Sbjct  73   PVHGGVAEGRPVTGRQRRLPCCGIGLGWFLFVVGFFLGAIPWYVGLFIMMFGRRIDYREK  132

Query  345  PGY  353
            PGY
Sbjct  133  PGY  135



>ref|XP_010501008.1| PREDICTED: 60S ribosomal protein L18a-like protein [Camelina 
sativa]
Length=153

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +  LPCCG G GW +F+ GF L  IPWYI  F L+C R+  REKPGY
Sbjct  81   ENRLPCCGLGLGWFLFIIGFLLGAIPWYIGVFTLVCARIDPREKPGY  127



>ref|XP_006305734.1| hypothetical protein CARUB_v10010518mg [Capsella rubella]
 gb|EOA38632.1| hypothetical protein CARUB_v10010518mg [Capsella rubella]
Length=158

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 40/63 (63%), Gaps = 8/63 (13%)
 Frame = +3

Query  189  PLLGGAPDDRP-------LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICG-RVGRREK  344
            P+ GG  + RP       LPCCG G GW +F+ GFFL  IPWY+  FI++ G R+  REK
Sbjct  71   PVHGGVAEGRPVTGRQRRLPCCGIGLGWFLFVVGFFLGAIPWYVGLFIMMFGRRIDYREK  130

Query  345  PGY  353
            PGY
Sbjct  131  PGY  133



>gb|KHG29377.1| 60S ribosomal L18a-1 -like protein [Gossypium arboreum]
Length=166

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  201  GAPDDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            G P    LPCCG G GW +F+ GFF+  +PWYI  F+L+C R+  REK GY
Sbjct  93   GTPVRDKLPCCGIGFGWFLFIIGFFIGGLPWYIGFFVLLCARIDDREKAGY  143



>ref|XP_010549483.1| PREDICTED: 60S ribosomal protein L18a-like protein isoform X1 
[Tarenaya hassleriana]
Length=158

 Score = 61.6 bits (148),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +  LPCCG G GW +F+ GF    IPWY+ AFIL+C  V  REKPGY
Sbjct  87   EHSLPCCGLGMGWFLFILGFLFGGIPWYLGAFILLCTSVDYREKPGY  133



>ref|XP_010064523.1| PREDICTED: 60S ribosomal protein L18a-like protein [Eucalyptus 
grandis]
Length=196

 Score = 62.0 bits (149),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  222  LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            LPCCG G GW +F+ GFFL  IPWYI   +L+C R+  REKPGY
Sbjct  128  LPCCGIGVGWFLFILGFFLGAIPWYIGLLLLVCRRIDYREKPGY  171



>ref|XP_004969469.1| PREDICTED: 60S ribosomal protein L18a-1-like [Setaria italica]
Length=189

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 34/47 (72%), Gaps = 1/47 (2%)
 Frame = +3

Query  216  RPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGR-REKPGY  353
            R LPCCG G GW +F+ GFFL  IPWY+ AF+LI  RV   REKPGY
Sbjct  118  RRLPCCGLGMGWFLFIIGFFLAAIPWYVGAFVLIFVRVHDYREKPGY  164



>gb|KCW75928.1| hypothetical protein EUGRSUZ_D00303 [Eucalyptus grandis]
Length=163

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +3

Query  192  LLGGAPDDRP-LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            ++ G P   P LPCCG G GW +F+ GFFL  IPWY+  F+LIC    RREKPGY
Sbjct  84   VVEGTPIREPRLPCCGIGIGWFLFLIGFFLGGIPWYLGTFLLICTCPDRREKPGY  138



>ref|XP_010459270.1| PREDICTED: 60S ribosomal protein L18a-like protein [Camelina 
sativa]
Length=159

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 8/63 (13%)
 Frame = +3

Query  189  PLLGGAPDDRP-------LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICG-RVGRREK  344
            P+ GG  + RP       LPCCG G GW +F+ GFFL  +PWY+  FI++ G R+  REK
Sbjct  72   PVPGGVAEGRPVTGRQRRLPCCGIGLGWFLFIVGFFLGAVPWYVGLFIMMFGRRIDYREK  131

Query  345  PGY  353
            PGY
Sbjct  132  PGY  134



>ref|XP_009135389.1| PREDICTED: 60S ribosomal protein L18a-like protein [Brassica 
rapa]
Length=121

