BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c28467_g1_i1 len=1121 path=[1099:0-1120]

Length=1121
                                                                      Score     E

ref|XP_009775254.1|  PREDICTED: probable carboxylesterase 17            404   2e-136   
ref|XP_009605841.1|  PREDICTED: probable carboxylesterase 17            399   4e-134   
emb|CDP13505.1|  unnamed protein product                                388   2e-130   
ref|XP_007011874.1|  Carboxyesterase 17                                 380   5e-127   
ref|XP_006364937.1|  PREDICTED: probable carboxylesterase 17-like       379   9e-127   
ref|XP_003588759.1|  Arylacetamide deacetylase                          377   7e-126   
ref|XP_004245027.1|  PREDICTED: probable carboxylesterase 17            375   2e-125   
gb|KHN33922.1|  Putative carboxylesterase 17                            370   2e-123   
ref|XP_011081569.1|  PREDICTED: probable carboxylesterase 17            367   9e-122   
ref|XP_006483354.1|  PREDICTED: probable carboxylesterase 17-like       364   6e-121   
ref|XP_010254388.1|  PREDICTED: probable carboxylesterase 17            364   9e-121   
ref|XP_009355731.1|  PREDICTED: probable carboxylesterase 17            363   2e-120   
gb|ABB89002.1|  CXE carboxylesterase                                    362   3e-120   Malus pumila [paradise apple]
ref|XP_004291462.1|  PREDICTED: probable carboxylesterase 6-like        361   7e-120   
ref|XP_008394075.1|  PREDICTED: probable carboxylesterase 17            361   9e-120   
ref|XP_011026452.1|  PREDICTED: probable carboxylesterase 6             361   1e-119   
gb|KDP33601.1|  hypothetical protein JCGZ_07172                         358   1e-118   
ref|XP_002324857.1|  hypothetical protein POPTR_0018s01650g             358   1e-118   Populus trichocarpa [western balsam poplar]
ref|XP_008219487.1|  PREDICTED: probable carboxylesterase 17            357   4e-118   
ref|XP_002285083.1|  PREDICTED: probable carboxylesterase 17            355   3e-117   Vitis vinifera
ref|XP_007161215.1|  hypothetical protein PHAVU_001G051600g             354   4e-117   
ref|XP_007223144.1|  hypothetical protein PRUPE_ppa009018mg             352   2e-116   
emb|CBI21036.3|  unnamed protein product                                352   5e-116   
ref|XP_010048207.1|  PREDICTED: probable carboxylesterase 17            351   7e-116   
ref|XP_002285090.3|  PREDICTED: probable carboxylesterase 17            353   8e-116   Vitis vinifera
ref|XP_002285085.1|  PREDICTED: probable carboxylesterase 17            349   3e-115   Vitis vinifera
emb|CAN69539.1|  hypothetical protein VITISV_007805                     349   5e-115   Vitis vinifera
ref|XP_002285088.1|  PREDICTED: probable carboxylesterase 17 isof...    348   1e-114   Vitis vinifera
ref|XP_010648659.1|  PREDICTED: probable carboxylesterase 17 isof...    347   2e-114   
gb|EYU20270.1|  hypothetical protein MIMGU_mgv1a010399mg                343   1e-112   
ref|XP_002285081.1|  PREDICTED: probable carboxylesterase 17            342   5e-112   Vitis vinifera
ref|XP_002285077.1|  PREDICTED: probable carboxylesterase 17            341   7e-112   Vitis vinifera
ref|XP_010696064.1|  PREDICTED: probable carboxylesterase 17            340   1e-111   
ref|XP_004498733.1|  PREDICTED: probable carboxylesterase 17-like       348   2e-111   
ref|NP_001268122.1|  serine hydrolase-like                              333   1e-108   
ref|XP_006382075.1|  hypothetical protein POPTR_0006s26960g             325   1e-105   
emb|CBI21033.3|  unnamed protein product                                344   5e-104   
ref|XP_002515523.1|  Arylacetamide deacetylase, putative                319   9e-104   Ricinus communis
emb|CAN64273.1|  hypothetical protein VITISV_012394                     303   2e-97    Vitis vinifera
ref|XP_006842080.1|  hypothetical protein AMTR_s00078p00065010          293   3e-93    
gb|KCW80387.1|  hypothetical protein EUGRSUZ_C01748                     290   1e-92    
gb|AAD04946.2|  PrMC3                                                   275   8e-86    Pinus radiata
gb|ABK26297.1|  unknown                                                 211   4e-61    Picea sitchensis
gb|ABK22851.1|  unknown                                                 201   4e-57    Picea sitchensis
gb|ABK23572.1|  unknown                                                 201   5e-57    Picea sitchensis
gb|ABK26549.1|  unknown                                                 192   1e-53    Picea sitchensis
ref|XP_003530910.1|  PREDICTED: probable carboxylesterase 17-like       191   3e-53    
gb|KCW86344.1|  hypothetical protein EUGRSUZ_B03032                     190   4e-53    
ref|XP_010044279.1|  PREDICTED: probable carboxylesterase 6             190   7e-53    
gb|ADE76723.1|  unknown                                                 187   1e-51    
gb|KFK25845.1|  hypothetical protein AALP_AA8G169600                    186   3e-51    
ref|XP_010492485.1|  PREDICTED: LOW QUALITY PROTEIN: probable car...    185   3e-51    
ref|XP_007139137.1|  hypothetical protein PHAVU_008G004600g             185   3e-51    
gb|KDP32942.1|  hypothetical protein JCGZ_12973                         184   8e-51    
ref|NP_197112.1|  carboxyesterase 17                                    184   9e-51    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010453762.1|  PREDICTED: probable carboxylesterase 17            184   1e-50    
ref|XP_006400140.1|  hypothetical protein EUTSA_v10013981mg             184   2e-50    
ref|XP_002887194.1|  hypothetical protein ARALYDRAFT_475988             183   2e-50    
ref|XP_010420290.1|  PREDICTED: probable carboxylesterase 17            183   3e-50    
ref|XP_010415489.1|  PREDICTED: probable carboxylesterase 6             182   3e-50    
ref|XP_006826793.1|  hypothetical protein AMTR_s00010p00019880          182   4e-50    
emb|CDX69476.1|  BnaA10g18250D                                          181   7e-50    
emb|CDY70129.1|  BnaCnng66860D                                          181   8e-50    
ref|XP_007046274.1|  Alpha/beta-Hydrolases superfamily protein          181   9e-50    
ref|XP_009121518.1|  PREDICTED: probable carboxylesterase 17            182   9e-50    
gb|AAM65164.1|  unknown                                                 181   1e-49    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006290116.1|  hypothetical protein CARUB_v10003763mg             181   2e-49    
gb|ABK22844.1|  unknown                                                 179   4e-49    Picea sitchensis
ref|XP_010681590.1|  PREDICTED: probable carboxylesterase 6             180   4e-49    
ref|XP_010032629.1|  PREDICTED: probable carboxylesterase 17            179   6e-49    
ref|XP_010470815.1|  PREDICTED: probable carboxylesterase 6             179   6e-49    
ref|XP_009618563.1|  PREDICTED: probable carboxylesterase 6             179   1e-48    
ref|XP_002873755.1|  hypothetical protein ARALYDRAFT_488458             179   1e-48    
ref|XP_004297130.1|  PREDICTED: probable carboxylesterase 6-like        179   1e-48    
ref|NP_564936.1|  probable carboxylesterase 6                           178   1e-48    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006391117.1|  hypothetical protein EUTSA_v10019529mg             178   1e-48    
ref|XP_006437705.1|  hypothetical protein CICLE_v10031957mg             179   1e-48    
ref|XP_011070822.1|  PREDICTED: probable carboxylesterase 6             178   1e-48    
ref|XP_010263304.1|  PREDICTED: probable carboxylesterase 17            178   1e-48    
ref|XP_006302519.1|  hypothetical protein CARUB_v10020617mg             178   2e-48    
ref|XP_009766513.1|  PREDICTED: probable carboxylesterase 6             178   2e-48    
ref|XP_007033296.1|  Carboxyesterase 17                                 178   2e-48    
ref|XP_003551853.1|  PREDICTED: probable carboxylesterase 17-like       177   6e-48    
gb|KFK41285.1|  hypothetical protein AALP_AA2G110100                    176   6e-48    
ref|XP_004497111.1|  PREDICTED: probable carboxylesterase 17-like       176   8e-48    
ref|XP_010511871.1|  PREDICTED: probable carboxylesterase 6             176   1e-47    
ref|XP_008243198.1|  PREDICTED: probable carboxylesterase 6             177   1e-47    
ref|XP_006362556.1|  PREDICTED: probable carboxylesterase 6-like        176   1e-47    
ref|XP_008800776.1|  PREDICTED: probable carboxylesterase 17            175   2e-47    
ref|XP_003637423.1|  Arylacetamide deacetylase                          176   2e-47    
ref|XP_010932611.1|  PREDICTED: probable carboxylesterase 17            175   2e-47    
ref|XP_010067679.1|  PREDICTED: probable carboxylesterase 15            175   3e-47    
ref|XP_008230396.1|  PREDICTED: probable carboxylesterase 17            175   3e-47    
ref|XP_002279965.2|  PREDICTED: probable carboxylesterase 17            174   7e-47    Vitis vinifera
ref|XP_008236533.1|  PREDICTED: probable carboxylesterase 12            173   7e-47    
ref|XP_007224811.1|  hypothetical protein PRUPE_ppa023588mg             174   8e-47    
ref|XP_009105029.1|  PREDICTED: probable carboxylesterase 6             173   9e-47    
ref|XP_011011184.1|  PREDICTED: probable carboxylesterase 17            174   9e-47    
ref|XP_009352462.1|  PREDICTED: probable carboxylesterase 17            173   1e-46    
gb|ABB89015.1|  CXE carboxylesterase                                    173   1e-46    Actinidia deliciosa [Chinese gooseberry]
gb|ABK22244.1|  unknown                                                 172   2e-46    Picea sitchensis
ref|XP_002516731.1|  Lipase, putative                                   172   2e-46    Ricinus communis
ref|XP_002315949.2|  hypothetical protein POPTR_0010s13770g             172   2e-46    Populus trichocarpa [western balsam poplar]
ref|XP_007217618.1|  hypothetical protein PRUPE_ppa016280mg             172   3e-46    
ref|XP_007142891.1|  hypothetical protein PHAVU_007G025700g             172   3e-46    
ref|XP_004238946.1|  PREDICTED: probable carboxylesterase 6             172   5e-46    
ref|XP_009421110.1|  PREDICTED: probable carboxylesterase 17            171   5e-46    
ref|XP_006373441.1|  hypothetical protein POPTR_0017s13800g             171   6e-46    
ref|XP_010558554.1|  PREDICTED: probable carboxylesterase 17            171   7e-46    
gb|ABD96915.1|  hypothetical protein                                    171   7e-46    Tarenaya spinosa
ref|XP_009791632.1|  PREDICTED: probable carboxylesterase 17            171   7e-46    
ref|XP_010916828.1|  PREDICTED: probable carboxylesterase 2             170   8e-46    
ref|XP_011008304.1|  PREDICTED: probable carboxylesterase 6             171   9e-46    
ref|XP_009357117.1|  PREDICTED: probable carboxylesterase 17            173   9e-46    
ref|XP_011021229.1|  PREDICTED: probable carboxylesterase 17            171   1e-45    
ref|XP_006430794.1|  hypothetical protein CICLE_v10012053mg             171   1e-45    
ref|XP_010692771.1|  PREDICTED: probable carboxylesterase 17            171   1e-45    
ref|XP_004142252.1|  PREDICTED: probable carboxylesterase 15-like       170   1e-45    
ref|XP_009347690.1|  PREDICTED: probable carboxylesterase 17            171   2e-45    
ref|XP_004135407.1|  PREDICTED: probable carboxylesterase 6-like        170   2e-45    
ref|XP_002278939.1|  PREDICTED: probable carboxylesterase 6             171   2e-45    Vitis vinifera
gb|KHN05581.1|  Putative carboxylesterase 17                            170   2e-45    
ref|XP_002305152.2|  hypothetical protein POPTR_0004s10090g             169   3e-45    Populus trichocarpa [western balsam poplar]
ref|XP_011077141.1|  PREDICTED: probable carboxylesterase 6             169   4e-45    
ref|XP_008805243.1|  PREDICTED: probable carboxylesterase 2             168   4e-45    
gb|KDP29384.1|  hypothetical protein JCGZ_18305                         169   5e-45    
ref|XP_010916155.1|  PREDICTED: probable carboxylesterase 17            169   5e-45    
gb|AAT72498.1|  AT1G68620                                               164   7e-45    Arabidopsis lyrata subsp. petraea
ref|XP_003555229.2|  PREDICTED: probable carboxylesterase 17-like       169   8e-45    
ref|XP_002311450.1|  hypothetical protein POPTR_0008s11720g             168   9e-45    Populus trichocarpa [western balsam poplar]
ref|XP_006482268.1|  PREDICTED: probable carboxylesterase 17-like       168   9e-45    
gb|KHN11435.1|  Putative carboxylesterase 17                            168   9e-45    
gb|AFK46820.1|  unknown                                                 168   1e-44    
ref|XP_008352926.1|  PREDICTED: probable carboxylesterase 6             169   1e-44    
ref|XP_010102838.1|  putative carboxylesterase 6                        169   1e-44    
ref|XP_004162022.1|  PREDICTED: probable carboxylesterase 15-like       167   1e-44    
ref|XP_008775049.1|  PREDICTED: probable carboxylesterase 17            168   1e-44    
ref|XP_003558312.1|  PREDICTED: probable carboxylesterase 17            169   1e-44    
ref|XP_009370630.1|  PREDICTED: probable carboxylesterase 15            167   1e-44    
ref|XP_009403354.1|  PREDICTED: tuliposide A-converting enzyme 1,...    167   1e-44    
gb|EYU40873.1|  hypothetical protein MIMGU_mgv1a018147mg                168   2e-44    
gb|ABK26852.1|  unknown                                                 167   2e-44    Picea sitchensis
ref|XP_008446570.1|  PREDICTED: probable carboxylesterase 6             167   3e-44    
ref|XP_009356465.1|  PREDICTED: probable carboxylesterase 6             168   3e-44    
ref|XP_004294833.1|  PREDICTED: probable carboxylesterase 12-like       166   3e-44    
ref|XP_009105413.1|  PREDICTED: probable carboxylesterase 6             166   4e-44    
gb|KHN24944.1|  Putative carboxylesterase 17                            164   5e-44    
ref|XP_009622412.1|  PREDICTED: probable carboxylesterase 17            166   7e-44    
ref|XP_001767205.1|  GLP3 GID1-like protein                             166   7e-44    
gb|ABK26127.1|  unknown                                                 166   8e-44    Picea sitchensis
ref|XP_008379534.1|  PREDICTED: probable carboxylesterase 17            166   1e-43    
ref|XP_008346678.1|  PREDICTED: probable carboxylesterase 15            165   1e-43    
ref|XP_004489120.1|  PREDICTED: probable carboxylesterase 17-like       165   1e-43    
gb|ABK25952.1|  unknown                                                 165   1e-43    Picea sitchensis
ref|XP_011085931.1|  PREDICTED: probable carboxylesterase 15 isof...    165   2e-43    
ref|XP_008449839.1|  PREDICTED: probable carboxylesterase 15            164   2e-43    
emb|CDP01339.1|  unnamed protein product                                164   2e-43    
gb|ADE75740.1|  unknown                                                 164   3e-43    
ref|XP_002529140.1|  catalytic, putative                                164   3e-43    Ricinus communis
ref|XP_010265194.1|  PREDICTED: probable carboxylesterase 6             164   3e-43    
emb|CAN61111.1|  hypothetical protein VITISV_006466                     163   3e-43    Vitis vinifera
ref|XP_010030292.1|  PREDICTED: probable carboxylesterase 18            163   4e-43    
ref|XP_009404788.1|  PREDICTED: probable carboxylesterase 17            164   4e-43    
ref|XP_004304137.1|  PREDICTED: probable carboxylesterase 17-like       163   5e-43    
ref|XP_002285064.2|  PREDICTED: probable carboxylesterase 2             165   5e-43    Vitis vinifera
gb|ABK25184.1|  unknown                                                 163   8e-43    Picea sitchensis
ref|XP_007152464.1|  hypothetical protein PHAVU_004G132800g             163   8e-43    
ref|XP_002277680.1|  PREDICTED: probable carboxylesterase 6             163   8e-43    Vitis vinifera
ref|XP_006826391.1|  hypothetical protein AMTR_s00004p00146330          162   9e-43    
emb|CDP12915.1|  unnamed protein product                                163   9e-43    
ref|XP_002461499.1|  hypothetical protein SORBIDRAFT_02g003610          163   1e-42    Sorghum bicolor [broomcorn]
ref|XP_007151773.1|  hypothetical protein PHAVU_004G073600g             162   1e-42    
ref|XP_002468158.1|  hypothetical protein SORBIDRAFT_01g040580          163   1e-42    Sorghum bicolor [broomcorn]
ref|XP_007199906.1|  hypothetical protein PRUPE_ppa007279mg             163   2e-42    
ref|XP_002510251.1|  Gibberellin receptor GID1, putative                161   2e-42    Ricinus communis
ref|NP_001149748.1|  LOC100283375                                       162   2e-42    Zea mays [maize]
ref|XP_007151780.1|  hypothetical protein PHAVU_004G074300g             162   2e-42    
emb|CDP00594.1|  unnamed protein product                                162   2e-42    
ref|XP_004494115.1|  PREDICTED: probable carboxylesterase 18-like       162   2e-42    
gb|ACF87795.1|  unknown                                                 162   3e-42    Zea mays [maize]
ref|XP_004291126.1|  PREDICTED: probable carboxylesterase 2-like        160   3e-42    
ref|XP_002994597.1|  hypothetical protein SELMODRAFT_138855             161   4e-42    
ref|XP_002966042.1|  hypothetical protein SELMODRAFT_25100              160   4e-42    
ref|XP_002974173.1|  hypothetical protein SELMODRAFT_15028              160   4e-42    
gb|ABK26900.1|  unknown                                                 160   5e-42    Picea sitchensis
ref|XP_003550344.1|  PREDICTED: probable carboxylesterase 13-like       160   7e-42    
ref|NP_001049607.1|  Os03g0258200                                       161   8e-42    Oryza sativa Japonica Group [Japonica rice]
emb|CAN75310.1|  hypothetical protein VITISV_033324                     160   8e-42    Vitis vinifera
ref|XP_008236606.1|  PREDICTED: probable carboxylesterase 5             161   8e-42    
ref|XP_008236532.1|  PREDICTED: probable carboxylesterase 12            159   8e-42    
ref|XP_004984954.1|  PREDICTED: probable carboxylesterase 17-like       161   9e-42    
ref|XP_004986199.1|  PREDICTED: probable carboxylesterase 15-like       160   9e-42    
gb|KDP32941.1|  hypothetical protein JCGZ_12972                         160   9e-42    
gb|KEH22636.1|  CXE carboxylesterase                                    160   1e-41    
ref|XP_004505198.1|  PREDICTED: probable carboxylesterase 2-like        159   1e-41    
ref|XP_006487818.1|  PREDICTED: probable carboxylesterase 15-like       159   1e-41    
ref|XP_007199222.1|  hypothetical protein PRUPE_ppa021907mg             159   1e-41    
ref|XP_007200860.1|  hypothetical protein PRUPE_ppa027099mg             159   2e-41    
ref|XP_008392310.1|  PREDICTED: probable carboxylesterase 12            160   2e-41    
ref|XP_008231719.1|  PREDICTED: probable carboxylesterase 15            159   2e-41    
ref|XP_010246597.1|  PREDICTED: probable carboxylesterase 18            159   2e-41    
ref|XP_007017300.1|  Catalytic, putative                                159   2e-41    
gb|EAY89312.1|  hypothetical protein OsI_10815                          159   2e-41    Oryza sativa Indica Group [Indian rice]
ref|XP_002270210.1|  PREDICTED: probable carboxylesterase 18            159   2e-41    Vitis vinifera
ref|XP_011041377.1|  PREDICTED: probable carboxylesterase 15            159   3e-41    
ref|XP_007218270.1|  hypothetical protein PRUPE_ppa008273mg             159   3e-41    
ref|XP_009410114.1|  PREDICTED: tuliposide A-converting enzyme 1,...    158   3e-41    
ref|XP_010269100.1|  PREDICTED: probable carboxylesterase 2             158   4e-41    
ref|XP_010546272.1|  PREDICTED: probable carboxylesterase 18            158   4e-41    
ref|XP_010547703.1|  PREDICTED: probable carboxylesterase 18            158   4e-41    
ref|XP_004294831.1|  PREDICTED: probable carboxylesterase 12-like       157   5e-41    
ref|XP_007136667.1|  hypothetical protein PHAVU_009G063600g             157   5e-41    
ref|XP_006837038.1|  hypothetical protein AMTR_s00110p00041000          159   5e-41    
ref|XP_004303415.1|  PREDICTED: probable carboxylesterase 15-like       158   5e-41    
ref|XP_007010790.1|  Alpha/beta-Hydrolases superfamily protein          157   7e-41    
ref|XP_008655646.1|  PREDICTED: probable carboxylesterase 15            157   8e-41    
ref|XP_003619717.1|  CXE carboxylesterase                               157   8e-41    
ref|XP_002285067.1|  PREDICTED: probable carboxylesterase 2             157   9e-41    Vitis vinifera
gb|EYU36292.1|  hypothetical protein MIMGU_mgv1a009954mg                157   9e-41    
ref|XP_008652039.1|  PREDICTED: probable carboxylesterase 15            157   9e-41    
ref|XP_007199215.1|  hypothetical protein PRUPE_ppa021861mg             157   1e-40    
gb|EYU46638.1|  hypothetical protein MIMGU_mgv1a009369mg                157   1e-40    
gb|ABB89006.1|  CXE carboxylesterase                                    156   1e-40    Malus pumila [paradise apple]
ref|XP_008344561.1|  PREDICTED: probable carboxylesterase 15            157   1e-40    
ref|XP_010908310.1|  PREDICTED: probable carboxylesterase 15            157   1e-40    
tpg|DAA63886.1|  TPA: hypothetical protein ZEAMMB73_971270              157   2e-40    
gb|EAY72594.1|  hypothetical protein OsI_00460                          157   2e-40    Oryza sativa Indica Group [Indian rice]
ref|XP_011089000.1|  PREDICTED: probable carboxylesterase 15            156   2e-40    
ref|XP_006836875.1|  hypothetical protein AMTR_s00099p00101950          156   2e-40    
ref|XP_002285076.1|  PREDICTED: probable carboxylesterase 2             156   2e-40    Vitis vinifera
gb|AEP68102.1|  CXE protein                                             156   2e-40    
ref|XP_007201337.1|  hypothetical protein PRUPE_ppa007658mg             157   2e-40    
ref|XP_009370628.1|  PREDICTED: probable carboxylesterase 15            156   2e-40    
ref|XP_007156545.1|  hypothetical protein PHAVU_003G295100g             155   2e-40    
ref|XP_008372377.1|  PREDICTED: LOW QUALITY PROTEIN: probable car...    155   2e-40    
ref|XP_006340439.1|  PREDICTED: probable carboxylesterase 15-like       156   2e-40    
ref|XP_006487081.1|  PREDICTED: probable carboxylesterase 5-like        155   3e-40    
ref|XP_009373950.1|  PREDICTED: gibberellin receptor GID1C-like         157   3e-40    
ref|XP_006358445.1|  PREDICTED: gibberellin receptor GID1B-like         156   3e-40    
gb|ABB89020.1|  CXE carboxylesterase                                    156   3e-40    Actinidia deliciosa [Chinese gooseberry]
ref|XP_001757066.1|  GLP1 GID1-like protein                             156   3e-40    
ref|XP_002268777.1|  PREDICTED: probable carboxylesterase 18            155   3e-40    Vitis vinifera
ref|XP_008652041.1|  PREDICTED: probable carboxylesterase 15            155   3e-40    
ref|XP_004233713.1|  PREDICTED: probable carboxylesterase 17            156   3e-40    
ref|XP_009401277.1|  PREDICTED: tuliposide A-converting enzyme 1,...    155   4e-40    
ref|XP_002322605.2|  hypothetical protein POPTR_0016s03130g             155   4e-40    Populus trichocarpa [western balsam poplar]
ref|NP_001042063.1|  Os01g0155000                                       155   4e-40    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004148971.1|  PREDICTED: probable carboxylesterase 18-like       156   4e-40    
ref|XP_009127658.1|  PREDICTED: probable carboxylesterase 6             155   4e-40    
ref|XP_009107422.1|  PREDICTED: probable carboxylesterase 2             155   4e-40    
ref|XP_010691030.1|  PREDICTED: probable carboxylesterase 2             155   4e-40    
ref|XP_009127732.1|  PREDICTED: probable carboxylesterase 6             155   4e-40    
ref|XP_008653405.1|  PREDICTED: probable carboxylesterase 18            156   4e-40    
emb|CDY17014.1|  BnaA08g03780D                                          155   5e-40    
ref|XP_004505199.1|  PREDICTED: probable carboxylesterase 2-like        154   5e-40    
ref|XP_004161541.1|  PREDICTED: probable carboxylesterase 18-like       155   5e-40    
gb|AFD32893.1|  GID1d                                                   155   5e-40    
ref|XP_003608010.1|  Hormone-sensitive lipase                           155   6e-40    
gb|KGN48323.1|  Gibberellin receptor GID1                               154   7e-40    
ref|XP_002268861.1|  PREDICTED: probable carboxylesterase 18            155   7e-40    Vitis vinifera
ref|XP_008459209.1|  PREDICTED: probable carboxylesterase 7             156   8e-40    
ref|XP_007200443.1|  hypothetical protein PRUPE_ppa008902mg             154   8e-40    
ref|XP_009627722.1|  PREDICTED: probable carboxylesterase 15            154   8e-40    
ref|XP_006370967.1|  hypothetical protein POPTR_0019s02210g             155   8e-40    
ref|XP_004958497.1|  PREDICTED: probable carboxylesterase 18-like       155   8e-40    
ref|XP_006424040.1|  hypothetical protein CICLE_v10028832mg             154   9e-40    
gb|KDP25934.1|  hypothetical protein JCGZ_22839                         154   9e-40    
ref|NP_001183655.1|  hypothetical protein                               155   9e-40    
ref|XP_003619730.1|  Arylacetamide deacetylase-like protein             155   9e-40    
ref|XP_010275601.1|  PREDICTED: probable carboxylesterase 2             154   1e-39    
ref|XP_008359882.1|  PREDICTED: gibberellin receptor GID1C-like         155   1e-39    
ref|XP_009372982.1|  PREDICTED: probable carboxylesterase 18            154   1e-39    
gb|ABB89024.1|  CXE carboxylesterase                                    155   1e-39    Actinidia chinensis
gb|KDP38377.1|  hypothetical protein JCGZ_04302                         154   1e-39    
emb|CAN76040.1|  hypothetical protein VITISV_017925                     154   1e-39    Vitis vinifera
ref|XP_002461496.1|  hypothetical protein SORBIDRAFT_02g003570          155   1e-39    Sorghum bicolor [broomcorn]
gb|AAF62404.1|AF212184_1  cell death associated protein                 154   1e-39    Nicotiana tabacum [American tobacco]
ref|XP_008346180.1|  PREDICTED: probable carboxylesterase 12            154   1e-39    
ref|XP_002964555.1|  hypothetical protein SELMODRAFT_166817             154   1e-39    
ref|XP_002277507.1|  PREDICTED: probable carboxylesterase 15            154   1e-39    
ref|XP_004964885.1|  PREDICTED: probable carboxylesterase 2-like        154   1e-39    
sp|I4DST8.1|TCEA1_TULGE  RecName: Full=Tuliposide A-converting en...    155   1e-39    
emb|CDY69438.1|  BnaC08g46740D                                          153   2e-39    
dbj|BAJ98353.1|  predicted protein                                      154   2e-39    
ref|XP_009592309.1|  PREDICTED: probable carboxylesterase 15            154   2e-39    
ref|XP_009374931.1|  PREDICTED: probable carboxylesterase 18            154   2e-39    
ref|XP_006441778.1|  hypothetical protein CICLE_v10020805mg             154   2e-39    
ref|XP_011074454.1|  PREDICTED: probable carboxylesterase 2             154   2e-39    
ref|XP_010647769.1|  PREDICTED: probable carboxylesterase 2             154   2e-39    
ref|NP_001060440.1|  Os07g0643100                                       154   2e-39    
dbj|BAM20981.1|  tuliposide A-converting enzyme                         155   2e-39    
emb|CBI24401.3|  unnamed protein product                                154   2e-39    
gb|KHN12768.1|  Putative carboxylesterase 13                            154   2e-39    
ref|XP_007143222.1|  hypothetical protein PHAVU_007G054300g             153   2e-39    
ref|XP_011083238.1|  PREDICTED: probable carboxylesterase 18            154   2e-39    
ref|XP_008236608.1|  PREDICTED: probable carboxylesterase 12            154   2e-39    
ref|XP_006363152.1|  PREDICTED: probable carboxylesterase 17-like       153   3e-39    
ref|XP_003534059.1|  PREDICTED: probable carboxylesterase 18-like       153   3e-39    
ref|XP_010653056.1|  PREDICTED: probable carboxylesterase 18            153   3e-39    
ref|XP_002462164.1|  hypothetical protein SORBIDRAFT_02g020810          153   3e-39    
ref|XP_004248669.1|  PREDICTED: probable carboxylesterase 18            153   3e-39    
ref|XP_004955528.1|  PREDICTED: probable carboxylesterase 15-like       153   3e-39    
ref|XP_007048611.1|  Carboxyesterase 18                                 153   3e-39    
ref|XP_004955512.1|  PREDICTED: probable carboxylesterase 15-like       154   3e-39    
gb|EAZ02863.1|  hypothetical protein OsI_24993                          153   3e-39    
ref|XP_003561402.1|  PREDICTED: probable carboxylesterase 15            154   3e-39    
ref|XP_003548267.1|  PREDICTED: probable carboxylesterase 18-like       153   3e-39    
ref|XP_004294838.1|  PREDICTED: probable carboxylesterase 1-like        152   3e-39    
ref|NP_001058947.1|  Os07g0162400                                       153   4e-39    
sp|I4DST9.1|TCEA2_TULGE  RecName: Full=Tuliposide A-converting en...    154   4e-39    
dbj|BAJ96540.1|  predicted protein                                      153   4e-39    
dbj|BAM20982.1|  tuliposide A-converting enzyme                         154   4e-39    
gb|AGU38487.1|  GID1b                                                   153   4e-39    
dbj|BAE16319.1|  hsr203J                                                153   4e-39    
ref|XP_002266969.2|  PREDICTED: probable carboxylesterase 15            155   4e-39    
ref|XP_008382301.1|  PREDICTED: probable carboxylesterase 18            153   4e-39    
ref|XP_008653975.1|  PREDICTED: tuliposide A-converting enzyme 1,...    152   4e-39    
dbj|BAM20980.1|  tuliposide A-converting enzyme                         154   4e-39    
ref|XP_004955527.1|  PREDICTED: probable carboxylesterase 15-like       153   4e-39    
dbj|BAD11070.1|  HSR203J like protein                                   152   5e-39    
ref|XP_004251433.1|  PREDICTED: probable carboxylesterase 15            152   5e-39    
ref|XP_008391530.1|  PREDICTED: probable carboxylesterase 15            152   5e-39    
ref|XP_008462636.1|  PREDICTED: probable carboxylesterase 15            152   5e-39    
ref|XP_006365924.1|  PREDICTED: probable carboxylesterase 18-like       153   5e-39    
emb|CAN87127.1|  putative gibberellin receptor                          153   6e-39    
emb|CAN82420.1|  hypothetical protein VITISV_033678                     152   6e-39    
ref|XP_007202225.1|  hypothetical protein PRUPE_ppa008578mg             152   7e-39    
ref|XP_009768118.1|  PREDICTED: gibberellin receptor GID1B-like         152   7e-39    
dbj|BAJ97938.1|  predicted protein                                      152   7e-39    
ref|XP_009778712.1|  PREDICTED: probable carboxylesterase 15            152   7e-39    
gb|KHN17325.1|  Putative carboxylesterase 17                            150   7e-39    
ref|XP_009785385.1|  PREDICTED: gibberellin receptor GID1B-like         152   8e-39    
tpg|DAA61795.1|  TPA: hypothetical protein ZEAMMB73_120443              152   8e-39    
ref|XP_006836874.1|  hypothetical protein AMTR_s00099p00101040          152   8e-39    
gb|AFA35961.1|  gid1-like gibberellin receptor                          152   8e-39    
ref|XP_004233172.1|  PREDICTED: probable carboxylesterase 15            152   8e-39    
gb|KDO39565.1|  hypothetical protein CISIN_1g038316mg                   152   8e-39    
ref|XP_006365923.1|  PREDICTED: probable carboxylesterase 18-like       152   9e-39    
ref|XP_004307204.1|  PREDICTED: probable carboxylesterase 17-like       152   9e-39    
ref|XP_006478363.1|  PREDICTED: probable carboxylesterase 18-like       152   9e-39    
ref|XP_002975994.1|  hypothetical protein SELMODRAFT_104649             151   9e-39    
ref|XP_011034694.1|  PREDICTED: probable carboxylesterase 15            152   1e-38    
ref|XP_008451245.1|  PREDICTED: probable carboxylesterase 18            152   1e-38    
ref|XP_002970604.1|  hypothetical protein SELMODRAFT_93760              150   1e-38    
ref|XP_006353022.1|  PREDICTED: probable carboxylesterase 15-like       152   1e-38    
emb|CAN74724.1|  hypothetical protein VITISV_037263                     151   1e-38    
ref|XP_002968441.1|  hypothetical protein SELMODRAFT_89683              150   1e-38    
ref|XP_009788938.1|  PREDICTED: probable carboxylesterase 15            151   1e-38    
gb|ABB89017.1|  CXE carboxylesterase                                    151   1e-38    
dbj|BAC15624.1|  hsr203J                                                151   1e-38    
gb|KDP31600.1|  hypothetical protein JCGZ_14825                         151   1e-38    
ref|XP_008375948.1|  PREDICTED: probable carboxylesterase 12            151   1e-38    
ref|XP_011006470.1|  PREDICTED: probable carboxylesterase 12            151   1e-38    
ref|XP_009403370.1|  PREDICTED: probable carboxylesterase 12            151   1e-38    
ref|XP_009370629.1|  PREDICTED: probable carboxylesterase 6             152   1e-38    
ref|XP_009607174.1|  PREDICTED: gibberellin receptor GID1B-like         151   2e-38    
gb|AGN72650.1|  gibberellin receptor GID1C                              151   2e-38    
gb|EAZ04908.1|  hypothetical protein OsI_27089                          151   2e-38    
ref|XP_009770110.1|  PREDICTED: probable carboxylesterase 17            151   2e-38    
ref|XP_010265448.1|  PREDICTED: probable carboxylesterase 18            151   2e-38    
ref|XP_011002919.1|  PREDICTED: probable carboxylesterase 18            151   2e-38    
ref|XP_008222955.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    151   2e-38    
ref|XP_004147396.1|  PREDICTED: probable carboxylesterase 18-like       151   2e-38    
ref|XP_009798409.1|  PREDICTED: probable carboxylesterase 15            152   2e-38    
ref|NP_001058951.1|  Os07g0162900                                       151   2e-38    
ref|XP_003527508.1|  PREDICTED: probable carboxylesterase 15-like...    151   2e-38    
ref|NP_001057132.1|  Os06g0214800                                       151   2e-38    
ref|XP_006379210.1|  hypothetical protein POPTR_0009s10780g             152   2e-38    
ref|XP_010943012.1|  PREDICTED: tuliposide A-converting enzyme 2,...    150   2e-38    
ref|XP_010454640.1|  PREDICTED: probable carboxylesterase 18            151   2e-38    
ref|XP_008459512.1|  PREDICTED: probable carboxylesterase 18            151   2e-38    
ref|XP_004955526.1|  PREDICTED: probable carboxylesterase 15-like       151   2e-38    
gb|EAY92127.1|  hypothetical protein OsI_13838                          151   2e-38    
ref|XP_006829146.1|  hypothetical protein AMTR_s00001p00269430          150   2e-38    
ref|XP_004307205.1|  PREDICTED: probable carboxylesterase 6-like        151   2e-38    
ref|XP_009406562.1|  PREDICTED: probable carboxylesterase 15            151   2e-38    
ref|XP_007019742.1|  Carboxyesterase 18, putative                       151   2e-38    
ref|XP_010644022.1|  PREDICTED: probable carboxylesterase 18            150   2e-38    
ref|XP_008373167.1|  PREDICTED: probable carboxylesterase 12            150   2e-38    
ref|NP_001051515.1|  Os03g0790500                                       151   2e-38    
ref|XP_002527569.1|  Gibberellin receptor GID1, putative                150   2e-38    
gb|KHG17903.1|  putative carboxylesterase 15 -like protein              150   2e-38    
ref|XP_002459376.1|  hypothetical protein SORBIDRAFT_02g003600          151   2e-38    
gb|AAO24912.1|  putative esterase                                       151   2e-38    
gb|AHB17753.1|  GA signaling receptor                                   151   3e-38    
ref|XP_007222670.1|  hypothetical protein PRUPE_ppa008575mg             150   3e-38    
ref|XP_006599655.1|  PREDICTED: probable carboxylesterase 18-like       150   3e-38    
ref|XP_010421157.1|  PREDICTED: probable carboxylesterase 18 isof...    150   3e-38    
ref|XP_002460347.1|  hypothetical protein SORBIDRAFT_02g026800          150   3e-38    
ref|XP_002528343.1|  Arylacetamide deacetylase, putative                150   3e-38    
dbj|BAA74434.1|  unnamed protein product                                150   3e-38    
ref|XP_002297728.1|  hsr203J family protein                             150   3e-38    
gb|KDP23572.1|  hypothetical protein JCGZ_23405                         150   3e-38    
ref|XP_009418894.1|  PREDICTED: probable carboxylesterase 12            150   3e-38    
ref|XP_002267394.1|  PREDICTED: probable carboxylesterase 15 isof...    150   3e-38    
ref|XP_007156546.1|  hypothetical protein PHAVU_003G295200g             150   3e-38    
ref|XP_001759459.1|  GLP2 GID1-like protein                             150   4e-38    
ref|XP_002518025.1|  Gibberellin receptor GID1, putative                150   4e-38    
ref|XP_007010789.1|  Alpha/beta-Hydrolases superfamily protein          150   4e-38    
ref|XP_009351128.1|  PREDICTED: probable carboxylesterase 12            150   4e-38    
ref|XP_004505200.1|  PREDICTED: probable carboxylesterase 12-like       150   4e-38    
ref|XP_010228720.1|  PREDICTED: probable carboxylesterase 15            150   4e-38    
gb|KCW85206.1|  hypothetical protein EUGRSUZ_B02030                     150   4e-38    
gb|ADE75646.1|  unknown                                                 150   4e-38    
ref|XP_010106123.1|  putative carboxylesterase 6                        150   4e-38    
ref|XP_002285071.1|  PREDICTED: probable carboxylesterase 12            150   4e-38    
ref|XP_007015630.1|  Alpha/beta-Hydrolases superfamily protein          150   4e-38    
ref|NP_001277148.1|  gibberellin receptor GID1C-like                    150   4e-38    
ref|XP_003619738.1|  Arylacetamide deacetylase-like protein             150   4e-38    
gb|ACN86361.1|  GID1-6                                                  150   5e-38    
ref|XP_003619718.1|  Gibberellin receptor GID1                          150   5e-38    
ref|XP_010551285.1|  PREDICTED: probable carboxylesterase 6             150   5e-38    
gb|ABB89016.1|  CXE carboxylesterase                                    150   5e-38    
gb|ABQ53633.1|  esterase                                                150   5e-38    
ref|XP_009614176.1|  PREDICTED: gibberellin receptor GID1B-like         150   5e-38    
ref|XP_007042383.1|  Catalytic, putative                                149   5e-38    
ref|XP_010043139.1|  PREDICTED: gibberellin receptor GID1C-like         150   5e-38    
ref|XP_010275604.1|  PREDICTED: probable carboxylesterase 2             150   5e-38    
ref|XP_011082518.1|  PREDICTED: gibberellin receptor GID1B-like         150   6e-38    
ref|XP_008236535.1|  PREDICTED: probable carboxylesterase 12            149   6e-38    
ref|XP_004957041.1|  PREDICTED: probable carboxylesterase 12-like       149   6e-38    
ref|XP_008236609.1|  PREDICTED: probable carboxylesterase 13            149   6e-38    
ref|XP_004506248.1|  PREDICTED: probable carboxylesterase 15-like       149   6e-38    
ref|XP_002313105.1|  hypothetical protein POPTR_0009s10700g             149   7e-38    
ref|XP_004135640.1|  PREDICTED: gibberellin receptor GID1C-like         150   7e-38    
ref|XP_008443740.1|  PREDICTED: probable carboxylesterase 18            150   7e-38    
ref|XP_002268654.1|  PREDICTED: probable carboxylesterase 18            149   8e-38    
ref|XP_010090529.1|  putative carboxylesterase 15                       149   8e-38    
ref|XP_007132516.1|  hypothetical protein PHAVU_011G100900g             149   8e-38    
ref|XP_004292013.1|  PREDICTED: probable carboxylesterase 18-like       149   8e-38    
ref|XP_006836233.1|  hypothetical protein AMTR_s00101p00114620          150   9e-38    
ref|XP_009348479.1|  PREDICTED: probable carboxylesterase 15            149   9e-38    
ref|XP_006478364.1|  PREDICTED: probable carboxylesterase 18-like       149   9e-38    
ref|XP_002987495.1|  hypothetical protein SELMODRAFT_126328             148   9e-38    
ref|XP_002992802.1|  hypothetical protein SELMODRAFT_136035             148   1e-37    
gb|KGN65585.1|  hypothetical protein Csa_1G466560                       149   1e-37    
ref|XP_008350223.1|  PREDICTED: probable carboxylesterase 15            149   1e-37    
gb|KDO36706.1|  hypothetical protein CISIN_1g021927mg                   148   1e-37    
ref|XP_002319576.1|  hypothetical protein POPTR_0013s02980g             149   1e-37    
ref|XP_010246596.1|  PREDICTED: probable carboxylesterase 18            149   1e-37    
ref|XP_006426384.1|  hypothetical protein CICLE_v10026049mg             149   1e-37    
ref|XP_002313099.1|  hypothetical protein POPTR_0009s10790g             148   1e-37    
ref|NP_001234767.1|  putative GID1-like gibberellin receptor            149   1e-37    
ref|XP_002518792.1|  catalytic, putative                                148   1e-37    
gb|EPS58636.1|  hypothetical protein M569_16177                         149   1e-37    
ref|XP_010546660.1|  PREDICTED: gibberellin receptor GID1A-like         149   1e-37    
emb|CDY41936.1|  BnaC05g46680D                                          149   1e-37    
ref|XP_008356214.1|  PREDICTED: probable carboxylesterase 12            148   2e-37    
emb|CDY27795.1|  BnaA05g32040D                                          149   2e-37    
ref|XP_008359232.1|  PREDICTED: probable carboxylesterase 18            149   2e-37    
ref|XP_006480126.1|  PREDICTED: probable carboxylesterase 5-like        148   2e-37    
ref|XP_011079771.1|  PREDICTED: gibberellin receptor GID1B-like         149   2e-37    
ref|XP_004170122.1|  PREDICTED: probable carboxylesterase 18-like       149   2e-37    
ref|XP_010910204.1|  PREDICTED: probable carboxylesterase 15            148   2e-37    
gb|EEE53894.1|  hypothetical protein OsJ_00420                          149   2e-37    
ref|XP_009335651.1|  PREDICTED: gibberellin receptor GID1C-like         149   2e-37    
gb|ABB89021.1|  CXE carboxylesterase                                    149   2e-37    
ref|XP_009338446.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    148   2e-37    
ref|XP_002313844.1|  hypothetical protein POPTR_0009s10660g             147   2e-37    
gb|KFK36146.1|  hypothetical protein AALP_AA4G083200                    147   2e-37    
ref|XP_006849403.1|  hypothetical protein AMTR_s00160p00062470          147   2e-37    
ref|XP_010671193.1|  PREDICTED: probable carboxylesterase 12            148   2e-37    
ref|XP_002463764.1|  hypothetical protein SORBIDRAFT_01g005720          148   2e-37    
ref|XP_004141616.1|  PREDICTED: probable carboxylesterase 18-like       148   2e-37    
ref|XP_006385976.1|  hypothetical protein POPTR_0003s19190g             148   2e-37    
ref|XP_004294832.1|  PREDICTED: probable carboxylesterase 12-like       147   3e-37    
ref|XP_004494289.1|  PREDICTED: probable carboxylesterase 15-like       147   3e-37    
ref|XP_009147275.1|  PREDICTED: gibberellin receptor GID1A              149   3e-37    
ref|XP_004141523.1|  PREDICTED: probable carboxylesterase 18-like       148   3e-37    
ref|XP_010242026.1|  PREDICTED: probable carboxylesterase 18            148   3e-37    
gb|ABK25869.1|  unknown                                                 148   3e-37    
ref|XP_010244418.1|  PREDICTED: probable carboxylesterase 15            148   3e-37    
ref|NP_001281280.1|  gibberellin receptor GID1C-like                    148   3e-37    
ref|XP_009773904.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    147   3e-37    
ref|XP_003619736.1|  Neutral cholesterol ester hydrolase                148   3e-37    
ref|XP_004172409.1|  PREDICTED: probable carboxylesterase 18-like       148   3e-37    
emb|CAN65915.1|  hypothetical protein VITISV_000065                     148   3e-37    
ref|XP_002459375.1|  hypothetical protein SORBIDRAFT_02g003560          147   4e-37    
ref|XP_009349526.1|  PREDICTED: probable carboxylesterase 2             147   4e-37    
ref|XP_006466231.1|  PREDICTED: probable carboxylesterase 18-like       147   4e-37    
gb|AFG17072.1|  GID1A                                                   148   4e-37    
ref|XP_008459713.1|  PREDICTED: probable carboxylesterase 18            147   4e-37    
ref|XP_006480128.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    147   4e-37    
ref|XP_009346270.1|  PREDICTED: probable carboxylesterase 12            147   4e-37    
ref|XP_010943016.1|  PREDICTED: tuliposide A-converting enzyme 2,...    147   4e-37    
ref|XP_008786455.1|  PREDICTED: probable carboxylesterase 18            147   5e-37    
ref|XP_008450715.1|  PREDICTED: gibberellin receptor GID1C              147   5e-37    
ref|XP_008241122.1|  PREDICTED: probable carboxylesterase 15            147   5e-37    
ref|XP_008385595.1|  PREDICTED: probable carboxylesterase 15            147   5e-37    
ref|XP_006480127.1|  PREDICTED: probable carboxylesterase 5-like        146   5e-37    
ref|XP_004293706.1|  PREDICTED: gibberellin receptor GID1B-like         147   5e-37    
ref|XP_011004866.1|  PREDICTED: probable carboxylesterase 12            147   5e-37    
gb|ACN86360.1|  GID1-5                                                  147   5e-37    
ref|XP_002978967.1|  hypothetical protein SELMODRAFT_35114              146   5e-37    
ref|XP_008231718.1|  PREDICTED: probable carboxylesterase 15            147   5e-37    
ref|XP_002978838.1|  hypothetical protein SELMODRAFT_418575             147   6e-37    
gb|ABB89009.1|  CXE carboxylesterase                                    147   6e-37    
emb|CBI34320.3|  unnamed protein product                                148   6e-37    
emb|CDP15825.1|  unnamed protein product                                147   6e-37    
ref|XP_006388419.1|  hypothetical protein POPTR_0190s00210g             146   6e-37    



>ref|XP_009775254.1| PREDICTED: probable carboxylesterase 17 [Nicotiana sylvestris]
Length=312

 Score =   404 bits (1037),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 219/311 (70%), Positives = 263/311 (85%), Gaps = 5/311 (2%)
 Frame = -2

Query  1069  VDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPEK  890
             V EAPGYIQVFSDG+VKRF+PEIATAS E  +G+KSKDV IDP KPI+GRI++PD +PE 
Sbjct  4     VAEAPGYIQVFSDGSVKRFAPEIATASIEPCNGYKSKDVNIDPLKPISGRIYLPD-FPES  62

Query  889   EQV-ELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAY  713
               + + LPVL+YFHGGGFC+GSTTW+GYHLFLG LSV SKS+++SVDYRLAPENKLP AY
Sbjct  63    GVINQQLPVLVYFHGGGFCIGSTTWLGYHLFLGDLSVASKSIILSVDYRLAPENKLPTAY  122

Query  712   EDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGI  533
             EDCY+ALEW+ KN + EP L+ ADL +VFL+GDSAGGNIVHQVA + +++ +   ++KG+
Sbjct  123   EDCYSALEWLIKNLENEPWLKRADLDQVFLSGDSAGGNIVHQVAIRAIRNEDFRGRLKGL  182

Query  532   MPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVG  353
             +PIHPYFGSE+RT  E  A GS G  V MNDMFWRLSLP+GSNRD++GCN EN  E+SV 
Sbjct  183   LPIHPYFGSEKRTELE-TANGSAG-EVEMNDMFWRLSLPQGSNRDYFGCNFEN-AEMSVA  239

Query  352   EWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHPDSEATR  173
             EW RFPA +VFVAG DFLKERGV YAEFL++ GVK VE+VEAE + HV+HVFHP+SEATR
Sbjct  240   EWSRFPAVIVFVAGSDFLKERGVKYAEFLKKNGVKRVELVEAEGQVHVYHVFHPESEATR  299

Query  172   LLQKQMSEFIH  140
             LLQKQMS+FIH
Sbjct  300   LLQKQMSDFIH  310



>ref|XP_009605841.1| PREDICTED: probable carboxylesterase 17 [Nicotiana tomentosiformis]
Length=333

 Score =   399 bits (1024),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 218/317 (69%), Positives = 266/317 (84%), Gaps = 6/317 (2%)
 Frame = -2

Query  1087  QKMSIIVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVP  908
             +KMSI+  EAPGYIQVFSDG+VKRF PEIATAS E  +G+KSKDV+IDP KPI+GRI++P
Sbjct  20    KKMSIVA-EAPGYIQVFSDGSVKRFEPEIATASIEPCNGYKSKDVIIDPLKPISGRIYLP  78

Query  907   DLWPEKEQV-ELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPEN  731
             D +PE   + + LPVLLYFHGGGFC+GSTTW+GYHLFLG LSV SKS+++SVDYRLAPEN
Sbjct  79    D-FPESGVINQQLPVLLYFHGGGFCIGSTTWLGYHLFLGDLSVASKSIILSVDYRLAPEN  137

Query  730   KLPIAYEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCA  551
             KLP AYEDCY+ALEW+ KN + EP L+ ADLS+VFL+GDSAGGNIVHQVA +  ++ +  
Sbjct  138   KLPTAYEDCYSALEWLIKNLEYEPWLKRADLSQVFLSGDSAGGNIVHQVAIRATRNEDFR  197

Query  550   AKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLEND  371
              ++KG++PIHPYFGSE+RT  E+ A GS G  V MNDMFW LSLP+GSNRD++GCN EN 
Sbjct  198   GRLKGLLPIHPYFGSEKRTELEM-ANGSAG-KVEMNDMFWGLSLPQGSNRDYFGCNFEN-  254

Query  370   RELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHP  191
              E+S  E+ +FP  +VFVAG DFLKERGV YAEFL++ GVK VE+VEAE + HV+HVF+P
Sbjct  255   AEMSAAEFSQFPEVIVFVAGSDFLKERGVKYAEFLKKNGVKRVELVEAEGQVHVYHVFYP  314

Query  190   DSEATRLLQKQMSEFIH  140
             +SEATRLLQKQMS+FIH
Sbjct  315   ESEATRLLQKQMSDFIH  331



>emb|CDP13505.1| unnamed protein product [Coffea canephora]
Length=310

 Score =   388 bits (997),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 208/311 (67%), Positives = 249/311 (80%), Gaps = 5/311 (2%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPE  893
             IVDE+PGY+QV SDG+VKRF+PE A AS ES++G+KS+DVVID SKP T RIF+PD+   
Sbjct  3     IVDESPGYMQVLSDGSVKRFAPETAAASTESSNGYKSRDVVIDSSKPTTARIFLPDV--S  60

Query  892   KEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAY  713
             +     LPVL+YFHGGGFC+GSTTW+GYH FLG LS  SKS+V+SVDYRLAPENKLPIAY
Sbjct  61    ESVAGQLPVLVYFHGGGFCIGSTTWLGYHHFLGDLSAVSKSIVLSVDYRLAPENKLPIAY  120

Query  712   EDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGI  533
             +DCY++LEW+  N  +EP LE ADL RVFL+GDSAGGNIVHQVA K ++D     +IKG+
Sbjct  121   DDCYSSLEWLSNNASSEPWLEKADLLRVFLSGDSAGGNIVHQVAVKVIKDKVSRVRIKGL  180

Query  532   MPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVG  353
             +PIHPYFGSE+RT  E+A E  +   V  NDMFWRLSLP G NRD+ GCN E   ELS  
Sbjct  181   IPIHPYFGSEKRTELEMAEE--SAGHVQSNDMFWRLSLPVGENRDYLGCNFEK-TELSGS  237

Query  352   EWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHPDSEATR  173
             EW +FP  LVFVAG DFLKERGVMYA+FL++KGV+ V ++EAE E HV+HVFHP SEAT 
Sbjct  238   EWDQFPRVLVFVAGLDFLKERGVMYADFLQKKGVQKVSLIEAEGESHVYHVFHPKSEATT  297

Query  172   LLQKQMSEFIH  140
             LLQKQMS+F+H
Sbjct  298   LLQKQMSDFMH  308



>ref|XP_007011874.1| Carboxyesterase 17 [Theobroma cacao]
 gb|EOY29493.1| Carboxyesterase 17 [Theobroma cacao]
Length=334

 Score =   380 bits (977),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 208/314 (66%), Positives = 255/314 (81%), Gaps = 7/314 (2%)
 Frame = -2

Query  1084  KMSIIVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPD  905
             KMSII  EAPGY QVFSDG VKRF+PEIA AS ES+ G+KSKDV++DPSKPITGRIF+PD
Sbjct  25    KMSIIA-EAPGYFQVFSDGCVKRFAPEIAPASQESSGGYKSKDVILDPSKPITGRIFLPD  83

Query  904   LWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKL  725
             +         LPVL+YFHGGGFC+GSTTW+GYH FLG  S  S+S+V+S+DYRLAPE++L
Sbjct  84    I---PGSCTSLPVLVYFHGGGFCIGSTTWLGYHHFLGDFSAASQSIVLSIDYRLAPEHRL  140

Query  724   PIAYEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAK  545
             PIAY+DCY++LEW+     +EP  + ADLSRVFL+GDSAGGNIVHQVA + +++     K
Sbjct  141   PIAYDDCYSSLEWLCSQVTSEPWFKLADLSRVFLSGDSAGGNIVHQVAIRAMRNKALHVK  200

Query  544   IKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRE  365
             IKG++ IHPYFGSE RT  E  A+G+ G  VAMNDMFWRLS+P+ SNRD++GCN E  + 
Sbjct  201   IKGLLMIHPYFGSEERTDRE-RADGAAG-DVAMNDMFWRLSIPDWSNRDYFGCNFEK-QV  257

Query  364   LSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHPDS  185
             +S  EW  FPA +V+VAG DFLKERGVMYAEFL+RKGVK +++VEAE E HVFHVF+P+S
Sbjct  258   VSEAEWREFPAVVVYVAGLDFLKERGVMYAEFLQRKGVKKLKLVEAERESHVFHVFYPES  317

Query  184   EATRLLQKQMSEFI  143
             EATRLLQ+QMSEF+
Sbjct  318   EATRLLQRQMSEFM  331



>ref|XP_006364937.1| PREDICTED: probable carboxylesterase 17-like [Solanum tuberosum]
Length=312

 Score =   379 bits (973),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 212/313 (68%), Positives = 257/313 (82%), Gaps = 9/313 (3%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPE  893
             IV EAPGYIQVFSDG+VKRF PEIATAS E ++G+ SKDVVID SKPI GR+++P    E
Sbjct  3     IVAEAPGYIQVFSDGSVKRFEPEIATASIEPSNGYMSKDVVIDSSKPILGRMYLP----E  58

Query  892   KEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAY  713
                 +  PVL+YFHGGGFC+GSTTW+GYH+FLG LSV SKS+++SVDYRLAPEN+LPIAY
Sbjct  59    SSVHQHFPVLVYFHGGGFCIGSTTWLGYHVFLGDLSVSSKSIILSVDYRLAPENRLPIAY  118

Query  712   EDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGI  533
             EDCY+ALEW+ KN + EP L+ ADLS++FL+GDSAGGNIVHQVA + +       ++KG+
Sbjct  119   EDCYSALEWLIKNIEFEPWLKRADLSQLFLSGDSAGGNIVHQVAIQAITSEVFRGRLKGL  178

Query  532   MPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVG  353
             +PIHPYFGSE+RT  E+   GS G  V MNDMFWRLSLP+GSNRD++GCN EN  +LSV 
Sbjct  179   LPIHPYFGSEKRTELEM-DNGSAG-GVEMNDMFWRLSLPQGSNRDYFGCNFEN-AQLSVA  235

Query  352   EWLRFPAALVFVAGKDFLKERGVMYAEFL-RRKGVK-WvevveaeeeghvfhvfHPDSEA  179
             EW +FPA +VFVAG D LKERGV YAEFL ++KGVK  V+VVEAEE+ HV+HVFHP+SEA
Sbjct  236   EWSQFPAVIVFVAGLDLLKERGVTYAEFLKKKKGVKSHVKVVEAEEQVHVYHVFHPESEA  295

Query  178   TRLLQKQMSEFIH  140
             TRLLQ QMS+FI+
Sbjct  296   TRLLQNQMSDFIN  308



>ref|XP_003588759.1| Arylacetamide deacetylase [Medicago truncatula]
 gb|AES59010.1| alpha/beta hydrolase fold protein [Medicago truncatula]
Length=312

 Score =   377 bits (967),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 211/314 (67%), Positives = 258/314 (82%), Gaps = 8/314 (3%)
 Frame = -2

Query  1081  MSIIVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDL  902
             MS+I  EAP ++QVFSDGTVKRF+PEIA  S +S++ +KSKD++IDP+KPITGRIF+P+ 
Sbjct  1     MSLIA-EAPEFLQVFSDGTVKRFNPEIAPPSLDSSNKYKSKDIIIDPTKPITGRIFIPNN  59

Query  901   WPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLP  722
              P K+   LLP+L+YFHGGGFC+GSTTW+GY+ FLG  SV S+S+++SVDYRLAPEN+LP
Sbjct  60    -PTKK---LLPLLVYFHGGGFCIGSTTWLGYNNFLGDFSVASQSIILSVDYRLAPENRLP  115

Query  721   IAYEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQ-DGNCAAK  545
             IAYEDCY++LEW+ +N K EP L  ADLS VFL+GDSAGGNI H VA K +Q DG C  K
Sbjct  116   IAYEDCYSSLEWLGENVKTEPFLRHADLSNVFLSGDSAGGNISHYVAVKAIQNDGFCPVK  175

Query  544   IKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRE  365
             IKG+M IHPYFGSE+RT  E+  EG     V MNDMFWRLSLPE S+RDF+GCN E D +
Sbjct  176   IKGVMLIHPYFGSEKRTEKEMEEEGGV-EDVKMNDMFWRLSLPEDSDRDFFGCNFEKD-D  233

Query  364   LSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHPDS  185
             +S   WL+FPA  V+VAGKDFLKERGVMYAEF+++KGVK V VVEAEEE HVFHVF+P+S
Sbjct  234   VSESVWLKFPAVEVYVAGKDFLKERGVMYAEFVKKKGVKEVNVVEAEEEKHVFHVFYPES  293

Query  184   EATRLLQKQMSEFI  143
             +ATRLLQ QMS+F+
Sbjct  294   DATRLLQNQMSQFM  307



>ref|XP_004245027.1| PREDICTED: probable carboxylesterase 17 [Solanum lycopersicum]
Length=311

 Score =   375 bits (964),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 205/312 (66%), Positives = 254/312 (81%), Gaps = 8/312 (3%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPE  893
             IV EAPGYIQVFSDG+VKRF P+IATAS E  +G+ SKDV+ID SK I GR+++P    E
Sbjct  3     IVAEAPGYIQVFSDGSVKRFEPQIATASIEPYNGYMSKDVIIDSSKLIFGRMYLP----E  58

Query  892   KEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAY  713
                 +  PVL+YFHGGGFC+GSTTW+GYH+FLG LSV SKS+++SVDYRLAPEN+LPIAY
Sbjct  59    SSIHQHFPVLVYFHGGGFCIGSTTWLGYHVFLGDLSVASKSIILSVDYRLAPENRLPIAY  118

Query  712   EDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGI  533
             EDCY+ALEW+ KN + EP L+ ADLS++FL+GDSAGGNIVHQVA + +       ++K +
Sbjct  119   EDCYSALEWLIKNIEFEPWLKRADLSQLFLSGDSAGGNIVHQVAIRAITSEVFRGRLKAL  178

Query  532   MPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVG  353
             +PIHPYFGSE+RT  E+  +  +   V MNDMFWRLSLP+GSNRD++GCN EN  +LS+ 
Sbjct  179   LPIHPYFGSEKRT--ELEMDNGSAGGVEMNDMFWRLSLPQGSNRDYFGCNFEN-AQLSLA  235

Query  352   EWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVK-WvevveaeeeghvfhvfHPDSEAT  176
             EW +FPA +VFVAG D LKERGV YAEFL++KGVK  V+VVEAEE+ HV+HVFHP+SEAT
Sbjct  236   EWSQFPAVIVFVAGLDLLKERGVTYAEFLKKKGVKSHVKVVEAEEQAHVYHVFHPESEAT  295

Query  175   RLLQKQMSEFIH  140
             RLLQKQMS+FI+
Sbjct  296   RLLQKQMSDFIN  307



>gb|KHN33922.1| Putative carboxylesterase 17 [Glycine soja]
Length=309

 Score =   370 bits (951),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 202/313 (65%), Positives = 249/313 (80%), Gaps = 7/313 (2%)
 Frame = -2

Query  1081  MSIIVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDL  902
             MS+I  EAP +++++SDG+VKRF PEI  AS EST G+KSKDV+ID SKPITGRIF+PD 
Sbjct  1     MSLIA-EAPNFLKLYSDGSVKRFDPEIVPASLESTKGYKSKDVIIDSSKPITGRIFLPD-  58

Query  901   WPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLP  722
             +P   +   LP+L+YFHGGGFC+GSTTW+GYH FLG  SV S+S+++SVDYRLAPE++LP
Sbjct  59    YPTSSKK--LPLLVYFHGGGFCIGSTTWLGYHNFLGDFSVTSQSIILSVDYRLAPEHRLP  116

Query  721   IAYEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKI  542
             IAYEDCY +LEW+      EP L+  DL+RVFL+GDSAGGNI H VA K +Q+  C  KI
Sbjct  117   IAYEDCYTSLEWLGDQVSCEPLLQQIDLTRVFLSGDSAGGNIAHHVAVKAIQNNECPLKI  176

Query  541   KGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDREL  362
             KG+M IHPYFGSE+RT  E+A E  +   VAMNDMFWRLS+PEG NRD++GCN E   +L
Sbjct  177   KGLMLIHPYFGSEKRTKNEMADE--SIKDVAMNDMFWRLSIPEGLNRDYFGCNFEK-TDL  233

Query  361   SVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHPDSE  182
             S   W +FPA  V+VAGKDFLKERGV YAEFL++KGVK VE+VEA+EE HVFHV++P+S 
Sbjct  234   STSVWSKFPAIGVYVAGKDFLKERGVRYAEFLKKKGVKEVELVEAKEETHVFHVYYPESC  293

Query  181   ATRLLQKQMSEFI  143
             ATRLLQ QMS F+
Sbjct  294   ATRLLQNQMSLFM  306



>ref|XP_011081569.1| PREDICTED: probable carboxylesterase 17 [Sesamum indicum]
Length=339

 Score =   367 bits (943),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 200/321 (62%), Positives = 248/321 (77%), Gaps = 12/321 (4%)
 Frame = -2

Query  1087  QKMSIIVDEAPGYIQVFSDGTVKRFSPEIATASAESTD---GFKSKDVVIDPSKPITGRI  917
             QKMS+ V EAPG++QVFS+GTVKRF P+ A++SAE ++    + SKDV+I PSKPIT RI
Sbjct  28    QKMSL-VAEAPGFLQVFSNGTVKRFIPQTASSSAEWSNISCTYNSKDVIIHPSKPITARI  86

Query  916   FVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAP  737
             F+P      + +  LP+L+YFHGGGFC+GSTTW+GYH+FLG LS  +K++V SVDYRLAP
Sbjct  87    FLPTHPTSSDSLSQLPLLVYFHGGGFCIGSTTWLGYHVFLGNLSATAKTIVFSVDYRLAP  146

Query  736   ENKLPIAYEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGN  557
             ENKLPIAYEDCY+ALEW+  +  +EP L  ADLS VFL+GDSAGGNI HQVA K ++   
Sbjct  147   ENKLPIAYEDCYSALEWL--SSSSEPWLRHADLSSVFLSGDSAGGNIAHQVAIKAIKANI  204

Query  556   CAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLE  377
                +IKG++PIHP+FGSE RT  E+A   S+  +VAMNDMFW+LSLPEG +RDFYGCN +
Sbjct  205   LNIRIKGLVPIHPFFGSETRTELELA--DSSADAVAMNDMFWKLSLPEGCDRDFYGCNFD  262

Query  376   NDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvf  197
                     EW  FPA +VFVAG DFLKERGVMY EFL+RKGVK V +VEAE E HVFHV+
Sbjct  263   KGET----EWSLFPAVMVFVAGLDFLKERGVMYVEFLKRKGVKKVSLVEAEGESHVFHVW  318

Query  196   HPDSEATRLLQKQMSEFIHGV  134
             +P+SEAT LLQKQ++ FI  +
Sbjct  319   NPESEATYLLQKQITSFIQSL  339



>ref|XP_006483354.1| PREDICTED: probable carboxylesterase 17-like [Citrus sinensis]
Length=311

 Score =   364 bits (935),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 197/310 (64%), Positives = 242/310 (78%), Gaps = 4/310 (1%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPE  893
             IV EAPG++QVF+DG+VKRF PEI   S+ES +G+K KDV IDPSKPITGRIF+PD  P 
Sbjct  3     IVAEAPGFLQVFADGSVKRFVPEIVHPSSESLNGYKFKDVNIDPSKPITGRIFLPDTPPL  62

Query  892   KEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAY  713
                +  LPVL+YFHGGGFC+GSTTW+GYH FLG  SV S+ +V+SVDYRLAPEN+LPIAY
Sbjct  63    ATSI-YLPVLVYFHGGGFCIGSTTWLGYHHFLGDFSVGSQCIVISVDYRLAPENRLPIAY  121

Query  712   EDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGI  533
             +DCY +LEW+    K +P L  ADL RVFL+GDSAGGNI HQV  + L+      KIKG+
Sbjct  122   DDCYFSLEWLCYQVKCDPWLAQADLHRVFLSGDSAGGNIAHQVGIRALRSKALDVKIKGL  181

