BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c28449_g1_i1 len=657 path=[635:0-656]

Length=657
                                                                      Score     E

ref|XP_009630090.1|  PREDICTED: early nodulin-93-like                   125   4e-33   
ref|XP_009773355.1|  PREDICTED: early nodulin-93-like                   124   2e-32   
ref|XP_009630092.1|  PREDICTED: early nodulin-93-like                   123   4e-32   
emb|CDP10372.1|  unnamed protein product                                123   7e-32   
ref|XP_009773354.1|  PREDICTED: early nodulin-93-like                   122   9e-32   
ref|XP_002313673.1|  hypothetical protein POPTR_0009s14600g             122   1e-31   Populus trichocarpa [western balsam poplar]
ref|XP_007013365.1|  Early nodulin-93                                   121   4e-31   
ref|XP_007013368.1|  Early nodulin-93 isoform 1                         121   4e-31   
gb|KHG12433.1|  Early nodulin-93                                        120   5e-31   
ref|XP_002305557.1|  hypothetical protein POPTR_0004s19470g             120   6e-31   Populus trichocarpa [western balsam poplar]
ref|XP_009620110.1|  PREDICTED: early nodulin-93-like                   120   7e-31   
ref|XP_011092415.1|  PREDICTED: early nodulin-93-like                   120   9e-31   
ref|XP_010250010.1|  PREDICTED: early nodulin-93-like                   120   1e-30   
ref|XP_011087860.1|  PREDICTED: early nodulin-93-like                   119   1e-30   
ref|XP_010250013.1|  PREDICTED: early nodulin-93-like                   119   2e-30   
ref|XP_002524454.1|  Early nodulin, putative                            119   2e-30   Ricinus communis
ref|XP_009403396.1|  PREDICTED: early nodulin-93-like                   119   2e-30   
ref|XP_011046280.1|  PREDICTED: early nodulin-93-like                   119   2e-30   
gb|EYU18492.1|  hypothetical protein MIMGU_mgv1a016647mg                119   2e-30   
ref|XP_008792075.1|  PREDICTED: early nodulin-93-like isoform X2        119   3e-30   
ref|XP_009391602.1|  PREDICTED: early nodulin-93-like isoform X2        118   3e-30   
gb|KHG12431.1|  Early nodulin-93                                        118   4e-30   
gb|ABN47005.1|  early nodulin 93 protein                                118   4e-30   Populus alba x Populus glandulosa
ref|XP_011045025.1|  PREDICTED: early nodulin-93-like                   117   1e-29   
ref|NP_001238685.1|  uncharacterized protein LOC100306683               117   2e-29   
gb|KDP32914.1|  hypothetical protein JCGZ_13695                         117   2e-29   
ref|XP_010254343.1|  PREDICTED: early nodulin-93-like                   117   2e-29   
ref|XP_010250017.1|  PREDICTED: early nodulin-93-like isoform X2        116   3e-29   
dbj|BAF63494.1|  nodule protein Dg93-like protein                       115   3e-29   Potamogeton distinctus
ref|XP_006450983.1|  hypothetical protein CICLE_v10009984mg             116   3e-29   
ref|XP_009403394.1|  PREDICTED: early nodulin-93-like                   116   3e-29   
ref|XP_007202786.1|  hypothetical protein PRUPE_ppa013711mg             115   6e-29   
ref|XP_010254480.1|  PREDICTED: early nodulin-93-like                   115   6e-29   
ref|XP_010250016.1|  PREDICTED: early nodulin-93-like isoform X1        115   6e-29   
ref|XP_008775025.1|  PREDICTED: early nodulin-93-like                   115   7e-29   
ref|XP_008809696.1|  PREDICTED: early nodulin-93-like                   115   7e-29   
ref|XP_006364894.1|  PREDICTED: early nodulin-93-like                   115   7e-29   
gb|KHN27413.1|  Early nodulin-93                                        114   1e-28   
ref|XP_006475805.1|  PREDICTED: early nodulin-93-like                   114   1e-28   
ref|XP_004251567.1|  PREDICTED: early nodulin-93-like                   114   2e-28   
ref|XP_004287357.1|  PREDICTED: early nodulin-93-like                   114   3e-28   
ref|XP_010909459.1|  PREDICTED: early nodulin-93-like                   113   3e-28   
ref|XP_003609265.1|  Early nodulin 93 protein                           113   3e-28   
ref|XP_010250015.1|  PREDICTED: early nodulin-93-like                   113   3e-28   
ref|NP_001240002.1|  uncharacterized protein LOC100820292               113   3e-28   
ref|XP_010254344.1|  PREDICTED: early nodulin-93-like                   113   4e-28   
ref|XP_010047806.1|  PREDICTED: early nodulin-93-like                   112   8e-28   
ref|XP_006364907.1|  PREDICTED: early nodulin-93-like                   112   9e-28   
ref|XP_009368814.1|  PREDICTED: early nodulin-93-like                   112   1e-27   
gb|AFK44884.1|  unknown                                                 112   1e-27   
ref|XP_003524537.2|  PREDICTED: early nodulin-93-like                   113   1e-27   
ref|XP_010914914.1|  PREDICTED: early nodulin-93-like                   112   1e-27   
ref|XP_004251574.1|  PREDICTED: early nodulin-93-like                   111   2e-27   
ref|XP_006842815.1|  hypothetical protein AMTR_s00081p00057480          112   2e-27   
ref|XP_010250012.1|  PREDICTED: early nodulin-93-like isoform X2        111   2e-27   
ref|NP_001237669.1|  early nodulin-93                                   111   2e-27   
ref|XP_010250011.1|  PREDICTED: early nodulin-93-like isoform X1        110   4e-27   
ref|XP_010047807.1|  PREDICTED: early nodulin-93-like                   110   7e-27   
ref|XP_010039608.1|  PREDICTED: early nodulin-93-like                   110   8e-27   
gb|ACU16453.1|  unknown                                                 110   8e-27   Glycine max [soybeans]
gb|AIE16049.1|  early nodulin 93 protein                                109   9e-27   
ref|XP_004508526.1|  PREDICTED: early nodulin-93-like                   109   9e-27   
ref|XP_009392935.1|  PREDICTED: early nodulin-93-like                   108   2e-26   
ref|XP_010039609.1|  PREDICTED: early nodulin-93-like                   108   3e-26   
ref|XP_010047808.1|  PREDICTED: early nodulin-93-like                   108   3e-26   
ref|XP_004964506.1|  PREDICTED: early nodulin-93-like                   108   6e-26   
ref|XP_002437802.1|  hypothetical protein SORBIDRAFT_10g002820          107   6e-26   Sorghum bicolor [broomcorn]
ref|XP_010100940.1|  hypothetical protein L484_005949                   107   6e-26   
ref|XP_004964505.1|  PREDICTED: early nodulin-93-like                   107   9e-26   
ref|XP_010688053.1|  PREDICTED: early nodulin-93-like                   106   1e-25   
ref|XP_007154975.1|  hypothetical protein PHAVU_003G162200g             106   2e-25   
ref|XP_008658093.1|  PREDICTED: uncharacterized protein LOC100193...    106   2e-25   
gb|ACG31347.1|  early nodulin 93                                        106   2e-25   Zea mays [maize]
gb|ACG23914.1|  early nodulin 93                                        106   2e-25   Zea mays [maize]
ref|XP_002436449.1|  hypothetical protein SORBIDRAFT_10g002900          106   2e-25   Sorghum bicolor [broomcorn]
gb|ACG24704.1|  early nodulin 93                                        106   2e-25   Zea mays [maize]
gb|ACG45703.1|  early nodulin 93                                        106   3e-25   Zea mays [maize]
ref|NP_001131809.1|  uncharacterized protein LOC100193182               106   3e-25   Zea mays [maize]
ref|XP_002285052.1|  PREDICTED: early nodulin-93                        105   3e-25   Vitis vinifera
ref|XP_002437803.1|  hypothetical protein SORBIDRAFT_10g002830          105   3e-25   Sorghum bicolor [broomcorn]
ref|XP_002436448.1|  hypothetical protein SORBIDRAFT_10g002890          105   4e-25   Sorghum bicolor [broomcorn]
ref|NP_001147053.1|  early nodulin 93                                   105   4e-25   Zea mays [maize]
gb|AAD28359.1|AF084573_1  root-nodule protein Dg93                      105   4e-25   Datisca glomerata
ref|XP_004964504.1|  PREDICTED: early nodulin-93-like                   105   4e-25   
ref|XP_004964509.1|  PREDICTED: early nodulin-93-like                   105   6e-25   
ref|XP_007138316.1|  hypothetical protein PHAVU_009G198400g             105   7e-25   
gb|EMT32242.1|  hypothetical protein F775_18516                         104   7e-25   
dbj|BAA83559.1|  putative early nodulin                                 104   9e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006655776.1|  PREDICTED: early nodulin-93-like                   104   1e-24   
ref|XP_002437807.1|  hypothetical protein SORBIDRAFT_10g002880          104   1e-24   Sorghum bicolor [broomcorn]
ref|XP_007013369.1|  Early nodulin-93 isoform 2                         103   1e-24   
gb|ABL85058.1|  early nodulin protein                                   103   2e-24   Brachypodium sylvaticum
ref|XP_003557202.1|  PREDICTED: early nodulin-93-like                   103   2e-24   
ref|XP_008659310.1|  PREDICTED: uncharacterized protein LOC103638099    106   2e-24   
ref|XP_006364908.1|  PREDICTED: early nodulin-93-like                   103   3e-24   
ref|XP_010049972.1|  PREDICTED: early nodulin-93-like                   102   3e-24   
ref|XP_010533179.1|  PREDICTED: early nodulin-93-like                   103   3e-24   
gb|EMS61130.1|  hypothetical protein TRIUR3_21694                       102   5e-24   
gb|EMT32241.1|  hypothetical protein F775_18515                         102   5e-24   
ref|NP_001056762.1|  Os06g0141700                                       102   5e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003524536.1|  PREDICTED: early nodulin-93-like                   102   7e-24   
ref|XP_010688054.1|  PREDICTED: early nodulin-93-like                   103   7e-24   
ref|XP_003557201.1|  PREDICTED: early nodulin-93-like                   102   8e-24   
gb|EEE65062.1|  hypothetical protein OsJ_20076                          103   8e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008385798.1|  PREDICTED: early nodulin-93-like                   101   1e-23   
ref|XP_006655775.1|  PREDICTED: early nodulin-93-like                   101   2e-23   
dbj|BAK07913.1|  predicted protein                                      101   2e-23   
ref|NP_001056768.1|  Os06g0142400                                       100   3e-23   Oryza sativa Japonica Group [Japonica rice]
dbj|BAA83567.1|  putative early nodulin                                 100   3e-23   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056766.2|  Os06g0142200                                       100   3e-23   Oryza sativa Japonica Group [Japonica rice]
gb|AAD30134.1|AF140229_1  early nodulin                                 101   3e-23   Oryza sativa [red rice]
gb|ABL85059.1|  early nodulin protein                                   100   5e-23   Brachypodium sylvaticum
ref|NP_001174593.1|  Os06g0142350                                       101   5e-23   
dbj|BAK06178.1|  predicted protein                                      100   6e-23   
ref|XP_004167345.1|  PREDICTED: early nodulin-93-like                 99.8    7e-23   
ref|XP_004139321.1|  PREDICTED: early nodulin-93-like                 99.8    7e-23   
ref|XP_008457774.1|  PREDICTED: early nodulin-93-like                   100   8e-23   
ref|XP_006655774.1|  PREDICTED: early nodulin-93-like                 99.4    1e-22   
ref|NP_001056767.2|  Os06g0142300                                     99.4    1e-22   Oryza sativa Japonica Group [Japonica rice]
gb|EMT32244.1|  hypothetical protein F775_30863                       99.0    1e-22   
ref|XP_010688052.1|  PREDICTED: early nodulin-93-like                 99.0    1e-22   
ref|XP_004964510.1|  PREDICTED: early nodulin-93-like                 99.0    1e-22   
ref|XP_008390004.1|  PREDICTED: early nodulin-93-like                 97.8    1e-22   
gb|EAZ35790.1|  hypothetical protein OsJ_20082                        99.4    1e-22   Oryza sativa Japonica Group [Japonica rice]
gb|EEC79963.1|  hypothetical protein OsI_21579                        99.0    2e-22   Oryza sativa Indica Group [Indian rice]
gb|EMT29548.1|  hypothetical protein F775_15200                       98.6    2e-22   
gb|ACH58421.1|  nodulin 93                                            95.5    6e-22   Prunus dulcis [sweet almond]
gb|EMS50054.1|  hypothetical protein TRIUR3_13855                     97.1    8e-22   
ref|XP_002437804.1|  hypothetical protein SORBIDRAFT_10g002850        96.7    1e-21   Sorghum bicolor [broomcorn]
ref|XP_008337324.1|  PREDICTED: early nodulin-93-like                 94.0    2e-21   
ref|NP_001145575.1|  uncharacterized protein LOC100279040             95.5    3e-21   Zea mays [maize]
gb|EMT32240.1|  hypothetical protein F775_30861                       95.9    3e-21   
gb|AFW75469.1|  hypothetical protein ZEAMMB73_751741                  94.0    1e-20   
ref|XP_004964508.1|  PREDICTED: early nodulin-93-like                 93.6    1e-20   
gb|EMS67158.1|  hypothetical protein TRIUR3_21254                     92.4    2e-20   
ref|XP_002437805.1|  hypothetical protein SORBIDRAFT_10g002860        93.2    2e-20   Sorghum bicolor [broomcorn]
gb|EAY99605.1|  hypothetical protein OsI_21583                        93.6    2e-20   Oryza sativa Indica Group [Indian rice]
gb|EMT32243.1|  hypothetical protein F775_30862                       91.3    5e-20   
gb|EMT32245.1|  hypothetical protein F775_08718                       89.7    2e-19   
gb|KHN27414.1|  Early nodulin-93                                      89.0    2e-19   
ref|XP_010250018.1|  PREDICTED: early nodulin-93-like isoform X1      89.4    4e-19   
gb|EMS50053.1|  hypothetical protein TRIUR3_13854                     88.6    7e-19   
gb|EMS50052.1|  hypothetical protein TRIUR3_13853                     88.6    1e-18   
gb|ACG48865.1|  early nodulin 93                                      87.4    3e-18   Zea mays [maize]
gb|ACG24380.1|  early nodulin 93                                      85.5    1e-17   Zea mays [maize]
gb|EMT29547.1|  hypothetical protein F775_24367                       86.3    1e-17   
gb|EAZ35784.1|  hypothetical protein OsJ_20075                        84.7    2e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004964507.1|  PREDICTED: early nodulin-93-like                 85.1    2e-17   
ref|NP_001056761.1|  Os06g0141600                                     84.3    7e-17   Oryza sativa Japonica Group [Japonica rice]
gb|EMS61159.1|  hypothetical protein TRIUR3_18822                     81.6    2e-16   
gb|EMS35732.1|  hypothetical protein TRIUR3_26870                     79.0    1e-15   
ref|XP_004148399.1|  PREDICTED: early nodulin-93-like                 80.5    1e-15   
ref|XP_008444985.1|  PREDICTED: early nodulin-93-like                 78.6    5e-15   
gb|EMS61131.1|  hypothetical protein TRIUR3_21695                     77.4    8e-15   
ref|XP_002525450.1|  Early nodulin, putative                          77.4    1e-14   Ricinus communis
ref|XP_006288877.1|  hypothetical protein CARUB_v10002236mg           77.0    2e-14   
gb|KDP20271.1|  hypothetical protein JCGZ_06857                       76.3    4e-14   
ref|XP_004498454.1|  PREDICTED: early nodulin-93-like                 75.9    5e-14   
ref|XP_007012195.1|  Early nodulin-93, putative                       75.9    5e-14   
ref|XP_010249474.1|  PREDICTED: early nodulin-93-like                 75.5    6e-14   
gb|AFK36825.1|  unknown                                               75.5    6e-14   
gb|AFW85923.1|  hypothetical protein ZEAMMB73_318061                  73.9    7e-14   
ref|XP_010421449.1|  PREDICTED: early nodulin-93-like                 75.1    8e-14   
gb|KHG21336.1|  Early nodulin-93                                      75.1    9e-14   
ref|XP_003588448.1|  Enod93 protein                                   75.1    9e-14   
ref|XP_006853715.1|  hypothetical protein AMTR_s00056p00156190        73.9    2e-13   
ref|NP_001235239.1|  uncharacterized protein LOC100500499             73.9    2e-13   
gb|EPS65341.1|  hypothetical protein M569_09436                       73.6    2e-13   
ref|XP_002325832.2|  hypothetical protein POPTR_0019s04930g           73.9    3e-13   Populus trichocarpa [western balsam poplar]
ref|XP_006366687.1|  PREDICTED: early nodulin-93-like                 73.6    3e-13   
ref|XP_009796123.1|  PREDICTED: early nodulin-93                      73.2    3e-13   
ref|XP_011010128.1|  PREDICTED: early nodulin-93-like                 73.6    3e-13   
ref|NP_197966.1|  early nodulin-related protein                       73.2    4e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009602784.1|  PREDICTED: early nodulin-93                      73.2    4e-13   
ref|XP_010047293.1|  PREDICTED: early nodulin-93                      73.2    4e-13   
gb|AAM63333.1|  nodulin-like protein                                  73.2    4e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009129938.1|  PREDICTED: early nodulin-93                      73.2    4e-13   
ref|XP_010325064.1|  PREDICTED: early nodulin-93                      73.2    4e-13   
gb|EAY99599.1|  hypothetical protein OsI_21577                        72.8    5e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_004291153.1|  PREDICTED: early nodulin-93-like                 73.2    5e-13   
gb|AFK35976.1|  unknown                                               72.0    1e-12   
ref|XP_011081751.1|  PREDICTED: early nodulin-93-like                 71.2    1e-12   
ref|XP_011081738.1|  PREDICTED: early nodulin-93-like isoform X2      72.4    1e-12   
emb|CDY05336.1|  BnaC02g40440D                                        71.6    1e-12   
gb|AFR46651.1|  ENOD93-like protein                                   71.2    2e-12   
emb|CDP08196.1|  unnamed protein product                              71.2    2e-12   
ref|XP_004517223.1|  PREDICTED: early nodulin-93-like                 70.5    2e-12   
ref|XP_007161502.1|  hypothetical protein PHAVU_001G074600g           71.2    2e-12   
ref|XP_006394840.1|  hypothetical protein EUTSA_v10005156mg           71.2    2e-12   
gb|ADE77942.1|  unknown                                               71.2    3e-12   
emb|CAB65283.1|  Enod93 protein                                       70.9    3e-12   Medicago sativa subsp. x varia
ref|XP_002874285.1|  hypothetical protein ARALYDRAFT_910661           70.5    3e-12   
ref|XP_008220129.1|  PREDICTED: early nodulin-93-like                 70.1    5e-12   
ref|XP_007225829.1|  hypothetical protein PRUPE_ppa011550mg           70.9    9e-12   
gb|EYU20409.1|  hypothetical protein MIMGU_mgv1a023606mg              67.8    1e-11   
gb|EPS59458.1|  hypothetical protein M569_15348                       68.2    2e-11   
ref|XP_010495507.1|  PREDICTED: uncharacterized protein LOC104772610  68.9    2e-11   
ref|XP_010668768.1|  PREDICTED: early nodulin-93-like                 68.2    2e-11   
ref|XP_008799774.1|  PREDICTED: early nodulin-93-like                 68.2    2e-11   
emb|CAN71779.1|  hypothetical protein VITISV_015688                   67.8    3e-11   Vitis vinifera
ref|XP_010914922.1|  PREDICTED: early nodulin-93-like                 67.8    3e-11   
gb|AFK34546.1|  unknown                                               67.8    3e-11   
gb|KEH36097.1|  early nodulin 93                                      67.8    3e-11   
gb|AFK33958.1|  unknown                                               67.8    4e-11   
gb|KHG26243.1|  Early nodulin-93                                      67.4    5e-11   
ref|XP_010536217.1|  PREDICTED: early nodulin-93                      67.0    5e-11   
ref|XP_011081737.1|  PREDICTED: uncharacterized protein LOC105164...  67.8    7e-11   
ref|XP_006475988.1|  PREDICTED: early nodulin-93-like isoform X1      65.1    3e-10   
ref|XP_009415371.1|  PREDICTED: early nodulin-93-like                 65.1    3e-10   
ref|XP_008357372.1|  PREDICTED: early nodulin-93-like                 64.7    3e-10   
ref|XP_009350245.1|  PREDICTED: early nodulin-93-like                 64.7    4e-10   
gb|ABQ42021.1|  Enod93 protein                                        63.9    4e-10   Sonneratia alba
gb|ACG23999.1|  early nodulin 93                                      63.5    7e-10   Zea mays [maize]
ref|NP_001150497.1|  early nodulin 93                                 63.5    7e-10   Zea mays [maize]
ref|XP_002453560.1|  hypothetical protein SORBIDRAFT_04g008090        63.5    7e-10   Sorghum bicolor [broomcorn]
ref|XP_008804878.1|  PREDICTED: uncharacterized protein LOC103718...  64.3    8e-10   
ref|XP_010917653.1|  PREDICTED: early nodulin-93-like isoform X1      64.3    9e-10   
ref|XP_004951404.1|  PREDICTED: early nodulin-93-like                 63.2    1e-09   
dbj|BAJ94955.1|  predicted protein                                    62.8    1e-09   
gb|EMT24869.1|  hypothetical protein F775_32597                       62.0    2e-09   
gb|EMT14561.1|  hypothetical protein F775_30178                       62.0    3e-09   
gb|EMS46857.1|  hypothetical protein TRIUR3_07600                     62.4    3e-09   
gb|ABQ42024.1|  Enod93 protein                                        61.6    3e-09   Sonneratia apetala
ref|XP_001761950.1|  predicted protein                                61.2    3e-09   
gb|AFW75468.1|  hypothetical protein ZEAMMB73_751741                  61.2    4e-09   
ref|NP_001046351.1|  Os02g0227200                                     61.2    4e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006647086.1|  PREDICTED: early nodulin-93-like                 60.5    8e-09   
ref|XP_002532958.1|  hypothetical protein RCOM_0639430                59.3    1e-08   Ricinus communis
ref|XP_003571774.1|  PREDICTED: early nodulin-93                      59.3    2e-08   
ref|NP_001056760.1|  Os06g0141400                                     58.9    4e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001780085.1|  predicted protein                                56.2    2e-07   
ref|XP_002275030.1|  PREDICTED: early nodulin-93                      55.1    8e-07   Vitis vinifera
gb|KDP32369.1|  hypothetical protein JCGZ_13294                       39.3    1e-05   
gb|ACN36680.1|  unknown                                               51.2    3e-05   Zea mays [maize]