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 Frame = +3

Query  210  DDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGYiactiaavaata  389
            + R LPCCG G GW +F+ GFF   IPWYI  F+L+C R   REKPGYIACTI AV AT 
Sbjct  50   EQRRLPCCGIGIGWLLFILGFFFGAIPWYIGFFLLLCSR-NPREKPGYIACTIGAVIATG  108

Query  390  aLIYGLYR  413
             +++G  R
Sbjct  109  FIVFGAIR  116



>ref|XP_009389994.1| PREDICTED: 60S ribosomal protein L18a-like protein [Musa acuminata 
subsp. malaccensis]
Length=152

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKP  347
            D PLP CG G GW +F+SGFFL +IPWY+  FIL+      REKP
Sbjct  81   DPPLPFCGIGIGWALFVSGFFLASIPWYVGVFILLFVATDYREKP  125



>ref|NP_001043806.1| Os01g0667100 [Oryza sativa Japonica Group]
 dbj|BAD73644.1| 60S ribosomal protein L18A-like [Oryza sativa Japonica Group]
 dbj|BAF05720.1| Os01g0667100 [Oryza sativa Japonica Group]
 gb|EAZ13020.1| hypothetical protein OsJ_02941 [Oryza sativa Japonica Group]
Length=185

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 34/47 (72%), Gaps = 1/47 (2%)
 Frame = +3

Query  216  RPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGR-REKPGY  353
            R LP CG G GW +F+ GFFL  IPWYI AF+LIC RV   REKPGY
Sbjct  114  RRLPFCGLGMGWFLFIIGFFLAAIPWYIGAFVLICVRVHDYREKPGY  160



>gb|KDP37962.1| hypothetical protein JCGZ_04605 [Jatropha curcas]
Length=157

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +  LPCCG G GW +F+ GFFL  IPWY+  FI++C +V  REK GY
Sbjct  86   EHRLPCCGLGMGWFLFIVGFFLGGIPWYVGTFIVLCVQVDYREKAGY  132



>emb|CDX75777.1| BnaC03g38600D [Brassica napus]
Length=139

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 48/73 (66%), Gaps = 1/73 (1%)
 Frame = +3

Query  195  LGGAPDDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGYiactiaa  374
            + G  +   LPCCG G GW +F+ GFF   IPWYI  F+L+C R   REKPGYIACTI A
Sbjct  63   VNGVTEHDRLPCCGIGIGWLLFILGFFFGAIPWYIGFFLLLCSR-NPREKPGYIACTIGA  121

Query  375  vaataaLIYGLYR  413
            V AT  +++G  R
Sbjct  122  VIATGFVVFGAIR  134



>ref|XP_004967333.1| PREDICTED: 60S ribosomal protein L18a-1-like isoform X1 [Setaria 
italica]
Length=175

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 33/51 (65%), Gaps = 1/51 (2%)
 Frame = +3

Query  201  GAPDDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            G   DR LPCCG G GW +F+ GFFL  IPWY+ A +L C  V  REKP Y
Sbjct  67   GHGHDR-LPCCGIGFGWFLFVIGFFLGAIPWYVGAILLCCSTVDHREKPAY  116



>ref|XP_010052072.1| PREDICTED: 60S ribosomal protein L18a-2-like isoform X2 [Eucalyptus 
grandis]
Length=317

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +3

Query  192  LLGGAPDDRP-LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            ++ G P   P LPCCG G GW +F+ GFFL  IPWY+  F+LIC    RREKPGY
Sbjct  84   VVEGTPIREPRLPCCGIGIGWFLFLIGFFLGGIPWYLGTFLLICTCPDRREKPGY  138



>dbj|BAJ94702.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=152

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = +3

Query  186  QPLLGGAPDDRP-LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPG  350
            Q L+ G P   P LP CG G GW +F+ GFFL  IPWYI AF+L    +  REKPG
Sbjct  70   QVLVEGLPVREPRLPFCGVGVGWALFLLGFFLAAIPWYIGAFLLFFVALDHREKPG  125



>gb|KCW67650.1| hypothetical protein EUGRSUZ_F013971, partial [Eucalyptus grandis]
Length=132

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 1/47 (2%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +  LPCCG G GW +F+ GFFL  IPWYI   +L+CGR+  REKPGY
Sbjct  81   ESRLPCCGIGVGWFLFILGFFLGPIPWYI-GLLLVCGRIDYREKPGY  126