Query  532   MPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVG  353
             + IHPYFGSE+R+  E+A   S    VAMNDMFWRLS+P GSNRD++GCN E  + +S  
Sbjct  182   LLIHPYFGSEKRSQNEMADGAS--KDVAMNDMFWRLSIPVGSNRDYFGCNFET-QVISKK  238

Query  352   EWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHPDSEATR  173
             EW  FPA +V+VAG DFLKERG+MYAEFL+ KGVK V +VEA  E HV+HVF+P+S+ATR
Sbjct  239   EWSLFPAVVVYVAGLDFLKERGIMYAEFLQDKGVKEVRLVEAMGESHVYHVFYPESQATR  298

Query  172   LLQKQMSEFI  143
             LLQ+QM+EF+
Sbjct  299   LLQQQMAEFM  308



>ref|XP_010254388.1| PREDICTED: probable carboxylesterase 17 [Nelumbo nucifera]
Length=319

 Score =   364 bits (934),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 198/310 (64%), Positives = 243/310 (78%), Gaps = 6/310 (2%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPE  893
             IV EAPG++QVFSDG+VKRF+PEI+ A  E ++G++SKDV+IDPS+PI+ RIF+P+    
Sbjct  3     IVAEAPGFLQVFSDGSVKRFAPEISAALPELSNGYRSKDVIIDPSRPISARIFLPE---T  59

Query  892   KEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAY  713
             K     LPVL+YFHGGGFC+GSTTW GYH FLG L   S+S+VVSVDYRLAPEN+LPIAY
Sbjct  60    KNSNTRLPVLVYFHGGGFCIGSTTWFGYHHFLGDLCFTSQSIVVSVDYRLAPENRLPIAY  119

Query  712   EDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGI  533
             +DCY AL+W+  +   +P LE ADLSRVFL+GDSAGGNI H VA + +++      + G+
Sbjct  120   DDCYFALDWLSTHIYTDPWLEQADLSRVFLSGDSAGGNISHHVALQVMRNRPNYVTVVGL  179

Query  532   MPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVG  353
             + IHPYFGSERRT  E+A E +    V MNDMFWRLSLPEGS+RD + CN E   ELS  
Sbjct  180   LIIHPYFGSERRTEREMAVEAA--GDVEMNDMFWRLSLPEGSSRDHFACNFEM-AELSKI  236

Query  352   EWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHPDSEATR  173
              W +FPA  VFVAG DFLKERGVMYAEFL+RKGV+ V++VEAE E HV+HVF P+SEATR
Sbjct  237   GWQQFPAVTVFVAGLDFLKERGVMYAEFLKRKGVREVKLVEAEGESHVYHVFRPESEATR  296

Query  172   LLQKQMSEFI  143
             LLQ+QMSEF+
Sbjct  297   LLQQQMSEFM  306



>ref|XP_009355731.1| PREDICTED: probable carboxylesterase 17 [Pyrus x bretschneideri]
Length=310

 Score =   363 bits (931),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 201/311 (65%), Positives = 244/311 (78%), Gaps = 7/311 (2%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPE  893
             IV+EAP ++QVFSDG+VKRFSP +A+AS ESTDGFKSKDV+ID SKPITGRIF+P     
Sbjct  3     IVEEAPDFLQVFSDGSVKRFSPGVASASPESTDGFKSKDVIIDSSKPITGRIFLPG---N  59

Query  892   KEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAY  713
                 + LPV++ FHGGGFC+GSTTW+GYH FLG L+V S+S+VVSVDYRLAPEN+LP+AY
Sbjct  60    PTSSKKLPVVVNFHGGGFCIGSTTWLGYHHFLGGLAVASQSIVVSVDYRLAPENRLPVAY  119

Query  712   EDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGI  533
             EDCY   +W+ +   +EP L+ ADLSRVFL GDSAGGNI H VA K + +     KI+G+
Sbjct  120   EDCYYTFDWLSRQASSEPWLDKADLSRVFLTGDSAGGNITHNVAVKAICNRIGHVKIRGL  179

Query  532   MPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVG  353
             + +HPYFGSE+RT  E+A EG+    VA NDMFWRLS+P+GSNRD++GCN E    LS  
Sbjct  180   LLVHPYFGSEKRTEIEMAEEGA--KDVASNDMFWRLSIPKGSNRDYFGCNFEK-TGLSAT  236

Query  352   EWL-RFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHPDSEAT  176
             EW   FPA +V+VAG DFLKERGVMYAEFL++KGVK V++VEAE E HVFHVFHPDSE  
Sbjct  237   EWSDEFPAVVVYVAGLDFLKERGVMYAEFLQKKGVKEVKLVEAENESHVFHVFHPDSEGA  296

Query  175   RLLQKQMSEFI  143
              LLQ+ M EFI
Sbjct  297   GLLQRNMGEFI  307



>gb|ABB89002.1| CXE carboxylesterase [Malus pumila]
Length=310

 Score =   362 bits (930),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 200/311 (64%), Positives = 244/311 (78%), Gaps = 7/311 (2%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPE  893
             IV+EAP ++QVFSDG+VKRFSP +A+AS ESTDGFKSKDV+ID SKPITGRIF+P     
Sbjct  3     IVEEAPDFLQVFSDGSVKRFSPGVASASPESTDGFKSKDVIIDSSKPITGRIFLPS---N  59

Query  892   KEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAY  713
                 + LPV++ FHGGGFC+GSTTW+GYH FLG L+V S+S+VVSVDYRLAPEN+LPIAY
Sbjct  60    PTSSKKLPVVVNFHGGGFCIGSTTWLGYHHFLGGLAVASQSIVVSVDYRLAPENRLPIAY  119

Query  712   EDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGI  533
             EDCY   +W+ +   +EP L+ ADLSRVFL GDSAGGNI H VA K + +     KI+G+
Sbjct  120   EDCYYTFDWLSRQASSEPWLDKADLSRVFLTGDSAGGNITHNVAVKAICNRISCVKIRGL  179

Query  532   MPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVG  353
             + +HPYFGSE+RT  E+A EG+    VA NDMFWRLS+P+GSNRD++GCN E   ELS  
Sbjct  180   LLVHPYFGSEKRTEKEMAEEGA--KDVASNDMFWRLSIPKGSNRDYFGCNFEK-TELSAT  236

Query  352   EWL-RFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHPDSEAT  176
             EW   FPA +V+VAG DFLKERGVMYAEFL++KGVK V++VEAE+E HVFHVF P S+  
Sbjct  237   EWSDEFPAVVVYVAGLDFLKERGVMYAEFLQKKGVKEVKLVEAEKESHVFHVFDPVSKGA  296

Query  175   RLLQKQMSEFI  143
              LLQ+ M EFI
Sbjct  297   GLLQRNMGEFI  307



>ref|XP_004291462.1| PREDICTED: probable carboxylesterase 6-like [Fragaria vesca subsp. 
vesca]
Length=311

 Score =   361 bits (927),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 197/311 (63%), Positives = 243/311 (78%), Gaps = 6/311 (2%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPE  893
             IV+E+P ++QVFSDGTVKRFSP I TAS+E ++G+K KDVVID SKPITGRIF+P    +
Sbjct  3     IVEESPDFLQVFSDGTVKRFSPGIVTASSEPSNGYKFKDVVIDSSKPITGRIFIP---CD  59

Query  892   KEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAY  713
                   LPV++YFHGGGFC+GSTTW+GYH FLG LSV S+S+V+S+DYRLAPEN+LPI Y
Sbjct  60    PTSSSKLPVMVYFHGGGFCIGSTTWIGYHHFLGDLSVASQSIVLSIDYRLAPENRLPIPY  119

Query  712   EDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGI  533
             EDCY +L W++     +P L  ADLSRVFL+GDSAGGNI H VA K + +     KI+G+
Sbjct  120   EDCYESLVWLRHQASCDPWLNKADLSRVFLSGDSAGGNIAHNVAVKTMHNSLIHVKIRGL  179

Query  532   MPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVG  353
             + IHPYFGSERRT  E++ +     +VA NDMFWRLS+PEGSNRD++GCN +   ELS+ 
Sbjct  180   LLIHPYFGSERRTDKEMSTDEEAVGNVASNDMFWRLSIPEGSNRDYFGCNFDK-TELSLT  238

Query  352   EWLR-FPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHPDSEAT  176
             +W   FPA  V+VA  DFLKERGVMYAEFL+RKGV+ V++VEAE E HVFHVF PD EAT
Sbjct  239   QWRNDFPAVTVYVAELDFLKERGVMYAEFLQRKGVE-VKLVEAENESHVFHVFKPDCEAT  297

Query  175   RLLQKQMSEFI  143
             RLLQK M++FI
Sbjct  298   RLLQKNMNDFI  308



>ref|XP_008394075.1| PREDICTED: probable carboxylesterase 17 [Malus domestica]
Length=310

 Score =   361 bits (927),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 200/311 (64%), Positives = 243/311 (78%), Gaps = 7/311 (2%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPE  893
             IV+EAP ++QVFSDG+VKRFSP +A+AS ESTDGFKSKDV+ID SKPITGRIF+P     
Sbjct  3     IVEEAPDFLQVFSDGSVKRFSPGVASASPESTDGFKSKDVIIDSSKPITGRIFLPS---N  59

Query  892   KEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAY  713
                 + LPV++ FHGGGFC+GSTTW+GYH FLG L+V S+S+VVSVDYRLAPEN+LPIAY
Sbjct  60    PTSSKKLPVVVNFHGGGFCIGSTTWLGYHHFLGGLAVASQSIVVSVDYRLAPENRLPIAY  119

Query  712   EDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGI  533
             EDCY   +W+ +   +EP L+ ADLSRVFL GDSAGGNI H VA K + +     KI+G+
Sbjct  120   EDCYYTFDWLSRQASSEPWLDKADLSRVFLTGDSAGGNITHNVAVKAICNRISCVKIRGL  179

Query  532   MPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVG  353
             + +HPYFGSE+RT  E+A EG+    VA NDMFWRLS+P+GSNRD++GCN E   ELS  
Sbjct  180   LLVHPYFGSEKRTEKEMAEEGA--KDVASNDMFWRLSIPKGSNRDYFGCNFEK-TELSAX  236

Query  352   EWL-RFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHPDSEAT  176
             EW   FPA +V+VAG DFLKERGVMYAEFL++KGVK V++VEAE+E HVFHVF P S   
Sbjct  237   EWSDEFPAVVVYVAGLDFLKERGVMYAEFLQKKGVKEVKLVEAEKESHVFHVFDPVSVGA  296

Query  175   RLLQKQMSEFI  143
              LLQ+ M EFI
Sbjct  297   GLLQRNMGEFI  307



>ref|XP_011026452.1| PREDICTED: probable carboxylesterase 6 [Populus euphratica]
Length=310

 Score =   361 bits (926),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 200/311 (64%), Positives = 246/311 (79%), Gaps = 7/311 (2%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAES-TDGFKSKDVVIDPSKPITGRIFVPDLWP  896
             IV EAPGY+QVFSDG+VKRF+ E    SAES +DGFK KDVVID SKPIT R+FVPD   
Sbjct  3     IVAEAPGYLQVFSDGSVKRFASETVPDSAESYSDGFKFKDVVIDSSKPITARLFVPD---  59

Query  895   EKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIA  716
              +  V  LPV++YFHGGGFC+ STTW+G+H FLG  SV S+SVV+SVDYRLAPEN+LPIA
Sbjct  60    TQGSVSQLPVVVYFHGGGFCICSTTWLGFHHFLGDFSVASQSVVLSVDYRLAPENRLPIA  119

Query  715   YEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKG  536
             Y+DC+ +LEW+  N  +EP L+ ADLSRVFL+GDSAGGNI HQVA + ++      +IKG
Sbjct  120   YDDCFRSLEWLSNNVSSEPWLKQADLSRVFLSGDSAGGNITHQVAIRAVRSKTYQVEIKG  179

Query  535   IMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSV  356
             +M IHPYFGSE+RT  E+ +EG+ G + AMNDMFW LS+PEGSNRD++GCN E  +++S 
Sbjct  180   LMLIHPYFGSEKRTKKEM-SEGAPGDA-AMNDMFWGLSIPEGSNRDYFGCNFEM-QDVSA  236

Query  355   GEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHPDSEAT  176
              EW  FPA  V+VAG DFL ERGVMYA+FL +KGVK V +VEAE + HVFHVF+P SEAT
Sbjct  237   AEWSAFPAVAVYVAGLDFLNERGVMYAQFLAKKGVKEVTLVEAEGQNHVFHVFYPQSEAT  296

Query  175   RLLQKQMSEFI  143
              +LQ+QMSEF+
Sbjct  297   LILQQQMSEFM  307



>gb|KDP33601.1| hypothetical protein JCGZ_07172 [Jatropha curcas]
Length=306

 Score =   358 bits (919),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 198/310 (64%), Positives = 239/310 (77%), Gaps = 9/310 (3%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPE  893
             IV EAPGY+QVFSDG+VKRF+PE    S +  + +K KD+VIDPSKPIT R+F+P+    
Sbjct  3     IVAEAPGYLQVFSDGSVKRFAPE-TFPSRQPHNKYKFKDLVIDPSKPITARLFLPE----  57

Query  892   KEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAY  713
                   LPVL+YFHGGGFCVGSTTW+GYH FL   SV S+S+V+S+DYRLAPEN+LPIAY
Sbjct  58    -SSASRLPVLVYFHGGGFCVGSTTWLGYHHFLADFSVTSQSIVLSIDYRLAPENRLPIAY  116

Query  712   EDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGI  533
             +DCY++LEW+      EP L+SADLSRVFL+GDSAGGNI H VA +   D     KIKG+
Sbjct  117   DDCYSSLEWLSHQVSVEPWLQSADLSRVFLSGDSAGGNISHNVAIRASSDKLPHVKIKGL  176

Query  532   MPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVG  353
             + IHPYFGS+ RT  E+A        V MNDMFWRLS+PEGSNRD+YGCN E  ++LSV 
Sbjct  177   LLIHPYFGSQERTEKEMA--DGAAKDVEMNDMFWRLSIPEGSNRDYYGCNFEI-QDLSVA  233

Query  352   EWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHPDSEATR  173
             +W  FPAA+V+VAG DFLKERGVMY  FL ++GVK VE+VEAE E H+FHVF PDSEATR
Sbjct  234   KWKEFPAAVVYVAGLDFLKERGVMYTLFLAKQGVKEVELVEAEGESHIFHVFSPDSEATR  293

Query  172   LLQKQMSEFI  143
             LLQ+QMS+FI
Sbjct  294   LLQQQMSKFI  303



>ref|XP_002324857.1| hypothetical protein POPTR_0018s01650g [Populus trichocarpa]
 gb|EEF03422.1| hypothetical protein POPTR_0018s01650g [Populus trichocarpa]
Length=310

 Score =   358 bits (920),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 198/311 (64%), Positives = 245/311 (79%), Gaps = 7/311 (2%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAES-TDGFKSKDVVIDPSKPITGRIFVPDLWP  896
             IV EAPGY+QVFSDG+VKRF+ E    SAES +DGFK KDV+ID SKPIT R+FVPD   
Sbjct  3     IVAEAPGYLQVFSDGSVKRFASETVPDSAESYSDGFKFKDVLIDSSKPITARLFVPD---  59

Query  895   EKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIA  716
              +  V  LPV++YFHGGGFC+ STTW+G+H FLG  SV S+S+V+SVDYRLAPEN+LPIA
Sbjct  60    TQGSVSQLPVVVYFHGGGFCICSTTWLGFHHFLGDFSVASQSIVLSVDYRLAPENRLPIA  119

Query  715   YEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKG  536
             Y+DC+ +LEW+  N  +EP L+ +DLSRVFL+GDSAGGNI HQVA + ++      +IKG
Sbjct  120   YDDCFRSLEWLSNNVSSEPWLKQSDLSRVFLSGDSAGGNITHQVAIRAVRSKTYQVEIKG  179

Query  535   IMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSV  356
             +M IHPYFGSE RT  E+ +EG+ G  VAMNDMFW LS+PEGSNRD++GCN E  +++S 
Sbjct  180   LMLIHPYFGSETRTKKEM-SEGAPG-DVAMNDMFWGLSIPEGSNRDYFGCNFEM-QDVSA  236

Query  355   GEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHPDSEAT  176
              EW  FPA  V+VAG DFL ERGVMYA+FL +KGVK V +VEAE + HVFHVF+P SEAT
Sbjct  237   AEWSAFPAVAVYVAGLDFLNERGVMYAQFLAKKGVKEVTLVEAEGQNHVFHVFYPKSEAT  296

Query  175   RLLQKQMSEFI  143
              +LQ+QMSEF+
Sbjct  297   LVLQQQMSEFM  307



>ref|XP_008219487.1| PREDICTED: probable carboxylesterase 17 [Prunus mume]
Length=310

 Score =   357 bits (916),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 198/310 (64%), Positives = 243/310 (78%), Gaps = 7/310 (2%)
 Frame = -2

Query  1069  VDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPEK  890
             V+EAP +++V SDG+VKRF P +  AS EST+GFKSKDV+ID SKPITGRIF+P      
Sbjct  4     VEEAPDFLEVLSDGSVKRFVPGVVPASPESTNGFKSKDVIIDSSKPITGRIFLPG---NP  60

Query  889   EQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYE  710
               +  LPV++YFHGGGFC+GSTTW GYH FLG  SV S+S+V+SVDYRLAPEN+LPIAYE
Sbjct  61    TSLRKLPVVVYFHGGGFCIGSTTWPGYHHFLGGFSVASQSIVISVDYRLAPENRLPIAYE  120

Query  709   DCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGIM  530
             DCY  L+W+     +EP L+ ADLSRVFL+GDSAGGNI H VA K +++     KI G++
Sbjct  121   DCYCTLDWLGHQVSSEPWLDQADLSRVFLSGDSAGGNISHNVAVKVIRNKISHVKISGLL  180

Query  529   PIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVGE  350
              IHPYFGSE+RT  E+A EG+    VA  DMFWRLS+PEGSNRD++GCN E   +LS  E
Sbjct  181   LIHPYFGSEKRTEKEMAEEGA--GDVASIDMFWRLSIPEGSNRDYFGCNFEK-TQLSATE  237

Query  349   WL-RFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHPDSEATR  173
             W+  FPA  V+VAG DFLKERGVMYAEFL++KGV  V++VEAE+E HVFHVFHP+SEATR
Sbjct  238   WIDEFPAVAVYVAGLDFLKERGVMYAEFLQKKGVTEVKLVEAEKESHVFHVFHPESEATR  297

Query  172   LLQKQMSEFI  143
             LL++ M+EFI
Sbjct  298   LLERNMTEFI  307



>ref|XP_002285083.1| PREDICTED: probable carboxylesterase 17 [Vitis vinifera]
Length=310

 Score =   355 bits (910),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 194/313 (62%), Positives = 241/313 (77%), Gaps = 9/313 (3%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAESTD-GFKSKDVVIDPSKPITGRIFVPDLWP  896
             IV E P ++QV S+G VKRF PEI+  S ES+  G+KSKDV+ID +K I+GR+F+PD   
Sbjct  3     IVAEVPSFLQVLSNGLVKRFEPEISPVSNESSSHGYKSKDVMIDSTKSISGRMFLPDTPG  62

Query  895   EKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIA  716
                    LPVL+YFHGGGFC+GSTTW+GYH FLG L+V S+++V+SVDYRLAPEN+LPIA
Sbjct  63    SSSH---LPVLVYFHGGGFCIGSTTWLGYHTFLGDLAVASQTIVLSVDYRLAPENRLPIA  119

Query  715   YEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNC-AAKIK  539
             Y+DCY++LEW+     +EP LE ADLSRVFL+GDSAGGNI H VA K +Q+      KI+
Sbjct  120   YDDCYSSLEWLSNQVSSEPWLERADLSRVFLSGDSAGGNIAHNVALKVIQEKTYDHVKIR  179

Query  538   GIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELS  359
             G++P+HPYFGSE RT  E   EG     VAMND+ W+LSLP+GSNRD+ GCN E    +S
Sbjct  180   GLLPVHPYFGSEERTEKE--REGEAAGYVAMNDLLWKLSLPQGSNRDYSGCNFER-AAIS  236

Query  358   VGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHPDSEA  179
               EW RFPA +V+VAG DFLKERGVMYA FL +KGV+ V++VEAE++ HV+HV+HP SEA
Sbjct  237   SAEWGRFPAVVVYVAGLDFLKERGVMYAGFLEKKGVE-VKLVEAEDQSHVYHVYHPQSEA  295

Query  178   TRLLQKQMSEFIH  140
             T LLQKQMSEFIH
Sbjct  296   THLLQKQMSEFIH  308



>ref|XP_007161215.1| hypothetical protein PHAVU_001G051600g [Phaseolus vulgaris]
 gb|ESW33209.1| hypothetical protein PHAVU_001G051600g [Phaseolus vulgaris]
Length=309

 Score =   354 bits (909),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 196/313 (63%), Positives = 243/313 (78%), Gaps = 7/313 (2%)
 Frame = -2

Query  1081  MSIIVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDL  902
             MS+I  EAP ++QVFS+G+VKRF PE  +AS EST+G+KSKDV+ID SKPITGRIF+P  
Sbjct  1     MSLIA-EAPNFLQVFSNGSVKRFDPETVSASLESTNGYKSKDVIIDSSKPITGRIFLPRF  59

Query  901   WPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLP  722
                 ++   LP+L+YFHGGGFC+GSTTW+GYH FLG L V S+S+++SVDYRLAPE++LP
Sbjct  60    PTSSKK---LPLLVYFHGGGFCIGSTTWLGYHAFLGDLCVTSQSIILSVDYRLAPEHRLP  116

Query  721   IAYEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKI  542
             +AYEDCY +LEW+      EP L+ AD++RVFL+GDSAGGNI H VA K +Q   C  +I
Sbjct  117   VAYEDCYTSLEWLSDEVGYEPLLQQADITRVFLSGDSAGGNIAHHVAVKAIQSNACPLRI  176

Query  541   KGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDREL  362
             KG+MPIHPYFGSE+RT  E+  E  +   V MNDMFW+LS+PEG NRD+YGCN E   +L
Sbjct  177   KGLMPIHPYFGSEKRTVKEMLDE--SIEDVTMNDMFWKLSIPEGLNRDYYGCNFEK-HDL  233

Query  361   SVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHPDSE  182
             S   W  FP   V+VAG+DFLKERGVMY EFL++KGVK VEVVEA+EE HVFHV++P S 
Sbjct  234   SNNVWHEFPPTEVYVAGQDFLKERGVMYEEFLKKKGVKEVEVVEAKEETHVFHVYYPQSS  293

Query  181   ATRLLQKQMSEFI  143
             AT LLQ QMS F+
Sbjct  294   ATLLLQTQMSRFM  306



>ref|XP_007223144.1| hypothetical protein PRUPE_ppa009018mg [Prunus persica]
 gb|EMJ24343.1| hypothetical protein PRUPE_ppa009018mg [Prunus persica]
Length=310

 Score =   352 bits (904),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 196/310 (63%), Positives = 242/310 (78%), Gaps = 7/310 (2%)
 Frame = -2

Query  1069  VDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPEK  890
             V+EAP +++V SDG+VKRF P +  AS ES +GFKSKDV+ID SKPITGRIF+P      
Sbjct  4     VEEAPDFLEVLSDGSVKRFVPGVVPASPESINGFKSKDVIIDSSKPITGRIFLPG---NP  60

Query  889   EQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYE  710
               +  LPV++YFHGGGFC+GSTTW GYH FLG  SV S+S+V+SVDYRLAPE++LPIAYE
Sbjct  61    TSLSKLPVVVYFHGGGFCIGSTTWPGYHNFLGGFSVASQSIVISVDYRLAPEHRLPIAYE  120

Query  709   DCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGIM  530
             DCY  L+W+     +EP L+ ADLSRVFL+GDSAGGNI H VA K +++     KI G++
Sbjct  121   DCYCTLDWLGHQVSSEPWLDQADLSRVFLSGDSAGGNISHNVAVKVIRNKISHVKISGLL  180

Query  529   PIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVGE  350
              IHPYFGSERRT  E+A EG+    VA  DMFWRLS+P+GSN D++GCN E   +LS  E
Sbjct  181   LIHPYFGSERRTEKEMAEEGA--GDVASIDMFWRLSIPDGSNHDYFGCNFEK-TQLSATE  237

Query  349   WL-RFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHPDSEATR  173
             W+  FPA  V+VAG DFLKERGVMYAEFL++KGVK V++VEAE+E HVFHVFHP+SEATR
Sbjct  238   WIDEFPAVAVYVAGLDFLKERGVMYAEFLQKKGVKEVKLVEAEKESHVFHVFHPESEATR  297

Query  172   LLQKQMSEFI  143
             LL++ M+EFI
Sbjct  298   LLERNMTEFI  307



>emb|CBI21036.3| unnamed protein product [Vitis vinifera]
Length=309

 Score =   352 bits (902),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 192/315 (61%), Positives = 243/315 (77%), Gaps = 9/315 (3%)
 Frame = -2

Query  1081  MSIIVDEAPGYIQVFSDGTVKRFSPEIATASAESTD-GFKSKDVVIDPSKPITGRIFVPD  905
             MS++ +E PG+IQ+FSDG+VKR   E + AS +S+  G+KSKDV+ID +KPI+GRIFVPD
Sbjct  1     MSMVAEE-PGFIQIFSDGSVKRPERETSPASEDSSSTGYKSKDVIIDSTKPISGRIFVPD  59

Query  904   LWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKL  725
                      LLPVL+YFHGGGFC+G+ TW+GYH FLG  +V ++S+V+SVDYRLAPE++L
Sbjct  60    T---PASSSLLPVLVYFHGGGFCIGTATWLGYHTFLGDFAVAAQSIVLSVDYRLAPEHRL  116

Query  724   PIAYEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAK  545
             P AY+DCY +LEW+ K   +EP L+ ADLSRVFL+GDSAGGNI H +A + +Q G    K
Sbjct  117   PTAYDDCYCSLEWLSKQVSSEPWLQRADLSRVFLSGDSAGGNIAHNIAIRAIQKGCDEVK  176

Query  544   IKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRE  365
             IKG++PIHPYFGSE R   E A+E  +   V + D+ W+LSLPEGSNRD++GCN E   E
Sbjct  177   IKGVLPIHPYFGSEERIDKEKASE--SAKDVGLTDLLWKLSLPEGSNRDYFGCNFEK-AE  233

Query  364   LSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHPDS  185
             LS  EW RFPA +V+VAG DF KERGVMYA FL ++G + V++VEAE E HV+H+FHP S
Sbjct  234   LSREEWDRFPAVVVYVAGLDFFKERGVMYAGFLEKRGAE-VKLVEAEGEQHVYHMFHPKS  292

Query  184   EATRLLQKQMSEFIH  140
             EATRLLQKQMSEFIH
Sbjct  293   EATRLLQKQMSEFIH  307



>ref|XP_010048207.1| PREDICTED: probable carboxylesterase 17 [Eucalyptus grandis]
Length=310

 Score =   351 bits (901),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 192/310 (62%), Positives = 235/310 (76%), Gaps = 5/310 (2%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPE  893
             I +E P ++QV SDG+VKRF PEIA  S +S+ G+ SKDV IDPSKPIT RIF+P+  P 
Sbjct  3     IREEVPRFLQVLSDGSVKRFVPEIAPPSTDSSLGYFSKDVTIDPSKPITARIFIPNAPPT  62

Query  892   KEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAY  713
                +  LPVL YFHGGGFC+GSTTW+GYH FLG   + S+ +V+SVDYRLAPEN+LP+AY
Sbjct  63    --SLARLPVLAYFHGGGFCIGSTTWLGYHHFLGDFCLASQCIVLSVDYRLAPENRLPVAY  120

Query  712   EDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGI  533
             EDCYA+LEW+ +++  +P LE ADLSR+FL+GDSAG NI H +A + LQD  C   I G+
Sbjct  121   EDCYASLEWLSRSKGTDPWLERADLSRLFLSGDSAGANIAHHMAIRALQDAACPVSIVGL  180

Query  532   MPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVG  353
             M IHPYFGSERRT  E+A  G  G SV+ ND+FWRLS+PEGS+RD+ GCN E  R +S  
Sbjct  181   MSIHPYFGSERRTKMELADGG--GKSVSTNDLFWRLSIPEGSDRDYPGCNFEMAR-MSAE  237

Query  352   EWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHPDSEATR  173
             EW RFPA +V VA  DFLKERGV YAEFL+ +GVK VE+VEA+ E HV+HVFHP SEAT 
Sbjct  238   EWRRFPAVVVHVAELDFLKERGVKYAEFLKGQGVKEVELVEAKGEQHVYHVFHPKSEATS  297

Query  172   LLQKQMSEFI  143
             LL KQ   F+
Sbjct  298   LLHKQTIHFM  307



>ref|XP_002285090.3| PREDICTED: probable carboxylesterase 17 [Vitis vinifera]
Length=354

 Score =   353 bits (905),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 193/318 (61%), Positives = 244/318 (77%), Gaps = 9/318 (3%)
 Frame = -2

Query  1090  LQKMSIIVDEAPGYIQVFSDGTVKRFSPEIATASAESTD-GFKSKDVVIDPSKPITGRIF  914
             L  MS++ +E PG+IQ+FSDG+VKR   E + AS +S+  G+KSKDV+ID +KPI+GRIF
Sbjct  43    LITMSMVAEE-PGFIQIFSDGSVKRPERETSPASEDSSSTGYKSKDVIIDSTKPISGRIF  101

Query  913   VPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPE  734
             VPD         LLPVL+YFHGGGFC+G+ TW+GYH FLG  +V ++S+V+SVDYRLAPE
Sbjct  102   VPD---TPASSSLLPVLVYFHGGGFCIGTATWLGYHTFLGDFAVAAQSIVLSVDYRLAPE  158

Query  733   NKLPIAYEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNC  554
             ++LP AY+DCY +LEW+ K   +EP L+ ADLSRVFL+GDSAGGNI H +A + +Q G  
Sbjct  159   HRLPTAYDDCYCSLEWLSKQVSSEPWLQRADLSRVFLSGDSAGGNIAHNIAIRAIQKGCD  218

Query  553   AAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLEN  374
               KIKG++PIHPYFGSE R   E A+E  +   V + D+ W+LSLPEGSNRD++GCN E 
Sbjct  219   EVKIKGVLPIHPYFGSEERIDKEKASE--SAKDVGLTDLLWKLSLPEGSNRDYFGCNFEK  276

Query  373   DRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfH  194
               ELS  EW RFPA +V+VAG DF KERGVMYA FL ++G + V++VEAE E HV+H+FH
Sbjct  277   -AELSREEWDRFPAVVVYVAGLDFFKERGVMYAGFLEKRGAE-VKLVEAEGEQHVYHMFH  334

Query  193   PDSEATRLLQKQMSEFIH  140
             P SEATRLLQKQMSEFIH
Sbjct  335   PKSEATRLLQKQMSEFIH  352



>ref|XP_002285085.1| PREDICTED: probable carboxylesterase 17 [Vitis vinifera]
Length=309

 Score =   349 bits (896),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 194/317 (61%), Positives = 242/317 (76%), Gaps = 9/317 (3%)
 Frame = -2

Query  1081  MSIIVDEAPGYIQVFSDGTVKRFSPEIATASAESTD-GFKSKDVVIDPSKPITGRIFVPD  905
             MS++ +E PG IQ+FSDG+VKR   E + AS +S+  G+KSKDV+ID +KPI+GRIFVPD
Sbjct  1     MSMVAEE-PGVIQIFSDGSVKRPERETSPASEDSSSTGYKSKDVIIDSTKPISGRIFVPD  59

Query  904   LWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKL  725
                      LLPVL+YFHGGGFC+G+ TW+GYH FLG  +V ++S+V+SVDYRLAPE++L
Sbjct  60    T---PASSSLLPVLVYFHGGGFCIGTATWLGYHTFLGDFAVAAQSIVLSVDYRLAPEHRL  116

Query  724   PIAYEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAK  545
             P AY+DCY +LEW+ K   +EP L+ ADLSRVFL+GDSAGGNI H +A + +Q G    K
Sbjct  117   PTAYDDCYCSLEWLSKQVSSEPWLQRADLSRVFLSGDSAGGNIAHNIAIRAIQKGCDEVK  176

Query  544   IKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRE  365
             IKG++PIHPYFGSE R   E A+E  +   V + D+ W+LSLPEGSNRD++GCN E   E
Sbjct  177   IKGVLPIHPYFGSEERIDKEKASE--SAKDVGLTDLIWKLSLPEGSNRDYFGCNFEK-AE  233

Query  364   LSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHPDS  185
             LS  EW RFPA +V+VA  DF KERGVMYA FL +KGV  V++VEAE E HV+HVFHP S
Sbjct  234   LSRDEWGRFPAVVVYVASLDFCKERGVMYAGFLEKKGVD-VKLVEAEGEQHVYHVFHPKS  292

Query  184   EATRLLQKQMSEFIHGV  134
             EATRLLQKQMSEFIH +
Sbjct  293   EATRLLQKQMSEFIHSL  309



>emb|CAN69539.1| hypothetical protein VITISV_007805 [Vitis vinifera]
Length=309

 Score =   349 bits (896),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 192/315 (61%), Positives = 243/315 (77%), Gaps = 9/315 (3%)
 Frame = -2

Query  1081  MSIIVDEAPGYIQVFSDGTVKRFSPEIATASAESTD-GFKSKDVVIDPSKPITGRIFVPD  905
             MS++ +E PG IQ+FSDG+VKR   E + AS +S+  G+KSKDV+ID +KPI+GRIFVPD
Sbjct  1     MSMVAEE-PGLIQIFSDGSVKRPERETSPASEDSSSTGYKSKDVIIDSTKPISGRIFVPD  59

Query  904   LWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKL  725
                      LLPVL+YFHGGGFC+G+ TW+GYH FLG  +V ++S+V+SVDYRLAPE++L
Sbjct  60    T---PASSSLLPVLVYFHGGGFCIGTATWLGYHTFLGDFAVAAQSIVLSVDYRLAPEHRL  116

Query  724   PIAYEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAK  545
             P AY+DCY +LEW+ K   +EP L+ ADLSRVFL+GDSAGGNI H +A + +Q G    K
Sbjct  117   PTAYDDCYCSLEWLSKQVSSEPWLQRADLSRVFLSGDSAGGNIAHNIAIRAIQKGCDEVK  176

Query  544   IKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRE  365
             IKG++PIHPYFGSE R   E A+E  +   V + D+ W+LSLPEGSNRD++GCN E   E
Sbjct  177   IKGVLPIHPYFGSEERIDKEKASE--SAKDVGLTDLXWKLSLPEGSNRDYFGCNFEK-AE  233

Query  364   LSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHPDS  185
             LS  EW RFPA +V+VAG DF KERGVMYA FL ++GV+ V++VEAE E HV+H+FHP S
Sbjct  234   LSREEWGRFPAVVVYVAGLDFFKERGVMYAGFLEKRGVE-VKLVEAEGEQHVYHMFHPKS  292

Query  184   EATRLLQKQMSEFIH  140
             EATRLLQK+MSEFIH
Sbjct  293   EATRLLQKKMSEFIH  307



>ref|XP_002285088.1| PREDICTED: probable carboxylesterase 17 isoform X1 [Vitis vinifera]
 emb|CBI21035.3| unnamed protein product [Vitis vinifera]
Length=310

 Score =   348 bits (893),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 191/313 (61%), Positives = 239/313 (76%), Gaps = 9/313 (3%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAESTD-GFKSKDVVIDPSKPITGRIFVPDLWP  896
             IV E P ++QV S+G VKRF PEI+  S ES+  G+KSKDV+ID +K I+GR+F+PD   
Sbjct  3     IVAEVPSFLQVLSNGLVKRFEPEISPVSNESSSHGYKSKDVMIDSTKSISGRMFLPDTPG  62

Query  895   EKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIA  716
                    LPVL+YFHGGGFC+GST W+GYH FLG L+V S+++V+SVDYRLAPEN+LPIA
Sbjct  63    SSSH---LPVLVYFHGGGFCIGSTAWLGYHTFLGDLAVASQTIVLSVDYRLAPENRLPIA  119

Query  715   YEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNC-AAKIK  539
             Y+DC+++LEW+     +EP LE ADL RVFL+GDSAGGNI H VA K +Q+      KI+
Sbjct  120   YDDCFSSLEWLSNQVSSEPWLERADLCRVFLSGDSAGGNIAHNVALKVIQEKTYDHVKIR  179

Query  538   GIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELS  359
             G++P+HPYFGSE RT  E   EG     VAMND+ W+LSLP+GSNRD+ GCN E    +S
Sbjct  180   GLLPVHPYFGSEERTEKE--REGEAAGYVAMNDLLWKLSLPQGSNRDYSGCNFER-AAIS  236

Query  358   VGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHPDSEA  179
               EW RFPA +V+VAG DFLKERGVMYA FL +KGV+ V++VEAE++ HV+HV+HP SEA
Sbjct  237   SAEWGRFPAVVVYVAGLDFLKERGVMYAGFLEKKGVE-VKLVEAEDQSHVYHVYHPQSEA  295

Query  178   TRLLQKQMSEFIH  140
             T LLQKQMSEFIH
Sbjct  296   THLLQKQMSEFIH  308



>ref|XP_010648659.1| PREDICTED: probable carboxylesterase 17 isoform X2 [Vitis vinifera]
Length=310

 Score =   347 bits (891),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 192/313 (61%), Positives = 238/313 (76%), Gaps = 9/313 (3%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAESTD-GFKSKDVVIDPSKPITGRIFVPDLWP  896
             IV E P ++QV S+G VKRF PEI+  S ES+  G+KSKDV+ID +K I+GR+F+PD   
Sbjct  3     IVAEVPSFLQVLSNGLVKRFEPEISPVSNESSSHGYKSKDVMIDSTKSISGRMFLPDTPG  62

Query  895   EKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIA  716
                    LPVL+YFHGGGFC+GST W+GYH FLG L+V S+++V+SVDYRLAPEN+LPIA
Sbjct  63    SSSH---LPVLVYFHGGGFCIGSTAWLGYHTFLGDLAVASQTIVLSVDYRLAPENRLPIA  119

Query  715   YEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNC-AAKIK  539
             Y+DC+++LEW+     +EP LE ADL RVFL+GDSAGGNI H VA K +Q+      KI+
Sbjct  120   YDDCFSSLEWLSNQVSSEPWLERADLCRVFLSGDSAGGNIAHNVALKVIQEKTYDHVKIR  179

Query  538   GIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELS  359
             G++P+HPYFGSE RT  E   EG     VAMND+ W+LSLP+GSNRD+ GCN E    +S
Sbjct  180   GLLPVHPYFGSEERTEKE--REGEAAGYVAMNDLLWKLSLPQGSNRDYSGCNFER-AAIS  236

Query  358   VGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHPDSEA  179
               EW RFPA +V+VAG DFLKERGVMYA FL +KGV+ V++VEAE E HV+H+FHP SEA
Sbjct  237   SAEWGRFPAVVVYVAGLDFLKERGVMYAGFLEKKGVE-VKLVEAEGEQHVYHMFHPKSEA  295

Query  178   TRLLQKQMSEFIH  140
             TRLLQKQ SEFIH
Sbjct  296   TRLLQKQTSEFIH  308



>gb|EYU20270.1| hypothetical protein MIMGU_mgv1a010399mg [Erythranthe guttata]
Length=313

 Score =   343 bits (880),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 184/314 (59%), Positives = 231/314 (74%), Gaps = 4/314 (1%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPE  893
             IV E+PG+IQVFS+G VKRFSP  A  S  + + +KSKDV+IDPSKPIT RIF+P     
Sbjct  3     IVAESPGFIQVFSNGAVKRFSPPTAAPSLSNNNKYKSKDVIIDPSKPITARIFLPQHHSS  62

Query  892   KEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAY  713
             + Q + +P+L+YFHGGGFC+GSTTW+GYH FLG LS  +  +V+SVDYRLAPENKLPI Y
Sbjct  63    QSQSKSIPILVYFHGGGFCIGSTTWLGYHTFLGNLSSTAGIIVLSVDYRLAPENKLPIPY  122

Query  712   EDCY-AALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKG  536
             EDC+ A           EP L+ ADLSR+FL+GDSAGGNI H V  K ++  N   ++KG
Sbjct  123   EDCFAALQWLAAAASNTEPWLQDADLSRIFLSGDSAGGNIAHHVTVKAIET-NINIRVKG  181

Query  535   IMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSV  356
             ++PIHPYFGSE RT  E+  E ++   VAMNDMFW+LSLPEGS+RD+YGCN+E       
Sbjct  182   LLPIHPYFGSEART--ELEMEEASAGEVAMNDMFWKLSLPEGSDRDYYGCNIEKAGLPET  239

Query  355   GEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHPDSEAT  176
              EW  FPA +VFVAG DFL+ERGVMY EFL++KGV+ V +V+AE E HVFH ++PDS A+
Sbjct  240   TEWGLFPAVVVFVAGLDFLRERGVMYVEFLKKKGVRNVSLVDAEGESHVFHAWNPDSTAS  299

Query  175   RLLQKQMSEFIHGV  134
              LLQ Q+S FI  +
Sbjct  300   FLLQNQISSFIQSL  313



>ref|XP_002285081.1| PREDICTED: probable carboxylesterase 17 [Vitis vinifera]
Length=311

 Score =   342 bits (876),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 187/313 (60%), Positives = 239/313 (76%), Gaps = 8/313 (3%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATAS-AESTDGFKSKDVVIDPSKPITGRIFVPDLWP  896
             +V E PGY+Q+ SDG+VKR   + + AS   S++G+KSKDV+I+ +KP + RIF+PD+  
Sbjct  3     VVAEIPGYLQLLSDGSVKRLQQQTSPASNGSSSNGYKSKDVIINSTKPTSARIFLPDILG  62

Query  895   EKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIA  716
                   LLPV++YFHGGGFCVGSTTW+GYH FLG L+V S+S+V+SVDYRLAPEN+LPIA
Sbjct  63    SSS---LLPVIVYFHGGGFCVGSTTWLGYHTFLGDLAVASQSIVLSVDYRLAPENRLPIA  119

Query  715   YEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNC-AAKIK  539
             Y+DCY++LEW+ +   +EP LE ADLSRVFL+GDSAGGNIVH VA + +Q+ +C   KIK
Sbjct  120   YDDCYSSLEWLSRQVSSEPWLERADLSRVFLSGDSAGGNIVHNVALRTIQEQSCDQVKIK  179

Query  538   GIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELS  359
             G++ IHP+FGSE RT  E A+ G     +   D+FW+LSLPEGSN D+ GCN     ELS
Sbjct  180   GLLIIHPFFGSEERTEKERAS-GGEAEVLTWLDLFWKLSLPEGSNCDYSGCNFAM-AELS  237

Query  358   VGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHPDSEA  179
               EW RFP A+V+VAG DF KER V YA FL +KGV+ V++VE+E E H +H+ HP+SEA
Sbjct  238   RAEWSRFPPAVVYVAGLDFSKERQVTYAAFLEKKGVE-VKLVESEGEIHAYHMLHPESEA  296

Query  178   TRLLQKQMSEFIH  140
             TRLLQKQMSEFIH
Sbjct  297   TRLLQKQMSEFIH  309



>ref|XP_002285077.1| PREDICTED: probable carboxylesterase 17 [Vitis vinifera]
Length=310

 Score =   341 bits (874),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 192/317 (61%), Positives = 241/317 (76%), Gaps = 10/317 (3%)
 Frame = -2

Query  1081  MSIIVDEAPGYIQVFSDGTVKRFSPEIATASAEST-DGFKSKDVVIDPSKPITGRIFVPD  905
             MS+I D  PGY QVFSDG+VKR+  E A AS +S+ +G+KSKDV+I  +KPI+ RIF+PD
Sbjct  1     MSLIAD-FPGYFQVFSDGSVKRYERETAPASIDSSSNGYKSKDVIISSTKPISARIFLPD  59

Query  904   LWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKL  725
                       LPVL+YFHGGGFC  STTW+G+H FLG  +V S+S+V+SVDYRLAPEN+L
Sbjct  60    TLDSSSH---LPVLVYFHGGGFCAVSTTWLGHHTFLGDFAVASQSIVLSVDYRLAPENRL  116

Query  724   PIAYEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNC-AA  548
             PIAY+DCY++LEW+     ++P LE ADLSRVFL+GDS+GGNIVH VA + +Q+ +C   
Sbjct  117   PIAYDDCYSSLEWLSCQASSDPWLERADLSRVFLSGDSSGGNIVHNVALRTIQEQSCDQV  176

Query  547   KIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDR  368
             KIKG++PIHP+FGS+ RT  E A+      +VA  D+ W+LSLPEGSNRD   CN E   
Sbjct  177   KIKGLLPIHPFFGSQERTEKERAS--GEAENVAKTDLLWKLSLPEGSNRDHPWCNFEK-A  233

Query  367   ELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHPD  188
             ELS  EW R+P  +V+VAG DFLKERGVMYA FL +KGV+ V++VEAE E HV+HV HP+
Sbjct  234   ELSRAEWSRYPPVVVYVAGSDFLKERGVMYAAFLEKKGVE-VKLVEAEGEVHVYHVLHPE  292

Query  187   SEATRLLQKQMSEFIHG  137
             S+ATRLLQKQMSEFIH 
Sbjct  293   SKATRLLQKQMSEFIHN  309



>ref|XP_010696064.1| PREDICTED: probable carboxylesterase 17 [Beta vulgaris subsp. 
vulgaris]
Length=316

 Score =   340 bits (873),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 184/317 (58%), Positives = 244/317 (77%), Gaps = 9/317 (3%)
 Frame = -2

Query  1081  MSIIVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDL  902
             MS+I  EAP ++QVFSDG+VKRF+PEIA AS ES + +KSKD+VI+PSK ITGRIF+P+ 
Sbjct  1     MSLIA-EAPDFLQVFSDGSVKRFAPEIALASPESLESYKSKDIVIEPSKSITGRIFLPNT  59

Query  901   WPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLP  722
                      LPV++YFHGGGFC+GSTTW+ YH+FLG  +  ++++V+S+DYRLAPEN+LP
Sbjct  60    PTINTSSHKLPVVVYFHGGGFCIGSTTWLNYHVFLGDFASSAEAIVLSIDYRLAPENRLP  119

Query  721   IAYEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNC---A  551
             IAY D  ++LEW+ ++   EP LE ADL+RVFL+GDSAGGNI H VA    ++ +    +
Sbjct  120   IAYSDGCSSLEWLIRSCYTEPWLERADLTRVFLSGDSAGGNIAHNVAMIAHENEDHDFKS  179

Query  550   AKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLEND  371
              +IKGI+ IHP+FGSE RT  E+  E  +G  V MNDMFW+LS+P+GSNRD++GCN E  
Sbjct  180   IQIKGILLIHPFFGSEERTPQELVNE--SGIEVQMNDMFWKLSIPQGSNRDYFGCNFE--  235

Query  370   RELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHP  191
              ++S  EW  FP  LV VAG DFLKERGVMY E+L+RKGVK V ++EA++EGH++HV+HP
Sbjct  236   -KVSFDEWSLFPRVLVHVAGLDFLKERGVMYVEYLKRKGVKDVSLIEAKDEGHIYHVYHP  294

Query  190   DSEATRLLQKQMSEFIH  140
              SE+T LL+ QM+EFI+
Sbjct  295   KSESTTLLRLQMAEFIN  311



>ref|XP_004498733.1| PREDICTED: probable carboxylesterase 17-like [Cicer arietinum]
Length=557

 Score =   348 bits (893),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 194/333 (58%), Positives = 253/333 (76%), Gaps = 17/333 (5%)
 Frame = -2

Query  1105  TQISNLQKMSI--------IVDEAPGYIQVFSDGTVKRFSPEIATASAESTDG---FKSK  959
             ++I N++ + I         + E   ++QVFSDGTVKRF+PE +  +++S+     +KSK
Sbjct  226   SEIQNMENIFIKLTTSALDTLKEIREFLQVFSDGTVKRFNPETSPPTSQSSTNQYKYKSK  285

Query  958   DVVIDPSKPITGRIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvq  779
             D++IDPSKPIT R+F+P+     +  +  P+L+YFHGGGFC+GSTTW+GY+ FL   +V 
Sbjct  286   DIIIDPSKPITARLFIPN--NSSQTTKQFPLLVYFHGGGFCIGSTTWLGYNNFLADFAVT  343

Query  778   sksvvvsVDYRLAPENKLPIAYEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGN  599
             S+S+V+S+DYRLAPE++LPIAYEDCY++LEW+ +N K EP L +ADLS VFL+GDSAGGN
Sbjct  344   SQSIVLSIDYRLAPEHRLPIAYEDCYSSLEWIAENVKIEPFLHNADLSNVFLSGDSAGGN  403

Query  598   IVHQVAKKCLQ-DGNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLS  422
             I H VA K ++ +G C  K+KG+M IHPYFGSE+RT  E+     +   V MNDMFWRLS
Sbjct  404   ISHYVAVKAVKNNGFCPVKVKGLMLIHPYFGSEKRTEKEMEE--ESVEDVRMNDMFWRLS  461

Query  421   LPEGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWv  242
             LPE S+RDF+GCN E D E+    WL+FPA  V+VAGKDFLKERGVMY EFL++KGV  V
Sbjct  462   LPEDSDRDFFGCNFEKD-EVFESVWLKFPAVEVYVAGKDFLKERGVMYGEFLKKKGVNEV  520

Query  241   evveaeeeghvfhvfHPDSEATRLLQKQMSEFI  143
             +VVEAEEE HVFHVF PDS+ATRLLQ+QMSEF+
Sbjct  521   KVVEAEEEKHVFHVFEPDSDATRLLQRQMSEFM  553



>ref|NP_001268122.1| serine hydrolase-like [Vitis vinifera]
 gb|AAN77692.1|AF487826_1 putative serine hydrolase [Vitis vinifera]
Length=310

 Score =   333 bits (853),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 189/313 (60%), Positives = 237/313 (76%), Gaps = 9/313 (3%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAEST-DGFKSKDVVIDPSKPITGRIFVPDLWP  896
              + EA  Y +V SDG++KR   E A AS +S+ +G+KSKDV+I+ +KPI+ RIF+PD+  
Sbjct  3     FIGEASAYFKVLSDGSIKRVEWESAPASNDSSSNGYKSKDVIINSTKPISARIFLPDVPG  62

Query  895   EKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIA  716
                +   LPVL+YFHGGGFC+GSTTW GYH FLG  +V S+S+V+SVDYR APEN+LPIA
Sbjct  63    SSGR---LPVLVYFHGGGFCLGSTTWFGYHTFLGDFAVASQSIVLSVDYRHAPENRLPIA  119

Query  715   YEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNC-AAKIK  539
             Y+DCY++LEW+     +EP LE ADLSRVFL+GDSAGGNIVH VA + +Q+ +C   KIK
Sbjct  120   YDDCYSSLEWLSCQVSSEPWLERADLSRVFLSGDSAGGNIVHNVALRTIQEQSCDQVKIK  179

Query  538   GIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELS  359
             G++ IHP+FGSE R   E A  G    ++A+ D  W+LSLPEGSNRD Y CN E   ELS
Sbjct  180   GLLLIHPFFGSEERIEKERA--GGEAENLALTDWMWKLSLPEGSNRDHYWCNYEM-AELS  236

Query  358   VGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHPDSEA  179
               EW RFP A+V+VAG DFLKERGVMYA FL + GV+ V++VEAE E HV+H+ HP+SEA
Sbjct  237   RAEWCRFPPAVVYVAGLDFLKERGVMYAAFLEKNGVE-VKLVEAEGEKHVYHMLHPESEA  295

Query  178   TRLLQKQMSEFIH  140
             TRLLQKQMSEFIH
Sbjct  296   TRLLQKQMSEFIH  308



>ref|XP_006382075.1| hypothetical protein POPTR_0006s26960g [Populus trichocarpa]
 gb|ERP59872.1| hypothetical protein POPTR_0006s26960g [Populus trichocarpa]
Length=294

 Score =   325 bits (832),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 183/313 (58%), Positives = 227/313 (73%), Gaps = 25/313 (8%)
 Frame = -2

Query  1075  IIVDEAPGYIQVFSDGTVKRFSPEIATASAEST--DGFKSKDVVIDPSKPITGRIFVPDL  902
              IV E PG++QVFSDG VKRF+PEI  ASAE +  +G K KDVVID SKPIT R+F+PD 
Sbjct  2     FIVAEIPGFLQVFSDGMVKRFAPEIVPASAEESYSNGLKFKDVVIDSSKPITARLFLPDT  61

Query  901   WPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLP  722
                  Q   LPV++YFHGG FC  STTW G+H FLG LS  S+S+V+SVDYRLAPEN+LP
Sbjct  62    RGSASQ---LPVVVYFHGGCFCFCSTTWFGFHHFLGDLSKASQSIVLSVDYRLAPENRLP  118

Query  721   IAYEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKI  542
             IAY+DC+++LEW+                 +FL+GDSAGGNI H VA + ++   C  KI
Sbjct  119   IAYDDCFSSLEWL-----------------MFLSGDSAGGNITHHVAIRAMRSNTCQVKI  161

Query  541   KGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDREL  362
             KG+M IHP FGSE+RT  E  AEG+    V MNDMFW LS+PEGSNRD++GCN E  +++
Sbjct  162   KGLMLIHPCFGSEKRTMKET-AEGA-ARDVVMNDMFWGLSIPEGSNRDYFGCNFEM-QDV  218

Query  361   SVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHPDSE  182
             S  EW  FPA +V+VAG DFL ERG MYA+FL +KGVK V++VEAE + HVFH+ + +SE
Sbjct  219   SAAEWSEFPAVIVYVAGLDFLNERGAMYAQFLAKKGVKEVKLVEAEGQQHVFHLLYSESE  278

Query  181   ATRLLQKQMSEFI  143
             ATR LQKQMSEF+
Sbjct  279   ATRSLQKQMSEFM  291



>emb|CBI21033.3| unnamed protein product [Vitis vinifera]
Length=1245

 Score =   344 bits (882),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 192/323 (59%), Positives = 241/323 (75%), Gaps = 10/323 (3%)
 Frame = -2

Query  1117  HPQNTQISNLQKMSIIVDEAPGYIQVFSDGTVKRFSPEIATASAESTD-GFKSKDVVIDP  941
             H   T   +   MSI+  E P ++QV S+G VKRF PEI+  S ES+  G+KSKDV+ID 
Sbjct  150   HRLPTAYDDFLAMSIVA-EVPSFLQVLSNGLVKRFEPEISPVSNESSSHGYKSKDVMIDS  208

Query  940   SKPITGRIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvv  761
             +K I+GR+F+PD          LPVL+YFHGGGFC+GSTTW+GYH FLG L+V S+++V+
Sbjct  209   TKSISGRMFLPDTPGSSSH---LPVLVYFHGGGFCIGSTTWLGYHTFLGDLAVASQTIVL  265

Query  760   sVDYRLAPENKLPIAYEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVA  581
             SVDYRLAPEN+LPIAY+DCY++LEW+     +EP LE ADLSRVFL+GDSAGGNI H VA
Sbjct  266   SVDYRLAPENRLPIAYDDCYSSLEWLSNQVSSEPWLERADLSRVFLSGDSAGGNIAHNVA  325

Query  580   KKCLQDGNC-AAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSN  404
              K +Q+      KI+G++P+HPYFGSE RT  E   EG     VAMND+ W+LSLP+GSN
Sbjct  326   LKVIQEKTYDHVKIRGLLPVHPYFGSEERTEKE--REGEAAGYVAMNDLLWKLSLPQGSN  383

Query  403   RDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveae  224
             RD+ GCN E    +S  EW RFPA +V+VAG DFLKERGVMYA FL +KGV+ V++VEAE
Sbjct  384   RDYSGCNFER-AAISSAEWGRFPAVVVYVAGLDFLKERGVMYAGFLEKKGVE-VKLVEAE  441

Query  223   eeghvfhvfHPDSEATRLLQKQM  155
             ++ HV+HV+HP SEAT LLQKQM
Sbjct  442   DQSHVYHVYHPQSEATHLLQKQM  464


 Score =   342 bits (876),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 192/318 (60%), Positives = 242/318 (76%), Gaps = 10/318 (3%)
 Frame = -2

Query  1087  QKMSIIVDEAPGYIQVFSDGTVKRFSPEIATASAEST-DGFKSKDVVIDPSKPITGRIFV  911
             + MS+I D  PGY QVFSDG+VKR+  E A AS +S+ +G+KSKDV+I  +KPI+ RIF+
Sbjct  934   KPMSLIAD-FPGYFQVFSDGSVKRYERETAPASIDSSSNGYKSKDVIISSTKPISARIFL  992

Query  910   PDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPEN  731
             PD          LPVL+YFHGGGFC  STTW+G+H FLG  +V S+S+V+SVDYRLAPEN
Sbjct  993   PDTLDSSSH---LPVLVYFHGGGFCAVSTTWLGHHTFLGDFAVASQSIVLSVDYRLAPEN  1049

Query  730   KLPIAYEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNC-  554
             +LPIAY+DCY++LEW+     ++P LE ADLSRVFL+GDS+GGNIVH VA + +Q+ +C 
Sbjct  1050  RLPIAYDDCYSSLEWLSCQASSDPWLERADLSRVFLSGDSSGGNIVHNVALRTIQEQSCD  1109

Query  553   AAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLEN  374
               KIKG++PIHP+FGS+ RT  E A+      +VA  D+ W+LSLPEGSNRD   CN E 
Sbjct  1110  QVKIKGLLPIHPFFGSQERTEKERAS--GEAENVAKTDLLWKLSLPEGSNRDHPWCNFEK  1167

Query  373   DRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfH  194
               ELS  EW R+P  +V+VAG DFLKERGVMYA FL +KGV+ V++VEAE E HV+HV H
Sbjct  1168  -AELSRAEWSRYPPVVVYVAGSDFLKERGVMYAAFLEKKGVE-VKLVEAEGEVHVYHVLH  1225

Query  193   PDSEATRLLQKQMSEFIH  140
             P+S+ATRLLQKQMSEFIH
Sbjct  1226  PESKATRLLQKQMSEFIH  1243


 Score =   328 bits (840),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 180/307 (59%), Positives = 234/307 (76%), Gaps = 8/307 (3%)
 Frame = -2

Query  1063  EAPGYIQVFSDGTVKRFSPEIATAS-AESTDGFKSKDVVIDPSKPITGRIFVPDLWPEKE  887
             + PGY+Q+ SDG+VKR   + + AS   S++G+KSKDV+I+ +KP + RIF+PD+     
Sbjct  584   QIPGYLQLLSDGSVKRLQQQTSPASNGSSSNGYKSKDVIINSTKPTSARIFLPDILGSSS  643

Query  886   QVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYED  707
                LLPV++YFHGGGFCVGSTTW+GYH FLG L+V S+S+V+SVDYRLAPEN+LPIAY+D
Sbjct  644   ---LLPVIVYFHGGGFCVGSTTWLGYHTFLGDLAVASQSIVLSVDYRLAPENRLPIAYDD  700

Query  706   CYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNC-AAKIKGIM  530
             CY++LEW+ +   +EP LE ADLSRVFL+GDSAGGNIVH VA + +Q+ +C   KIKG++
Sbjct  701   CYSSLEWLSRQVSSEPWLERADLSRVFLSGDSAGGNIVHNVALRTIQEQSCDQVKIKGLL  760

Query  529   PIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVGE  350
              IHP+FGSE RT  E A+ G     +   D+FW+LSLPEGSN D+ GCN     ELS  E
Sbjct  761   IIHPFFGSEERTEKERAS-GGEAEVLTWLDLFWKLSLPEGSNCDYSGCNFAM-AELSRAE  818

Query  349   WLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHPDSEATRL  170
             W RFP A+V+VAG DF KER V YA FL +KGV+ V++VE+E E H +H+ HP+SEATRL
Sbjct  819   WSRFPPAVVYVAGLDFSKERQVTYAAFLEKKGVE-VKLVESEGEIHAYHMLHPESEATRL  877

Query  169   LQKQMSE  149
             LQKQM++
Sbjct  878   LQKQMTK  884


 Score =   144 bits (363),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 101/132 (77%), Gaps = 5/132 (4%)
 Frame = -2

Query  1090  LQKMSIIVDEAPGYIQVFSDGTVKRFSPEIATASAESTD-GFKSKDVVIDPSKPITGRIF  914
             L  MS++ +E PG IQ+FSDG+VKR   E + AS +S+  G+KSKDV+ID +KPI+GRIF
Sbjct  34    LITMSMVAEE-PGVIQIFSDGSVKRPERETSPASEDSSSTGYKSKDVIIDSTKPISGRIF  92

Query  913   VPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPE  734
             VPD         LLPVL+YFHGGGFC+G+ TW+GYH FLG  +V ++S+V+SVDYRLAPE
Sbjct  93    VPD---TPASSSLLPVLVYFHGGGFCIGTATWLGYHTFLGDFAVAAQSIVLSVDYRLAPE  149

Query  733   NKLPIAYEDCYA  698
             ++LP AY+D  A
Sbjct  150   HRLPTAYDDFLA  161



>ref|XP_002515523.1| Arylacetamide deacetylase, putative [Ricinus communis]
 gb|EEF46972.1| Arylacetamide deacetylase, putative [Ricinus communis]
Length=280

 Score =   319 bits (818),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 162/264 (61%), Positives = 202/264 (77%), Gaps = 7/264 (3%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPE  893
             IV EAPG++QVFSDG+VKRF+PEI  AS +S +G+K KDVVI PSKPIT R+F+P+  P 
Sbjct  3     IVAEAPGFLQVFSDGSVKRFAPEIMPASVQSINGYKFKDVVIHPSKPITARLFLPESPPS  62

Query  892   KEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAY  713
                  LLPVL+YFHGGGFC+GSTTW+GYH FLG  SV S+S+++S+DYRLAPEN+LPIAY
Sbjct  63    S----LLPVLVYFHGGGFCIGSTTWLGYHHFLGDFSVTSQSIILSIDYRLAPENRLPIAY  118

Query  712   EDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGI  533
             +DCY++LEW+      EP L  ADLS V+L+GDSAGGNI H VA K +++      IKG+
Sbjct  119   DDCYSSLEWLSHQVTVEPWLSLADLSSVYLSGDSAGGNITHCVAIKAMRNRVPHVTIKGL  178

Query  532   MPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVG  353
             + IHPYFGSE+RT  E+  EG+ G  V MNDMFW LS+PEGSNRD++GCN E  +  S  
Sbjct  179   LLIHPYFGSEKRTKKEM-DEGAAG-EVEMNDMFWGLSIPEGSNRDYFGCNFE-IQNFSAD  235

Query  352   EWLRFPAALVFVAGKDFLKERGVM  281
             EW  FPA +V+VAG DFL ERGV+
Sbjct  236   EWREFPATVVYVAGLDFLNERGVI  259



>emb|CAN64273.1| hypothetical protein VITISV_012394 [Vitis vinifera]
Length=290

 Score =   303 bits (777),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 177/313 (57%), Positives = 219/313 (70%), Gaps = 29/313 (9%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAESTD-GFKSKDVVIDPSKPITGRIFVPDLWP  896
             IV E P ++QV S+G VKRF PEI+  S ES+  G+KSKDV+ID +K I+GR+F+PD   
Sbjct  3     IVAEVPSFLQVLSNGLVKRFEPEISPVSNESSSHGYKSKDVMIDLTKSISGRMFLPDTPG  62

Query  895   EKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIA  716
                    LPVL+YFHG    V S T V                 +SVDYRLAPEN+LPIA
Sbjct  63    SSSH---LPVLVYFHG---AVASQTIV-----------------LSVDYRLAPENRLPIA  99

Query  715   YEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNC-AAKIK  539
             Y+DC+++LEW+     +EP LE ADL RVFL+GDSAGGNI H VA K +Q+      KI+
Sbjct  100   YDDCFSSLEWLSNQVSSEPWLERADLCRVFLSGDSAGGNIAHNVALKVIQEKTYDHVKIR  159

Query  538   GIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELS  359
             G++P+HPYFGSE RT  E   EG     VAMND+ W+LSLP+GSNRD+ GCN E    +S
Sbjct  160   GLLPVHPYFGSEERTEKE--REGEAAGYVAMNDLLWKLSLPQGSNRDYSGCNFER-AAIS  216

Query  358   VGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHPDSEA  179
               EW RFPA +V+VAG DFLKERGVMYA FL +KGV+ V++VEAE++ HV+HV+HP SEA
Sbjct  217   SAEWGRFPAVVVYVAGLDFLKERGVMYAGFLEKKGVE-VKLVEAEDQSHVYHVYHPQSEA  275

Query  178   TRLLQKQMSEFIH  140
             T LLQKQMSEFIH
Sbjct  276   THLLQKQMSEFIH  288



>ref|XP_006842080.1| hypothetical protein AMTR_s00078p00065010 [Amborella trichopoda]
 gb|ERN03755.1| hypothetical protein AMTR_s00078p00065010 [Amborella trichopoda]
Length=291

 Score =   293 bits (749),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 172/312 (55%), Positives = 214/312 (69%), Gaps = 26/312 (8%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPE  893
             IV E PG+ Q+FS G + R SP I+  S+E TDGFKSKDV ID  KP+T RIFVP+    
Sbjct  3     IVGEIPGFFQLFSSGKINRISPGISPPSSEFTDGFKSKDVTIDLFKPVTARIFVPNTI--  60

Query  892   KEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAY  713
               +  LLP+++YFHGGGFC+GSTTW G+H FLG LSV S S+VVSVDYRLAPEN++P   
Sbjct  61    --ETSLLPLIVYFHGGGFCIGSTTWSGFHNFLGGLSVVSHSIVVSVDYRLAPENRIP---  115

Query  712   EDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGI  533
                             EP LE +DLSRVFL+G+SAGGNI + VA + L       +IKGI
Sbjct  116   ----------------EPWLERSDLSRVFLSGESAGGNITYHVALQSLHKDLSPMEIKGI  159

Query  532   MPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRE-LSV  356
             + IHPYFGSE R  +E   E      + +NDMFWRLSLPE   RD Y C+ +   + LS 
Sbjct  160   LVIHPYFGSEARIESEKGKE--VAHVIELNDMFWRLSLPEAEGRDHYACSFKTKADGLSE  217

Query  355   GEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHPDSEAT  176
              EW RFP+  VFVAG D L+ERGV+YAEFL+R+GV+ VE+VEA+ E H +HV++P S+AT
Sbjct  218   IEWTRFPSVKVFVAGADVLRERGVLYAEFLKREGVRVVELVEAQGEPHAYHVYYPRSKAT  277

Query  175   RLLQKQMSEFIH  140
               LQKQMSEF+H
Sbjct  278   HDLQKQMSEFVH  289



>gb|KCW80387.1| hypothetical protein EUGRSUZ_C01748 [Eucalyptus grandis]
Length=278

 Score =   290 bits (743),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 169/310 (55%), Positives = 208/310 (67%), Gaps = 37/310 (12%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPE  893
             I +E P ++QV SDG+VKRF PEIA  S +S+ G+ SKDV IDPSKPIT RIF+P+  P 
Sbjct  3     IREEVPRFLQVLSDGSVKRFVPEIAPPSTDSSLGYFSKDVTIDPSKPITARIFIPNAPPT  62