>ref|XP_009630090.1| PREDICTED: early nodulin-93-like [Nicotiana tomentosiformis]
Length=96

 Score =   125 bits (315),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +2

Query  143  AKNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTA  322
            AKNVSLAS+DQKLAMAKR SHEGVVAGAKAAV AT+ATAIPTLA  +M+PWARANLNPTA
Sbjct  2    AKNVSLASVDQKLAMAKRCSHEGVVAGAKAAVVATVATAIPTLACGKMLPWARANLNPTA  61

Query  323  QALIVSTAAGMAYFIVADKTILATARRNSFKNGS  424
            +ALI+STAAGMAYFIVADKTILATAR+NSFK G+
Sbjct  62   KALIISTAAGMAYFIVADKTILATARQNSFKQGN  95



>ref|XP_009773355.1| PREDICTED: early nodulin-93-like [Nicotiana sylvestris]
Length=96

 Score =   124 bits (311),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +2

Query  143  AKNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTA  322
            AKNVSLAS+DQKLAMAKR SHEGVVAGAKAAV AT+ATAIPTLA  +M+PWARANLNPTA
Sbjct  2    AKNVSLASVDQKLAMAKRCSHEGVVAGAKAAVVATVATAIPTLACGKMLPWARANLNPTA  61

Query  323  QALIVSTAAGMAYFIVADKTILATARRNSFKNGS  424
            +ALIVSTAAGMAYFIVADKTILA AR+NSFK G+
Sbjct  62   KALIVSTAAGMAYFIVADKTILAAARQNSFKQGN  95



>ref|XP_009630092.1| PREDICTED: early nodulin-93-like [Nicotiana tomentosiformis]
Length=94

 Score =   123 bits (308),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  AKNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTA  322
            AKNVSLAS+DQKLAMAKR SHEGVVAGAKAAV AT+ATAIPTLA  +  PWARANLNPTA
Sbjct  2    AKNVSLASVDQKLAMAKRCSHEGVVAGAKAAVIATVATAIPTLACGKKSPWARANLNPTA  61

Query  323  QALIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            +ALIVSTAAGMAYFIVADKTILATAR+NSFK G
Sbjct  62   KALIVSTAAGMAYFIVADKTILATARQNSFKQG  94



>emb|CDP10372.1| unnamed protein product [Coffea canephora]
Length=109

 Score =   123 bits (308),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 88/108 (81%), Gaps = 10/108 (9%)
 Frame = +2

Query  140  AAKNV---------SLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVP  292
            AAKNV         SLASLD KLAMAKR SHEGVVAGAKAA  A+IATAIPTLAS RMVP
Sbjct  3    AAKNVAQSPLERSCSLASLDHKLAMAKRCSHEGVVAGAKAAAVASIATAIPTLASARMVP  62

Query  293  WARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSFKNGSVSGN  436
            WARANLNPTAQALIVST AGMAYFIVADKT+LATARRNSF N   S N
Sbjct  63   WARANLNPTAQALIVSTVAGMAYFIVADKTVLATARRNSF-NRQTSNN  109



>ref|XP_009773354.1| PREDICTED: early nodulin-93-like [Nicotiana sylvestris]
Length=94

 Score =   122 bits (306),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 81/91 (89%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = +2

Query  143  AKNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTA  322
            AKNVSLAS+DQKLAMAKR SHEGVVAGAKAAV AT+ATAIPTLA  +M PWARANLNPTA
Sbjct  2    AKNVSLASVDQKLAMAKRCSHEGVVAGAKAAVVATVATAIPTLAFGKMSPWARANLNPTA  61

Query  323  QALIVSTAAGMAYFIVADKTILATARRNSFK  415
            +ALIVSTAAGMAYFIVADKTILATAR+NSFK
Sbjct  62   KALIVSTAAGMAYFIVADKTILATARQNSFK  92



>ref|XP_002313673.1| hypothetical protein POPTR_0009s14600g [Populus trichocarpa]
 gb|EEE87628.1| hypothetical protein POPTR_0009s14600g [Populus trichocarpa]
Length=109

 Score =   122 bits (307),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/92 (86%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +2

Query  155  SLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALI  334
            SLASLDQKLAMAKR SHEGVVAGAKAA  ATIATAIPTLAS RM+PWARANLNPTAQALI
Sbjct  15   SLASLDQKLAMAKRCSHEGVVAGAKAAALATIATAIPTLASARMLPWARANLNPTAQALI  74

Query  335  VSTAAGMAYFIVADKTILATARRNSFKNGSVS  430
            +ST AG AYFIVADKT+LATAR+NSFK+ S S
Sbjct  75   ISTVAGAAYFIVADKTVLATARKNSFKSRSSS  106



>ref|XP_007013365.1| Early nodulin-93 [Theobroma cacao]
 gb|EOY30984.1| Early nodulin-93 [Theobroma cacao]
Length=103

 Score =   121 bits (303),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +2

Query  143  AKNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTA  322
            A++ +LASLDQKLAMAKR SHEGV+AGAKAAV A+IATAIPTLASVRM+PWARANLN TA
Sbjct  6    AQSATLASLDQKLAMAKRCSHEGVLAGAKAAVVASIATAIPTLASVRMLPWARANLNHTA  65

Query  323  QALIVSTAAGMAYFIVADKTILATARRNSFKN  418
            QALI+ST AG AYFIVADKT+LATAR+NSFK+
Sbjct  66   QALIISTVAGAAYFIVADKTVLATARKNSFKH  97



>ref|XP_007013368.1| Early nodulin-93 isoform 1 [Theobroma cacao]
 gb|EOY30987.1| Early nodulin-93 isoform 1 [Theobroma cacao]
Length=103

 Score =   121 bits (303),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +2

Query  143  AKNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTA  322
            A++ +LASLDQKLAMAKR SHEGV+AGAKAAV A+IATAIPTLASVRM+PWARANLN TA
Sbjct  6    AQSATLASLDQKLAMAKRCSHEGVLAGAKAAVVASIATAIPTLASVRMLPWARANLNHTA  65

Query  323  QALIVSTAAGMAYFIVADKTILATARRNSFKN  418
            QALI+ST AG AYFIVADKT+LATAR+NSFK+
Sbjct  66   QALIISTVAGAAYFIVADKTVLATARKNSFKH  97



>gb|KHG12433.1| Early nodulin-93 [Gossypium arboreum]
Length=103

 Score =   120 bits (302),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  AKNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTA  322
            A++ +LASLDQKLAMAKR SHEGVVAGAKAAV ATIATAIPTLASVRM+PWARANLN TA
Sbjct  6    AQSATLASLDQKLAMAKRCSHEGVVAGAKAAVVATIATAIPTLASVRMLPWARANLNHTA  65

Query  323  QALIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            QALI+STAAG AYFIVADKT+LATAR+NSFK  
Sbjct  66   QALIISTAAGAAYFIVADKTVLATARKNSFKQA  98



>ref|XP_002305557.1| hypothetical protein POPTR_0004s19470g [Populus trichocarpa]
 gb|ABK94914.1| unknown [Populus trichocarpa]
 gb|EEE86068.1| hypothetical protein POPTR_0004s19470g [Populus trichocarpa]
Length=109

 Score =   120 bits (302),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 87/97 (90%), Gaps = 2/97 (2%)
 Frame = +2

Query  155  SLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALI  334
            SLASLDQKLAMAKR SHEGVVAGAKAAV ATIATAIPT+AS RM+PWARANLN TAQALI
Sbjct  15   SLASLDQKLAMAKRCSHEGVVAGAKAAVLATIATAIPTMASARMLPWARANLNHTAQALI  74

Query  335  VSTAAGMAYFIVADKTILATARRNSFKNGSVSGNIQA  445
            +ST AG AYFIVADKT+LATAR+NSFK  S S NI+A
Sbjct  75   ISTVAGAAYFIVADKTVLATARKNSFK--SPSSNIEA  109



>ref|XP_009620110.1| PREDICTED: early nodulin-93-like [Nicotiana tomentosiformis]
Length=101

 Score =   120 bits (301),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +2

Query  143  AKNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTA  322
            AKNVSLAS+DQKLAMAKR SHEGVVAGAKAAV A++ATAIPTLA  +M PWARANLNPTA
Sbjct  2    AKNVSLASVDQKLAMAKRCSHEGVVAGAKAAVVASVATAIPTLACGKMSPWARANLNPTA  61

Query  323  QALIVSTAAGMAYFIVADKTILATARRNSF  412
            +ALIVSTAAGMAYFIVADKT+LATAR+NSF
Sbjct  62   KALIVSTAAGMAYFIVADKTVLATARQNSF  91



>ref|XP_011092415.1| PREDICTED: early nodulin-93-like [Sesamum indicum]
Length=107

 Score =   120 bits (300),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 76/87 (87%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +2

Query  155  SLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALI  334
            +LASLDQKLA AKR SHEGVVAGAKAAV AT+A AIPTLAS RMVPWARANLNPTAQALI
Sbjct  13   TLASLDQKLASAKRCSHEGVVAGAKAAVVATVAAAIPTLASARMVPWARANLNPTAQALI  72

Query  335  VSTAAGMAYFIVADKTILATARRNSFK  415
            +ST  GMAYFIVADKT+LATARRNSFK
Sbjct  73   ISTVGGMAYFIVADKTVLATARRNSFK  99



>ref|XP_010250010.1| PREDICTED: early nodulin-93-like [Nelumbo nucifera]
Length=107

 Score =   120 bits (300),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 84/95 (88%), Gaps = 3/95 (3%)
 Frame = +2

Query  158  LASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIV  337
            LASLDQKLA+AKR S EGV+AG KAA  ATIATAIPTLASVRM+PWARANLNPTAQALI+
Sbjct  15   LASLDQKLALAKRCSREGVMAGMKAAAVATIATAIPTLASVRMLPWARANLNPTAQALII  74

Query  338  STAAGMAYFIVADKTILATARRNSFKNGSVSGNIQ  442
            ST AG AYFIVADKT+LATARRNSFKN +   NIQ
Sbjct  75   STVAGSAYFIVADKTVLATARRNSFKNHT---NIQ  106



>ref|XP_011087860.1| PREDICTED: early nodulin-93-like [Sesamum indicum]
Length=105

 Score =   119 bits (299),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +2

Query  155  SLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALI  334
            +L SLDQKLA+AKR SHEGVVAGAKAAV ATIATAIPTLASVRMVPWA+ANLNPTAQALI
Sbjct  15   TLVSLDQKLALAKRCSHEGVVAGAKAAVVATIATAIPTLASVRMVPWAKANLNPTAQALI  74

Query  335  VSTAAGMAYFIVADKTILATARRNSF  412
            +ST AGMAYFIVADKT+LATARRNSF
Sbjct  75   ISTVAGMAYFIVADKTVLATARRNSF  100



>ref|XP_010250013.1| PREDICTED: early nodulin-93-like [Nelumbo nucifera]
Length=107

 Score =   119 bits (298),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 86/96 (90%), Gaps = 3/96 (3%)
 Frame = +2

Query  158  LASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIV  337
            LASLD KLA+AKR  HEGVVAGAKAAV ATIA+A+PTLASVRM+PWARA+LNPTAQALI+
Sbjct  15   LASLDHKLALAKRCGHEGVVAGAKAAVLATIASAVPTLASVRMLPWARAHLNPTAQALII  74

Query  338  STAAGMAYFIVADKTILATARRNSFKNGSVSGNIQA  445
            ST AG AYFIVADKT+LATARRNSFK+ S   NIQA
Sbjct  75   STVAGSAYFIVADKTVLATARRNSFKDYS---NIQA  107



>ref|XP_002524454.1| Early nodulin, putative [Ricinus communis]
 gb|EEF37894.1| Early nodulin, putative [Ricinus communis]
Length=108

 Score =   119 bits (298),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 86/100 (86%), Gaps = 3/100 (3%)
 Frame = +2

Query  146  KNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQ  325
            K  S+ASLDQKLAMAKR SHEGVVAGAKAAV A+IATAIPTLAS RM+PWARANLN TAQ
Sbjct  12   KTCSMASLDQKLAMAKRCSHEGVVAGAKAAVVASIATAIPTLASARMLPWARANLNHTAQ  71