>ref|XP_004967334.1| PREDICTED: 60S ribosomal protein L18a-1-like isoform X2 [Setaria 
italica]
Length=141

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 33/51 (65%), Gaps = 1/51 (2%)
 Frame = +3

Query  201  GAPDDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            G   DR LPCCG G GW +F+ GFFL  IPWY+ A +L C  V  REKP Y
Sbjct  67   GHGHDR-LPCCGIGFGWFLFVIGFFLGAIPWYVGAILLCCSTVDHREKPAY  116



>ref|XP_010549484.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X2 [Tarenaya 
hassleriana]
Length=312

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +  LPCCG G GW +F+ GF    IPWY+ AFIL+C  V  REKPGY
Sbjct  87   EHSLPCCGLGMGWFLFILGFLFGGIPWYLGAFILLCTSVDYREKPGY  133



>gb|KFK44822.1| hypothetical protein AALP_AA1G307300 [Arabis alpina]
Length=158

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +  LPCCG G GW +F+ GF    IPWY+ AFI++C  V  REK GY
Sbjct  87   EHDLPCCGFGMGWLLFVLGFLFGGIPWYLGAFIIMCTHVDNREKAGY  133



>ref|XP_008386394.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L18a-like 
protein, partial [Malus domestica]
Length=129

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGR  326
            +R LPCCG G GWC+F+ GF L T+PWY+ AFIL+C R
Sbjct  88   ERRLPCCGFGLGWCLFIIGFVLATVPWYVGAFILLCAR  125



>ref|XP_010241284.1| PREDICTED: 60S ribosomal protein L18a-like protein [Nelumbo nucifera]
Length=180

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGR-VGRREKPGY  353
            +R LPCCG G GW +F+ GFFL  IPWY+ AF+L+  R +  REKPGY
Sbjct  108  ERRLPCCGIGCGWFLFIIGFFLAAIPWYVGAFVLLFVRTMDYREKPGY  155



>ref|XP_006392780.1| hypothetical protein EUTSA_v10011841mg [Eutrema salsugineum]
 gb|ESQ30066.1| hypothetical protein EUTSA_v10011841mg [Eutrema salsugineum]
Length=157

 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 2/48 (4%)
 Frame = +3

Query  210  DDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +DR LPCCG G GW +F++GF L  IPWY+  F ++C ++  REKPGY
Sbjct  87   EDR-LPCCGLGLGWFLFLTGF-LCAIPWYVGVFNIVCAKINPREKPGY  132



>ref|XP_010062750.1| PREDICTED: 60S ribosomal protein L18a-like protein [Eucalyptus 
grandis]
Length=157

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 54/78 (69%), Gaps = 3/78 (4%)
 Frame = +3

Query  189  PLLGGAP-DDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAA-FILIC-GRVGRREKPGYia  359
            P+  G P  +R LPCCG G GWC+F+ GFFL  IPWY+   F++ C  R+  REKPGYI 
Sbjct  75   PVAEGRPVRERRLPCCGLGLGWCLFIIGFFLGGIPWYVGLCFMVFCRHRMDYREKPGYIT  134

Query  360  ctiaavaataaLIYGLYR  413
            CTIAAV  T ALI+G+ +
Sbjct  135  CTIAAVLETIALIFGVAK  152



>ref|XP_010501981.1| PREDICTED: 60S ribosomal protein L18a-like protein [Camelina 
sativa]
Length=141

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 2/50 (4%)
 Frame = +3

Query  204  APDDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            A  DR LPCCG G GW +F+ GFF  TIPWYI  F+L+  R   RE+PGY
Sbjct  68   AQHDR-LPCCGIGVGWVLFILGFFFGTIPWYIGFFLLLFSR-NIRERPGY  115



>ref|XP_009118121.1| PREDICTED: 60S ribosomal protein L18a-like protein [Brassica 
rapa]
Length=150

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICG-RVGRREKPGY  353
             R L CCG G GW +F+ GFFL  IPWY+   I+I G RV  REKPGY
Sbjct  79   QRRLSCCGIGLGWFLFIVGFFLGGIPWYVGMGIMIVGRRVDHREKPGY  126



>ref|XP_003568798.1| PREDICTED: 60S ribosomal protein L18a-like protein [Brachypodium 
distachyon]
Length=154