Query  892   KEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAY  713
                +  LP ++                                 SVDYRLAPEN+LP+AY
Sbjct  63    --SLARLPCIVL--------------------------------SVDYRLAPENRLPVAY  88

Query  712   EDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGI  533
             EDCYA+LEW+ +++  +P LE ADLSR+FL+GDSAG NI H +A + LQD  C   I G+
Sbjct  89    EDCYASLEWLSRSKGTDPWLERADLSRLFLSGDSAGANIAHHMAIRALQDAACPVSIVGL  148

Query  532   MPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVG  353
             M IHPYFGSERRT  E+A  G  G SV+ ND+FWRLS+PEGS+RD+ GCN E  R +S  
Sbjct  149   MSIHPYFGSERRTKMELADGG--GKSVSTNDLFWRLSIPEGSDRDYPGCNFEMAR-MSAE  205

Query  352   EWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHPDSEATR  173
             EW RFPA +V VA  DFLKERGV YAEFL+ +GVK VE+VEA+ E HV+HVFHP SEAT 
Sbjct  206   EWRRFPAVVVHVAELDFLKERGVKYAEFLKGQGVKEVELVEAKGEQHVYHVFHPKSEATS  265

Query  172   LLQKQMSEFI  143
             LL KQ   F+
Sbjct  266   LLHKQTIHFM  275



>gb|AAD04946.2| PrMC3 [Pinus radiata]
Length=319

 Score =   275 bits (702),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 159/320 (50%), Positives = 218/320 (68%), Gaps = 8/320 (3%)
 Frame = -2

Query  1090  LQKMSIIVDEAPGYIQVFSDGTVKRFSPEIATASAE-STDGFKSKDVVIDPSKPITGRIF  914
             ++    ++++ PG+IQV+ DG V RF   +  AS + ++DG +SKDVVIDP K I+ R+F
Sbjct  1     MEITHTLLEDVPGFIQVYEDGFVARFDHRLTPASPQVASDGARSKDVVIDPVKGISARLF  60

Query  913   VPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPE  734
             +P   P  ++   LP+L YFHGGGFC+G+T W GYHLFL  L+  ++++V+SVDYRLAPE
Sbjct  61    LPAELPLAQK---LPLLFYFHGGGFCIGTTAWEGYHLFLSLLAATTRALVISVDYRLAPE  117

Query  733   NKLPIAYEDCYAALEWVQKNQ-KAEPCLES-ADLSRVFLAGDSAGGNIVHQVAKKCLQDG  560
             ++LP AY+DC+ A+EWV     KAEP L++ AD  R FLAG+SAGGNI H V  +     
Sbjct  118   HRLPAAYDDCFDAVEWVASGGGKAEPWLDAHADYGRCFLAGESAGGNIAHVVGSRTADQD  177

Query  559   NCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNL  380
                 KI+G++ IHPYFGSE R   E  A G   +++ +ND+FWRL+LP GS+RD+  CN 
Sbjct  178   LGPLKIRGLIVIHPYFGSEERIECEKVAAGDDAAALELNDLFWRLALPPGSDRDYPTCNP  237

Query  379   ENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhv  200
                R   + + +  P  LV VAG D LK RG++Y E L+  G K  E++EAE E H +HV
Sbjct  238   RGPRSADLRK-VPLPPVLVTVAGLDLLKTRGLLYYELLQSCG-KEAELMEAEGEIHAYHV  295

Query  199   fHPDSEATRLLQKQMSEFIH  140
             FHP SEATRLLQ++MS+FIH
Sbjct  296   FHPRSEATRLLQERMSQFIH  315



>gb|ABK26297.1| unknown [Picea sitchensis]
Length=338

 Score =   211 bits (537),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 136/328 (41%), Positives = 196/328 (60%), Gaps = 23/328 (7%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRF-SPEIATASA------ESTDGFKSKDVVIDPSKPITGRIF  914
             IV EAPG+I+++ DGTV+R    EI   S+      E  +G  SKDVV+DP   +  R +
Sbjct  9     IVSEAPGFIRIYEDGTVERLVDREIVPPSSQDDNFDEEKEGVASKDVVLDPQTGVFVRFY  68

Query  913   VPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPE  734
             +P L     +  + PVLLYFHGGGFC+GS     YH +L +++  +K + +SVDYR APE
Sbjct  69    LPRLEVTNGKGRV-PVLLYFHGGGFCIGSAASPVYHHYLNQVATDAKVICLSVDYRRAPE  127

Query  733   NKLPIAYEDCYAALEWVQKNQ------KAEPCLES-ADLSRVFLAGDSAGGNIVHQVAKK  575
             ++LP AY+DC+  LEW+ +          +P L S AD S+VFLAGDSAG NI+HQV  +
Sbjct  128   HRLPAAYDDCFGVLEWLDRQAMVLEGVSVDPWLASHADFSKVFLAGDSAGANILHQVGIR  187

Query  574   CLQ---DGNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSN  404
                   DG C   ++G + +HP+FG   R   E+ AE    +   M D  W +SLP  ++
Sbjct  188   ASGRNWDGLC---LQGAILVHPFFGGAERIGCELLAEAEVDAFNTMTDAIWSISLPAEAD  244

Query  403   RDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveae  224
             RD   CN    R  ++   L +P  L+FVAGKD L++RG+ Y E +++ G+   ++V  E
Sbjct  245   RDHPFCNPVGPRSPALST-LVYPRMLIFVAGKDLLRDRGIWYYEEIKKAGID-TDLVMTE  302

Query  223   eeghvfhvfHPDSEATRLLQKQMSEFIH  140
              E HVFH+F+P SE   L+ K++ +FIH
Sbjct  303   GESHVFHLFNPKSENVPLMMKRIFDFIH  330



>gb|ABK22851.1| unknown [Picea sitchensis]
Length=335

 Score =   201 bits (510),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 132/328 (40%), Positives = 196/328 (60%), Gaps = 26/328 (8%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFK-------SKDVVIDPSKPITGRIF  914
             IV E+PG ++++ DGTV+R         +   D F        SKDV++DP   +  R++
Sbjct  10    IVFESPG-LRIYEDGTVERLIDRGTVPPSTQDDNFDEEKEGVASKDVLLDPQTGVFVRLY  68

Query  913   VPDLWPEKEQV-ELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAP  737
             +P L  E   V + +P+L+YFHGG FC+ S    GYH +L +++ ++K + VSV+YR AP
Sbjct  69    LPRL--EVTDVKQKVPILVYFHGGAFCIESAASPGYHSYLNKVATEAKVIGVSVEYRRAP  126

Query  736   ENKLPIAYEDCYAALEWVQKNQKA------EPCLES-ADLSRVFLAGDSAGGNIVHQVAK  578
             E++LP AY+DC+  LEW+ +  +       +P L S AD S+VF+AGDSAGGNIVHQV  
Sbjct  127   EHRLPAAYDDCFGVLEWLARQAEVAEGVPIDPWLASHADFSKVFVAGDSAGGNIVHQVCI  186

Query  577   KCLQ---DGNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGS  407
             +      DG C   ++G + +HP+F  E R   E+         V + D  W +SLPEG+
Sbjct  187   RASARNWDGLC---LQGAILVHPFFAGEERIECELGTGAEVEGFVKLVDGIWSISLPEGA  243

Query  406   NRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevvea  227
             +RD   CN +  R  ++   L FP  LVFVA KDFL++RG++Y E L++ G K V+ V  
Sbjct  244   DRDHPFCNPDGPRSPALST-LAFPRTLVFVAEKDFLRDRGILYYEALKKAG-KVVDFVIT  301

Query  226   eeeghvfhvfHPDSEATRLLQKQMSEFI  143
             E E H FH+ +P SE   L+ K++S+F+
Sbjct  302   EGENHDFHLLNPKSENALLMMKRISDFM  329



>gb|ABK23572.1| unknown [Picea sitchensis]
Length=336

 Score =   201 bits (510),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 130/328 (40%), Positives = 198/328 (60%), Gaps = 23/328 (7%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFK-------SKDVVIDPSKPITGRIF  914
             IV E+PG+++++ DGTV+R         +   D F        SKDV++DP   +  R++
Sbjct  10    IVFESPGFLRIYEDGTVERLIDRGTVPPSTQDDNFDEEKEGVASKDVLLDPQTGVFVRLY  69

Query  913   VPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPE  734
             +P L     + + +P+L+YFHGGGFCV S     YH +L +++ ++K + VSV+YR APE
Sbjct  70    LPRLQVTDVK-QKVPILVYFHGGGFCVESAASPLYHSYLNKVATEAKVIGVSVEYRRAPE  128

Query  733   NKLPIAYEDCYAALEWVQKNQKA------EPCLES-ADLSRVFLAGDSAGGNIVHQVAKK  575
             ++LP AY+DC+  LEW+ +  +A      +P L S AD S+VF+AGDSAGGNIVHQV  +
Sbjct  129   HRLPAAYDDCFGVLEWLVRQAEAAEGVTIDPWLASHADFSKVFVAGDSAGGNIVHQVCIR  188

Query  574   CLQ---DGNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSN  404
                   DG C   ++G + +HP+F  E R   E+         + + D  W +SLPEG++
Sbjct  189   ASARNWDGLC---LQGAILVHPFFAGEERIECELGTGAEVEGILKVVDGIWSISLPEGAD  245

Query  403   RDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveae  224
             RD   CN +    L++   L  P  LV VA KDFL++RG++Y E L++ G K V++V  E
Sbjct  246   RDHPFCNPDGPHSLALST-LVCPRTLVIVAEKDFLRDRGILYYEALKKAG-KDVDLVMTE  303

Query  223   eeghvfhvfHPDSEATRLLQKQMSEFIH  140
              E HVFH+ +P SE   L+ K++S+F++
Sbjct  304   GENHVFHLLNPKSENAPLMMKRISDFMN  331



>gb|ABK26549.1| unknown [Picea sitchensis]
Length=357

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 139/328 (42%), Positives = 194/328 (59%), Gaps = 28/328 (9%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRF-----SPEIATASAESTDGFKSKDVVIDPSKPITGRIFVP  908
             IV EAPG ++++ DGTV R       P  +    ES +G  S+DVVIDP   +  RIF+P
Sbjct  29    IVAEAPGMLRIYEDGTVDRLIDSSTVPPSSQLGDESREGVASEDVVIDPQTGVFVRIFLP  88

Query  907   DLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENK  728
              L    E  + +PVL+YFHGG FC+GS     YH ++  ++ ++K + +SV+YR APE++
Sbjct  89    RL----EGKQKVPVLVYFHGGAFCIGSAVSPIYHNYVNEVASEAKVICLSVEYRKAPEHR  144

Query  727   LPIAYEDCYAALEWVQKNQKAE------PCLES-ADLSRVFLAGDSAGGNIVHQV---AK  578
             LP AY D +  LEW+ +  +AE      P L S AD S VFLAGDSAGGNIVHQV   A 
Sbjct  145   LPAAYYDGFGVLEWLNRQAEAEEGAPVDPWLASHADFSNVFLAGDSAGGNIVHQVGILAS  204

Query  577   KCLQDGNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRD  398
                 DG C   ++G + +HP FG +     EV  EG + +    +D  W +SLP G+++D
Sbjct  205   GRNWDGLC---LQGAILVHPAFGGKELIGWEVEPEGESQNFSKFSDAIWGISLPPGADKD  261

Query  397   FYGCNLENDRE--LSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveae  224
                 N    R   LS  E+ R    LVFVA KD L++R V+Y E L++ G K  ++V AE
Sbjct  262   HPFSNPVGPRSPALSTLEYGRI---LVFVAEKDLLRDRAVLYYEALKKAG-KDADLVMAE  317

Query  223   eeghvfhvfHPDSEATRLLQKQMSEFIH  140
              E HVFH+F+P SE    + K++S+F+H
Sbjct  318   GEDHVFHLFNPKSENVSPMLKRISDFMH  345



>ref|XP_003530910.1| PREDICTED: probable carboxylesterase 17-like [Glycine max]
Length=362

 Score =   191 bits (486),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 117/302 (39%), Positives = 178/302 (59%), Gaps = 19/302 (6%)
 Frame = -2

Query  1111  QNTQISNL-QKMSIIVDEAPGYIQVFSDGTVKRFS--PEIATASAESTDGFKSKDVVIDP  941
              N Q +N  Q+  II +E  G I+V  DG V+R S  P +++  A S  G  +KDV+I+ 
Sbjct  27    HNPQANNTNQQREIITEEIQGLIRVHRDGRVERPSIVPSVSSTVA-SERGVTAKDVMINK  85

Query  940   SKPITGRIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvv  761
                +  R++VP         +LLP+L+YFHGGGFCVGS  W  YH FL  L+ ++  V++
Sbjct  86    ETNLWARVYVP--ISACHYSKLLPLLVYFHGGGFCVGSAAWSCYHEFLTNLASKANCVIL  143

Query  760   sVDYRLAPENKLPIAYEDCYAALEWVQKNQKAEPC-----LESADLSRVFLAGDSAGGNI  596
             SVDY LAPEN+LP+AY+D   AL WV++      C     L   ++S +FLAGDSAG NI
Sbjct  144   SVDYHLAPENRLPMAYDDGCNALMWVKREALNGSCVQKWWLSHCNMSSLFLAGDSAGANI  203

Query  595   VHQVAKKCLQDGNCA----AKIKGIMPIHPYFGSERRTAAEVAAEGSTGS--SVAMNDMF  434
              + VA + +  G+ +      +KG++ I P+FG E RT +E  +     S  +++++D +
Sbjct  204   AYNVATR-MHMGSTSNTPLLSLKGVILIQPFFGGEERTFSEKHSLQPPNSALTLSVSDTY  262

Query  433   WRLSLPEGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             WRL+LP G+ RD   CNL  D  + + + LR P+ +V VA  D L++R + ++  L + G
Sbjct  263   WRLALPLGATRDHSYCNLLADGSVKLRD-LRLPSTMVCVAEMDILRDRNLEFSNALAKAG  321

Query  253   VK  248
              +
Sbjct  322   KR  323



>gb|KCW86344.1| hypothetical protein EUGRSUZ_B03032, partial [Eucalyptus grandis]
Length=330

 Score =   190 bits (483),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 119/289 (41%), Positives = 170/289 (59%), Gaps = 21/289 (7%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKR--FSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLW  899
             + DE  G I+V+ DG V+R    P +++A  +   G  S D+V+D    +  R++VP+  
Sbjct  6     VTDEIGGLIRVYKDGHVERPNIVPFVSSALPQEL-GVTSTDMVVDKFTNVWARVYVPN--  62

Query  898   PEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPI  719
                 Q +L+P+++YFHGGGFCVGS  W  YH FL +L+++   V++SV+YRLAPEN LP 
Sbjct  63    --HVQNQLVPLIVYFHGGGFCVGSAGWNCYHEFLAKLALKVNCVIMSVNYRLAPENPLPA  120

Query  718   AYEDCYAALEWV-QKNQKA--EPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAA  548
             AY+D + AL W+ Q+ Q A  E  +   D SRVFLAGDSAG N+ H +A +   +     
Sbjct  121   AYDDGFKALTWLGQRLQGASSEWWMRQCDFSRVFLAGDSAGANVAHHLATRLASNNGTKL  180

Query  547   K------IKGIMPIHPYFGSERRTAAEVAAEGSTGS--SVAMNDMFWRLSLPEGSNRDFY  392
             K       KG + I P+FG E RT +E       GS  +VA +D +WRL+LP GS+RD  
Sbjct  181   KAVNSLCFKGAILIQPFFGGEARTESEKRTPQPPGSALTVAASDTYWRLALPRGSSRDHP  240

Query  391   GCN-LENDRELSVG-EWLR-FPAALVFVAGKDFLKERGVMYAEFLRRKG  254
              CN L+ D+      E LR  P  LV ++ +D L++R V Y E L + G
Sbjct  241   WCNPLKQDKRSGCNLEKLRVLPRTLVCISERDILRDRNVEYCEALAKAG  289



>ref|XP_010044279.1| PREDICTED: probable carboxylesterase 6 [Eucalyptus grandis]
Length=355

 Score =   190 bits (483),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 119/289 (41%), Positives = 170/289 (59%), Gaps = 21/289 (7%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKR--FSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLW  899
             + DE  G I+V+ DG V+R    P +++A  +   G  S D+V+D    +  R++VP+  
Sbjct  31    VTDEIGGLIRVYKDGHVERPNIVPFVSSALPQEL-GVTSTDMVVDKFTNVWARVYVPN--  87

Query  898   PEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPI  719
                 Q +L+P+++YFHGGGFCVGS  W  YH FL +L+++   V++SV+YRLAPEN LP 
Sbjct  88    --HVQNQLVPLIVYFHGGGFCVGSAGWNCYHEFLAKLALKVNCVIMSVNYRLAPENPLPA  145

Query  718   AYEDCYAALEWV-QKNQKA--EPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAA  548
             AY+D + AL W+ Q+ Q A  E  +   D SRVFLAGDSAG N+ H +A +   +     
Sbjct  146   AYDDGFKALTWLGQRLQGASSEWWMRQCDFSRVFLAGDSAGANVAHHLATRLASNNGTKL  205

Query  547   K------IKGIMPIHPYFGSERRTAAEVAAEGSTGS--SVAMNDMFWRLSLPEGSNRDFY  392
             K       KG + I P+FG E RT +E       GS  +VA +D +WRL+LP GS+RD  
Sbjct  206   KAVNSLCFKGAILIQPFFGGEARTESEKRTPQPPGSALTVAASDTYWRLALPRGSSRDHP  265

Query  391   GCN-LENDRELSVG-EWLR-FPAALVFVAGKDFLKERGVMYAEFLRRKG  254
              CN L+ D+      E LR  P  LV ++ +D L++R V Y E L + G
Sbjct  266   WCNPLKQDKRSGCNLEKLRVLPRTLVCISERDILRDRNVEYCEALAKAG  314



>gb|ADE76723.1| unknown [Picea sitchensis]
Length=385

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 115/306 (38%), Positives = 173/306 (57%), Gaps = 30/306 (10%)
 Frame = -2

Query  1111  QNTQISNLQKMSIIVDEAPGYIQVFSDGTVKRFSPEIATASAESTDG--FKSKDVVIDPS  938
             +N   + L +     +E  G+I+V+ DG+V+RFS  ++        G    SKDVV+D  
Sbjct  14    ENITPALLHEAGTAEEELEGFIRVYRDGSVERFSYVVSNVPPSDKPGEPVASKDVVVDAD  73

Query  937   KPITGRIFVPDLWPEKEQVE-LLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvv  761
               +  R+++P    +K++    LP+++YFHGGGF +GS  W  YH F+ RL+ +  SV++
Sbjct  74    TRVWARLYLP---ADKQRGHGKLPLVIYFHGGGFVIGSPAWSIYHAFMCRLACEINSVII  130

Query  760   sVDYRLAPENKLPIAYEDCYAALEWVQKNQKAEPCLES--------------ADLSRVFL  623
             SV YRLAPE++LP AY+DC++A+EWV++       +++               D SR FL
Sbjct  131   SVGYRLAPEHRLPAAYDDCFSAVEWVRRQAAGVRSVQTQNPKEPEESWMTTYCDFSRCFL  190

Query  622   AGDSAGGNIVHQVAKKCLQDGNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMN  443
             AGDSAGGNI H VA +  +       I+G + I P+FG E R+  E      T     + 
Sbjct  191   AGDSAGGNIAHHVAMRAAKTDVKPLHIRGAIIIQPFFGGESRSKWEC----ETSDPALLQ  246

Query  442   ---DMFWRLSLPEGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAE  272
                D+FW+LSLP G+NRD   CN+ N   LS+ + L  P  L+ V+ +D L+ER + Y E
Sbjct  247   KWIDVFWKLSLPVGANRDHPACNVPN--SLSLQDVL-LPPVLLCVSERDVLRERNLEYFE  303

Query  271   FLRRKG  254
              L+R G
Sbjct  304   ALKRAG  309



>gb|KFK25845.1| hypothetical protein AALP_AA8G169600 [Arabis alpina]
Length=345

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 114/281 (41%), Positives = 163/281 (58%), Gaps = 12/281 (4%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPE  893
             +V+E  G I+VF+DG V+R  P + T S       K     I  S  I  R+++PD    
Sbjct  28    VVEEIEGLIKVFNDGCVER-PPIVPTVSPTLHPSAKVTAFDITLSNDIWTRVYIPDAGAS  86

Query  892   KEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAY  713
                   LP+L+YFHGGGFCVGS  W  YH FL  L+V+++ +VVSV+YRLAPE++LP AY
Sbjct  87    PSVT--LPLLVYFHGGGFCVGSAAWSCYHDFLTDLAVKARCIVVSVNYRLAPEHRLPRAY  144

Query  712   EDCYAALEWVQKNQKAEPC--LESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAA---  548
             ED    + W+ K +    C  L   +LS VFLAGDSAG NI +QVA +   + +  +   
Sbjct  145   EDGVNVVSWLVKQKSNGGCSWLSKCNLSNVFLAGDSAGANIAYQVAVRITTNASGKSVNT  204

Query  547   -KIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAM--NDMFWRLSLPEGSNRDFYGCNLE  377
               +KGI+ IHP+FG E RT +E   + S  S++ +  +D +WRL+LP G++RD   CN  
Sbjct  205   LNLKGIILIHPFFGGESRTTSEKQQQHSKSSALTLSASDTYWRLALPRGASRDHPWCNPM  264

Query  376   NDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
              +    + E  + PA +VFVA  D +K+R +     +R  G
Sbjct  265   VNSAGYLRE-AKLPATMVFVAEYDIMKDRNLEICRVMRSHG  304



>ref|XP_010492485.1| PREDICTED: LOW QUALITY PROTEIN: probable carboxylesterase 17 
[Camelina sativa]
Length=342

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 117/289 (40%), Positives = 165/289 (57%), Gaps = 15/289 (5%)
 Frame = -2

Query  1096  SNLQKMSIIVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRI  917
             S+  +   +V+E  G I+VF+DG V+R  P + T S       K+    I  S   + R+
Sbjct  20    SHHHRHGPVVEEIEGLIKVFNDGCVER-PPIVPTVSPTLHPSAKATAFDIKLSNDTSVRV  78

Query  916   FVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAP  737
             +VPD          LP+L+YFHGGGFCVGST W  YH FL  L+V+++ VVVSV+YRLAP
Sbjct  79    YVPDAAASPSVT--LPLLVYFHGGGFCVGSTAWSCYHDFLASLAVKTRCVVVSVNYRLAP  136

Query  736   ENKLPIAYEDCYAALEWVQKNQKAEPCLES----ADLSRVFLAGDSAGGNIVHQVAKKCL  569
             E++LP AY+D    L W+ K Q +     S     +LS VFLAGDSAG NI +QVA +  
Sbjct  137   EHRLPAAYDDGVNVLSWLVKQQISHGGYSSWVSKCNLSNVFLAGDSAGANIAYQVAVRVT  196

Query  568   QDGNC--AAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAM--NDMFWRLSLPEGSNR  401
               G    +  +KGI+ IHP+FG E RT++E     S  S++++  +D +WRL+LP G++R
Sbjct  197   ASGKYVNSLNLKGIVLIHPFFGGESRTSSEKQQHHSKSSALSLPASDTYWRLALPRGASR  256

Query  400   DFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             D   CN      +      + P  LVF+A  D LK+R +     +R  G
Sbjct  257   DHPWCN----PLVMSSAGAKLPTTLVFMAEFDILKDRNLEMCRVMRSHG  301



>ref|XP_007139137.1| hypothetical protein PHAVU_008G004600g [Phaseolus vulgaris]
 gb|ESW11131.1| hypothetical protein PHAVU_008G004600g [Phaseolus vulgaris]
Length=341

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 110/299 (37%), Positives = 172/299 (58%), Gaps = 19/299 (6%)
 Frame = -2

Query  1111  QNTQISNL-QKMSIIVDEAPGYIQVFSDGTVKR--FSPEIATASAESTDGFKSKDVVIDP  941
              N Q++N+ Q+  II +E  G I+V  DG V+R    P +   S+ S  G   KDV+I+ 
Sbjct  8     HNPQVNNISQQREIITEEIQGLIRVHRDGRVERPPIVPSVPCTSS-SERGVTPKDVIINK  66

Query  940   SKPITGRIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvv  761
                +  R++VP         + LP+L+YFHGGGFCVGS  W  YH FL  L+ ++  V++
Sbjct  67    ETNLWARVYVP----LSSHTKPLPLLVYFHGGGFCVGSAAWSCYHEFLTNLASKANCVIL  122

Query  760   sVDYRLAPENKLPIAYEDCYAALEWVQK-----NQKAEPCLESADLSRVFLAGDSAGGNI  596
             SVDY LAPEN+LP+AY+D +  L WV++     +   +  L   D+S +FLAGDSAG NI
Sbjct  123   SVDYHLAPENRLPVAYDDGFKTLMWVKREALNISSAQKWWLNHCDMSSLFLAGDSAGANI  182

Query  595   VHQVAKKCLQDGNCAA---KIKGIMPIHPYFGSERRTAAE--VAAEGSTGSSVAMNDMFW  431
              H VA +     N +     +KG++ I P+FG E RT +E       ++  +++++D +W
Sbjct  183   AHNVATRMGLSSNTSTAPLSLKGVILIQPFFGGEERTNSEKHFLQPPNSALTLSVSDTYW  242

Query  430   RLSLPEGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             RL+LP G+ RD   CN      + + + LR  + +V V+  D L++R + +++ L + G
Sbjct  243   RLALPLGATRDHTYCNPLAHGTVKLRD-LRVSSIMVCVSEMDILRDRNLEFSKALAKAG  300



>gb|KDP32942.1| hypothetical protein JCGZ_12973 [Jatropha curcas]
Length=344

 Score =   184 bits (467),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 167/291 (57%), Gaps = 21/291 (7%)
 Frame = -2

Query  1075  IIVDEAPGYIQVFSDGTVKR--FSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDL  902
             IIV+E  G I+V+ DG V+R    P +  +  +  DG  SKDV+ID    +  RI++P  
Sbjct  21    IIVEEIEGLIKVYRDGRVERPPIIPNVPCSGIQE-DGVTSKDVIIDKFTNLWARIYLPS-  78

Query  901   WPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLP  722
                      LP+L+YFHGGGFCVGS +W  YH FL  L+ ++  +++SV+YRLAPEN+LP
Sbjct  79    ----NTAGRLPLLVYFHGGGFCVGSASWSCYHEFLANLAYKAGCIIMSVNYRLAPENRLP  134

Query  721   IAYEDCYAALEWV-QKNQKAEP----CLESADLSRVFLAGDSAGGNIVHQVAKKC---LQ  566
             +AYED    L WV Q++    P     L   + SR FL+GDSAG NI + VA +    + 
Sbjct  135   VAYEDGINTLMWVKQQSAMGSPEHSWWLNQCNFSRFFLSGDSAGANIAYTVATRLGSNVI  194

Query  565   DGNCAAK---IKGIMPIHPYFGSERRTAAE--VAAEGSTGSSVAMNDMFWRLSLPEGSNR  401
               NC  K   ++G++ I P+FG E RT++E  +    ++  + + +D +WRLSLP G+NR
Sbjct  195   SENCNIKPLCLRGLILIQPFFGGEARTSSEKNLTQPPNSALTSSASDTYWRLSLPFGTNR  254

Query  400   DFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVK  248
             D+  CN   +  ++    L  P+ +V ++  D LK+  + +   L   G K
Sbjct  255   DYPYCNPLANNGVNRMRDLNLPSTMVCISEMDILKDTNLEFCTALTSAGKK  305



>ref|NP_197112.1| carboxyesterase 17 [Arabidopsis thaliana]
 sp|Q9LFR7.1|CXE17_ARATH RecName: Full=Probable carboxylesterase 17; AltName: Full=AtCXE17 
[Arabidopsis thaliana]
 gb|AAK44142.1|AF370327_1 unknown protein [Arabidopsis thaliana]
 emb|CAC01807.1| putative protein [Arabidopsis thaliana]
 gb|AAM44955.1| unknown protein [Arabidopsis thaliana]
 gb|AED92244.1| carboxyesterase 17 [Arabidopsis thaliana]
Length=344

 Score =   184 bits (467),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 114/290 (39%), Positives = 164/290 (57%), Gaps = 16/290 (6%)
 Frame = -2

Query  1096  SNLQKMSIIVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRI  917
             S+  +   +V+E  G I+VF+DG V+R  P +   S       K+    I  S     R+
Sbjct  20    SHHHRHGPVVEEIEGLIKVFNDGCVER-PPIVPIVSPTIHPSSKATAFDIKLSNDTWTRV  78

Query  916   FVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAP  737
             ++PD       V L P+L+YFHGGGFCVGS  W  YH FL  L+V+++ V+VSV+YRLAP
Sbjct  79    YIPDAAAASPSVTL-PLLVYFHGGGFCVGSAAWSCYHDFLTSLAVKARCVIVSVNYRLAP  137

Query  736   ENKLPIAYEDCYAALEWVQKNQKAE-----PCLESADLSRVFLAGDSAGGNIVHQVAKKC  572
             E++LP AY+D    + W+ K Q +        L   +LS VFLAGDSAG NI +QVA + 
Sbjct  138   EHRLPAAYDDGVNVVSWLVKQQISTGGGYPSWLSKCNLSNVFLAGDSAGANIAYQVAVRI  197

Query  571   LQDGNCA--AKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAM--NDMFWRLSLPEGSN  404
             +  G  A    +KGI+ IHP+FG E RT++E     +  S++ +  +D +WRL+LP G++
Sbjct  198   MASGKYANTLHLKGIILIHPFFGGESRTSSEKQQHHTKSSALTLSASDAYWRLALPRGAS  257

Query  403   RDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             RD   CN      L      + P  +VF+A  D LKER +   + +R  G
Sbjct  258   RDHPWCN-----PLMSSAGAKLPTTMVFMAEFDILKERNLEMCKVMRSHG  302



>ref|XP_010453762.1| PREDICTED: probable carboxylesterase 17 [Camelina sativa]
Length=342

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 119/289 (41%), Positives = 164/289 (57%), Gaps = 15/289 (5%)
 Frame = -2

Query  1096  SNLQKMSIIVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRI  917
             S+  +   +V+E  G I+VF+DG V+R  P + T S       K+    I  S   + R+
Sbjct  20    SHHHRHGPVVEEIEGLIKVFNDGCVER-PPIVPTVSPTLHPSTKATAFDIKLSNDTSVRV  78

Query  916   FVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAP  737
             +VPD          LP+L+YFHGGGFCVGST W  YH FL  L+V+++ VVVSV YRLAP
Sbjct  79    YVPDAAASPSVT--LPLLVYFHGGGFCVGSTAWSCYHDFLASLAVKTRCVVVSVKYRLAP  136

Query  736   ENKLPIAYEDCYAALEWVQKNQKAEPCLES----ADLSRVFLAGDSAGGNIVHQVAKKCL  569
             E++LP AY+D    L W+ K Q +     S     +LS VFL GDSAG NI +QVA +  
Sbjct  137   EHRLPAAYDDGVNVLSWLVKQQISHGGYSSWVSKCNLSNVFLVGDSAGANIAYQVAVRVT  196

Query  568   QDGNC--AAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAM--NDMFWRLSLPEGSNR  401
               G    +  +KGI+ IHP+FG E RT++E     S  S++ +  +D +WRL+LP G++R
Sbjct  197   ASGKYVNSLNLKGIILIHPFFGGESRTSSEKQQHHSKSSALTLSASDTYWRLALPRGASR  256

Query  400   DFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             D   CN       SVG   + P  LVF+A  D LK+R +     +R  G
Sbjct  257   DHPWCNPL--VMSSVGA--KLPTTLVFMAEFDILKDRNLEMCRVMRSHG  301



>ref|XP_006400140.1| hypothetical protein EUTSA_v10013981mg [Eutrema salsugineum]
 gb|ESQ41593.1| hypothetical protein EUTSA_v10013981mg [Eutrema salsugineum]
Length=350

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 112/283 (40%), Positives = 159/283 (56%), Gaps = 12/283 (4%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPE  893
             +V+E  G I+VF+DG V+R  P + T S       K     I        R+++PD+   
Sbjct  29    VVEEIEGLIRVFNDGCVER-PPIVPTVSPTVHPSAKVTAFDIKLCNDTWTRVYIPDVAAS  87

Query  892   KEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAY  713
                  L P+L+YFHGGGFCVGS +W  YH FL  L+V+++ VVVSVDYRLAPE++LP AY
Sbjct  88    SPSFTL-PLLVYFHGGGFCVGSASWSCYHDFLTSLAVKARCVVVSVDYRLAPEHRLPAAY  146

Query  712   EDCYAALEWVQKNQKA-----EPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCA-  551
             +D  + + WV K            +   +LS VFLAGDSAG NI +QVA +    G    
Sbjct  147   DDGVSVVSWVLKQHHVSNGGYSSWVSKCNLSNVFLAGDSAGANIAYQVAVRITASGKSVN  206

Query  550   -AKIKGIMPIHPYFGSERRTAAEVAAEGSTGSS---VAMNDMFWRLSLPEGSNRDFYGCN  383
                +KG++ IHP+FG E RT++E   +  + SS   ++ +D +WRL+LP G++RD   CN
Sbjct  207   NLNLKGVILIHPFFGGESRTSSEKKQQQHSKSSALTLSASDTYWRLALPRGASRDHPWCN  266

Query  382   LENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
                   +      R PA +VF+A  D LK+R +     +R  G
Sbjct  267   PLVSSSVGFLREARLPATMVFMAEFDILKDRNLEMCRVMRSLG  309



>ref|XP_002887194.1| hypothetical protein ARALYDRAFT_475988 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63453.1| hypothetical protein ARALYDRAFT_475988 [Arabidopsis lyrata subsp. 
lyrata]
Length=336

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 118/284 (42%), Positives = 162/284 (57%), Gaps = 17/284 (6%)
 Frame = -2

Query  1120  FHPQNTQISNLQKMSIIVDEAPGYIQVFSDGTVKR--FSPEIATASAESTDGFKSKDVVI  947
              +P NT I        +VDE  G I+V+ DG V+R    P +   S     G    DVVI
Sbjct  12    INPNNTNIH-----GPVVDEVEGLIKVYKDGHVERSQLVPCVG-PSLPLELGVACSDVVI  65

Query  946   DPSKPITGRIFVPDLWPEKEQV-ELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsks  770
             D    +  R++VP +   K  V +LLP+++YFHGGGFCVGST+W  YH FL RLS +S+ 
Sbjct  66    DKLNNVWARLYVPMMTTTKSSVSKLLPLIVYFHGGGFCVGSTSWSCYHEFLARLSSRSRC  125

Query  769   vvvsVDYRLAPENKLPIAYEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVH  590
             +V+SVDYRLAPEN LP AYED   A+ W+ K +      +  D  R+FLAGDSAGGNI  
Sbjct  126   MVMSVDYRLAPENPLPAAYEDGVNAILWLNKARNDNLWTKLCDFGRIFLAGDSAGGNIAD  185

Query  589   QVAKKCLQDGNCAAKIKGIMPIHPYFGSERRTAAE--VAAEGSTGSSVAMNDMFWRLSLP  416
             QVA +     +   KI+G + I P++G E RT +E  V    S+  ++  +D +WRLSLP
Sbjct  186   QVAARLASTEDLTLKIEGTILIQPFYGGEERTESEKRVGNNKSSVLTLEGSDAWWRLSLP  245

Query  415   EGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGV  284
              G++R+   C     +  +V   +R    LV VA  D L +R +
Sbjct  246   RGADREHPYCKPVKIKSSTV---IR---TLVCVAEMDLLMDRNM  283



>ref|XP_010420290.1| PREDICTED: probable carboxylesterase 17 [Camelina sativa]
Length=342

 Score =   183 bits (464),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 116/282 (41%), Positives = 162/282 (57%), Gaps = 17/282 (6%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPE  893
             +V+E  G I+VF+DG V+R  P + T S       K+    I  S   + R++VPD    
Sbjct  28    VVEEIEGLIKVFNDGCVER-PPIVPTVSPTLHPSAKATAFDIKLSNDTSVRVYVPDAAAS  86

Query  892   KEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAY  713
                   LP+L+YFHGGGFCVGST W  YH FL  L+V+++ VVVSV+YRLAPE++LP AY
Sbjct  87    PSVT--LPLLVYFHGGGFCVGSTAWSCYHDFLASLAVKTRCVVVSVNYRLAPEHRLPAAY  144

Query  712   EDCYAALEWVQKNQKAEPCLES----ADLSRVFLAGDSAGGNIVHQVAKKCLQDGNC--A  551
             +D  + L W+ K Q +     S     +LS V LAGDSAG NI +QVA +    G    +
Sbjct  145   DDGVSVLSWLVKQQISHGGYSSWVSKCNLSNVLLAGDSAGANIAYQVAVRVTASGKYVNS  204

Query  550   AKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAM--NDMFWRLSLPEGSNRDFYGCNLE  377
               +KGI+ IHP+FG E RT++E     S  S++ +  +D +WRL+LP G++RD   CN  
Sbjct  205   LNLKGIVLIHPFFGGESRTSSEKQQHHSKSSALTLSASDAYWRLALPRGASRDHPWCN--  262

Query  376   NDRELSVGEW-LRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
                 L +     + P  LVF+A  D LK+R +     +R  G
Sbjct  263   ---PLVISSAGAKLPTMLVFMAEFDILKDRNLEMCRVMRSHG  301



>ref|XP_010415489.1| PREDICTED: probable carboxylesterase 6 [Camelina sativa]
Length=339

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 115/284 (40%), Positives = 159/284 (56%), Gaps = 16/284 (6%)
 Frame = -2

Query  1120  FHPQNTQISNLQKMSIIVDEAPGYIQVFSDGTVKRFS--PEIATASAESTDGFKSKDVVI  947
              +P NT I        +VDE  G I+V+ DG V+R    P + T S     G    D+VI
Sbjct  12    INPNNTNIH-----GPVVDEVEGLIRVYKDGHVERTQVVPCVGT-SLPLELGVTCSDIVI  65

Query  946   DPSKPITGRIFVPDLWPE-KEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsks  770
             D    +  R++VP +    K  V  LP+++YFHGGGFC+GS +W  YH FL RLS +S+ 
Sbjct  66    DKLTNVWARLYVPMMTTTTKSSVSKLPLIVYFHGGGFCIGSASWSCYHEFLARLSARSRC  125

Query  769   vvvsVDYRLAPENKLPIAYEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVH  590
             +++SV+YRLAPEN LP AYED   A+ W+ K +      +  D SR+FLAGDSAGGNI H
Sbjct  126   LIMSVNYRLAPENPLPAAYEDGVNAILWLNKARNDTLWAKLCDFSRIFLAGDSAGGNIAH  185

Query  589   QVAKKCLQDGNCAAKIKGIMPIHPYFGSERRTAAE--VAAEGSTGSSVAMNDMFWRLSLP  416
             QVA +         +I+G + I P+FG E RT +E  V     +  +++ +D +WRLSLP
Sbjct  186   QVAARLASTELKPLEIEGAILIQPFFGGEARTESEKRVGNNKRSVLTLSSSDAWWRLSLP  245

Query  415   EGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGV  284
              G+NR+   C     R  +V         LV VA  D L +R +
Sbjct  246   RGANREHPYCKPVKTRSSTV-----MMRTLVCVAEMDLLMDRNM  284



>ref|XP_006826793.1| hypothetical protein AMTR_s00010p00019880 [Amborella trichopoda]
 gb|ERM94030.1| hypothetical protein AMTR_s00010p00019880 [Amborella trichopoda]
Length=336

 Score =   182 bits (462),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 113/284 (40%), Positives = 163/284 (57%), Gaps = 18/284 (6%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPE  893
             ++DE PG I+V+ DG V R+ P +  +      G  S+D  ID    +  R +VP+    
Sbjct  23    VIDEIPGLIRVYKDGHVYRY-PVVQESPCTIETGVSSRDFSIDCG--LWARFYVPN----  75

Query  892   KEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAY  713
               +V+   +L+YFHGGGFCVGS  W  YH FL +L+V+S  V++SV+YRLAPE+ LP AY
Sbjct  76    --RVDKPALLIYFHGGGFCVGSAAWKCYHEFLSKLAVKSGCVIMSVNYRLAPEHPLPAAY  133

Query  712   EDCYAALEWVQKNQKA-----EPC--LESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNC  554
             +D + AL W  +   A     +P   L   D SRVFLAGDSAG NI H V  +   +   
Sbjct  134   DDGFVALTWAIRRVGAGSGADDPSRWLARCDSSRVFLAGDSAGANIAHHVMARHGSEPGS  193

Query  553   AAKIKGIMPIHPYFGSERRTAAE--VAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNL  380
                ++G + I P+FG E RT +E  +     +  ++A +D +WRL+LP  S+RD + CN 
Sbjct  194   RLSLRGTILIQPFFGGEPRTDSEKHLVQPPDSALTLATSDTYWRLALPPDSSRDHFWCNP  253

Query  379   ENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVK  248
              + +     E ++ PA LV V+  D LK+R + Y E LR+ G K
Sbjct  254   LSSKSPLKLEEVKLPAILVCVSENDILKDRDLGYCEGLRKMGKK  297



>emb|CDX69476.1| BnaA10g18250D [Brassica napus]
Length=332

 Score =   181 bits (460),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 113/284 (40%), Positives = 160/284 (56%), Gaps = 15/284 (5%)
 Frame = -2

Query  1096  SNLQKMSIIVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRI  917
             S+  +   IV+E  G I+VF+DG V+R  P + T SA      K     I  S     R+
Sbjct  20    SHNHRHGPIVEEIEGLIKVFNDGCVER-PPIVPTVSATVHPSAKVTAFDIKLSNDTWARV  78

Query  916   FVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAP  737
             ++PD       V L P+L+YFHGGGFCVGS  W  YH FL  L+V+++ V+VSV+YRLAP
Sbjct  79    YIPDAAAFSPSVTL-PLLVYFHGGGFCVGSAAWSCYHDFLTDLAVKARCVIVSVNYRLAP  137

Query  736   ENKLPIAYEDCYAALEWVQK--NQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQD  563
             E++LP AY+D    + W+ K  +      +   DLS VFLAGDSAG N+ +QVA K    
Sbjct  138   EHRLPAAYDDGINVVSWLMKQGSNGGYSWVNKCDLSNVFLAGDSAGANVAYQVALKITNT  197

Query  562   GNCAAKIKGIMPIHPYFGSERRTAAEVAAEG-STGSSVAMNDMFWRLSLPEGSNRDFYGC  386
              N    +KG++ IHP+FG E RT +E      S+  +++ +D +WRL+LP G +RD   C
Sbjct  198   SN----LKGVILIHPFFGGEARTFSEKQQHSKSSALTLSASDTYWRLALPRGVSRDHPWC  253

Query  385   NLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             N        +    R P  +VF+A  D LK+R +   + +R  G
Sbjct  254   NPP------ISSSARLPTTMVFMAEFDILKDRNMEMCKMMRSHG  291



>emb|CDY70129.1| BnaCnng66860D [Brassica napus]
Length=333

 Score =   181 bits (460),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 114/286 (40%), Positives = 163/286 (57%), Gaps = 14/286 (5%)
 Frame = -2

Query  1096  SNLQKMSIIVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRI  917
             S+  +   IV+E  G I+VF+DG V+R  P + T SA      K     I  S     R 
Sbjct  20    SHNHRHGPIVEEIEGLIKVFNDGCVER-PPIVPTVSATVHPSAKVTAFDIKLSNDTWARA  78

Query  916   FVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAP  737
             ++PD       V L P+L+YFHGGGFCVGS  W  YH FL  L+V ++ V+VSV+YRLAP
Sbjct  79    YIPDAAAFSPSVTL-PLLVYFHGGGFCVGSAAWSCYHDFLTDLAVTARCVIVSVNYRLAP  137

Query  736   ENKLPIAYEDCYAALEWVQK--NQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQD  563
             E++LP AY+D    + W+ K  +      +   DLS +FLAGDSAG NI +QVA   L+ 
Sbjct  138   EHRLPAAYDDGVNVVSWLMKQGSNGGYSWVSKCDLSNLFLAGDSAGANIAYQVA---LKI  194

Query  562   GNCAAKIKGIMPIHPYFGSERRTAAEVAAEG-STGSSVAMNDMFWRLSLPEGSNRDFYGC  386
              N +  +KG++ IHP+FG E RT +E   +  S+  +++ +D +WRL+LP G++RD   C
Sbjct  195   TNTSKNLKGVILIHPFFGGEARTFSEKQQQSKSSALTLSASDTYWRLALPRGASRDHPWC  254

Query  385   NLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVK  248
             N        V    R P  +VF+A  D LK+R +   + +R  G +
Sbjct  255   NPL------VSSSARLPTTMVFMAEFDILKDRNMEMCKVMRSHGKR  294



>ref|XP_007046274.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY02106.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=337

 Score =   181 bits (460),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 113/282 (40%), Positives = 156/282 (55%), Gaps = 15/282 (5%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKR--FSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLW  899
             +V+E PG I+V  DG V+R    P ++TA A    G  SKD+VID    +  R +VP   
Sbjct  25    VVEEIPGLIKVSKDGHVERPQIVPNVSTALAPEL-GVTSKDMVIDEFTNVWARFYVP---  80

Query  898   PEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPI  719
                +    LP+++YFHGGGFCVGS  W  YH FL +L+ ++  +++SV+YRLAPEN LP 
Sbjct  81    ---KSNRKLPLVVYFHGGGFCVGSAAWSCYHEFLAKLAAKAGCLIMSVNYRLAPENPLPA  137

Query  718   AYEDCYAALEWVQK---NQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAA  548
             AYED +  L W+++   N   E      + S VFLAGDSAG NI H VA +         
Sbjct  138   AYEDGFKCLTWLKQEAWNGSGEWWSNHCNFSSVFLAGDSAGANIAHNVAARLGSHNPYPL  197

Query  547   KIKGIMPIHPYFGSERRTAAE--VAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLEN  374
              + G + I P+ G E RT +E  +     +  S+A +D +WRL+LP GSNRD   CN   
Sbjct  198   TLNGTILIQPFVGGETRTNSERNMVQSPRSALSLAASDTYWRLALPCGSNRDHPWCNPLG  257

Query  373   DRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVK  248
                  + E +R    LV V+  D LK+R + +   L R G K
Sbjct  258   KGSAKMEE-MRLLPTLVCVSEMDILKDRNLEFCTALGRAGKK  298



>ref|XP_009121518.1| PREDICTED: probable carboxylesterase 17 [Brassica rapa]
Length=358

 Score =   182 bits (461),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 113/284 (40%), Positives = 160/284 (56%), Gaps = 15/284 (5%)
 Frame = -2

Query  1096  SNLQKMSIIVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRI  917
             S+  +   IV+E  G I+VF+DG V+R  P + T SA      K     I  S     R+
Sbjct  46    SHNHRHGPIVEEIEGLIKVFNDGCVER-PPIVPTVSATVHPSAKVTAFDIKLSNDTWARV  104

Query  916   FVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAP  737
             ++PD       V L P+L+YFHGGGFCVGS  W  YH FL  L+V+++ V+VSV+YRLAP
Sbjct  105   YIPDAAAFSPSVTL-PLLVYFHGGGFCVGSAAWSCYHDFLTDLAVKARCVIVSVNYRLAP  163

Query  736   ENKLPIAYEDCYAALEWVQK--NQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQD  563
             E++LP AY+D    + W+ K  +      +   DLS VFLAGDSAG N+ +QVA K    
Sbjct  164   EHRLPAAYDDGINVVSWLMKQGSNGGYSWVNKCDLSNVFLAGDSAGANVAYQVALKITNT  223

Query  562   GNCAAKIKGIMPIHPYFGSERRTAAEVAAEG-STGSSVAMNDMFWRLSLPEGSNRDFYGC  386
              N    +KG++ IHP+FG E RT +E      S+  +++ +D +WRL+LP G +RD   C
Sbjct  224   SN----LKGVILIHPFFGGEARTFSEKQQHSKSSALTLSASDTYWRLALPRGVSRDHPWC  279

Query  385   NLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             N        +    R P  +VF+A  D LK+R +   + +R  G
Sbjct  280   NPP------ISSSARLPTTMVFMAEFDILKDRNMEMCKMMRSHG  317



>gb|AAM65164.1| unknown [Arabidopsis thaliana]
Length=344

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 112/290 (39%), Positives = 163/290 (56%), Gaps = 16/290 (6%)
 Frame = -2

Query  1096  SNLQKMSIIVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRI  917
             S+  +   +V+E  G I+VF+DG V+R  P +   S       K+    I  S     R+
Sbjct  20    SHHHRHGPVVEEIEGLIKVFNDGCVER-PPIVPIVSPTIHPSSKATAFDIKLSNDTWTRV  78

Query  916   FVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAP  737
             ++PD       V L P+L+YFHGGGFCVGS  W  YH FL  L+V+++ V+VSV+YRLAP
Sbjct  79    YIPDAAAASPSVTL-PLLVYFHGGGFCVGSAAWSCYHDFLTSLAVKARCVIVSVNYRLAP  137

Query  736   ENKLPIAYEDCYAALEWVQKNQKAE-----PCLESADLSRVFLAGDSAGGNIVHQVAKKC  572
             E++LP AY+D    + W+ K   +        +   +LS VFLAGDSAG NI +QVA + 
Sbjct  138   EHRLPAAYDDGVNVVSWLIKQHISTGGGYPSWVSKCNLSNVFLAGDSAGANIAYQVAVRI  197

Query  571   LQDGNCA--AKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAM--NDMFWRLSLPEGSN  404
             +  G  A    +KGI+ IHP+FG E RT++E     +  S++ +  +D +WRL+LP G++
Sbjct  198   MASGKYANTLHLKGIILIHPFFGGESRTSSEKQQHHTKSSALTLSASDAYWRLALPRGAS  257

Query  403   RDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             RD   CN      L      + P  +VF+A  D LKER +   + +R  G
Sbjct  258   RDHPWCN-----PLMSSAGAKLPTTMVFMAEFDILKERNLEMCKVMRSHG  302



>ref|XP_006290116.1| hypothetical protein CARUB_v10003763mg [Capsella rubella]
 gb|EOA23014.1| hypothetical protein CARUB_v10003763mg [Capsella rubella]
Length=343

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 114/290 (39%), Positives = 165/290 (57%), Gaps = 17/290 (6%)
 Frame = -2

Query  1096  SNLQKMSIIVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRI  917
             S+  +   +V+E  G I+VF+DG V+R  P + T S       K+    I  S     R+
Sbjct  20    SHHHRHGPVVEEIEGLIKVFNDGCVER-PPIVPTVSPTLHPSAKATAFDIKLSNDTLIRV  78

Query  916   FVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAP  737
             ++P+          LP+L+YFHGGGFCVGST W  YH FL  L+V+++ VVVSV+YRLAP
Sbjct  79    YIPEAVASPSVT--LPLLVYFHGGGFCVGSTAWSCYHDFLTSLAVKTRCVVVSVNYRLAP  136

Query  736   ENKLPIAYEDCYAALEWVQKNQKAEPCLES----ADLSRVFLAGDSAGGNIVHQVAKKCL  569
             E++LP AY+D    + W+ K   +     S     +LS VFLAGDSAG NI +QVA +  
Sbjct  137   EHRLPAAYDDGVNVVSWLVKQHISHGGYSSWVSKCNLSNVFLAGDSAGANIAYQVAVRIT  196

Query  568   QDGNCA--AKIKGIMPIHPYFGSERRTAAEVAAEGSTGSS---VAMNDMFWRLSLPEGSN  404
               G  A    +KG++ IHP+FG E RT++E   +  + SS   ++ +D +WRL+LP G++
Sbjct  197   ASGRYANSLNLKGVILIHPFFGGESRTSSEKQQQHHSKSSALTLSASDAYWRLALPRGAS  256

Query  403   RDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             RD   CN      L     ++ P  LVF+A  D LK+R +   + +R  G
Sbjct  257   RDHPWCN-----PLVGSTGVKLPTTLVFMAEFDILKDRNLEMCKVMRSHG  301



>gb|ABK22844.1| unknown [Picea sitchensis]
Length=319

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 117/319 (37%), Positives = 179/319 (56%), Gaps = 13/319 (4%)
 Frame = -2

Query  1078  SIIVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLW  899
             + +V++  G +QV+S+GT+ R       A  E      SKDVV +PS  +  R+++P L 
Sbjct  3     ATVVEDCRGVLQVYSNGTITRSQKPSFVAPFEDDGRVLSKDVVFEPSLGLELRLYIPALV  62

Query  898   PEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPI  719
                +    LP+ +YFHGGGFC+GS TW  +H +  RL+    ++VV+ DYRL PE++LP 
Sbjct  63    VTTK----LPIFVYFHGGGFCIGSRTWPNFHNYCLRLAASLNAIVVAPDYRLGPEHRLPD  118

Query  718   AYEDCYAALEWVQKNQKA------EPCL-ESADLSRVFLAGDSAGGNIVHQVAKKCLQDG  560
             A +D + AL W++    A      EP L + AD +RV+++GDSAGG+I H V+ +   + 
Sbjct  119   ALDDGFWALRWIRAQAAAAGSSAAEPWLADHADFARVYVSGDSAGGSIAHHVSVRAQSED  178

Query  559   NCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNL  380
                 KIKG + +  ++G E R  +E         ++ +ND FWRLSLP G+NRD   CN 
Sbjct  179   WGQMKIKGYVHLMAFYGGEDRKPSEAMCPTDARLNLELNDRFWRLSLPVGANRDHPICNP  238

Query  379   ENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhv  200
                    +   +  P  LV   G+D L++R + YAE L+  G K VE+   EEE H F  
Sbjct  239   LAPGAPCLSN-VALPPVLVVAGGRDLLRDREIEYAEVLKSSG-KEVELAVFEEEEHGFFT  296

Query  199   fHPDSEATRLLQKQMSEFI  143
               P+S A+  L +++ +F+
Sbjct  297   LTPNSPASGRLMERIIQFM  315



>ref|XP_010681590.1| PREDICTED: probable carboxylesterase 6 [Beta vulgaris subsp. 
vulgaris]
Length=355

 Score =   180 bits (456),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 113/290 (39%), Positives = 163/290 (56%), Gaps = 19/290 (7%)
 Frame = -2

Query  1111  QNTQISNLQKMSIIVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFK--SKDVVIDPS  938
             QN  + +      I++E  G I+++ DG V+R    ++  S       +  ++DV ID  
Sbjct  16    QNLGLKSDDDRGSIIEEIKGLIKLYKDGYVERSLKAMSCVSPFLAPDLQVNARDVFIDKI  75

Query  937   KPITGRIFVP-----DLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsk  773
               I  R++VP     D          LP+++YFHGGGFCVGST W  YH FLG L+ +++
Sbjct  76    TNIWARVYVPKCNNQDYTNSNNNNNKLPIIVYFHGGGFCVGSTAWKSYHNFLGNLASKAR  135

Query  772   svvvsVDYRLAPENKLPIAYEDCYAALEWVQKN----QKAEPCLESADLSRVFLAGDSAG  605
              V+VSV+YRLAPE+ LP AYED   AL WV++     Q +E   + +D S +FLAGDS+G
Sbjct  136   CVIVSVNYRLAPEDPLPAAYEDGMKALMWVKQQETMGQNSEFWAKYSDFSSIFLAGDSSG  195

Query  604   GNIVHQVAKKCLQDGNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGS--SVAMNDMFW  431
              N+ + VA K     N    +KGI+ + P+FG E RT +E+    S  S  S+A ND +W
Sbjct  196   ANLAYNVALKLGTSHNMPLIVKGIILVQPFFGGEERTNSELIRVQSCKSALSLAANDTYW  255

Query  430   RLSLPEGSNRDFYGCN-LENDRELSVGEWLRFPAALVFVAGKDFLKERGV  284
             RL+LP G+NRD   CN L  D +      L     +V +A KD L++R +
Sbjct  256   RLALPSGANRDHPWCNSLRKDTKK-----LENMRVMVCIAEKDILRDRNL  300



>ref|XP_010032629.1| PREDICTED: probable carboxylesterase 17 [Eucalyptus grandis]
 gb|KCW52055.1| hypothetical protein EUGRSUZ_J01495 [Eucalyptus grandis]
Length=341

 Score =   179 bits (455),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 116/299 (39%), Positives = 168/299 (56%), Gaps = 33/299 (11%)
 Frame = -2

Query  1096  SNLQKMSIIVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKS--KDVVIDPSKPITG  923
             S+ Q+ S++++E  G I+V+ DG V+RF P I + S     G  +  +DV ID    +  
Sbjct  17    SHQQQQSLVLEEIEGLIRVYKDGRVERF-PIIPSVSCTIFSGVDTHARDVTIDKFTNLWA  75

Query  922   RIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRL  743
             R++VP+  P K      P+L+YFHGGGFCVGS  W  YH FL  L+  +  V+VSV+YRL
Sbjct  76    RVYVPNR-PGK-----YPLLVYFHGGGFCVGSAAWSCYHEFLANLASTASCVIVSVNYRL  129

Query  742   APENKLPIAYEDCYAALEWVQK-----NQKAEPCLESADLSRVFLAGDSAGGNIVHQVAK  578
             APEN+LP AYED   A+ W+++     + + +  +   +LS  FL GDSAG NI   VA 
Sbjct  130   APENRLPAAYEDGVNAIMWLKRQVANGSDEHKWWVSQCNLSNFFLVGDSAGANIAFNVA-  188

Query  577   KCLQDGNCAAKI---------KGIMPIHPYFGSERRTAAEVAAEGSTGSSVAM--NDMFW  431
               +Q GN +A +         KG++ I P+FG E RT +E  A     S++ +  +D +W
Sbjct  189   --VQLGNISASVSNAIKPLHLKGVILIQPFFGGEIRTGSEKMASQPPNSALTLSASDTYW  246

Query  430   RLSLPEGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             RLSLP G+NRD   CN  ++R  S       P+A+V ++  D LK+R       L   G
Sbjct  247   RLSLPSGANRDHPWCNPLSNRINS-----SIPSAMVCISELDILKDRNSQLCNALANMG  300



>ref|XP_010470815.1| PREDICTED: probable carboxylesterase 6 [Camelina sativa]
Length=339

 Score =   179 bits (454),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 109/268 (41%), Positives = 154/268 (57%), Gaps = 11/268 (4%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFS--PEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLW  899
             +VDE  G I+V+ DG V+R    P + T S     G    D+VID    +  R++VP + 
Sbjct  23    VVDEVEGLIKVYKDGHVERTQVVPCVGT-SLPLELGVACSDIVIDKLTNVRARLYVPMMT  81

Query  898   PE-KEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLP  722
                K  V  LP+++YFHGGGFC+GS++W  YH FL RLS +S+ +++SV+YRLAPEN LP
Sbjct  82    TTTKSSVSKLPLIVYFHGGGFCIGSSSWSCYHEFLARLSARSRCLIMSVNYRLAPENPLP  141

Query  721   IAYEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKI  542
              AYED   A+ W+ K +      +  D  R+FLAGDSAGGNI HQVA +         +I
Sbjct  142   AAYEDGVNAILWLNKARNDTLWAKLCDFDRIFLAGDSAGGNIAHQVAARLASTELKPLEI  201

Query  541   KGIMPIHPYFGSERRTAAE--VAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDR  368
             +G + I P+FG E RT +E  V     +  +++ +D +WRLSLP G+NR+   C     +
Sbjct  202   EGAILIQPFFGGEARTESEKRVGNNKRSVLTLSSSDAWWRLSLPRGANREHPYCKPVKTK  261

Query  367   ELSVGEWLRFPAALVFVAGKDFLKERGV  284
               +V         LV VA  D L +R +
Sbjct  262   SSTV-----MMRTLVCVAEMDLLMDRNM  284



>ref|XP_009618563.1| PREDICTED: probable carboxylesterase 6 [Nicotiana tomentosiformis]
Length=351

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 112/296 (38%), Positives = 162/296 (55%), Gaps = 24/296 (8%)
 Frame = -2

Query  1093  NLQKMS-------IIVDEAPGYIQVFSDGTVKRFS--PEIATASAESTDGFKSKDVVIDP  941
             +LQK+S       ++V+E  G I+V+ DG V+R    P + T       G  S DV+ID 
Sbjct  16    SLQKISKEKSQHRVLVEEIEGLIKVYKDGHVERLPIVPNVTTTLPLEL-GVISSDVIIDS  74

Query  940   SKPITGRIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvv  761
                I  R++VP L  EK      P+L+YFHGGGFCVGS +W+ YH FL +L+  +  V++
Sbjct  75    FTNIWARLYVPKLCQEKS-----PLLIYFHGGGFCVGSVSWICYHEFLAKLAANANCVIM  129

Query  760   sVDYRLAPENKLPIAYEDCYAALEWVQKNQKAEPC-----LESADLSRVFLAGDSAGGNI  596
             SV+YRLAPEN+LP AY+D    + W++    +        L   + S +F  GDSAGGNI
Sbjct  130   SVNYRLAPENRLPAAYDDGVKTIMWLKHKVISGANEDYWWLSKINFSSIFFGGDSAGGNI  189

Query  595   VHQVAKK-CLQDGNCA-AKIKGIMPIHPYFGSERRTAAE--VAAEGSTGSSVAMNDMFWR  428
              H VAK+ C +  +     +KG + I P+FG E RT +E   A    +   +A  D +WR
Sbjct  190   AHNVAKRVCSKSHDLKPLTLKGTILIQPFFGGESRTYSEKYTAQPPRSALMLASADTYWR  249

Query  427   LSLPEGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRR  260
             L+LP G+NRD   CN       ++ +    P  LV ++  D LK+R + +   L R
Sbjct  250   LALPAGANRDHPWCNPAAKECQNLVDLRDIPGILVCISELDILKDRNLEFCATLNR  305



>ref|XP_002873755.1| hypothetical protein ARALYDRAFT_488458 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50014.1| hypothetical protein ARALYDRAFT_488458 [Arabidopsis lyrata subsp. 
lyrata]
Length=343

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 113/289 (39%), Positives = 161/289 (56%), Gaps = 14/289 (5%)
 Frame = -2

Query  1096  SNLQKMSIIVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRI  917
             S+  +   +V+E  G I+VF+DG V+R  P + T S       K+    I  S     R+
Sbjct  20    SHHHRHGPVVEEIEGLIKVFNDGCVER-PPIVPTVSPTLHPSAKATAFDIKLSNDTWTRV  78

Query  916   FVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAP  737
             ++PD       V L P+L+YFHGGGFCVGS  W  YH FL  L+VQ++ VVVSV+YRLAP
Sbjct  79    YIPDAAAASPSVTL-PLLVYFHGGGFCVGSAAWSCYHDFLTSLAVQARCVVVSVNYRLAP  137

Query  736   ENKLPIAYEDCYAALEWVQKNQKAE----PCLESADLSRVFLAGDSAGGNIVHQVAKKCL  569
             E++LP AY+D    + W+ K Q +       +   +LS V+LAGDSAG NI +QVA +  
Sbjct  138   EHRLPAAYDDGVNVVTWLVKQQISNGGYPSWVSKCNLSNVYLAGDSAGANIAYQVAVRIT  197

Query  568   QDGN--CAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAM--NDMFWRLSLPEGSNR  401
               G       +KGI+ IHP+FG E RT++E     S  S++ +  +D +WRL+LP G++R
Sbjct  198   ASGKYVNTPNLKGIILIHPFFGGESRTSSEKQQHHSKSSALTLSASDAYWRLALPRGASR  257

Query  400   DFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             D   CN               P  +VF+A  D LK+R +   + +R  G
Sbjct  258   DHPWCNPLGSSTAGA----ELPTTMVFMAEFDILKDRNLEMCKVMRSHG  302



>ref|XP_004297130.1| PREDICTED: probable carboxylesterase 6-like [Fragaria vesca subsp. 
vesca]
Length=367

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 112/307 (36%), Positives = 167/307 (54%), Gaps = 23/307 (7%)
 Frame = -2

Query  1111  QNTQISNLQKMSIIVDEAPGYIQVFSDGTVKR--FSPEIATASAESTDGFKSKDVVIDPS  938
              NT   + Q+ + +++E  G I+V+ DG V+R    P +   +A+   G  S D+VID  
Sbjct  25    NNTVDHHQQQENFVIEEIEGLIRVYKDGRVERPQIVPCVTAGAADPELGVTSMDIVIDRF  84

Query  937   KPITGRIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvs  758
               ++ R +VP        ++ LP+L+YFHGGGFCVGS  W  YH FL +L+ ++  +++S
Sbjct  85    TNVSSRFYVPIRRDMNNPMKKLPLLVYFHGGGFCVGSAAWSCYHEFLAKLAAKAGCIIMS  144

Query  757   VDYRLAPENKLPIAYEDCYAALEWVQKNQKAEPCLE---------SADLSRVFLAGDSAG  605
             V+YRLAPE+ LP AYED   +L W+++    E   E           D SR+FL GDSAG
Sbjct  145   VNYRLAPEHPLPAAYEDGLRSLVWLKQEASCERGGEEESNQWWSTQCDFSRIFLVGDSAG  204

Query  604   GNIVHQVAKK--CLQDGNCAAKIKGIMPIHPYFGSERRTAAE-----VAAEGSTGSSVAM  446
              NI H V++K  C +       IKG++ + P+FG E RT++E     V     +  ++A 
Sbjct  205   ANIAHNVSRKLLCSETFLLPLIIKGVILVQPFFGGEDRTSSEKNHDMVQPRRRSVLNLAA  264

Query  445   NDMFWRLSLPEGSNRDFYGCN-LENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEF  269
             +D +WRL+LP GSNRD   CN L N             A +V ++  D LK+R   +   
Sbjct  265   SDTYWRLALPAGSNRDHPWCNPLANGSCFGSDS----VAMMVCISELDILKDREFEFCGA  320

Query  268   LRRKGVK  248
             + R G K
Sbjct  321   MVRAGKK  327



>ref|NP_564936.1| probable carboxylesterase 6 [Arabidopsis thaliana]
 sp|Q9SX25.1|CXE6_ARATH RecName: Full=Probable carboxylesterase 6; AltName: Full=AtCXE6 
[Arabidopsis thaliana]
 gb|AAD49980.1|AC008075_13 Similar to gb|AF110333 PrMC3 protein from Pinus radiata and is 
a member of PF|00135 Carboxylesterases family. EST gb|N37841 
comes from this gene [Arabidopsis thaliana]
 gb|AAK43966.1|AF370151_1 unknown protein [Arabidopsis thaliana]
 gb|AAK59842.1| At1g68620/F24J5_21 [Arabidopsis thaliana]
 gb|AAL15199.1| unknown protein [Arabidopsis thaliana]
 gb|AEE34820.1| probable carboxylesterase 6 [Arabidopsis thaliana]
Length=336

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 105/248 (42%), Positives = 146/248 (59%), Gaps = 6/248 (2%)
 Frame = -2

Query  1117  HPQNTQISNLQKMSIIVDEAPGYIQVFSDGTVKR--FSPEIATASAESTDGFKSKDVVID  944
             H   T  +N      +VDE  G I+V+ DG V+R    P +   S     G    DVVID
Sbjct  8     HVTTTNPNNSNIHGPVVDEVEGLIKVYKDGHVERSQLLPCV-DPSLPLELGVTCSDVVID  66

Query  943   PSKPITGRIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvv  764
                 +  R++VP +   K  V  LP+++YFHGGGFCVGS +W+ YH FL RLS +S+ +V
Sbjct  67    KLTNVWARLYVP-MTTTKSSVSKLPLIVYFHGGGFCVGSASWLCYHEFLARLSARSRCLV  125