Query  326  ALIVSTAAGMAYFIVADKTILATARRNSFKNGSVSGNIQA  445
            ALI+ST AG AYFIVADKT+LATARRNSFK      NI+A
Sbjct  72   ALIISTVAGAAYFIVADKTVLATARRNSFKQN---PNIEA  108



>ref|XP_009403396.1| PREDICTED: early nodulin-93-like [Musa acuminata subsp. malaccensis]
Length=96

 Score =   119 bits (297),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 84/92 (91%), Gaps = 1/92 (1%)
 Frame = +2

Query  161  ASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIVS  340
            A+LDQKLAMAKR SHEG +AGAKAAV A++A AIPTLASVRM+PWAR+NLNPTAQALI+S
Sbjct  4    AALDQKLAMAKRCSHEGAMAGAKAAVVASVAAAIPTLASVRMLPWARSNLNPTAQALIIS  63

Query  341  TAAGMAYFIVADKTILATARRNSFKNGSVSGN  436
            TAAG AYFIVADKT+LA+AR+NSFKN S  GN
Sbjct  64   TAAGAAYFIVADKTVLASARKNSFKN-SYQGN  94



>ref|XP_011046280.1| PREDICTED: early nodulin-93-like [Populus euphratica]
Length=109

 Score =   119 bits (298),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 86/97 (89%), Gaps = 2/97 (2%)
 Frame = +2

Query  155  SLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALI  334
            SLASLDQKLAMAKR SHEGVVAGAKAA  ATIATAIPT+AS RM+PWARANLN TAQALI
Sbjct  15   SLASLDQKLAMAKRCSHEGVVAGAKAAALATIATAIPTMASARMLPWARANLNHTAQALI  74

Query  335  VSTAAGMAYFIVADKTILATARRNSFKNGSVSGNIQA  445
            +ST AG AYFIVADKT+LATAR+NSFK  S S NI+A
Sbjct  75   ISTVAGAAYFIVADKTVLATARKNSFK--SPSSNIEA  109



>gb|EYU18492.1| hypothetical protein MIMGU_mgv1a016647mg [Erythranthe guttata]
Length=113

 Score =   119 bits (298),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/88 (84%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = +2

Query  161  ASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIVS  340
            ASL+QKLA+AKR SHEGV+AGAKAA  ATIATAIPT+ASVRM+PWARANLNPTAQALI+S
Sbjct  19   ASLEQKLALAKRCSHEGVMAGAKAAAVATIATAIPTMASVRMLPWARANLNPTAQALIIS  78

Query  341  TAAGMAYFIVADKTILATARRNSFKNGS  424
            T AGMAYFIVADKT+LATARRNSF  G+
Sbjct  79   TVAGMAYFIVADKTVLATARRNSFNGGA  106



>ref|XP_008792075.1| PREDICTED: early nodulin-93-like isoform X2 [Phoenix dactylifera]
Length=104

 Score =   119 bits (297),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +2

Query  137  MAAKNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNP  316
            M    V+L+SLDQKLAMAKR SHEGVVAGAKAA+ A+ A AIPTLASVRM+PWAR+NLN 
Sbjct  1    MKMGTVTLSSLDQKLAMAKRCSHEGVVAGAKAAIVASAAAAIPTLASVRMLPWARSNLNH  60

Query  317  TAQALIVSTAAGMAYFIVADKTILATARRNSFKNGSVSG  433
            TAQALI+ST AG AYFIVADKT+LA+AR+NSFK+   SG
Sbjct  61   TAQALIISTVAGAAYFIVADKTVLASARKNSFKDAHQSG  99



>ref|XP_009391602.1| PREDICTED: early nodulin-93-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=100

 Score =   118 bits (296),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 83/95 (87%), Gaps = 1/95 (1%)
 Frame = +2

Query  161  ASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIVS  340
            ASLDQKLAMAKR SHEGVVAGAKAAV A  A A+PTLASVR++PWAR NLNPTAQALIVS
Sbjct  7    ASLDQKLAMAKRCSHEGVVAGAKAAVVAGFAAAVPTLASVRILPWARYNLNPTAQALIVS  66

Query  341  TAAGMAYFIVADKTILATARRNSFKNGSVSGNIQA  445
            TAAGM+YFIVADKT+LA AR+NSFK+    GNI A
Sbjct  67   TAAGMSYFIVADKTVLAAARKNSFKDA-YPGNISA  100



>gb|KHG12431.1| Early nodulin-93 [Gossypium arboreum]
Length=103

 Score =   118 bits (296),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  AKNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTA  322
            A++ +LASLDQKLA+AKR SHEGVVAGAKAA+ ATIATAIPTLASVRM+PWA+ANLN TA
Sbjct  6    AQSATLASLDQKLALAKRCSHEGVVAGAKAAIVATIATAIPTLASVRMLPWAKANLNHTA  65

Query  323  QALIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            QALI+STAAG AYFIVADKT+LATAR+NSFK+ 
Sbjct  66   QALIISTAAGAAYFIVADKTVLATARKNSFKHA  98



>gb|ABN47005.1| early nodulin 93 protein [Populus alba x Populus glandulosa]
Length=109

 Score =   118 bits (296),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 86/97 (89%), Gaps = 2/97 (2%)
 Frame = +2

Query  155  SLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALI  334
            SLASLDQKLAMAKR SHEGVVAGAKAAV ATIATAIPT+AS RM+PWARANLN TAQALI
Sbjct  15   SLASLDQKLAMAKRCSHEGVVAGAKAAVLATIATAIPTMASARMLPWARANLNHTAQALI  74

Query  335  VSTAAGMAYFIVADKTILATARRNSFKNGSVSGNIQA  445
            +ST AG AYFIVADKT+LATAR+NSFK  S   NI+A
Sbjct  75   ISTVAGAAYFIVADKTVLATARKNSFK--SPRSNIEA  109



>ref|XP_011045025.1| PREDICTED: early nodulin-93-like [Populus euphratica]
Length=109

 Score =   117 bits (293),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +2

Query  155  SLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALI  334
            SLASLDQKLA+AKR SHEGVVAGAKAA  ATIATAIPTLAS RM+PWARANLN TAQALI
Sbjct  15   SLASLDQKLALAKRCSHEGVVAGAKAAALATIATAIPTLASARMLPWARANLNHTAQALI  74

Query  335  VSTAAGMAYFIVADKTILATARRNSFKNGSVS  430
            +ST AG AYFIVADKT+LATAR+NSFK+ S S
Sbjct  75   ISTVAGAAYFIVADKTVLATARKNSFKSRSTS  106



>ref|NP_001238685.1| uncharacterized protein LOC100306683 [Glycine max]
 gb|ACU14979.1| unknown [Glycine max]
 gb|KHN15116.1| Early nodulin-93 [Glycine soja]
Length=107

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +2

Query  146  KNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQ  325
            ++ SLASLDQKLAMAKR SHEG +AGAKAAVAATIATAIPTLASVRM+PWARANLN TAQ
Sbjct  13   ESTSLASLDQKLAMAKRCSHEGAMAGAKAAVAATIATAIPTLASVRMLPWARANLNHTAQ  72

Query  326  ALIVSTAAGMAYFIVADKTILATARRNSFKNGS  424
            ALI+ST AG AYFIVADKT+LATAR+NSF   S
Sbjct  73   ALIISTVAGAAYFIVADKTVLATARKNSFNRPS  105



>gb|KDP32914.1| hypothetical protein JCGZ_13695 [Jatropha curcas]
Length=108

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 86/100 (86%), Gaps = 3/100 (3%)
 Frame = +2

Query  146  KNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQ  325
            +  +LASLDQKLAMAKR SHEGVVAGAKAAV ATIATAIPTLAS RM+PWARANLN TAQ
Sbjct  12   EQTTLASLDQKLAMAKRCSHEGVVAGAKAAVMATIATAIPTLASARMLPWARANLNHTAQ  71

Query  326  ALIVSTAAGMAYFIVADKTILATARRNSFKNGSVSGNIQA  445
            ALI+ST AG AYFIVADKT+LATAR+NSF   S   NI+A
Sbjct  72   ALIISTVAGAAYFIVADKTVLATARKNSFNQRS---NIEA  108



>ref|XP_010254343.1| PREDICTED: early nodulin-93-like [Nelumbo nucifera]
Length=109

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +2

Query  158  LASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIV  337
            LAS DQKLAMAKR SHEGV+AG KAA  A IATAIPT ASVRM+PWARANLNPTAQALI+
Sbjct  15   LASFDQKLAMAKRCSHEGVMAGVKAAALAAIATAIPTFASVRMLPWARANLNPTAQALII  74

Query  338  STAAGMAYFIVADKTILATARRNSFK  415
            ST AG AYFIVADKT+LATAR+NSFK
Sbjct  75   STVAGSAYFIVADKTVLATARKNSFK  100



>ref|XP_010250017.1| PREDICTED: early nodulin-93-like isoform X2 [Nelumbo nucifera]
Length=107

 Score =   116 bits (291),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 85/100 (85%), Gaps = 8/100 (8%)
 Frame = +2

Query  143  AKNVS--------LASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWA  298
            A+NVS        L S+DQKLA+AKR  HEGVVAGAKAAV AT A+A+PTLASVRM+PWA
Sbjct  2    ARNVSHSHLEINGLVSVDQKLALAKRCGHEGVVAGAKAAVLATFASAVPTLASVRMLPWA  61

Query  299  RANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSFKN  418
            RA+LNPTAQALI+ST AG AYFIVADKT+LATARRNSFK+
Sbjct  62   RAHLNPTAQALIISTVAGSAYFIVADKTVLATARRNSFKD  101



>dbj|BAF63494.1| nodule protein Dg93-like protein [Potamogeton distinctus]
Length=94

 Score =   115 bits (289),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
            +VS +++DQ++A+AKR SHEG+ AG KAAV AT+A+AIPTLASVRM+PWAR NLNPTAQA
Sbjct  3    SVSRSAMDQQMALAKRCSHEGIKAGVKAAVVATVASAIPTLASVRMLPWARTNLNPTAQA  62

Query  329  LIVSTAAGMAYFIVADKTILATARRNSF  412
            LIVSTAAGMAYFIVADKTILATAR+NSF
Sbjct  63   LIVSTAAGMAYFIVADKTILATARKNSF  90



>ref|XP_006450983.1| hypothetical protein CICLE_v10009984mg [Citrus clementina]
 gb|ESR64223.1| hypothetical protein CICLE_v10009984mg [Citrus clementina]
 gb|KDO80308.1| hypothetical protein CISIN_1g033978mg [Citrus sinensis]
Length=107

 Score =   116 bits (290),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +2

Query  146  KNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQ  325
            +  SLASLD KLAMAKR SHEGV+AGAKAAV AT+ATAIPTLASVRM+PWARANLN TAQ
Sbjct  11   ERTSLASLDHKLAMAKRCSHEGVIAGAKAAVVATVATAIPTLASVRMLPWARANLNHTAQ  70

Query  326  ALIVSTAAGMAYFIVADKTILATARRNSFKNGS  424
            ALI+ST AG AYFIVADKT+LATAR+NSF+  S
Sbjct  71   ALIISTVAGAAYFIVADKTVLATARKNSFQQAS  103



>ref|XP_009403394.1| PREDICTED: early nodulin-93-like [Musa acuminata subsp. malaccensis]
Length=103

 Score =   116 bits (290),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
            +V+ A+LDQK+AMAKR +HEGV+AGAKAAV A++A AIPTLASVRM+PWARANLNPTAQA
Sbjct  3    SVTRAALDQKVAMAKRCAHEGVMAGAKAAVVASVAAAIPTLASVRMLPWARANLNPTAQA  62

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFKN  418
            LI+ST AG AYFIVADKT+LATARRNSF++
Sbjct  63   LIISTVAGAAYFIVADKTVLATARRNSFQS  92



>ref|XP_007202786.1| hypothetical protein PRUPE_ppa013711mg [Prunus persica]
 ref|XP_008242731.1| PREDICTED: early nodulin-93-like [Prunus mume]
 gb|EMJ03985.1| hypothetical protein PRUPE_ppa013711mg [Prunus persica]
Length=107

 Score =   115 bits (288),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 82/90 (91%), Gaps = 1/90 (1%)
 Frame = +2

Query  155  SLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALI  334
            SL S+DQ LA+AKR SHEGV AGAKAAV ATIATAIPT+ASVRM+PWARANLNPTAQALI
Sbjct  15   SLTSIDQ-LALAKRCSHEGVKAGAKAAVVATIATAIPTMASVRMLPWARANLNPTAQALI  73

Query  335  VSTAAGMAYFIVADKTILATARRNSFKNGS  424
            +ST AGMAYFIVADKT+LATARRNSFK  +
Sbjct  74   ISTVAGMAYFIVADKTVLATARRNSFKQAA  103



>ref|XP_010254480.1| PREDICTED: early nodulin-93-like [Nelumbo nucifera]
Length=107

 Score =   115 bits (288),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +2

Query  158  LASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIV  337
            LASLDQKLA+AKR  HEGVVAGAKAA+ AT+ATAIPT ASVRM+PWARANLNPTAQALI+
Sbjct  15   LASLDQKLALAKRCGHEGVVAGAKAALLATVATAIPTFASVRMLPWARANLNPTAQALII  74

Query  338  STAAGMAYFIVADKTILATARRNSFK  415
            ST AG AYFIVADKT+LATAR+NSFK
Sbjct  75   STVAGSAYFIVADKTVLATARKNSFK  100



>ref|XP_010250016.1| PREDICTED: early nodulin-93-like isoform X1 [Nelumbo nucifera]
Length=107

 Score =   115 bits (288),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 88/108 (81%), Gaps = 11/108 (10%)
 Frame = +2

Query  143  AKNVS--------LASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWA  298
            A+NVS        L S+DQKLA+AKR  HEGVVAGAKAAV AT A+A+PTLASVRM+PWA
Sbjct  2    ARNVSHSHLEINGLVSVDQKLALAKRCGHEGVVAGAKAAVLATFASAVPTLASVRMLPWA  61

Query  299  RANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSFKNGSVSGNIQ  442
            RA+LNPTAQALI+ST AG  YFIVADKT+LATARRNSFK+ S   N+Q
Sbjct  62   RAHLNPTAQALIISTVAGSTYFIVADKTVLATARRNSFKDFS---NVQ  106



>ref|XP_008775025.1| PREDICTED: early nodulin-93-like [Phoenix dactylifera]
Length=100

 Score =   115 bits (287),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
            +VS  SLDQKLAMAKR SHEGVVAGAKAA+ AT+A+AIPTLASVRM+PWAR+ LNP AQA
Sbjct  3    SVSRPSLDQKLAMAKRCSHEGVVAGAKAAMVATVASAIPTLASVRMIPWARSFLNPAAQA  62

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            LIVS+AAG AYFIVADKT+LA AR+NSFK+ 
Sbjct  63   LIVSSAAGAAYFIVADKTVLAAARKNSFKDA  93



>ref|XP_008809696.1| PREDICTED: early nodulin-93-like [Phoenix dactylifera]
Length=96

 Score =   115 bits (287),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
            +VS +SLDQKLAMAKR SHEGVVAGAKAA+ AT+A+AIPTLASVRM+PWAR+ LNP AQA
Sbjct  3    SVSRSSLDQKLAMAKRCSHEGVVAGAKAAMVATVASAIPTLASVRMIPWARSFLNPAAQA  62

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            LIVS+AAG AYFIVADKT+LA AR+NSF++ 
Sbjct  63   LIVSSAAGAAYFIVADKTVLAAARKNSFRDA  93



>ref|XP_006364894.1| PREDICTED: early nodulin-93-like [Solanum tuberosum]
Length=94

 Score =   115 bits (287),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  AKNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTA  322
            AKNVSLAS+DQKLAMAKR SHEGV+AGAKAAV A++ATAIPT A  +M+PWAR  LNPTA
Sbjct  2    AKNVSLASMDQKLAMAKRCSHEGVIAGAKAAVVASVATAIPTFAIGKMLPWARTYLNPTA  61

Query  323  QALIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            +ALIVSTAAGMAYF+VADKTIL TAR+NSFK  
Sbjct  62   KALIVSTAAGMAYFVVADKTILKTARQNSFKQA  94



>gb|KHN27413.1| Early nodulin-93 [Glycine soja]
Length=107

 Score =   114 bits (286),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +2

Query  146  KNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQ  325
            +  SL SLDQKLAMAKR SHEGV+AGAKAAV ATIAT IPTLASVRM+PWARANLN +AQ
Sbjct  13   ERTSLPSLDQKLAMAKRCSHEGVMAGAKAAVVATIATTIPTLASVRMLPWARANLNHSAQ  72

Query  326  ALIVSTAAGMAYFIVADKTILATARRNSFKNGS  424
            ALI+ST AG AYFIVADKT+LATAR+NSF   S
Sbjct  73   ALIISTVAGAAYFIVADKTVLATARKNSFNRPS  105



>ref|XP_006475805.1| PREDICTED: early nodulin-93-like [Citrus sinensis]
Length=107

 Score =   114 bits (286),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +2

Query  146  KNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQ  325
            +  SL SLD KLAMAKR SHEGV+AGAKAAV AT+ATAIPTLASVRM+PWARANLN TAQ
Sbjct  11   ERTSLVSLDHKLAMAKRCSHEGVIAGAKAAVVATVATAIPTLASVRMLPWARANLNHTAQ  70