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = +3

Query  186  QPLLGGAPDDRP-LPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPG  350
            Q  + G P   P LP CG G GW +F+ GFF+  IPWYI AFIL    +  REKPG
Sbjct  73   QIFVEGLPVREPRLPFCGVGIGWTLFLLGFFIAAIPWYIGAFILFFVALDHREKPG  128



>gb|KCW69886.1| hypothetical protein EUGRSUZ_F03217 [Eucalyptus grandis]
Length=205

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 54/78 (69%), Gaps = 3/78 (4%)
 Frame = +3

Query  189  PLLGGAP-DDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAA-FILIC-GRVGRREKPGYia  359
            P+  G P  +R LPCCG G GWC+F+ GFFL  IPWY+   F++ C  R+  REKPGYI 
Sbjct  123  PVAEGRPVRERRLPCCGLGLGWCLFIIGFFLGGIPWYVGLCFMVFCRHRMDYREKPGYIT  182

Query  360  ctiaavaataaLIYGLYR  413
            CTIAAV  T ALI+G+ +
Sbjct  183  CTIAAVLETIALIFGVAK  200



>ref|NP_564343.1| 60S ribosomal protein L18a-1 [Arabidopsis thaliana]
 sp|Q8L9S1.2|R18AL_ARATH RecName: Full=60S ribosomal protein L18a-like protein [Arabidopsis 
thaliana]
 dbj|BAF01174.1| 60S ribosomal protein L18A like [Arabidopsis thaliana]
 gb|ABR46187.1| At1g29970 [Arabidopsis thaliana]
 gb|AEE31160.1| 60S ribosomal protein L18a-1 [Arabidopsis thaliana]
Length=158

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +  LPCCG G GW +F+ GF    IPWY+ AFI++   V  REK GY
Sbjct  87   EHELPCCGLGMGWFLFIMGFLFGGIPWYLGAFIVLVTSVDHREKAGY  133



>emb|CDY21766.1| BnaA09g45170D [Brassica napus]
Length=145

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICG-RVGRREKPGY  353
             R L CCG G GW +F+ GFFL  IPWY+   I+I G RV  REKPGY
Sbjct  74   QRRLSCCGIGLGWFLFIVGFFLGGIPWYVGMGIMIVGRRVDHREKPGY  121



>gb|AFK49106.1| unknown [Lotus japonicus]
Length=152

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPG  350
            +R L CCG G GW +F++GFFL   PWYI AF+L+C ++  REKPG
Sbjct  79   ERRLCCCGLGLGWFLFITGFFLGGGPWYIGAFLLLCVQMDYREKPG  124



>emb|CDX81802.1| BnaC08g37990D [Brassica napus]
Length=147

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICG-RVGRREKPGY  353
             R L CCG G GW +F+ GFFL  IPWY+   I+I G RV  REKPGY
Sbjct  76   QRRLSCCGIGLGWFLFIVGFFLGGIPWYVGMGIMIVGRRVDHREKPGY  123



>ref|XP_001783148.1| predicted protein [Physcomitrella patens]
 gb|EDQ52034.1| predicted protein [Physcomitrella patens]
Length=130

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  210  DDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPG  350
            D   LP CG G GW +F+ GFF+V++PWY+ AFI  C     REK G
Sbjct  59   DSDELPFCGLGFGWFLFILGFFIVSVPWYVGAFIFFCLSYDYREKTG  105



>gb|AAM65804.1| 60S ribosomal protein L18A, putative [Arabidopsis thaliana]
Length=158

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +  LPCCG G GW +F+ GF    IPWY+ AFI++   V  REK GY
Sbjct  87   EHELPCCGLGMGWFLFIMGFLFGGIPWYLGAFIVLVTSVDHREKAGY  133



>ref|NP_001057602.2| Os06g0359400 [Oryza sativa Japonica Group]
 gb|EEE65682.1| hypothetical protein OsJ_21300 [Oryza sativa Japonica Group]
 dbj|BAF19516.2| Os06g0359400 [Oryza sativa Japonica Group]
Length=156

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 34/54 (63%), Gaps = 1/54 (2%)
 Frame = +3

Query  192  LLGGAP-DDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPG  350
            L+ G P  + PLP CG G GW +F+ GFFL  +PWY  AFIL    +  REKPG
Sbjct  77   LVEGVPIREPPLPFCGIGLGWILFLLGFFLAALPWYAGAFILFFVALDHREKPG  130