Query  763   vsVDYRLAPENKLPIAYEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQV  584
             +SV+YRLAPEN LP AYED   A+ W+ K +      +  D  R+FLAGDSAGGNI  QV
Sbjct  126   MSVNYRLAPENPLPAAYEDGVNAILWLNKARNDNLWAKQCDFGRIFLAGDSAGGNIAQQV  185

Query  583   AKKCLQDGNCAAKIKGIMPIHPYFGSERRTAAE--VAAEGSTGSSVAMNDMFWRLSLPEG  410
             A +     + A KI+G + I P++  E RT +E  V  + +   ++A +D +WR+SLP G
Sbjct  186   AARLASPEDLALKIEGTILIQPFYSGEERTESERRVGNDKTAVLTLASSDAWWRMSLPRG  245

Query  409   SNRDFYGC  386
             +NR+   C
Sbjct  246   ANREHPYC  253



>ref|XP_006391117.1| hypothetical protein EUTSA_v10019529mg [Eutrema salsugineum]
 gb|ESQ28403.1| hypothetical protein EUTSA_v10019529mg [Eutrema salsugineum]
Length=336

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 116/284 (41%), Positives = 157/284 (55%), Gaps = 21/284 (7%)
 Frame = -2

Query  1120  FHPQNTQISNLQKMSIIVDEAPGYIQVFSDGTVKR--FSPEIATASAESTDGFKSKDVVI  947
              +P NT I +      +VDE  G I+V++DG V+R  F P +   S     G    DV I
Sbjct  12    INPNNTNIDH----GPVVDELDGLIRVYTDGHVERPQFEPCVG-PSLPLELGVACSDVHI  66

Query  946   DPSKPITGRIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksv  767
             D    +  R++VP L   K  V  LP+L+YFHGGGFC+GS +W  YH FL RLS  S+ +
Sbjct  67    DKLTNVWARLYVPML--TKTSVSKLPLLVYFHGGGFCIGSASWSCYHQFLARLSASSRCL  124

Query  766   vvsVDYRLAPENKLPIAYEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQ  587
             V+SV+YRLAPEN LP AYED   A+ W+ K +      +  D  ++FLAGDSAGGNI + 
Sbjct  125   VMSVNYRLAPENPLPAAYEDGVNAVLWLNKTRNDNLWSKLCDFGKIFLAGDSAGGNIANH  184

Query  586   VAKKCLQDGNCAA--KIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAM---NDMFWRLS  422
             VA +     +     KI+G + I P+FG E RT +E   E +  SSV     +D +WRL+
Sbjct  185   VAARLAASDDLIKPLKIEGTILIQPFFGGEARTESERRVENNMKSSVLTLEGSDAWWRLA  244

Query  421   LPEGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKER  290
             LP G+NR+   C         V   ++    LV VA  D L +R
Sbjct  245   LPRGANREHPYCK-------PVKTMIKMVRTLVCVAEMDVLMDR  281



>ref|XP_006437705.1| hypothetical protein CICLE_v10031957mg [Citrus clementina]
 ref|XP_006484433.1| PREDICTED: probable carboxylesterase 6-like [Citrus sinensis]
 gb|ESR50945.1| hypothetical protein CICLE_v10031957mg [Citrus clementina]
 gb|KDO70030.1| hypothetical protein CISIN_1g039669mg [Citrus sinensis]
Length=351

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 117/296 (40%), Positives = 159/296 (54%), Gaps = 24/296 (8%)
 Frame = -2

Query  1093  NLQKMSIIVDEAPGYIQVFSDGTVKRFSPEIATASAESTD-GFKSKDVVIDPSKPITGRI  917
             NL     ++DE  G I+V+ DG V+R         A + D G  S+D+VID    I    
Sbjct  17    NLNPQGAVIDEIEGLIRVYKDGHVERLPIVPCVTCALAPDMGVTSRDIVIDKFTNIWALF  76

Query  916   FVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAP  737
             +VP L     Q   LP+L+YFHGGGFCVGS  W  YH FL  L+ ++  +++SV+YRLAP
Sbjct  77    YVPILC----QSTKLPLLVYFHGGGFCVGSAAWSCYHEFLATLAKKAGCIIMSVNYRLAP  132

Query  736   ENKLPIAYEDCYAALEWVQKNQKAEPCLESAD-------LSRVFLAGDSAGGNIVHQVAK  578
             EN LP AYED + +L W+ K Q    C  S D        S +FLAGDSAG NI H VA 
Sbjct  133   ENPLPAAYEDGFTSLMWL-KQQATSSCGGSVDWLSRQCNFSSIFLAGDSAGANIAHNVAL  191

Query  577   KCLQDGNCAAKI-----KGIMPIHPYFGSERRTAAE--VAAEGSTGSSVAMNDMFWRLSL  419
             +     N  A +     KG + I P+FG E RT +E  +A    +  S+A +D +WRL+L
Sbjct  192   RLGNSNNKVATLKPLTFKGTILIQPFFGGEARTNSEKYLAQPPRSALSLAASDTYWRLAL  251

Query  418   PEGSNRDFYGCNLENDRELSVGEW---LRFPAALVFVAGKDFLKERGVMYAEFLRR  260
             P GSNRD    N  +     + ++   L  P  LV ++  D LK+R + +   L R
Sbjct  252   PRGSNRDHPWSNPMSKGSTELEQYCGLLPLP-TLVCISEMDILKDRNLEFCSALGR  306



>ref|XP_011070822.1| PREDICTED: probable carboxylesterase 6 [Sesamum indicum]
Length=336

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 113/285 (40%), Positives = 163/285 (57%), Gaps = 25/285 (9%)
 Frame = -2

Query  1075  IIVDEAPGYIQVFSDGTVKR--FSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDL  902
             ++V E  G I+V+ DG V+R    P +A + A    G   +D++ID    +  R++VP+ 
Sbjct  29    VVVAEIDGLIRVYKDGHVERPQIVPSVACSLAPEL-GVTCRDMIIDKCTNVLARLYVPN-  86

Query  901   WPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLP  722
                 +++ L P+++YFHGGGFCVGS +W  YH FL +L+ +    VVSV+YRLAPEN LP
Sbjct  87    ---TDRLRL-PLMVYFHGGGFCVGSASWSCYHEFLAKLASRLSCAVVSVNYRLAPENPLP  142

Query  721   IAYEDCYAALEWVQKNQKAEPC----LESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNC  554
              AY+D   AL W+ + Q   P         D S +FLAGDSAG NI + VA    +    
Sbjct  143   AAYDDGVKALVWLTQ-QNFVPSNDWWTSKCDFSSIFLAGDSAGANIAYNVALSVSR----  197

Query  553   AAKIKGIMPIHPYFGSERRTAAE--VAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNL  380
               +IKG++ I P+FG ERRT +E        +  ++A +D +WRLSLP G+NRD   CN 
Sbjct  198   VLEIKGLVLIQPFFGGERRTHSEKYTVQPPRSALTLAASDTYWRLSLPSGANRDHPWCN-  256

Query  379   ENDRELSVG-EWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVK  248
                  ++ G E LR    +V ++  D L++R +     LR KGVK
Sbjct  257   ----PVAKGAEELRNLRVMVCISEMDILRDRNLELCANLRSKGVK  297



>ref|XP_010263304.1| PREDICTED: probable carboxylesterase 17 [Nelumbo nucifera]
Length=347

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 112/296 (38%), Positives = 167/296 (56%), Gaps = 23/296 (8%)
 Frame = -2

Query  1087  QKMSIIVDEAPGYIQVFSDGTVKR--FSPEIATASAESTDGFKSKDVVIDPSKPITGRIF  914
             ++  I+ DE  G I V+ DG ++R    P +A   A       S+DV+I+    +  R +
Sbjct  19    RQHGIVTDEIEGIITVYKDGHLERPLVVPNVACTVAPQPH-VTSRDVIINKVSNVWARFY  77

Query  913   VPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPE  734
             VP    +      LP+L+YFHGGGFCVGS  W  YH FL  L+ ++  +++SV+YRLAPE
Sbjct  78    VPRCQRK------LPLLVYFHGGGFCVGSAAWKCYHEFLANLASRAGCLIMSVNYRLAPE  131

Query  733   NKLPIAYEDCYAALEWVQKNQKAEPCLE------SADLSRVFLAGDSAGGNIVHQVAKKC  572
             N+LP AYED   AL WV++        +        + S+VFLAGDSAG NI H VA + 
Sbjct  132   NRLPAAYEDGCNALLWVKQQASDGSSTDQRWWWSQCNFSKVFLAGDSAGANIAHNVATRL  191

Query  571   ---LQDGNCAAK---IKGIMPIHPYFGSERRTAAEV-AAEGSTGS-SVAMNDMFWRLSLP  416
                    + A+K   +KG + I P+FG E RT +E+  A+ ST + S+  +D++WRL+LP
Sbjct  192   GSFESSESMASKPFCLKGTILIQPFFGGEGRTHSELYTAQPSTSALSLTASDVYWRLALP  251

Query  415   EGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVK  248
              G+NRD   CN   +   ++ E  R P  +VF++  D LK+R + +   + + G K
Sbjct  252   VGANRDHPWCNPLVNNGSAMLETSRIPPTMVFISEMDILKDRNLEFCSAMIKAGNK  307



>ref|XP_006302519.1| hypothetical protein CARUB_v10020617mg [Capsella rubella]
 gb|EOA35417.1| hypothetical protein CARUB_v10020617mg [Capsella rubella]
Length=336

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 110/281 (39%), Positives = 159/281 (57%), Gaps = 15/281 (5%)
 Frame = -2

Query  1117  HPQNTQISNLQKMSIIVDEAPGYIQVFSDGTVKRFS--PEIATASAESTDGFKSKDVVID  944
             HP NT I        +VDE  G I+V+ DG V+R S  P + T S     G    DVV+D
Sbjct  14    HPNNTIIHG-----PVVDEVEGLIRVYKDGHVERCSVVPCVDT-SLPLELGVACSDVVLD  67

Query  943   PSKPITGRIFVPDLWPE-KEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksv  767
                 + GR++VP +    K  V  LP+++YFHGGGFC+GS +W  YH F+ RLS +++ +
Sbjct  68    KLTNVWGRLYVPMMTASTKSSVSKLPLIVYFHGGGFCIGSASWSCYHEFVARLSARTQCL  127

Query  766   vvsVDYRLAPENKLPIAYEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQ  587
             V+SV+YRLAPEN LP AYED   A+ W++K +      +  D  ++FLAGDSAGGNI H 
Sbjct  128   VLSVNYRLAPENPLPAAYEDGVNAILWLKKARNGNLWAKLCDFDKIFLAGDSAGGNIAHH  187

Query  586   VAKKCLQDGNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGS  407
             VA +         +I+G + I P+FG E RT +E      +  +++ +D +WR+SLP G+
Sbjct  188   VAARLASTELKPLEIQGTILIQPFFGGEARTESERRVGNKSMLTLSSSDTWWRMSLPRGA  247

Query  406   NRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGV  284
             +R+   C     +  +V         LV VA  D L +R +
Sbjct  248   DREHPYCKPVKPKSSTVMR------TLVCVAEMDPLMDRNM  282



>ref|XP_009766513.1| PREDICTED: probable carboxylesterase 6 [Nicotiana sylvestris]
Length=353

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 106/283 (37%), Positives = 159/283 (56%), Gaps = 17/283 (6%)
 Frame = -2

Query  1075  IIVDEAPGYIQVFSDGTVKRFS--PEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDL  902
             ++++E  G I+V+ DG V+RF   P + T       G  S DV+ID    I  R++VP L
Sbjct  29    VLIEEIEGLIKVYKDGHVERFPIVPNVTTTLPLEL-GVISNDVIIDSFTNIWARLYVPKL  87

Query  901   WPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLP  722
               EK      P+L+YFHGGGFCVGS +W+ YH FL +L+ ++  V++SV+YRLAPEN+LP
Sbjct  88    CQEK-----FPLLIYFHGGGFCVGSASWICYHEFLAKLAAKANCVIMSVNYRLAPENRLP  142

Query  721   IAYEDCYAALEWVQK-----NQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKK-CLQDG  560
              AY+D    + W+++     + +    L   + S +F  GDSAGGNI H V K+ C +  
Sbjct  143   AAYDDGVKTIMWLREKVISGDNEDHWWLSKVNFSSIFFGGDSAGGNIAHNVVKRVCSKSH  202

Query  559   NCAA-KIKGIMPIHPYFGSERRTAAEVAAEGSTGSSV--AMNDMFWRLSLPEGSNRDFYG  389
             +     +KG + + P+FG E RT +E        S++  A  D +WRL+LP G+NRD   
Sbjct  203   DLKPLTLKGTILLQPFFGGELRTYSEKYTAQPPRSALISASADTYWRLALPSGANRDHPW  262

Query  388   CNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRR  260
             CN       ++ +    P  LV ++  D LK+R + +   L R
Sbjct  263   CNPATKECQNLVDLRDIPGILVCISELDILKDRNLEFCATLNR  305



>ref|XP_007033296.1| Carboxyesterase 17 [Theobroma cacao]
 gb|EOY04222.1| Carboxyesterase 17 [Theobroma cacao]
Length=344

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 115/302 (38%), Positives = 165/302 (55%), Gaps = 22/302 (7%)
 Frame = -2

Query  1120  FHPQ-NTQISNLQKMSIIVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVID  944
             F P+ N Q+   +   ++V+E  G I+V+ +G V+R  P I    +  T G  SKDVVID
Sbjct  11    FDPRLNVQVGQ-KNHGVVVEEIEGLIRVYKNGHVER-PPIIPIVPSTVTGGVISKDVVID  68

Query  943   PSKPITGRIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvv  764
                    RI+ P    +      +P+L+YFHGGGFCVGS  W  YH FL  L+ ++  ++
Sbjct  69    KFTSSWTRIYAPSYSSK------MPLLVYFHGGGFCVGSAAWSCYHEFLSALASKAGCII  122

Query  763   vsVDYRLAPENKLPIAYEDCYAALEWVQK---NQKAEP--CLESADLSRVFLAGDSAGGN  599
              SV+YR APEN+LP AY+D    L W+++   N  +E    L   D S +FL GDSAG N
Sbjct  123   FSVNYRQAPENRLPAAYDDGINTLMWLKQQALNGSSEHKWWLSQCDFSSLFLGGDSAGAN  182

Query  598   IVHQVAKKCLQDGNCAAK-----IKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMN--D  440
             I + VA +    G   +      +KG + I P+FG E RTA+E+ A     S++ ++  D
Sbjct  183   IAYNVATRLGSYGTSDSSFKPLVLKGTILIQPFFGGEARTASEMQATQPASSALTLSAYD  242

Query  439   MFWRLSLPEGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRR  260
              +WRLSLP G+NRD   CN        + E LR PA +V ++  D LK+R + +   L  
Sbjct  243   TYWRLSLPLGANRDHPWCNPLAKGAAKLRE-LRLPATMVCISEMDILKDRNLEFCNALAS  301

Query  259   KG  254
              G
Sbjct  302   TG  303



>ref|XP_003551853.1| PREDICTED: probable carboxylesterase 17-like [Glycine max]
Length=340

 Score =   177 bits (448),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 108/296 (36%), Positives = 169/296 (57%), Gaps = 14/296 (5%)
 Frame = -2

Query  1111  QNTQISNL-QKMSIIVDEAPGYIQVFSDGTVKR--FSPEIATASAESTDGFKSKDVVIDP  941
              N Q++N  Q+  II +E  G I+V  DG V+R    P + + +  S  G  +KDV+I+ 
Sbjct  8     HNPQVNNTNQQREIIAEEIQGLIRVHRDGRVERPPIVPSV-SCTVPSERGVTAKDVMINK  66

Query  940   SKPITGRIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvv  761
                +  R+++P      +   LLP+L+YFHGGGFCVGS  W  YH FL  L+ ++  V++
Sbjct  67    ETNLWARVYMPISCHHSKL--LLPLLVYFHGGGFCVGSAAWSCYHEFLTNLASKANCVIL  124

Query  760   sVDYRLAPENKLPIAYEDCYAALEWVQKN-----QKAEPCLESADLSRVFLAGDSAGGNI  596
             SVDY LAPEN+LP+AY+D   AL WV++         +  L   ++S +FLAGDSAG NI
Sbjct  125   SVDYHLAPENRLPMAYDDGSNALMWVKREALNGFSVQKWWLSHCNMSSLFLAGDSAGANI  184

Query  595   VHQVAKKCLQDGNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGS--SVAMNDMFWRLS  422
              + VA +     N    +KG++ I P+FG E  T +E  +     S  +++++D +WRL+
Sbjct  185   AYNVATRMGSTSNTPLSLKGVILIQPFFGGEDITFSEKHSLQPPNSALTLSVSDTYWRLA  244

Query  421   LPEGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             LP G+  D   CN      + + + LR P+ +V V+  D L++R + ++  L + G
Sbjct  245   LPLGATLDHPYCNPLAHGTVKLRD-LRLPSTMVCVSEMDILRDRNLEFSNALAKAG  299



>gb|KFK41285.1| hypothetical protein AALP_AA2G110100 [Arabis alpina]
Length=332

 Score =   176 bits (447),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 106/249 (43%), Positives = 147/249 (59%), Gaps = 11/249 (4%)
 Frame = -2

Query  1120  FHPQNTQISNLQKMSIIVDEAPGYIQVFSDGTVKR--FSPEIATASAESTDGFKSKDVVI  947
              +P NT I        +VDE  G I+V+ DG V+R    P +  + A    G    DV I
Sbjct  12    INPNNTNIH-----GPVVDEVEGLIRVYKDGHVERSQIVPCVGPSLALEL-GVACSDVHI  65

Query  946   DPSKPITGRIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksv  767
             D    +  R++VP +  +   V  LP+L+YFHGGGFCVGS +W  YH FL RLS +S+ +
Sbjct  66    DKLNNVWARLYVP-MVTKSSSVSKLPLLVYFHGGGFCVGSASWSCYHEFLARLSSRSQCL  124

Query  766   vvsVDYRLAPENKLPIAYEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQ  587
             V+SV+YRLAPEN LP AYED + A+ W+ K++      +  D  R+FLAGDSAGGNI H+
Sbjct  125   VMSVNYRLAPENPLPAAYEDGFNAIRWLNKSRNDNLWAKLCDFDRIFLAGDSAGGNIAHR  184

Query  586   VAKKCLQDGNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGS--SVAMNDMFWRLSLPE  413
             VA K  +       I+G + I P+FG E RT +E   E +  S  ++A +D +WRL+L  
Sbjct  185   VAAKLAEADLKPMNIEGTILIQPFFGGEARTESERRVENNKSSVLTLAASDAWWRLALRC  244

Query  412   GSNRDFYGC  386
             G+NR+   C
Sbjct  245   GANREHPYC  253



>ref|XP_004497111.1| PREDICTED: probable carboxylesterase 17-like [Cicer arietinum]
Length=350

 Score =   176 bits (447),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 115/290 (40%), Positives = 165/290 (57%), Gaps = 29/290 (10%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIA---TASAESTDGFKSKDVVIDPSKPITGRIFVPDL  902
             +V+E  G I+V  DG V+R  P I    T          S+D++ID    I  R +VP  
Sbjct  32    VVEEIKGLIKVHKDGYVER--PNIVPFVTCDLNPNLNIISRDIIIDNVTNIWARFYVP--  87

Query  901   WPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLP  722
               +K+    LP+L+YFHGGGFCVGS  W  YH FL +LS + + +++SV+YRLAPEN LP
Sbjct  88    ISQKK----LPLLIYFHGGGFCVGSAAWSCYHDFLAKLSSKVECLIMSVNYRLAPENPLP  143

Query  721   IAYEDCYAALEWVQK--------NQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQ  566
               Y+D   AL W+++        N + E  +++ + S VFL GDSAGGNI + VAK+   
Sbjct  144   APYDDGLKALTWLKQKLLYQNEANDECEWWIKNCNFSSVFLGGDSAGGNIAYNVAKRVFS  203

Query  565   DGNCA---AKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMN--DMFWRLSLPEGSNR  401
               +      K+KG++ I P+FG E RT +E      +GS++ +   D +WRL+LP G +R
Sbjct  204   CESVILKPLKLKGLILIQPFFGGEVRTISEKCMVQLSGSALNLEAYDTYWRLALPYGEDR  263

Query  400   DFYGCN-LENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             D   CN L    EL V   L  P  LV ++  D LK+R + + + LRR+G
Sbjct  264   DHPWCNPLMKLEELKV---LMMP-CLVCISEMDILKDRNLEFCDALRREG  309



>ref|XP_010511871.1| PREDICTED: probable carboxylesterase 6 [Camelina sativa]
Length=336

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 111/283 (39%), Positives = 156/283 (55%), Gaps = 17/283 (6%)
 Frame = -2

Query  1120  FHPQNTQISNLQKMSIIVDEAPGYIQVFSDGTVKR--FSPEIATASAESTDGFKSKDVVI  947
              +P NT I        +VDE  G I+V+ DG V+R    P + T S     G    D+VI
Sbjct  12    INPNNTNIH-----GPVVDEVEGLIRVYKDGHVERSQVVPCVGT-SLPLELGVACSDIVI  65

Query  946   DPSKPITGRIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksv  767
             D    +  R++VP +      V  LP+++YFHGGGFC+GS +W  YH FL RLS +S+ +
Sbjct  66    DKLTNVWARLYVPMM--TTTTVSKLPLIVYFHGGGFCIGSASWSCYHEFLARLSARSRCL  123

Query  766   vvsVDYRLAPENKLPIAYEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQ  587
             ++SV+YRLAPEN LP AYED   A+ W+ K +      +  D  R+FLAGDSAGGNI H 
Sbjct  124   IMSVNYRLAPENPLPAAYEDGVNAIIWLNKARNDTLWAKLCDFGRIFLAGDSAGGNIAHH  183

Query  586   VAKKCLQDGNCAAKIKGIMPIHPYFGSERRTAAE--VAAEGSTGSSVAMNDMFWRLSLPE  413
             VA +         +I+G + I P+FG E RT +E  V     +  +++ +D +WRLSLP 
Sbjct  184   VAARLASTELKPLEIEGTILIQPFFGGEARTESEKRVGNNKRSVLTLSSSDAWWRLSLPR  243

Query  412   GSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGV  284
             G+NR+   C     +  +V         LV VA  D L +R +
Sbjct  244   GANREHPYCKPVKTKSSTV-----MMRTLVCVAEMDLLMDRNM  281



>ref|XP_008243198.1| PREDICTED: probable carboxylesterase 6 [Prunus mume]
Length=405

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 111/307 (36%), Positives = 166/307 (54%), Gaps = 33/307 (11%)
 Frame = -2

Query  1120  FHPQNTQISNLQKMSIIVDEAPGYIQVFSDGTVKRFS--PEIATASAESTDGFKSKDVVI  947
             F+P+     + Q+   +++E  G I+V+ DG V+R    P +ATA A    G  S+DVVI
Sbjct  16    FNPKTNPHGHDQQHGNVIEEIEGLIKVYKDGHVERLHIVPCVATAVAPEL-GVTSRDVVI  74

Query  946   DPSKPITGRIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksv  767
             D    I  R +VP       +   LP+L+YFHGGGFCVGS  W  YH FL +L+ ++  +
Sbjct  75    DKFTNIWSRFYVPKCHGNDNK---LPLLVYFHGGGFCVGSAAWSCYHEFLAKLAAKAGCL  131

Query  766   vvsVDYRLAPENKLPIAYEDCYAALEWVQKNQKAEPCLES------ADLSRVFLAGDSAG  605
             ++SV+YRL PE+ LP AYED   AL W+++   ++    +       D +R+FL GDSAG
Sbjct  132   IMSVNYRLVPEHPLPAAYEDGLKALLWLKQQALSQRGANNKWWSRQCDFTRIFLVGDSAG  191

Query  604   GNIVHQVAKK---CLQDGNCAAK-----------IKGIMPIHPYFGSERRTAAE---VAA  476
              NI H VA +    + DG C  +           IKG + + P+FG E RT++E   +  
Sbjct  192   ANIAHNVATRLCNIISDGPCDEQIIISSLIKPLTIKGTILLQPFFGGEERTSSEKYYMEK  251

Query  475   EGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLK  296
             +  +  S+A +D +WRL+LP G+NRD   CN           W    A +V ++  D LK
Sbjct  252   QPRSALSLAASDTYWRLALPCGANRDHPWCNPLKSASSLRAVW----ATMVCISEMDILK  307

Query  295   ERGVMYA  275
             +R + + 
Sbjct  308   DRNIEFC  314



>ref|XP_006362556.1| PREDICTED: probable carboxylesterase 6-like [Solanum tuberosum]
Length=351

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 109/297 (37%), Positives = 167/297 (56%), Gaps = 23/297 (8%)
 Frame = -2

Query  1096  SNLQKMS------IIVDEAPGYIQVFSDGTVKRFSPEIA---TASAESTDGFKSKDVVID  944
             +NLQK+       +I++E  G I+V+ DG V+R  P+I    T       G  S DVVID
Sbjct  16    NNLQKIKEYPQHKVILEEIEGLIKVYKDGHVER--PQIVPNVTNKLPLELGVTSSDVVID  73

Query  943   PSKPITGRIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvv  764
                 I  R++VP +  +  +   LP+L+YFHGGGFCVGS++W+ YH FL +L+  +  V+
Sbjct  74    RYTNIWARLYVPKILCQGNK---LPMLIYFHGGGFCVGSSSWICYHEFLAKLASIANCVI  130

Query  763   vsVDYRLAPENKLPIAYEDCYAALEWVQK-----NQKAEPCLESADLSRVFLAGDSAGGN  599
             +SV+YRLAPEN+LP AY+D    + W+++     + +    L   + S ++L GDSAGGN
Sbjct  131   MSVNYRLAPENRLPSAYDDGVKTIVWIRQKVLIGSNEDYWWLNKVNFSNIYLVGDSAGGN  190

Query  598   IVHQVAKKCLQD-GNCA-AKIKGIMPIHPYFGSERRTAAE--VAAEGSTGSSVAMNDMFW  431
             I + VA       G+     +KGI+ I P+FG E RT +E        +  ++A  D +W
Sbjct  191   IAYNVAIMLRSKIGDLKPITLKGIILIQPFFGGESRTYSEKYTIQPPRSALTLASADTYW  250

Query  430   RLSLPEGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRR  260
             RL+LP G NRD+  CN      +++ +    P  LV ++  D L++R + +   L R
Sbjct  251   RLALPTGVNRDYPWCNPIGKEGVNLVDIRNIPGILVCISELDILRDRNLEFCATLNR  307



>ref|XP_008800776.1| PREDICTED: probable carboxylesterase 17 [Phoenix dactylifera]
Length=336

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 113/286 (40%), Positives = 162/286 (57%), Gaps = 23/286 (8%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFS--PEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLW  899
             +V+E  G ++V+ DG V+R    P++        D   S+D+  +    +  R +VPD  
Sbjct  15    VVEEIQGLLKVYEDGHVERLPAMPDVPCTWTPEPD-VASRDISFNHPTGLWARFYVPD--  71

Query  898   PEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPI  719
               + Q   LP+L+YFHGGGFCVGS  W  YH FL RLS Q+  +++SV YRLAPEN+LP 
Sbjct  72    -RRGQ---LPLLVYFHGGGFCVGSAAWRCYHEFLARLSSQASCLIMSVSYRLAPENRLPA  127

Query  718   AYEDCYAALEWVQKNQKAEPCLE-------SADLSRVFLAGDSAGGNIVHQVAKKCLQDG  560
             AYED  AA++WV+  Q A  C++           S++FL GDSAGG I H  A + L   
Sbjct  128   AYEDGLAAIKWVR--QHATYCIDELSWWQTKCSFSQMFLGGDSAGGAIAHDAAAR-LGLA  184

Query  559   NCAAKIKGIMPIHPYFGSERRTAAEVAAEG----STGSSVAMNDMFWRLSLPEGSNRDFY  392
                A +KG++ I P+FG E RT++E  +      ST  S+A +D +WRL+LP GSNRD  
Sbjct  185   GAPAWLKGVILIQPFFGGEARTSSEKNSTTQPVRSTSLSLAASDCYWRLALPLGSNRDHP  244

Query  391   GCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
              CN          E  R P  LV ++  D L++R + + + ++R G
Sbjct  245   WCNPLATPSFPKLEDPRLPPMLVCISEMDILRDRNLEFCKAMKRTG  290



>ref|XP_003637423.1| Arylacetamide deacetylase [Medicago truncatula]
 gb|KEH44251.1| carboxylesterase, putative [Medicago truncatula]
Length=353

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 117/308 (38%), Positives = 173/308 (56%), Gaps = 33/308 (11%)
 Frame = -2

Query  1114  PQNTQISNLQKMSIIVDEAPGYIQVFSDGTVKRFSPEIA---TASAESTDGFKSKDVVID  944
             PQ+ +     + S +V+E  G I+V  DG ++R  P I    T+         S+D++ID
Sbjct  12    PQHGKNHQQHQGSCVVEEIKGLIKVHKDGYIER--PNIVPCVTSDLCPKINVTSRDIIID  69

Query  943   PSKPITGRIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvv  764
                 I  R +VP+  P+K+    LP+L+YFHGGGFCVGS  W  YH FL  LS++   ++
Sbjct  70    SVTNIWARFYVPNS-PQKK----LPLLVYFHGGGFCVGSAAWSCYHEFLAMLSLKVGCLI  124

Query  763   vsVDYRLAPENKLPIAYEDCYAALEWVQK-------NQKAEPCLESADLSRVFLAGDSAG  605
             +SV+YRLAPEN LP  Y+D   AL W++K       + + E   +  + S VFL GDSAG
Sbjct  125   MSVNYRLAPENPLPAPYDDGLNALMWLKKQFLYQNESSEFEWWTKKCNFSNVFLGGDSAG  184

Query  604   GNIVHQVAKKCLQDGNCAA------KIKGIMPIHPYFGSERRTAAEVAAEGSTGSS--VA  449
             GNI + VAK+    G+C         +KG++ + P+FG + RT +E   E  +GS+  +A
Sbjct  185   GNIAYNVAKRV---GSCEGAFLRPLNLKGLILVQPFFGGKERTLSEKCMEQLSGSALNLA  241

Query  448   MNDMFWRLSLPEGSNRDFYGCN-LENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAE  272
              +D +WRL+LP G +RD   CN L    EL +   L  P  LV ++  D LK+R + + +
Sbjct  242   ASDTYWRLALPYGEDRDHPWCNPLVKMEELKL---LMMP-MLVCISEMDILKDRNMEFCD  297

Query  271   FLRRKGVK  248
              L R G +
Sbjct  298   ALGRTGTR  305



>ref|XP_010932611.1| PREDICTED: probable carboxylesterase 17 [Elaeis guineensis]
Length=334

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 114/286 (40%), Positives = 163/286 (57%), Gaps = 21/286 (7%)
 Frame = -2

Query  1078  SIIVDEAPGYIQVFSDGTVKRFS--PEIATASAESTDGFKSKDVVIDPSKPITGRIFVPD  905
             + +V+E  G ++V  DG V+R    P++    A   +   S+D+  + S  +  R  VP+
Sbjct  13    TAVVEEIEGLLKVHEDGHVERLPTMPDVPCTWAPEPN-VASRDISFNNSTGLWARFHVPN  71

Query  904   LWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKL  725
                 + Q   LP+L+YFHGGGFC+GS  W  YH FL RLS Q+  +++SV YRLAPEN L
Sbjct  72    ---RRGQ---LPLLVYFHGGGFCIGSAAWRCYHEFLARLSSQANCLIMSVSYRLAPENPL  125

Query  724   PIAYEDCYAALEWVQKNQKAEPCLE-------SADLSRVFLAGDSAGGNIVHQVAKKCLQ  566
             P AYED  AA++WV+  Q A  C +         + S++F+ GDSAGG I + VA + L 
Sbjct  126   PAAYEDGLAAIKWVR--QHATHCTDELSWWQTKCNFSQMFVGGDSAGGAIANNVAAQ-LG  182

Query  565   DGNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGS--SVAMNDMFWRLSLPEGSNRDFY  392
                  A +KG++ I P+FG E RTA+E  +  S  S  S+A +D +WRL+LP GSNRD  
Sbjct  183   LAGVPAWLKGVILIQPFFGGETRTASEKNSRPSMRSTLSLAASDCYWRLALPLGSNRDHP  242

Query  391   GCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
              CN          E LR P  LV ++  D L++R + + + L R G
Sbjct  243   WCNPIAMLSSPKLEDLRLPPLLVCISEMDILRDRNLEFCKALERAG  288



>ref|XP_010067679.1| PREDICTED: probable carboxylesterase 15 [Eucalyptus grandis]
Length=337

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 108/278 (39%), Positives = 154/278 (55%), Gaps = 16/278 (6%)
 Frame = -2

Query  1090  LQKMSIIVDEAPGYIQVFSDGTVKR---------FSPEIATASAESTDGFKSKDVVIDPS  938
             + +  ++VDE PG+++V+ DG+V R         F  E      E  DG   +DVV D  
Sbjct  1     MVRQMMMVDEVPGWLRVYEDGSVDRTWTGPPEAKFMAEPVAPHEEFIDGVAVRDVVTDRK  60

Query  937   KPITGRIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvs  758
                  RI++P+  PE +  +L PV+L+FHGGGFC+    W  Y+    +L+  ++++ VS
Sbjct  61    SGRRVRIYLPEDIPEADSAKL-PVILHFHGGGFCISQADWFMYYNTYTKLAASARAICVS  119

Query  757   VDYRLAPENKLPIAYEDCYAALEW---VQKNQKAEPCLES-ADLSRVFLAGDSAGGNIVH  590
                RLAPEN+LP A ED YAALEW   V + +  EP LE  AD SRVFL GDS+GGN+VH
Sbjct  120   AYLRLAPENRLPAAMEDAYAALEWLISVARGESREPWLEDHADFSRVFLIGDSSGGNVVH  179

Query  589   QVAKKCLQDGNCA-AKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPE  413
             +VA++  +  +    ++ G +PIHP F    R+ +E+    +   + AM D F  L LPE
Sbjct  180   EVARRAGEAEDLGPVRLAGAIPIHPGFVRAERSRSELEHPETPFLNRAMVDKFLSLGLPE  239

Query  412   GSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFL  299
             G+ RD +       R     E LR P  L  VA KD +
Sbjct  240   GATRD-HPLTCPMGRAAPALEGLRLPPVLFCVAEKDLV  276



>ref|XP_008230396.1| PREDICTED: probable carboxylesterase 17 [Prunus mume]
Length=347

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 107/286 (37%), Positives = 161/286 (56%), Gaps = 20/286 (7%)
 Frame = -2

Query  1075  IIVDEAPGYIQVFSDGTVKRFSPEIATASAEST--DGFKSKDVVIDPSKPITGRIFVPDL  902
             ++++E  G+++V  DG ++R  P I T  +      G  +KDVVID    +  RI+VP  
Sbjct  29    VVLEEIEGFLRVHKDGNIER-PPIIPTVPSTLALPHGVTAKDVVIDKFTNLWARIYVP--  85

Query  901   WPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLP  722
                      LPVL+YFHGGGFCVGS  W  YH FL  L+ ++  V++SV+YRLAPEN+LP
Sbjct  86    ----SHPGNLPVLVYFHGGGFCVGSAAWSCYHDFLANLACKASCVIISVNYRLAPENRLP  141

Query  721   IAYEDCYAALEWVQKNQKAEPC-----LESADLSRVFLAGDSAGGNIVHQVAKKCLQDGN  557
              AY+D +  L WV++   +EP      L    LS +F+ GDSAG NI + V  + +    
Sbjct  142   AAYDDGFKTLMWVKQQALSEPSEQRWWLSRCSLSSLFIVGDSAGANIAYNVTTQLVSRDP  201

Query  556   CAAK---IKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAM--NDMFWRLSLPEGSNRDFY  392
              + +   +KG + I P+FG E RT +E  A     S++ +  +D++WRL+LP G+N+D  
Sbjct  202   SSLRPLSLKGTILIQPFFGGEARTWSEKYATQPPTSALTLSNSDVYWRLALPLGANKDHP  261

Query  391   GCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
              CN   +    + + LR PA +V ++  D LK+R +     L   G
Sbjct  262   WCNPLANGMTKLRD-LRLPAIMVCISELDILKDRNLEVCNALSSLG  306



>ref|XP_002279965.2| PREDICTED: probable carboxylesterase 17 [Vitis vinifera]
Length=347

 Score =   174 bits (441),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 110/293 (38%), Positives = 160/293 (55%), Gaps = 21/293 (7%)
 Frame = -2

Query  1093  NLQKMSIIVDEAPGYIQVFSDGTVKR--FSPEIATASAESTDGFKSKDVVIDPSKPITGR  920
             NL +  ++V++  G I+V++DG V+R    P +    A    G   KDVVI+    +  R
Sbjct  22    NLYQNGVVVEKVEGLIRVYNDGHVERPAIVPNVPCTVALEL-GVTVKDVVIEKYSNLWAR  80

Query  919   IFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLA  740
              +VP     K     LP+L+YFHGGGFCVGS  W  YH FL  L+ ++  +++SV+YRLA
Sbjct  81    FYVPSCPAGK-----LPLLVYFHGGGFCVGSAAWNCYHGFLADLASKAGCLIMSVNYRLA  135

Query  739   PENKLPIAYEDCYAALEWVQKNQKAEPC------LESADLSRVFLAGDSAGGNIVHQVAK  578
             PEN+LP AYED + A+ WV KNQ           L   +LS +FL GDSAG NI + VA 
Sbjct  136   PENRLPAAYEDGFNAVMWV-KNQALNGAGEQKWWLSRCNLSSLFLTGDSAGANIAYNVAT  194

Query  577   KCLQDGNCAAK---IKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAM--NDMFWRLSLPE  413
             +         K   +KG + I P+FG E RT +E  +     S++ +  +D +WRLSLP 
Sbjct  195   RLGSSDTTFLKPLSLKGTILIQPFFGGEARTGSENHSTQPPNSALTLSASDTYWRLSLPL  254

Query  412   GSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             G+NRD   CN   +    +   L+ P  +V ++  D LK+R + +   +   G
Sbjct  255   GANRDHPCCNPLANGSTKL-RTLQLPPTMVCISDTDILKDRNLQFCTAMANAG  306



>ref|XP_008236533.1| PREDICTED: probable carboxylesterase 12 [Prunus mume]
Length=318

 Score =   173 bits (439),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 115/280 (41%), Positives = 155/280 (55%), Gaps = 14/280 (5%)
 Frame = -2

Query  1066  DEAPGYIQVFSDGTVKRFS-PEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPEK  890
             D +PG I+V+ DG V+R    +I   S +   G +SKDVVI     I+ R+++P      
Sbjct  9     DFSPG-IKVYKDGRVERLQGTDIVPPSTDPKTGVQSKDVVISQEPAISARLYIPKSTTTS  67

Query  889   EQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksv--vvsVDYRLAPENKLPIA  716
                  LP+L+YFHGGGFC+ S++   YH +L  L   S++    VSVDYRLAPEN LP A
Sbjct  68    SPQTKLPLLIYFHGGGFCIESSSSPTYHNYLNALVSDSEANVVAVSVDYRLAPENPLPAA  127

Query  715   YEDCYAALEWVQKN---QKAEPCLES-ADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAA  548
             YED +AAL+WV  +     +E  L S AD  RVF +GDSAGGN+ H +A K   +G    
Sbjct  128   YEDSWAALKWVASHSDGNSSEDWLNSFADFQRVFFSGDSAGGNLAHNMALKVGCEGLAGV  187

Query  547   KIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDR  368
              + GI+ +HPYF        E+ A  +    V+     WR + P  S  D    N   D 
Sbjct  188   NLIGIVLVHPYFWGTEPVGEELTAPAAAREIVS---ALWRFTYPSTSGSDDPFFNPGKDS  244

Query  367   ELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVK  248
             +L  GE L     LVFVA KD LK+RG+ Y+E L++ G K
Sbjct  245   KL--GE-LGCVKVLVFVAEKDILKDRGLYYSEILKKSGWK  281



>ref|XP_007224811.1| hypothetical protein PRUPE_ppa023588mg [Prunus persica]
 gb|EMJ26010.1| hypothetical protein PRUPE_ppa023588mg [Prunus persica]
Length=362

 Score =   174 bits (441),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 111/307 (36%), Positives = 164/307 (53%), Gaps = 33/307 (11%)
 Frame = -2

Query  1120  FHPQNTQISNLQKMSIIVDEAPGYIQVFSDGTVKR--FSPEIATASAESTDGFKSKDVVI  947
             F+P+     + Q+   +++E  G I+V+ DG V+R    P +ATA      G  S+DVVI
Sbjct  10    FNPKTNPHEHDQQHGNVIEEIEGLIKVYKDGHVERPHIVPCVATAVPPEL-GVTSRDVVI  68

Query  946   DPSKPITGRIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksv  767
             D    I  R +VP       +   LP L+YFHGGGFCVGS  W  YH FL +L+ ++  +
Sbjct  69    DKFTNIWSRFYVPKCHGNDNK---LPFLVYFHGGGFCVGSAAWSCYHEFLAKLAAKAGCL  125

Query  766   vvsVDYRLAPENKLPIAYEDCYAALEWVQKNQKAEPCLES------ADLSRVFLAGDSAG  605
             ++SV+YRL PE+ LP AYED   AL W+++   ++    +       D SR+FL GDSAG
Sbjct  126   IMSVNYRLVPEHPLPAAYEDGLKALLWLKQQALSQRGANNKWWSRQCDFSRIFLVGDSAG  185

Query  604   GNIVHQVAKK---CLQDGNCAAK-----------IKGIMPIHPYFGSERRTAAE---VAA  476
              NI H VA +    + DG C  +           IKG + + P+FG E RT++E   +  
Sbjct  186   ANIAHNVATRLCNIISDGPCDEQIIISSLIKPLTIKGTILLQPFFGGEARTSSEKYNMVK  245

Query  475   EGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLK  296
             +  +  S+A +D +WRL+LP G+NRD   CN           W    A +V ++  D LK
Sbjct  246   QPRSALSLAASDTYWRLALPCGANRDHPWCNPLKRASSLRAVW----ATMVCISEMDILK  301

Query  295   ERGVMYA  275
             +R + + 
Sbjct  302   DRNLEFC  308



>ref|XP_009105029.1| PREDICTED: probable carboxylesterase 6 [Brassica rapa]
Length=328

 Score =   173 bits (439),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 110/256 (43%), Positives = 145/256 (57%), Gaps = 27/256 (11%)
 Frame = -2

Query  1120  FHPQNTQISNLQKMSIIVDEAPGYIQVFSDGTVKRFSPEIATASAESTD---GFKSKDVV  950
              +P NT I        +VDE  G I+V+ DG V+R   E+      S     G    DV 
Sbjct  12    INPYNTNIH-----GPVVDEVEGLIKVYKDGHVER--SELVPCVGPSLPLELGVACSDVY  64

Query  949   IDPSKPITGRIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsks  770
             ID    +  R++VP      +    LP+L+YFHGGGFCVGS +W  YH FL RLS  S+ 
Sbjct  65    IDKLTNVWARLYVP-----MDTNSKLPLLVYFHGGGFCVGSASWSCYHEFLARLSASSRC  119

Query  769   vvvsVDYRLAPENKLPIAYEDCYAALEWVQKNQK---AEPCLESADLSRVFLAGDSAGGN  599
             +V+SV+YRLAPEN LP AYED    + W++K      A+ C    DLSR+FL GDSAGGN
Sbjct  120   MVMSVNYRLAPENPLPAAYEDGVNVIHWLKKRSNSLWAKLC----DLSRIFLVGDSAGGN  175

Query  598   IVHQVAKKCLQDGN--CAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSV---AMNDMF  434
             I H VA +   D +     +I+G + I P+FG E RT +E   E +T SS+   A +D +
Sbjct  176   IAHHVAARLATDADDLKPLRIEGTILIQPFFGGEARTESERRVENNTKSSILTLAASDAW  235

Query  433   WRLSLPEGSNRDFYGC  386
             WRL+LP G NR+   C
Sbjct  236   WRLALPRGENREHPYC  251



>ref|XP_011011184.1| PREDICTED: probable carboxylesterase 17 [Populus euphratica]
Length=346

 Score =   174 bits (440),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 109/305 (36%), Positives = 167/305 (55%), Gaps = 22/305 (7%)
 Frame = -2

Query  1120  FHPQNTQISNLQKMSIIVDEAPGYIQVFSDGTVKR--FSPEIATASAESTDGFKSKDVVI  947
             F P+  + ++     +I++E  G I+V+ DG ++R    P +    A   D   +KD+ I
Sbjct  11    FDPRINRQTSKNSHEVIIEEIEGLIRVYKDGHIERPPIIPSVPCNVATVND-VSAKDIFI  69

Query  946   DPSKPITGRIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksv  767
             +    +  RI+V +      +   LP+L+YFHGGGFCVGS  W  YH FL  L+ ++  +
Sbjct  70    NKFTNLWARIYVSN------RSGTLPLLVYFHGGGFCVGSAAWSSYHEFLANLASKASCI  123

Query  766   vvsVDYRLAPENKLPIAYEDCYAALEWV-QKNQKAEP----CLESADLSRVFLAGDSAGG  602
             ++S++YRLAPEN+LP AY+D   A  WV Q+     P     L   + S VFL+GDSAG 
Sbjct  124   ILSINYRLAPENRLPSAYDDGIDAFSWVKQQVLNGSPEHNWWLSRCNFSSVFLSGDSAGA  183

Query  601   NIVHQVAKKCLQDGNCAAK-----IKGIMPIHPYFGSERRTAAE--VAAEGSTGSSVAMN  443
             NI + VA +     N  +      +KGI+ I P+FG E RT +E  +    ++  +++ +
Sbjct  184   NIAYNVATRLESRYNPESMTKPLCLKGIILIQPFFGGEARTFSEKNMTQPANSALTLSAS  243

Query  442   DMFWRLSLPEGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLR  263
             D +WRLSLP GSNRD   CN   +    + + LR PA +V ++  D LK+R   +   L 
Sbjct  244   DTYWRLSLPLGSNRDHPYCNPLANGASKLRD-LRLPAIMVGISELDILKDRNSEFCSALT  302

Query  262   RKGVK  248
             R G +
Sbjct  303   RAGKR  307



>ref|XP_009352462.1| PREDICTED: probable carboxylesterase 17 [Pyrus x bretschneideri]
Length=343

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 116/304 (38%), Positives = 164/304 (54%), Gaps = 29/304 (10%)
 Frame = -2

Query  1111  QNTQISNLQKMSIIVDEAPGYIQVFSDGTVKR--FSPEIATASAESTDGFKSKDVVIDPS  938
             Q T+ SN  +  ++++E  G I+V  DG V+R    P + +  A    G  +KDVVID  
Sbjct  13    QATRKSN--QHGVVLEEIEGLIRVHKDGYVERPPMIPSVPSTLALPP-GVVAKDVVIDKF  69

Query  937   KPITGRIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvs  758
               +  RI+VP           LP+++YFHGGGFCVGS  W  YH FL +L+ Q+  V++S
Sbjct  70    ANLWARIYVP------SHPGNLPMIVYFHGGGFCVGSAAWSCYHEFLAKLASQASCVIIS  123

Query  757   VDYRLAPENKLPIAYEDCYAALEWVQKNQKAEPC------LESADLSRVFLAGDSAGGNI  596
             V+YRLAP+N+LP AY+D + AL WV K Q    C      L   +LS +F+ GDSAG NI
Sbjct  124   VNYRLAPDNRLPAAYDDGFKALMWV-KQQALNECSEQKWWLSKCNLSSLFIGGDSAGANI  182

Query  595   VHQVAKKCLQDGNCAAKI------KGIMPIHPYFGSERRTAAEVAAEGSTGSSVAM--ND  440
              + V       G+C   I      KG + I P+FG E RT AE  A     S++ +  +D
Sbjct  183   AYHVTT---HSGSCDPSILRPLSLKGTVLIQPFFGGEARTWAEKCATQPPYSALTLSNSD  239

Query  439   MFWRLSLPEGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRR  260
              +WRLSLP G++RD   CN      ++    L  P+ +V V+  D LK+R       L  
Sbjct  240   TYWRLSLPLGASRDHPWCNPLTKASVAKLRDLMLPSMMVCVSELDILKDRNFELCNALSS  299

Query  259   KGVK  248
              G++
Sbjct  300   MGIR  303



>gb|ABB89015.1| CXE carboxylesterase [Actinidia deliciosa]
Length=329

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 110/284 (39%), Positives = 157/284 (55%), Gaps = 19/284 (7%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKR--FSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLW  899
             +V+E  G I+V+ DG V+R    P + ++ A       S+D+VID    I  R ++P   
Sbjct  24    VVEEIEGLIRVYKDGHVERSQIVPFVMSSVAPEPV-VTSRDIVIDKPTNIWARFYLPKYH  82

Query  898   PEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPI  719
                     LP+L+YFHGGGFCVGST W  YH FL +L+ ++  +++SV+YRLAPEN+L  
Sbjct  83    KN------LPLLVYFHGGGFCVGSTAWSCYHEFLAKLAAKANCLILSVNYRLAPENRLAA  136

Query  718   AYEDCYAALEWVQKNQKA----EPCLESADLSRVFLAGDSAGGNIVHQVAKK---CLQDG  560
             AY+D + AL WV++        E   +  + S +FLAGDSAG NI H VA +   C    
Sbjct  137   AYDDGFKALMWVKQQAICGSGNEWWSKQCNFSSIFLAGDSAGANIAHNVAIRLNSCQPMS  196

Query  559   NCAAKIKGIMPIHPYFGSERRTAAE--VAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGC  386
                  IKG + I P+FG ERRT +E        +  S+A +D +WRL+LP G++RD   C
Sbjct  197   IKPLTIKGTILIQPFFGGERRTNSEKYTVEPPRSALSLAASDTYWRLALPPGASRDHPWC  256

Query  385   NLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             N      + +GE L     +V VA  D L++R +     L R G
Sbjct  257   NPRAKGSIQLGE-LGISPIMVCVAEMDVLRDRNLDMCAALARAG  299



>gb|ABK22244.1| unknown [Picea sitchensis]
Length=339

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 114/274 (42%), Positives = 155/274 (57%), Gaps = 17/274 (6%)
 Frame = -2

Query  1054  GYIQVFSDGTVKRFSPEIA--TASAEST--DGFKSKDVVIDPSKPITGRIFVPDLWPEKE  887
             G +   +DGTV R    +     SA+ T   G  +KD+VID +  +  R+FVPD     +
Sbjct  35    GAVTRRNDGTVNRRLANLIDRKVSADQTPRHGVYTKDIVIDKTTGVRVRLFVPDNGAHGD  94

Query  886   QVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYED  707
                  PV++YFHGG FC  S   V Y  F  +L+ +    VVSVDYRLAPE+K P AY+D
Sbjct  95    ----FPVVVYFHGGAFCALSGADVAYDTFCRKLAGRLTVAVVSVDYRLAPEHKCPAAYDD  150

Query  706   CYAALEWVQKNQKAEPCL-ESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCA-AKIKGI  533
             C+ AL W++   +   CL  SADLSR FL GDSAGGNIVH V  +  ++ + +  KI G 
Sbjct  151   CFVALAWLRA--QGRDCLPPSADLSRCFLMGDSAGGNIVHHVGCRVAREADMSPIKIAGH  208

Query  532   MPIHPYFGSERRTAAEV-AAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSV  356
             + + PYFG E RT AEV  + G    +V   D +WR  LPEG+ RD    N+ +     +
Sbjct  209   VLMQPYFGGEERTPAEVRLSNGVPLITVEAADWYWRAFLPEGATRDHPAANVTS---TDI  265

Query  355   GEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
              E L  P +LV V G D L++  + YAE L++ G
Sbjct  266   SE-LSLPPSLVVVGGLDLLQDWQLRYAEHLKKMG  298



>ref|XP_002516731.1| Lipase, putative [Ricinus communis]
 gb|EEF45629.1| Lipase, putative [Ricinus communis]
Length=342

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 105/289 (36%), Positives = 169/289 (58%), Gaps = 23/289 (8%)
 Frame = -2

Query  1075  IIVDEAPGYIQVFSDGTVKR--FSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDL  902
             ++V+E  G I+V+ DG  +R    P +A A A   DG  +KDV ID    +  RI++P  
Sbjct  21    VLVEEIEGLIKVYRDGRTERPPIVPNVACAPAPE-DGVTAKDVFIDKLTNLWARIYLPSC  79

Query  901   WPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLP  722
                +     LP+L+YFHGGGFCVGS  W+ YH FL  L+ ++  +++S++YRLAPEN+LP
Sbjct  80    PGTR-----LPLLVYFHGGGFCVGSAAWICYHEFLVNLASKAGCIIISINYRLAPENRLP  134

Query  721   IAYEDCYAALEWVQK-----NQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKK----CL  569
              AY+D    L W+++     + + +  L   + S +FLAGDSAG NI + VA +     +
Sbjct  135   AAYDDGTNTLMWLKQQVLIGSAEHKWWLSQCNFSNLFLAGDSAGANIAYNVAARLGSSVM  194

Query  568   QDGNCAA-KIKGIMPIHPYFGSERRTAAE--VAAEGSTGSSVAMNDMFWRLSLPEGSNRD  398
              + N     ++GI+ I P+FG E RT++E  +    ++  +++ +D +WRLSLP G+NRD
Sbjct  195   SESNIRPFCLRGIILIQPFFGGEARTSSERQMTQPANSALTLSASDTYWRLSLPLGANRD  254

Query  397   FYGCN-LENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
                CN L N   ++    L+ P+ +V ++  D +K+R + ++  L   G
Sbjct  255   HPCCNPLANG--VNKLRNLQLPSIMVCISEMDIMKDRNLEFSTALASAG  301



>ref|XP_002315949.2| hypothetical protein POPTR_0010s13770g [Populus trichocarpa]
 gb|EEF02120.2| hypothetical protein POPTR_0010s13770g [Populus trichocarpa]
Length=351

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 115/297 (39%), Positives = 166/297 (56%), Gaps = 26/297 (9%)
 Frame = -2

Query  1093  NLQKMSIIVDEAPGYIQVFSDGTVKRFSPEIA---TASAESTDGFKSKDVVIDPSKPITG  923
             +  +  ++ +E  G I+ + DG V+R  P+I    T++     G  S+D VID    I  
Sbjct  22    DCHQHGVVAEEIDGLIKAYKDGRVER--PQIVPCVTSALAPGLGVTSRDTVIDNFTNIWA  79

Query  922   RIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRL  743
             R +VP  +  K     LP+L+YFHGGGFCVGS  W  YH FL RL+ ++  +++SV+YRL
Sbjct  80    RFYVPIKFQGK-----LPLLVYFHGGGFCVGSAAWSCYHDFLARLAAKANCIIMSVNYRL  134

Query  742   APENKLPIAYEDCYAALEWVQKNQKAEPCLES-----ADLSRVFLAGDSAGGNIVHQVAK  578
             APEN LP AY+D   AL+W+ K Q    C ++      + S VFLAGDSAG NI   V  
Sbjct  135   APENPLPAAYDDGIKALKWL-KQQALSVCTDNWWTSQWNFSDVFLAGDSAGANIAFNVIT  193

Query  577   K--CLQDGNCAAKI-----KGIMPIHPYFGSERRTAAEVAAEGSTGSS--VAMNDMFWRL  425
             +      G  AA I     KGI+ I P+FG E RT +E  +  S  S+  +A +D +WRL
Sbjct  194   RLDSFNAGQAAAAIKPLTLKGIILIQPFFGGEARTHSEKHSVQSPRSALNLAASDTYWRL  253

Query  424   SLPEGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             +LP G++RD   CN      + + ++ RFP  +V ++  D LK+R + +   L R G
Sbjct  254   ALPCGASRDHPWCNPLAKGSVKLEDFGRFP-IMVCISEMDILKDRSLEFVASLGRAG  309



>ref|XP_007217618.1| hypothetical protein PRUPE_ppa016280mg [Prunus persica]
 gb|EMJ18817.1| hypothetical protein PRUPE_ppa016280mg [Prunus persica]
Length=344

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 106/288 (37%), Positives = 160/288 (56%), Gaps = 22/288 (8%)
 Frame = -2

Query  1075  IIVDEAPGYIQVFSDGTVKR--FSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDL  902
             ++++E  G ++V  DG ++R    P + +  A    G  +KDVVID    +  RI+VP  
Sbjct  24    VVLEEIEGLLRVHKDGNIERPPIIPSVPSTLALP-HGVTAKDVVIDKFTNLWARIYVP--  80

Query  901   WPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLP  722
                      LPVL+YFHGGGFCVGS  W  YH FL  L+ ++  V++SV+YRLAPEN+LP
Sbjct  81    ----SHPGNLPVLVYFHGGGFCVGSAAWSCYHDFLANLACKASCVIISVNYRLAPENRLP  136

Query  721   IAYEDCYAALEWVQKNQKAEPC-----LESADLSRVFLAGDSAGGNIVHQVAKKCLQDGN  557
              AY+D +  L WV++   +EP      L    LS +F+ GDSAG NI + V  + +    
Sbjct  137   AAYDDGFKTLMWVKQQAMSEPSEQRWWLSRCSLSSLFIVGDSAGANIAYNVTTQLVSRDP  196

Query  556   CAAK-----IKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAM--NDMFWRLSLPEGSNRD  398
              + +     +KG + I P+FG E RT +E  A     S++ +  +D++WRL+LP G+N+D
Sbjct  197   SSLRPLTLSLKGTILIQPFFGGEARTWSEKYATQPPTSALTLSNSDVYWRLALPLGANKD  256

Query  397   FYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
                CN   +    + + LR PA +V ++  D LK+R +     L   G
Sbjct  257   HPWCNPLANGVTKLRD-LRLPAIMVCISELDILKDRNLEVGNALSSLG  303



>ref|XP_007142891.1| hypothetical protein PHAVU_007G025700g [Phaseolus vulgaris]
 gb|ESW14885.1| hypothetical protein PHAVU_007G025700g [Phaseolus vulgaris]
Length=345

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 111/282 (39%), Positives = 151/282 (54%), Gaps = 18/282 (6%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKR--FSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLW  899
             +V+E  G I+V  DG V+R    P +   +        S+D+VID +     R +VP   
Sbjct  32    VVEEIAGLIRVHKDGYVERPQVLPCVTAGTMNPELNVTSRDMVIDSATNTWARFYVPI--  89

Query  898   PEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPI  719
                     LP+L+YFHGGGFCVGS  W  YH FL RLS +   V++SV+YRLAPEN LP 
Sbjct  90    ----SQHKLPLLVYFHGGGFCVGSAAWSCYHDFLARLSAKVGCVIMSVNYRLAPENPLPA  145

Query  718   AYEDCYAALEWVQ-----KNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNC  554
              Y+D   AL W +     K   +E      + S VFL GDSAG NI + V   C      
Sbjct  146   PYDDGIKALMWAKQQVLYKGSGSEWWRTKCNFSSVFLGGDSAGANIAYNVVAACDGAALR  205

Query  553   AAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSS--VAMNDMFWRLSLPEGSNRDFYGCNL  380
                +KG++ I P+FG E RT +E     S+GS+  +A +D +WRL+LP G+NRD   CN 
Sbjct  206   PLNLKGLILIQPFFGGEVRTGSEKCMAQSSGSALNLAASDSYWRLALPCGANRDHPWCNP  265

Query  379   ENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
                 +L   E L+    LV ++  D LK+R + + E L R G
Sbjct  266   LVKGKL---EELKVLRTLVCISEMDILKDRNLEFCETLVRAG  304



>ref|XP_004238946.1| PREDICTED: probable carboxylesterase 6 [Solanum lycopersicum]
Length=350

 Score =   172 bits (435),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 109/298 (37%), Positives = 166/298 (56%), Gaps = 27/298 (9%)
 Frame = -2

Query  1093  NLQKMS------IIVDEAPGYIQVFSDGTVKRFSPEIA---TASAESTDGFKSKDVVIDP  941
             NLQKM       ++++E  G I+V+ +G V+R  P+I    T       G  S DVVID 
Sbjct  16    NLQKMKEYPQHKVLLEEIEGLIKVYKNGHVER--PQIVPNVTNKLPLELGVTSSDVVIDR  73

Query  940   SKPITGRIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvv  761
                I  R++VP    +  +   LP+L+YFHGGGFCVGS++W+ YH FL +L+  +  V++
Sbjct  74    YTNIWARLYVPKTLCQGNK---LPLLIYFHGGGFCVGSSSWICYHEFLAKLASIANCVIM  130

Query  760   sVDYRLAPENKLPIAYEDCYAALEWVQKN-----QKAEPCLESADLSRVFLAGDSAGGNI  596
             SV+YRLAPEN+LP AY+D    + W+++       +    L   + S  +L GDSAGGNI
Sbjct  131   SVNYRLAPENRLPSAYDDGVKTISWIKQKVLIGANEDYRWLNKVNFSTTYLVGDSAGGNI  190

Query  595   VHQVA---KKCLQDGNCAAKIKGIMPIHPYFGSERRTAAE---VAAEGSTGSSVAMNDMF  434
              + VA   +  + D      +KGI+ I P+FG E RT +E   + +  S  ++V+  D +
Sbjct  191   AYNVAIMLRSKMGDLK-PITLKGIILIQPFFGGESRTYSEKYIIQSPRSALTNVSA-DTY  248

Query  433   WRLSLPEGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRR  260
             WRL+LP G NRD   CN      +++ +    P  LV ++  D L++R + +   L R
Sbjct  249   WRLALPTGVNRDHPWCNPIGRESVNLVDTRNIPRILVCISELDILRDRNLEFCATLNR  306



>ref|XP_009421110.1| PREDICTED: probable carboxylesterase 17 [Musa acuminata subsp. 
malaccensis]
Length=341

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 114/299 (38%), Positives = 165/299 (55%), Gaps = 24/299 (8%)
 Frame = -2

Query  1120  FHPQNTQISNLQKMSIIVDEAPGYIQVFSDGTVKRFSP--EIATASAESTDGFKSKDVVI  947
             FHP+   I        +++E  G I+V+ DG V+R     E+    A   D   SKDV +
Sbjct  15    FHPREEDIGP------VIEEIEGLIKVYRDGHVERLPAVVEVPCTWAPEPD-VVSKDVAV  67

Query  946   DPSKPITGRIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksv  767
               S  +  R +VP+L  +K     LP+L+YFHGGGFCVGS +W  YH FL RL+ Q+  V
Sbjct  68    GHSAGLWARFYVPELRKQK-----LPLLVYFHGGGFCVGSASWRCYHEFLARLASQASCV  122

Query  766   vvsVDYRLAPENKLPIAYEDCYAALEWVQKNQKAEPCLE------SADLSRVFLAGDSAG  605
             V+SV+YRLAPE++LP AYED  A + WV +        E        D +RVFL GDSAG
Sbjct  123   VLSVNYRLAPEHRLPAAYEDGLAVMRWVTQQASHRGPDELGWWRARCDFARVFLGGDSAG  182

Query  604   GNIVHQVAKKCLQDGNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAM--NDMFW  431
               I + VA + L      A ++G++ I P+FG   RT++E     S+ S++++  +D +W
Sbjct  183   AAIAYNVAVQ-LGSLGVPACLRGVILIQPFFGGVARTSSEKNTMQSSRSALSLTTSDCYW  241

Query  430   RLSLPEGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             R++LP G++RD   CN        + E LR P  LV V+  D L++R +   E +   G
Sbjct  242   RMALPPGTDRDHPWCNPLAKSSPKL-EDLRLPPLLVCVSELDILRDRNLELCEAMSSAG  299



>ref|XP_006373441.1| hypothetical protein POPTR_0017s13800g [Populus trichocarpa]
 gb|ERP51238.1| hypothetical protein POPTR_0017s13800g [Populus trichocarpa]
Length=329

 Score =   171 bits (433),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 111/290 (38%), Positives = 159/290 (55%), Gaps = 25/290 (9%)
 Frame = -2

Query  1075  IIVDEAPGYIQVFSDGTVKR--FSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDL  902
             +I +E  G I+V+ DG ++R    P +    A   D   +KDVVID    +  RI+V   
Sbjct  8     VISEEIEGLIRVYKDGRIERPPIVPNVPCNVAP-VDDVTAKDVVIDKFTNLWARIYV---  63

Query  901   WPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLP  722
                 ++  +LP+L+YFHGGGFCV S  W+ YH FL  L+ ++  ++VSV+YRLAPEN+LP
Sbjct  64    ---TKRSGILPLLVYFHGGGFCVASAAWICYHEFLANLASKAGCIIVSVNYRLAPENRLP  120

Query  721   IAYEDCYAALEWV-QKNQKAEP----CLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGN  557
              AYED    L WV Q+     P     L   + S +FLAGDSAG NI + +A +     N
Sbjct  121   TAYEDGIKTLMWVKQQTLNCSPEHNWWLSRCNFSSLFLAGDSAGANIAYNMATRLGSSNN  180

Query  556   --CAAK----IKGIMPIHPYFGSERRTAAE--VAAEGSTGSSVAMNDMFWRLSLPEGSNR  401
               C       +KGI+ I P+FG E RT +E  +    ++  +++ +D +W LSLP GS R
Sbjct  181   PDCMTIKPLCLKGIILIQPFFGGEARTLSEKNMTQPANSALTLSASDTYWLLSLPLGSTR  240

Query  400   DFYGCN-LENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             D   CN L N       +  RFPA +V ++  D LK+R + +   L   G
Sbjct  241   DHPYCNPLANGASKLRDQ--RFPATMVCISEMDILKDRNLEFCAALVNAG  288



>ref|XP_010558554.1| PREDICTED: probable carboxylesterase 17 [Tarenaya hassleriana]
Length=337

 Score =   171 bits (433),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 114/283 (40%), Positives = 163/283 (58%), Gaps = 20/283 (7%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPE  893
             +V+E    ++VFSDG V+R         +  +D  K     I  +  I  R++VP     
Sbjct  24    VVEEIDPLLRVFSDGCVERPPVVPTVPPSVLSDPSKLTASDIKLTNDIWTRVYVP-----  78

Query  892   KEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAY  713
                   LP+L+YFHGGGFCVGS +W  YH FL  ++V+ + V+VSV+YRLAPE++LP AY
Sbjct  79    AGHHTPLPLLVYFHGGGFCVGSASWGCYHEFLCNVAVKVRCVIVSVNYRLAPEHRLPAAY  138

Query  712   EDCYAALEWVQ-----KNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAA  548
             ED    + W++     KNQK+   L   DLS VFL GDSAG NI + VA +    G    
Sbjct  139   EDGETVIAWIKQQAFDKNQKS--WLSKCDLSSVFLVGDSAGANIAYHVAVRLTASGRSVN  196

Query  547   KI--KGIMPIHPYFGSERRTAAE-VAAEGSTGSSVAM--NDMFWRLSLPEGSNRDFYGCN  383
              +  KGI+ I P+FG E RTA+E V+ + ++ S++ M  +D +WRL+LP G+ RD   C 
Sbjct  197   PLNFKGIVLIQPFFGGESRTASEKVSDKKNSNSALTMSASDTYWRLALPRGATRDHQWC-  255