Query  326  ALIVSTAAGMAYFIVADKTILATARRNSFKNGS  424
            ALI+ST AG AYFIVADKT+LATAR+NSF+  S
Sbjct  71   ALIISTVAGAAYFIVADKTVLATARKNSFQQAS  103



>ref|XP_004251567.1| PREDICTED: early nodulin-93-like [Solanum lycopersicum]
Length=92

 Score =   114 bits (284),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +2

Query  143  AKNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTA  322
            AKNVSLAS+DQKLAMAKRYS+EGVVAGAKAAV A++ATAIPT A  +M PWAR  LNPTA
Sbjct  2    AKNVSLASMDQKLAMAKRYSYEGVVAGAKAAVVASVATAIPTFAIGKMSPWARTYLNPTA  61

Query  323  QALIVSTAAGMAYFIVADKTILATARRNSFK  415
            +ALI+ST AGMAYF+VADKTIL TAR+NSFK
Sbjct  62   KALIISTVAGMAYFVVADKTILKTARQNSFK  92



>ref|XP_004287357.1| PREDICTED: early nodulin-93-like [Fragaria vesca subsp. vesca]
Length=105

 Score =   114 bits (284),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 78/89 (88%), Gaps = 2/89 (2%)
 Frame = +2

Query  155  SLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALI  334
            SL S DQ+LA  KR SHEGV AG KAAV ATIA+AIPT ASVRM+PWA+ANLNPTAQALI
Sbjct  14   SLTSFDQQLA--KRCSHEGVKAGVKAAVVATIASAIPTFASVRMLPWAKANLNPTAQALI  71

Query  335  VSTAAGMAYFIVADKTILATARRNSFKNG  421
            +STAAGMAYFIVADKTILATARRNSF  G
Sbjct  72   ISTAAGMAYFIVADKTILATARRNSFHQG  100



>ref|XP_010909459.1| PREDICTED: early nodulin-93-like [Elaeis guineensis]
Length=100

 Score =   113 bits (283),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
            +VS +SLDQKLAMAKR SHEGVVAGAKAAV AT+A+AIPTLASVRM+PWAR+ LNP AQA
Sbjct  3    SVSRSSLDQKLAMAKRCSHEGVVAGAKAAVVATVASAIPTLASVRMIPWARSFLNPAAQA  62

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            LIVS+AAG AYFIVADKT+LA AR+NSFK+ 
Sbjct  63   LIVSSAAGAAYFIVADKTVLAAARKNSFKDA  93



>ref|XP_003609265.1| Early nodulin 93 protein [Medicago truncatula]
 gb|AES91462.1| early nodulin 93 [Medicago truncatula]
 gb|AFK49073.1| unknown [Medicago truncatula]
Length=107

 Score =   113 bits (283),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +2

Query  146  KNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQ  325
            +  SLA LDQ+LAMAKR SHEGV+AGAKAAV ATIATAIPTLASVRM+PWARANLNPTAQ
Sbjct  13   ERTSLAYLDQRLAMAKRCSHEGVMAGAKAAVVATIATAIPTLASVRMLPWARANLNPTAQ  72

Query  326  ALIVSTAAGMAYFIVADKTILATARRNSFKNGS  424
            ALI+ST AG AYF+VADKT+LATAR+NS    S
Sbjct  73   ALIISTVAGAAYFVVADKTVLATARKNSINRPS  105



>ref|XP_010250015.1| PREDICTED: early nodulin-93-like [Nelumbo nucifera]
Length=107

 Score =   113 bits (283),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 82/99 (83%), Gaps = 8/99 (8%)
 Frame = +2

Query  143  AKNVS--------LASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWA  298
            AKNV+        LASLDQKLAMAKR  HEGVVAG KAA+ AT A+AIPT ASVRM+PWA
Sbjct  2    AKNVAHSPLERNGLASLDQKLAMAKRCGHEGVVAGTKAAIVATFASAIPTFASVRMLPWA  61

Query  299  RANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSFK  415
            RANLNPTAQALI+S  AG AYF+VADKT+LATAR+NSF+
Sbjct  62   RANLNPTAQALIISIVAGSAYFVVADKTVLATARKNSFQ  100



>ref|NP_001240002.1| uncharacterized protein LOC100820292 [Glycine max]
 gb|ACU20557.1| unknown [Glycine max]
 gb|KHN15115.1| Early nodulin-93 [Glycine soja]
Length=107

 Score =   113 bits (283),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +2

Query  155  SLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALI  334
            +LASLDQKLAMAKR SHEGV+AGAKAAV ATIATAIPTLASVRM+PWA+ANLN TAQALI
Sbjct  16   TLASLDQKLAMAKRCSHEGVMAGAKAAVVATIATAIPTLASVRMLPWAKANLNHTAQALI  75

Query  335  VSTAAGMAYFIVADKTILATARRNSF  412
            +ST AG AYFIVADKT+LATAR+NSF
Sbjct  76   ISTVAGAAYFIVADKTVLATARKNSF  101



>ref|XP_010254344.1| PREDICTED: early nodulin-93-like [Nelumbo nucifera]
Length=103

 Score =   113 bits (282),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +2

Query  158  LASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIV  337
            LASLDQKLA+AKR  HEGVVAGAKAAV A +A+A+PTLASVRM+PWA+ANLNPTAQALI+
Sbjct  15   LASLDQKLALAKRCGHEGVVAGAKAAVVAAVASAVPTLASVRMLPWAKANLNPTAQALII  74

Query  338  STAAGMAYFIVADKTILATARRNSFK  415
            ST AG AYF+VADKT+L TAR+NSFK
Sbjct  75   STVAGSAYFVVADKTVLKTARKNSFK  100



>ref|XP_010047806.1| PREDICTED: early nodulin-93-like [Eucalyptus grandis]
 ref|XP_010039614.1| PREDICTED: early nodulin-93-like [Eucalyptus grandis]
 gb|KCW45866.1| hypothetical protein EUGRSUZ_L00290 [Eucalyptus grandis]
Length=108

 Score =   112 bits (281),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = +2

Query  146  KNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQ  325
            +  SLASLDQ+LAMAKR S EGV AGAKAAV A IATAIPTLAS RM+PWARANLN +AQ
Sbjct  12   EKTSLASLDQRLAMAKRCSREGVKAGAKAAVLAGIATAIPTLASARMLPWARANLNHSAQ  71

Query  326  ALIVSTAAGMAYFIVADKTILATARRNSFK  415
            ALI+ST AG AYFIVADKTILATAR+NSFK
Sbjct  72   ALIISTVAGAAYFIVADKTILATARQNSFK  101



>ref|XP_006364907.1| PREDICTED: early nodulin-93-like [Solanum tuberosum]
Length=95

 Score =   112 bits (279),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +2

Query  143  AKNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTA  322
            AKNVSL S+DQKLA+AKR SHEG  AGAKAAV AT+ATAIPT A  +M PWARA+LNPTA
Sbjct  2    AKNVSLDSMDQKLALAKRCSHEGAKAGAKAAVFATVATAIPTYACGKMSPWARAHLNPTA  61

Query  323  QALIVSTAAGMAYFIVADKTILATARRNSFK  415
            +ALIVST AGMAYFIVADKTIL TAR+NSFK
Sbjct  62   KALIVSTVAGMAYFIVADKTILKTARQNSFK  92



>ref|XP_009368814.1| PREDICTED: early nodulin-93-like [Pyrus x bretschneideri]
Length=107

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 74/83 (89%), Positives = 78/83 (94%), Gaps = 1/83 (1%)
 Frame = +2

Query  164  SLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIVST  343
            S+DQ LAMAKRYS EGV AGAKAAV ATIATAIPT+ASVRM+PWARANLNPTAQALI+ST
Sbjct  14   SIDQ-LAMAKRYSREGVKAGAKAAVVATIATAIPTMASVRMLPWARANLNPTAQALIIST  72

Query  344  AAGMAYFIVADKTILATARRNSF  412
             AGMAYFIVADKTILATARRNSF
Sbjct  73   VAGMAYFIVADKTILATARRNSF  95



>gb|AFK44884.1| unknown [Lotus japonicus]
Length=107

 Score =   112 bits (279),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +2

Query  146  KNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQ  325
            +  SL SLDQ+LA+AKR SHEGV+AGA+AAV A+IATAIPTL SVRM+PWARANLN TAQ
Sbjct  13   ERTSLPSLDQRLAIAKRCSHEGVMAGARAAVVASIATAIPTLTSVRMLPWARANLNHTAQ  72

Query  326  ALIVSTAAGMAYFIVADKTILATARRNSFKNGS  424
            AL++ST AG AYFIVADKT+LATAR+NSFK  S
Sbjct  73   ALLISTVAGAAYFIVADKTVLATARKNSFKPPS  105



>ref|XP_003524537.2| PREDICTED: early nodulin-93-like [Glycine max]
Length=152

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +2

Query  146  KNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQ  325
            +  SL SLDQKLAMAKR SHEGV+AGAKAAV ATIATAIPTLASVRM+PWARANLN +AQ
Sbjct  58   ERTSLPSLDQKLAMAKRCSHEGVMAGAKAAVVATIATAIPTLASVRMLPWARANLNHSAQ  117

Query  326  ALIVSTAAGMAYFIVADKTILATARRNSFKNGS  424
            ALI+ST AG AYFIVADKT+LATAR+NSF   S
Sbjct  118  ALIISTVAGAAYFIVADKTVLATARKNSFNRPS  150



>ref|XP_010914914.1| PREDICTED: early nodulin-93-like [Elaeis guineensis]
Length=102

 Score =   112 bits (279),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +2

Query  152  VSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQAL  331
            V+ +SLDQKLAMAKR SHEGVVAGAKAAV A++A A+PTLASVRM+PWAR+NLN TAQAL
Sbjct  4    VTRSSLDQKLAMAKRCSHEGVVAGAKAAVVASVAAAVPTLASVRMLPWARSNLNHTAQAL  63

Query  332  IVSTAAGMAYFIVADKTILATARRNSFKNGSVS  430
            I+ST AG AYFIVADKT+LA+AR+NSF +  +S
Sbjct  64   IISTVAGAAYFIVADKTVLASARKNSFTDAHLS  96



>ref|XP_004251574.1| PREDICTED: early nodulin-93-like [Solanum lycopersicum]
Length=95

 Score =   111 bits (277),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  143  AKNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTA  322
            AKNVSL S+DQKLA AKR SHEG  AGAKAAV AT+ TAIPT A  ++ PWARA+LNPTA
Sbjct  2    AKNVSLDSIDQKLAYAKRCSHEGAKAGAKAAVFATVVTAIPTYACGKISPWARAHLNPTA  61

Query  323  QALIVSTAAGMAYFIVADKTILATARRNSFKN  418
            +ALIVSTAAGMAYFIVADKTIL TAR+NSFK 
Sbjct  62   KALIVSTAAGMAYFIVADKTILKTARQNSFKQ  93



>ref|XP_006842815.1| hypothetical protein AMTR_s00081p00057480 [Amborella trichopoda]
 gb|ERN04490.1| hypothetical protein AMTR_s00081p00057480 [Amborella trichopoda]
Length=113

 Score =   112 bits (279),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +2

Query  158  LASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIV  337
            LASLDQKLAMAKR SHEGV+AGAKAAV A+IATAIPTLASVRM  WAR++LN TAQALI+
Sbjct  23   LASLDQKLAMAKRCSHEGVIAGAKAAVVASIATAIPTLASVRMSRWARSHLNHTAQALII  82

Query  338  STAAGMAYFIVADKTILATARRNSFKNGSV  427
            ST AG AYFIVADKT+LA+AR+NSFKN ++
Sbjct  83   STVAGAAYFIVADKTVLASARKNSFKNDTL  112



>ref|XP_010250012.1| PREDICTED: early nodulin-93-like isoform X2 [Nelumbo nucifera]
Length=107

 Score =   111 bits (278),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 85/97 (88%), Gaps = 3/97 (3%)
 Frame = +2

Query  155  SLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALI  334
            SLASLDQKL+MAKR   EGVVAGAKAAV ATIATAIPT ASVR +PWARANLNPTAQALI
Sbjct  14   SLASLDQKLSMAKRCGLEGVVAGAKAAVVATIATAIPTFASVRSLPWARANLNPTAQALI  73

Query  335  VSTAAGMAYFIVADKTILATARRNSFKNGSVSGNIQA  445
            +ST AG AYF+VADKT+LATAR+NSFK+    GNI++
Sbjct  74   ISTVAGSAYFVVADKTVLATARKNSFKD---HGNIES  107



>ref|NP_001237669.1| early nodulin-93 [Glycine max]
 sp|Q02921.1|NO93_SOYBN RecName: Full=Early nodulin-93; Short=N-93 [Glycine max]
 dbj|BAA02724.1| early nodulin [Glycine max]
 dbj|BAA33816.1| early nodulin [Glycine max]
 gb|KHN35891.1| Early nodulin-93 [Glycine soja]
 prf||1913422D nodulin
Length=105

 Score =   111 bits (278),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +2

Query  155  SLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALI  334
            SLASLDQKLA AKR SHEGV+AGAKAAV A++A+AIPTLASVRM+PWARANLN TAQALI
Sbjct  12   SLASLDQKLAFAKRCSHEGVLAGAKAAVVASVASAIPTLASVRMLPWARANLNHTAQALI  71

Query  335  VSTAAGMAYFIVADKTILATARRNSFKNGSVS  430
            +STA   AYFIVADKT+LATAR+NSF   S S
Sbjct  72   ISTATAAAYFIVADKTVLATARKNSFNQPSNS  103



>ref|XP_010250011.1| PREDICTED: early nodulin-93-like isoform X1 [Nelumbo nucifera]
Length=104

 Score =   110 bits (276),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  155  SLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALI  334
            SLASLDQKL+MAKR   EGVVAGAKAAV ATIATAIPT ASVR +PWARANLNPTAQALI
Sbjct  14   SLASLDQKLSMAKRCGLEGVVAGAKAAVVATIATAIPTFASVRSLPWARANLNPTAQALI  73

Query  335  VSTAAGMAYFIVADKTILATARRNSFK  415
            +ST AG AYFIVADKT+LATARRNSFK
Sbjct  74   ISTVAGSAYFIVADKTVLATARRNSFK  100



>ref|XP_010047807.1| PREDICTED: early nodulin-93-like [Eucalyptus grandis]
Length=108

 Score =   110 bits (274),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +2

Query  146  KNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQ  325
            +  SLASLDQ+LAMAKR S EGV AGAKAAV A IATAIPTLAS RM+PWARANLN +AQ
Sbjct  12   EKTSLASLDQRLAMAKRCSREGVKAGAKAAVLAGIATAIPTLASARMLPWARANLNHSAQ  71

Query  326  ALIVSTAAGMAYFIVADKTILATARRNSFK  415
            ALI+ST AG AYFIVADKTILA AR+NSFK
Sbjct  72   ALIISTVAGAAYFIVADKTILAKARQNSFK  101



>ref|XP_010039608.1| PREDICTED: early nodulin-93-like [Eucalyptus grandis]
 gb|KCW45867.1| hypothetical protein EUGRSUZ_L00292 [Eucalyptus grandis]
Length=108

 Score =   110 bits (274),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +2

Query  146  KNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQ  325
            +  SLASLDQ+LAMAKR S EGV AGAKAAV A IATAIPTLAS RM+PWARANLN +AQ
Sbjct  12   EKTSLASLDQRLAMAKRCSREGVKAGAKAAVLAGIATAIPTLASARMLPWARANLNHSAQ  71

Query  326  ALIVSTAAGMAYFIVADKTILATARRNSFKNGS  424
            ALI+ST AG AYFIVADK ILATAR+NSFK  S
Sbjct  72   ALIISTVAGAAYFIVADKPILATARQNSFKQVS  104



>gb|ACU16453.1| unknown [Glycine max]
Length=105

 Score =   110 bits (274),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +2

Query  155  SLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALI  334
            SLASLDQKLA AKR SHEGV+AGAKAAV A++A+AIPTLASVRM PWARANLN TAQALI
Sbjct  12   SLASLDQKLAFAKRCSHEGVLAGAKAAVVASVASAIPTLASVRMRPWARANLNHTAQALI  71

Query  335  VSTAAGMAYFIVADKTILATARRNSFKNGSVS  430
            +STA   AYFIVADKT+LATAR+NSF   S S
Sbjct  72   ISTATAAAYFIVADKTVLATARKNSFNQPSNS  103



>gb|AIE16049.1| early nodulin 93 protein [Elaeis guineensis]
Length=102

 Score =   109 bits (273),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +2

Query  152  VSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQAL  331
            V+ +SLDQKLAMAKR SHEGVVAGAKAAV A++A A+P LASVRM+PWAR+NLN TAQAL
Sbjct  4    VTRSSLDQKLAMAKRCSHEGVVAGAKAAVVASVAAAVPILASVRMLPWARSNLNHTAQAL  63

Query  332  IVSTAAGMAYFIVADKTILATARRNSFKNGSVS  430
            I+ST AG AYFIVADKT+LA+AR+NSF +  +S
Sbjct  64   IISTVAGAAYFIVADKTVLASARKNSFTDAHLS  96



>ref|XP_004508526.1| PREDICTED: early nodulin-93-like [Cicer arietinum]
Length=107