>ref|XP_010478372.1| PREDICTED: 60S ribosomal protein L18a-like protein [Camelina 
sativa]
Length=162

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +  LPCCG G GW +F+ GF    IPWY+ AFI++   V  REK GY
Sbjct  91   EHDLPCCGLGMGWFLFIMGFLFGGIPWYLGAFIILVTSVDHREKAGY  137



>ref|XP_010499516.1| PREDICTED: 60S ribosomal protein L18a-like protein [Camelina 
sativa]
Length=163

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +  LPCCG G GW +F+ GF    IPWY+ AFI++   V  REK GY
Sbjct  92   EHDLPCCGLGMGWFLFIMGFLFGGIPWYLGAFIILVTSVDHREKAGY  138



>ref|XP_006656069.1| PREDICTED: 60S ribosomal protein L18a-like protein-like [Oryza 
brachyantha]
Length=155

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPG  350
            + PLP CG G GW +F+ GFFL  +PWY  AFIL    +  REKPG
Sbjct  84   EPPLPFCGAGVGWTLFLLGFFLAAMPWYAGAFILFFIALDHREKPG  129



>ref|XP_010110993.1| 60S ribosomal protein L18a-1 [Morus notabilis]
 gb|EXC29379.1| 60S ribosomal protein L18a-1 [Morus notabilis]
Length=241

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 35/60 (58%), Gaps = 13/60 (22%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCM-------------FMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +  LPCCG G GW +             F+ GFFL  IPWY+ AFIL+C RV  REKPGY
Sbjct  85   EHRLPCCGLGMGWFLSVVLEHSVSETGEFLIGFFLGGIPWYVGAFILLCVRVDYREKPGY  144



>ref|XP_010460776.1| PREDICTED: 60S ribosomal protein L18a-like protein [Camelina 
sativa]
Length=163

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +  LPCCG G GW +F+ GF    IPWY+ AFI++   V  REK GY
Sbjct  92   EHDLPCCGLGMGWFLFIMGFLFGGIPWYLGAFIILVTSVDHREKAGY  138



>ref|XP_009115203.1| PREDICTED: 60S ribosomal protein L18a-like protein isoform X1 
[Brassica rapa]
 ref|XP_009115204.1| PREDICTED: 60S ribosomal protein L18a-like protein isoform X2 
[Brassica rapa]
Length=169

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +3

Query  210  DDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
             D P+PCCG G GW +F+ GF    IPWY+ A I++   V  REK GY
Sbjct  96   HDVPVPCCGFGMGWFLFIMGFLFGGIPWYLGAVIILFTSVDHREKAGY  143



>emb|CDY26303.1| BnaA09g26540D [Brassica napus]
Length=169

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +3

Query  210  DDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
             D P+PCCG G GW +F+ GF    IPWY+ A I++   V  REK GY
Sbjct  96   HDVPVPCCGFGMGWFLFIMGFLFGGIPWYLGAVIILFTSVDHREKAGY  143



>ref|XP_010487261.1| PREDICTED: 60S ribosomal protein L18a-like protein [Camelina 
sativa]
Length=144

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = +3

Query  210  DDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +   LPCCG G GW +F+ GFF   IPWYI  F+L+  R   RE+PGY
Sbjct  72   EHHRLPCCGIGVGWVLFILGFFFGAIPWYIGFFLLLFSR-NLRERPGY  118



>gb|AAG52055.1|AC022455_9 60S ribosomal protein L18A, putative; 23187-20334 [Arabidopsis 
thaliana]
Length=321

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +  LPCCG G GW +F+ GF    IPWY+ AFI++   V  REK GY
Sbjct  84   EHELPCCGLGMGWFLFIMGFLFGGIPWYLGAFIVLVTSVDHREKAGY  130



>emb|CDX98477.1| BnaC05g38980D [Brassica napus]
Length=139

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 32/53 (60%), Gaps = 1/53 (2%)
 Frame = +3

Query  195  LGGAPDDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            + G  +   LPCCG G GW +F+ GFF   IPWYI  F+ +  R   REKPGY
Sbjct  62   VNGVTEHDRLPCCGIGIGWLLFILGFFFGAIPWYIGFFLFLFSR-NPREKPGY  113