Query  382   LENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
               N    S+ E  +FPAA+V V+  D LK+R +   + +R  G
Sbjct  256   --NPNPASLREAGKFPAAMVMVSEMDVLKDRNLEMCKMMRGCG  296



>gb|ABD96915.1| hypothetical protein [Cleome spinosa]
Length=337

 Score =   171 bits (433),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 114/283 (40%), Positives = 163/283 (58%), Gaps = 20/283 (7%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPE  893
             +V+E    ++VFSDG V+R         +  +D  K     I  +  I  R++VP     
Sbjct  24    VVEEIEPLLRVFSDGCVERPPVVPTVPPSVLSDPSKLTASDIKLTNDIWTRVYVP-----  78

Query  892   KEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAY  713
                   LP+L+YFHGGGFCVGS +W  YH FL  ++V+ + V+VSV+YRLAPE++LP AY
Sbjct  79    AGHHTPLPLLVYFHGGGFCVGSASWGCYHEFLCNVAVKVRCVIVSVNYRLAPEHRLPAAY  138

Query  712   EDCYAALEWVQ-----KNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAA  548
             ED    + W++     KNQK+   L   DLS VFL GDSAG NI + VA +    G    
Sbjct  139   EDGETVIAWIKQQAFDKNQKS--WLSKCDLSSVFLVGDSAGANIAYHVAVRLTASGRSVN  196

Query  547   KI--KGIMPIHPYFGSERRTAAE-VAAEGSTGSSVAM--NDMFWRLSLPEGSNRDFYGCN  383
              +  KGI+ I P+FG E RTA+E V+ + ++ S++ M  +D +WRL+LP G+ RD   C 
Sbjct  197   PLNFKGIVLIQPFFGGESRTASEKVSDKKNSNSALTMSASDTYWRLALPRGATRDHQWC-  255

Query  382   LENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
               N    S+ E  +FPAA+V V+  D LK+R +   + +R  G
Sbjct  256   --NPNPASLREAGKFPAAMVMVSEMDVLKDRNLEMCKMMRGCG  296



>ref|XP_009791632.1| PREDICTED: probable carboxylesterase 17 [Nicotiana sylvestris]
Length=341

 Score =   171 bits (433),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 110/301 (37%), Positives = 166/301 (55%), Gaps = 27/301 (9%)
 Frame = -2

Query  1108  NTQISNLQKMSIIV-DEAPGYIQVFSDGTVKR--FSPEIATASAESTDGFKSKDVVIDPS  938
             N +  +LQ+  ++V +E  G I+V+++G ++R    P +   S        +KDV++   
Sbjct  14    NVRKDHLQQHGVVVLEEIDGLIKVYNNGHIERPQIVPNVPHYSLPQELSVTAKDVILHNP  73

Query  937   KPITGRIFVPD-LWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvv  761
               +  RI++P+ L P  +    LP+L+YFHGGGFCVGS  W  YH FL  L+ +   V++
Sbjct  74    TNLWSRIYLPNTLIPATK----LPLLVYFHGGGFCVGSVAWKCYHDFLANLASKIGCVIM  129

Query  760   sVDYRLAPENKLPIAYEDCYAALEWVQKNQKAEPCLES------ADLSRVFLAGDSAGGN  599
             SV+YRLAPEN+LP AY+D   A+ W+ KNQ      E        + S +FL+GDSAG N
Sbjct  130   SVNYRLAPENRLPAAYDDGVHAITWL-KNQALANSKEQNWWSSKCNFSNLFLSGDSAGAN  188

Query  598   IVHQVAKKCLQDGNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAM--NDMFWRL  425
             I + VA +          +KG++ I P+FG E RT +E  +     S++ +  +D +WRL
Sbjct  189   IAYHVATRLNSYNLKPLSLKGLILIQPFFGGESRTHSEKYSIQPPYSALNLSASDTYWRL  248

Query  424   SLPEGSNRDFYGCN--LENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGV  251
             +LP GSNRD   C   L N+        LR P+ LV ++  D LK+R +     L   G+
Sbjct  249   ALPIGSNRDHPWCKPRLSNN--------LRLPSTLVCISETDLLKDRNLELCSALADAGI  300

Query  250   K  248
             K
Sbjct  301   K  301



>ref|XP_010916828.1| PREDICTED: probable carboxylesterase 2 [Elaeis guineensis]
Length=318

 Score =   170 bits (431),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 111/274 (41%), Positives = 151/274 (55%), Gaps = 15/274 (5%)
 Frame = -2

Query  1051  YIQVFSDGTVKRFSP-EIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPEKEQVEL  875
             +I+ + DG V+R  P ++ + S + T G  SKDV+ID    ++ R++ PDL    +  + 
Sbjct  15    FIRTYRDGRVERLVPTDVVSPSLDPTTGVTSKDVMIDRETNVSARLYHPDL-ASFDPSQK  73

Query  874   LPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYEDCYAA  695
             LP+L+YFHGGGFC GS  W  YH +L  L  ++K V VSVDYRLAPEN +P AYED + A
Sbjct  74    LPILVYFHGGGFCFGSPFWTLYHNYLNSLVAKAKVVAVSVDYRLAPENPIPAAYEDSWQA  133

Query  694   LEWVQKNQK---AEPCL-ESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGIMP  527
             L+WV  + +   +EP L E  DLSRVFLAGDSAG NIVH +A +        A+I+G++ 
Sbjct  134   LQWVVSHSEGAGSEPWLAERGDLSRVFLAGDSAGANIVHNMAMR------AKARIEGVVL  187

Query  526   IHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVGEW  347
             +HP+F    R   E   +          D+ W    P     D    N       S+   
Sbjct  188   VHPFFWGSERMGCEKDRDDKPLLDPVTTDLVWPFVCPGAVGSDDPRLNPMAKGGPSLAG-  246

Query  346   LRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKW  245
             L     LV VA KD L++RG  Y E L  KG +W
Sbjct  247   LGCGRVLVVVAEKDLLRDRGRAYYEAL--KGSRW  278



>ref|XP_011008304.1| PREDICTED: probable carboxylesterase 6 [Populus euphratica]
Length=351

 Score =   171 bits (433),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 114/297 (38%), Positives = 164/297 (55%), Gaps = 26/297 (9%)
 Frame = -2

Query  1093  NLQKMSIIVDEAPGYIQVFSDGTVKRFSPEIA---TASAESTDGFKSKDVVIDPSKPITG  923
             +  +  ++ +E  G I+ + DG V+R  P+I    T++     G  S+D VID    I  
Sbjct  22    DCHQHGVVAEEIDGLIKAYKDGRVER--PQIVPCVTSTLAPGLGVTSRDTVIDNFTNIWA  79

Query  922   RIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRL  743
             R +VP     K     LP+L+YFHGGGFCVGS  W  YH FL RL+ ++  +++SV+YRL
Sbjct  80    RFYVPIKIHGK-----LPLLVYFHGGGFCVGSAAWSCYHDFLARLAAKANCIIMSVNYRL  134

Query  742   APENKLPIAYEDCYAALEWVQKNQKAEPCLES-----ADLSRVFLAGDSAGGNIVHQVAK  578
             APEN LP AY+D   AL W+ K Q    C ++      + S VFLAGDSAG NI   V  
Sbjct  135   APENPLPAAYDDGIKALMWL-KQQALSVCTDNWWTSQWNFSDVFLAGDSAGANIAFNVIT  193

Query  577   K--CLQDGNCAAKI-----KGIMPIHPYFGSERRTAAEVAAEGSTGSS--VAMNDMFWRL  425
             +      G   A I     KG++ I P+FG E RT +E  +  S  S+  +A +D +WRL
Sbjct  194   RLDSFNAGQADAAIKPLTLKGMILIQPFFGGEARTHSEKHSVQSPRSALNLAASDTYWRL  253

Query  424   SLPEGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             +LP G+NRD   CN      + + +++RFP  +V ++  D LK+R + +   L R G
Sbjct  254   ALPCGANRDHPWCNPLAKGSVKLEDFVRFP-IMVCISEMDILKDRSLEFVASLGRAG  309



>ref|XP_009357117.1| PREDICTED: probable carboxylesterase 17 [Pyrus x bretschneideri]
Length=428

 Score =   173 bits (438),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 112/297 (38%), Positives = 163/297 (55%), Gaps = 25/297 (8%)
 Frame = -2

Query  1093  NLQKMSIIVDEAPGYIQVFSDGTVKR--FSPEIATASAESTDGFKSKDVVIDPSKPITGR  920
             N  +  +I++E  G I+V  DG ++R    P + +  A    G  +KDVVID    +  R
Sbjct  23    NPNQHGVILEEIEGLIRVHKDGYIERPLMIPSVPSTLALPP-GVTAKDVVIDKFTNLWAR  81

Query  919   IFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLA  740
             I+VP           LPV++YFHGGGFCVGS  W  YH FL +L+ Q+  V++SV+YRLA
Sbjct  82    IYVP------SHPGNLPVIVYFHGGGFCVGSAAWSCYHDFLAKLASQASCVIISVNYRLA  135

Query  739   PENKLPIAYEDCYAALEWVQKNQKAEPC-----LESADLSRVFLAGDSAGGNIVHQVAKK  575
             PE++LP AY+D +  L WV++   +E       L   +LS +F+ GDSAG NI + V   
Sbjct  136   PESRLPAAYDDGFKTLMWVKQQALSESTEQKWWLSKCNLSSLFIGGDSAGANIAYNVTT-  194

Query  574   CLQDGNCAAKI------KGIMPIHPYFGSERRTAAEVAAEGSTGSSVAM--NDMFWRLSL  419
               Q G+C   I      KG + I P+FG E RT +E  A     S++++  +D +WRLSL
Sbjct  195   --QVGSCDPSILRPLSLKGTVLIQPFFGGEARTWSEKCATQPPYSALSLSSSDTYWRLSL  252

Query  418   PEGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVK  248
             P G++RD   CN   +  ++    LR P+ +V V+  D LK+R       L   G +
Sbjct  253   PLGASRDHPWCNPLVNASVAKLRDLRLPSMMVCVSELDILKDRNFELCNALSSIGTR  309



>ref|XP_011021229.1| PREDICTED: probable carboxylesterase 17 [Populus euphratica]
Length=342

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 111/290 (38%), Positives = 158/290 (54%), Gaps = 25/290 (9%)
 Frame = -2

Query  1075  IIVDEAPGYIQVFSDGTVKR--FSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDL  902
             +I +E  G I+V+ DG ++R    P +    A   D   +KDVVID    +  RI+V   
Sbjct  21    VISEEIEGLIRVYRDGRIERPPIVPNVPRNVAP-VDDVTAKDVVIDKFTNLWARIYV---  76

Query  901   WPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLP  722
                 ++  +LP+L+YFHGGGFCV S  W+ YH FL  L+ ++  ++VSV+YRLAPEN+LP
Sbjct  77    ---TKRSGILPLLVYFHGGGFCVASAAWICYHEFLANLASKAGCIIVSVNYRLAPENRLP  133

Query  721   IAYEDCYAALEWV-QKNQKAEP----CLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGN  557
              AYED    L WV Q+     P         + S +FLAGDSAG NI + +A +     N
Sbjct  134   TAYEDGIKTLMWVKQQTLNCSPEHNWWFSRCNFSSLFLAGDSAGANIAYNMATRLGSSNN  193

Query  556   CAAKI------KGIMPIHPYFGSERRTAAE--VAAEGSTGSSVAMNDMFWRLSLPEGSNR  401
                 I      KGI+ I P+FG E RT +E  +A   ++  +++ +D +W LSLP GS R
Sbjct  194   PDCMIIKPLCLKGIILIQPFFGGEARTLSEKNMAQPANSALTLSASDTYWLLSLPLGSTR  253

Query  400   DFYGCN-LENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             D   CN L N       +  RFPA +V ++  D LK+R + +   L   G
Sbjct  254   DHPCCNPLANGASKLRDQ--RFPATMVCISEMDILKDRNLEFCAALVNAG  301



>ref|XP_006430794.1| hypothetical protein CICLE_v10012053mg [Citrus clementina]
 gb|ESR44034.1| hypothetical protein CICLE_v10012053mg [Citrus clementina]
Length=357

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 109/288 (38%), Positives = 163/288 (57%), Gaps = 20/288 (7%)
 Frame = -2

Query  1075  IIVDEAPGYIQVFSDGTVKRFSPEIATASAEST--DGFKSKDVVIDPSKPITGRIFVPDL  902
             + ++E  G I+V+ +G V+R  P I       T      ++DV I+    +  R++VP  
Sbjct  20    VCIEEIEGLIRVYKNGQVER-PPAIPIVPCNVTLNGQVTARDVFINKYINLWARVYVPSC  78

Query  901   WPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLP  722
              P       LPVL+YFHGGGFCVGS  W  YH FL  L+ ++  V++S++YRLAPEN+LP
Sbjct  79    -PAGN----LPVLVYFHGGGFCVGSAAWSCYHEFLASLAYKAGCVIMSINYRLAPENRLP  133

Query  721   IAYEDCYAALEWVQK-----NQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGN  557
              AYED   +L W+++     + + +  +   + S +FLAGDSAG NI +  A +   D N
Sbjct  134   AAYEDGLNSLRWLKQQVLSGSSEHKWWMNQCNFSSLFLAGDSAGANIAYNAATRVAID-N  192

Query  556   CAAK---IKGIMPIHPYFGSERRTAAEVAAEGSTGS--SVAMNDMFWRLSLPEGSNRDFY  392
                K   +KGI+ I P+FG E RT +E  +     S  +V+ +D +WRLSLP G+NRD  
Sbjct  193   AVIKPLSVKGIILIQPFFGGESRTVSEKHSTQPANSALTVSASDAYWRLSLPVGTNRDHP  252

Query  391   GCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVK  248
              CN   +    + E LR P+ +V V+  D LK+R + +++ L   G K
Sbjct  253   WCNPLANATAGLQE-LRLPSVMVCVSELDILKDRNLEFSKALAGGGKK  299



>ref|XP_010692771.1| PREDICTED: probable carboxylesterase 17 [Beta vulgaris subsp. 
vulgaris]
Length=343

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 117/288 (41%), Positives = 160/288 (56%), Gaps = 24/288 (8%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIAT--ASAESTDGFKSKDVVIDPSKPITGRIFVPDLW  899
             +V+E  G I+V+ DG V+RF P I     S  S     S D+VID    +  R++VP   
Sbjct  24    LVEEIQGLIKVYKDGNVERF-PIIKNVPCSIPSELRVTSSDIVIDRFTNLWARLYVP---  79

Query  898   PEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPI  719
                 Q++L P+L+YFHGGGFCVGS  W  YH F+  L+ ++  VV+SV+YRLAPEN+LP 
Sbjct  80    --HAQMKL-PLLVYFHGGGFCVGSAEWSCYHDFISNLASKAGCVVLSVNYRLAPENRLPA  136

Query  718   AYEDCYAALEWVQK---NQKAEPC--LESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNC  554
             AYED Y  + WV+K   N   E    L   +LS  FLAGDSAG NI H VA +       
Sbjct  137   AYEDGYNTIMWVKKQAANSSGEHSWWLSRCNLSGFFLAGDSAGANIAHNVALRFGASKAE  196

Query  553   AAKI------KGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMN--DMFWRLSLPEGSNRD  398
              + I      +G + I P+FG E RTA+E A +   GS++ ++  D +WRLSLP GSNR+
Sbjct  197   RSNITRPLCHRGTILIQPFFGGEARTASEKAPQ-PQGSALTLSAADTYWRLSLPVGSNRE  255

Query  397   FYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
                CN   D    +   +  PA +V V+  D L +R   +   +   G
Sbjct  256   HPWCNPLADGAAKLKS-IELPATMVCVSDMDILMDRNKEFCSAMVNAG  302



>ref|XP_004142252.1| PREDICTED: probable carboxylesterase 15-like [Cucumis sativus]
 gb|KGN54059.1| hypothetical protein Csa_4G279870 [Cucumis sativus]
Length=320

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 120/318 (38%), Positives = 179/318 (56%), Gaps = 14/318 (4%)
 Frame = -2

Query  1075  IIVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWP  896
             I VDE  G ++V+SDG++ R S    +           KD++ DP   +  R++ P    
Sbjct  5     IEVDECRGVLRVYSDGSIVRSSNPSFSVPVLDDGSVLWKDLLFDPIHNLHLRLYKPAHIS  64

Query  895   EKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIA  716
               +    LPV  Y HGGGFC+GS TW     +  RL+ +  ++V+S DYRLAPEN+LP A
Sbjct  65    SPK----LPVFFYIHGGGFCIGSRTWPNCQNYCFRLASELSALVISPDYRLAPENRLPAA  120

Query  715   YEDCYAALEWVQKNQKA---EPCL-ESADLSRVFLAGDSAGGNIVHQVAKKCLQDGN---  557
              +D +AAL W+Q   ++   +P L E AD S VF++GDSAGGNI H +A   L  G+   
Sbjct  121   IDDGFAALRWLQAQAESDHPDPWLAEVADFSTVFISGDSAGGNIAHHLAVG-LGVGSPEL  179

Query  556   CAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLE  377
                +++G + + P+FG   RT +E         ++ + D FWRLS+P GSN D    N+ 
Sbjct  180   APVQVRGYVLLGPFFGGTVRTRSEAEGSKEAFLNLELIDRFWRLSIPIGSNTDHPLVNVF  239

Query  376   NDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvf  197
               R L++ E +     +V VAG D LK+R V Y E L+++G K +++VE EE+ H F   
Sbjct  240   GPRSLNL-EAVEMDPIVVVVAGADLLKDRAVEYVEELKKQGKK-IDLVEFEEKQHGFFTI  297

Query  196   HPDSEATRLLQKQMSEFI  143
              P+SEA+  L   ++ F+
Sbjct  298   DPNSEASNQLMLLINHFV  315



>ref|XP_009347690.1| PREDICTED: probable carboxylesterase 17 [Pyrus x bretschneideri]
Length=349

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 115/304 (38%), Positives = 162/304 (53%), Gaps = 29/304 (10%)
 Frame = -2

Query  1111  QNTQISNLQKMSIIVDEAPGYIQVFSDGTVKR--FSPEIATASAESTDGFKSKDVVIDPS  938
             Q T+ SN  +  ++++E  G I+V  DG V+R    P + +  A    G  +KDVVID  
Sbjct  19    QATRKSN--QHGVVLEEIEGLIRVHKDGYVERPPMIPSVPSTLALPP-GVAAKDVVIDKF  75

Query  937   KPITGRIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvs  758
               +  RI+VP           LP+++YFHGGGFCVGS  W  YH FL +L+ Q+  V++S
Sbjct  76    ANLWARIYVP------SHPGNLPMIVYFHGGGFCVGSAAWSCYHEFLAKLASQASCVIIS  129

Query  757   VDYRLAPENKLPIAYEDCYAALEWVQKNQKAEPC------LESADLSRVFLAGDSAGGNI  596
             V+YRLAP+N+LP AY+D + AL WV K Q    C      L   +LS +F+ GDSAG NI
Sbjct  130   VNYRLAPDNRLPAAYDDGFKALMWV-KQQALNECSEQKWWLSKCNLSSLFIGGDSAGANI  188

Query  595   VHQVAKKCLQDGNCAAKI------KGIMPIHPYFGSERRTAAEVAAEGSTGSSVAM--ND  440
              + V       G+C   I      KG + I P+FG E RT  E  A     S++ +  +D
Sbjct  189   AYHVTT---HSGSCDPSILRPLSLKGTVLIQPFFGGEARTWDEKCATQPPYSALTLSNSD  245

Query  439   MFWRLSLPEGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRR  260
              +WRLSLP G++RD   CN      +     L  P+ +V V+  D LK+R       L  
Sbjct  246   TYWRLSLPLGASRDHPWCNPLTKASVVKLRDLMLPSMMVCVSELDILKDRNFELCNALSS  305

Query  259   KGVK  248
              G++
Sbjct  306   MGIR  309



>ref|XP_004135407.1| PREDICTED: probable carboxylesterase 6-like [Cucumis sativus]
 ref|XP_004159320.1| PREDICTED: probable carboxylesterase 6-like [Cucumis sativus]
 gb|KGN52062.1| hypothetical protein Csa_5G608500 [Cucumis sativus]
Length=351

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 108/299 (36%), Positives = 164/299 (55%), Gaps = 24/299 (8%)
 Frame = -2

Query  1102  QISNLQKMSIIVDEAPGYIQVFSDGTVKRFSPEIATASAESTD---GFKSKDVVIDPSKP  932
              ++   +  ++V+E  G I+V+ +G V+R  P+I    + +     G  S DVV+D    
Sbjct  20    HVNGFDQHDVLVEEIEGLIRVYGNGYVER--PQIVPCVSNALPPELGVTSWDVVVDKLNN  77

Query  931   ITGRIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVD  752
             I  R ++P    EK     LP+++YFHGGGFCVGS  W  YH FL +LS ++  +++SV+
Sbjct  78    IWARFYIPTQCQEK-----LPLIVYFHGGGFCVGSAAWSCYHEFLAKLSAKANCIIMSVN  132

Query  751   YRLAPENKLPIAYEDCYAALEWVQK----NQKAEPCLESADLSRVFLAGDSAGGNIVHQV  584
             YRLAPEN LP  YED    L+W+++      K        D ++++L+GDSAGGNI   V
Sbjct  133   YRLAPENPLPAPYEDGLKTLQWLKQVAFVGGKQNWWSRYCDFTKIYLSGDSAGGNIAFNV  192

Query  583   AK----KCLQDGNCAAK---IKGIMPIHPYFGSERRTAAE--VAAEGSTGSSVAMNDMFW  431
             A     K    G    K   IKG + I P+FG E RT +E  +     +  ++ ++D +W
Sbjct  193   AARLGGKTTASGAVILKPLVIKGSILIQPFFGGESRTKSEKFLVQPPRSPLTLGVSDTYW  252

Query  430   RLSLPEGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             RL+LP G+NRD   CN  + + L   E LR   +L+ ++  D LK+R + +   L R G
Sbjct  253   RLALPSGTNRDHPWCN-PSTKGLFTVEDLRVLPSLICISEMDILKDRNLEFCSALHRAG  310



>ref|XP_002278939.1| PREDICTED: probable carboxylesterase 6 [Vitis vinifera]
Length=359

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 107/287 (37%), Positives = 158/287 (55%), Gaps = 19/287 (7%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIA---TASAESTDGFKSKDVVIDPSKPITGRIFVPDL  902
             +V+E  G I+V+ DG V+R  P+I    T+   S  G    D+VI     I  R +VP +
Sbjct  29    VVEEIHGLIRVYKDGHVER--PQIVPCVTSLLPSDLGVTCGDIVIHKLTNIWARFYVPAV  86

Query  901   WPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLP  722
                 +    LP+L+YFHGGGFCVGS  W  YH FL RL+ ++  +++SV+YRLAPEN LP
Sbjct  87    RCHGK----LPLLVYFHGGGFCVGSAAWSCYHDFLARLAAKAGCLIMSVNYRLAPENPLP  142

Query  721   IAYEDCYAALEWVQKNQ---KAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCA  551
              AYED + A  W+++      +E    + + S +FLAGDSAGGNI H ++ +   +    
Sbjct  143   AAYEDGFKAFLWLKQEAVSGASEWWSRACNFSSIFLAGDSAGGNIAHHLSLRLGSNRASE  202

Query  550   AK------IKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYG  389
             A        KG + I P+FG E RT +E      +  S+  +D +WRLSLP G+NRD   
Sbjct  203   ATALKPLVFKGTILIQPFFGGEARTHSEKQMVSPSVLSLTASDTYWRLSLPYGANRDHPW  262

Query  388   CNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVK  248
             CN  +   + + E LR    +V ++  D L++R + +   L   G +
Sbjct  263   CNPMSKGSIKLLE-LRLLPTMVCISEMDILRDRNLEFCSALASAGKR  308



>gb|KHN05581.1| Putative carboxylesterase 17 [Glycine soja]
Length=344

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 117/289 (40%), Positives = 160/289 (55%), Gaps = 28/289 (10%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIA---TASAESTD-GFKSKDVVIDPSKPITGRIFVPD  905
             +V+E  G I+V  DG V+R  P++    TAS  S +    S+D+VID    I  R +VP 
Sbjct  27    VVEEIQGLIRVHKDGYVER--PQVVPCVTASTMSPELNVTSRDMVIDSVTNIWARFYVP-  83

Query  904   LWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKL  725
                   Q + +P+L++FHGGGFCVGS  W  YH FL RLS +   V++SV+YRLAPEN L
Sbjct  84    ----ISQHKKMPLLVFFHGGGFCVGSAAWSCYHDFLARLSTKVGCVIMSVNYRLAPENPL  139

Query  724   PIAYEDCYAALEWV--QKNQK---AEPCLESADLSRVFLAGDSAGGNIVHQVAKK-CLQD  563
             P  Y+D   A+ W+  Q N K    E      + S VFL GDSAG NI + VA + C  D
Sbjct  140   PAPYDDGLKAIMWLHQQHNNKGSGTEWWTSKCNFSSVFLGGDSAGANIAYNVATRLCACD  199

Query  562   GNCAA----KIKGIMPIHPYFGSERRTAAEVAAEGSTGSS--VAMNDMFWRLSLPEGSNR  401
             G         +KG++ I P+FG E RT +E     S GS+  +A +D +WRL+LP G+ R
Sbjct  200   GAALTLRPMNLKGLILIQPFFGGEVRTDSEKGMAQSPGSALNLAASDSYWRLALPCGAKR  259

Query  400   DFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             D   CN      L   E L+    LV ++  D LK+R + + + L R G
Sbjct  260   DHPWCN-----PLVKLEELKLMRTLVCISEMDILKDRNLEFCDALVRAG  303



>ref|XP_002305152.2| hypothetical protein POPTR_0004s10090g [Populus trichocarpa]
 gb|EEE85663.2| hypothetical protein POPTR_0004s10090g [Populus trichocarpa]
Length=322

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 109/301 (36%), Positives = 162/301 (54%), Gaps = 33/301 (11%)
 Frame = -2

Query  1120  FHPQNTQISNLQKMSIIVDEAPGYIQVFSDGTVKR--FSPEIATASAESTDGFKSKDVVI  947
             F P+  + ++     +I +E  G I+V+ DG ++R    P +    A   D   +KDVVI
Sbjct  6     FDPRINRQTSKNSHGVITEEIEGLIRVYKDGHIERPPIIPNVPCNVATVND-VTAKDVVI  64

Query  946   DPSKPITGRIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksv  767
             D    +  RI+V +      +   LP+L+YFHGGGFCVGS +W GYH FL  L+ ++  +
Sbjct  65    DKFTNLWARIYVSN------RSGTLPLLVYFHGGGFCVGSASWSGYHEFLANLASKASCI  118

Query  766   vvsVDYRLAPENKLPIAYEDCYAALEWVQKNQKAEPC-LESADLSRVFLAGDSAGGNIVH  590
             ++S++YRLAPEN+LP AYE               EP  L   + S +FLAGDSAG NI +
Sbjct  119   ILSINYRLAPENRLPTAYE---------------EPGWLSRCNFSSMFLAGDSAGANIAY  163

Query  589   QVAKKCLQDGNCAAK-----IKGIMPIHPYFGSERRTAAE--VAAEGSTGSSVAMNDMFW  431
              VA +     N  +       KGI+ I P+FG E RT +E  +    ++  +++ +D +W
Sbjct  164   NVATRLESRYNPESMTKPLCFKGIILIQPFFGGEARTLSEKNMTQPANSALTLSASDTYW  223

Query  430   RLSLPEGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGV  251
             RLSLP GSNRD   CN   +    + + LR P  +V ++  D LK+R   +   L R G 
Sbjct  224   RLSLPLGSNRDHPYCNPLANGASKLRD-LRLPTIMVGISELDILKDRNSEFCSALTRAGK  282

Query  250   K  248
             +
Sbjct  283   R  283



>ref|XP_011077141.1| PREDICTED: probable carboxylesterase 6 [Sesamum indicum]
Length=344

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 114/290 (39%), Positives = 162/290 (56%), Gaps = 34/290 (12%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIA---TASAESTDGFKSKDVVIDPSKPITGRIFVPDL  902
             +V+E  G I+V+ DG V+R  P+I    T S         +D++ID    I  R +VP+ 
Sbjct  33    VVEEIDGLIRVYIDGHVER--PQIVPYVTCSLAPELQVTCRDMIIDKYTNIWARFYVPNA  90

Query  901   WPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLP  722
                 ++   LP+L+YFHGGGFCVGS +W  YH FL  L+ + K ++VSV YRLAPEN LP
Sbjct  91    SLGNKK---LPLLVYFHGGGFCVGSPSWSCYHDFLANLASKIKCLIVSVSYRLAPENPLP  147

Query  721   IAYEDCYAALEWVQK------NQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKC--LQ  566
              AY+D    L W+++      N   +  +   D SR+FLAGDSAG NI + VA +   L 
Sbjct  148   AAYDDGVKTLVWLKQQAFAAGNHDHKWWINKCDFSRIFLAGDSAGANIAYNVALRVRPLM  207

Query  565   DGNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGS--SVAMNDMFWRLSLPEGSNRDFY  392
             D      IKG++ I P+FG E RT +E       GS  ++A +D +WRL+LP G+NRD  
Sbjct  208   D-----IIKGLILIQPFFGGESRTHSEKCMVQPPGSALTLAASDTYWRLALPAGANRDHP  262

Query  391   GCN--LENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVK  248
              CN  ++   E+ +         +V VA  D LK+R + +   L R+G K
Sbjct  263   WCNPVVKGATEVPI---------MVCVAEMDILKDRNMEFCGVLGREGRK  303



>ref|XP_008805243.1| PREDICTED: probable carboxylesterase 2 [Phoenix dactylifera]
Length=318

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 106/271 (39%), Positives = 144/271 (53%), Gaps = 13/271 (5%)
 Frame = -2

Query  1051  YIQVFSDGTVKRFSP-EIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPEKEQVEL  875
             +I+ + DG V+R  P +    S + T G  SKDV+ID    ++ R+++PDL       + 
Sbjct  15    FIRTYKDGRVERLLPTDFVPPSLDPTSGLTSKDVMIDRETNVSARLYLPDL-ASLHPSQK  73

Query  874   LPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYEDCYAA  695
             LP+L+YFHGGGFC+GS  W  YH  L  L  ++  V VSVDYRLAPEN +P AYED + A
Sbjct  74    LPILVYFHGGGFCIGSPFWTQYHNHLNSLVTRANVVAVSVDYRLAPENPIPAAYEDSWRA  133

Query  694   LEWVQKNQKA---EPCL-ESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGIMP  527
             L+WV  + +    EP L E  D SRVFLAGDSAG NIVH +           A+I+G++ 
Sbjct  134   LQWVVSHSEGAGPEPWLAEHGDFSRVFLAGDSAGANIVHNIVM------GAKARIEGVVL  187

Query  526   IHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVGEW  347
             +HP+F    R   E   +          D+ W L  P  +  D    N       S+   
Sbjct  188   LHPFFWGSERMGCEKNRDDKPLLDPVTTDLMWSLVCPGAAGSDDPRLNPMAKGAPSLAG-  246

Query  346   LRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             L     LV VA +D L++RG  Y E L+  G
Sbjct  247   LGCGRVLVVVAERDLLRDRGRAYYEALKGSG  277



>gb|KDP29384.1| hypothetical protein JCGZ_18305 [Jatropha curcas]
Length=342

 Score =   169 bits (428),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 107/287 (37%), Positives = 164/287 (57%), Gaps = 15/287 (5%)
 Frame = -2

Query  1075  IIVDEAPGYIQVFSDGTVKRFSPEIATASAESTD-GFKSKDVVIDPSKPITGRIFVPDLW  899
             +I +E  G I+V+ DG V+R     + A   +++ G  S+DVVID    +  R +VP   
Sbjct  22    VITEEIEGLIKVYKDGYVERSHIVASVAPKLASELGVMSQDVVIDKFTNVWARFYVPSSC  81

Query  898   PEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPI  719
                     LP+++YFHGGGFCVGS +W+ YH FL RL+ ++  +++SV+YRLAPEN LP 
Sbjct  82    HGNNNPNNLPLMIYFHGGGFCVGSASWICYHEFLARLASKANCLIMSVNYRLAPENPLPA  141

Query  718   AYEDCYAALEWVQKNQKAEPCL---ESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCA-  551
             A+ED   AL W++K   +E      +  + S++F+AGDSAG NI + +  + L   N   
Sbjct  142   AFEDGIKALMWLRKQGLSEEYYWWSKKCNFSKIFVAGDSAGANIAYNIITR-LSSSNGVL  200

Query  550   ----AKIKGIMPIHPYFGSERRTAAEVAAEGSTGS--SVAMNDMFWRLSLPEGSNRDFYG  389
                   IKG++ I P+FG E RT +E     ST S  ++A +D +WRL+LP  +NR+   
Sbjct  201   DMKPLTIKGLILIQPFFGGEVRTNSEKYLVQSTRSALTLASSDTYWRLALPRDANRNHPW  260

Query  388   CNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVK  248
             CN +   ++   E L     +VF++  D LK+R + +   L + G K
Sbjct  261   CNPQVGVKM---EKLMDLEIMVFISEMDILKDRNLEFVNGLCKAGKK  304



>ref|XP_010916155.1| PREDICTED: probable carboxylesterase 17 [Elaeis guineensis]
Length=348

 Score =   169 bits (428),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 109/288 (38%), Positives = 158/288 (55%), Gaps = 22/288 (8%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAE--STDGFKSKDVVIDPSKPITGRIFVPDLW  899
             +++E  G I+V+ +G V R  P ++             S+DVVI+ S  +  R +VP+  
Sbjct  26    VLEEIVGLIRVYKNGHVDRL-PAVSDVPCTWAPEANVTSRDVVINHSTGVWARFYVPN--  82

Query  898   PEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPI  719
               K Q  L P+LLYFHGGGFCVGS  W  YH FL RL+ ++  +++SV+YRLAPEN+LP 
Sbjct  83    --KAQGRL-PLLLYFHGGGFCVGSAAWSCYHEFLARLASRAGCLIMSVNYRLAPENRLPA  139

Query  718   AYEDCYAALEWVQKNQKAEPCLE------SADLSRVFLAGDSAGGNIVHQVAKK--CLQD  563
             AYED  AA  WV++        E        + +RVFL GDSAG +I H VA +   L D
Sbjct  140   AYEDGLAATRWVRQQASYGGSDEFNWWRTHCNFARVFLGGDSAGASIAHSVAAQLGSLGD  199

Query  562   GNCAAK---IKGIMPIHPYFGSERRTAAE--VAAEGSTGSSVAMNDMFWRLSLPEGSNRD  398
                  K   ++G++ I P+FG E RT +E  +     +  S+  +D +WR++LP G NRD
Sbjct  200   PETVLKPVCLRGVILIQPFFGGEARTESERNLVQASRSALSLTTSDCYWRMALPLGCNRD  259

Query  397   FYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
                CN        + E L+ P  LV ++  D L++R   + + LR  G
Sbjct  260   HPWCNPLAKSAPRL-EGLKLPPVLVCISEMDILRDRNQEFCKALRSAG  306



>gb|AAT72498.1| AT1G68620 [Arabidopsis lyrata subsp. petraea]
Length=212

 Score =   164 bits (416),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 124/193 (64%), Gaps = 3/193 (2%)
 Frame = -2

Query  955  VVIDPSKPITGRIFVPDLWPEKEQV-ELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvq  779
            VVID    +  R++VP +   K  V +LLP+++YFHGGGFCVGST+W  YH FL RLS +
Sbjct  1    VVIDNLTNVWARLYVPMMTTTKSSVSKLLPLIVYFHGGGFCVGSTSWSCYHEFLARLSSR  60

Query  778  sksvvvsVDYRLAPENKLPIAYEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGN  599
            S+ +V+SVDYRLAPEN LP AYED   A+ W+ K +      +  D  R+FLAGDSAGGN
Sbjct  61   SRCMVMSVDYRLAPENPLPAAYEDGVNAILWLNKARNDNLWTKLCDFGRIFLAGDSAGGN  120

Query  598  IVHQVAKKCLQDGNCAAKIKGIMPIHPYFGSERRTAAE--VAAEGSTGSSVAMNDMFWRL  425
            I  QVA +     +   KI+G + I P++G E RT +E  V    S+  ++  +D +WRL
Sbjct  121  IADQVAARLASTEDLTLKIEGTILIQPFYGGEERTESEKRVGNNKSSVRTLEGSDAWWRL  180

Query  424  SLPEGSNRDFYGC  386
            SLP G++R+   C
Sbjct  181  SLPRGADREHPYC  193



>ref|XP_003555229.2| PREDICTED: probable carboxylesterase 17-like [Glycine max]
Length=352

 Score =   169 bits (427),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 114/289 (39%), Positives = 160/289 (55%), Gaps = 24/289 (8%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKR--FSPEIATASAESTD-GFKSKDVVIDPSKPITGRIFVPDL  902
             +V+E  G I+V   G V+R    P +  +S  S +    S+D+ ID +     R +VP  
Sbjct  31    VVEEIQGLIRVHKHGYVERPQVVPCVTASSKMSPELNVTSRDMAIDSATNTWARFYVPI-  89

Query  901   WPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLP  722
                  Q + +P L+YFHGGGFCVGS  W  YH FL RLS + + V++SV+YRLAPEN LP
Sbjct  90    ----SQHKKMPFLVYFHGGGFCVGSAAWSCYHDFLARLSAKVECVIMSVNYRLAPENPLP  145

Query  721   IAYEDCYAALEWV------QKNQK--AEPCLESADLSRVFLAGDSAGGNIVHQVAKK-CL  569
               Y+D   A+ WV      Q++ K  +E      + S VFL GDSAG NI + VA + C 
Sbjct  146   APYDDGLKAIMWVKQQMLHQQHNKGGSEWWTSKCNFSSVFLGGDSAGANIAYNVATRLCA  205

Query  568   QDGNC--AAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSS--VAMNDMFWRLSLPEGSNR  401
              DG       +KG++ I P+FG E RT +E     S GS+  +A +D +WRL+LP G+NR
Sbjct  206   CDGAALRPLNLKGLILIQPFFGGEVRTGSEKCMAQSPGSALNLAASDTYWRLALPCGANR  265

Query  400   DFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             D   CN     +L   E L+    LV ++  D LK+R + + + L R G
Sbjct  266   DHPWCNPLVKVKL---EELKLMRTLVCISEMDILKDRNLEFCDALVRAG  311



>ref|XP_002311450.1| hypothetical protein POPTR_0008s11720g [Populus trichocarpa]
 gb|EEE88817.1| hypothetical protein POPTR_0008s11720g [Populus trichocarpa]
Length=349

 Score =   168 bits (426),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 121/332 (36%), Positives = 175/332 (53%), Gaps = 27/332 (8%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIA---TASAESTDGFKSKDVVIDPSKPITGRIFVPDL  902
             + +E  G I+V+ D  V+R  P+I    T+      G  S+DVVID    I  R +V   
Sbjct  26    VTEEIDGLIKVYKDEHVER--PKIVPCVTSDLPHELGVTSRDVVIDKFTNIWARFYVSIK  83

Query  901   WPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLP  722
                K     LP+L+YFHGGGFCVGS  W  YH FL RL+ ++ S+++SV+YRLAPE+ LP
Sbjct  84    CHGK-----LPLLVYFHGGGFCVGSAAWSCYHDFLARLAAETSSIIMSVNYRLAPESPLP  138

Query  721   IAYEDCYAALEWVQKNQKAEPC----LESADLSRVFLAGDSAGGNIVHQVAKK--CLQDG  560
              AY+D   AL W+++   +           + S +FLAGDSAG NI + +  +      G
Sbjct  139   AAYDDGIKALMWLKQQALSVGADNWWTSQCNFSNIFLAGDSAGANIAYNIITRPGSFNAG  198

Query  559   NCAAKIK-----GIMPIHPYFGSERRTAAE--VAAEGSTGSSVAMNDMFWRLSLPEGSNR  401
               AA +K     GI+ I P+FG E RT +E  +     +  S+A +D +WRL+LP GSNR
Sbjct  199   QAAAAMKPLSLRGIVLIQPFFGGEARTNSEKYLVQSPRSALSLAASDTYWRLALPCGSNR  258

Query  400   DFYGCN-LENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveae  224
             D   CN L    ++ + + LRFP  +V ++  D LK+R + +   L R G     VV   
Sbjct  259   DHPWCNPLAKGLDVELEDLLRFP-IMVCISEMDILKDRSLEFVASLDRAGKMVEHVVHKG  317

Query  223   eeghvfhvfHPDSEATRLLQ--KQMSEFIHGV  134
                    +       TR L+   Q+ +FI G+
Sbjct  318   VGHAFQILSKSQLSRTRTLEMMSQIKDFISGI  349



>ref|XP_006482268.1| PREDICTED: probable carboxylesterase 17-like [Citrus sinensis]
 gb|KDO58971.1| hypothetical protein CISIN_1g019624mg [Citrus sinensis]
Length=338

 Score =   168 bits (425),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 108/288 (38%), Positives = 163/288 (57%), Gaps = 20/288 (7%)
 Frame = -2

Query  1075  IIVDEAPGYIQVFSDGTVKRFSPEIATASAEST--DGFKSKDVVIDPSKPITGRIFVPDL  902
             + ++E  G I+V+ +G V+R  P I       T      ++DV I+    +  R++VP  
Sbjct  20    VCIEEIEGLIRVYKNGQVER-PPAIPIVPCNVTLNGQVTARDVFINKYINLWARVYVPSC  78

Query  901   WPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLP  722
              P       LPVL+YFHGGGFCVGS  W  YH FL  L+ ++  V++S++Y LAPEN+LP
Sbjct  79    -PAGN----LPVLVYFHGGGFCVGSAAWSCYHEFLASLAYKAGCVIMSINYLLAPENRLP  133

Query  721   IAYEDCYAALEWVQK-----NQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGN  557
              AYED   +L W+++     + + +  +   + S +FLAGDSAG NI + V+ +   D N
Sbjct  134   AAYEDGLNSLMWLKQQILSGSSEHKWWMNQCNFSSLFLAGDSAGANIAYNVSTRVAID-N  192

Query  556   CAAK---IKGIMPIHPYFGSERRTAAEVAAEGSTGS--SVAMNDMFWRLSLPEGSNRDFY  392
                K   +KGI+ I P+FG E RT +E  +     S  +V+ +D +WRLSLP G+NRD  
Sbjct  193   AVIKPLCVKGIILIQPFFGGESRTVSEKHSTQPANSALTVSASDAYWRLSLPVGTNRDHP  252

Query  391   GCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVK  248
              CN   +    + E LR P+ +V V+  D LK+R + +++ L   G K
Sbjct  253   WCNPLANATAGLQE-LRLPSVMVCVSELDILKDRDLEFSKALAGAGKK  299



>gb|KHN11435.1| Putative carboxylesterase 17 [Glycine soja]
Length=347

 Score =   168 bits (426),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 114/289 (39%), Positives = 160/289 (55%), Gaps = 24/289 (8%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKR--FSPEIATASAESTD-GFKSKDVVIDPSKPITGRIFVPDL  902
             +V+E  G I+V   G V+R    P +  +S  S +    S+D+ ID +     R +VP  
Sbjct  26    VVEEIQGLIRVHKHGYVERPQVVPCVTASSKMSPELNVTSRDMAIDSATNTWARFYVP--  83

Query  901   WPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLP  722
                  Q + +P L+YFHGGGFCVGS  W  YH FL RLS + + V++SV+YRLAPEN LP
Sbjct  84    ---ISQHKKMPFLVYFHGGGFCVGSAAWSCYHDFLARLSAKVECVIMSVNYRLAPENPLP  140

Query  721   IAYEDCYAALEWV------QKNQK--AEPCLESADLSRVFLAGDSAGGNIVHQVAKK-CL  569
               Y+D   A+ WV      Q++ K  +E      + S VFL GDSAG NI + VA + C 
Sbjct  141   APYDDGLKAIMWVKQQMLHQQHNKGGSEWWTSKCNFSSVFLGGDSAGANIAYNVATRLCA  200

Query  568   QDGNC--AAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSS--VAMNDMFWRLSLPEGSNR  401
              DG       +KG++ I P+FG E RT +E     S GS+  +A +D +WRL+LP G+NR
Sbjct  201   CDGAALRPLNLKGLILIQPFFGGEVRTGSEKCMAQSPGSALNLAASDTYWRLALPCGANR  260

Query  400   DFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             D   CN     +L   E L+    LV ++  D LK+R + + + L R G
Sbjct  261   DHPWCNPLVKVKL---EELKLMRTLVCISEMDILKDRNLEFCDALVRAG  306



>gb|AFK46820.1| unknown [Medicago truncatula]
 gb|KEH21489.1| alpha/beta hydrolase fold protein [Medicago truncatula]
Length=351

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 104/290 (36%), Positives = 167/290 (58%), Gaps = 25/290 (9%)
 Frame = -2

Query  1054  GYIQVFSDGTVKRFSPEIA---TASAESTDGFKSKDVVIDPSKPITGRIFVP-DLWPEKE  887
             G I+V  DG V+R  P+I    +   +S +G  S+D+ I+    +  R+++P        
Sbjct  27    GLIKVHKDGHVER--PQIVPNVSCKLQSENGVTSRDITINKETNLWARVYLPTSTLTSHN  84

Query  886   QVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYED  707
              +  LP+L+YFHGGGFCVGS +W+ YH FL  LS+++  VVVS +YRLAPEN+LP AY+D
Sbjct  85    NLNKLPLLVYFHGGGFCVGSVSWICYHEFLNNLSLKANCVVVSFNYRLAPENRLPSAYDD  144

Query  706   CYAALEWVQK----NQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAA---  548
              + AL W++     N+     L+  ++S +FL GDSAG NI + +    L   + A+   
Sbjct  145   AFNALMWIKHEALYNKNQSWWLKHCNISSLFLCGDSAGANIAYNIVATRLGSNSNASSCL  204

Query  547   -----KIKGIMPIHPYFGSERRTAAE--VAAEGSTGSSVAMNDMFWRLSLPEGSN--RDF  395
                   +KG++ I P+FG E RT +E     + ++  S++++D +WRLSLP G +  R+ 
Sbjct  205   NLNPLSLKGVILIQPFFGGEERTNSEKLFRQQQNSALSLSVSDTYWRLSLPIGVSVTRNH  264

Query  394   YGCN-LENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVK  248
               CN L N   ++    LR P+ ++ V+  D L++R + ++  L + G K
Sbjct  265   PYCNPLANG--IAKLRDLRVPSIMMCVSELDILRDRNLEFSNCLVKAGKK  312



>ref|XP_008352926.1| PREDICTED: probable carboxylesterase 6 [Malus domestica]
Length=392

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 111/324 (34%), Positives = 169/324 (52%), Gaps = 53/324 (16%)
 Frame = -2

Query  1087  QKMSIIVDEAPGYIQVFSDGTVKRFSPEIA---TASAESTDGFKSKDVVIDPSKPITGRI  917
             Q+   +++E  G I+V+ DG V+R  P+I    T +     G  SKDVVID    I  R 
Sbjct  31    QQYETVIEEIEGLIKVYKDGHVER--PQIVPCVTGAVAPELGVTSKDVVIDKFTNIWSRF  88

Query  916   FVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAP  737
             +VP    ++     LP+L+YFHGGGFCVGS  W  YH FL +L+ +   +++SV+YRL P
Sbjct  89    YVPKC--QENNKMKLPLLVYFHGGGFCVGSAAWSCYHDFLAKLASKLGCLIMSVNYRLVP  146

Query  736   ENKLPIAYEDCYAALEWVQKNQKAEPCLES--------ADLSRVFLAGDSAGGNIVHQVA  581
             E+ LP AYED + ++ W+++   ++    +         D SR+FL GDSAG NI H VA
Sbjct  147   EHPLPAAYEDGFNSIMWLKQQALSQRGANNNNTWWSMQCDFSRIFLVGDSAGANIAHNVA  206

Query  580   KKCLQDGNCAAK------------------------------IKGIMPIHPYFGSERRTA  491
              +    G    +                              +KG + + P+FG E RT+
Sbjct  207   TRLYTRGGSVFESPSTDQYRLHQSNSYRPCDEGIISSTKPLIVKGTILLQPFFGGEARTS  266

Query  490   AE---VAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVGEWLR--FPAAL  326
             +E   +  +  +  SVA +D +WRL+LP G+NRD   CN    +  S G  L+  +P  +
Sbjct  267   SEKYNMVKQPRSVLSVAASDSYWRLALPRGANRDHPFCNXM--KSSSDGGTLKAGWP-TM  323

Query  325   VFVAGKDFLKERGVMYAEFLRRKG  254
             V ++  D LK+R + + E LR++G
Sbjct  324   VCISEMDILKDRNLEFCEALRKRG  347



>ref|XP_010102838.1| putative carboxylesterase 6 [Morus notabilis]
 gb|EXB94198.1| putative carboxylesterase 6 [Morus notabilis]
Length=362

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 111/304 (37%), Positives = 157/304 (52%), Gaps = 37/304 (12%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATA------SAESTDGFKSKDVVIDPSKPITGRIFV  911
             +V+E  G I+V+ +G V+R  P+I         S E      S+D+VID SK I  R +V
Sbjct  27    VVEEIEGLIRVYKEGKVER--PQIVPCVEASFLSPEYQGVVNSRDIVIDKSKNIWARFYV  84

Query  910   P-----DLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYR  746
             P      L   +     LP+L+YFHGGGFCVGS  W  YH FL +LS     +++SV+YR
Sbjct  85    PISVTSQLAHTRSNNNKLPLLVYFHGGGFCVGSAAWSCYHEFLSKLSSNLGCLIMSVNYR  144

Query  745   LAPENKLPIAYEDCYAALEWVQKNQKAEPCL----------------ESADLSRVFLAGD  614
             LAPEN LP AYED + +L W++  Q+A P                     D SR+FL GD
Sbjct  145   LAPENPLPTAYEDGFKSLNWLK--QQAAPAAAMTTVKSHNSECYWWWRHCDFSRIFLIGD  202

Query  613   SAGGNIVHQVAKKCLQDGNCAAKIKGIMPIHPYFGSERRTAAE--VAAEGSTGSSVAMND  440
             SAG NI   +A             +G + + P+FG + RT +E  VA    +  S+  +D
Sbjct  203   SAGANITQHLATSLASYNLTPLTFRGSVLLQPFFGGKARTNSERLVAQSPRSTLSLQASD  262

Query  439   MFWRLSLPEGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRR  260
              +WRL+LP G+NRD   CN   + E S+   L     +V V+  D L++R + +   L +
Sbjct  263   TYWRLALPPGANRDHPWCNPSANSE-SLRHVL---PVMVCVSEIDILRDRNLEFCAALSK  318

Query  259   KGVK  248
              G K
Sbjct  319   AGKK  322



>ref|XP_004162022.1| PREDICTED: probable carboxylesterase 15-like [Cucumis sativus]
Length=320

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 119/318 (37%), Positives = 178/318 (56%), Gaps = 14/318 (4%)
 Frame = -2

Query  1075  IIVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWP  896
             I VDE  G ++V+SDG++ R S    +           KD++ DP   +  R++ P    
Sbjct  5     IEVDECRGVLRVYSDGSIVRSSNPSFSVPVLDDGSVLWKDLLFDPIHNLHLRLYKPAHIS  64

Query  895   EKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIA  716
               +    LPV  Y HGGGFC+GS TW     +  RL+ +  ++V+S DYRLAPEN+LP A
Sbjct  65    SPK----LPVFFYIHGGGFCIGSRTWPNCQNYCFRLASELSALVISPDYRLAPENRLPAA  120

Query  715   YEDCYAALEWVQKNQKA---EPCL-ESADLSRVFLAGDSAGGNIVHQVAKKCLQDGN---  557
              +D +AAL W+Q   ++   +P L E AD S VF++GDSAGGNI H +A   L  G+   
Sbjct  121   IDDGFAALRWLQAQAESDHPDPWLAEVADFSTVFISGDSAGGNIAHHLAVG-LGVGSPEL  179

Query  556   CAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLE  377
                +++G + + P+FG   RT +E         ++ + D FWRLS+P GSN D    N+ 
Sbjct  180   APVQVRGYVLLGPFFGGTVRTRSEAEGSKEAFLNLELIDRFWRLSIPIGSNTDHPLVNVF  239

Query  376   NDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvf  197
                 L++ E +     +V VAG D LK+R V Y E L+++G K +++VE EE+ H F   
Sbjct  240   GPTSLNL-EAVEMDPIVVVVAGADLLKDRAVEYVEELKKQGKK-IDLVEFEEKQHGFFTI  297

Query  196   HPDSEATRLLQKQMSEFI  143
              P+SEA+  L   ++ F+
Sbjct  298   DPNSEASNQLMLLINHFV  315



>ref|XP_008775049.1| PREDICTED: probable carboxylesterase 17 [Phoenix dactylifera]
Length=347

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 114/294 (39%), Positives = 165/294 (56%), Gaps = 35/294 (12%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIA----TASAESTDGFKSKDVVIDPSKPITGRIFVPD  905
             +++E  G I+V+ +G V R  P ++    T + E++    S+DVVI  S  +  R +VP 
Sbjct  26    VLEEIVGLIRVYKNGHVDRL-PAVSDVPCTWAPEAS--VTSRDVVISHSTGVWARFYVP-  81

Query  904   LWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKL  725
                 K Q  L P+L+YFHGGGFCVGS  W  YH FL RL+ ++  +++SV+YRLAPEN+L
Sbjct  82    ----KAQGRL-PLLVYFHGGGFCVGSAAWSCYHEFLARLASRASCLIMSVNYRLAPENRL  136

Query  724   PIAYEDCYAALEWVQKNQKAEPCLE------SADLSRVFLAGDSAGGNIVHQVAKKCLQD  563
             P AYED  AA  WV++        E        + +R+FL GDSAG  I H VA +    
Sbjct  137   PAAYEDGLAATRWVRQQASYGGSDEFSWWRMHCNFARLFLGGDSAGATIAHNVAAQLGSL  196

Query  562   GNCAAKIK-----GIMPIHPYFGSERRTAAEVAAEGSTGSSVAM--NDMFWRLSLPEGSN  404
             G   + +K     G++ I P+ G E RTA+E     S+ S++ +  +D +WRL+LP G N
Sbjct  197   GGPESVLKPICLRGVILIQPFIGGEARTASEKDLVQSSRSALGLTTSDCYWRLALPFGCN  256

Query  403   RDFYGCNLENDRELSVG----EWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             RD   CN      L+ G    E L+ P  LV V+  D L++R + + + LRR G
Sbjct  257   RDHPWCN-----PLAKGAPRLEDLKLPPLLVCVSEMDILRDRNLEFCKALRRAG  305



>ref|XP_003558312.1| PREDICTED: probable carboxylesterase 17 [Brachypodium distachyon]
Length=371

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 108/298 (36%), Positives = 166/298 (56%), Gaps = 33/298 (11%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFS--PEI----ATASAESTDGFKSKDVVIDPSKPITGRIFV  911
             +V+E  G I+V+ DG V+R    P++     + + +   G  ++DVV+D +  +  R++ 
Sbjct  38    VVEEIHGLIRVYKDGHVERLPAMPDVPCTWGSTAVQGPGGVIARDVVVDRATGVWARLYA  97

Query  910   PDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPEN  731
             P      E    +PV++YFHGGGFCVGS  W  YH FL +L ++S   V+SVDYRLAPE+
Sbjct  98    P-----AESGNKVPVVVYFHGGGFCVGSAAWSCYHEFLAQLPIKSGCAVMSVDYRLAPEH  152

Query  730   KLPIAYEDCYAALEWVQKNQKAEPCLESADLS---------RVFLAGDSAGGNIVHQVAK  578
             +LP A++D  AA+ W++  Q+A  C  + DLS          VFL GDSAG  I   VA 
Sbjct  153   RLPAAFDDGLAAVRWLR--QQAASCRNNDDLSWWRGRCRFDSVFLMGDSAGATIAFHVAA  210

Query  577   KCLQDGNCAAK-----IKGIMPIHPYFGSERRTAAE--VAAEGSTGSSVAMNDMFWRLSL  419
             + L  G+  A      ++G + + P+FG E RTA+E  +A    +  S++ +D +WR++L
Sbjct  211   R-LGQGHLGASLGPLCVRGAILVQPFFGGEARTASEKTMAQPPRSALSLSTSDSYWRMAL  269

Query  418   PEGSNRDFYGCN---LENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             P G+ RD   CN     + R     + L  P  LV +A  D L++R +   + LR+ G
Sbjct  270   PAGAGRDHPWCNPLSSSSSRGAPRLDTLPLPPVLVCIAEADILRDRNLELCKALRKAG  327



>ref|XP_009370630.1| PREDICTED: probable carboxylesterase 15 [Pyrus x bretschneideri]
Length=336

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 106/283 (37%), Positives = 161/283 (57%), Gaps = 16/283 (6%)
 Frame = -2

Query  1069  VDEAPGYIQVFSDGTVKRF---SPEI------ATASAESTDGFKSKDVVIDPSKPITGRI  917
             V+E  G+++VF DG+V R     PE+        A  E  DG  +KDV+ D S  +  RI
Sbjct  9     VEEVSGWLRVFDDGSVDRRWTGPPEVQFMVKPVAAHDEFVDGVSTKDVIADKSSGLRVRI  68

Query  916   FVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAP  737
             ++P+  PE    +L P++L+FHGGGFC+    W  Y+    +LS  + ++V+SV  RLAP
Sbjct  69    YLPEQKPENNDTKL-PIILHFHGGGFCISQADWYMYYHIYTKLSRSTNAIVISVYQRLAP  127

Query  736   ENKLPIAYEDCYAALEWVQ---KNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQ  566
             E++LP A ED Y+AL W++   + +  EP L  AD +RVFL GDS+GGNIVH VA +   
Sbjct  128   EHRLPAAIEDGYSALLWLRSLDQGEPHEPHLSHADYNRVFLIGDSSGGNIVHHVAAQAGT  187

Query  565   DGNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDF-YG  389
                   ++ G +PIHP F    R+ +++    ST  ++ M D F  L+LP GS +D    
Sbjct  188   ADLSPLRLAGGIPIHPGFVRAERSKSQLEQPQSTFLTLDMVDKFLGLALPVGSTKDHPIT  247

Query  388   CNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRR  260
             C +  + +  +G  L+ P  L+ VA KD L +  + Y E +++
Sbjct  248   CPIGPEAQ-PLGN-LKLPPFLLCVASKDLLIDTEIEYFEAMKK  288



>ref|XP_009403354.1| PREDICTED: tuliposide A-converting enzyme 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=317

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 114/279 (41%), Positives = 153/279 (55%), Gaps = 15/279 (5%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRF-SPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLW-  899
             +V  AP ++++F  G V+R    E+  A  +   G  SKDV+IDP+  +  R+++PDL  
Sbjct  7     VVLHAPPFVRIFKSGRVERLLGNEVLPAGLDPATGVVSKDVLIDPATNLVARLYLPDLAG  66

Query  898   --PEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKL  725
               P+++    LPVL+Y+HGGGF + +     YH +L  L   +  V VSVDYR APE+ L
Sbjct  67    SPPDRK----LPVLVYYHGGGFVIETAFSPTYHNYLNSLVAAAGVVAVSVDYRRAPEHPL  122

Query  724   PIAYEDCYAALEWVQKNQKAEPCL-ESADLSRVFLAGDSAGGNIVHQVAKKCLQDG-NCA  551
             P AY+D +AAL+WV     AE  L E  DL RVFLAGDSAG NIVHQVA +   +G   A
Sbjct  123   PAAYDDSWAALQWVASRPPAEEWLAERGDLGRVFLAGDSAGANIVHQVALRVAAEGLGGA  182

Query  550   AKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLEND  371
             A IKG++ IHPYF      A  + +E     + A  +  W L  P     D    N   +
Sbjct  183   ATIKGLLLIHPYFWG----AEPLGSESRDPETRAGPEKIWTLVCPGTVGPDDPRLNPLAE  238

Query  370   RELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
                S+   L     LV VA +D L+ERG  Y E L R G
Sbjct  239   GATSMAG-LPCRRVLVMVAEEDILRERGRAYYEALERSG  276



>gb|EYU40873.1| hypothetical protein MIMGU_mgv1a018147mg [Erythranthe guttata]
Length=365

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 113/279 (41%), Positives = 158/279 (57%), Gaps = 19/279 (7%)
 Frame = -2

Query  1075  IIVDEAPGYIQVFSDGTVKRFSPEIATASAESTD---GFKSKDVVIDPSKPITGRIFVPD  905
             ++V++  G I+V+ DG V R  P+I      S     G    D +ID    +  R++VP 
Sbjct  39    VLVEKIDGLIRVYKDGHVDR--PQIVPCVGCSLAPDLGVTCGDTIIDKYTNVWARVYVPR  96

Query  904   LWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKL  725
                +K+Q + LP+L+YFHGGGFCVGS +W+ YH FL +L+     VVVSV+YRLAPEN L
Sbjct  97    K--KKQQQQQLPLLVYFHGGGFCVGSASWICYHEFLAKLAASVNCVVVSVNYRLAPENPL  154

Query  724   PIAYEDCYAALEWVQKNQKA---EPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNC  554
             P AY+D   AL W++K Q A   E   E  D S V LAGDSAG NI + VA   ++    
Sbjct  155   PAAYDDGVVALGWLRKQQFAGGGEWWTERCDFSSVCLAGDSAGANIAYNVA---VRVATP  211

Query  553   AAKIKGIMPIHPYFGSERRTAAE--VAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNL  380
                +KG++ I P+FG E RT +E  +     +  ++A +D +WRLSLP G++RD   CN 
Sbjct  212   PLPLKGLVLIQPFFGGEARTDSEKYMVQPPRSALTLAASDTYWRLSLPAGADRDHPWCNP  271

Query  379   ENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLR  263
                 EL           LV V+  D L++R + + E LR
Sbjct  272   AAAGELPAAR----VGVLVCVSEMDILRDRNMEFCERLR  306



>gb|ABK26852.1| unknown [Picea sitchensis]
Length=327

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 126/323 (39%), Positives = 186/323 (58%), Gaps = 23/323 (7%)
 Frame = -2

Query  1054  GYIQVFSDGTVKRF-SPEI-ATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPEKE-Q  884
             G ++V+ DGT+ R   P +   AS +      SKDVV++    +  R+++P    +++ +
Sbjct  9     GILKVYRDGTIFRVEDPRMFVKASLQGEGDVASKDVVLNEKLGLWVRLYLPSSHLQQQTE  68

Query  883   VELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYEDC  704
                LP+++YFHGGGFCV S     +H F  +L+    ++VVSV YRLAPE++LP AY+DC
Sbjct  69    KRRLPLIVYFHGGGFCVASPALPDFHNFTLKLAATVGAIVVSVAYRLAPEHRLPAAYDDC  128

Query  703   YAALEWVQKNQ------KAEPCLES-ADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCA--  551
              +AL+WV  +       K +P LES AD S V+L GDSAGGNI H V    L+ G  A  
Sbjct  129   ISALQWVNSHAGDGGDFKHDPWLESYADFSAVYLMGDSAGGNIAHHVV--ALRGGVEAWN  186

Query  550   -AKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDF---YGCN  383
               K+KG + + P+FG+E+RT +E         ++ ++D  WRLSLP GS+RD    Y C+
Sbjct  187   PIKLKGSILVEPFFGAEQRTLSESECPCDAVLNLELSDACWRLSLPVGSDRDHPFSYPCS  246

Query  382   LENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfh  203
                 +     E +  P  LV + G+D L++R   Y E L++ G K VEVV   EE H F+
Sbjct  247   PAAPKL----EKISLPPLLVAIGGRDMLRDRDHEYCELLKQHG-KSVEVVVFGEEEHGFY  301

Query  202   vfHPDSEATRLLQKQMSEFIHGV  134
             V  P S++   L +++S FI  V
Sbjct  302   VVRPQSQSCERLIQEISRFISPV  324



>ref|XP_008446570.1| PREDICTED: probable carboxylesterase 6 [Cucumis melo]
 ref|XP_008446572.1| PREDICTED: probable carboxylesterase 6 [Cucumis melo]
 ref|XP_008446573.1| PREDICTED: probable carboxylesterase 6 [Cucumis melo]
 ref|XP_008446574.1| PREDICTED: probable carboxylesterase 6 [Cucumis melo]
 ref|XP_008446575.1| PREDICTED: probable carboxylesterase 6 [Cucumis melo]
Length=346

 Score =   167 bits (423),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 107/299 (36%), Positives = 162/299 (54%), Gaps = 24/299 (8%)
 Frame = -2

Query  1102  QISNLQKMSIIVDEAPGYIQVFSDGTVKRFSPEIATASAESTD---GFKSKDVVIDPSKP  932
              ++   +  ++V+E  G I+V+ +G V+R  P+I    + +     G  S DVV+D    
Sbjct  15    HVNGFDQHDVLVEEIEGLIRVYGNGYVER--PQIVPCVSNALPPELGVTSWDVVVDKLNN  72

Query  931   ITGRIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVD  752
             I  R ++P    EK     LP+++YFHGGGFCVGS  W  YH FL +LS +S  +++SV+
Sbjct  73    IWARFYIPTQCQEK-----LPLIVYFHGGGFCVGSAAWSCYHEFLAKLSAKSDCIIISVN  127

Query  751   YRLAPENKLPIAYEDCYAALEWVQK----NQKAEPCLESADLSRVFLAGDSAGGNIVHQV  584
             YRLAPEN LP  YED    L+W+++      K        D ++++L+GDSAGGNI   V
Sbjct  128   YRLAPENPLPAPYEDGLKTLQWLKQVAFVGGKQNWWSRYCDFTKIYLSGDSAGGNIAFNV  187

Query  583   AK----KCLQDGNCAAK---IKGIMPIHPYFGSERRTAAE--VAAEGSTGSSVAMNDMFW  431
             A     K    G    K   IKG + I P+FG E RT +E  +     +  ++ ++D +W
Sbjct  188   AARLGGKTTASGAVILKPLVIKGSILIQPFFGGESRTNSEKFLVQPPRSPLTLGVSDTYW  247

Query  430   RLSLPEGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             RL+LP G+NRD   CN       +V +    P +L+ ++  D LK+R + +   L R G
Sbjct  248   RLALPSGTNRDHPWCNPSTKGLFTVEDSRVLP-SLICISEMDILKDRNLEFCSALHRAG  305



>ref|XP_009356465.1| PREDICTED: probable carboxylesterase 6 [Pyrus x bretschneideri]
Length=392

 Score =   168 bits (425),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 109/321 (34%), Positives = 161/321 (50%), Gaps = 47/321 (15%)
 Frame = -2

Query  1087  QKMSIIVDEAPGYIQVFSDGTVKRFSPEIA---TASAESTDGFKSKDVVIDPSKPITGRI  917
             Q+   +++E  G I+V+ DG V+R  P+I    T +     G  SKDVVID    I  R 
Sbjct  31    QQYETVIEEIEGLIKVYKDGHVER--PQIVPCVTGAVAPELGVTSKDVVIDKFTNIWSRF  88

Query  916   FVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAP  737
             +VP    ++     LP+L+YFHGGGFCVGS  W  YH FL +L+ +   +++SV+YRL P
Sbjct  89    YVPKC--QENNKMKLPLLVYFHGGGFCVGSAAWSCYHDFLAKLASKLGCLIMSVNYRLVP  146