 Score =   109 bits (273),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +2

Query  155  SLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALI  334
            SLASLDQ+LA+AKR SHEGV+AGAKAAV ATIATAIPT ASVRM+PWA+ANLN TAQALI
Sbjct  16   SLASLDQRLAVAKRCSHEGVMAGAKAAVVATIATAIPTFASVRMLPWAKANLNHTAQALI  75

Query  335  VSTAAGMAYFIVADKTILATARRNSFKNGS  424
            +ST AG AYFIVADKT+LATAR+NSF   S
Sbjct  76   ISTVAGAAYFIVADKTVLATARKNSFNRPS  105



>ref|XP_009392935.1| PREDICTED: early nodulin-93-like [Musa acuminata subsp. malaccensis]
Length=101

 Score =   108 bits (271),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +2

Query  152  VSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQAL  331
            V+ A+LDQKLAMAK  SHEGVVAGAKAAV AT+A AIPTLAS +++PWAR+NLNPTAQAL
Sbjct  4    VTRAALDQKLAMAKLCSHEGVVAGAKAAVVATVAAAIPTLASFKILPWARSNLNPTAQAL  63

Query  332  IVSTAAGMAYFIVADKTILATARRNSFKNGSV  427
            I+ST AG AYFIVADKT+LA+AR+NSF+ G++
Sbjct  64   IISTVAGAAYFIVADKTVLASARKNSFEGGNI  95



>ref|XP_010039609.1| PREDICTED: early nodulin-93-like [Eucalyptus grandis]
 gb|KCW45868.1| hypothetical protein EUGRSUZ_L00293 [Eucalyptus grandis]
Length=108

 Score =   108 bits (270),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +2

Query  146  KNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQ  325
            +  SLASLDQ+LAMAKR S EGV+AGAKAAV A IATAIPTLAS RM+PWAR N N +AQ
Sbjct  12   EKTSLASLDQRLAMAKRCSREGVIAGAKAAVLAGIATAIPTLASARMLPWARTNFNHSAQ  71

Query  326  ALIVSTAAGMAYFIVADKTILATARRNSFK  415
            ALI+ST AG AYFIVADKT+LATARRNSF+
Sbjct  72   ALIISTVAGAAYFIVADKTVLATARRNSFE  101



>ref|XP_010047808.1| PREDICTED: early nodulin-93-like [Eucalyptus grandis]
 gb|KCW79789.1| hypothetical protein EUGRSUZ_C01130 [Eucalyptus grandis]
Length=108

 Score =   108 bits (270),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +2

Query  146  KNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQ  325
            +  SLASLDQ+LAMAKR S EGV AGAKAAV A IATAIPTLAS RM+PWAR N N +AQ
Sbjct  12   EKTSLASLDQRLAMAKRCSREGVKAGAKAAVLAGIATAIPTLASARMLPWARTNFNHSAQ  71

Query  326  ALIVSTAAGMAYFIVADKTILATARRNSFK  415
            ALI+ST AG AYFIVADKT+LATARRNSF+
Sbjct  72   ALIISTVAGAAYFIVADKTVLATARRNSFE  101



>ref|XP_004964506.1| PREDICTED: early nodulin-93-like [Setaria italica]
Length=115

 Score =   108 bits (269),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             VS ASLDQKLAMAKR S E  +AG KAA  ATI +AIPTLASVRM+PWA+AN+NPT QA
Sbjct  3    TVSRASLDQKLAMAKRCSREATLAGTKAAAVATIVSAIPTLASVRMLPWAKANINPTGQA  62

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            LI+ST AGMAYFI ADK IL+ ARR+S++  
Sbjct  63   LIISTVAGMAYFIAADKKILSLARRHSYEEA  93



>ref|XP_002437802.1| hypothetical protein SORBIDRAFT_10g002820 [Sorghum bicolor]
 gb|EER89169.1| hypothetical protein SORBIDRAFT_10g002820 [Sorghum bicolor]
Length=115

 Score =   107 bits (268),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             VS ASLDQKLA+AKR S E  +AG KAA  AT+A+A+PTLASVRM+PWA+AN+NPT QA
Sbjct  3    TVSRASLDQKLALAKRCSREATMAGFKAAAVATVASAVPTLASVRMLPWAKANINPTGQA  62

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            LI+ST AGMAYFI ADK IL+ ARR+SF+N 
Sbjct  63   LIISTVAGMAYFIAADKKILSLARRHSFENA  93



>ref|XP_010100940.1| hypothetical protein L484_005949 [Morus notabilis]
 gb|EXB86238.1| hypothetical protein L484_005949 [Morus notabilis]
Length=108

 Score =   107 bits (268),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = +2

Query  155  SLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALI  334
            SLA+LDQKLAMA+R + EGV AGAKAAV A+IATAIPT ASVR++PWA+A+LN TAQALI
Sbjct  14   SLAALDQKLAMAQRCAQEGVKAGAKAAVVASIATAIPTFASVRLLPWAKAHLNHTAQALI  73

Query  335  VSTAAGMAYFIVADKTILATARRNSFKNGS  424
            +ST AG AYFIVADKT+LATAR+NSFK  S
Sbjct  74   ISTVAGAAYFIVADKTVLATARKNSFKQAS  103



>ref|XP_004964505.1| PREDICTED: early nodulin-93-like [Setaria italica]
Length=115

 Score =   107 bits (267),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             VS ASLDQKLAMAKR S E  +AG KAA  ATIA+AIPTLASVRM+PWA+AN+NPT QA
Sbjct  3    TVSRASLDQKLAMAKRCSREATLAGTKAAAVATIASAIPTLASVRMLPWAKANINPTGQA  62

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            LI+ST AGMAYFI ADK IL+ ARR+SF+  
Sbjct  63   LIISTVAGMAYFIAADKKILSLARRHSFEEA  93



>ref|XP_010688053.1| PREDICTED: early nodulin-93-like [Beta vulgaris subsp. vulgaris]
Length=100

 Score =   106 bits (265),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +2

Query  170  DQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIVSTAA  349
            DQ+LAMAK+YSHEGVVAGAKAA+ A + TAIPT+AS RM+PWARANLN TAQALI+ST A
Sbjct  16   DQRLAMAKQYSHEGVVAGAKAAIVAGVVTAIPTIASARMLPWARANLNSTAQALIISTVA  75

Query  350  GMAYFIVADKTILATARRNSFKN  418
            G AYFIVADKT+L +ARRNS+ N
Sbjct  76   GAAYFIVADKTVLKSARRNSYYN  98



>ref|XP_007154975.1| hypothetical protein PHAVU_003G162200g [Phaseolus vulgaris]
 gb|ESW26969.1| hypothetical protein PHAVU_003G162200g [Phaseolus vulgaris]
Length=107

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +2

Query  152  VSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQAL  331
             +LASLDQKLA+AKR S EGV+AGAKAAV ATIATAIPT+ASV+M+PWA+ANLN TAQAL
Sbjct  15   TTLASLDQKLALAKRCSREGVMAGAKAAVVATIATAIPTMASVKMLPWAKANLNHTAQAL  74

Query  332  IVSTAAGMAYFIVADKTILATARRNSF  412
            I+ST AG AYFIVADKT+LATAR+NSF
Sbjct  75   IISTVAGAAYFIVADKTVLATARKNSF  101



>ref|XP_008658093.1| PREDICTED: uncharacterized protein LOC100193182 isoform X1 [Zea 
mays]
 gb|AFW85920.1| early nodulin 93 [Zea mays]
Length=115

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             VS ASLDQKLA+AKR S E  +AGAKAA  ATIA+AIPTLASVRM+PWA+AN+NPT QA
Sbjct  3    TVSRASLDQKLALAKRCSREATLAGAKAAAVATIASAIPTLASVRMLPWAKANINPTGQA  62

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            LIVST AGMAYFI ADK IL+ ARR+SF+  
Sbjct  63   LIVSTVAGMAYFIAADKKILSLARRHSFEEA  93



>gb|ACG31347.1| early nodulin 93 [Zea mays]
Length=116

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             VS ASLDQKLA+AKR S E  +AGAKAA  ATIA+AIPTLASVRM+PWA+AN+NPT QA
Sbjct  4    TVSRASLDQKLALAKRCSREATLAGAKAAAVATIASAIPTLASVRMLPWAKANINPTGQA  63

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            LIVST AGMAYFI ADK IL+ ARR+SF+  
Sbjct  64   LIVSTVAGMAYFIAADKKILSLARRHSFEQA  94



>gb|ACG23914.1| early nodulin 93 [Zea mays]
 gb|ACG24450.1| early nodulin 93 [Zea mays]
 gb|ACG24741.1| early nodulin 93 [Zea mays]
 gb|AFW85921.1| early nodulin 93 [Zea mays]
Length=116

 Score =   106 bits (264),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             VS ASLDQKLA+AKR S E  +AGAKAA  ATIA+AIPTLASVRM+PWA+AN+NPT QA
Sbjct  4    TVSRASLDQKLALAKRCSREATLAGAKAAAVATIASAIPTLASVRMLPWAKANINPTGQA  63

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            LIVST AGMAYFI ADK IL+ ARR+SF+  
Sbjct  64   LIVSTVAGMAYFIAADKKILSLARRHSFEQA  94



>ref|XP_002436449.1| hypothetical protein SORBIDRAFT_10g002900 [Sorghum bicolor]
 gb|EER87816.1| hypothetical protein SORBIDRAFT_10g002900 [Sorghum bicolor]
Length=115

 Score =   106 bits (264),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             VS ASL+QKLA+AKR S E  +AGAKAA  ATIA+AIPTLASVRM+PWA+AN+NPT QA
Sbjct  3    TVSRASLEQKLALAKRCSREATLAGAKAAAVATIASAIPTLASVRMLPWAKANINPTGQA  62

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            LI+ST AGMAYFI ADK IL+ ARR+SF+N 
Sbjct  63   LIISTVAGMAYFIAADKKILSLARRHSFENA  93



>gb|ACG24704.1| early nodulin 93 [Zea mays]
Length=115

 Score =   106 bits (264),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             VS ASLDQKLA+AKR S E  +AGAKAA  ATIA+AIPTLASVRM+PWA+AN+NPT QA
Sbjct  3    TVSRASLDQKLALAKRCSREATLAGAKAAAVATIASAIPTLASVRMLPWAKANINPTGQA  62

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            LIVST AGMAYFI ADK IL+ ARR+SF+  
Sbjct  63   LIVSTVAGMAYFIAADKKILSLARRHSFEQA  93



>gb|ACG45703.1| early nodulin 93 [Zea mays]
Length=116

 Score =   106 bits (264),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 79/103 (77%), Gaps = 7/103 (7%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             VS ASLDQKLA+AKR S E  +AGAKAA  ATIA+AIPTLASVRM+PWA+AN+NPT QA
Sbjct  4    TVSXASLDQKLALAKRCSREATLAGAKAAAVATIASAIPTLASVRMLPWAKANINPTGQA  63

Query  329  LIVSTAAGMAYFIVADKTILATARRNSF-------KNGSVSGN  436
            LIVST AGMAYFI ADK IL+ ARR+SF       KN S  G 
Sbjct  64   LIVSTVAGMAYFIAADKKILSLARRHSFDQAPDHLKNTSFQGT  106



>ref|NP_001131809.1| uncharacterized protein LOC100193182 [Zea mays]
 ref|XP_008658094.1| PREDICTED: uncharacterized protein LOC100193182 isoform X2 [Zea 
mays]
 gb|ACF80385.1| unknown [Zea mays]
 gb|ACG48862.1| early nodulin 93 [Zea mays]
Length=115

 Score =   106 bits (264),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             VS ASLDQKLA+AKR S E  +AGAKAA  ATIA+AIPTLASVRM+PWA+AN+NPT QA
Sbjct  3    TVSRASLDQKLALAKRCSREATLAGAKAAAVATIASAIPTLASVRMLPWAKANINPTGQA  62

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            LIVST AGMAYFI ADK IL+ ARR+SF+  
Sbjct  63   LIVSTVAGMAYFIAADKKILSLARRHSFEQA  93



>ref|XP_002285052.1| PREDICTED: early nodulin-93 [Vitis vinifera]
 emb|CBI28165.3| unnamed protein product [Vitis vinifera]
Length=107

 Score =   105 bits (263),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +2

Query  158  LASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIV  337
            LAS DQKLAMAKR SHEGVVAGAKAAV A+IATAIPT+AS R +PWA+ANLN TAQALI+
Sbjct  15   LASFDQKLAMAKRCSHEGVVAGAKAAVVASIATAIPTMASARWLPWAKANLNHTAQALII  74

Query  338  STAAGMAYFIVADKTILATARRNSFK  415
            ST AG AYFIVADKT+LA+ARRNS K
Sbjct  75   STVAGAAYFIVADKTVLASARRNSLK  100



>ref|XP_002437803.1| hypothetical protein SORBIDRAFT_10g002830 [Sorghum bicolor]
 gb|EER89170.1| hypothetical protein SORBIDRAFT_10g002830 [Sorghum bicolor]
Length=115

 Score =   105 bits (263),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             VS ASLDQKLA+AKR S E  +AGAKAA  AT+A+AIPTLASVRM+PWA+AN+NPT QA
Sbjct  3    TVSRASLDQKLALAKRCSREATLAGAKAAAVATVASAIPTLASVRMLPWAKANINPTGQA  62

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            LI+ST AGMAYFI ADK IL+ AR++SF+N 
Sbjct  63   LIISTVAGMAYFIAADKKILSLARQHSFENA  93



>ref|XP_002436448.1| hypothetical protein SORBIDRAFT_10g002890 [Sorghum bicolor]
 gb|EER87815.1| hypothetical protein SORBIDRAFT_10g002890 [Sorghum bicolor]
Length=115

 Score =   105 bits (263),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             VS ASLDQKLA+AKR S E  +AGAKAA  ATIA+AIPTLASVRM+PWA+AN+NPT QA
Sbjct  3    TVSRASLDQKLALAKRCSREATLAGAKAAAVATIASAIPTLASVRMLPWAKANINPTGQA  62

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            LI+ST AGMAYFI ADK IL+ ARR+SF+  
Sbjct  63   LIISTVAGMAYFIAADKKILSLARRHSFEEA  93



>ref|NP_001147053.1| early nodulin 93 [Zea mays]
 gb|ACG25286.1| early nodulin 93 [Zea mays]
 gb|ACG48867.1| early nodulin 93 [Zea mays]
Length=116

 Score =   105 bits (263),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 79/103 (77%), Gaps = 7/103 (7%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             VS ASLDQKLA+AKR S E  +AGAKAA  ATIA+AIPTLASVRM+PWA+AN+NPT QA
Sbjct  4    TVSRASLDQKLALAKRCSREATLAGAKAAAVATIASAIPTLASVRMLPWAKANINPTGQA  63

Query  329  LIVSTAAGMAYFIVADKTILATARRNSF-------KNGSVSGN  436
            LIVST AGMAYFI ADK IL+ ARR+SF       KN S  G 
Sbjct  64   LIVSTVAGMAYFIAADKKILSLARRHSFDQAPEHLKNTSFQGT  106



>gb|AAD28359.1|AF084573_1 root-nodule protein Dg93 [Datisca glomerata]
Length=105

 Score =   105 bits (262),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +2

Query  158  LASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIV  337
            L S D KLA+AKR +HEGV+AGAKAA  A+IATAIPTLASVRM+PWARANLN TAQALIV
Sbjct  15   LTSSDPKLALAKRCAHEGVMAGAKAAAIASIATAIPTLASVRMMPWARANLNHTAQALIV  74

Query  338  STAAGMAYFIVADKTILATARRNSFKNGS  424
            ST AG+AYFIVADKT+LATAR+NS  + S
Sbjct  75   STVAGLAYFIVADKTVLATARKNSLNHNS  103



>ref|XP_004964504.1| PREDICTED: early nodulin-93-like [Setaria italica]
Length=115

 Score =   105 bits (262),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             VS ASLDQKLA+AKR S E  +AGAKAA  ATIA+A+PTLASVRM+PWA+AN+NPT QA
Sbjct  3    TVSHASLDQKLALAKRCSREATLAGAKAAAVATIASAVPTLASVRMLPWAKANINPTGQA  62

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            LI+ST AGMAYFI ADK IL+ ARR+SF+  
Sbjct  63   LIISTVAGMAYFIAADKKILSLARRHSFEEA  93



>ref|XP_004964509.1| PREDICTED: early nodulin-93-like [Setaria italica]
Length=112

 Score =   105 bits (261),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  VSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQAL  331
            +S ASLDQKLA+AKR S E  +AGAKAA  ATIA+AIPT+ASVRM+PWA+AN+NPT QAL
Sbjct  1    MSAASLDQKLALAKRCSREATLAGAKAAAVATIASAIPTMASVRMLPWAKANINPTGQAL  60

Query  332  IVSTAAGMAYFIVADKTILATARRNSFKNG  421
            I+ST AGMAYFI ADK IL+ ARR+SF+N 
Sbjct  61   IISTVAGMAYFIAADKKILSLARRHSFENA  90



>ref|XP_007138316.1| hypothetical protein PHAVU_009G198400g [Phaseolus vulgaris]
 gb|ESW10310.1| hypothetical protein PHAVU_009G198400g [Phaseolus vulgaris]
Length=112