>ref|XP_009146341.1| PREDICTED: 60S ribosomal protein L18a-like protein [Brassica 
rapa]
 emb|CDX97586.1| BnaA05g24930D [Brassica napus]
Length=140

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 32/53 (60%), Gaps = 1/53 (2%)
 Frame = +3

Query  195  LGGAPDDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            + G  +   LPCCG G GW +F+ GFF   IPWYI  F+ +  R   REKPGY
Sbjct  63   VNGVTEHDRLPCCGIGIGWLLFILGFFFGAIPWYIGFFLFLFSR-NPREKPGY  114



>ref|XP_006407064.1| hypothetical protein EUTSA_v10021729mg [Eutrema salsugineum]
 gb|ESQ48517.1| hypothetical protein EUTSA_v10021729mg [Eutrema salsugineum]
Length=139

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +3

Query  210  DDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGYiactiaavaata  389
            +   LPCCG G GW +F+ GFF   IPWYI  F+L+  +   REKPGY+AC I AV AT 
Sbjct  68   EHHRLPCCGIGIGWLLFILGFFFGAIPWYIGFFLLLFSK-NPREKPGYVACAIGAVIATI  126

Query  390  aLIYGLYR  413
             +++G  R
Sbjct  127  IIVFGAIR  134



>ref|XP_002893593.1| 60S ribosomal protein L18A-1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69852.1| 60S ribosomal protein L18A-1 [Arabidopsis lyrata subsp. lyrata]
Length=314

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +  LPCCG G GW +F+ GF    IPWY+ AFI++   V  REK GY
Sbjct  89   EHELPCCGLGMGWFLFIMGFLFGGIPWYLGAFIVLVTSVDHREKAGY  135



>ref|NP_001077626.1| 60S ribosomal protein L18a-1 [Arabidopsis thaliana]
 gb|AEE31161.1| 60S ribosomal protein L18a-1 [Arabidopsis thaliana]
Length=312

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +  LPCCG G GW +F+ GF    IPWY+ AFI++   V  REK GY
Sbjct  87   EHELPCCGLGMGWFLFIMGFLFGGIPWYLGAFIVLVTSVDHREKAGY  133



>ref|XP_006645697.1| PREDICTED: 60S ribosomal protein L18a-like protein-like, partial 
[Oryza brachyantha]
Length=93

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 36/51 (71%), Gaps = 1/51 (2%)
 Frame = +3

Query  201  GAPDDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            G   DR LPCCG G GW +F+ GFFL  IPWY+ AF+L C RV  REKPGY
Sbjct  21   GHSHDR-LPCCGIGIGWFLFIFGFFLGAIPWYVGAFLLWCSRVDYREKPGY  70



>ref|XP_010465350.1| PREDICTED: 60S ribosomal protein L18a-like protein [Camelina 
sativa]
Length=142

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = +3

Query  210  DDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +   LPCCG G GW +F+ GFF   IPWYI  F+L+  R   RE+PGY
Sbjct  70   EHHRLPCCGIGIGWVLFILGFFFGAIPWYIGFFLLLFSR-NPRERPGY  116



>gb|KFK43899.1| hypothetical protein AALP_AA1G188400 [Arabis alpina]
Length=152

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICG-RVGRREKPGY  353
             R LPCCG G GW +F+ GFFL  +PWY+   I++ G R+  REKPGY
Sbjct  80   QRRLPCCGIGLGWFLFIIGFFLGALPWYLGLGIMMFGRRIDYREKPGY  127



>ref|XP_006306031.1| hypothetical protein CARUB_v10011327mg [Capsella rubella]
 gb|EOA38929.1| hypothetical protein CARUB_v10011327mg [Capsella rubella]
Length=319

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +  LPCCG G GW +F+ GF    IPWY+ AFI++   V  REK GY
Sbjct  94   EHDLPCCGLGMGWFLFIIGFLFGGIPWYLGAFIILVTSVDHREKAGY  140



>ref|XP_002969760.1| hypothetical protein SELMODRAFT_440940 [Selaginella moellendorffii]
 gb|EFJ28884.1| hypothetical protein SELMODRAFT_440940 [Selaginella moellendorffii]
Length=145

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 1/47 (2%)
 Frame = +3

Query  210  DDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPG  350
             DR LPCCG G GWC+F+ GF  +++PW++ AFI  C +   RE  G
Sbjct  77   HDR-LPCCGLGIGWCLFILGFLTLSLPWFVGAFIFFCIKTDAREHVG  122