Query  736   ENKLPIAYEDCYAALEWVQKN---QKAEPCL------ESADLSRVFLAGDSAGGNIVHQV  584
             E+ LP AYED + ++ W+++    Q+              D SR+FL GDSAG NI H V
Sbjct  147   EHPLPAAYEDGFNSIMWLKQQALIQRGANNNNNTWWSTQCDFSRIFLVGDSAGANIAHNV  206

Query  583   AKKCLQDGNCAAK------------------------------IKGIMPIHPYFGSERRT  494
             A +    G    +                              +KG + + P+FG E RT
Sbjct  207   ATRLYTGGGSVLESPSTDQYRLHQSNSDRPCDEEIISSTKPLIVKGTILLQPFFGGEART  266

Query  493   AAE-VAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVGEWLRFPAALVFV  317
             ++E    +  +  SVA +D +WRL+LP G+NRD   CN         G        +V +
Sbjct  267   SSEKYNKQPRSVLSVAASDAYWRLALPHGANRDHPFCNPMKSSSGGGGTLKAGWPTMVCI  326

Query  316   AGKDFLKERGVMYAEFLRRKG  254
             +  D LK+R + + E LR++G
Sbjct  327   SEMDILKDRNLEFCEALRKRG  347



>ref|XP_004294833.1| PREDICTED: probable carboxylesterase 12-like [Fragaria vesca 
subsp. vesca]
Length=315

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 110/270 (41%), Positives = 147/270 (54%), Gaps = 11/270 (4%)
 Frame = -2

Query  1048  IQVFSDGTVKRF-SPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPEKEQVELL  872
             ++V+ DG V+R        AS     G +SKDVVI  S PI+ R+++P      E  + L
Sbjct  13    LKVYKDGRVERLLGTARVPASIHPQTGVQSKDVVISTSPPISARLYIPKSSASSESSQKL  72

Query  871   PVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYEDCYAAL  692
             PVL+YFHGGGFC+ S     YH +L  L  ++  V VSVDYRLAPE+ LP AYED +AAL
Sbjct  73    PVLVYFHGGGFCIESAFSPAYHNYLNSLVSEANVVAVSVDYRLAPEHPLPAAYEDSWAAL  132

Query  691   EWVQKN----QKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGIMPI  524
             +WV+ +       E     ADL+RVF +GDSAG NI H +  +   +     K+ GI+ +
Sbjct  133   KWVESHFAGMGPEEWLNRHADLNRVFFSGDSAGANIAHHMGLRVGSEKPVGFKLNGIVLV  192

Query  523   HPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVGEWL  344
             HPYF  E     E+A   S  + +A     WR   P  S  D    N   D +L  GE +
Sbjct  193   HPYFWGEEPIGGELALGESHRNLLA---TLWRFCYPLTSGSDDPLYNPGKDPKL--GE-M  246

Query  343   RFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
                  LV VA KD LK+RG  Y+E L++ G
Sbjct  247   GCEKVLVCVAEKDSLKDRGWYYSELLKKSG  276



>ref|XP_009105413.1| PREDICTED: probable carboxylesterase 6 [Brassica rapa]
 ref|XP_009105414.1| PREDICTED: probable carboxylesterase 6 [Brassica rapa]
Length=334

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 105/242 (43%), Positives = 139/242 (57%), Gaps = 21/242 (9%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKR--FSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLW  899
             +V+E  G I+V+ DG V+R  F P +   S     G    DV ID    + GR++VP + 
Sbjct  24    VVEEVEGLIRVYKDGHVERSQFVPCV-DPSLPLELGVACSDVHIDKLTNVWGRLYVPTV-  81

Query  898   PEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPI  719
                  V  LP+++YFHGGGFC GS  W  YH FLGRLS +S+ +V+ V+YRLAPEN LP 
Sbjct  82    TNSTSVSKLPLIVYFHGGGFCAGSAYWSCYHQFLGRLSAKSRCLVMHVNYRLAPENPLPA  141

Query  718   AYEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAA---  548
             AYED   A+ W++K +      +  D   +FLAGDSAGGNI + VA      G  AA   
Sbjct  142   AYEDGVNAILWLKKTRNDNLWSKQCDFGSIFLAGDSAGGNIANHVA------GRLAAADA  195

Query  547   -----KIKGIMPIHPYFGSERRTAAEVAAEGSTGSSV---AMNDMFWRLSLPEGSNRDFY  392
                  KI+G + I P+FG E RT  E   E +T SSV   A +D +WRL+LP  +NR+  
Sbjct  196   LIKPLKIEGTILIQPFFGGEARTETERRVENNTESSVLTLASSDTWWRLTLPREANREHP  255

Query  391   GC  386
              C
Sbjct  256   YC  257



>gb|KHN24944.1| Putative carboxylesterase 17 [Glycine soja]
Length=281

 Score =   164 bits (416),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 95/244 (39%), Positives = 146/244 (60%), Gaps = 15/244 (6%)
 Frame = -2

Query  952  VIDPSKPITGRIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsk  773
            +I+    +  R++VP         +LLP+L+YFHGGGFCVGS  W  YH FL  L+ ++ 
Sbjct  1    MINKETNLWARVYVPI--SACHYSKLLPLLVYFHGGGFCVGSAAWSCYHEFLTNLASKAN  58

Query  772  svvvsVDYRLAPENKLPIAYEDCYAALEWVQKNQKAEPC-----LESADLSRVFLAGDSA  608
             V++SVDY LAPEN+LP+AY+D   AL WV++      C     L   ++S +FLAGDSA
Sbjct  59   CVILSVDYHLAPENRLPMAYDDGCNALMWVKREALNGSCVQKWWLSHCNMSSLFLAGDSA  118

Query  607  GGNIVHQVAKKCLQDGNCA----AKIKGIMPIHPYFGSERRTAAEVAAEGSTGS--SVAM  446
            G NI + VA + +  G+ +      +KG++ I P+FG E RT +E  +     S  ++++
Sbjct  119  GANIAYNVATR-MHMGSTSNTPLLSLKGVILIQPFFGGEERTFSEKHSLQPPNSALTLSV  177

Query  445  NDMFWRLSLPEGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFL  266
            +D +WRL+LP G+ RD   CNL  D  + + + LR P+ +V VA  D L++R + ++  L
Sbjct  178  SDTYWRLALPLGATRDHSYCNLLADGSVKLRD-LRLPSTMVCVAEMDILRDRNLEFSNAL  236

Query  265  RRKG  254
             + G
Sbjct  237  AKAG  240



>ref|XP_009622412.1| PREDICTED: probable carboxylesterase 17 [Nicotiana tomentosiformis]
Length=342

 Score =   166 bits (420),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 108/302 (36%), Positives = 162/302 (54%), Gaps = 25/302 (8%)
 Frame = -2

Query  1111  QNTQISN---LQKMSIIVDEAPGYIQVFSDGTVKR--FSPEIATASAESTDGFKSKDVVI  947
             QN  + N    Q   ++++E  G I+ +++G ++R    P +   S     G  +KDV++
Sbjct  11    QNLNVRNDHHQQNGVVVLEEIEGLIKFYNNGHIERPQIVPTVPPYSLPQELGVTAKDVIL  70

Query  946   DPSKPITGRIFVPD-LWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsks  770
                  +  RI++P+ L P K+    LP+L+YFHGGGFCVGS  W  YH FL  L+ +   
Sbjct  71    HNPTNLWSRIYLPNTLIPAKK----LPLLVYFHGGGFCVGSAAWKCYHDFLANLTSKIGC  126

Query  769   vvvsVDYRLAPENKLPIAYEDCYAALEWVQKNQKAEPCLE------SADLSRVFLAGDSA  608
             V++SV+YRLAPEN+LP AY+D   A+ W+ KNQ      E          S +FL+GDSA
Sbjct  127   VIMSVNYRLAPENRLPAAYDDGVHAITWL-KNQALANSKEHNWWSSKCSFSNLFLSGDSA  185

Query  607   GGNIVHQVAKKCLQDGNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAM--NDMF  434
             G NI + VA +          +KG++ I P+FG E R  +E  +     S++ +  +D +
Sbjct  186   GANIAYHVATRLNSYNLKPLSLKGLILIQPFFGGESRIHSEKYSVQPPYSALNLPASDTY  245

Query  433   WRLSLPEGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             WRL+LP  SNRD   C       LS    +R P+ LV ++  D LK+R +     L   G
Sbjct  246   WRLALPVASNRDHPWC----KPRLSYN--IRLPSTLVCISETDLLKDRNLELCSALADAG  299

Query  253   VK  248
             +K
Sbjct  300   IK  301



>ref|XP_001767205.1| GLP3 GID1-like protein [Physcomitrella patens]
 gb|EDQ67886.1| GLP3 GID1-like protein [Physcomitrella patens]
Length=330

 Score =   166 bits (419),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 105/276 (38%), Positives = 150/276 (54%), Gaps = 23/276 (8%)
 Frame = -2

Query  1033  DGTVKR----FSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPEKEQVELLPV  866
             DGTV R    F      A+ ++  G  + DV++D  K +  R+F+P    + +  +L P+
Sbjct  24    DGTVNRKWDKFLGTQVPANPQAKCGVSTVDVIVDFEKDVWVRLFIPK---KPQAQKLFPI  80

Query  865   LLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYR----LAPENKLPIAYEDCYA  698
             + ++HGGGF   S   V Y  F  RL+ +  ++V+SV YR      PE+K P AY+DC+A
Sbjct  81    IFFYHGGGFVFLSPDSVCYDTFCRRLARKCHALVISVHYRQELLTTPEHKFPAAYDDCFA  140

Query  697   ALEWVQKNQKAEPCLESA------DLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKG  536
             ALEW+Q  Q A  CL  +      DLSRVFL GDSAGGNI H VA +  +       IKG
Sbjct  141   ALEWLQSGQ-ATQCLPRSIDPRCIDLSRVFLCGDSAGGNIAHHVAVRASETEISPLCIKG  199

Query  535   IMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNL--ENDREL  362
             +M + P+FG + RT AE+        SV   D +W+  LP G+NRD   CN+   N  +L
Sbjct  200   VMLLSPFFGGQERTPAEIRVRNVPMVSVKRLDWYWKSFLPHGANRDHPACNIFGRNSPDL  259

Query  361   SVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             S    +  P+ L+ + G D L++    YA+ L R G
Sbjct  260   SD---VSLPSVLIIIGGLDILQDWETRYADCLNRAG  292



>gb|ABK26127.1| unknown [Picea sitchensis]
Length=351

 Score =   166 bits (420),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 123/327 (38%), Positives = 184/327 (56%), Gaps = 19/327 (6%)
 Frame = -2

Query  1054  GYIQVFSDGTVKRF-SPEI-ATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPEKE-Q  884
             G ++++ DG++ R   P++   AS E  DG  SKDVV++    +  R+++P    +++ +
Sbjct  23    GVLKLYRDGSIFRLEDPQMFVKASLEGEDGVASKDVVLNEKLGLWVRLYLPSSHLQQQTE  82

Query  883   VELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYEDC  704
                LP+++YFHGGGFC+ S     YH F  +L+    ++V+SV YRLAPE++LP AY+DC
Sbjct  83    KRRLPLIVYFHGGGFCLASPALPDYHNFTLKLAASVGAIVISVAYRLAPEHRLPAAYDDC  142

Query  703   YAALEWVQKNQKAEPCLE-------SADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAA-  548
               AL+WV  +       E        AD SRV+L GDSAGGNI + V  +C   G   A 
Sbjct  143   IKALQWVSSHAVDGGDFERDLWLDFQADFSRVYLLGDSAGGNIANHVLLQC---GGVEAW  199

Query  547   ---KIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLE  377
                +++G + + PYFGS +RT +E         S+ ++D  WRLSLP GS+RD    N  
Sbjct  200   SPMRVRGAIFVQPYFGSVQRTRSESECPPDAWLSLQLSDAGWRLSLPVGSDRDHPFSNPW  259

Query  376   NDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvf  197
             +     + E    P  LV + G+D L++RG  Y E L++ G K VEVV  EEE H F+  
Sbjct  260   SPEAPKLEE-APLPPLLVAIGGRDMLRDRGHDYCESLKQCG-KSVEVVVFEEEEHAFYAL  317

Query  196   HPDSEATRLLQKQMSEFIHGV*SSMVI  116
              P  +++  L +++S FI    S  VI
Sbjct  318   KPHCDSSERLMEKISHFISSSLSEAVI  344



>ref|XP_008379534.1| PREDICTED: probable carboxylesterase 17 [Malus domestica]
Length=349

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 105/279 (38%), Positives = 158/279 (57%), Gaps = 19/279 (7%)
 Frame = -2

Query  1093  NLQKMSIIVDEAPGYIQVFSDGTVKR--FSPEIATASAESTDGFKSKDVVIDPSKPITGR  920
             N  +  +I++E  G I+V  DG V+R    P + +  A    G ++KD+VID    +  R
Sbjct  23    NPNQHGVILEEIEGLIRVHKDGYVERPLMIPSVPSTLAL-PPGVEAKDIVIDKFTNLWAR  81

Query  919   IFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLA  740
             I+VP           LPV++YFHGGGFCVGS  W  YH FL +L+ Q+  V++SV+YRLA
Sbjct  82    IYVPS------HPGNLPVIVYFHGGGFCVGSAAWSCYHEFLAKLASQASCVIISVNYRLA  135

Query  739   PENKLPIAYEDCYAALEWVQKNQKAEPC-----LESADLSRVFLAGDSAGGNIVHQVAKK  575
             PE++LP AY+D +  L WV++   +E       L   +LS +F+ GDSAG NI + V  +
Sbjct  136   PESRLPAAYDDGFKTLMWVKQKALSESSEQKWWLSKCNLSSLFIGGDSAGANIAYNVTTQ  195

Query  574   CLQDGNCAAK---IKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAM--NDMFWRLSLPEG  410
                      +   +KG + I P+FG E RT +E  A     S++++  +D +WRLSLP G
Sbjct  196   VGSRDPSILRPLSLKGTVLIQPFFGGEARTWSEKCATQPPYSALSLSSSDTYWRLSLPLG  255

Query  409   SNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKE  293
             ++RD   CN   +  ++    LR P+ +V V+  D LK+
Sbjct  256   ASRDHPWCNPLVNAGVAKLRDLRLPSMMVCVSELDILKD  294



>ref|XP_008346678.1| PREDICTED: probable carboxylesterase 15 [Malus domestica]
Length=336

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 103/283 (36%), Positives = 158/283 (56%), Gaps = 16/283 (6%)
 Frame = -2

Query  1069  VDEAPGYIQVFSDGTVKR---------FSPEIATASAESTDGFKSKDVVIDPSKPITGRI  917
             V+E  G+++VF DG+V R         F  E   A  E  DG  +KDVV D S     RI
Sbjct  9     VEEVSGWLRVFDDGSVDRRWTGPPEVQFMVEPVEAHDEFIDGVSTKDVVADKSSGXRVRI  68

Query  916   FVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAP  737
             ++P+  PE    +L P++L+FHGGGFC+    W  Y+    +LS  +  +V+SV  RLAP
Sbjct  69    YLPERKPENNDTKL-PIILHFHGGGFCISQADWYMYYQIYTKLSRSTNXIVISVYQRLAP  127

Query  736   ENKLPIAYEDCYAALEWVQ---KNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQ  566
             E++LP A ED Y+AL W++   + ++ EP L  AD +RVFL GDS+GGNIVH VA +   
Sbjct  128   EHRLPAAIEDGYSALLWLRSLAQGEQNEPLLSHADYNRVFLIGDSSGGNIVHHVAAQSGT  187

Query  565   DGNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDF-YG  389
                   ++ G +PIHP F    R+ +++    S   ++ M D F  L+LP GS +D    
Sbjct  188   ADLSPLRLAGXIPIHPGFVRAERSKSQLEQPQSPFLTLDMVDKFLGLALPVGSTKDHPIT  247

Query  388   CNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRR  260
             C +  + +  +G  L+ P  L+ +A +D + +  + Y E +++
Sbjct  248   CPIGPEAQ-PLGN-LKLPPFLLCIASRDLIIDTQMEYFEAMKK  288



>ref|XP_004489120.1| PREDICTED: probable carboxylesterase 17-like [Cicer arietinum]
Length=356

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 114/314 (36%), Positives = 180/314 (57%), Gaps = 30/314 (10%)
 Frame = -2

Query  1111  QNTQISNL--QKMSIIVDEAPGYIQVFSDGTVKRFSPEIA---TASAESTDGFKSKDVVI  947
              N +++N+  QK  II++E  G I+V  DG V+R  P+I    +    S +G  S+DV I
Sbjct  9     NNPKVNNIHQQKGHIIIEEIEGLIRVHKDGHVER--PQIVPNVSCKVPSENGVTSRDVTI  66

Query  946   DPSKPITGRIFVPD---LWPEKEQVEL---LPVLLYFHGGGFCVGSTTWVGYHLFLGRLs  785
             +    +  R++VP    L            LP+L+YFHGGGFCVGST+W+ YH FL  L+
Sbjct  67    NRDTNLFARVYVPSSILLLTSHNNNNNNNKLPLLVYFHGGGFCVGSTSWICYHEFLNNLA  126

Query  784   vqsksvvvsVDYRLAPENKLPIAYEDCYAALEWVQK-----NQKAEPCLESADLSRVFLA  620
             +++  V++SVDYRLAPEN+LP+AY+D + AL W++      + K    L   ++ ++FL+
Sbjct  127   IKANCVILSVDYRLAPENRLPLAYDDGFNALMWIKHEALNGSNKQNWWLSHCNM-KLFLS  185

Query  619   GDSAGGNIVHQVAKKCLQDGNCAAK------IKGIMPIHPYFGSERRTAAEVAAEGSTGS  458
             GDSAG NI + VA + L   N  +       +KG++ I P+FG E RT +E   +    S
Sbjct  186   GDSAGANIAYNVATR-LASSNINSSCLNPFCLKGVILIQPFFGGEERTFSEKHFQQPQNS  244

Query  457   --SVAMNDMFWRLSLPEGS--NRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKER  290
               +++++D +WRLSLP  +   RD   CN   +  ++    L+ P+ +V V+  D LK+R
Sbjct  245   ALTLSISDTYWRLSLPLEATITRDHPYCNPLANGIVNKLRDLKLPSIMVCVSELDILKDR  304

Query  289   GVMYAEFLRRKGVK  248
              + ++  L + G K
Sbjct  305   NLEFSNALVKAGKK  318



>gb|ABK25952.1| unknown [Picea sitchensis]
Length=338

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 122/329 (37%), Positives = 189/329 (57%), Gaps = 13/329 (4%)
 Frame = -2

Query  1069  VDEAPGYIQVFSDGTVKRF-SPEI-ATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWP  896
             V+   G ++V+ DGT+ R  +P +    S +   G  SKDVV++ +  +  R+++P  + 
Sbjct  6     VENMRGLLKVYRDGTIFRLENPRMFVQPSLQGEGGVASKDVVLNETLGLWVRLYLPSSYL  65

Query  895   EKE-QVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPI  719
             +++ +   LP+++YFHGGGFC+ S      H F  +L+    ++VVSV YRLAPE++LP 
Sbjct  66    QQQTEKRRLPLIVYFHGGGFCLFSPAVPDLHNFTLKLTQSVGAIVVSVAYRLAPEHRLPA  125

Query  718   AYEDCYAALEWVQKNQ------KAEPCLES-ADLSRVFLAGDSAGGNIVHQ-VAKKCLQD  563
             AY+DC  AL+WV  +       + +P L S AD S+V+L GDSAGGNI H  V +    +
Sbjct  126   AYDDCITALQWVSSHAVDGGDFERDPWLHSHADFSQVYLLGDSAGGNIAHHGVVRSGGVE  185

Query  562   GNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCN  383
                  KI+G + + P FG+E+RT +E         ++  +D  WR+SLP GSNRD   CN
Sbjct  186   AWSPMKIRGAIFVQPGFGAEKRTRSESECPPDAFLTLQHSDACWRISLPVGSNRDHPFCN  245

Query  382   LENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfh  203
               +D    + E +  P  LV + G+D L++   +Y E L++ G K VEV+  EEEGH F+
Sbjct  246   PWSDGAPKL-EDVTLPPLLVAIGGRDMLRDSNYVYCESLKQCG-KSVEVMVLEEEGHAFY  303

Query  202   vfHPDSEATRLLQKQMSEFIHGV*SSMVI  116
                P  +++  L +++S FI    S  VI
Sbjct  304   ALKPHCQSSERLMERISRFISSSPSESVI  332



>ref|XP_011085931.1| PREDICTED: probable carboxylesterase 15 isoform X1 [Sesamum indicum]
 ref|XP_011085939.1| PREDICTED: probable carboxylesterase 15 isoform X2 [Sesamum indicum]
Length=335

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 106/286 (37%), Positives = 163/286 (57%), Gaps = 16/286 (6%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRF---SPEIATASA------ESTDGFKSKDVVIDPSKPITGR  920
             ++DE  G+++VF DG+V R     P++   SA         DG    DVV D    +  R
Sbjct  7     VIDEVSGWLRVFDDGSVDRTWTGPPQVKFMSALVPPHHHFIDGVAIADVVGDQDSGLKLR  66

Query  919   IFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLA  740
             I++P+   +++  E LPVLL+FHGGGFC+    W  Y+    RL+  +++VVVSV  RLA
Sbjct  67    IYLPE--KQEDDPEKLPVLLHFHGGGFCISQADWFMYYSVYTRLARTARAVVVSVFLRLA  124

Query  739   PENKLPIAYEDCYAALEWVQK---NQKAEPCL-ESADLSRVFLAGDSAGGNIVHQVAKKC  572
             PE++LP A +D +AAL W++     QK +P L + AD +RVFL GDS+GGNIVHQVA + 
Sbjct  125   PEHRLPAACDDGFAALLWLRSVAGGQKQQPWLHDHADFNRVFLIGDSSGGNIVHQVASRA  184

Query  571   LQDGNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFY  392
              ++     ++ G +PIHP F   +R+ +E+    +   ++ M D F RL+LP G+ +D +
Sbjct  185   GRENLEPLRVAGAIPIHPGFCRSQRSKSEMEQPETPFLTLDMVDKFLRLALPVGATKD-H  243

Query  391   GCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
                          E L+ P  L  VA +D +K+  + + E ++R G
Sbjct  244   PITCPMGEAAPAIEKLKLPPYLYCVAEQDLIKDTEMEFYEAMKRGG  289



>ref|XP_008449839.1| PREDICTED: probable carboxylesterase 15 [Cucumis melo]
Length=320

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 120/318 (38%), Positives = 176/318 (55%), Gaps = 18/318 (6%)
 Frame = -2

Query  1069  VDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVP-DLWPE  893
             VDE  G ++V+SDG++ R S                KD++ DP   +  R++ P D+   
Sbjct  7     VDECRGVLRVYSDGSIVRSSNPSFNVPVNDDGSVLWKDLLFDPINDLHLRLYKPADISSP  66

Query  892   KEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAY  713
             K     L V  Y HGGGFC+GS TW     +  RL+ Q  ++V+S DYRLAPEN+LP A 
Sbjct  67    K-----LSVFFYIHGGGFCIGSRTWPNCQNYCFRLASQLPALVISPDYRLAPENRLPAAI  121

Query  712   EDCYAALEWVQKNQKA---EPCL-ESADLSRVFLAGDSAGGNIVHQVAKKC-LQDGNCA-  551
             +D +AAL W+Q   ++   +P L + AD SRVF++GDSAGGNI H +A    L     A 
Sbjct  122   DDGFAALRWLQAQAESDHPDPWLADVADFSRVFISGDSAGGNIAHHLAVGLGLGSPELAP  181

Query  550   AKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNL--E  377
              +++G + + P+FG   RT +E         ++ + D FWRLS+P GS+ D    N+   
Sbjct  182   VRVRGYVLLGPFFGGTVRTRSEAEGSKEAFLNLELIDRFWRLSIPIGSDTDHPLVNVFGP  241

Query  376   NDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvf  197
               R L   E +     +V VAG D LK+R V YAE L+++G K +++VE E + H F   
Sbjct  242   TSRNL---EAVEMDPIMVVVAGADLLKDRAVEYAEELKKQGKK-IDLVEFEGKQHGFFTI  297

Query  196   HPDSEATRLLQKQMSEFI  143
              P+SEA+  L   ++ F+
Sbjct  298   DPNSEASNQLMLLINHFV  315



>emb|CDP01339.1| unnamed protein product [Coffea canephora]
Length=322

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 124/329 (38%), Positives = 173/329 (53%), Gaps = 26/329 (8%)
 Frame = -2

Query  1078  SIIVDEAPGYIQVFSDGTVKRF-SPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDL  902
             S I DE P Y++V+ DGTV+R    E+  A+ +S  G  SKD+++ P   +T R++ P+L
Sbjct  6     SEIADEVPPYLRVYKDGTVERLLGTEVTPAAFDSKTGVSSKDIIVIPEAGVTARLYRPNL  65

Query  901   WPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLP  722
               + ++   LP+L+YFHGG FC+ S +   YH  L  L  ++K + VSVDYRL PE+ LP
Sbjct  66    VTKTQR---LPLLVYFHGGAFCISSPSDPKYHNCLNLLVAEAKIIAVSVDYRLVPEHPLP  122

Query  721   IAYEDCYAALEWVQKNQKAEPC----LESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNC  554
              AYED +A L+WV  +   E       E  D S+VFLAGDSAG N+ H +A   ++ GN 
Sbjct  123   AAYEDSWAVLKWVASHISGEGSEDWLRECVDFSKVFLAGDSAGANLSHHMA---IRAGNA  179

Query  553   ------AAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFY  392
                     K++G + IHPYF  E     E       G    M D +W+   P G   D  
Sbjct  180   DPPRIGGLKLRGTIMIHPYFWGEDPIGIEAKDPVRKG----MVDKWWQFVCPSGKGCDDP  235

Query  391   GCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeee--  218
               N   D        L     ++FVA  D L +RG  Y EFL +   KW    E  E   
Sbjct  236   LINPFVDGGAESLSRLACDFIIIFVAQNDILADRGRRYYEFLAKS--KWQGKAEMVETPG  293

Query  217   -ghvfhvfHPDSEATRLLQKQMSEFIHGV  134
               HVFH+F+P S+  R+L K+ + FI+ V
Sbjct  294   EDHVFHIFNPCSDKARMLIKRCASFINQV  322



>gb|ADE75740.1| unknown [Picea sitchensis]
Length=338

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 103/290 (36%), Positives = 161/290 (56%), Gaps = 26/290 (9%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIA---TASAESTDGFKSKDVVIDPSKPITGRIFVPDL  902
             I+DE  G I+++SDG+++R    ++   +AS    DG  ++D+ I P   I  RI++P+ 
Sbjct  5     IIDEITGIIRIYSDGSIERPLNILSIPVSASQAFVDGVATRDLKISPQTGIWARIYLPET  64

Query  901   WPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLP  722
              P+  QVE  P+LL+FHGGGFC+GS  W   +LFL RL  Q + + VSVDYRLAPE++LP
Sbjct  65    SPDMSQVEKYPILLHFHGGGFCIGSADWRCLNLFLSRLVKQCRVMCVSVDYRLAPEHRLP  124

Query  721   IAYEDCYAALEWVQKNQKA---EPCLES-ADLSRVFLAGDSAGGNIVHQVA-KKCLQDGN  557
              A ED   +L+W+ +  +    +P L +  D +R  L G+SAGGN+VH+VA +    +  
Sbjct  125   AACEDGMESLDWLHRLARGDSEDPWLSAHGDFTRCILLGESAGGNLVHEVAIRAATMERL  184

Query  556   CAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGS-SVAMNDMFWRLSLPEGSNRDF-----  395
                +++G + IHP F  E+R+ +E+         S    D  + L+LPEGS +D      
Sbjct  185   HPLRLRGGIMIHPGFVREQRSRSEMETPPDIAKLSTEAVDKLFSLALPEGSTKDHPIINP  244

Query  394   ---YGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
                +  NL++         L  P  LV +A  D +++    Y E ++  G
Sbjct  245   MGPFAPNLQH---------LNLPPFLVAMADHDLIRDTQFEYCEAMKIAG  285



>ref|XP_002529140.1| catalytic, putative [Ricinus communis]
 gb|EEF33253.1| catalytic, putative [Ricinus communis]
Length=356

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 104/290 (36%), Positives = 156/290 (54%), Gaps = 22/290 (8%)
 Frame = -2

Query  1075  IIVDEAPGYIQVFSDGTVKRFSPEIA---TASAESTDGFKSKDVVIDPSKPITGRIFVPD  905
             ++ +E  G I+V+ DG V+R  P+I    T+      G  S D VID S  I  RI+VP 
Sbjct  24    VVTEEITGLIKVYKDGHVER--PQIVPCVTSKLAPELGVSSIDTVIDKSTNIWARIYVPT  81

Query  904   LWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKL  725
                   + +L P+++YFHGGGFCVGS  W  YH FL RL+ ++  +++SV+YRLAPEN L
Sbjct  82    TCHGNSKQQL-PLIVYFHGGGFCVGSAAWSCYHEFLARLAAKAGCLIMSVNYRLAPENPL  140

Query  724   PIAYEDCYAALEWVQKNQKAEPCLES------ADLSRVFLAGDSAGGNIVHQVAKKCLQD  563
             P A+ED   AL W+++    +   +        + S + +AGDSAG NI + +      D
Sbjct  141   PAAFEDGIKALMWLRQQALLKAASDQYWWSKHCNFSNIIVAGDSAGANIAYNIITMLSSD  200

Query  562   GNCAA-----KIKGIMPIHPYFGSERRTAAE--VAAEGSTGSSVAMNDMFWRLSLPEGSN  404
                AA      +KG++ I P+FG E RT +E  +     +  S+A +D +WRL LP G+N
Sbjct  201   NYDAAAMKPLTLKGMILIQPFFGGEARTNSEKNLVQPPRSALSLAASDTYWRLGLPSGAN  260

Query  403   RDFYGCN--LENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRR  260
             RD   CN   +   +L     +  P  +V ++  D LK+R +     L +
Sbjct  261   RDHPWCNPLSKGSVKLMQKSMINLP-TMVCISEMDILKDRNLELVAALSK  309



>ref|XP_010265194.1| PREDICTED: probable carboxylesterase 6 [Nelumbo nucifera]
Length=345

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 107/292 (37%), Positives = 159/292 (54%), Gaps = 20/292 (7%)
 Frame = -2

Query  1087  QKMSIIVDEAPGYIQVFSDGTVKR--FSPEIATASAESTDGFKSKDVVIDPSKPITGRIF  914
             ++  ++ DE  G I+V+ DG V+R    P +    A   D   S+DV I+    +  R +
Sbjct  19    RQHGVVTDEIEGIIRVYKDGHVERPPIVPNVVCTVASEPD-VASRDVAINKITNVWARFY  77

Query  913   VPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPE  734
             VP     + Q   LP L+YFHGGGFCVGS  W  YH FL +L+ ++  +++SV++R APE
Sbjct  78    VP-----RCQQGKLPFLVYFHGGGFCVGSAAWKCYHEFLAKLAARAGCLIMSVNFRSAPE  132

Query  733   NKLPIAYEDCYAALEWVQK-----NQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKK--  575
             N+LP AYED   A+ W ++     +          + ++VFLAGDSAG NI H VA +  
Sbjct  133   NRLPAAYEDGCNAVLWAKQQALNGSNDQRWWWSQCNFTKVFLAGDSAGANIAHNVAIRLG  192

Query  574   CLQDGNCAAK---IKGIMPIHPYFGSERRTAAEV--AAEGSTGSSVAMNDMFWRLSLPEG  410
              L+      K   +KG + I P+FG E RT +E+  A   S+  S+A +D++WRLSLP G
Sbjct  193   SLELSEAVPKQFCLKGTILIQPFFGGEARTHSEINTAQSSSSALSLAASDVYWRLSLPVG  252

Query  409   SNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             +NRD   CN  +     +      P  LV ++  D LK+R + +   + R G
Sbjct  253   ANRDHPWCNPLSKSSTKLEALKLPPETLVCISEMDILKDRNLEFCTAMARAG  304



>emb|CAN61111.1| hypothetical protein VITISV_006466 [Vitis vinifera]
Length=323

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 104/275 (38%), Positives = 153/275 (56%), Gaps = 17/275 (6%)
 Frame = -2

Query  1057  PGYIQVFSDGTVKRF-SPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPEKEQV  881
             P +++VF DG V+RF   +    S     G  SKD+VI+P   ++ R+++P +    +Q 
Sbjct  14    PPFLRVFKDGKVERFVGTDSVPPSLNIETGVNSKDIVIEPETGVSARLYIPKI---NDQS  70

Query  880   ELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYEDCY  701
             + LP+L+YFHGG FC+ +++   YH +L  L  ++  V VS++YR APE+ LP+AY+DC+
Sbjct  71    QKLPLLVYFHGGAFCIETSSSPTYHNYLDSLVAEANVVAVSIEYRRAPEHPLPVAYDDCW  130

Query  700   AALEWV---QKNQKAEPCL-ESADLSRVFLAGDSAGGNIVHQVAKKCLQDGN--CAAKIK  539
             AA++WV     +Q  EP L + ADL  +F AGDSAG N+ H +A +    G+   + K+ 
Sbjct  131   AAVKWVVSHSNSQGPEPWLNDYADLDXLFFAGDSAGANLSHNMAIRAGTRGHELGSVKVS  190

Query  538   GIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELS  359
             GI+ IHPYF  +    AEV      G    + D  W    P  S  D    N   D +L+
Sbjct  191   GIILIHPYFWGKDPVGAEVKDLQKKG----LVDSLWLFVCPTTSGCDDPLINPATDPKLA  246

Query  358   VGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
                 L     LVFVA KD L++RG  Y E L + G
Sbjct  247   S---LGCQRVLVFVAEKDTLRDRGWFYHETLGKSG  278



>ref|XP_010030292.1| PREDICTED: probable carboxylesterase 18 [Eucalyptus grandis]
Length=324

 Score =   163 bits (413),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 96/242 (40%), Positives = 134/242 (55%), Gaps = 6/242 (2%)
 Frame = -2

Query  973  GFKSKDVVIDPSKPITGRIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLG  794
            G  S DV +DPS+P+  R+F P           LPVL++FHGGGFC        Y     
Sbjct  45   GVTSSDVTVDPSRPLWFRVFTPSA--PASTAASLPVLVFFHGGGFCYLGAASSAYDAVCR  102

Query  793  RLsvqsksvvvsVDYRLAPENKLPIAYEDCYAALEWVQKNQKAEPCLESADLSRVFLAGD  614
            R + +  +VVVSVDYRLAPE++ P  Y+D +  L ++ +N  A P +  AD+S+ FLAGD
Sbjct  103  RFARKLPAVVVSVDYRLAPEHRFPSQYDDGFDVLRFLDENPSALPPV--ADVSKCFLAGD  160

Query  613  SAGGNIVHQVAKKCLQDGNCAAKIK--GIMPIHPYFGSERRTAAEVAAEGSTGSSVAMND  440
            SAG NI H VA +        A+++  G++ I P+FG   RT +E+   G+   SV   D
Sbjct  161  SAGANIAHHVAVRASLPERKLARVRVVGLVAIQPFFGGAERTESEIRLTGAPLVSVPRTD  220

Query  439  MFWRLSLPEGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRR  260
              WR  LPEG++RD +  N+       V     FPA +VFV G D L++    Y E+LR+
Sbjct  221  WCWRAFLPEGADRDHWAVNVSGPNAADVAGLEEFPATVVFVGGFDPLRDWQKRYCEWLRK  280

Query  259  KG  254
             G
Sbjct  281  SG  282



>ref|XP_009404788.1| PREDICTED: probable carboxylesterase 17 [Musa acuminata subsp. 
malaccensis]
Length=350

 Score =   164 bits (415),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 112/292 (38%), Positives = 168/292 (58%), Gaps = 30/292 (10%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAESTD-GFKSKDVVIDPSKPITGRIFVPDLWP  896
             +++E  G I+V  DG V+R    +      + +    SKDV +     +  R++VP    
Sbjct  28    VIEEIQGLIKVCKDGHVERLPAVVDVPCTWAPEPDVASKDVAVGHGG-LWARLYVP----  82

Query  895   EKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIA  716
              + Q + LP+L+YFHGGGFCVGS  W  YH FL R++ Q+  VV+SV+YRLAPE++LP+A
Sbjct  83    -RVQTQKLPLLVYFHGGGFCVGSAAWRCYHEFLARVASQAPCVVLSVNYRLAPEHRLPVA  141

Query  715   YEDCYAALEWV--QKNQKA--EP--CLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNC  554
             YED  AA+ WV  Q + +A  EP   L   D +RVFL GDSAG  I + VA +    G  
Sbjct  142   YEDGLAAVRWVRQQMSHRAADEPGWWLAHCDFARVFLGGDSAGAAIAYNVAAQLGSFGVP  201

Query  553   ------AAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAM--NDMFWRLSLPEGSNRD  398
                    A ++G++ I P+FG   RT++E     S+ S++++  +D +WRL+LP G++RD
Sbjct  202   ESALLKPACLRGMVLIQPFFGGVARTSSEKNLVQSSRSALSLTTSDCYWRLALPPGADRD  261

Query  397   FYGCNLENDRELSVG----EWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
                CN      L+ G    E LR P ALV ++  D L++R + + + +R  G
Sbjct  262   HPWCN-----PLAKGSPKLEDLRLPPALVCISELDILRDRNMEFCKAMRSAG  308



>ref|XP_004304137.1| PREDICTED: probable carboxylesterase 17-like [Fragaria vesca 
subsp. vesca]
Length=336

 Score =   163 bits (413),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 102/287 (36%), Positives = 157/287 (55%), Gaps = 20/287 (7%)
 Frame = -2

Query  1087  QKMSIIVDEAPGYIQVFSDGTVKRFS--PEIATASAESTDGFKSKDVVIDPSKPITGRIF  914
              +  ++V+E  G I+V  +G ++R S  P +   +A       ++DVVID    +  R++
Sbjct  20    HQHGVVVEEIEGLIRVHKNGYIERPSLIPSVPCTTA------TARDVVIDKFSNLWARVY  73

Query  913   VPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPE  734
             VP           LPVL+YFHGGGFCVGS  W  YH FL  L+ ++  V++SV+YRLAPE
Sbjct  74    VPS----HPGANNLPVLVYFHGGGFCVGSAAWSCYHEFLTNLACKASCVIISVNYRLAPE  129

Query  733   NKLPIAYEDCYAALEWVQKNQKAEPC-----LESADLSRVFLAGDSAGGNIVHQVAKKCL  569
             ++LP AY+D   A+ WV++   +        L   + S +F+ GDSAG NI + V  +  
Sbjct  130   SRLPAAYDDGVNAVMWVKQQALSGSTEQKWWLSRCNFSSLFITGDSAGANIAYNVTTRLS  189

Query  568   QDGNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAM--NDMFWRLSLPEGSNRDF  395
              +     ++KG + I P+FG E RT +E  A     S++ +  +D++WRLSLP G+NRD 
Sbjct  190   NEHLQPLRLKGTVLIQPFFGGEARTWSEKYATQPPHSALTLSNSDVYWRLSLPLGANRDH  249

Query  394   YGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
               CN   +    + + LR P  +V ++  D LK+R +     L   G
Sbjct  250   PWCNPLANGVAKLRD-LRIPRIMVCISELDILKDRNLELCNALTSLG  295



>ref|XP_002285064.2| PREDICTED: probable carboxylesterase 2 [Vitis vinifera]
Length=391

 Score =   165 bits (417),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 105/275 (38%), Positives = 153/275 (56%), Gaps = 17/275 (6%)
 Frame = -2

Query  1057  PGYIQVFSDGTVKRF-SPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPEKEQV  881
             P +++VF DG V+RF   +    S     G  SKD+VIDP   ++ R+++P +    +Q 
Sbjct  82    PPFLRVFKDGKVERFVGTDSVPPSLNIETGVNSKDIVIDPETGVSARLYIPKI---NDQS  138

Query  880   ELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYEDCY  701
             + LP+L+YFHGG FC+ + +   YH +L  L  ++  V VS++YR APE+ LP+AY+DC+
Sbjct  139   QKLPLLVYFHGGAFCIETFSSPTYHNYLDSLVAEANVVAVSIEYRRAPEHPLPVAYDDCW  198

Query  700   AALEWV---QKNQKAEPCL-ESADLSRVFLAGDSAGGNIVHQVAKKCLQDGN--CAAKIK  539
             AA++W+     +Q  EP L + ADL R+F AGDSAG N+ H +A +    G+   + K+ 
Sbjct  199   AAVKWLVSHSNSQGPEPWLNDYADLDRLFFAGDSAGANLSHNMAIRAGTRGHELGSVKVS  258

Query  538   GIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELS  359
             GI+ IHPYF  +    AEV      G    + D  W    P  S  D    N   D +L+
Sbjct  259   GIILIHPYFWGKDPVGAEVKDLQKKG----LVDSLWLFVCPTTSGCDDPLINPATDPKLA  314

Query  358   VGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
                 L     LVFVA KD L++RG  Y E L + G
Sbjct  315   S---LGCQRVLVFVAEKDTLRDRGWFYHETLGKSG  346



>gb|ABK25184.1| unknown [Picea sitchensis]
Length=338

 Score =   163 bits (412),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 116/323 (36%), Positives = 186/323 (58%), Gaps = 19/323 (6%)
 Frame = -2

Query  1069  VDEAPGYIQVFSDGTVKRF-SPEI-ATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWP  896
             V+   G ++V+ DGT+ R   P +   AS +      SKD+V++    +  R+++P    
Sbjct  6     VENMSGVLKVYRDGTIFRVEDPRMFVKASLQGEGDVASKDIVLNEKLGLWVRLYLPSSHL  65

Query  895   EKE-QVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPI  719
             +++ +   LP+++YFHGGGFC+ S     +H F  +L+    ++VVSV YRLAPE++LP 
Sbjct  66    QQQTEKRRLPLIVYFHGGGFCLASPALPDFHNFTLKLAASVGAIVVSVAYRLAPEHRLPA  125

Query  718   AYEDCYAALEWVQKNQ------KAEPCLES-ADLSRVFLAGDSAGGNIVHQVAKKCLQDG  560
             AY+D   AL+WV  +       + +P L+S AD S+V+L GDSAG NI H    +C   G
Sbjct  126   AYDDGITALQWVSSHAVHGGDYEHDPWLDSHADFSQVYLLGDSAGANIAHHAVAEC---G  182

Query  559   NCAA----KIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFY  392
                A    +++G + + PYFG+E+RT +E         ++ ++D  WR+SLP GSNRD  
Sbjct  183   GVEAWSPMRVRGAIFVQPYFGAEKRTRSESECPPDAFFTLPLSDACWRVSLPVGSNRDHP  242

Query  391   GCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeegh  212
               N  +D    + E +  P  LV + G+D L++RG+ Y E L++ G K +EV+  EEE H
Sbjct  243   FSNPWSDGAPKLEE-VPLPPLLVAIGGRDMLRDRGLDYCESLKQCG-KSLEVMVLEEEEH  300

Query  211   vfhvfHPDSEATRLLQKQMSEFI  143
              F+   P  +++  L +++S FI
Sbjct  301   AFYALKPHCQSSERLMERISRFI  323



>ref|XP_007152464.1| hypothetical protein PHAVU_004G132800g [Phaseolus vulgaris]
 gb|ESW24458.1| hypothetical protein PHAVU_004G132800g [Phaseolus vulgaris]
Length=354

 Score =   163 bits (413),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 105/267 (39%), Positives = 152/267 (57%), Gaps = 14/267 (5%)
 Frame = -2

Query  1036  SDGTVKR----FSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPEKEQVELLP  869
             SDGTVKR    F    +   A+S +G  +KDV +D ++ +  R+F P          ++P
Sbjct  45    SDGTVKRGFMNFFNYKSQPKAKSVNGVSTKDVTVDANRNLWFRVFTPT---ASSANGVVP  101

Query  868   VLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYEDCYAALE  689
             V+++FHGGGF   S     Y     R   +  +VVVSV+YRLAPE++ P  Y+D    L+
Sbjct  102   VVVFFHGGGFAFLSPDSYVYDAVCRRFCRRIPAVVVSVNYRLAPEHRCPSQYDDGEDVLK  161

Query  688   WVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGIMPIHPYFG  509
             ++ +N    P  E+ADLS+ FLAGDSAG N+ H VA +  + G    ++ G++ I P+FG
Sbjct  162   FLAENPAVLP--ENADLSKCFLAGDSAGANLAHHVAVRVAKSGIRNVRVVGLVSIQPWFG  219

Query  508   SERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLE--NDRELSVGEWLRFP  335
              E RTAAEV  EG+   S A  D  W+  LP+GS+RD +  N+   N  +LS    L +P
Sbjct  220   GEERTAAEVRLEGAPTVSTARTDWLWKAFLPDGSDRDHWAVNVSGANSEDLS---GLDYP  276

Query  334   AALVFVAGKDFLKERGVMYAEFLRRKG  254
              +LVFV G D L++    Y E+L+  G
Sbjct  277   DSLVFVGGFDPLQDWQRRYYEWLKNSG  303



>ref|XP_002277680.1| PREDICTED: probable carboxylesterase 6 [Vitis vinifera]
 emb|CBI32810.3| unnamed protein product [Vitis vinifera]
Length=335

 Score =   163 bits (412),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 109/286 (38%), Positives = 160/286 (56%), Gaps = 16/286 (6%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKR---------FSPEIATASAESTDGFKSKDVVIDPSKPITGR  920
             +V E  G+++VF DG+V R         F  E      E  +G  + DV+IDP+  +T R
Sbjct  7     LVQEVTGWLKVFDDGSVDRTWTGPPEARFMTEPVPPHHEFKNGVATSDVIIDPTSGLTVR  66

Query  919   IFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLA  740
             I++P+  P  E  + LPVLL+FHGGGFCV    W  Y+     L+++++ + VSV  R A
Sbjct  67    IYLPEKKPGDE--DKLPVLLHFHGGGFCVSQADWYIYYHTHTVLAIRARVICVSVYLRRA  124

Query  739   PENKLPIAYEDCYAALEWVQ---KNQKAEPCLES-ADLSRVFLAGDSAGGNIVHQVAKKC  572
             PEN+LP A ED Y+AL W+Q   K Q  +P L S AD +RVFL GDS+GGN+VHQVA   
Sbjct  125   PENRLPAACEDGYSALLWLQCVAKGQSEQPWLHSHADFTRVFLIGDSSGGNLVHQVAAVG  184

Query  571   LQDGNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFY  392
              +      ++ G + IHP F    R+ +E+  E S   ++ M D F +L+LP GSN++  
Sbjct  185   GKMQLGPLRLAGGVMIHPGFVRSERSKSELQQEDSPFLTLEMADKFLKLALPVGSNKEHP  244

Query  391   GCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
                        + + L+ P  L+ VA KD L +  + Y E +++ G
Sbjct  245   ITCPMGAAAPPISD-LKLPPLLLCVAEKDQLMDTEMEYYEAMKKGG  289



>ref|XP_006826391.1| hypothetical protein AMTR_s00004p00146330 [Amborella trichopoda]
 gb|ERM93628.1| hypothetical protein AMTR_s00004p00146330 [Amborella trichopoda]
Length=327

 Score =   162 bits (411),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 100/276 (36%), Positives = 155/276 (56%), Gaps = 8/276 (3%)
 Frame = -2

Query  1069  VDEAPGYIQVFSDGTVKRFSPEIATASAESTDG-FKSKDVVIDPSKPITGRIFVPDLWPE  893
             ++   G +Q+FS+G++ R SP+ +       DG    KDV  D +  +  R++ P L  E
Sbjct  20    IENCRGVLQIFSNGSIVR-SPQPSFQIPVEDDGSVLWKDVGFDKALDLHLRVYKP-LSHE  77

Query  892   KEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAY  713
               +   LP+  YFHGGG+C+GS TW  +H F  +LS +  ++V++ DYRLAPEN+LP A 
Sbjct  78    NNR---LPIFYYFHGGGYCIGSRTWPNFHNFCLKLSRELPAIVIAPDYRLAPENRLPSAI  134

Query  712   EDCYAALEWVQKNQKAEPCL-ESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKG  536
             +D ++A+ W+  +   +  L ++AD  RV+++GDSAGGNI H +A    + G+    IKG
Sbjct  135   DDAFSAVRWLATDGITDQFLSQTADFGRVYISGDSAGGNIAHHLAVGLSEGGHENLTIKG  194

Query  535   IMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSV  356
              + + P+FG    T +E          + +ND +WRLSLPEG++RD    N        +
Sbjct  195   FVLLMPFFGGVEHTLSEATCPQDAFLKLDLNDRYWRLSLPEGTDRDHPLSNPFGPGAKDL  254

Query  355   GEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVK  248
             G  + F   L  V  +D L++RGV Y + L   G K
Sbjct  255   GS-VDFIPMLDVVGERDLLRDRGVEYGKRLVEMGKK  289



>emb|CDP12915.1| unnamed protein product [Coffea canephora]
Length=341

 Score =   163 bits (412),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 108/289 (37%), Positives = 154/289 (53%), Gaps = 16/289 (6%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKR---------FSPEIATASAESTDGFKSKDVVIDPSKPITGR  920
             +V++  G+++VF DG+V R         F  E      E  DG  +KDVVID    +  R
Sbjct  7     VVEDVSGWLRVFDDGSVDRTWTGPGEVKFMSESVPPHEEFIDGVATKDVVIDQESGLQVR  66

Query  919   IFVPDLWPEKE--QVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYR  746
             I++P    +K       LP++L+FHGGGFC+    W  Y+    RL+  + ++VVSV  R
Sbjct  67    IYLPQNTDDKNLNNHHKLPIILHFHGGGFCISQADWFMYYTVYTRLARSAGAIVVSVYLR  126

Query  745   LAPENKLPIAYEDCYAALEWV----QKNQKAEPCL-ESADLSRVFLAGDSAGGNIVHQVA  581
              APE++LP A +D YAAL W+    Q   + EP L E AD SRVFL GDS+GGNIVHQVA
Sbjct  127   RAPEHRLPAACDDGYAALLWLGSLAQGKVEPEPWLGEYADFSRVFLIGDSSGGNIVHQVA  186

Query  580   KKCLQDGNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNR  401
              +   D     K+ G +PIHP F  + R+ +E     S   ++ M D F  L+LP GS +
Sbjct  187   ARSGNDDLKPVKVAGAIPIHPGFVRKERSKSEQEQPQSPFLTLDMVDKFLNLALPIGSTK  246

Query  400   DFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             D        D  +   + L  P  L  VA  D +K+  + + E +++ G
Sbjct  247   DHPITCPMGDGVVPKIQNLNLPPYLFCVADCDLIKDTEMEFYEAMKKAG  295



>ref|XP_002461499.1| hypothetical protein SORBIDRAFT_02g003610 [Sorghum bicolor]
 gb|EER98020.1| hypothetical protein SORBIDRAFT_02g003610 [Sorghum bicolor]
Length=350

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 116/319 (36%), Positives = 168/319 (53%), Gaps = 18/319 (6%)
 Frame = -2

Query  1054  GYIQVFSDGTVKR------FSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPE  893
             G+++V SDGTV R      F P     S  S    + K+ V D +K +  R++ P     
Sbjct  25    GFLRVLSDGTVLRSPAGPVFCPTTFPGSHPSV---QWKEAVYDKAKNLRVRMYKPTTTAS  81

Query  892   KEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAY  713
                 + LPVL++FHGGGFC+GS TW   H F  RL+  + +VV+S  YRLAPE++LP A+
Sbjct  82    AAAGKKLPVLVHFHGGGFCLGSCTWANVHEFCLRLAADAGAVVLSAGYRLAPEHRLPAAF  141

Query  712   EDCYAALEWVQKNQKAEP----CLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGN---C  554
             +D    + W++    A         +AD  RVF+ GDSAGG I H +A +   +      
Sbjct  142   DDGAGFMRWLRDQSVAAADGWLAEAAADFGRVFVTGDSAGGTIAHHLAVRAAAEPEPEPG  201

Query  553   AAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLEN  374
                ++G + + P+FG  RRTA+E         ++ + D FWRLSLP G+ RD    N   
Sbjct  202   HVTVRGYVLLMPFFGGVRRTASEAECPEEAFPNLDLVDRFWRLSLPAGATRDHPAANPFG  261

Query  373   DRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfH  194
                  +G  + FP  LV V G D +++R V YAE L   G K VEV +   + H F++  
Sbjct  262   PDSPDLGS-VDFPPVLVVVGGLDLIRDRTVDYAERLAAMG-KPVEVAKFAGKPHGFYLHE  319

Query  193   PDSEATRLLQKQMSEFIHG  137
             P SEAT  L + ++ F+ G
Sbjct  320   PGSEATGELIQTVARFVDG  338



>ref|XP_007151773.1| hypothetical protein PHAVU_004G073600g [Phaseolus vulgaris]
 gb|ESW23767.1| hypothetical protein PHAVU_004G073600g [Phaseolus vulgaris]
Length=334

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 103/269 (38%), Positives = 152/269 (57%), Gaps = 14/269 (5%)
 Frame = -2

Query  1036  SDGTVKRFSPEI----ATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPEKEQVELLP  869
             SDGTV R    +    + + A+S  G  +KDV +D ++ +  R+F P          ++P
Sbjct  33    SDGTVNRGFMNLLDYKSRSKAKSVKGVSTKDVTVDANRNLWFRVFTP---TASSGDGVVP  89

Query  868   VLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYEDCYAALE  689
             V+++FHGGGF   S+   GY     R   Q  ++VVSV+YR  PE++ P  Y+D    L+
Sbjct  90    VVIFFHGGGFAFLSSDSFGYDAVCRRFCRQINAIVVSVNYRRTPEHRFPSQYDDGEDVLK  149

Query  688   WVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGIMPIHPYFG  509
             ++ +N    P  E ADLS+ FLAGDSAGGN+ H VA +  + G    ++ G++ I P+FG
Sbjct  150   FLDENPAVLP--EKADLSKCFLAGDSAGGNLAHHVAVRVAKSGLREVRVVGLVSIQPWFG  207

Query  508   SERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLE--NDRELSVGEWLRFP  335
              E RTAAEV  +G+   S +  D  W+  LPEGS+RD +  N+   N  +L+    L +P
Sbjct  208   GEERTAAEVKFKGAPLVSTSRTDWLWKAFLPEGSDRDHWAVNVSGANSEDLT---GLDYP  264

Query  334   AALVFVAGKDFLKERGVMYAEFLRRKGVK  248
               LVFV G D L++    Y E+LR+ G K
Sbjct  265   DTLVFVGGFDPLQDWQRRYYEWLRKSGKK  293



>ref|XP_002468158.1| hypothetical protein SORBIDRAFT_01g040580 [Sorghum bicolor]
 gb|EER95156.1| hypothetical protein SORBIDRAFT_01g040580 [Sorghum bicolor]
Length=372

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 111/314 (35%), Positives = 165/314 (53%), Gaps = 28/314 (9%)
 Frame = -2

Query  1120  FHPQNTQISNLQKMSIIVDEAPGYIQVFSDGTVKRFSPEIAT-------ASAESTDGFKS  962
             F  Q   +        +V+E  G I+V+ DG V+R  P I T         A++  G  +
Sbjct  20    FQQQPAAVVAKNGHGPVVEEIHGLIRVYKDGHVERL-PAIPTVPCTWGGTGADAPGGVVA  78

Query  961   KDVVIDPSKPITGRIFVPDLWPEKEQVELL----PVLLYFHGGGFCVGSTTWVGYHLFLG  794
             +DVV+DP+  +  R++ P                PV++YFHGGGFCVGS  W  YH FL 
Sbjct  79    RDVVVDPATGVWARLYAPMTTTTSAGGGTGGSRPPVVVYFHGGGFCVGSAAWSCYHEFLA  138

Query  793   RLsvqsksvvvsVDYRLAPENKLPIAYEDCYAALEWVQ-KNQKAEPCLE------SADLS  635
             +LS ++   V+SVDYRLAPE++LP A++D  AA+ W++ +  +A  C +           
Sbjct  139   QLSARAGCAVMSVDYRLAPEHRLPAAFDDGLAAVRWLRHQASRAAACDDLSWWRARCGFD  198

Query  634   RVFLAGDSAGGNIVHQVAKKCLQDGNCAA----KIKGIMPIHPYFGSERRTAAE--VAAE  473
             RVFL GDSAG +I   VA + L  G+  A     ++G + I P+FG E RT +E  +A  
Sbjct  199   RVFLMGDSAGASIAFHVAAR-LGQGHLGALSPLTVRGAVLIQPFFGGEARTVSEKSMAQP  257

Query  472   GSTGSSVAMNDMFWRLSLPEG-SNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLK  296
               +  ++A +D +WRL+LP G S+RD   CN    R     E +  P  LV V+  D L+
Sbjct  258   PRSALTLATSDCYWRLALPAGASSRDHPWCN-PLSRAAPRLETVPLPPVLVCVSETDILR  316

Query  295   ERGVMYAEFLRRKG  254
             +R +     +R+ G
Sbjct  317   DRNLELCRAMRKAG  330



>ref|XP_007199906.1| hypothetical protein PRUPE_ppa007279mg [Prunus persica]
 gb|EMJ01105.1| hypothetical protein PRUPE_ppa007279mg [Prunus persica]
Length=375

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 105/270 (39%), Positives = 150/270 (56%), Gaps = 15/270 (6%)
 Frame = -2

Query  1051  YIQVFSDGTVKRFS-PEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPEKEQVEL  875
             +++++ DG V+R S  +I   S ++  G  SKD VI P   ++ R+++P         +L
Sbjct  71    FLKIYKDGRVERLSGTDIVPTSLDAQTGVASKDAVISPDTGVSVRLYIPKTKITTNPTKL  130

Query  874   LPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYEDCYAA  695
              P+L+YFHGGGFC+GS     YH ++  L  ++ +V VSVDYR APEN LP+ ++D +AA
Sbjct  131   -PLLVYFHGGGFCMGSPFCAYYHSYVTSLVAETNAVAVSVDYRKAPENPLPLGFDDSWAA  189

Query  694   LEWVQKN---QKAEPCLES-ADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGIMP  527
             L WVQ +   Q  E  L S AD  RVF AGDSAG NI H +A +   +G    K+KGI  
Sbjct  190   LNWVQSHFEGQGPEEWLNSYADFERVFFAGDSAGANIAHHMALRLGHEGLVGVKLKGIAL  249

Query  526   IHPYF-GSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVGE  350
             +HPYF GSE      +  E     + A  +  WR + P  S  D    N   D +L+   
Sbjct  250   VHPYFWGSE-----PIEGETHVVENRARAEGIWRFACPSSSGADDPLINPGKDPKLAK--  302

Query  349   WLRFPAALVFVAGKDFLKERGVMYAEFLRR  260
              L     LV VA +D L++RG  Y+E L++
Sbjct  303   -LGADRVLVCVAEQDVLRQRGWYYSELLKK  331



>ref|XP_002510251.1| Gibberellin receptor GID1, putative [Ricinus communis]
 gb|EEF52438.1| Gibberellin receptor GID1, putative [Ricinus communis]
Length=312

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 120/309 (39%), Positives = 167/309 (54%), Gaps = 17/309 (6%)
 Frame = -2

Query  1051  YIQVFSDGTVKRFS-PEIATASAESTDGFKSKDVVIDPSK--PITGRIFVPDLWPEKEQV  881
             Y++V++DGT++R++  E+A A  +S     SKD+ I  S+   ++ R++ PD     +  
Sbjct  14    YLRVYADGTIQRYAGTEVAPAGFDSQTRVLSKDIFITISQQATLSARLYRPD---SVKIS  70

Query  880   ELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYEDCY  701
             + LPVL+YFHGG FC+ S     YH  + +L  Q+  +VVSVDYRLAPEN LP AY D  
Sbjct  71    QKLPVLIYFHGGAFCIASAAEPKYHHCMNQLVSQANVIVVSVDYRLAPENPLPAAYGDSG  130

Query  700   AALEWVQKNQKAEPCLES-ADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGIMPI  524
              AL+WV    + EP LE  AD  R+FLAGDSAG NIVH +  +     N   KIKGI+ I
Sbjct  131   TALQWVGSGGRGEPWLEDYADFGRLFLAGDSAGANIVHHLGLRV----NPNMKIKGIVMI  186

Query  523   HPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVGEWL  344
             HPYF  +     EV    +     +M D +W    P     D    N   D   SV + L
Sbjct  187   HPYFWGKDPIGKEV----NDSLRKSMVDTWWMFVCPSDKGCDDPLINPFADGAPSV-KGL  241

Query  343   RFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvf-hvfHPDSEATRLL  167
                + LVF A KD L ERG  Y E L + G K    +   +      H+F+PD +  R+L
Sbjct  242   GCESVLVFTAEKDILCERGQFYYENLVKSGWKGKAEIVETKGEDHVFHIFNPDCDNARVL  301

Query  166   QKQMSEFIH  140
              K+ + +I+
Sbjct  302   IKRWASYIN  310



>ref|NP_001149748.1| LOC100283375 [Zea mays]
 gb|ACG36650.1| prMC3 [Zea mays]
Length=370

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 108/300 (36%), Positives = 162/300 (54%), Gaps = 30/300 (10%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIAT-------ASAESTDGFKSKDVVIDPSKPITGRIF  914
             +V+E  G I+V+ DG V+R  P I          + ++  G  ++DVV+DP+  +  R++
Sbjct  36    VVEEIHGLIRVYKDGHVERL-PAIPAVPCTWGGTAPDAPGGVVARDVVVDPATGVWARLY  94

Query  913   VPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPE  734
              P    +  +    PV++YFHGGGFCVGS  W  YH FL +L+ ++   V+SVDYRLAPE
Sbjct  95    APTSAGDGAR---RPVVVYFHGGGFCVGSAAWSCYHEFLAQLAARAGCAVMSVDYRLAPE  151

Query  733   NKLPIAYEDCYAALEWVQKNQKAEPCLESA---DLS---------RVFLAGDSAGGNIVH  590
             ++LP A++D  AA+ W++    A     +    DLS         RVFL GDSAG +I  
Sbjct  152   HRLPAAFDDXLAAVRWLRHQAAASASASACCNDDLSWWRARCGFDRVFLMGDSAGASIAL  211

Query  589   QVAKKCLQDGNCAA----KIKGIMPIHPYFGSERRTAAE--VAAEGSTGSSVAMNDMFWR  428
              VA + L  G   A     ++G + I P+ G E RTA+E  VA    +  ++A +D +WR
Sbjct  212   HVAAR-LGQGQLGALPPLTVRGAVLIQPFLGGEGRTASEKNVAQPPRSALTLATSDCYWR  270

Query  427   LSLPEGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVK  248
             L+LP G++R+   CN  + R     E    P  LV V+  D L++R +     LR  G +
Sbjct  271   LALPAGASREHPWCNPLSGRAAPRLETTPLPPLLVCVSETDILRDRNLELCRALREAGKR  330



>ref|XP_007151780.1| hypothetical protein PHAVU_004G074300g [Phaseolus vulgaris]
 gb|ESW23774.1| hypothetical protein PHAVU_004G074300g [Phaseolus vulgaris]
Length=364

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 105/269 (39%), Positives = 150/269 (56%), Gaps = 14/269 (5%)
 Frame = -2

Query  1036  SDGTVKRFSPEI----ATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPEKEQVELLP  869
             SDG+V R   ++    +    +S  G  +KDV +D S+ +  RIF P          ++P
Sbjct  63    SDGSVNRGLMKLVDYKSRPKTKSVKGVSTKDVTVDASRDLWFRIFTPT---ASSGDGVVP  119

Query  868   VLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYEDCYAALE  689
             V++YFHGGGF   S    GY         Q  ++VVSV+YR  PE++ P  Y+D    L+
Sbjct  120   VVIYFHGGGFAFHSPDSYGYDPLCRGFCRQINAIVVSVNYRRTPEHRFPSQYDDGEDVLK  179

Query  688   WVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGIMPIHPYFG  509
             ++ +N    P  E ADLS+ FLAGDSAGGN+ H VA +  + G    ++ G++ I P+FG
Sbjct  180   FLDENPAVLP--EKADLSKCFLAGDSAGGNLAHHVAVRVAKSGLREVRVVGLVSIQPWFG  237

Query  508   SERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLE--NDRELSVGEWLRFP  335
              E RTAAEV  +G+   S +  D  WR+ LPEGS+RD +  N+   N  +L+    L FP
Sbjct  238   GEERTAAEVKFKGARLVSTSRTDWLWRVFLPEGSDRDHWAANVSGANSEDLT---GLDFP  294

Query  334   AALVFVAGKDFLKERGVMYAEFLRRKGVK  248
               LVFV G D L++    Y E+LR+ G K
Sbjct  295   DTLVFVGGFDPLQDWQRRYYEWLRKSGKK  323



>emb|CDP00594.1| unnamed protein product [Coffea canephora]
Length=341

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 108/290 (37%), Positives = 155/290 (53%), Gaps = 30/290 (10%)
 Frame = -2

Query  1066  DEAPGYIQVFSDGTVKRFSPEIA---TASAESTDGFKSKDVVIDPSKPITGRIFVPDLWP  896
             +E  G I+V+ DG V+R  P+I    T +        S D+VID    +  R +VP    
Sbjct  26    EEIEGLIKVYKDGHVER--PQIVPSVTCAVAPDQALTSTDIVIDKCTNVWARFYVPKCHA  83

Query  895   EKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIA  716
             +      LP+L+YFHGGGFCVGS +W  YH FL +L+ ++  V++SV+YRLAPEN LP A
Sbjct  84    K------LPLLVYFHGGGFCVGSASWSCYHEFLAKLASKANCVIMSVNYRLAPENPLPAA  137

Query  715   YEDCYAALEWVQKNQKAEP---CLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAK  545
             Y+D   AL WV++   +          +LS +FLAGDSAG NI + +A +    G     
Sbjct  138   YDDGIKALFWVKQQAFSAANDWFTSKCNLSSIFLAGDSAGANIAYNIAIRLGSPGGKLEA  197

Query  544   I-----KGIMPIHPYFGSERRTAAE--VAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGC  386
             +     KG + I P+FG E RT +E  +     +  ++A +D +WRLSLP G+NRD   C
Sbjct  198   LSPLGFKGAILIQPFFGGESRTYSEKYMVQPPRSALTLAASDTYWRLSLPVGANRDHPWC  257

Query  385   NLENDRELSVG----EWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVK  248
             N      L+ G    E +R    +V ++  D LK+R +     L   G K
Sbjct  258   N-----PLAKGAPKLEDIRLVPMVVCISEMDILKDRNLEVCNALVSAGKK  302



>ref|XP_004494115.1| PREDICTED: probable carboxylesterase 18-like [Cicer arietinum]
Length=346

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 104/273 (38%), Positives = 150/273 (55%), Gaps = 17/273 (6%)
 Frame = -2

Query  1036  SDGTVKR----FSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVP------DLWPEKE  887
             S+GTV R    F     +A+    +G  +KDV +DP + I  R+F P      D     +
Sbjct  35    SNGTVNRGFLKFLDRKCSANITPVNGVFTKDVTVDPERNIWFRLFTPTDAVTVDGGDADD  94