 Score =   105 bits (261),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +2

Query  155  SLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALI  334
            S ASLDQKLA A++ SHEGV+AGAKAAV A +A+AIPT+ASVRMVPWARANLN TAQALI
Sbjct  12   SFASLDQKLAFAQQSSHEGVLAGAKAAVVAGVASAIPTVASVRMVPWARANLNHTAQALI  71

Query  335  VSTAAGMAYFIVADKTILATARRNSF  412
            +STA   A+FIV+DKTILATARRNSF
Sbjct  72   ISTAMAAAFFIVSDKTILATARRNSF  97



>gb|EMT32242.1| hypothetical protein F775_18516 [Aegilops tauschii]
Length=103

 Score =   104 bits (260),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             V+ A LDQ+LA AKR S E  +AGAKAA  AT+A A+PTLASVRM+PWARA+LNPT QA
Sbjct  3    TVTRAYLDQRLAAAKRCSKEATMAGAKAAAVATVAAAVPTLASVRMLPWARAHLNPTGQA  62

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            LI+ST AGMAYFIVADKTIL+ ARR+SF + 
Sbjct  63   LIISTVAGMAYFIVADKTILSMARRHSFDDA  93



>dbj|BAA83559.1| putative early nodulin [Oryza sativa Japonica Group]
 gb|EAY99600.1| hypothetical protein OsI_21578 [Oryza sativa Indica Group]
Length=116

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  AKNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTA  322
            A  V+ A LDQ+LA+AKR S E  +AG KAA  ATIA+A+PTLASVRMVPWA+AN+NPT 
Sbjct  2    ATTVTRAHLDQRLALAKRCSREANLAGVKAAAVATIASAVPTLASVRMVPWAKANINPTG  61

Query  323  QALIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            QALI+ TAAGMAYF+ ADK IL+ ARR+SF+N 
Sbjct  62   QALIICTAAGMAYFVAADKKILSLARRHSFENA  94



>ref|XP_006655776.1| PREDICTED: early nodulin-93-like [Oryza brachyantha]
Length=116

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  AKNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTA  322
            A  V+ A LDQKLA+AKR S E  +AG KAA  ATIA+A+PTLASVRM+PWA+AN+NPT 
Sbjct  2    ANTVTRAHLDQKLALAKRCSKEANIAGVKAAAGATIASAVPTLASVRMLPWAKANINPTG  61

Query  323  QALIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            QALI+ TAAGMAYF+ ADK IL+ ARR+SF+N 
Sbjct  62   QALIICTAAGMAYFVAADKKILSLARRHSFENA  94



>ref|XP_002437807.1| hypothetical protein SORBIDRAFT_10g002880 [Sorghum bicolor]
 gb|EER89174.1| hypothetical protein SORBIDRAFT_10g002880 [Sorghum bicolor]
Length=115

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             V+ ASLDQKLA+AKR S E  +AGAKAA  ATIA+AIPTLASVRM+PWA+AN+NPT QA
Sbjct  3    TVTRASLDQKLALAKRCSREATLAGAKAAAVATIASAIPTLASVRMLPWAKANINPTGQA  62

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFK  415
            LI+ST AGMAYFI ADK IL+ ARR+SF+
Sbjct  63   LIISTVAGMAYFIAADKKILSLARRHSFE  91



>ref|XP_007013369.1| Early nodulin-93 isoform 2 [Theobroma cacao]
 gb|EOY30988.1| Early nodulin-93 isoform 2 [Theobroma cacao]
Length=106

 Score =   103 bits (258),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +2

Query  179  LAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIVSTAAGMA  358
            LAMAKR SHEGV+AGAKAAV A+IATAIPTLASVRM+PWARANLN TAQALI+ST AG A
Sbjct  21   LAMAKRCSHEGVLAGAKAAVVASIATAIPTLASVRMLPWARANLNHTAQALIISTVAGAA  80

Query  359  YFIVADKTILATARRNSFKN  418
            YFIVADKT+LATAR+NSFK+
Sbjct  81   YFIVADKTVLATARKNSFKH  100



>gb|ABL85058.1| early nodulin protein [Brachypodium sylvaticum]
Length=111

 Score =   103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             VS A LDQ+LA AKR S E  +AGAKAA  AT+A A+PTLASVRMVPWARA+LNPT QA
Sbjct  4    TVSRAYLDQRLAAAKRCSKEAAMAGAKAAAVATVAAAVPTLASVRMVPWARAHLNPTGQA  63

Query  329  LIVSTAAGMAYFIVADKTILATARRNSF  412
            LI+ST AGMAYFIVADKT+L+ AR++SF
Sbjct  64   LIISTVAGMAYFIVADKTVLSMARKHSF  91



>ref|XP_003557202.1| PREDICTED: early nodulin-93-like [Brachypodium distachyon]
Length=121

 Score =   103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             VS A LDQ+LA AKR S E  +AGAKAA  AT+A A+PTLASVRM+PWARA+LNPT QA
Sbjct  4    TVSRAYLDQRLAAAKRCSKEAAMAGAKAAAVATVAAAVPTLASVRMLPWARAHLNPTGQA  63

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            LI+ST AGMAYFIVADKTIL+ AR++SF+  
Sbjct  64   LIISTVAGMAYFIVADKTILSMARKHSFEEA  94



>ref|XP_008659310.1| PREDICTED: uncharacterized protein LOC103638099 [Zea mays]
Length=215

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  AKNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTA  322
            +  VS ASLDQKLA+AKR S E  +AGAKAA  ATIA+AIPTLASVRM+PWA+AN+NPT 
Sbjct  101  STTVSRASLDQKLALAKRCSREATLAGAKAAAVATIASAIPTLASVRMLPWAKANINPTG  160

Query  323  QALIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            QALIVST AGMAYFI ADK IL+ ARR+SF+  
Sbjct  161  QALIVSTVAGMAYFIAADKKILSLARRHSFEQA  193



>ref|XP_006364908.1| PREDICTED: early nodulin-93-like [Solanum tuberosum]
Length=94

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = +2

Query  146  KNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQ  325
            KNVSL ++DQKLA+AK+YSHEGVVAGAKAAV A++ATAIP  A  +M PWA+  LNPTA+
Sbjct  3    KNVSLDAVDQKLALAKQYSHEGVVAGAKAAVVASVATAIPIYAFGKMSPWAKTYLNPTAK  62

Query  326  ALIVSTAAGMAYFIVADKTILATARRNSFK  415
            ALI+STAAGMAYF+VADKTIL  AR+NSFK
Sbjct  63   ALIISTAAGMAYFVVADKTILKIARQNSFK  92



>ref|XP_010049972.1| PREDICTED: early nodulin-93-like [Eucalyptus grandis]
 gb|KCW82808.1| hypothetical protein EUGRSUZ_C04179 [Eucalyptus grandis]
Length=100

 Score =   102 bits (255),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 87/102 (85%), Gaps = 4/102 (4%)
 Frame = +2

Query  143  AKNVSLASLDQ-KLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPT  319
            AKNV+ + L++   ++AK+ +HEGV+AGAKAAV A+IATAIPT+ASVRM+PWARANLN T
Sbjct  2    AKNVAQSPLERTSYSVAKQCAHEGVMAGAKAAVIASIATAIPTMASVRMLPWARANLNHT  61

Query  320  AQALIVSTAAGMAYFIVADKTILATARRNSFKNGSVSGNIQA  445
            AQALI+ST AG AYFIVADKT+LATARRNSFK  S   N++A
Sbjct  62   AQALIISTVAGAAYFIVADKTVLATARRNSFKRAS---NVEA  100



>ref|XP_010533179.1| PREDICTED: early nodulin-93-like [Tarenaya hassleriana]
Length=109

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +2

Query  155  SLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALI  334
            ++A+LD  LA+AKR + EGV+AGAKAA+ A  A A+PT+ASVRM+PWARANLN TAQALI
Sbjct  15   TVAALDHNLAIAKRCAQEGVLAGAKAAIVAGFAAAVPTMASVRMLPWARANLNHTAQALI  74

Query  335  VSTAAGMAYFIVADKTILATARRNSFK  415
            +STAAG AYFIVADKT+L TAR+NSFK
Sbjct  75   ISTAAGAAYFIVADKTVLKTARKNSFK  101



>gb|EMS61130.1| hypothetical protein TRIUR3_21694 [Triticum urartu]
Length=103

 Score =   102 bits (254),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             V+ A LDQ+LA AKR S E  +AGAKAA  AT+A A+PTLASVRM+PWA+A+LNPT QA
Sbjct  3    TVTRAYLDQRLAAAKRCSKEAAMAGAKAAAVATVAAAVPTLASVRMLPWAKAHLNPTGQA  62

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            LI+ST AGMAYFIVADKTIL+ AR++SF++ 
Sbjct  63   LIISTVAGMAYFIVADKTILSMARKHSFEDA  93



>gb|EMT32241.1| hypothetical protein F775_18515 [Aegilops tauschii]
Length=103

 Score =   102 bits (254),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             V+ A LDQ+LA AKR S E  +AGAKAA  AT+A A+PTLASVRM+PWA+A+LNPT QA
Sbjct  3    TVTRAHLDQRLAAAKRSSKEAAMAGAKAAAVATVAAAVPTLASVRMLPWAKAHLNPTGQA  62

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            LI+ST AGMAYFIVADKTIL+ AR++S++  
Sbjct  63   LIISTVAGMAYFIVADKTILSMARKHSYETA  93



>ref|NP_001056762.1| Os06g0141700 [Oryza sativa Japonica Group]
 dbj|BAA83560.1| putative early nodulin [Oryza sativa Japonica Group]
 dbj|BAF18676.1| Os06g0141700 [Oryza sativa Japonica Group]
 dbj|BAH00659.1| unnamed protein product [Oryza sativa Japonica Group]
Length=115

 Score =   102 bits (255),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             V+ A LDQKLA+AKR S E  +AGAKAA  AT+A+A+PTLASVRM+PWA+AN+NPT QA
Sbjct  3    TVTRAYLDQKLALAKRCSREATLAGAKAAAVATVASAVPTLASVRMLPWAKANINPTGQA  62

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            LI+ TAAGMAYF+ ADK IL+ ARR+SF+N 
Sbjct  63   LIICTAAGMAYFVAADKKILSLARRHSFENA  93



>ref|XP_003524536.1| PREDICTED: early nodulin-93-like [Glycine max]
 gb|KHN27412.1| Early nodulin-93 [Glycine soja]
Length=106

 Score =   102 bits (254),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 79/93 (85%), Gaps = 1/93 (1%)
 Frame = +2

Query  146  KNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQ  325
            +  SLASL QKLAMAKR S +GV+AGAK AVAA+IATAIPTLASVRM+PWARANLN TAQ
Sbjct  13   ETTSLASLHQKLAMAKRCS-QGVMAGAKTAVAASIATAIPTLASVRMLPWARANLNHTAQ  71

Query  326  ALIVSTAAGMAYFIVADKTILATARRNSFKNGS  424
            ALI+ST  G AYFI ADKT+LATAR+NSF   S
Sbjct  72   ALIISTVTGAAYFIEADKTVLATARKNSFNQPS  104



>ref|XP_010688054.1| PREDICTED: early nodulin-93-like [Beta vulgaris subsp. vulgaris]
Length=147

 Score =   103 bits (257),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 79/97 (81%), Gaps = 1/97 (1%)
 Frame = +2

Query  155  SLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALI  334
            SLA  DQ+L MAKR +HEGV+AGAKAAV +  A AIPT+AS RM+PWA+ANLN TAQALI
Sbjct  52   SLAPFDQRLTMAKRCAHEGVLAGAKAAVVSGFAAAIPTIASARMLPWAKANLNHTAQALI  111

Query  335  VSTAAGMAYFIVADKTILATARRNSFKNGSVSGNIQA  445
            +ST AG AYFIVADKT+L +ARRNSF N + + NI A
Sbjct  112  ISTVAGAAYFIVADKTVLKSARRNSF-NQAGNSNIGA  147



>ref|XP_003557201.1| PREDICTED: early nodulin-93-like [Brachypodium distachyon]
Length=127

 Score =   102 bits (255),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             V+ A LD+KLA+AKR S E  +AGAKAA  AT+A+A+PTLASVRM+PWA+ANLNPT QA
Sbjct  3    TVTGAYLDRKLALAKRCSREATLAGAKAAAVATVASAVPTLASVRMLPWAKANLNPTGQA  62

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            LIV TAAGMAYF+ ADKTIL+ ARR+SF+  
Sbjct  63   LIVCTAAGMAYFVAADKTILSLARRHSFEEA  93



>gb|EEE65062.1| hypothetical protein OsJ_20076 [Oryza sativa Japonica Group]
Length=157

 Score =   103 bits (257),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             V+ A LDQKLA+AKR S E  +AGAKAA  AT+A+A+PTLASVRM+PWA+AN+NPT QA
Sbjct  45   TVTRAYLDQKLALAKRCSREATLAGAKAAAVATVASAVPTLASVRMLPWAKANINPTGQA  104

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            LI+ TAAGMAYF+ ADK IL+ ARR+SF+N 
Sbjct  105  LIICTAAGMAYFVAADKKILSLARRHSFENA  135



>ref|XP_008385798.1| PREDICTED: early nodulin-93-like [Malus domestica]
 ref|XP_008354378.1| PREDICTED: early nodulin-93-like [Malus domestica]
Length=103

 Score =   101 bits (252),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 74/83 (89%), Gaps = 1/83 (1%)
 Frame = +2

Query  164  SLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIVST  343
            S+DQ LA+AK  S EGV AGAKAAV ATIATAIPTL SVRM+PWAR NLNPTAQALI+ST
Sbjct  14   SIDQ-LALAKHCSREGVKAGAKAAVVATIATAIPTLVSVRMLPWARTNLNPTAQALIIST  72

Query  344  AAGMAYFIVADKTILATARRNSF  412
             AGMAYFIVADKT+LATARRNSF
Sbjct  73   VAGMAYFIVADKTVLATARRNSF  95



>ref|XP_006655775.1| PREDICTED: early nodulin-93-like [Oryza brachyantha]
Length=115

 Score =   101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 78/102 (76%), Gaps = 7/102 (7%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             VS A LDQKLA+AKR S E  +AGAKAA  AT+A+A+PTLASVRM+PWA+AN+NPT QA
Sbjct  3    TVSRAYLDQKLALAKRCSREATLAGAKAAAVATVASAVPTLASVRMLPWAKANINPTGQA  62

Query  329  LIVSTAAGMAYFIVADKTILATARRNSF-------KNGSVSG  433
            LI+ TAAGMAYF+ ADK IL+ ARR+SF       KN S  G
Sbjct  63   LIICTAAGMAYFVAADKKILSLARRHSFEAAPEHLKNTSFQG  104



>dbj|BAK07913.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=120

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
            +V+ A LD KLA+AKR S E  +AGAKAA  AT+A+A+PTLASVRM+PWA+ANLNPT QA
Sbjct  3    SVTSAHLDHKLALAKRCSREATLAGAKAAAVATVASAVPTLASVRMLPWAKANLNPTGQA  62

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            LIV T AGMAYFI ADKTIL+ ARR+S+++ 
Sbjct  63   LIVCTVAGMAYFIAADKTILSLARRHSYESA  93



>ref|NP_001056768.1| Os06g0142400 [Oryza sativa Japonica Group]
 dbj|BAA83568.1| putative early nodulin [Oryza sativa Japonica Group]
 dbj|BAF18682.1| Os06g0142400 [Oryza sativa Japonica Group]
 gb|EAY99608.1| hypothetical protein OsI_21586 [Oryza sativa Indica Group]
 gb|EAZ35792.1| hypothetical protein OsJ_20084 [Oryza sativa Japonica Group]
 dbj|BAH00986.1| unnamed protein product [Oryza sativa Japonica Group]
Length=115

 Score =   100 bits (250),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             V+ A L+Q+LA+AKR S E  +AG KAA  ATIA+A+PTLASVRM+PWA+AN+NPT QA
Sbjct  3    TVTRAHLEQRLALAKRCSREANIAGVKAAAVATIASAVPTLASVRMLPWAKANINPTGQA  62

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            LI+ TAAGMAYF+ ADK IL+ ARR+SF+N 
Sbjct  63   LIICTAAGMAYFVAADKKILSLARRHSFENA  93



>dbj|BAA83567.1| putative early nodulin [Oryza sativa Japonica Group]
 gb|EAY99607.1| hypothetical protein OsI_21585 [Oryza sativa Indica Group]
 gb|EAZ35791.1| hypothetical protein OsJ_20083 [Oryza sativa Japonica Group]
Length=116

 Score =   100 bits (250),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             V+ A L+Q+LA+AKR S E  +AG KAA  ATIA+A+PTLASVRM+PWA+AN+NPT QA
Sbjct  4    TVTRAHLEQRLALAKRCSREANLAGVKAAAVATIASAVPTLASVRMLPWAKANINPTGQA  63

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            LI+ TAAGMAYF+ ADK IL+ ARR+SF+N 
Sbjct  64   LIICTAAGMAYFVAADKKILSLARRHSFENA  94



>ref|NP_001056766.2| Os06g0142200 [Oryza sativa Japonica Group]
 dbj|BAA33813.1| early nodulin [Oryza sativa Japonica Group]
 dbj|BAA33814.1| early nodulin [Oryza sativa Japonica Group]
 dbj|BAA83565.1| putative early nodulin [Oryza sativa Japonica Group]
 dbj|BAH00828.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF18680.2| Os06g0142200 [Oryza sativa Japonica Group]
Length=115