>ref|XP_006298504.1| hypothetical protein CARUB_v10014581mg [Capsella rubella]
 gb|EOA31402.1| hypothetical protein CARUB_v10014581mg [Capsella rubella]
Length=222

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 31/50 (62%), Gaps = 1/50 (2%)
 Frame = +3

Query  204  APDDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
              +   LPCCG G GW +F+ GFF   IPWYI  F+L+  R   RE+PGY
Sbjct  148  TAEHHRLPCCGIGVGWVLFILGFFFGAIPWYIGFFLLLFSR-NVRERPGY  196



>ref|XP_006415527.1| hypothetical protein EUTSA_v10009933mg [Eutrema salsugineum]
 gb|ESQ33880.1| hypothetical protein EUTSA_v10009933mg [Eutrema salsugineum]
Length=317

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +  LPCCG G GW +F+ GF    IPWY+ A I++C  +  REK GY
Sbjct  92   EHDLPCCGFGMGWFLFIMGFLFGGIPWYLGAIIILCTSLDHREKAGY  138



>gb|EAY75299.1| hypothetical protein OsI_03190 [Oryza sativa Indica Group]
Length=521

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  216  RPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRV  329
            R LP CG G GW +F+ GFFL  IPWYI AF+LIC RV
Sbjct  114  RRLPFCGLGMGWFLFIIGFFLAAIPWYIGAFVLICVRV  151



>emb|CDX99868.1| BnaC05g22900D [Brassica napus]
Length=154

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +  +PCCG G GW +F+ GF    IPWY+ A I++   V  REK GY
Sbjct  82   EHDVPCCGFGMGWFLFIMGFLFGGIPWYLGAVIILFTSVDHREKAGY  128



>gb|KFK38817.1| hypothetical protein AALP_AA3G164200 [Arabis alpina]
Length=144

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 1/54 (2%)
 Frame = +3

Query  192  LLGGAPDDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            + GG  +   LPCCG G GW +F+ GFF   IPW+I  F+ +  R   RE+PGY
Sbjct  66   VAGGRHEYDRLPCCGLGIGWVLFILGFFFGAIPWFIGFFLFLFSR-NPRERPGY  118



>ref|XP_007147892.1| hypothetical protein PHAVU_006G163700g [Phaseolus vulgaris]
 gb|ESW19886.1| hypothetical protein PHAVU_006G163700g [Phaseolus vulgaris]
Length=147

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPG  350
            +  LPCCG G GW +F+ G+FL  +PWYI  F+L+  ++  REKPG
Sbjct  74   EHRLPCCGLGLGWFLFIIGWFLGGVPWYIGTFVLVFVQMDCREKPG  119



>ref|XP_006597529.1| PREDICTED: 60S ribosomal protein L18a-like protein-like [Glycine 
max]
 gb|KHN33138.1| 60S ribosomal protein L18a-1 [Glycine soja]
Length=147

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPG  350
            +R LPCCG   GW +F+ G+FL  +PWY+  FIL+   +  REKPG
Sbjct  72   ERRLPCCGLSLGWFLFIMGWFLGGVPWYVGTFILMFVHMDCREKPG  117



>ref|XP_001759098.1| predicted protein [Physcomitrella patens]
 gb|EDQ76167.1| predicted protein [Physcomitrella patens]
Length=170

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 28/47 (60%), Gaps = 0/47 (0%)
 Frame = +3

Query  210  DDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPG  350
            D   LP CG G GW +F+ GF + ++PWY+ AFI  C     RE+ G
Sbjct  96   DSDRLPFCGLGFGWFLFLLGFIIASVPWYVGAFIFFCLNYDHREETG  142



>ref|XP_006348354.1| PREDICTED: 60S ribosomal protein L18a-like protein-like isoform 
X3 [Solanum tuberosum]
Length=160

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = +3

Query  207  PDDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGR-VGRREKPGY  353
            P   P    G G GW +F+ GFFL   PWY+AAFI +C R +  REK GY
Sbjct  85   PVTEPRLPFGIGLGWFLFIIGFFLAGFPWYVAAFIPLCNRSIDHREKSGY  134



>ref|XP_006348353.1| PREDICTED: 60S ribosomal protein L18a-like protein-like isoform 
X2 [Solanum tuberosum]
Length=195