Query  886   QVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYED  707
             +   LPV+++FHGGGF   S     Y     R   +   VVVSV+YRL PE++ P  Y+D
Sbjct  95    KTASLPVVIFFHGGGFTYLSPASASYDAVCRRFCRKMSVVVVSVNYRLTPEHRYPSQYDD  154

Query  706   CYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGIMP  527
                 L+++ +N+   P  E+AD+S+ FLAGDSAG N+ H VA +  + G    ++ G++ 
Sbjct  155   GEEVLKFLDENKTVLP--ENADVSKCFLAGDSAGANLAHHVAVRVCKAGLQNIQVVGLIS  212

Query  526   IHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLE--NDRELSVG  353
             I P+FG E RT +EV  EGS   S+A  D  W++ LPEGS+RD    N+   N  +LS  
Sbjct  213   IQPFFGGEERTESEVRLEGSPLVSMARTDWMWKVFLPEGSDRDHGAANVSGPNSEDLS--  270

Query  352   EWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
               L FP  L+FV G D L +    Y ++LR+ G
Sbjct  271   -GLDFPDTLIFVGGFDPLNDWQKRYYDWLRKNG  302



>gb|ACF87795.1| unknown [Zea mays]
 gb|AFW88919.1| prMC3 [Zea mays]
Length=370

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 108/300 (36%), Positives = 162/300 (54%), Gaps = 30/300 (10%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIAT-------ASAESTDGFKSKDVVIDPSKPITGRIF  914
             +V+E  G I+V+ DG V+R  P I          + ++  G  ++DVV+DP+  +  R++
Sbjct  36    VVEEIHGLIRVYKDGHVERL-PAIPAVPCTWGGTAPDAPGGVVARDVVVDPATGVWARLY  94

Query  913   VPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPE  734
              P    +  +    PV++YFHGGGFCVGS  W  YH FL +L+ ++   V+SVDYRLAPE
Sbjct  95    APTSAGDGAR---RPVVVYFHGGGFCVGSAAWSCYHEFLAQLAARAGCAVMSVDYRLAPE  151

Query  733   NKLPIAYEDCYAALEWVQKNQKAEPCLESA---DLS---------RVFLAGDSAGGNIVH  590
             ++LP A++D  AA+ W++    A     +    DLS         RVFL GDSAG +I  
Sbjct  152   HRLPAAFDDGLAAVRWLRHQAAASASASACCNDDLSWWRARCGFDRVFLMGDSAGASIAL  211

Query  589   QVAKKCLQDGNCAA----KIKGIMPIHPYFGSERRTAAE--VAAEGSTGSSVAMNDMFWR  428
              VA + L  G   A     ++G + I P+ G E RTA+E  VA    +  ++A +D +WR
Sbjct  212   HVAAR-LGQGQLGALPPLTVRGAVLIQPFLGGEGRTASEKNVAQPPRSALTLATSDCYWR  270

Query  427   LSLPEGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVK  248
             L+LP G++R+   CN  + R     E    P  LV V+  D L++R +     LR  G +
Sbjct  271   LALPAGASREHPWCNPLSGRAAPRLETTPLPPLLVCVSETDILRDRNLELCRALREAGKR  330



>ref|XP_004291126.1| PREDICTED: probable carboxylesterase 2-like [Fragaria vesca subsp. 
vesca]
Length=314

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 120/316 (38%), Positives = 179/316 (57%), Gaps = 13/316 (4%)
 Frame = -2

Query  1075  IIVDEAPGYIQVFSDGTVKRFS-PEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLW  899
             +++D +P Y +V  DGT++R +  ++  A  +   G  SKD+VI P   ++ R++ P++ 
Sbjct  6     VLLDVSP-YARVLKDGTIERLNGTQVVPAGLDPLTGVLSKDIVICPQTGVSARLYKPNI-  63

Query  898   PEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPI  719
                E  + LP+++Y+HGG FC+ S     YH  L  L  +++++ VSV+YRLAPE+ LPI
Sbjct  64    --TETSQKLPLIVYYHGGAFCIASAAEPLYHNCLNMLVAEARAIAVSVNYRLAPEHPLPI  121

Query  718   AYEDCYAALEWVQKNQKAEPCL-ESADLSRVFLAGDSAGGNIVHQVAKKCLQ-DGNCAAK  545
             AYED +AALEWV   ++ +  + +  DL RVFL GDSAG NI H +A +  + D +   K
Sbjct  122   AYEDSWAALEWVFGGEELDEWVKDHVDLERVFLVGDSAGANIAHHLALRVKKSDPDPKVK  181

Query  544   IKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRE  365
             I GI  IHPYF  +     EVA         +M D +W    P     D    N   D  
Sbjct  182   IAGIGMIHPYFWGKDPIGREVADSFRK----SMVDTWWSFVCPSEKGSDDPLINPFIDGS  237

Query  364   LSVGEWLRFPAALVFVAGKDFLKERG-VMYAEFLRRKGVKWvevveaeeeghvfhvfHPD  188
              S+ E L     LV VAG+D L++RG + Y E ++  G    E++E E E HVFH+F+P+
Sbjct  238   PSL-EGLACGKVLVLVAGEDILRDRGRLYYDELVKSNGAGSKELIETEGEDHVFHIFNPN  296

Query  187   SEATRLLQKQMSEFIH  140
             SE  + L K +  FI+
Sbjct  297   SEKAKSLIKDLGSFIN  312



>ref|XP_002994597.1| hypothetical protein SELMODRAFT_138855 [Selaginella moellendorffii]
 gb|EFJ04341.1| hypothetical protein SELMODRAFT_138855 [Selaginella moellendorffii]
Length=329

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 101/278 (36%), Positives = 151/278 (54%), Gaps = 15/278 (5%)
 Frame = -2

Query  1048  IQVFSDGTVKRFS----PEIATASAESTDGFKSKDVVIDPSKPITGRIFVPD---LWPEK  890
             +Q +SDG V R S    P+ A   +   D    KDV++D    +  RIF P    +  + 
Sbjct  13    VQHYSDGRVVRTSKPQWPDCAADPSFEKDEIGCKDVILDEGTGMWARIFAPKSATVVHDA  72

Query  889   EQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYE  710
                    +L+YFHGGGF   S     +H     +S +   +VVSV YRLAPE++LP+A++
Sbjct  73    SSTGKHALLVYFHGGGFVAFSPASSIFHGLCSGISHKMGMIVVSVAYRLAPEHRLPVAFD  132

Query  709   DCYAALEWVQKNQKAEPC-----LESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAK  545
             D + +L+W+Q   K  P      L++AD SR+FL G SAGG IVH +A + +       +
Sbjct  133   DSFVSLQWLQSQAKKSPMDRDPWLQNADFSRIFLMGGSAGGTIVHYMAARSIHSDLSPLE  192

Query  544   IKGIMPIHPYFGSERRTAAEVAAEGSTGS-SVAMNDMFWRLSLPEGSNRDFYGCNLENDR  368
             IKG+ P+ P+FG+E R+ +E+ +       ++A  D FWR  LPEG+NRD   C + +  
Sbjct  193   IKGLFPVVPFFGAEERSKSEIRSLVQPDVLTLADCDTFWRFCLPEGTNRDHEYCRVPSAE  252

Query  367   ELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             E+   + +  P +LV V  +D L  R V Y E LR+ G
Sbjct  253   EIVKIDPM--PPSLVVVGARDVLHSRQVEYYEELRKAG  288



>ref|XP_002966042.1| hypothetical protein SELMODRAFT_25100, partial [Selaginella moellendorffii]
 gb|EFJ33462.1| hypothetical protein SELMODRAFT_25100, partial [Selaginella moellendorffii]
Length=296

 Score =   160 bits (404),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 100/277 (36%), Positives = 152/277 (55%), Gaps = 15/277 (5%)
 Frame = -2

Query  1045  QVFSDGTVKRFS----PEIATASAESTDGFKSKDVVIDPSKPITGRIFVPD---LWPEKE  887
             Q++SDG V R S    P+ A   +        KDV++D    +  RIF P    +  +  
Sbjct  1     QLYSDGRVVRTSKPQWPDCAADPSFEKGEIGCKDVILDEGTGMWARIFAPKSATVVHDAS  60

Query  886   QVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYED  707
                   +L+YFHGGGF   S     +H     +S +   +VVSV YRLAPE++LP+A++D
Sbjct  61    STGKHALLVYFHGGGFVAFSPASSIFHGLCSGISHKMGMIVVSVAYRLAPEHRLPVAFDD  120

Query  706   CYAALEWVQKNQKA-----EPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKI  542
              + +L+W+Q   K      +P L++AD SR+FL G SAGG IVH +A + +       +I
Sbjct  121   SFVSLQWLQSQAKKSPMDRDPWLQNADFSRIFLMGGSAGGTIVHYMAARSIHSDLSPLEI  180

Query  541   KGIMPIHPYFGSERRTAAEVAAEGSTGS-SVAMNDMFWRLSLPEGSNRDFYGCNLENDRE  365
             KG+ P+ P+FG+E R+ +E+ +       ++A  D FWR  LPEG+NRD   C + +  E
Sbjct  181   KGLFPVVPFFGAEERSKSEIQSLVQPDVLTLADCDTFWRFCLPEGTNRDHEYCRVPSAEE  240

Query  364   LSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             ++  + +  P +LV V  +D L  R V Y E LR+ G
Sbjct  241   IAKIDPM--PPSLVVVGARDVLHSRQVEYYEELRKAG  275



>ref|XP_002974173.1| hypothetical protein SELMODRAFT_15028, partial [Selaginella moellendorffii]
 gb|EFJ25128.1| hypothetical protein SELMODRAFT_15028, partial [Selaginella moellendorffii]
Length=296

 Score =   160 bits (404),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 100/277 (36%), Positives = 152/277 (55%), Gaps = 15/277 (5%)
 Frame = -2

Query  1045  QVFSDGTVKRFS----PEIATASAESTDGFKSKDVVIDPSKPITGRIFVPD---LWPEKE  887
             Q++SDG V R S    P+ A   +        KDV++D    +  RIF P    +  +  
Sbjct  1     QLYSDGRVVRTSKPQWPDCAADPSFEKGEIGCKDVILDEGTGMWARIFAPKWATVVHDAS  60

Query  886   QVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYED  707
                   +L+YFHGGGF   S     +H     +S +   +VVSV YRLAPE++LP+A++D
Sbjct  61    STGKHALLVYFHGGGFVAFSPASSIFHGLCSGISHKMGMIVVSVAYRLAPEHRLPVAFDD  120

Query  706   CYAALEWVQKNQKA-----EPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKI  542
              + +L+W+Q   K      +P L++AD SR+FL G SAGG IVH +A + +       +I
Sbjct  121   SFVSLQWLQSQAKKSPMDRDPWLQNADFSRIFLMGGSAGGTIVHYMAARSIHSDLSTLEI  180

Query  541   KGIMPIHPYFGSERRTAAEVAAEGSTGS-SVAMNDMFWRLSLPEGSNRDFYGCNLENDRE  365
             KG+ P+ P+FG+E R+ +E+ +       ++A  D FWR  LPEG+NRD   C + +  E
Sbjct  181   KGLFPVVPFFGAEERSKSEIQSLVQPDVLTLADCDTFWRFCLPEGTNRDHEYCRVPSAEE  240

Query  364   LSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             ++  + +  P +LV V  +D L  R V Y E LR+ G
Sbjct  241   IAKIDPM--PPSLVVVGARDVLHSRQVEYYEELRKAG  275



>gb|ABK26900.1| unknown [Picea sitchensis]
Length=337

 Score =   160 bits (406),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 118/327 (36%), Positives = 181/327 (55%), Gaps = 11/327 (3%)
 Frame = -2

Query  1069  VDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPD-LWPE  893
             V+   G I+V+ DGT+ R  P    AS +   G  SK VV++ +  +  R+++P    P+
Sbjct  6     VENVSGLIKVYRDGTIVRHPPTFVKASLQGEGGVASKGVVLNETLGLWVRLYLPSSHLPQ  65

Query  892   KEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAY  713
             + +   L +++YFHGGGFC+ S      H F  +L+    ++VVSV YRL PE++LP AY
Sbjct  66    QTEKRRLRLIVYFHGGGFCLFSPAEPDIHNFTLKLTESVGAIVVSVAYRLTPEHRLPAAY  125

Query  712   EDCYAALEWVQKNQ------KAEPCLES-ADLSRVFLAGDSAGGNIVHQ-VAKKCLQDGN  557
             +DC  AL+WV  +       + +P L S AD S+V++ GDSAG N  H  V +    +  
Sbjct  126   DDCITALQWVSSHAVDGGDFERDPWLHSHADFSQVYILGDSAGANNAHHGVVRSGGVEAW  185

Query  556   CAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLE  377
                KI+G + + P F +E+RT +E         ++   D  WR+SLP GSNRD   CN  
Sbjct  186   SPLKIRGAIFVQPAFSAEKRTRSESECPPDAFLTLQEGDACWRISLPVGSNRDHPFCNPW  245

Query  376   NDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvf  197
             +D   ++ E +  P  LV + G+D L++   +Y E L++ G K VEV+  EEEGH F+  
Sbjct  246   SDGAPNMEE-VTLPPLLVAIGGRDMLRDSNHVYCESLKQCG-KSVEVMVLEEEGHAFYAL  303

Query  196   HPDSEATRLLQKQMSEFIHGV*SSMVI  116
              P  +++  L +++S FI    S  VI
Sbjct  304   KPHCQSSERLMERISRFISSSPSESVI  330



>ref|XP_003550344.1| PREDICTED: probable carboxylesterase 13-like [Glycine max]
Length=337

 Score =   160 bits (405),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 109/280 (39%), Positives = 151/280 (54%), Gaps = 12/280 (4%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDV-VIDP-SKPITGRIFVPDLW  899
             I  + PG I+VF+DG V+RF+         +T    SKD+ ++ P S  ++ R+F+P   
Sbjct  17    IAHDFPGLIRVFTDGRVQRFT-GTDVVPPSTTPHITSKDITLLHPHSATLSARLFLPTPQ  75

Query  898   PEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPI  719
                 +   LP+L+YFHGG FC  S     YH ++  +  ++K V VSVDYRLAPE+ +P 
Sbjct  76    TTSRRNNNLPLLIYFHGGAFCASSPFTANYHNYVATIVAEAKVVAVSVDYRLAPEHPIPA  135

Query  718   AYEDCYAALEWVQKNQK---AEPCL-ESADLSRVFLAGDSAGGNIVHQVAKKCLQ-DGNC  554
             AYED +AAL+WV  ++     EP L E AD  RVFLAGDSAG NIVH +       D + 
Sbjct  136   AYEDSWAALQWVASHRNKNGQEPWLNEHADFGRVFLAGDSAGANIVHNLTMLLGDPDWDI  195

Query  553   AAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLEN  374
                I G+  +HPYF       +E A +    + V   D  WR   PE +++D    N   
Sbjct  196   GMDILGVCLVHPYFWGSVPVGSEEAVDPERKAVV---DRLWRFVSPEMADKDDPRVNPVA  252

Query  373   DRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             +   S+G WL     LV VA KD L++RG +Y   L R G
Sbjct  253   EGAPSLG-WLGCRRVLVCVAEKDVLRDRGWLYYNALSRSG  291



>ref|NP_001049607.1| Os03g0258200 [Oryza sativa Japonica Group]
 gb|ABF95061.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF11521.1| Os03g0258200 [Oryza sativa Japonica Group]
 dbj|BAG94837.1| unnamed protein product [Oryza sativa Japonica Group]
Length=367

 Score =   161 bits (407),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 109/291 (37%), Positives = 160/291 (55%), Gaps = 26/291 (9%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFS--PEIATA--SAESTDGFK-SKDVVIDPSKPITGRIFVP  908
             +V+E  G I+V+ DG V+R    P++     +  S  G   ++D V+D +  +  R++ P
Sbjct  39    VVEEIHGLIKVYRDGFVERIPAIPDVPCTWGTTASVPGVVIARDAVVDRATRVWARLYAP  98

Query  907   DLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENK  728
                    +V   PV++YFHGGGFCVGS  W  YH FL +L+ ++   V+SVDYRLAPEN+
Sbjct  99    AAAAAAGRV---PVVVYFHGGGFCVGSAAWSCYHEFLAKLAARAGCAVMSVDYRLAPENR  155

Query  727   LPIAYEDCYAALEWVQKNQKAEPCLESADLS---------RVFLAGDSAGGNIVHQVAKK  575
             LP A++D   A+ W++  Q+A     + +LS         RVFLAGDSAG  I   VA +
Sbjct  156   LPAAFDDGVTAVRWLR--QQAAISSAADELSWWRGRCRFDRVFLAGDSAGATIAFHVAAR  213

Query  574   CLQDGNCAA----KIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAM--NDMFWRLSLPE  413
              L  G   A     +KG + I P+FG E RTA+E       GS++ +  +D +WR+SLP 
Sbjct  214   -LGHGQLGALTPLDVKGAILIQPFFGGETRTASEKTMPQPPGSALTLSTSDTYWRMSLPA  272

Query  412   GSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRR  260
             G+ RD   CN    R     + L  P  LV ++ +D L++R +     LRR
Sbjct  273   GATRDHPWCNPVTGRGAPRLDSLPLPDFLVCISEQDILRDRNLELCSALRR  323



>emb|CAN75310.1| hypothetical protein VITISV_033324 [Vitis vinifera]
Length=317

 Score =   160 bits (404),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 104/292 (36%), Positives = 153/292 (52%), Gaps = 40/292 (14%)
 Frame = -2

Query  1093  NLQKMSIIVDEAPGYIQVFSDGTVKR--FSPEIATASAESTDGFKSKDVVIDPSKPITGR  920
             NL +  ++V++  G I+V++DG V+R    P +    A    G   KDVVI+    +  R
Sbjct  17    NLYQNGVVVEKVEGLIRVYNDGHVERPAIVPNVPCTVALEL-GVTVKDVVIEKYSNLWAR  75

Query  919   IFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLA  740
              +VP     K     LP+L+YFHGGGFCVGS  W  YH FL  L+ ++  +++SV+YRLA
Sbjct  76    FYVPSCPAGK-----LPLLVYFHGGGFCVGSAAWNCYHGFLADLASKAGCLIMSVNYRLA  130

Query  739   PENKLPIAYEDCYAALEWVQKNQKAEPC------LESADLSRVFLAGDSAGGNIVHQVAK  578
             PEN+LP AYED + A+ WV KNQ           L   +LS +FL GDSAG NI +    
Sbjct  131   PENRLPAAYEDGFNAVMWV-KNQALNGAGEQKWWLSRCNLSSLFLTGDSAGANIAY----  185

Query  577   KCLQDGNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAM--NDMFWRLSLPEGSN  404
                               +P+FG E RT +E  +     S++ +  +D +WRLSLP G+N
Sbjct  186   ------------------NPFFGGEARTGSENHSTQPPNSALTLSASDTYWRLSLPLGAN  227

Query  403   RDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVK  248
             RD   CN   +    +   L+ P  +V ++  D LK+R + +   +   G +
Sbjct  228   RDHPCCNPLANGSTKL-RTLQLPPTMVCISDTDILKDRNLQFCTAMANAGKR  278



>ref|XP_008236606.1| PREDICTED: probable carboxylesterase 5 [Prunus mume]
Length=375

 Score =   161 bits (407),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 104/270 (39%), Positives = 148/270 (55%), Gaps = 15/270 (6%)
 Frame = -2

Query  1051  YIQVFSDGTVKRFS-PEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPEKEQVEL  875
             +++++ DG V+R S  +I   S +   G +SKD VI P   ++ R+++P         +L
Sbjct  71    FLKIYKDGRVERLSGTDIVPTSLDPQTGVESKDAVISPDTGVSARLYIPKTKITTNPTKL  130

Query  874   LPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYEDCYAA  695
              P+L+YFHGGGFC+GS     YH ++  L  ++  V VSVDYR APEN LP+ ++D +AA
Sbjct  131   -PLLVYFHGGGFCMGSPFCAYYHSYVTSLVAETNVVAVSVDYRKAPENPLPLGFDDSWAA  189

Query  694   LEWVQKN---QKAEPCLES-ADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGIMP  527
             L WVQ +   Q  E  L S AD   VF AGDSAG NI H +A +   +G    K+KGI  
Sbjct  190   LNWVQSHFEGQGPEEWLNSYADFESVFFAGDSAGANIAHHMALRLGHEGLVGVKLKGIAL  249

Query  526   IHPYF-GSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVGE  350
             +HPYF GSE      +  E     + A  +  WR + P  S  D    N   D +L+   
Sbjct  250   VHPYFWGSE-----PIEGETHVVENRARAEGIWRFACPSSSGADDPLINPGKDPKLAK--  302

Query  349   WLRFPAALVFVAGKDFLKERGVMYAEFLRR  260
              L     LV VA +D L++RG  Y+E L++
Sbjct  303   -LGADRVLVCVAEQDVLRQRGWYYSELLKK  331



>ref|XP_008236532.1| PREDICTED: probable carboxylesterase 12 [Prunus mume]
Length=315

 Score =   159 bits (403),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 106/270 (39%), Positives = 145/270 (54%), Gaps = 12/270 (4%)
 Frame = -2

Query  1048  IQVFSDGTVKRFS-PEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPEKEQVELL  872
             I+V+ DG V+R +  +    S    +G +SKDVVI     I+ RI++P    +  Q +L 
Sbjct  14    IKVYKDGRVERLAGTDRVPPSTNPENGVQSKDVVISEEPAISARIYIPKTSTDSPQTKL-  72

Query  871   PVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYEDCYAAL  692
             P+L+YFHGGGFCV S     YH ++  L  ++  V VSVDYRL PE+ LP AY+D +AA+
Sbjct  73    PLLIYFHGGGFCVESPFSPAYHSYVNTLVSEANVVAVSVDYRLVPEHPLPAAYDDSWAAI  132

Query  691   EWVQKN---QKAEPCLES-ADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGIMPI  524
             +WV  +     +E  L   ADL RVF AGDSAG NI H +A K   +     K+ GI+ +
Sbjct  133   KWVASHFDGNGSEDWLNRFADLQRVFFAGDSAGANITHNMAVKLGCERLVGVKLVGIVLV  192

Query  523   HPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVGEWL  344
             HPYF       AE+    +T   +A     WR + P     D    N   D +L     L
Sbjct  193   HPYFWGTEPVGAEITTPAATKEYMA---GVWRFACPSTCGSDDPLINPAKDLKLGK---L  246

Query  343   RFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
                  LV VA KD LK+RG  Y+E L++ G
Sbjct  247   GCEKVLVCVAEKDGLKDRGWHYSEILKKSG  276



>ref|XP_004984954.1| PREDICTED: probable carboxylesterase 17-like [Setaria italica]
Length=371

 Score =   161 bits (407),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 109/297 (37%), Positives = 161/297 (54%), Gaps = 29/297 (10%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFS--PEI-----ATASAESTDGFKSKDVVIDPSKPITGRIF  914
             +V+E  G I+V+ DG V+R    P++     ATA   +  G  ++D V+D +  +  R++
Sbjct  38    VVEEIHGLIRVYKDGHVERLPAIPDVPCTWGATAPG-APGGVVARDAVVDRATGVWARLY  96

Query  913   VPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPE  734
              P           LPV++YFHGGGFCVGS  W  YH FL +L+ ++   V+SVDYRLAPE
Sbjct  97    AP--MAAATTGARLPVVVYFHGGGFCVGSAAWSCYHEFLAQLAARAGCAVMSVDYRLAPE  154

Query  733   NKLPIAYEDCYAALEWV--QKNQKAEPCLESADLS---------RVFLAGDSAGGNIVHQ  587
             ++LP A++D  AA+ W+  Q    A       +LS         RVFL GDSAG N+   
Sbjct  155   HRLPAAFDDGLAAVRWLRHQAAVAATRAAAPDELSWWRARCGFDRVFLMGDSAGANVAFH  214

Query  586   VAKKCLQDGNCAA----KIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAM--NDMFWRL  425
             VA + L  G+  A     ++G + + P+FG E RTA+E       GS++ +  +D +WRL
Sbjct  215   VAAR-LGQGHLGALHPVTVRGAVIVQPFFGGEARTASEKTMAQPPGSALTLPTSDCYWRL  273

Query  424   SLPEGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             +LP G+ RD   CN    R     E L  P  LV V+ +D L++R +     +R+ G
Sbjct  274   ALPAGAGRDHPWCN-PLSRAAPRLETLPLPPVLVCVSEQDILRDRNLELCRAMRKAG  329



>ref|XP_004986199.1| PREDICTED: probable carboxylesterase 15-like [Setaria italica]
Length=345

 Score =   160 bits (405),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 111/285 (39%), Positives = 152/285 (53%), Gaps = 14/285 (5%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFS---PEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDL  902
             +V +  G  Q+ SDGT  R +     +  AS+ ST   + KDV  DP   +  R++ PD 
Sbjct  20    VVADFAGMAQLLSDGTFVRHTDAASALPPASSPSTSSAQWKDVAYDPDHDLKLRMYRPDS  79

Query  901   WPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLP  722
               ++   E LPVL+YFHGGGFCVGS +    H+   RL+ +  ++V+S DYRLAPEN+LP
Sbjct  80    ADDEAASEKLPVLVYFHGGGFCVGSFSLPNTHVSCLRLAGELPAIVLSADYRLAPENRLP  139

Query  721   IAYEDCYAALEWVQKNQKAEPC------LESADLSRVFLAGDSAGGNIVHQVAKKCLQD-  563
              A++D    + W+ +NQ A P        ESAD  RVF+ GDSAGGNI H VA       
Sbjct  140   AAHDDARTLVSWM-RNQAASPADADPWLAESADFGRVFVTGDSAGGNIAHHVAVAVGSGM  198

Query  562   -GNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLP-EGSNRDFYG  389
              G   A++ G +   P+F    RTA+E         ++ ++D F RLSLP EG  RD   
Sbjct  199   LGVSPARVAGYVLFWPFFAGVERTASEAEYPPGPFLTLTVSDQFLRLSLPSEGDTRDHPA  258

Query  388   CNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
              N        +G  +  P  LV  AG+D L++R   YA  LR  G
Sbjct  259   VNPFGPDSPPLGG-VALPPTLVVAAGRDLLRDRVAGYAARLRAMG  302



>gb|KDP32941.1| hypothetical protein JCGZ_12972 [Jatropha curcas]
Length=345

 Score =   160 bits (405),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 106/305 (35%), Positives = 164/305 (54%), Gaps = 27/305 (9%)
 Frame = -2

Query  1108  NTQISNLQKMSIIVDEAPGYIQVFSDGTVKRFSPE-IATASAESTD--GFKSKDVVIDPS  938
             N Q S +     I++E  G I+V+ DG ++R  P+ IA     +       SKD++I+  
Sbjct  11    NLQGSKIHIHGAIIEEIEGLIRVYKDGYIER--PQMIANVPCNTIQEVSVASKDIIINQH  68

Query  937   KPITGRIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvs  758
               +  R+++P      +     PVLLYFHGGGFC+GS +W  Y  FL  LS ++  ++VS
Sbjct  69    TNLWSRLYIPSYSFSGK----FPVLLYFHGGGFCLGSASWSCYDEFLANLSWKAGCIIVS  124

Query  757   VDYRLAPENKLPIAYEDCYAALEWVQK---NQKAEP--CLESADLSRVFLAGDSAGGNIV  593
             ++YRLAPE++LP AYED +  L W+++   N   E    L   + +R+FL GDSAG NI 
Sbjct  125   LNYRLAPEHRLPAAYEDGFNTLIWLKQQAWNDSPEHKWWLNYCNFNRLFLGGDSAGANIA  184

Query  592   HQVAKKCLQDGNCAAK----IKGIMPIHPYFGSERRTAAE----VAAEGSTGSSVAMNDM  437
             + VA +     N        ++G++ + P+FG E ++  E       E ++  +V+ +D 
Sbjct  185   YNVAIRLGSSTNINIIKPFCLRGVILVQPFFGGEEQSLFEKNVTTQLESNSALTVSASDT  244

Query  436   FWRLSLPEGSNRDFYGCNLENDRELSVGEW--LRFPAALVFVAGKDFLKERGVMYAEFLR  263
             +WRLSLP G+NRD   C   N   +S  +   L  P+ +V V+  D LKER + +   L 
Sbjct  245   YWRLSLPVGANRDHPWC---NPVAISANKLRNLNLPSTMVCVSEMDILKERNLEFCRVLA  301

Query  262   RKGVK  248
               G K
Sbjct  302   SVGKK  306



>gb|KEH22636.1| CXE carboxylesterase [Medicago truncatula]
Length=356

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 107/283 (38%), Positives = 151/283 (53%), Gaps = 20/283 (7%)
 Frame = -2

Query  1075  IIVDEAPGYIQVFSDGTVKRFS-PEIATASAESTDGFKSKDVVIDPSKPITGRIFVP---  908
             +++D +P  I+V+ DG ++R S  +I   S +ST   +SKDV I  ++ I+ RIF+P   
Sbjct  40    VVLDLSP-MIKVYKDGHIERLSGSDIVPPSFDSTTNVESKDVFISKAQNISARIFIPIPN  98

Query  907   -DLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPEN  731
              D +P ++    LP+L+YFHGGGFCV +     YH +L  +  Q+  + VSVDYR APE+
Sbjct  99    NDEFPNQK----LPLLVYFHGGGFCVETPFSPTYHNYLNTIVSQANVMAVSVDYRRAPEH  154

Query  730   KLPIAYEDCYAALEWV----QKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQD  563
              LPIAYED + +L+WV      N + E     AD  +VF AGDSAG NI H +A +   +
Sbjct  155   PLPIAYEDSWTSLKWVASHLHGNGRDEWINSYADFGKVFFAGDSAGANIAHHMAIRVGTE  214

Query  562   GNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCN  383
             G     I+GI+ +H +F    R  +E        S V   D  WR   P  S  D    N
Sbjct  215   GLQGINIEGIVLVHAFFWGVERVGSEAEKPEQYLSFV---DNLWRFVCPTSSGPDDMLLN  271

Query  382   LENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
                D+ L     L   + LV VA  D +K+RG  Y E L + G
Sbjct  272   PGKDKNLG---RLGCKSVLVCVAENDLMKDRGWYYKELLEKNG  311



>ref|XP_004505198.1| PREDICTED: probable carboxylesterase 2-like [Cicer arietinum]
 ref|XP_004513745.1| PREDICTED: probable carboxylesterase 2-like [Cicer arietinum]
Length=306

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 102/275 (37%), Positives = 149/275 (54%), Gaps = 28/275 (10%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRF-SPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWP  896
             IV E P   +++ DG V+R    E   A  +   G +SKD+ I+    +  R+++P   P
Sbjct  8     IVREFPNLFRLYKDGRVERLLGIETTPAGTDPLTGVQSKDITINSETGLAARLYLP---P  64

Query  895   EKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIA  716
                  + LP+L+Y HGG FCV S    GYH  L  +S Q+  VV S+ YRLAPE+ LP+A
Sbjct  65    NATTTQKLPLLVYIHGGAFCVCSPYNTGYHHHLNTVSAQANIVVFSIHYRLAPEHPLPVA  124

Query  715   YEDCYAALEWVQKNQKAEPCL-ESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIK  539
             Y+D + A++W+ K    +P L + ADL+ VF AGDSAGGN+ H +A +   +G  + K++
Sbjct  125   YDDTWEAIQWISK--ATDPWLADHADLNIVFFAGDSAGGNLSHNMAMRGATEGFGSLKLQ  182

Query  538   GIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELS  359
             GI+ +HP+FG+E +         S G    +ND               +  N  N   L 
Sbjct  183   GIVLLHPFFGNEEKDELLEFLYPSYG---GLND------------PKIHAANDPNLSSLG  227

Query  358   VGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
              G+       LVFVAGKDFL+ERG  Y + L++ G
Sbjct  228   CGK------VLVFVAGKDFLRERGRTYYDALKKSG  256



>ref|XP_006487818.1| PREDICTED: probable carboxylesterase 15-like [Citrus sinensis]
Length=326

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 105/282 (37%), Positives = 152/282 (54%), Gaps = 13/282 (5%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPE  893
             +VDE  G + V+SDG++ R      +           KDVV DP   ++ R++ P L P 
Sbjct  12    LVDECRGVLFVYSDGSIVRLPKPSFSVPVHDDGSVVWKDVVFDPVHDLSLRLYKPAL-PV  70

Query  892   KEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAY  713
               +   LP+  Y HGGGFC+GS TW     +  +L+ + ++V++S DYRLAPEN+LP A 
Sbjct  71    STK---LPIFYYIHGGGFCIGSRTWPNCQNYCFKLASELQAVIISPDYRLAPENRLPAAI  127

Query  712   EDCYAALEWVQKNQKA-EP---CLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGN---C  554
             ED Y A++W+Q    A EP     E AD  +VF++GDSAGGNI H +A + L+ G+    
Sbjct  128   EDGYMAVKWLQAQAVANEPDTWLTEVADFGKVFISGDSAGGNIAHNLAVR-LKAGSLELA  186

Query  553   AAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLEN  374
               ++KG + + P+FG   R  +E         ++ + D FWRLS+P G   D    N   
Sbjct  187   PVRVKGYILLAPFFGGTVRKKSEAEGPREAFLNLELIDRFWRLSIPIGETTDHPLINPFG  246

Query  373   DRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVK  248
                 S+ E +     LV V G D LK+RG  YA+ L+  G K
Sbjct  247   PVSPSL-EAVDLDPILVVVGGSDLLKDRGEDYAKTLKNFGKK  287



>ref|XP_007199222.1| hypothetical protein PRUPE_ppa021907mg [Prunus persica]
 gb|EMJ00421.1| hypothetical protein PRUPE_ppa021907mg [Prunus persica]
Length=315

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 107/272 (39%), Positives = 146/272 (54%), Gaps = 16/272 (6%)
 Frame = -2

Query  1048  IQVFSDGTVKRF-SPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPEKEQVELL  872
             I+V+ DG V+R    E    S    +G +SKDVVI     I+ RIF+P       Q +L 
Sbjct  14    IKVYKDGRVERLMGTERVPPSTHPENGVQSKDVVISQEPAISARIFIPKTSTHSPQTKL-  72

Query  871   PVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYEDCYAAL  692
             P+L+YFHGGGFC+ S++   YH ++  L  ++  V VSVD+RLAPE+ LP AY D +AA+
Sbjct  73    PLLIYFHGGGFCIESSSSPAYHSYVNTLVSEANVVAVSVDFRLAPEHPLPAAYNDSWAAI  132

Query  691   EWVQKN---QKAEPCLES-ADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGIMPI  524
             +WV  +     +E  L   AD  RVF AGDSAG NI H +A K   +     K+ GI+ +
Sbjct  133   KWVASHFDGNGSEDWLNRFADFQRVFFAGDSAGANITHNMAVKLGCERLVGVKLVGIVLV  192

Query  523   HPYFGSERRTAAEVAAEGSTGSSVAMNDM--FWRLSLPEGSNRDFYGCNLENDRELSVGE  350
             HPYF        E+     T  + A + M   WR + P  S  D    N   D++L    
Sbjct  193   HPYFWGTEPVGDEL-----TTPAAARDYMVGVWRFACPSTSGSDDPLINPAKDQKLGK--  245

Query  349   WLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
              L     LV VA KD LK+RG  Y+E L++ G
Sbjct  246   -LGCEKVLVCVAEKDVLKDRGWHYSEILKKSG  276



>ref|XP_007200860.1| hypothetical protein PRUPE_ppa027099mg [Prunus persica]
 gb|EMJ02059.1| hypothetical protein PRUPE_ppa027099mg [Prunus persica]
Length=321

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 109/289 (38%), Positives = 154/289 (53%), Gaps = 22/289 (8%)
 Frame = -2

Query  1078  SIIVDEAPGYIQVFSDGTVKRFSPEIATA-SAESTDGFKSKDVVIDPSKPITGRIFVPDL  902
             ++ +D +P  ++++ +GT++R   + +   S +   G +SKDV I   + I+ R+++P+ 
Sbjct  4     AVAIDFSP-LVKIYVNGTIERLIGKSSVPPSLDPKTGVQSKDVAISRRRGISARLYLPNS  62

Query  901   WPEKEQVEL---LPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPEN  731
                         LP+L+YFHGGGFCV   +   YH +L  L   +  V VSVDYRLAPE+
Sbjct  63    VTNSTTNSTQSKLPLLVYFHGGGFCVEHASSPTYHNYLNSLVTAANVVAVSVDYRLAPEH  122

Query  730   KLPIAYEDCYAALEWVQK-----NQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQ  566
              LPIAY+D +AAL WV       N+  E     AD  RVF +GDSAG NI HQ+A K   
Sbjct  123   PLPIAYQDSWAALNWVSSHFGGGNRSEEWLSRYADPQRVFFSGDSAGANIAHQMAMKLGS  182

Query  565   DGNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGC  386
             D     K+ GI+ +HP+F   +   AE  A      S+ M  + WR   P     D    
Sbjct  183   DRLNGFKLNGIVLVHPFFWGSQPVGAE--ATLPVVVSLYMTAL-WRFVNPTSFGPDDPLF  239

Query  385   NLEND---RELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVK  248
             N   D   REL  G+       LVFVAGKD LK+RG+ Y + L++ G K
Sbjct  240   NPTMDPKLRELGCGK------VLVFVAGKDALKDRGLYYGDVLKKSGWK  282



>ref|XP_008392310.1| PREDICTED: probable carboxylesterase 12 [Malus domestica]
 gb|ABB89010.1| CXE carboxylesterase [Malus pumila]
Length=371

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 103/270 (38%), Positives = 147/270 (54%), Gaps = 15/270 (6%)
 Frame = -2

Query  1051  YIQVFSDGTVKRFS-PEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPEKEQVEL  875
             +++++ DG V+R S  ++   S +   G + KD VI     ++ R+++P         +L
Sbjct  67    FLKIYKDGRVERLSGTDVVPTSLDPQTGVECKDAVISAETGVSARLYIPKTKITTNSTKL  126

Query  874   LPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYEDCYAA  695
              P+L+Y+HGGGFC+GS     YH +L  L  ++  V VSVDYR APEN LP+ Y+D +AA
Sbjct  127   -PLLIYYHGGGFCMGSPFCAYYHNYLTTLVAEANVVAVSVDYRKAPENPLPLGYDDSWAA  185

Query  694   LEWVQKN---QKAEPCLES-ADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGIMP  527
             L WVQ +   Q  E  L S AD  RVF AGDSAG NI H +A +   +G     +KGI+ 
Sbjct  186   LGWVQSHIEGQGPEEWLNSYADFERVFFAGDSAGANIAHHMAVRLGHEGLVGVNLKGIIL  245

Query  526   IHPYF-GSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVGE  350
             +HPYF GSE      +  E     + A  +  WR + P  S  D    N   D +LS   
Sbjct  246   VHPYFWGSE-----PIEGETDVVENRARAEAIWRFAYPTTSGADDLLINPGKDPKLSK--  298

Query  349   WLRFPAALVFVAGKDFLKERGVMYAEFLRR  260
              L     LV VA +D L++RG  Y++ LR+
Sbjct  299   -LGAERVLVCVAEQDALRQRGWYYSDLLRK  327



>ref|XP_008231719.1| PREDICTED: probable carboxylesterase 15 [Prunus mume]
Length=338

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 102/285 (36%), Positives = 156/285 (55%), Gaps = 16/285 (6%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKR---------FSPEIATASAESTDGFKSKDVVIDPSKPITGR  920
             +V+E  G+++VF DG+V R         F  E      E  DG  +KDV++D    +  R
Sbjct  8     LVEEVSGWLRVFDDGSVDRTWTGPPEVKFMVEPVAPHNEFIDGVATKDVIVDEPSGLRVR  67

Query  919   IFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLA  740
             I++P+  PE  +   LP++L+FHGGGFC+    W  Y+    +L+  + ++VVSV  RLA
Sbjct  68    IYLPEQKPEGHEDTKLPIILHFHGGGFCISQADWYMYYHIYTKLARATNAIVVSVYQRLA  127

Query  739   PENKLPIAYEDCYAALEWVQK---NQKAEPCLES-ADLSRVFLAGDSAGGNIVHQVAKKC  572
             PE++LP A +D Y AL W++K    ++ EP L S AD S VFL GDS+GGNIVH VA + 
Sbjct  128   PEHRLPAAIDDGYTALLWLRKLARGEQNEPWLLSYADFSSVFLIGDSSGGNIVHHVAARA  187

Query  571   LQDGNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDF-  395
                     ++ G +PIHP F    R+ +E+    S   ++ M D F  L++P GS +D  
Sbjct  188   GTVDLSPLRLAGGIPIHPGFVRAERSKSELEQPESPFLTLDMVDKFLGLAIPVGSTKDHP  247

Query  394   YGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRR  260
               C +        G  L+ P  L+ +A KD + +  + Y E +++
Sbjct  248   VTCPMGPGAPRLDG--LKLPPFLLCIASKDLIIDTEMEYFEAMKK  290



>ref|XP_010246597.1| PREDICTED: probable carboxylesterase 18 [Nelumbo nucifera]
Length=343

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 97/287 (34%), Positives = 156/287 (54%), Gaps = 9/287 (3%)
 Frame = -2

Query  1099  ISNLQKMSIIVDEAPGYIQVFSDGTVKR-----FSPEIATASAESTDGFKSKDVVIDPSK  935
             +S + +  + V  A  +     DGT+ R     F P++     +   G ++ D+ +DP++
Sbjct  15    LSWMTRFVLYVVTAVSHFACRPDGTINRRLLTFFDPKV-FPYGKPLKGVRTADISVDPAR  73

Query  934   PITGRIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsV  755
              +  R+F+P   P    + L PV+++FHGGGF   S   +G+ +F  R++    ++VVSV
Sbjct  74    NLWFRLFIPTESPHHTSLPL-PVIVFFHGGGFAFQSADSIGFEIFCRRMARSISAIVVSV  132

Query  754   DYRLAPENKLPIAYEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKK  575
             +YRL+PE++ P  Y+D + AL ++ + Q  +     ADL R FLAGDSAG N+ H VA +
Sbjct  133   NYRLSPEHRFPAQYDDGFDALRFLDE-QNFDGFPADADLKRCFLAGDSAGANLAHHVACR  191

Query  574   CLQDGNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDF  395
               +      K+ G++ I P+FG E RT +E+   G+   S+ + D  W+  LPEGS+RD 
Sbjct  192   ASKAEFREVKVIGLISIVPFFGGEERTESEIRLVGAPLVSMRITDWLWKAFLPEGSDRDH  251

Query  394   YGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
                N+       +  +   PA LV V G D L++    Y E+LRR G
Sbjct  252   EAVNVSGPNAADITSF-NHPATLVLVGGFDPLQDWQRRYYEWLRRSG  297



>ref|XP_007017300.1| Catalytic, putative [Theobroma cacao]
 gb|EOY14525.1| Catalytic, putative [Theobroma cacao]
Length=325

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 105/278 (38%), Positives = 154/278 (55%), Gaps = 21/278 (8%)
 Frame = -2

Query  1051  YIQVFSDGTVKRFS-PEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPEKEQVEL  875
             Y++V+ DGT++R +  E+ +   +      SKD+VI P   ++ RI+ P+L    E+   
Sbjct  15    YLKVYKDGTLERIAGVEVVSPGLDPETDVLSKDIVIVPETGVSARIYRPNLATTHEK---  71

Query  874   LPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYEDCYAA  695
             LP+++YFHGG FCV S  +  YH  L +L  ++  V +SVDYRL PE  LP AYED +AA
Sbjct  72    LPLVVYFHGGAFCVASPAFPNYHTSLNKLVAEANIVALSVDYRLVPEFPLPTAYEDSWAA  131

Query  694   LEWVQKNQKAEPCLES-----ADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIK--G  536
             LEW+  +++ + C E+     ADL +VFLAGDSAG NI H +A + L+D +   K+K  G
Sbjct  132   LEWIASHKEGDSCHEAWIKDHADLDQVFLAGDSAGSNISHHLALR-LKDSDLGQKLKILG  190

Query  535   IMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLP--EGSNRDFYGCNLENDREL  362
             I  IHPYF       +E A +        + D +W    P  +G +       ++   +L
Sbjct  191   IGMIHPYFWGTNPIGSEFADQFRK----ELVDKWWLYVCPSDKGCDDPLINPFVDGSSDL  246

Query  361   SVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVK  248
             S    L     LV VA KD LK+RG +Y + L + G K
Sbjct  247   S---GLACDGILVIVAEKDILKDRGRLYYDKLVKSGWK  281



>gb|EAY89312.1| hypothetical protein OsI_10815 [Oryza sativa Indica Group]
Length=362

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 108/291 (37%), Positives = 159/291 (55%), Gaps = 26/291 (9%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFS--PEIATA--SAESTDGFK-SKDVVIDPSKPITGRIFVP  908
             +V+E  G I+V+ DG V+R    P++     +  S  G   ++D V+D +  +  R++ P
Sbjct  34    VVEEIHGLIKVYRDGLVERIPAIPDVPCTWGTTASVPGVVIARDAVVDRATGVWARLYAP  93

Query  907   DLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENK  728
                    +V   PV++YFHGGGFCVGS  W  YH FL +L+ ++   V+SVDYRLAPEN+
Sbjct  94    AAAAAAGRV---PVVVYFHGGGFCVGSAAWSCYHEFLAKLAARAGCAVMSVDYRLAPENR  150

Query  727   LPIAYEDCYAALEWVQKNQKAEPCLESADLS---------RVFLAGDSAGGNIVHQVAKK  575
             LP A++D   A+ W++  Q+A     + +LS         RVFLAGDSAG  I   VA +
Sbjct  151   LPAAFDDGVTAVRWLR--QQAAISSAADELSWWRGRCRFDRVFLAGDSAGATIAFHVAAR  208

Query  574   CLQDGNCAA----KIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAM--NDMFWRLSLPE  413
              L  G   A     +KG + I P+F  E RTA+E       GS++ +  +D +WR+SLP 
Sbjct  209   -LGHGQLGALTPLDVKGAILIQPFFSGETRTASEKTMPQPPGSALTLSTSDTYWRMSLPA  267

Query  412   GSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRR  260
             G+ RD   CN    R     + L  P  LV ++ +D L++R +     LRR
Sbjct  268   GATRDHPWCNPVTGRGAPRLDSLPLPDFLVCISEQDILRDRNLELCSALRR  318



>ref|XP_002270210.1| PREDICTED: probable carboxylesterase 18 [Vitis vinifera]
Length=335

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 103/292 (35%), Positives = 155/292 (53%), Gaps = 19/292 (7%)
 Frame = -2

Query  1114  PQNTQISNLQKMSIIVDEAPGYIQVFSDGTVKR----FSPEIATASAESTDGFKSKDVVI  947
             P  T+I+ L  +S + D       +  DGT+ R    F    A  ++    G K+ DV +
Sbjct  9     PWKTKIA-LSAISAVTD-----FSLRDDGTINRRLLSFLDFRAPPNSTPVHGVKTSDVTV  62

Query  946   DPSKPITGRIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksv  767
             DPS+ +  R+F P   P +   E LPV+++FHGGGF   S     Y     R + +  ++
Sbjct  63    DPSRNLWFRLFEPTEVPGRG--EKLPVIVFFHGGGFAYLSAYSKAYDAVCRRFARKIPAI  120

Query  766   vvsVDYRLAPENKLPIAYEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQ  587
             V SV+YRL+PE++ P  Y+D +  L+++     A     ++DLS  FL GDSAG N+ H 
Sbjct  121   VASVNYRLSPEHRCPAQYDDGFDVLKYLDSQPPA-----NSDLSMCFLVGDSAGANLAHN  175

Query  586   VA-KKCLQDGNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEG  410
             V  + C        K+ G++PI P+FG E RT +E   EGS   S+   D  W++ LPEG
Sbjct  176   VTVRACETTTFREVKVVGLVPIQPFFGGEERTESERRLEGSPLVSMRRTDCMWKMFLPEG  235

Query  409   SNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             +NRD    N+   R   + E + FPA +VF+ G D L++    Y E+L+R G
Sbjct  236   ANRDHEAANVSGPRGRELSE-VEFPATMVFIGGFDPLQDWQRRYCEWLKRSG  286



>ref|XP_011041377.1| PREDICTED: probable carboxylesterase 15 [Populus euphratica]
Length=337

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 100/286 (35%), Positives = 157/286 (55%), Gaps = 14/286 (5%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRF---SPEI------ATASAESTDGFKSKDVVIDPSKPITGR  920
             IVDE PG+I+V+ DGTV R    +PE+       +   E  +G   +D +IDP   +  R
Sbjct  7     IVDEVPGWIRVYDDGTVDRTWTGTPEMEPLLKPVSPHEEFINGVAVRDQIIDPKTGLAVR  66

Query  919   IFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLA  740
             I+VP++    +    +P++L+ HGGG+CV    W  Y+ F  RL    ++++VSV +RLA
Sbjct  67    IYVPEMKSNVQTKAKIPLILHLHGGGYCVCQPDWSLYYHFCTRLVSSVQAILVSVYFRLA  126

Query  739   PENKLPIAYEDCYAALEWVQKNQKAEP----CLESADLSRVFLAGDSAGGNIVHQVAKKC  572
             PE++LP+A ED YAAL W++ N + E         AD +RVFL GDS+GGN+VHQVA + 
Sbjct  127   PEHRLPVAVEDSYAALLWLRANARGELSDQWLTSYADFNRVFLVGDSSGGNLVHQVAAQA  186

Query  571   LQDGNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFY  392
               D     K++G + I P F S++ + + +    +  S+  M   F  L++P GS  + +
Sbjct  187   GFDDIEPLKLRGGIAIQPGFISDKPSKSYLEIPENPLSTREMMKKFTSLAVPIGSTGE-H  245

Query  391   GCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
                     +      L+ P  LV VA  D L++  + Y E +++ G
Sbjct  246   PIVWPLGPQAPPLTTLKLPPMLVVVAEMDLLRDYELEYCEEMKKAG  291



>ref|XP_007218270.1| hypothetical protein PRUPE_ppa008273mg [Prunus persica]
 gb|EMJ19469.1| hypothetical protein PRUPE_ppa008273mg [Prunus persica]
Length=338

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 101/285 (35%), Positives = 157/285 (55%), Gaps = 16/285 (6%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKR---------FSPEIATASAESTDGFKSKDVVIDPSKPITGR  920
             +V+E  G+++VF+DG+V R         F  E      E  +G  ++DV++D    +  R
Sbjct  8     LVEEVSGWLRVFNDGSVDRTWTGPPEVKFMSEPVAPHKEFVNGVATEDVIVDEPSGLRVR  67

Query  919   IFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLA  740
             I++P+   E      LP++L+FHGGGFC+    W  Y+    +L+  + ++VVSV  RLA
Sbjct  68    IYLPEQKQEGHDDNKLPIILHFHGGGFCISQADWYMYYHIYTKLARATNAIVVSVYQRLA  127

Query  739   PENKLPIAYEDCYAALEWVQK---NQKAEPCLES-ADLSRVFLAGDSAGGNIVHQVAKKC  572
             PE++LP A +D Y AL W++K    ++ EP L S AD SRVFL GDS+GGNIVH VA + 
Sbjct  128   PEHRLPAAIDDGYTALLWLRKLARGEQKEPWLLSYADFSRVFLIGDSSGGNIVHHVAARA  187

Query  571   LQDGNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDF-  395
                     ++ G +PIHP F    R+ +E+    S   ++ M D F  L++P GS +D  
Sbjct  188   GTVDLSPLRLAGGIPIHPGFVRAERSKSELEQPESPFLTLDMVDKFLGLAIPVGSTKDHP  247

Query  394   YGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRR  260
               C +     L  G  L+ P  L+ +A KD + +  + Y E +++
Sbjct  248   VTCPMGPGAPLLDG--LKLPPFLLCIASKDLIIDTEMEYFEAMKK  290



>ref|XP_009410114.1| PREDICTED: tuliposide A-converting enzyme 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=324

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 107/284 (38%), Positives = 145/284 (51%), Gaps = 16/284 (6%)
 Frame = -2

Query  1075  IIVDEAPGYIQVFSDGTVKRFSPEIAT-ASAESTDGFKSKDVVIDPSKPITGRIFVPDLW  899
             I+ D  P  I+VF  G V+R+    AT AS +   G  SKDV++ P   ++ R+++P L 
Sbjct  7     IVYDTTPRLIRVFKSGRVERYLCTDATPASVDPATGVSSKDVLVSPETGVSARLYIPMLR  66

Query  898   PEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPI  719
                   + LPVL+YFHGGGFC+GS     +H +L  L  Q+  V VS DYRLAPE+ +P 
Sbjct  67    EGDRPEQKLPVLVYFHGGGFCLGSAFIPLFHNYLNSLVAQAHVVAVSADYRLAPEHPVPT  126

Query  718   AYEDCYAALEWVQKNQKAEP-------CLESADLSRVFLAGDSAGGNIVHQVAKKCLQDG  560
             A++D +  L WV  +              E AD  RVFLAG+SAG NI H +A +    G
Sbjct  127   AHDDSWTVLRWVAGHAGGVGGPAAEAWLAERADFERVFLAGESAGANIAHHMAMRAGIGG  186

Query  559   -NCAAKIKGIMPIHPYF-GSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGC  386
               C   I+G+  IHPYF GS+R  +AE+    +        +  WR   P  S  D    
Sbjct  187   LPCGVTIRGVALIHPYFLGSDRVESAEIYPAATENL-----ETLWRTMCPSSSGLDDPMI  241

Query  385   NLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             N   +   S+   L    ALV V G D L++RG  Y   LR  G
Sbjct  242   NPVTEAAPSLAG-LGCGRALVCVGGADALRDRGRAYYGRLRESG  284



>ref|XP_010269100.1| PREDICTED: probable carboxylesterase 2 [Nelumbo nucifera]
Length=317

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 105/279 (38%), Positives = 147/279 (53%), Gaps = 17/279 (6%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRF-SPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWP  896
             I  E P +  ++ DG VKR    +   AS +   G  SKDV+I P   ++ R+++P +  
Sbjct  8     IAYEFPPFYVLYKDGHVKRLIGTDFVQASLDPQTGVSSKDVIIVPETGVSARLYLPKITD  67

Query  895   EKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIA  716
               ++   LP+L+YFHGGGF + +     YH +L  L  Q+  V VSV+YR APE  LPIA
Sbjct  68    PHQK---LPLLIYFHGGGFVIETAFSPTYHYYLNSLVAQANIVAVSVEYRRAPEYPLPIA  124

Query  715   YEDCYAALEWVQKNQK----AEPCL-ESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCA  551
             Y+D +A L+WV  +      AEP L +  D  R+FLAGDSAG NI H +A +    G   
Sbjct  125   YDDSWAVLQWVVSHSMDQDGAEPWLRDHVDCKRIFLAGDSAGANIAHDMAMRA---GATG  181

Query  550   AKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLEND  371
              K++GI  IHPYF  E+R    + +E        M D  W L+ P  +  D    N   +
Sbjct  182   LKLRGIALIHPYFWGEKR----IGSEAEDPDKAKMADKMWLLACPSSAGADDPRINPVGE  237

Query  370   RELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
                S+   L     LV V  KD LK+RG++Y E L + G
Sbjct  238   GAPSLSR-LGCSRLLVCVGEKDILKDRGLIYYETLVKSG  275



>ref|XP_010546272.1| PREDICTED: probable carboxylesterase 18 [Tarenaya hassleriana]
Length=332

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 96/244 (39%), Positives = 141/244 (58%), Gaps = 4/244 (2%)
 Frame = -2

Query  976  DGFKSKDVVIDPSKPITGRIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFL  797
            DG  + D V+DPS+ +  R+F P      +    LPV+++FHGGGF   S + V +    
Sbjct  50   DGVSTADFVVDPSRDLWFRLFTPHA--ASDDRRRLPVVVFFHGGGFMYLSPSSVLFDRLC  107

Query  796  GRLsvqsksvvvsVDYRLAPENKLPIAYEDCYAALEWVQKNQKAEPCLESADLSRVFLAG  617
             R S +  + VVSV+YR +PE++ P  Y+D + AL ++ +N  A     +ADL++ FLAG
Sbjct  108  RRFSRKIHAFVVSVNYRRSPEHRYPAQYDDGFDALRFLDENHAAI-LPPNADLAKCFLAG  166

Query  616  DSAGGNIVHQVAKKCLQDGNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDM  437
            DSAGGNI H V+ +       A K+ GI+ I P+FG E RT AE    G+   SV+  D 
Sbjct  167  DSAGGNIAHNVSVRSCSAVFRAVKLTGIIAIQPFFGGEGRTEAEERIVGAPLISVSRTDW  226

Query  436  FWRLSLPEGSNRDFYGCNLENDRELS-VGEWLRFPAALVFVAGKDFLKERGVMYAEFLRR  260
            +WR  LPEGSNRD    N+     +  +G+ LR PA +V V G D L++    Y E+L++
Sbjct  227  WWREFLPEGSNRDHVAANVSGPNAVDIIGKELRLPATVVVVGGMDPLQDWQRRYYEWLKK  286

Query  259  KGVK  248
             G++
Sbjct  287  SGIR  290



>ref|XP_010547703.1| PREDICTED: probable carboxylesterase 18 [Tarenaya hassleriana]
Length=338

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 96/243 (40%), Positives = 136/243 (56%), Gaps = 6/243 (2%)
 Frame = -2

Query  976  DGFKSKDVVIDPSKPITGRIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFL  797
            +G  S D  +DPS+ +  R+F P           LPV+++FHGGGF       V Y    
Sbjct  60   NGVSSSDFSVDPSRDLWFRVFTP----HAADGRSLPVVVFFHGGGFVFLRPDSVTYDRVC  115

Query  796  GRLsvqsksvvvsVDYRLAPENKLPIAYEDCYAALEWVQKNQKAEPCLESADLSRVFLAG  617
             RL+ + ++ V+S++YR APE++ P  Y+D + AL+++  N  A     +ADL + FLAG
Sbjct  116  RRLARKIQAYVISINYRHAPEHRYPAQYDDGFDALKFLDDNH-ATILPHNADLKKCFLAG  174

Query  616  DSAGGNIVHQVAKKCLQDGNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDM  437
            DSAGGNI H VA +    G  A K+ GI+ I P+FG E RT AE    G+   SV   D 
Sbjct  175  DSAGGNIAHNVAVRVCSVGFRAVKLAGIVAIQPFFGGEERTEAEERVVGAPLVSVPRTDW  234

Query  436  FWRLSLPEGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRK  257
             WR  LPEG+NRD    N+     + +   L FPA +V VAG D L++    Y+E+L++ 
Sbjct  235  CWRAVLPEGTNRDHVAANVSGPNAVDISG-LDFPATMVVVAGFDPLQDWQRRYSEWLKKS  293

Query  256  GVK  248
            G K
Sbjct  294  GKK  296



>ref|XP_004294831.1| PREDICTED: probable carboxylesterase 12-like [Fragaria vesca 
subsp. vesca]
Length=313

 Score =   157 bits (398),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 107/272 (39%), Positives = 145/272 (53%), Gaps = 16/272 (6%)
 Frame = -2

Query  1048  IQVFSDGTVKRF---SPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPEKEQVE  878
             I+V+ DG ++R    SP  AT   ++  G +SKDVVI     I+ R+++P      E   
Sbjct  13    IKVYKDGRIERLWDTSPVPATIDPQT--GVQSKDVVISTIPLISARLYLPKS-ATPESTG  69

Query  877   LLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYEDCYA  698
               P+L+YFHGGGFC+ S     YH +L     ++  V VSVDYRLAPE+ LP AYED +A
Sbjct  70    KFPLLVYFHGGGFCIESAFSRTYHNYLNSFVSEANIVAVSVDYRLAPEHPLPAAYEDSWA  129

Query  697   ALEWVQKNQKA----EPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGIM  530
             AL+WV+ +       E   + ADL+RVF AGDSAG NI H +  +   +      + GI+
Sbjct  130   ALKWVESHFAGTGPEEWLNQHADLNRVFFAGDSAGANIAHHMGLRVGSEKPVGFMLNGIV  189

Query  529   PIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVGE  350
              +HPYFG E     E+A   +T    A     WR   P  S  D    N   D +L+   
Sbjct  190   LVHPYFGGEEPIGGELALAENTRKRFA---DLWRFCYPLTSGTDDPFLNPGKDPKLAE--  244

Query  349   WLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
              L     LV VA KD LK+RG  Y+E L++ G
Sbjct  245   -LGCEKVLVCVAEKDLLKDRGWHYSEVLKKSG  275



>ref|XP_007136667.1| hypothetical protein PHAVU_009G063600g [Phaseolus vulgaris]
 gb|ESW08661.1| hypothetical protein PHAVU_009G063600g [Phaseolus vulgaris]
Length=317

 Score =   157 bits (398),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 114/320 (36%), Positives = 172/320 (54%), Gaps = 15/320 (5%)
 Frame = -2

Query  1081  MSIIVDEAPGYIQVFSDGTVKRFS-PEIATASAESTDGFKSKDVVIDPSKPITGRIFVPD  905
             M I +D  P Y++V  DGTV+R +  ++  A  +S     SKD+++ P   +T R++ P+
Sbjct  1     MEISMD-VPPYLRVHKDGTVERMAGTQVVPAGFDSNTNVVSKDILVIPETAVTARLYRPN  59

Query  904   LWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKL  725
               P+  +   LP++LY HGG FC+ S +   YH  L +L   S  V +S++YRLAPE+ L
Sbjct  60    STPQNAK---LPLVLYLHGGAFCISSASDPVYHNSLNKLVADSNVVALSLNYRLAPEHPL  116

Query  724   PIAYEDCYAALEWVQKNQKAEP--CLESADLSRVFLAGDSAGGNIVHQVAKKC--LQDGN  557
             P AY+D ++A++WV    KA+     ++ D  RVFLAGDSAG NI H +A K   +   +
Sbjct  117   PAAYQDSWSAIQWVASQAKAQEDWFRDNVDFERVFLAGDSAGANIGHYIALKLNNVSKND  176

Query  556   CAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLE  377
                K+KG++ ++PYF  +     E+    +      M DM+W    P     D    N  
Sbjct  177   FDFKVKGLVMVNPYFWGKEAIGVEI----TDPERKKMVDMWWDFVCPSDKGNDDPLINPF  232

Query  376   NDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaee-eghvfhv  200
                  SV E +     LV VA KD LKERG +Y + L   G K          E HVFH+
Sbjct  233   VQEAPSV-EGVACEKVLVIVAEKDILKERGKLYHKMLSNSGWKGKAEFYETLGEDHVFHI  291

Query  199   fHPDSEATRLLQKQMSEFIH  140
             F+PD +  + L K++++FI+
Sbjct  292   FNPDCDKAKSLIKRIADFIN  311



>ref|XP_006837038.1| hypothetical protein AMTR_s00110p00041000 [Amborella trichopoda]
 gb|ERM99891.1| hypothetical protein AMTR_s00110p00041000 [Amborella trichopoda]
Length=367

 Score =   159 bits (401),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 117/307 (38%), Positives = 165/307 (54%), Gaps = 20/307 (7%)
 Frame = -2

Query  1054  GYIQVFSDGTVKRFSPEIATASAESTDGFK-SKDVVIDPSKPITGRIFVPDLWPEKEQVE  878
             G ++V   G V+R SP       +  D    SKDV I+  K    R+++P     +E+  
Sbjct  47    GLMRVHKGGLVERLSPLFIEVPPDLDDPLVVSKDVGINQEKGTWARVYLPKHHARREK--  104

Query  877   LLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYEDCYA  698
              LP+L+YFHGGGFC+GS  W  YH F+  L+ +   +VVSV YRLAPE K+P  YED   
Sbjct  105   -LPILVYFHGGGFCLGSAAWSIYHSFISHLAREIGCLVVSVSYRLAPECKIPSQYEDGIE  163

Query  697   ALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGIMPIHP  518
             ALEWV  +QK    +   +L R+F+ GDSAG NI H V+       +    + G + + P
Sbjct  164   ALEWVS-HQKDAWLVNHGNLRRIFIGGDSAGANIAHHVSL------SARVALSGCLLMQP  216

Query  517   YFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCN--LENDRELSVGEWL  344
             +FG E     E   E        + D FW+ +LPEG+ +D   CN  LE+ +      W 
Sbjct  217   FFGGEDVLRWEEEIEDPALPHKWV-DTFWKWALPEGATKDHPACNPLLESPK-----SWP  270

Query  343   RFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHPDSEATRLLQ  164
                  LV VA +D ++ERGV+YA  + R G K V +V +E  GH F VF P+S+A   L 
Sbjct  271   EGLPILVLVAERDLMRERGVIYANAMTRAG-KPVRLVVSEGVGHGFQVFQPNSDAIPKLL  329

Query  163   KQMSEFI  143
             + + EF+
Sbjct  330   RHLGEFV  336



>ref|XP_004303415.1| PREDICTED: probable carboxylesterase 15-like [Fragaria vesca 
subsp. vesca]
Length=332

 Score =   158 bits (399),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 105/288 (36%), Positives = 151/288 (52%), Gaps = 18/288 (6%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATAS--AESTDGFKSKDVVIDPSKPITGRIFVPDLW  899
             IV++  G +Q+FSDG+V R S +           D    KDVV D    I+ R++ P   
Sbjct  7     IVEDCMGVLQLFSDGSVHRCSMKDINFPFPVVHDDSVDFKDVVFDKKLNISLRLYRPKSH  66

Query  898   PEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPI  719
                    LLPV+ YFHGGGFCVGS  W   H    RL+    ++VV+ DYRLAPE+KLP 
Sbjct  67    ASATPTNLLPVVFYFHGGGFCVGSRVWPNCHNCCIRLASGLDALVVAPDYRLAPEHKLPA  126

Query  718   AYEDCYAALEWVQKNQKAEPCLES----------ADLSRVFLAGDSAGGNIVHQVAKKCL  569
             A +D  +A+EW+Q+                     D  RV++ GDS+GGN+ H VA + L
Sbjct  127   ALDDAVSAVEWLQREALMSAGSSGDCDAWLGGGLVDFDRVYVVGDSSGGNMAHHVAVR-L  185

Query  568   QDGNCAA---KIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRD  398
               G+  A   +++G + + P+FG E RT +E      T  ++ + D FWRLS+P+G +RD
Sbjct  186   GSGSVKAAPVRVRGYVLLAPFFGGEERTKSE-EGPPETFLNLEILDRFWRLSMPKGESRD  244

Query  397   FYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
                 N      LS+ E +     LV V G + LK+R  +Y+  L+  G
Sbjct  245   HPMVNPFGPISLSLKE-VDLDPILVMVGGNEMLKDRVEIYSRRLKELG  291



>ref|XP_007010790.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY19600.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=335

 Score =   157 bits (398),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 106/287 (37%), Positives = 150/287 (52%), Gaps = 24/287 (8%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKR---------FSPEIATASAESTDGFKSKDVVIDPSKPITGR  920
             +VDE  G+++ + DG+V R         F  E      +  +G  ++DV ID +  +  R
Sbjct  7     LVDEVSGWLRAYDDGSVDRTWTGPPEVKFMAEAVPPHEDFIEGVATRDVTIDSNSGLRVR  66

Query  919   IFVPDLWPEKEQV----ELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVD  752
             I++P      EQV      LP+LL+FHGGGFC+    W  Y+    RL+    ++ VSV 
Sbjct  67    IYLP------EQVLTAKTKLPILLHFHGGGFCISQADWYMYYHIYARLARSVPAICVSVY  120