 Score =   100 bits (250),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             V+ A L+Q+LA+AKR S E  +AG KAA  ATIA+A+PTLASVRM+PWA+AN+NPT QA
Sbjct  3    TVTRAHLEQRLALAKRCSREANIAGVKAAAVATIASAVPTLASVRMLPWAKANINPTGQA  62

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            LI+ TAAGMAYF+ ADK IL+ ARR+SF+N 
Sbjct  63   LIICTAAGMAYFVAADKKILSLARRHSFENA  93



>gb|AAD30134.1|AF140229_1 early nodulin [Oryza sativa]
Length=136

 Score =   101 bits (251),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  AKNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTA  322
            +  V+ A L+Q+LA+AKR S E  +AG KAA  ATIA+A+PTLASVRM+PWA+AN+NPT 
Sbjct  36   STTVTRAHLEQRLALAKRCSREANIAGVKAAAVATIASAVPTLASVRMLPWAKANINPTG  95

Query  323  QALIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            QALI+ TAAGMAYF+ ADK IL+ ARR+SF+N 
Sbjct  96   QALIICTAAGMAYFVAADKKILSLARRHSFENA  128



>gb|ABL85059.1| early nodulin protein [Brachypodium sylvaticum]
Length=133

 Score =   100 bits (250),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             V+ A LD+KLA+AKR S E  +AGAKAA  AT+A+A+PTLASVRM+PWA+A+LNPT QA
Sbjct  3    TVTGAYLDRKLALAKRCSREATLAGAKAAAVATVASAVPTLASVRMLPWAKAHLNPTGQA  62

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            LIV TAAGMAYF+ ADKTIL+ ARR+SF+  
Sbjct  63   LIVCTAAGMAYFVAADKTILSLARRHSFEEA  93



>ref|NP_001174593.1| Os06g0142350 [Oryza sativa Japonica Group]
 dbj|BAH93321.1| Os06g0142350, partial [Oryza sativa Japonica Group]
Length=154

 Score =   101 bits (251),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  AKNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTA  322
            +  V+ A L+Q+LA+AKR S E  +AG KAA  ATIA+A+PTLASVRM+PWA+AN+NPT 
Sbjct  40   STTVTRAHLEQRLALAKRCSREANLAGVKAAAVATIASAVPTLASVRMLPWAKANINPTG  99

Query  323  QALIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            QALI+ TAAGMAYF+ ADK IL+ ARR+SF+N 
Sbjct  100  QALIICTAAGMAYFVAADKKILSLARRHSFENA  132



>dbj|BAK06178.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=133

 Score =   100 bits (249),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
            +V+ A LD KLA+AKR S E  +AGAKAA  AT+A+A+PTLASVRM+PWA+ANLNPT QA
Sbjct  18   SVTRAHLDHKLALAKRCSREATLAGAKAAAVATVASAVPTLASVRMLPWAKANLNPTGQA  77

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            LIV T AGMAYF+ ADKTIL+ ARR+S+++ 
Sbjct  78   LIVCTVAGMAYFVAADKTILSLARRHSYESA  108



>ref|XP_004167345.1| PREDICTED: early nodulin-93-like [Cucumis sativus]
Length=111

 Score = 99.8 bits (247),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = +2

Query  155  SLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALI  334
            ++AS D K+AMAKR + EGV+AGAKAA  A+IATAIPT ASVRM+PWA+A+LN TAQALI
Sbjct  14   NMASHDPKVAMAKRCAKEGVIAGAKAAAIASIATAIPTFASVRMLPWAKAHLNHTAQALI  73

Query  335  VSTAAGMAYFIVADKTILATARRNSFK  415
            +ST AG AYFIVADKT+LATARRNSFK
Sbjct  74   ISTVAGAAYFIVADKTVLATARRNSFK  100



>ref|XP_004139321.1| PREDICTED: early nodulin-93-like [Cucumis sativus]
 gb|KGN60663.1| Early nodulin 93 protein [Cucumis sativus]
Length=111

 Score = 99.8 bits (247),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = +2

Query  155  SLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALI  334
            ++AS D K+AMAKR + EGV+AGAKAA  A+IATAIPT ASVRM+PWA+A+LN TAQALI
Sbjct  14   NIASHDPKVAMAKRCAKEGVIAGAKAAAIASIATAIPTFASVRMLPWAKAHLNHTAQALI  73

Query  335  VSTAAGMAYFIVADKTILATARRNSFK  415
            +ST AG AYFIVADKT+LATARRNSFK
Sbjct  74   ISTVAGAAYFIVADKTVLATARRNSFK  100



>ref|XP_008457774.1| PREDICTED: early nodulin-93-like [Cucumis melo]
Length=149

 Score =   100 bits (249),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +2

Query  158  LASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIV  337
            LAS D K+AMAKR + EGV+AGAKAA  A+IATAIPT ASVRM+PWA+A+LN TAQALI+
Sbjct  53   LASHDPKVAMAKRCAREGVIAGAKAAAIASIATAIPTFASVRMLPWAKAHLNHTAQALII  112

Query  338  STAAGMAYFIVADKTILATARRNSFK  415
            ST AG AYFIVADKT+LATARRNSFK
Sbjct  113  STVAGAAYFIVADKTVLATARRNSFK  138



>ref|XP_006655774.1| PREDICTED: early nodulin-93-like [Oryza brachyantha]
Length=116

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             V+ A LDQ+LA+AKR S E  +AG KAA  ATIA+A+PTLASVRM+PWA+AN+NPT QA
Sbjct  4    TVTRAYLDQRLALAKRCSREANLAGVKAAAVATIASAVPTLASVRMLPWAKANINPTGQA  63

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFK  415
            LI+ TAAGMAYF+ ADK IL+ ARR+SF+
Sbjct  64   LIICTAAGMAYFVAADKKILSLARRHSFE  92



>ref|NP_001056767.2| Os06g0142300 [Oryza sativa Japonica Group]
 dbj|BAA83566.1| putative early nodulin [Oryza sativa Japonica Group]
 gb|EEC79966.1| hypothetical protein OsI_21584 [Oryza sativa Indica Group]
 dbj|BAF18681.2| Os06g0142300 [Oryza sativa Japonica Group]
Length=115

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             V+ A LDQKLA+AKR S E  +AGAKAA  AT+A+A+PTLASVRM+PWA+AN+NPT QA
Sbjct  3    TVTRAYLDQKLALAKRCSREATLAGAKAAAVATVASAVPTLASVRMLPWAKANINPTGQA  62

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFK  415
            LI+ TAAGMAYF+ ADK IL+ AR++SF+
Sbjct  63   LIICTAAGMAYFVAADKKILSLARKHSFE  91



>gb|EMT32244.1| hypothetical protein F775_30863 [Aegilops tauschii]
Length=103

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             V+ A LDQ+LA A R S E  +AGAKAA  AT+A A+PTLASVRM+PWA+A+LNPT QA
Sbjct  3    TVNRAYLDQRLAAANRCSKEAAMAGAKAAAVATVAAAVPTLASVRMLPWAKAHLNPTGQA  62

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            LI+ST AGMAYFIVADKTIL+ AR++SF + 
Sbjct  63   LIISTVAGMAYFIVADKTILSMARKHSFDDA  93



>ref|XP_010688052.1| PREDICTED: early nodulin-93-like [Beta vulgaris subsp. vulgaris]
Length=109

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +2

Query  155  SLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALI  334
            +L +LDQ+LA+AK+ SH+GV+AGAKAAV A  ATAIPT+AS RM+PWARANLN TAQALI
Sbjct  14   NLVALDQRLAIAKQCSHDGVLAGAKAAVVAGFATAIPTIASARMLPWARANLNHTAQALI  73

Query  335  VSTAAGMAYFIVADKTILATARRNSF  412
            +ST AG AYFIVADKT+L +AR+NSF
Sbjct  74   ISTVAGAAYFIVADKTVLKSARQNSF  99



>ref|XP_004964510.1| PREDICTED: early nodulin-93-like [Setaria italica]
Length=115

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             V+ A LDQ+LAMAKR S E  +AGAKAA  AT+A+A+PTLASVRM+PWA+ANLNPT QA
Sbjct  3    TVTRAYLDQRLAMAKRCSREATLAGAKAAAVATVASAVPTLASVRMLPWAKANLNPTGQA  62

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            LI+ T AGMAYF+  DK IL+ ARR+SF+  
Sbjct  63   LIICTVAGMAYFVATDKKILSLARRHSFEEA  93



>ref|XP_008390004.1| PREDICTED: early nodulin-93-like, partial [Malus domestica]
Length=78

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSF  412
            PTLASVRM+PWARANLNP AQALI+ST AGMAYFIVADKTILATARRNSF
Sbjct  21   PTLASVRMLPWARANLNPXAQALIISTVAGMAYFIVADKTILATARRNSF  70



>gb|EAZ35790.1| hypothetical protein OsJ_20082 [Oryza sativa Japonica Group]
Length=122

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             V+ A LDQKLA+AKR S E  +AGAKAA  AT+A+A+PTLASVRM+PWA+AN+NPT QA
Sbjct  10   TVTRAYLDQKLALAKRCSREATLAGAKAAAVATVASAVPTLASVRMLPWAKANINPTGQA  69

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            LI+ TAAGMAYF+ ADK IL+ AR++SF+  
Sbjct  70   LIICTAAGMAYFVAADKKILSLARKHSFEGA  100



>gb|EEC79963.1| hypothetical protein OsI_21579 [Oryza sativa Indica Group]
Length=112

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 70/90 (78%), Gaps = 3/90 (3%)
 Frame = +2

Query  152  VSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQAL  331
            V+ A LDQKLA+AKR S E  +AGAKAA  A+     PTLASVRM+PWA+AN+NPT QAL
Sbjct  4    VTRAYLDQKLALAKRCSREATLAGAKAATVASAV---PTLASVRMLPWAKANINPTGQAL  60

Query  332  IVSTAAGMAYFIVADKTILATARRNSFKNG  421
            I+ TAAGM YF+ ADK IL+ ARR+SF+N 
Sbjct  61   IICTAAGMTYFVAADKKILSLARRHSFENA  90



>gb|EMT29548.1| hypothetical protein F775_15200 [Aegilops tauschii]
Length=103

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             V+ A LDQ+LA+A R S E  +AGAKAA  AT+A A+PTLAS RM+PWARA+LNPT QA
Sbjct  3    TVTRAYLDQRLAVANRCSKEAAMAGAKAAAVATVAAAVPTLASARMLPWARAHLNPTGQA  62

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            LI+ST AGMAYFIVADKTIL+ AR++S++  
Sbjct  63   LIISTVAGMAYFIVADKTILSMARKHSYETA  93



>gb|ACH58421.1| nodulin 93 [Prunus dulcis]
Length=50

 Score = 95.5 bits (236),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +2

Query  269  LASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSFK  415
            +ASVRM+PWARANLNPTAQALI+ST AGMAYFIVADKT+LATARRNSFK
Sbjct  1    MASVRMLPWARANLNPTAQALIISTVAGMAYFIVADKTVLATARRNSFK  49



>gb|EMS50054.1| hypothetical protein TRIUR3_13855 [Triticum urartu]
Length=122

 Score = 97.1 bits (240),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             V+ A L+ KLA+AKR S E  +AGAKAA  AT+A+A+PTLASVRM+PWA+ANLNPT QA
Sbjct  6    TVTRAHLENKLALAKRCSREATLAGAKAAAVATVASAVPTLASVRMLPWAKANLNPTGQA  65

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            LIV T AGMAYFI ADK IL+ ARR+S+++ 
Sbjct  66   LIVCTVAGMAYFIAADKAILSLARRHSYESA  96



>ref|XP_002437804.1| hypothetical protein SORBIDRAFT_10g002850 [Sorghum bicolor]
 gb|EER89171.1| hypothetical protein SORBIDRAFT_10g002850 [Sorghum bicolor]
Length=117

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +2

Query  137  MAAKNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNP  316
            M    V+ AS+DQ LA+AK+ S E  +AG KAA   T+A+ IPTL SVRM+PWA+AN+NP
Sbjct  1    MPNTTVTSASVDQNLALAKQCSREAAIAGFKAAAIGTVASGIPTLVSVRMLPWAKANINP  60

Query  317  TAQALIVSTAAGMAYFIVADKTILATARRNSFKN  418
              QALI+ST AGMAYFI ADK ILA AR++S++N
Sbjct  61   AGQALIISTVAGMAYFIAADKKILALARQHSYEN  94



>ref|XP_008337324.1| PREDICTED: early nodulin-93-like [Malus domestica]
Length=60

 Score = 94.0 bits (232),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +2

Query  269  LASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSF  412
            +ASVRM+PWARANLNPTAQALI+ST AGMAYFIVADKTILATARRNSF
Sbjct  1    MASVRMLPWARANLNPTAQALIISTVAGMAYFIVADKTILATARRNSF  48



>ref|NP_001145575.1| uncharacterized protein LOC100279040 [Zea mays]
 gb|ACG48626.1| hypothetical protein [Zea mays]
Length=116

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  VSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQAL  331
            V+ ASLDQ L +AK+ S E  +AG KAA  AT+A+A+PTLASVRM+PWA+AN+NP  QAL
Sbjct  5    VNSASLDQNLELAKQCSREAALAGFKAAAVATVASAVPTLASVRMLPWAKANINPAGQAL  64

Query  332  IVSTAAGMAYFIVADKTILATARRNSFKNG  421
            IVST AGMAYFI ADK IL+ AR++S++N 
Sbjct  65   IVSTVAGMAYFIAADKKILSLARQHSYENA  94



>gb|EMT32240.1| hypothetical protein F775_30861 [Aegilops tauschii]
Length=127

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             V+ A L+ KLA+AKR S E  +AGAKAA  AT+A+A+PTLASVRM+PWARA+LNPT QA
Sbjct  9    TVTRAHLENKLALAKRCSREATLAGAKAAAIATVASAVPTLASVRMLPWARAHLNPTGQA  68

Query  329  LIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            L+V T AGMAYF+ ADK IL+ ARR+S+++ 
Sbjct  69   LVVCTVAGMAYFVAADKAILSLARRHSYESA  99



>gb|AFW75469.1| hypothetical protein ZEAMMB73_751741 [Zea mays]
Length=116

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  VSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQAL  331
            V+ ASLDQ L +AK+ S E  +AG KAA  AT+A+A+PTL SVRM+PWA+AN+NP  QAL
Sbjct  5    VNSASLDQNLELAKQCSREAALAGFKAAAVATVASAVPTLVSVRMLPWAKANINPAGQAL  64

Query  332  IVSTAAGMAYFIVADKTILATARRNSFKNG  421
            IVST AGMAYFI ADK IL+ AR++S++N 
Sbjct  65   IVSTVAGMAYFIAADKKILSLARQHSYENA  94



>ref|XP_004964508.1| PREDICTED: early nodulin-93-like [Setaria italica]
Length=116

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +2

Query  167  LDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIVSTA  346
            L+Q+LAMAK+ S E  + GAKAAVAATI +AIPTLASVRM PWA AN+NP  QALI+ST 
Sbjct  10   LEQQLAMAKKSSREAALTGAKAAVAATIVSAIPTLASVRMSPWATANINPAGQALIISTV  69

Query  347  AGMAYFIVADKTILATARRNSFKNG  421
            AGMAYFI ADK IL  AR++S++N 
Sbjct  70   AGMAYFIAADKKILLLARKHSYENA  94



>gb|EMS67158.1| hypothetical protein TRIUR3_21254 [Triticum urartu]
Length=79

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            PTLASVRM+PWA+ANLNPT QALI+ST AGMAYFIVADKTIL+ AR++SF++ 
Sbjct  17   PTLASVRMLPWAKANLNPTGQALIISTVAGMAYFIVADKTILSMARKHSFQDA  69



>ref|XP_002437805.1| hypothetical protein SORBIDRAFT_10g002860 [Sorghum bicolor]
 gb|EER89172.1| hypothetical protein SORBIDRAFT_10g002860 [Sorghum bicolor]
Length=117

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +2

Query  137  MAAKNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNP  316
            M    V+ AS+DQ LA+AK+ S E  +AG KAA   T+A+ I TL SVRM+PWA+AN+NP
Sbjct  1    MPPNTVTSASVDQNLALAKQCSREAALAGFKAAAIGTVASGIATLVSVRMLPWAKANINP  60

Query  317  TAQALIVSTAAGMAYFIVADKTILATARRNSFKN  418
              QALI+ST AGMAYFI ADK ILA AR++S++N
Sbjct  61   AGQALIISTVAGMAYFIAADKKILALARQHSYEN  94



>gb|EAY99605.1| hypothetical protein OsI_21583 [Oryza sativa Indica Group]
 gb|EAZ35789.1| hypothetical protein OsJ_20081 [Oryza sativa Japonica Group]
Length=124

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 75/100 (75%), Gaps = 9/100 (9%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPT---------LASVRMVPWAR  301
             V+ A L+Q+LA+AKR S E  +AG KAA  ATIA+A+PT         LASVRM+PWA+
Sbjct  3    TVTRAHLEQRLALAKRCSREANIAGVKAAAVATIASAVPTSSFISRAHQLASVRMLPWAK  62

Query  302  ANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            AN+NPT QALI+ TAAGMAYF+ ADK IL+ ARR+SF+N 
Sbjct  63   ANINPTGQALIICTAAGMAYFVAADKKILSLARRHSFENA  102