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = +3

Query  207  PDDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGR-VGRREKPGY  353
            P   P    G G GW +F+ GFFL   PWY+AAFI +C R +  REK GY
Sbjct  120  PVTEPRLPFGIGLGWFLFIIGFFLAGFPWYVAAFIPLCNRSIDHREKSGY  169



>ref|XP_006348352.1| PREDICTED: 60S ribosomal protein L18a-like protein-like isoform 
X1 [Solanum tuberosum]
Length=217

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 28/41 (68%), Gaps = 1/41 (2%)
 Frame = +3

Query  234  GCGTGWCMFMSGFFLVTIPWYIAAFILICGR-VGRREKPGY  353
            G G GW +F+ GFFL   PWY+AAFI +C R +  REK GY
Sbjct  151  GIGLGWFLFIIGFFLAGFPWYVAAFIPLCNRSIDHREKSGY  191



>ref|XP_008808927.1| PREDICTED: 60S ribosomal protein L18a-like protein isoform X1 
[Phoenix dactylifera]
 ref|XP_008808928.1| PREDICTED: 60S ribosomal protein L18a-like protein isoform X1 
[Phoenix dactylifera]
 ref|XP_008808929.1| PREDICTED: 60S ribosomal protein L18a-like protein isoform X1 
[Phoenix dactylifera]
 ref|XP_008808930.1| PREDICTED: 60S ribosomal protein L18a-like protein isoform X1 
[Phoenix dactylifera]
Length=104

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 29/48 (60%), Gaps = 3/48 (6%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGR--REKPG  350
            D+PLPCCGCG GWC  + GF    I WY AA + +C    R  RE+ G
Sbjct  34   DKPLPCCGCGIGWCSLLLGFVCPLI-WYCAAILYLCSYYHRDPRERSG  80



>ref|XP_008808931.1| PREDICTED: 60S ribosomal protein L18a-like protein isoform X2 
[Phoenix dactylifera]
 ref|XP_008808932.1| PREDICTED: 60S ribosomal protein L18a-like protein isoform X2 
[Phoenix dactylifera]
Length=101

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 29/48 (60%), Gaps = 3/48 (6%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGR--REKPG  350
            D+PLPCCGCG GWC  + GF    I WY AA + +C    R  RE+ G
Sbjct  31   DKPLPCCGCGIGWCSLLLGFVCPLI-WYCAAILYLCSYYHRDPRERSG  77



>ref|XP_004488664.1| PREDICTED: 60S ribosomal protein L18a-1-like [Cicer arietinum]
Length=154

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  213  DRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            +R L CCG G GWC+F+ GFFL  IPWY+ A I++C RV  REKPGY
Sbjct  83   ERRLGCCGFGCGWCLFILGFFLAAIPWYVGAIIMLCSRVDYREKPGY  129



>gb|KEH38467.1| transmembrane protein, putative [Medicago truncatula]
Length=160

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 39/56 (70%), Gaps = 1/56 (2%)
 Frame = +3

Query  189  PLLGGAP-DDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGRVGRREKPGY  353
            P+  G P  +R L CCG G GWC+F+ GFFL  IPWY+ A I++C RV  REKPG+
Sbjct  80   PVAEGRPVRERRLGCCGIGCGWCLFIMGFFLAAIPWYVGAIIMLCSRVDYREKPGF  135



>ref|XP_004244309.1| PREDICTED: 60S ribosomal protein L18a-like protein [Solanum lycopersicum]
Length=195

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = +3

Query  207  PDDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILICGR-VGRREKPGY  353
            P   P    G G GW +F+ GFFL   PWY+AAFI +C R +  REK G+
Sbjct  120  PVTEPRLPFGIGLGWFLFIIGFFLAGFPWYVAAFIPLCNRSIDHREKSGF  169



>gb|ABK23978.1| unknown [Picea sitchensis]
Length=114

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 32/57 (56%), Gaps = 3/57 (5%)
 Frame = +3

Query  186  QPLLGGAPDDRPLPCCGCGTGWCMFMSGFFLVTIPWYIAAFILI--CGRVGRREKPG  350
            +P L G   D PLPC GCG GW  F+ GF    + WY AAF+ +    R   RE+PG
Sbjct  35   EPYLYGGLYDEPLPCFGCGIGWFSFLLGFVFPPL-WYYAAFLYLRKYSRKNPRERPG  90



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 959982664718