Query  751   YRLAPENKLPIAYEDCYAALEWVQ---KNQKAEPCL-ESADLSRVFLAGDSAGGNIVHQV  584
              RLAPENKLP A +D YA L W++   K +  EP L + AD +RVFL GDS+GGNIVHQV
Sbjct  121   LRLAPENKLPAACDDGYATLLWLKSLAKGESHEPWLNDHADFNRVFLIGDSSGGNIVHQV  180

Query  583   AKKCLQDGNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSN  404
             A +         ++ G +PIHP F    R+ +E+    S   ++ M D F  L+LP GS 
Sbjct  181   AVRAGNLDLSPLRLAGGIPIHPGFVRAERSKSELEQPESPFLTLDMVDKFLALALPIGST  240

Query  403   RDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLR  263
             +D +             E L  P  L  VA KD +K+  + Y E +R
Sbjct  241   KD-HPITCPMGPAAPAMEGLNLPPFLFCVAEKDLIKDTEMEYYEAMR  286



>ref|XP_008655646.1| PREDICTED: probable carboxylesterase 15 [Zea mays]
 gb|AFW80074.1| hypothetical protein ZEAMMB73_806887 [Zea mays]
Length=340

 Score =   157 bits (398),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 110/291 (38%), Positives = 159/291 (55%), Gaps = 20/291 (7%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAE---STDGFKSKDVVIDPSKPITGRIFVPDL  902
             +V++  G IQ+ SDGTV R  P +   S E      G + +DVV D +  ++ R++ P  
Sbjct  9     VVEDYRGVIQLLSDGTVVRSDPAVLRPSGEHFPDVPGVQWEDVVYDAAHGLSLRVYRPAA  68

Query  901   WP--------EKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYR  746
                       E+E+ + LPVL+YFH GGFC+G+ +   +H    RL+ +  +VV+S DYR
Sbjct  69    ATATAGDAAREEEKKKKLPVLMYFHSGGFCLGTFSQPNFHAGSLRLASELPAVVISADYR  128

Query  745   LAPENKLPIAYEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQ  566
             L PE++LP A +D  AAL W+ + Q+     ESAD +RVF+AG+S+G N+ H VA +   
Sbjct  129   LGPEHRLPAAIDDAAAALSWL-REQRHPWLAESADFTRVFVAGESSGANMSHHVAVRHGS  187

Query  565   DGNCAA------KIKGIMPIHPYFGSERRTAAEVAAEGSTGS-SVAMNDMFWRLSLPEGS  407
              G   A      ++ G + + P+FG   RTAAE A+       +  M D  WRLSLP G+
Sbjct  188   SGGQLALALAPLRVAGYLLLTPFFGGAVRTAAEEASPPPGAPFTPEMADKMWRLSLPAGA  247

Query  406   NRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
               D    N       ++G  + FP  LV  AG+DFL ER + YA  LR  G
Sbjct  248   TMDHPATNPFGPDSRALGP-VAFPRVLVVSAGRDFLHERVLRYAARLREMG  297



>ref|XP_003619717.1| CXE carboxylesterase [Medicago truncatula]
 gb|AES75935.1| carboxylesterase [Medicago truncatula]
Length=342

 Score =   157 bits (398),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 103/275 (37%), Positives = 146/275 (53%), Gaps = 17/275 (6%)
 Frame = -2

Query  1036  SDGTVKR----FSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWP------EKE  887
             S+G+V R    F     +A A   +G  +KD+ +D    I  R+F P             
Sbjct  32    SNGSVNRRLLNFLDNKTSAKATPINGVSTKDITVDAESKIWFRLFTPTGINASAGGGSNT  91

Query  886   QVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYED  707
             +   LPV+++FHGGGF   S   + Y     R S +   VVVSV+YR  PE + P  YED
Sbjct  92    ETTSLPVVIFFHGGGFTFMSPASLSYDTICRRFSRELNVVVVSVNYRRTPEYRYPTQYED  151

Query  706   CYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGIMP  527
                AL+++ +N+   P  E+ D+S+ FLAGDSAG N+ H VA +  + G    ++ G++ 
Sbjct  152   GETALKFLDENKSVLP--ENVDVSKCFLAGDSAGANLAHHVAVRACKAGLQRIRVAGLIS  209

Query  526   IHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLE--NDRELSVG  353
             + P+FG E RT AE+  EGS   S+A  D  W++ LPEGSNRD    N+   N  +LS  
Sbjct  210   MQPFFGGEERTEAEIRLEGSLMISMARTDWMWKVFLPEGSNRDHNAANVSGPNAEDLS--  267

Query  352   EWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVK  248
               L +P  LVFV G D L +    Y E+L+  G K
Sbjct  268   -RLDYPDTLVFVGGLDGLYDWQKRYYEWLKISGKK  301



>ref|XP_002285067.1| PREDICTED: probable carboxylesterase 2 [Vitis vinifera]
Length=322

 Score =   157 bits (397),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 100/276 (36%), Positives = 150/276 (54%), Gaps = 19/276 (7%)
 Frame = -2

Query  1057  PGYIQVFSDGTVKRF-SPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDL-WPEKEQ  884
             P +++VF DG V+RF   +    S    +G  SKD+VI+P   I+ R+++P + +P ++ 
Sbjct  14    PPFLRVFKDGRVERFLGNDTVPPSLNVENGVHSKDIVIEPETGISARLYIPKITYPSQK-  72

Query  883   VELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYEDC  704
                LP+L+YFHGGGFC+ +++   YH +L  L  +   V VSV+YR APE+ LP+AY+DC
Sbjct  73    ---LPLLIYFHGGGFCIETSSSPTYHNYLDSLVAEGNVVAVSVNYRRAPEDPLPVAYDDC  129

Query  703   YAALEWV---QKNQKAEPCL-ESADLSRVFLAGDSAGGNIVHQVAKKCLQDGN--CAAKI  542
             + A +WV     +Q  EP L + AD + +FLAGD AG N+ H +A +     N     K+
Sbjct  130   WTAFKWVVSHSNSQGLEPWLNDHADFNHLFLAGDDAGANLAHNMAIRAGTRVNELGGVKV  189

Query  541   KGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDREL  362
              GI+ +HPYF  +      + +E +     A  D  W    P  S  D    N   D +L
Sbjct  190   SGIILVHPYFWGKD----PIGSEMNDLQKKARVDTLWHFVCPTTSGCDDPLINPATDPQL  245

Query  361   SVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
                  L     L+F+A KD L++RG  Y E L + G
Sbjct  246   RS---LGCQKVLIFLAEKDMLRDRGWFYYETLGKSG  278



>gb|EYU36292.1| hypothetical protein MIMGU_mgv1a009954mg [Erythranthe guttata]
Length=326

 Score =   157 bits (397),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 121/330 (37%), Positives = 173/330 (52%), Gaps = 20/330 (6%)
 Frame = -2

Query  1081  MSIIVDEAPGYIQVFSDGTVKRF-SPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPD  905
             M  +V + P Y++V+ DGTV+RF   E   A+ +   G  SKDV+  P   ++ R++ P 
Sbjct  1     MKTVVHDVPPYLRVYEDGTVERFIGTETTPAALDPHTGVSSKDVLFLPESGVSARLYRPI  60

Query  904   LWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKL  725
                     + LP+++YFHGG FC+ S+    YH  L  L  +++ ++VSVDYR+APEN L
Sbjct  61    NPAAAGSHKKLPLVVYFHGGAFCISSSADPKYHDMLNILVNEAQILLVSVDYRIAPENPL  120

Query  724   PIAYEDCYAALEWVQKNQKAEPC--------LESADLSRVFLAGDSAGGNIVHQVAKKCL  569
             P AYED +AAL+W   +   E           ESAD  RVFLAGDSAG NI H +A +  
Sbjct  121   PAAYEDSWAALKWAASHLSPEETETGGDIWLRESADFDRVFLAGDSAGANISHHLAIRAG  180

Query  568   QDGNCAA-----KIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSN  404
              + +        KI G++ + PYF  E   A  V AE     SV   D +WR   P    
Sbjct  181   SETHGPELGDKFKIAGVLMVQPYFWGEE--AIGVEAENPVFKSVV--DKWWRFVCPSDRG  236

Query  403   RDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevv-ea  227
              D    N   D    V + L     LV VAG D L+ERG +Y + L     K    + + 
Sbjct  237   CDDPWINPFGDGAPGV-DGLACGRVLVCVAGNDVLRERGKLYYQCLVEGKKKMKAELFQT  295

Query  226   eeeghvfhvfHPDSEATRLLQKQMSEFIHG  137
             E E HVFH+  P ++ +++L K+ ++FI+G
Sbjct  296   EGEDHVFHILDPTAQNSKILIKRCAQFING  325



>ref|XP_008652039.1| PREDICTED: probable carboxylesterase 15 [Zea mays]
 tpg|DAA59631.1| TPA: hypothetical protein ZEAMMB73_835930 [Zea mays]
Length=348

 Score =   157 bits (398),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 116/320 (36%), Positives = 166/320 (52%), Gaps = 13/320 (4%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKS---KDVVIDPSKPITGRIFVPDL  902
             +V++  G+++V  DGTV R   E A   A       S   K+ V D    +  R++ P  
Sbjct  23    VVEDIYGFLRVLGDGTVLRSPEEPAFCPASFPSSHPSVQWKEAVYDKPNNLRVRMYKPSA  82

Query  901   WPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLP  722
                    E LPVL++FHGGGFC+GS TW   H F  RL+ ++ +VV+S  YRLAPE++LP
Sbjct  83    --AGRTREKLPVLVHFHGGGFCLGSCTWANVHAFCLRLAAEAGAVVLSAGYRLAPEHRLP  140

Query  721   IAYEDCYAALEWVQKNQKAEP---CLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNC-  554
              A +D    L W++    A       E+AD  RVF+ GDSAGGNI H +A +   D +  
Sbjct  141   TAVDDGAGFLRWLRDQSSAAADGWLAEAADFGRVFVTGDSAGGNIAHHLAVRAEADADVD  200

Query  553   ---AAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCN  383
                   ++G + + P+FG  RRT +E         ++ + D FWRL+LP G+ RD    N
Sbjct  201   VLRPVTVRGYVLLMPFFGGVRRTRSEAKCPAEVLLNLDLFDRFWRLALPPGATRDHPAAN  260

Query  382   LENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfh  203
                     +G        LV V G D +++R V YA+ L   G K VE+VE   + H F+
Sbjct  261   PFGPDSPDLGSVHFRAPLLVVVGGLDMMRDRTVDYAQRLAAMG-KPVELVEFAGKPHGFY  319

Query  202   vfHPDSEATRLLQKQMSEFI  143
             +  P SEAT  L   +S F+
Sbjct  320   LHEPGSEATGELIGLVSRFL  339



>ref|XP_007199215.1| hypothetical protein PRUPE_ppa021861mg [Prunus persica]
 gb|EMJ00414.1| hypothetical protein PRUPE_ppa021861mg [Prunus persica]
Length=316

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 107/272 (39%), Positives = 142/272 (52%), Gaps = 11/272 (4%)
 Frame = -2

Query  1048  IQVFSDGTVKRF-SPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPEKEQVELL  872
             I+V+ DG V+R         S    +G +SKDVVI     I+ R+++P           L
Sbjct  14    IKVYKDGRVERLLGTSTVPPSTHPENGVQSKDVVISQEPAISARLYIPKSAATSSPQTKL  73

Query  871   PVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYEDCYAAL  692
             P+L+YFHGGGFC+ S++   YH +L  L  ++  V VSVDYRLAPEN LP AY+D +AAL
Sbjct  74    PLLVYFHGGGFCIESSSSPTYHNYLNTLVSEANVVAVSVDYRLAPENPLPAAYDDSWAAL  133

Query  691   EWVQKN---QKAEPCLES-ADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGIMPI  524
             +WV  +     +E  L   ADL  VF  GDSAG NI H +A K   +G    K+ GI+ I
Sbjct  134   KWVASHFDGNGSEDWLNRFADLRGVFFGGDSAGANIAHNMALKLGCEGLVGVKLIGIVLI  193

Query  523   HPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVGEWL  344
             HPYF        E+    +    +A     WR + P     D    N   D +L  GE L
Sbjct  194   HPYFWGTEPVGEELTIPAAKREYIA---ALWRFTCPLSIGSDDPLFNPGKDPKL--GE-L  247

Query  343   RFPAALVFVAGKDFLKERGVMYAEFLRRKGVK  248
                  LV VA KD  K+RG  Y+E L++ G K
Sbjct  248   GCEKVLVCVAEKDVFKDRGWHYSEVLKKSGWK  279



>gb|EYU46638.1| hypothetical protein MIMGU_mgv1a009369mg [Erythranthe guttata]
Length=344

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 108/313 (35%), Positives = 162/313 (52%), Gaps = 22/313 (7%)
 Frame = -2

Query  1033  DGTVKR----FSPEIATASAESTDGFKSKDVVIDPSKPITGRIF-----------VPDLW  899
             DGT  R    +     TA+A   DG  S DVV D S  +  R++           + +L 
Sbjct  38    DGTFNRDLNEYLDRKVTANANPVDGVYSFDVV-DRSTSLLNRVYLSARENGAHWGINELE  96

Query  898   PEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPI  719
                   E++PV+++FHGG F   S     Y  F  RL    K+ VVSV+YR +PEN+ P 
Sbjct  97    KPLSTTEVIPVIVFFHGGSFVHSSANSAIYDTFCRRLVSTCKAAVVSVNYRRSPENRYPC  156

Query  718   AYEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIK  539
             AY+D + AL+WVQ         +S+ +  V+LAGDS+GGNI H VA +  ++G    ++K
Sbjct  157   AYDDGWTALKWVQSRLWLRSGAQSSRV-HVYLAGDSSGGNIAHHVAVRAAEEG---VEVK  212

Query  538   GIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELS  359
             G + +HP FG + RT +E   +G     +   D +WR  LPEG +RD   CN+   R  S
Sbjct  213   GNILLHPLFGGQERTESEKLLDGKYFVKIQDRDWYWRAYLPEGEDRDHPACNVFGPRGKS  272

Query  358   VGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHPDSEA  179
             V  ++ FP +LV VAG D L++  + Y + L + G +    +   E+  +   F P+++ 
Sbjct  273   VQGFVNFPKSLVVVAGLDLLQDWQLRYVDGLEKSGQE--VKLLYLEKATIGFYFLPNNDH  330

Query  178   TRLLQKQMSEFIH  140
                L  +M  FIH
Sbjct  331   FHSLMDEMRSFIH  343



>gb|ABB89006.1| CXE carboxylesterase [Malus pumila]
Length=319

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 104/276 (38%), Positives = 143/276 (52%), Gaps = 22/276 (8%)
 Frame = -2

Query  1048  IQVFSDGTVKRF-SPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPEKEQVELL  872
             I+ + DG ++R         S +   G +SKDVVI     I+ R+++P     K     L
Sbjct  14    IKAYKDGRIERLLGTATVPPSTQPETGVQSKDVVISQQPAISVRLYIP-----KSAATKL  68

Query  871   PVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYEDCYAAL  692
             P+L+YFHGGGFC+ S +   YH +L  L  ++  V VSV+YRLAPE+ +P AY+D +AAL
Sbjct  69    PLLVYFHGGGFCIESASSPTYHDYLNSLVSEANVVAVSVEYRLAPEHPVPAAYDDSWAAL  128

Query  691   EWVQKN---------QKAEPCLES-ADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKI  542
             +WV  +         ++ E  + S AD  RVF AGDSAG NI H +  K   DG    K+
Sbjct  129   KWVASHFDGTRKGGEEEDEDWITSYADSQRVFFAGDSAGANIAHHMGLKVGSDGLVGVKL  188

Query  541   KGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDREL  362
              G++ +HPYF        E+ A  +    +A     WR   P  S  D    N E D +L
Sbjct  189   IGVVLVHPYFWGSESIGVELNAPAAMREFMA---AMWRFVNPLSSGSDDPLMNPEKDPKL  245

Query  361   SVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
                  L     +VFVA KD LK+RG  Y E LR+ G
Sbjct  246   GK---LGCGKVVVFVAEKDVLKDRGWYYGEVLRKSG  278



>ref|XP_008344561.1| PREDICTED: probable carboxylesterase 15 [Malus domestica]
Length=341

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 98/283 (35%), Positives = 153/283 (54%), Gaps = 14/283 (5%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKR---------FSPEIATASAESTDGFKSKDVVIDPSKPITGR  920
             +V+E  G+++VF DG+V R         F  E      E  DG  +KDVV   S  +  R
Sbjct  8     LVEEVSGWLRVFDDGSVDRRWTGPPEVQFMVEPVAPHDEFVDGVSTKDVVAGKSSGLRXR  67

Query  919   IFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLA  740
             +++P   PE +  +L P++L+FHGGGFC+    W  Y+    +LS  + ++V S   RLA
Sbjct  68    LYLPKRKPEDDDTKL-PIILHFHGGGFCMSQADWYMYYHIYTKLSRSTNAIVASXYQRLA  126

Query  739   PENKLPIAYEDCYAALEWVQ---KNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCL  569
             PE++LP A +D Y+AL W++   + ++ EP L  AD +RVFL GDS GGNIVH +A +  
Sbjct  127   PEHRLPAAIDDXYSALLWLRSLARGEQNEPLLSHADFNRVFLIGDSTGGNIVHHLAAQAG  186

Query  568   QDGNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYG  389
                    +I G + IHP F    R+ +E+    S   ++ M D F  L+LP GS ++ + 
Sbjct  187   TADLSPLRIAGGILIHPGFVRAERSKSELEQPQSPFLTLDMVDKFLDLALPVGSTKN-HP  245

Query  388   CNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRR  260
                    E +  + L+ P  L+ VA KD + +  + Y E +++
Sbjct  246   ITCPMGPEAAPLDNLKXPPFLLCVASKDLMVDTEMEYFEAMKK  288



>ref|XP_010908310.1| PREDICTED: probable carboxylesterase 15 [Elaeis guineensis]
Length=330

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 103/281 (37%), Positives = 155/281 (55%), Gaps = 12/281 (4%)
 Frame = -2

Query  1069  VDEAPGYIQVFSDGTVKRFSPEIATASAESTDG-FKSKDVVIDPSKPITGRIFVPDLWPE  893
             VDE  G ++VFSDG++ R SP  +       DG    KD   D +  +  R++ P     
Sbjct  9     VDECRGVLRVFSDGSIVR-SPNPSFPVPVQDDGSVDWKDAQFDAAHDLQLRLYKPRYRLP  67

Query  892   KEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAY  713
              +  +  PV  YFHGGGFC+GS TW     +  RL+ + ++VVV+ DYRLAPE++LP A 
Sbjct  68    SDGPKF-PVFYYFHGGGFCIGSRTWPNCQNYCLRLAAELRAVVVAPDYRLAPEHRLPAAI  126

Query  712   EDCYAALEWVQK---NQKAEPCL-ESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCA--  551
             +D  A++EW+ +   +   +P L E+AD+ RVF++GDSAGGNI H +A +       A  
Sbjct  127   DDGAASVEWLHRQAVSPDPDPWLAEAADIGRVFISGDSAGGNIAHHLAVRFGSATGRAKL  186

Query  550   --AKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLE  377
                +I+G + + P+FG  RRT +E         ++ +ND +WRLSLP G+  D    N  
Sbjct  187   EPVRIRGFVHLMPFFGGTRRTKSEAECPKDAFLNLELNDRYWRLSLPRGATADHPLVNPF  246

Query  376   NDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
                  ++ E + F   LV V  +D L++R   YA+ L+  G
Sbjct  247   GPESPNL-EPVEFEPMLVVVGERDLLRDRAAEYAKRLKEWG  286



>tpg|DAA63886.1| TPA: hypothetical protein ZEAMMB73_971270 [Zea mays]
Length=343

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 110/274 (40%), Positives = 147/274 (54%), Gaps = 23/274 (8%)
 Frame = -2

Query  1033  DGTVKRFSPEIA-----TASAESTDGFKSKDVVIDPSKPITGRIFVPDL-WPEKEQVELL  872
             DG+V+R    +      T S     G +S DV ID S+ +  R+F P            +
Sbjct  32    DGSVRRLLFSLGDLKSGTTSRPGASGVRSADVTIDASRGLWARVFSPSSGADADAAAAPV  91

Query  871   PVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYEDCYAAL  692
             PV++YFHGGGF + S     Y  F  RL    ++VVVSV+YRLAP ++ P AY+D  AAL
Sbjct  92    PVVVYFHGGGFVLFSAASRPYDAFCRRLCRGLRAVVVSVNYRLAPGHRFPAAYDDGVAAL  151

Query  691   EWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKK----CLQDGNCAAKIKGIMPI  524
              ++  N  + P     DLS  FLAGDSAGGNI H VA++     +   N   ++ G + I
Sbjct  152   RYLDANADSLPAHVPVDLSSCFLAGDSAGGNITHHVAQRWAVAAVSPTNL--RVAGAVLI  209

Query  523   HPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVGEWL  344
              P+FG E RTAAEVA +G++  SVA  D FW+  LPEG+ RD     +        GE +
Sbjct  210   QPFFGGEERTAAEVALDGASALSVAATDHFWKEFLPEGATRDHEAARV-------CGEGV  262

Query  343   R----FPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             +    FP A+V V G D LK+    Y E LR KG
Sbjct  263   KLADAFPPAMVVVGGFDLLKDWQARYVEALRGKG  296



>gb|EAY72594.1| hypothetical protein OsI_00460 [Oryza sativa Indica Group]
Length=340

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 124/326 (38%), Positives = 171/326 (52%), Gaps = 22/326 (7%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASA-------ESTDGFKSKDVVIDPSKPITGRIF  914
             +V++  G IQ+ SDGTV R S   A A A           G + KD+V D +  +  R++
Sbjct  11    VVEDYRGVIQLLSDGTVVR-SDAGAGAGALLPPEDFPDVPGVQWKDLVYDATHGLKLRVY  69

Query  913   VPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPE  734
              P   P     E LPVL+ FHGGG+C+G+     +H    RL+ + ++VV+S DYRL PE
Sbjct  70    RP---PTAGDAERLPVLVCFHGGGYCLGTFEKPSFHCCCQRLASELRAVVLSADYRLGPE  126

Query  733   NKLPIAYEDCYAALEWVQKNQKAEP-----CLESADLSRVFLAGDSAGGNIVHQVAKKCL  569
             ++LP A +D  A L W++    + P       ESAD +RVF+AG+SAGGN+ H VA   +
Sbjct  127   HRLPAAIDDGAAVLSWLRDQAMSGPGADSWLAESADFARVFVAGESAGGNMSHHVA-VLI  185

Query  568   QDGNCAA---KIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRD  398
               G       ++ G M + P+FG   R  +E         +  M+D  WRLSLPEG+ RD
Sbjct  186   GSGQLTVDPLRVAGYMLLTPFFGGVERAPSEAEPPAGAFFTPDMSDKLWRLSLPEGATRD  245

Query  397   FYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeee  218
                 N       S+   + FP  LV VAG+D L +R V YA  L+    K VE+V  EEE
Sbjct  246   HPVANPFGPDSPSLAA-VAFPPVLVVVAGRDILHDRTVHYAARLKEME-KPVELVTFEEE  303

Query  217   ghvfhvfHPDSEATRLLQKQMSEFIH  140
              H+F    P SE    L + M  FIH
Sbjct  304   KHLFLSLQPWSEPANELIRVMKRFIH  329



>ref|XP_011089000.1| PREDICTED: probable carboxylesterase 15 [Sesamum indicum]
Length=334

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 100/287 (35%), Positives = 150/287 (52%), Gaps = 20/287 (7%)
 Frame = -2

Query  1075  IIVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWP  896
             I V+E  G ++++SDG++ R +                KDV+ D +  +  R++ P   P
Sbjct  18    IEVEECRGVLRIYSDGSIWRSNKSSFEVPVNDDGSVLWKDVLFDATHNLHLRLYKPASPP  77

Query  895   EKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIA  716
                +   LP+  Y HGGGFC+GS  W     +  +L  + ++V++S DYRLAPEN+LP A
Sbjct  78    TSTK---LPIFYYIHGGGFCIGSRAWPNCQNYCFKLCSELQAVIISPDYRLAPENRLPAA  134

Query  715   YEDCYAALEWVQKNQKAEP----CLESADLSRVFLAGDSAGGNIVHQVAKKC-LQDGNCA  551
              ED YA+L+W+Q    AE       +  D S VF++GDSAGGNI H +A +     G  A
Sbjct  135   IEDGYASLKWLQDQALAEEPDTWLTDVVDFSHVFISGDSAGGNIAHNLAVRLGAGSGELA  194

Query  550   -AKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDF-----YG  389
               +++G + + P+FG   RT +E         ++ + D FWRLS+P G   D      +G
Sbjct  195   PVRVRGYVYLAPFFGGTARTGSEAEGPKEAFLNLELIDRFWRLSIPVGETTDHPLVNPFG  254

Query  388   CNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVK  248
              N  N  ++ +         LV V G D LK+R V YAE L++ G K
Sbjct  255   PNSPNLEKMDLD------PILVVVGGSDLLKDRAVEYAEKLKKWGKK  295



>ref|XP_006836875.1| hypothetical protein AMTR_s00099p00101950 [Amborella trichopoda]
 gb|ERM99728.1| hypothetical protein AMTR_s00099p00101950 [Amborella trichopoda]
Length=312

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/247 (37%), Positives = 135/247 (55%), Gaps = 12/247 (5%)
 Frame = -2

Query  1000 ATASAESTDG-----FKSKDVVIDPSKPITGRIFVPDLWPEKEQVELLPVLLYFHGGGFC  836
            AT   E+  G       +KD+ +DP+K +  R+F P+  PE       PV++YFHGGGF 
Sbjct  51   ATGKPETVHGKPGTTVTAKDITLDPAKNLWVRVFAPNGKPEGNAKSSFPVIIYFHGGGFT  110

Query  835  VGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYEDCYAALEWV----QKNQK  668
             GS    G+H    R S +  +VVVSV+YRL+PEN+ P  YED    + W+    +K+  
Sbjct  111  FGSPASRGFHHLCKRFSGEIPAVVVSVNYRLSPENRYPAPYEDGVEVMRWISGAGRKSSG  170

Query  667  AEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGN--CAAKIKGIMPIHPYFGSERRT  494
                 E+AD+SR FLAGDSAG NI+H V  +  +  +     K+ G + + P+FG E R 
Sbjct  171  DGALPENADVSRCFLAGDSAGANILHHVGYQTTKSADEFWPVKVAGHILLQPFFGGEERV  230

Query  493  AAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVGEWLRFPAALVFVA  314
             +E+    +   S+   D  W+  LPE SNRD +  N+       +G+ L FPA+LV + 
Sbjct  231  PSELRITNAPIISINRTDWHWKFFLPENSNRDHHASNVFGPNSQEIGD-LDFPASLVLIG  289

Query  313  GKDFLKE  293
            G D L++
Sbjct  290  GLDPLQD  296



>ref|XP_002285076.1| PREDICTED: probable carboxylesterase 2 [Vitis vinifera]
Length=323

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 108/276 (39%), Positives = 153/276 (55%), Gaps = 18/276 (7%)
 Frame = -2

Query  1051  YIQVFSDGTVKRF-SPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPD-LWPEKEQVE  878
             +++V++DG V+R    ++   +  S  G  +KDVVI P   ++ R+F P+ + PEK    
Sbjct  15    FLRVYTDGLVERLIGTDVVPPAMNSETGVSTKDVVIAPETGVSARLFKPNSVNPEKR---  71

Query  877   LLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYEDCYA  698
              LP+L+YFHGGGF + S     YH +L  L +++  + VSV YRLAPEN +P AYED +A
Sbjct  72    -LPLLVYFHGGGFSLCSPYCSIYHNYLTSLVLEADIIAVSVAYRLAPENPVPAAYEDSWA  130

Query  697   ALEWVQKN---QKAEPCL-ESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGIM  530
             AL+WV  +   Q +EP L + AD  RVFLAGDSAGGNI H +A +   +G    K++GI 
Sbjct  131   ALQWVVSHCNGQGSEPWLKDHADFQRVFLAGDSAGGNISHNLAVQAGVEGLGGVKLQGIC  190

Query  529   PIHPYFGSERRTAAEVAAEGSTGSSVAMN---DMFWRLSLPEGSNRDFYGCNLENDRELS  359
              +HPYFG +         + ++G    +    D +W  + P  S  +    N   D  L 
Sbjct  191   VVHPYFGRKSEDDVGKVDDNASGGRPDVRPGVDNWWLYACPTTSGFNDPRYNPAADERL-  249

Query  358   VGEW-LRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
                W L     LV VA KD L+ERG  Y E L + G
Sbjct  250   ---WRLGCSKVLVCVAEKDALRERGWFYYETLGKSG  282



>gb|AEP68102.1| CXE protein [Hevea brasiliensis]
Length=316

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 122/315 (39%), Positives = 176/315 (56%), Gaps = 23/315 (7%)
 Frame = -2

Query  1051  YIQVFSDGTVKRFS-PEIATASAESTDGFKSKDVVID-PSKPITGRIFVPDLWPEKEQVE  878
             Y++V+ DGT++R++  E+  A  +S  G  SKD+ +  P   ++ RI+ P      ++  
Sbjct  14    YLRVYKDGTIERYAGTEVTPAGFDSQTGVLSKDIFLTTPQTTLSARIYRPQFINNNQK--  71

Query  877   LLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYEDCYA  698
              LP+L+Y+HGG FC+ S     Y   L +L  ++K +VVSVDYRLAPE+ LP AYED +A
Sbjct  72    -LPLLVYYHGGAFCIASPAEPKYQNCLNQLVSKAKIIVVSVDYRLAPEHPLPAAYEDSWA  130

Query  697   ALEWV--QKNQKAEPCLES-ADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGIMP  527
             +L+W+    N   E  LE  AD  RVFLAGDSAG NI HQ+A + ++D     +++GI  
Sbjct  131   SLQWLVAHVNGGIEEWLEDYADFERVFLAGDSAGANIAHQLALR-MKDFPNMKRLQGIAM  189

Query  526   IHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVG--  353
             IHPYF  +      +  E +     +M D +W    P  SN+   GC+         G  
Sbjct  190   IHPYFWGKE----PIGEEANESLKKSMVDNWWMFVCP--SNK---GCDDPYINPFVKGAP  240

Query  352   --EWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaee-eghvfhvfHPDSE  182
               + L   + LVFVA KD L ERG +Y E L + G K    +   + E HVFH+F+PD E
Sbjct  241   SLKGLASESVLVFVAEKDILCERGKLYYEKLVKSGWKGKAEIVETKGEDHVFHIFNPDCE  300

Query  181   ATRLLQKQMSEFIHG  137
                LL K+ + FI+G
Sbjct  301   NAHLLIKRWAAFING  315



>ref|XP_007201337.1| hypothetical protein PRUPE_ppa007658mg [Prunus persica]
 gb|EMJ02536.1| hypothetical protein PRUPE_ppa007658mg [Prunus persica]
Length=360

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 104/270 (39%), Positives = 143/270 (53%), Gaps = 11/270 (4%)
 Frame = -2

Query  1048  IQVFSDGTVKRFS-PEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPEKEQVELL  872
             I+V+ DG V+R +  +    S +   G +SKDVVI     I+ R+++P           L
Sbjct  14    IKVYKDGRVERLNDTDRVPPSTDPKTGVQSKDVVISQEPAISARLYIPKSTTTSAPQTKL  73

Query  871   PVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYEDCYAAL  692
             P+L+YFHGGGFCV S++   YH +L  L  ++  V VSVDYRL PE+ LP AY+D +AAL
Sbjct  74    PLLIYFHGGGFCVRSSSSAKYHSYLNALVSEANVVAVSVDYRLVPEHPLPAAYDDSWAAL  133

Query  691   EWVQKNQK---AEPCLES-ADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGIMPI  524
             +WV  +     +E  L   AD  RVF AG+SAG NI H +A K   +G    K+ GI+  
Sbjct  134   KWVASHSDGNGSEDWLNRFADFQRVFFAGNSAGANITHNMAVKLGCEGLVGVKLIGIVLE  193

Query  523   HPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVGEWL  344
             HPYF        E+    +    +A     WR + P  S  D    N   D++L     L
Sbjct  194   HPYFWGTEPVGEELTTPAAAREYMA---GVWRFACPSTSGSDDPLINPAKDQKLGK---L  247

Query  343   RFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
                  LV VA KD LK+RG  Y+E L++ G
Sbjct  248   GCEKVLVCVAEKDVLKDRGWHYSETLKKSG  277



>ref|XP_009370628.1| PREDICTED: probable carboxylesterase 15 [Pyrus x bretschneideri]
Length=342

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 103/287 (36%), Positives = 155/287 (54%), Gaps = 18/287 (6%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKR---------FSPEIATASAESTDGFKSKDVVIDPSKPITGR  920
             +V+E   +++VF DG+V R         F  E   A  E  DG  +KDVV D S  +  R
Sbjct  8     LVEEVSSWLRVFDDGSVDRKWTGPPEIQFMVEPVPAHDEFVDGISTKDVVADKSSGLRVR  67

Query  919   IFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLA  740
             I++P+  PE    +L P++L+FHGGGFC+    W  Y+    +LS  + ++VVSV  RLA
Sbjct  68    IYLPERKPEGYDTKL-PIILHFHGGGFCISQADWYMYYHIYTKLSRSTNAIVVSVYQRLA  126

Query  739   PENKLPIAYEDCY----AALEWVQK---NQKAEPCLESADLSRVFLAGDSAGGNIVHQVA  581
             PE++LP A ED Y    +AL W++     +K EP L  AD +RVFL GDS+GGNIVH V 
Sbjct  127   PEHRLPAAIEDGYFDGYSALLWLRSLAGGEKREPLLSHADYNRVFLIGDSSGGNIVHHVV  186

Query  580   KKCLQDGNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNR  401
              +         ++ G +PIHP F    R+ +E+    S   ++ M D F  L++P GS +
Sbjct  187   AQAGTADLSPLRLAGGIPIHPGFVRAERSKSELEQPQSPLLTLDMVDKFLGLAVPTGSTK  246

Query  400   DFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRR  260
             + +        E    + L+ P  L+ VA KD + +  + Y E +++
Sbjct  247   N-HPITCPMGPEAPPLDNLKLPPFLLCVASKDLIIDTQMEYFEAMKK  292



>ref|XP_007156545.1| hypothetical protein PHAVU_003G295100g [Phaseolus vulgaris]
 gb|ESW28539.1| hypothetical protein PHAVU_003G295100g [Phaseolus vulgaris]
Length=316

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 99/272 (36%), Positives = 143/272 (53%), Gaps = 17/272 (6%)
 Frame = -2

Query  1051  YIQVFSDGTVKRFSP-EIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPEKEQVEL  875
             +++V+ DGTV+R S  ++     ++    +SKDVVI     ++ R+F+P L    +Q + 
Sbjct  15    FLKVYKDGTVQRVSGCDVVPPCFDTETNVESKDVVISKDDDVSARLFIPKL---TDQTQK  71

Query  874   LPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYEDCYAA  695
             LP+L+YFHGGGFC+ +     YH FL  +  ++  V VSV YR APE+ +PIAYED + +
Sbjct  72    LPLLVYFHGGGFCIETPYSPPYHKFLNSIVSKANIVAVSVHYRRAPEHPVPIAYEDSWTS  131

Query  694   LEWVQK----NQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGIMP  527
             L+WV      N   E     AD  +VF  GDSAG NIVH +  +    G     I+GI+ 
Sbjct  132   LKWVASHFDGNGPEEWLNRHADFGKVFCGGDSAGANIVHNMGIRAGTHGLPGLNIEGIVL  191

Query  526   IHPYF-GSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVGE  350
             +HPYF G ER     + +E      +AM D  WR   P  +  D    N   D  L    
Sbjct  192   VHPYFWGVER-----IGSESEKAELLAMVDNLWRFVSPTSTGSDDPLINPGTDPNLGK--  244

Query  349   WLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
              L     ++FVA  D +K+RG  Y E + + G
Sbjct  245   -LGCKRVVIFVAENDLMKDRGWYYKELVEKCG  275



>ref|XP_008372377.1| PREDICTED: LOW QUALITY PROTEIN: probable carboxylesterase 12 
[Malus domestica]
Length=319

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 104/276 (38%), Positives = 143/276 (52%), Gaps = 22/276 (8%)
 Frame = -2

Query  1048  IQVFSDGTVKRF-SPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPEKEQVELL  872
             I+ + DG ++R         S +   G +SKDVVI     I+ R+++P     K     L
Sbjct  14    IKAYKDGRIERLLGTATVPPSTQPETGVQSKDVVISQQPAISVRLYIP-----KSAATKL  68

Query  871   PVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYEDCYAAL  692
             P+L+YFHGGGFC+ S +   YH +L  L  ++  V VSV+YRLAPE+ +P AY+D +AAL
Sbjct  69    PLLVYFHGGGFCIESASSPTYHDYLNSLVSEANVVAVSVEYRLAPEHPVPAAYDDSWAAL  128

Query  691   EWVQKN---------QKAEPCLES-ADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKI  542
             +WV  +         ++ E  + S AD  R+F AGDSAG NI H +  K   DG    K+
Sbjct  129   KWVASHFDGTRKGGEEEDEDWITSYADSQRMFFAGDSAGANIAHXMGLKVGSDGLVGVKL  188

Query  541   KGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDREL  362
              G++ +HPYF        E+ A  +    +A     WR   P  S  D    N E D +L
Sbjct  189   IGVVLVHPYFWGSESIGVELNAPAAMREFMA---AMWRFVNPLSSGSDDPLMNPEKDPKL  245

Query  361   SVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
                  L     +VFVA KD LKERG  Y E LR+ G
Sbjct  246   GK---LGCGKVVVFVAEKDVLKERGWYYGEVLRKSG  278



>ref|XP_006340439.1| PREDICTED: probable carboxylesterase 15-like [Solanum tuberosum]
Length=322

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 116/317 (37%), Positives = 168/317 (53%), Gaps = 13/317 (4%)
 Frame = -2

Query  1069  VDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPEK  890
             V+E  G ++V+SDGT+ R +                KDVV      +  R++ P      
Sbjct  8     VEECRGVLRVYSDGTILRLTKPSFEVPIHDDGSILWKDVVFQAMYNLQLRLYKP---ASP  64

Query  889   EQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYE  710
                  LPV  Y HGGGFC+GS TW     +  +L+ + ++VV+S DYRLAPEN+LP A E
Sbjct  65    ISAAKLPVFYYIHGGGFCIGSRTWPNCQNYCFKLASELQAVVISPDYRLAPENRLPAAIE  124

Query  709   DCYAALEWVQKNQKA-EP---CLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNC---A  551
             D YAA++W+Q    + EP     + AD SRVF++GDSAGGNI H +A + LQ G+     
Sbjct  125   DGYAAVKWLQDQAVSDEPDKWLTDVADFSRVFISGDSAGGNIAHNLAVR-LQAGSAELDP  183

Query  550   AKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLEND  371
              +++G + + P+FG   RT  E         ++ + D FWRLS+P GS  D    N    
Sbjct  184   VRVRGYVYLLPFFGGTIRTKFEAEGPKDAFLNIELIDRFWRLSIPIGSTTDHPLVNPFGP  243

Query  370   RELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHP  191
             +  ++ E +     LV V G D LK+R   YA  L+  G K +E VE E + H F    P
Sbjct  244   KSPNL-ENIDLDPILVLVGGCDLLKDRAKDYANKLKNYG-KNIEYVEFEGQQHGFFTIDP  301

Query  190   DSEATRLLQKQMSEFIH  140
             +SE+++ L   + +FI 
Sbjct  302   NSESSKKLMLIIKKFIQ  318



>ref|XP_006487081.1| PREDICTED: probable carboxylesterase 5-like [Citrus sinensis]
Length=315

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 124/326 (38%), Positives = 169/326 (52%), Gaps = 33/326 (10%)
 Frame = -2

Query  1087  QKMSIIVDEAPGYIQVFSDGTVKRF-SPEIATASAESTDGFKSKDVVIDPSKPITGRIFV  911
              K   I  E   Y + + DG V+RF   +   AS +S++   SKDVVI P K ++ RIF+
Sbjct  8     SKTRAIAHEFLPYFRAYRDGHVERFFGSDKVPASMDSSNAVFSKDVVIVPEKGVSARIFI  67

Query  910   PDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPEN  731
             P    +  Q   LP+L+Y+HGGGF +GS     YH ++G LS ++  +VVSVDYRLAPE+
Sbjct  68    PSAAIKTNQ--KLPLLVYYHGGGFFMGSPFCSTYHNYVGSLSAKANVIVVSVDYRLAPEH  125

Query  730   KLPIAYEDCYAALEWVQ-----KNQKAEPCL-ESADLSRVFLAGDSAGGNIVHQVAKKCL  569
              +P AYED +A L WV           E  L + AD +RVFLAGDSAGGNIVH +A +  
Sbjct  126   LVPAAYEDSWAVLTWVAYHFNINGHGYEAWLNDHADFARVFLAGDSAGGNIVHNMAVQAS  185

Query  568   QDGNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYG  389
              +     ++ GI  + PYFG                      D  W    P  S  +   
Sbjct  186   FEDLNGIQLAGICLVQPYFGRNDEVV----------------DKCWVFVCPNTSGYNDVR  229

Query  388   CNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeg--  215
              N   D  L     LR P  LV VA KD L++RG++Y E L+  G  W   +E  E    
Sbjct  230   INPAADSRLMS---LRCPRVLVCVAEKDNLRDRGLLYYETLKNCG--WAGEIEIVETEGE  284

Query  214   -hvfhvfHPDSEATRLLQKQMSEFIH  140
              HVFH+F+PDSE    L  +++ F++
Sbjct  285   DHVFHLFNPDSEKAVALMDKLASFLN  310



>ref|XP_009373950.1| PREDICTED: gibberellin receptor GID1C-like [Pyrus x bretschneideri]
Length=364

 Score =   157 bits (396),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 108/278 (39%), Positives = 152/278 (55%), Gaps = 24/278 (9%)
 Frame = -2

Query  1033  DGTVKRFSPEI----ATASAESTDGFKSKDVVIDPSKPITGRIFVPD---LWP-------  896
             DGT  R   E       A+A   DG  S DV+ID    +  RI+ PD   L P       
Sbjct  58    DGTFNRHLAEFLDRKVPANANPVDGVVSFDVIIDRETSLLSRIYHPDNADLSPLNIVDLK  117

Query  895   EKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIA  716
                  E+LPV+++FHGG F   S+    Y +   RL    K+VVVSV+YR APEN+ P A
Sbjct  118   RPVNKEVLPVIVFFHGGSFVHSSSNSGIYDILCRRLVGICKAVVVSVNYRRAPENRYPCA  177

Query  715   YEDCYAALEWVQKNQKAEPCLESADLSRV--FLAGDSAGGNIVHQVAKKCLQDGNCAAKI  542
             Y+D + AL+WV    K+ P L+S   S+V  +LAGDS+GGNIVH VA +  + G     +
Sbjct  178   YDDGWTALKWV----KSRPWLKSTKDSKVHIYLAGDSSGGNIVHNVALRAAESG---INV  230

Query  541   KGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDREL  362
              G + ++P FG + RT +E+  +G    ++   D +WR  LPEG +RD   CN    R  
Sbjct  231   LGNILLNPMFGGQERTESEMRLDGKYFVTIQDRDWYWRALLPEGEDRDHPACNPFGPRGQ  290

Query  361   SVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVK  248
             S+ E ++FP +LV VAG D +++  + YA  L R G+ 
Sbjct  291   SL-EAVKFPKSLVVVAGLDLVQDWQLAYARGLERAGIN  327



>ref|XP_006358445.1| PREDICTED: gibberellin receptor GID1B-like [Solanum tuberosum]
Length=345

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 111/315 (35%), Positives = 168/315 (53%), Gaps = 26/315 (8%)
 Frame = -2

Query  1036  SDGTVKR----FSPEIATASAESTDGFKSKDVVIDPSKPITGRIFVP-----------DL  902
             SDGT  R    F      A++   DG  S DVV D S  +  R++ P           DL
Sbjct  37    SDGTFNRDLAEFLERKVPANSIPVDGVYSFDVV-DRSTSLLNRVYKPAPKNESDWGKIDL  95

Query  901   WPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLP  722
                    E++PV+++FHGG F   S     Y  F  RL    K+VVVSV+YR +PEN+ P
Sbjct  96    DKPLSTTEIVPVIIFFHGGSFTHSSANSAIYDTFCRRLVSICKAVVVSVNYRRSPENRYP  155

Query  721   IAYEDCYAALEWVQKNQKAEPCLESADLS-RVFLAGDSAGGNIVHQVAKKCLQDGNCAAK  545
              AY+D +AAL+WV+  Q  +      DL   V++AGDS+GGNI H VA +  + G    +
Sbjct  156   CAYDDGWAALKWVKSRQWLQ---SGKDLKVHVYMAGDSSGGNIAHHVAVQAAESG---VE  209

Query  544   IKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRE  365
             + G + +HP FG ++RT +E   +G    +V   D +WR  LPEG +RD   CN+   R 
Sbjct  210   VFGNILLHPMFGGQKRTESESRLDGKYFVTVQDRDWYWRAYLPEGEDRDHPACNIFGPRG  269

Query  364   LSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeghvfhvfHPDS  185
              ++ E L FP +LV VAG D +++  + Y E L++ G +    +   ++  +   F P++
Sbjct  270   RTL-EGLNFPKSLVVVAGLDLVQDWQLTYVEGLQKSGHE--VNLLYLKQATIGFYFLPNN  326

Query  184   EATRLLQKQMSEFIH  140
             +  R L ++++ FIH
Sbjct  327   DHFRCLMEEITSFIH  341



>gb|ABB89020.1| CXE carboxylesterase [Actinidia deliciosa]
Length=332

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 100/269 (37%), Positives = 148/269 (55%), Gaps = 20/269 (7%)
 Frame = -2

Query  1036  SDGTVKRFSPEIATASAEST----DGFKSKDVVIDPSKPITGRIFVPDLWPEKEQVELLP  869
             S+GTV R       A +  T    +G  S D+ +D S+ +  R+F P         + LP
Sbjct  32    SNGTVNRLLMNFLDAKSPPTPKPMNGVTSSDITVDVSRNLWFRLFTP------ADADTLP  85

Query  868   VLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYEDCYAALE  689
             V++YFHGGGF   S +   Y  F  RL+    +VVVSV+YRLAPE++ P  ++D + AL+
Sbjct  86    VIVYFHGGGFVFFSASTKPYDEFCRRLAENIPAVVVSVNYRLAPEHRFPAQFDDAFDALK  145

Query  688   WVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQD------GNCAAKIKGIMP  527
             ++  N        +ADLSR F+AGDSAGGNI HQVA +          G    +I G++ 
Sbjct  146   FLDANFLPP----NADLSRCFIAGDSAGGNIAHQVALRSAAADADADAGFRRLRIAGVIA  201

Query  526   IHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVGEW  347
             I P+FG E RT +E+        ++ ++D  W+  LPEGSNR+  G N  +D + +    
Sbjct  202   IQPFFGGEERTESELRLTHMPILNMELSDWMWKAFLPEGSNRNHEGVNFLSDPKSAHISG  261

Query  346   LRFPAALVFVAGKDFLKERGVMYAEFLRR  260
             L FPA +VFV G D L++    Y ++L++
Sbjct  262   LNFPATMVFVGGFDPLQDLQRKYYDWLKK  290



>ref|XP_001757066.1| GLP1 GID1-like protein [Physcomitrella patens]
 gb|ABX10762.1| gibberellin receptor GID1-like protein [Physcomitrella patens]
 gb|EDQ78297.1| GLP1 GID1-like protein [Physcomitrella patens]
Length=336

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 102/279 (37%), Positives = 145/279 (52%), Gaps = 24/279 (9%)
 Frame = -2

Query  1033  DGTVKRFSPEI----ATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPEKEQVEL---  875
             DGT+ R+  +       A+     G  S DV ID    I  R+F   L  E E+  L   
Sbjct  25    DGTINRWLADTLEKKVPANPIPVKGVSSADVTIDAEAGIWARVF--SLTEEIEETSLPTA  82

Query  874   ----------LPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKL  725
                       +P++LY+HGGGF V    +  Y +F  RL+ +  ++V+SV YR APE K 
Sbjct  83    TDGNQRLFKTMPIILYYHGGGFAVLCPNFYLYDIFCRRLARKCNAIVISVHYRRAPEFKF  142

Query  724   PIAYEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAK  545
             P AY+D Y A+EW+Q  +       + D SRVFL+GDSAGGNI H VA +          
Sbjct  143   PTAYDDSYKAMEWLQSKEATVSLPPNVDFSRVFLSGDSAGGNIAHHVALRAAGKDLGRLS  202

Query  544   IKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNL--END  371
             +KG++ I P+FG E RT+AE+  +     SV   D  W+  LPEG+NRD   CN+   N 
Sbjct  203   LKGLVLIQPFFGGEERTSAELRLKNVPIVSVESLDWHWKAYLPEGANRDHPSCNIFGPNS  262

Query  370   RELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
              +LS    +  P  L  V G D L++  + Y+E +++ G
Sbjct  263   PDLSD---VPLPPILNIVGGLDILQDWEMRYSEGMKKAG  298



>ref|XP_002268777.1| PREDICTED: probable carboxylesterase 18 [Vitis vinifera]
Length=320

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 99/286 (35%), Positives = 153/286 (53%), Gaps = 11/286 (4%)
 Frame = -2

Query  997  TASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTW  818
            + S +  +G  + D+ +DPS+ +  R F+P      E  + LPV +YFHGGGF + S + 
Sbjct  44   SPSDKPVNGVTTSDITVDPSRNLWFRYFLPS---AAEAGKKLPVTVYFHGGGFVMLSPSS  100

Query  817  VGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYEDCYAALEWVQKNQKAEPCLESADL  638
              +     RL+ +  +V+VSV+YRLAPE++ P +YED    L+++ +N  A     +ADL
Sbjct  101  QLFDDLCRRLAKELPAVIVSVNYRLAPEHRCPASYEDGVDVLKFLDENPPA-----NADL  155

Query  637  SRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGS  458
            +R ++ GDSAGGNI H V  +  +       I G++PI PYFG E RT +E+   G+   
Sbjct  156  TRCYIVGDSAGGNIAHHVTARAGEHNFTNLNIAGVIPIQPYFGGEERTESEIQLAGAPLV  215

Query  457  SVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMY  278
            SV   D  W+  LPEGS+RD    N+   +   V   L+FP +LVF+ G D L++    Y
Sbjct  216  SVERTDWCWKAFLPEGSDRDHPAANVFGPKSSDVSG-LKFPKSLVFMGGFDPLRDWQESY  274

Query  277  AEFLRRKGVKWvevveaeeeghvfhvfHPDSEATRLLQKQMSEFIH  140
             E L+  G +    V             PD   + L  +++ +FI+
Sbjct  275  CEGLKGNGKE--VKVVDYPNAMHSFYAFPDLPESTLFMRELQDFIY  318



>ref|XP_008652041.1| PREDICTED: probable carboxylesterase 15 [Zea mays]
 tpg|DAA59637.1| TPA: hypothetical protein ZEAMMB73_875550 [Zea mays]
Length=328

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 105/282 (37%), Positives = 151/282 (54%), Gaps = 15/282 (5%)
 Frame = -2

Query  1075  IIVDEAPGYIQVFSDGTV-KRFSPEIATASAESTDGFKS-KDVVIDPSKPITGRIFVPDL  902
             ++VDE  G + V+SDGTV +R  P  AT   +  DG    KDV  D ++ +  R+++P  
Sbjct  9     VVVDECRGVLFVYSDGTVVRRAQPGFATPVRD--DGTVDWKDVTFDEARGLALRLYLPRD  66

Query  901   WPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLP  722
                      LPV  Y+HGGGFC+GS  W     +  RL+    ++VV+ DYRLAPE++LP
Sbjct  67    RGAGAG-RRLPVFFYYHGGGFCIGSRAWPNCQNYCLRLASDLGALVVAPDYRLAPEHRLP  125

Query  721   IAYEDCYAALEWVQKNQKAEPCL-ESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAK  545
              A +D  AA+ W+ +    +P + E+ADL RVF++GDSAGG I H +A +    G   A 
Sbjct  126   AAIDDGAAAVLWLARQGGGDPWVAEAADLGRVFVSGDSAGGTIAHHLAVRF---GGSPAD  182

Query  544   -----IKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNL  380
                  ++G + + P+FG   RT +E            +ND +WRLSLPEG+  D    N 
Sbjct  183   LAPVAVRGYVQLMPFFGGVARTRSEAECPADAFLDRPLNDRYWRLSLPEGATPDHPVANP  242

Query  379   ENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
                    + + + F   LV V G+D L +R V YA  LR  G
Sbjct  243   FGPGAPPL-DAVDFAPTLVVVGGRDLLHDRAVDYAARLRAAG  283



>ref|XP_004233713.1| PREDICTED: probable carboxylesterase 17 [Solanum lycopersicum]
Length=343

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 97/297 (33%), Positives = 164/297 (55%), Gaps = 24/297 (8%)
 Frame = -2

Query  1096  SNLQKMS---IIVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKSKDVVIDPSKPIT  926
             +N++K+    ++V+E  G I+V+++G ++R           S     SKD++      + 
Sbjct  14    NNVRKIDHDIVVVEEIEGLIKVYNNGHIERPPIIPNVPPNNSLPHLTSKDIIF---HNLW  70

Query  925   GRIFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYR  746
              RI++P+     ++   LP+L+YFHGGGF +GS  W  YH FL  L+ +  +V+VSV+Y+
Sbjct  71    SRIYLPNPPTNNKK---LPLLVYFHGGGFSLGSAAWKCYHDFLSTLASKIGAVIVSVNYQ  127

Query  745   LAPENKLPIAYEDCYAALEWVQKNQKAEPCLES-----ADLSRVFLAGDSAGGNIVHQVA  581
             LAPEN+LP AY+D + A+ W++      P  ++      + S +F+ GDSAG NI + VA
Sbjct  128   LAPENRLPAAYDDGFHAITWLKNQAILNPKEQNWWSSKCNFSNMFIGGDSAGANIAYHVA  187

Query  580   KKCLQDGNCAAK----IKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAM--NDMFWRLSL  419
              +   + N        +KG++ I P+FG E RT +E  +     S++ +  +D +WR++L
Sbjct  188   IRLNNNNNNNNIKPLCLKGVILIQPFFGGESRTYSEKYSVQPPYSALNLSASDTYWRIAL  247

Query  418   PEGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVK  248
             P GSNRD   CN      LS    ++ P+ L+ ++  D L++R +     L   G+K
Sbjct  248   PVGSNRDHPWCN----PRLSDTNNIKLPSVLICISEMDILRDRNLEMCNVLGEAGIK  300



>ref|XP_009401277.1| PREDICTED: tuliposide A-converting enzyme 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=321

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 104/280 (37%), Positives = 153/280 (55%), Gaps = 16/280 (6%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRF-SPEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLW-  899
             +V +AP +I+V+  G ++R    E+  A  +   G  SKDV++DP+  +T R+++PDL  
Sbjct  11    VVIDAPPFIRVYKSGRIERLVGTEVLPAGLDPATGVASKDVLVDPATNLTARLYLPDLSG  70

Query  898   --PEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKL  725
               P+K+    +PVL+Y+HGGGF + +     YH +L  L   +  V VSVDYR APE+ L
Sbjct  71    SPPDKK----IPVLVYYHGGGFVIETAFSPTYHNYLNSLVAAAGVVAVSVDYRRAPEHPL  126

Query  724   PIAYEDCYAALEWVQKNQKAEPCL-ESADLSRVFLAGDSAGGNIVHQVAKKCLQD--GNC  554
             P AY+D +AAL WV      E  L E  DL RVFLAGDSAG NIVHQ+A +  +D  G  
Sbjct  127   PAAYDDSWAALRWVASRPTEETWLSERGDLGRVFLAGDSAGANIVHQMALRAAEDGLGGG  186

Query  553   AAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLEN  374
               +I+G++ +HP+F      A  + +E     +    +  W    P  +  D    +   
Sbjct  187   DTEIRGLLLVHPFFCG----AEPLESESWDPKAREWVERLWAFVRPGTTGLDDPWIDPLT  242

Query  373   DRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
             +   S+   L     LV VA KD L+++G  Y E L+R G
Sbjct  243   EGAPSLAA-LPCRRVLVTVAEKDMLRKKGREYQEALKRSG  281



>ref|XP_002322605.2| hypothetical protein POPTR_0016s03130g [Populus trichocarpa]
 gb|EEF04366.2| hypothetical protein POPTR_0016s03130g [Populus trichocarpa]
Length=338

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 100/286 (35%), Positives = 156/286 (55%), Gaps = 14/286 (5%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRF---SPEI------ATASAESTDGFKSKDVVIDPSKPITGR  920
             IVDE PG+I+VF DGTV R    +PE+       +   E  +G   +D +ID    +  R
Sbjct  7     IVDEVPGWIRVFEDGTVDRTWTGAPEMEPLLKPVSPHEEFINGVAVRDQIIDSKTGLAVR  66

Query  919   IFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLA  740
             I+VP++    +    +P++L+ HGGG+C+    W  Y+ F  RL    ++V+VSV +RLA
Sbjct  67    IYVPEMKSSVQTKAKIPLILHLHGGGYCICQPDWSLYYHFCTRLVSSVQAVLVSVYFRLA  126

Query  739   PENKLPIAYEDCYAALEWVQKNQKAEP----CLESADLSRVFLAGDSAGGNIVHQVAKKC  572
             PE++LP+A ED YAAL W++ N + E         AD +RVFL GDS+GGN+VHQVA + 
Sbjct  127   PEHRLPVAVEDSYAALLWLRANARGELSDQWLTSYADFNRVFLVGDSSGGNLVHQVAAQA  186

Query  571   LQDGNCAAKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFY  392
               D     K++G + I P F S++ + + +    +  S+  M   F  L++P GS  + +
Sbjct  187   GFDDIEPLKLRGGIAIQPGFISDKPSKSYLEIPENPLSTREMMKKFTSLAVPIGSTGE-H  245

Query  391   GCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
                     +      L+ P  LV VA  D L++  + Y E +++ G
Sbjct  246   PIVWPIGPQAPPLTTLKLPPMLVVVAEMDLLRDYELEYCEEMKKAG  291



>ref|NP_001042063.1| Os01g0155000 [Oryza sativa Japonica Group]
 dbj|BAB44070.1| putative PrMC3 [Oryza sativa Japonica Group]
 dbj|BAB64639.1| putative PrMC3 [Oryza sativa Japonica Group]
 dbj|BAF03977.1| Os01g0155000 [Oryza sativa Japonica Group]
 gb|EAZ10597.1| hypothetical protein OsJ_00429 [Oryza sativa Japonica Group]
 dbj|BAG93577.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87397.1| unnamed protein product [Oryza sativa Japonica Group]
Length=337

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 120/325 (37%), Positives = 168/325 (52%), Gaps = 20/325 (6%)
 Frame = -2

Query  1072  IVDEAPGYIQVFSDGTVKRFSPEIATASAESTDGFKS------KDVVIDPSKPITGRIFV  911
             +V++  G IQ+ SDGTV R        +    + F        KD+V D +  +  R++ 
Sbjct  11    VVEDYRGVIQLLSDGTVVRSDAGSGAGALLPPEDFPDVPGVQWKDLVYDATHGLKLRVYR  70

Query  910   PDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPEN  731
             P   P     E LPVL+ FHGGG+C+G+     +H    RL+ + ++VV+S DYRL PE+
Sbjct  71    P---PTAGDAERLPVLVCFHGGGYCLGTFEKPSFHCCCQRLASELRAVVLSADYRLGPEH  127

Query  730   KLPIAYEDCYAALEWVQKNQKAEP-----CLESADLSRVFLAGDSAGGNIVHQVAKKCLQ  566
             +LP A +D  A L W++    + P       ESAD +RVF+AG+SAGGN+ H VA   + 
Sbjct  128   RLPAAIDDGAAVLSWLRDQAMSGPGADSWLAESADFARVFVAGESAGGNMSHHVA-VLIG  186

Query  565   DGNCAA---KIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDF  395
              G       ++ G M + P+FG   R  +E         +  M+D  WRLSLPEG+ RD 
Sbjct  187   SGQLTVDPLRVAGYMLLTPFFGGVERAPSEAEPPAGAFFTPDMSDKLWRLSLPEGATRDH  246

Query  394   YGCNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKGVKWvevveaeeeg  215
                N       S+   + FP  LV VAG+D L +R V YA  L+    K VE+V  EEE 
Sbjct  247   PVANPFGPDSPSLAA-VAFPPVLVVVAGRDILHDRTVHYAARLKEME-KPVELVTFEEEK  304

Query  214   hvfhvfHPDSEATRLLQKQMSEFIH  140
             H+F    P SE    L + M  FIH
Sbjct  305   HLFLSLQPWSEPANELIRVMKRFIH  329



>ref|XP_004148971.1| PREDICTED: probable carboxylesterase 18-like [Cucumis sativus]
 gb|KGN44731.1| hypothetical protein Csa_7G375730 [Cucumis sativus]
Length=344

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 98/285 (34%), Positives = 151/285 (53%), Gaps = 13/285 (5%)
 Frame = -2

Query  1084  KMSIIVDEAPGYIQVFSDGTVKR-----FSPEIATASAESTDGFKSKDVVIDPSKPITGR  920
             ++ + +    G +    +GTV R     F  +      +   G  S DV++D S+ ++ R
Sbjct  24    RLLVSLSSVCGDLATRPNGTVNRRLFRLFDFKSPPNPVKPIHGVLSFDVIVDSSRNLSVR  83

Query  919   IFVPDLWPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLA  740
             +F P        V  LP+L++FHGGGF + S +   Y     R + +  ++V+SVDYRL+
Sbjct  84    VFTP-----SSDVASLPILIFFHGGGFALLSNSSFSYVAVCRRFARRLPAIVLSVDYRLS  138

Query  739   PENKLPIAYEDCYAALEWVQKNQKAEPCLE-SADLSRVFLAGDSAGGNIVHQVAKK-CLQ  566
             PE++ P  Y+D +  L ++         L  +ADLS+ FLAGDSAG N+ H VA + C Q
Sbjct  139   PEHRFPSQYDDGFDVLRFLDHESNTIGLLPPNADLSKCFLAGDSAGANLAHHVAVRFCRQ  198

Query  565   DGNCA-AKIKGIMPIHPYFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYG  389
                   A++ G++ I P+FG E RT AE+  +     S+A  D  WR  LPEG++RD   
Sbjct  199   RSQFERARVVGLVSIQPFFGGEERTEAEIQLDPGYIVSIARTDWLWRAFLPEGADRDHGA  258

Query  388   CNLENDRELSVGEWLRFPAALVFVAGKDFLKERGVMYAEFLRRKG  254
              N+  +    + E   FPA LVFV G D LK+    Y ++L++ G
Sbjct  259   ANVSGENAEEISELEEFPATLVFVGGFDPLKDWQRRYYDWLKKNG  303



>ref|XP_009127658.1| PREDICTED: probable carboxylesterase 6 [Brassica rapa]
 ref|XP_009112886.1| PREDICTED: probable carboxylesterase 6 [Brassica rapa]
Length=337

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 110/285 (39%), Positives = 151/285 (53%), Gaps = 24/285 (8%)
 Frame = -2

Query  1120  FHPQNTQISNLQKMSIIVDEAPGYIQVFSDGTVKRFSPEIATASAESTD-GFKSKDVVID  944
              +P NT I         +DE  G I+V+ DG V+RF        +   D      DV ID
Sbjct  12    INPTNTNIHGPA-----IDEVDGLIRVYKDGHVERFQLVPCVGPSLPLDLAVACSDVHID  66

Query  943   PSKPITGRIFVPDL-WPEKEQVELLPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksv  767
                 +  R++VP +          LP+L+YFH GGFCVGS +W  YH FL RLS  S+ +
Sbjct  67    ELTNVWARLYVPTVTKSLSVSSSKLPLLVYFHDGGFCVGSASWSCYHEFLARLSASSRCI  126

Query  766   vvsVDYRLAPENKLPIAYEDCYAALEWVQKNQKAEPCLESADLSRVFLAGDSAGGNIVHQ  587
             ++SV+YRLAPEN LP AYED   A+ W++K +      +  D  ++FL GDSAGGNI + 
Sbjct  127   IMSVNYRLAPENPLPAAYEDGVNAILWLKKTRNDNLWSKLCDFGKIFLTGDSAGGNIANH  186

Query  586   VAKKCLQDGNCAA---KIKGIMPIHPYFGSERRTAAEVAAEGSTGSSV---AMNDMFWRL  425
             VA + LQ  +      KI+G + I P+FG E RT +E   E +  SSV   A +D +WRL
Sbjct  187   VAAR-LQAVDALIQPLKIEGTILIQPFFGGEARTESERRVENNMKSSVLTLAASDAWWRL  245

Query  424   SLPEGSNRDFYGCNLENDRELSVGEWLRFPAALVFVAGKDFLKER  290
             +LP G+NR+   C     +  +          LV VA  D L +R
Sbjct  246   ALPRGANREHPYCKPAKSKTRT----------LVCVAEMDVLMDR  280



>ref|XP_009107422.1| PREDICTED: probable carboxylesterase 2 [Brassica rapa]
Length=314

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 104/264 (39%), Positives = 144/264 (55%), Gaps = 13/264 (5%)
 Frame = -2

Query  1051  YIQVFSDGTVKRFS-PEIATASAESTDGFKSKDVVIDPSKPITGRIFVPDLWPEKEQVEL  875
             ++ V SDGT++R +  E+     +   G  SKD++IDP   ++ RI+ PD     +  + 
Sbjct  15    WLVVHSDGTLERLAGTEVCPPGLDPETGVLSKDIIIDPKTGLSARIYRPD---SIQPGQK  71

Query  874   LPVLLYFHGGGFCVGSTTWVGYHLFLGRLsvqsksvvvsVDYRLAPENKLPIAYEDCYAA  695
             LPV+LYFHGG F + S +   YH  + +L  Q+  + VSV+YRLAPE+ LP AYED + A
Sbjct  72    LPVVLYFHGGAFLIASASLPNYHTSINKLVAQANIIAVSVNYRLAPEHPLPTAYEDSWNA  131

Query  694   LEWVQKNQKAEPCL-ESADLSRVFLAGDSAGGNIVHQVAKKCLQDGNCAAKIKGIMPIHP  518
             L+ VQ     EP + + AD ++ FLAGDSAG NI H +A +  Q  N   KIKGI  IHP
Sbjct  132   LQGVQAGN--EPWINDYADFNQFFLAGDSAGANISHHLAFRAKQ-SNHTVKIKGIGMIHP  188

Query  517   YFGSERRTAAEVAAEGSTGSSVAMNDMFWRLSLPEGSNRDFYGCNLENDRELSVGEWLRF  338
             YF   +   +EV  E        M D +WR   P     D    N   D   ++ E L  
Sbjct  189   YFWGTQPVGSEVTDEARK----QMVDGWWRFVCPSDKGSDDPWINPFADGSPNL-EGLEC  243

Query  337   PAALVFVAGKDFLKERGVMYAEFL  266
                ++ VA +D L+ERG MY E L
Sbjct  244   ERVIITVAERDILRERGKMYYEKL  267



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2689904046432