>gb|EMT32243.1| hypothetical protein F775_30862 [Aegilops tauschii]
Length=79

 Score = 91.3 bits (225),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            PTLASVRM+PWARA+LNPT QALI+ST AGMAYFIVADKTIL+ AR++SF + 
Sbjct  17   PTLASVRMLPWARAHLNPTGQALIISTVAGMAYFIVADKTILSMARKHSFDDA  69



>gb|EMT32245.1| hypothetical protein F775_08718 [Aegilops tauschii]
Length=79

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            PTLASVRM+PWARA+LNPT +ALI+ST AGMAYFIVADKTIL+ AR++SF + 
Sbjct  17   PTLASVRMLPWARAHLNPTGKALIISTVAGMAYFIVADKTILSMARKHSFDDA  69



>gb|KHN27414.1| Early nodulin-93 [Glycine soja]
Length=56

 Score = 89.0 bits (219),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +2

Query  269  LASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSFKNGS  424
            LASVR +PWARANLNPTAQALI+ST AG AYFIVADKT+LATAR+NSF   S
Sbjct  3    LASVRTIPWARANLNPTAQALIISTVAGAAYFIVADKTVLATARKNSFNPPS  54



>ref|XP_010250018.1| PREDICTED: early nodulin-93-like isoform X1 [Nelumbo nucifera]
Length=92

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 49/56 (88%), Gaps = 3/56 (5%)
 Frame = +2

Query  278  VRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSFKNGSVSGNIQA  445
            VRM PWARANLNPTAQALI+ST AG AYFIVADKT+LATARRNSFK+ +   NIQA
Sbjct  40   VRMFPWARANLNPTAQALIISTVAGSAYFIVADKTVLATARRNSFKDCT---NIQA  92



>gb|EMS50053.1| hypothetical protein TRIUR3_13854 [Triticum urartu]
Length=101

 Score = 88.6 bits (218),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             V+ A L+ KLA+A+R S E  +AGAKAA  AT+A+A+PTLASVRM+PWA+ANLNPT QA
Sbjct  6    TVTRAHLENKLALARRCSREATLAGAKAAAIATVASAVPTLASVRMLPWAKANLNPTGQA  65

Query  329  LIVSTAAGMAYFIVADKTILATARRN  406
            LIV T AGMAYF+ ADKT+L+ A ++
Sbjct  66   LIVCTVAGMAYFVAADKTLLSPATKS  91



>gb|EMS50052.1| hypothetical protein TRIUR3_13853 [Triticum urartu]
Length=109

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 69/97 (71%), Gaps = 6/97 (6%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             V+ A  DQ+LA  +R S E  +AG+KAA  A +A  +PTLASVRM+PW +A+LNPT Q 
Sbjct  3    TVTRAYHDQRLAAGRRCSKEAAMAGSKAAAVAIVAAVVPTLASVRMLPWVKAHLNPTGQV  62

Query  329  LIVSTAAGMAYFIVADKTILAT------ARRNSFKNG  421
            L++ST AGMAYFIVADKTILA       AR NSF++ 
Sbjct  63   LVISTVAGMAYFIVADKTILADKTILSMARNNSFEDA  99



>gb|ACG48865.1| early nodulin 93 [Zea mays]
 gb|ACG48983.1| early nodulin 93 [Zea mays]
 gb|AFW85922.1| early nodulin 93 [Zea mays]
Length=105

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            PTLASVRM+PWA+AN+NPT QALIVST AGMAYFI ADK IL+ ARR+SF+  
Sbjct  31   PTLASVRMLPWAKANINPTGQALIVSTVAGMAYFIAADKKILSLARRHSFEQA  83



>gb|ACG24380.1| early nodulin 93 [Zea mays]
Length=101

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 48/65 (74%), Gaps = 7/65 (11%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSF-------KNG  421
            PTLASVRM+PW +AN+NPT QALIVST AGMAYFI ADK IL+ ARR+SF       KN 
Sbjct  27   PTLASVRMLPWVKANINPTGQALIVSTVAGMAYFIAADKKILSLARRHSFDQAPEHLKNT  86

Query  422  SVSGN  436
            S  G 
Sbjct  87   SFQGT  91



>gb|EMT29547.1| hypothetical protein F775_24367 [Aegilops tauschii]
Length=142

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 77/123 (63%), Gaps = 33/123 (27%)
 Frame = +2

Query  149  NVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQA  328
             V+ A L+ KLA+AKR S E  +AGAKAA  AT+A+A+PTLASVRM+PWA+ANLNPT QA
Sbjct  6    TVTRAHLENKLALAKRCSREATLAGAKAAAVATVASAVPTLASVRMLPWAKANLNPTGQA  65

Query  329  LIV---------------------------------STAAGMAYFIVADKTILATARRNS  409
            LIV                                 ST AGMAYF+VADKTIL+ AR++S
Sbjct  66   LIVCTAGDGVAEAAMAGAKAAAVATVAAAVPIALIISTVAGMAYFVVADKTILSMARKHS  125

Query  410  FKN  418
            F++
Sbjct  126  FQD  128



>gb|EAZ35784.1| hypothetical protein OsJ_20075 [Oryza sativa Japonica Group]
Length=97

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 58/93 (62%), Gaps = 19/93 (20%)
 Frame = +2

Query  143  AKNVSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTA  322
            A  V+ A LDQ+LA+++                         LASVRMVPWA+AN+NPT 
Sbjct  2    ATTVTRAHLDQRLALSQALLQGY-------------------LASVRMVPWAKANINPTG  42

Query  323  QALIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            QALI+ TAAGMAYF+ ADK IL+ ARR+SF+N 
Sbjct  43   QALIICTAAGMAYFVAADKKILSLARRHSFENA  75



>ref|XP_004964507.1| PREDICTED: early nodulin-93-like [Setaria italica]
Length=116

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +2

Query  164  SLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIVST  343
            SLD++ A+AK+ S E  +AGAKAA  AT+ATAIPTLASVRM  WA+AN+NP  QALI+ST
Sbjct  9    SLDEQRALAKQCSREAALAGAKAAAIATVATAIPTLASVRMSRWAKANINPAGQALIIST  68

Query  344  AAGMAYFIVADKTILATARRNSFKNG  421
             AGMAYFI ADK +L+ AR++S++N 
Sbjct  69   VAGMAYFIAADKKVLSLARQHSYENA  94



>ref|NP_001056761.1| Os06g0141600 [Oryza sativa Japonica Group]
 dbj|BAF18675.1| Os06g0141600 [Oryza sativa Japonica Group]
 dbj|BAG87116.1| unnamed protein product [Oryza sativa Japonica Group]
Length=139

 Score = 84.3 bits (207),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +2

Query  269  LASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            LASVRMVPWA+AN+NPT QALI+ TAAGMAYF+ ADK IL+ ARR+SF+N 
Sbjct  67   LASVRMVPWAKANINPTGQALIICTAAGMAYFVAADKKILSLARRHSFENA  117



>gb|EMS61159.1| hypothetical protein TRIUR3_18822 [Triticum urartu]
Length=77

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSFKNG  421
            P LASVRM+PW  A+LNPT QALI+ST AGMAYFI+ADK IL  AR++SF++ 
Sbjct  15   PKLASVRMLPWESAHLNPTGQALIISTVAGMAYFIIADKIILLMARKHSFEDA  67



>gb|EMS35732.1| hypothetical protein TRIUR3_26870 [Triticum urartu]
Length=61

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  LASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNS  409
            +ASVRM+PW RA+LNPT QALI+ST AGMAYFIVADKTIL+ AR++S
Sbjct  1    MASVRMLPWVRAHLNPTGQALIISTVAGMAYFIVADKTILSMARKHS  47



>ref|XP_004148399.1| PREDICTED: early nodulin-93-like [Cucumis sativus]
 ref|XP_004162973.1| PREDICTED: early nodulin-93-like [Cucumis sativus]
 gb|KGN62792.1| hypothetical protein Csa_2G372870 [Cucumis sativus]
Length=116

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +2

Query  170  DQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIVSTAA  349
            D+K+A AKR + EGV AG K A  A +A+A+PTL +VR+VPWA+ANLN TAQALI+S A+
Sbjct  26   DRKIANAKRCTQEGVRAGFKNASIACVASAVPTLVAVRVVPWAKANLNYTAQALIISAAS  85

Query  350  GMAYFIVADKTILATARRNS  409
              AYFI ADKTIL  ARRNS
Sbjct  86   IAAYFITADKTILECARRNS  105



>ref|XP_008444985.1| PREDICTED: early nodulin-93-like [Cucumis melo]
Length=116

 Score = 78.6 bits (192),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +2

Query  170  DQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIVSTAA  349
            ++K+A AKR + EGV AG K A  A +A+A+PTL +VR+VPWA+ANLN TAQALI+S A+
Sbjct  26   ERKIANAKRCTQEGVRAGFKNASIACVASAVPTLVAVRVVPWAKANLNYTAQALIISAAS  85

Query  350  GMAYFIVADKTILATARRNS  409
              AYFI ADKTIL  ARRNS
Sbjct  86   IAAYFITADKTILECARRNS  105



>gb|EMS61131.1| hypothetical protein TRIUR3_21695 [Triticum urartu]
Length=90

 Score = 77.4 bits (189),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSFKN  418
            PTLASVRM+ WARA+L P  Q LI+ST  GMAYFIVA+KTIL+ AR++SF++
Sbjct  17   PTLASVRMLSWARAHLIPNGQGLIISTVTGMAYFIVANKTILSMARKHSFED  68



>ref|XP_002525450.1| Early nodulin, putative [Ricinus communis]
 gb|EEF36940.1| Early nodulin, putative [Ricinus communis]
Length=128

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +2

Query  170  DQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIVSTAA  349
            DQ++  A+R + EGV AGAKAA  A +A+AIPTL +VR++PWA+ANLN TAQALI+S A+
Sbjct  43   DQRILEARRCTQEGVKAGAKAAAVAAVASAIPTLVAVRVIPWAKANLNYTAQALIISAAS  102

Query  350  GMAYFIVADKTILATARRNS  409
              AYFI ADKTIL  ARRN+
Sbjct  103  ISAYFITADKTILECARRNA  122



>ref|XP_006288877.1| hypothetical protein CARUB_v10002236mg, partial [Capsella rubella]
 gb|EOA21775.1| hypothetical protein CARUB_v10002236mg, partial [Capsella rubella]
Length=135

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNS  409
            PTLA+VRM+PWA+ANLN TAQALIVS+A+  A+FI ADKTIL  ARRN+
Sbjct  75   PTLAAVRMIPWAKANLNYTAQALIVSSASIAAFFITADKTILQGARRNT  123



>gb|KDP20271.1| hypothetical protein JCGZ_06857 [Jatropha curcas]
Length=125

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 67/88 (76%), Gaps = 0/88 (0%)
 Frame = +2

Query  170  DQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIVSTAA  349
            DQ++  A+R + EGV AGAKAA  A +A+ +PTL +VR++PWA+ANLN TAQALI+S A+
Sbjct  35   DQRILEARRCTQEGVRAGAKAAAVACVASTVPTLVAVRVIPWAKANLNYTAQALIISAAS  94

Query  350  GMAYFIVADKTILATARRNSFKNGSVSG  433
              AYFI ADKTIL  ARRN+  + +++ 
Sbjct  95   IAAYFITADKTILECARRNAQYDKTINA  122



>ref|XP_004498454.1| PREDICTED: early nodulin-93-like [Cicer arietinum]
Length=120

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +2

Query  170  DQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIVSTAA  349
            ++KL  +K+ +HEGV+AG KAA  A + +A+PTL +VR +PWA+ANLN TAQALI+S A+
Sbjct  26   ERKLLRSKKCTHEGVIAGFKAASVACVVSAVPTLTAVRKIPWAKANLNYTAQALIISAAS  85

Query  350  GMAYFIVADKTILATARRNSFKNGSVSGN  436
              AYFI ADKTIL  AR+N+    S+  N
Sbjct  86   IAAYFITADKTILECARKNAQLENSLRHN  114



>ref|XP_007012195.1| Early nodulin-93, putative [Theobroma cacao]
 gb|EOY29814.1| Early nodulin-93, putative [Theobroma cacao]
Length=129

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +2

Query  170  DQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIVSTAA  349
            ++K + A+R+S EGV AG KAA  A + +A+PTL +VR +PWA+ANLN TAQALI+S A+
Sbjct  42   EEKRSRAERFSQEGVRAGVKAAAIAAVVSAVPTLIAVRKIPWAKANLNHTAQALIISGAS  101

Query  350  GMAYFIVADKTILATARRNS  409
              AYFI  DKT+L +ARRNS
Sbjct  102  IAAYFITVDKTVLESARRNS  121



>ref|XP_010249474.1| PREDICTED: early nodulin-93-like [Nelumbo nucifera]
Length=113

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = +2

Query  170  DQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIVSTAA  349
            +QK+  +KR + EGV AGAKAA  A + +A+PTL +VR++PWA+ANLN TAQ LI+S A+
Sbjct  26   EQKILRSKRCTEEGVRAGAKAAAVACVVSAVPTLVAVRVIPWAKANLNYTAQTLIISAAS  85

Query  350  GMAYFIVADKTILATARRNSF  412
              AYFI ADKTIL  ARRNS 
Sbjct  86   IAAYFITADKTILECARRNSI  106



>gb|AFK36825.1| unknown [Lotus japonicus]
Length=120

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  170  DQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIVSTAA  349
            + KL  +K+ ++EGV AG KAA  A +A+A+PTLA+VRM+PWA+ANLN TAQALI+S A+
Sbjct  27   ESKLLRSKQCTNEGVRAGLKAATIACVASAVPTLAAVRMIPWAKANLNYTAQALIISAAS  86

Query  350  GMAYFIVADKTILATARRNS  409
              +YFIVADKTIL  AR+N+
Sbjct  87   IASYFIVADKTILECARKNA  106



>gb|AFW85923.1| hypothetical protein ZEAMMB73_318061 [Zea mays]
Length=68

 Score = 73.9 bits (180),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  284  MVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSFK  415
            M+PWA+AN+NPT QALIVST AGMAYFI ADK IL+ ARR+SF+
Sbjct  1    MLPWAKANINPTGQALIVSTVAGMAYFIAADKKILSLARRHSFE  44



>ref|XP_010421449.1| PREDICTED: early nodulin-93-like [Camelina sativa]
 ref|XP_010454933.1| PREDICTED: early nodulin-93-like [Camelina sativa]
Length=109

 Score = 75.1 bits (183),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNS  409
            PTLA+VRM+PWA+ANLN TAQALIVS+A+  A+FI ADKTIL  AR+N+
Sbjct  49   PTLAAVRMIPWAKANLNYTAQALIVSSASIAAFFITADKTILHGARKNT  97



>gb|KHG21336.1| Early nodulin-93 [Gossypium arboreum]
Length=114

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +2

Query  170  DQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIVSTAA  349
            D+K   AK++S EG+ AG KAA  A + +A+PTL +VR +PWA+ANLN TAQALI+S A+
Sbjct  27   DEKNLRAKQFSQEGIRAGVKAAAVAAVVSAVPTLIAVRKIPWAKANLNHTAQALIISGAS  86

Query  350  GMAYFIVADKTILATARRNS  409
              AYFI  DKT+L +ARRNS
Sbjct  87   IAAYFITVDKTVLESARRNS  106



>ref|XP_003588448.1| Enod93 protein [Medicago truncatula]
 gb|AES58699.1| early nodulin 93 [Medicago truncatula]
 gb|AFK42368.1| unknown [Medicago truncatula]
Length=120

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +2

Query  170  DQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIVSTAA  349
            ++K+   K+ ++EGV AG KAA  A + + +PTLA+VRMVPWA+ANLN TAQALI+S A+
Sbjct  26   ERKILRTKKCTNEGVRAGFKAAAVACVVSTVPTLAAVRMVPWAKANLNYTAQALIISAAS  85

Query  350  GMAYFIVADKTILATARRNS  409
              AYFI ADKTIL  AR+N+
Sbjct  86   IAAYFITADKTILECARKNA  105



>ref|XP_006853715.1| hypothetical protein AMTR_s00056p00156190 [Amborella trichopoda]
 gb|ERN15182.1| hypothetical protein AMTR_s00056p00156190 [Amborella trichopoda]
Length=114

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = +2

Query  155  SLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALI  334
            +L   +Q+   +KR + EGV AG KAA  A +A+A+PTL  VR++PWA+ANLN TAQALI
Sbjct  22   TLTLAEQRALNSKRCTEEGVRAGIKAASIACVASAVPTLIGVRVIPWAKANLNYTAQALI  81

Query  335  VSTAAGMAYFIVADKTILATARRNSF  412
            +S A+  AYFI ADKTIL  ARRNS 
Sbjct  82   ISAASIAAYFITADKTILECARRNSI  107



>ref|NP_001235239.1| uncharacterized protein LOC100500499 [Glycine max]
 gb|ACU15599.1| unknown [Glycine max]
 gb|KHN02163.1| Early nodulin-93 [Glycine soja]
Length=116

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = +2

Query  170  DQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIVSTAA  349
            D+K   +K+ + EGV AG KAA  A +A+A+PTLA+VRM+PWA+ANLN TAQALI+S A+
Sbjct  26   DRKTLRSKQCTREGVRAGFKAASIAGVASAVPTLAAVRMIPWAKANLNYTAQALIISAAS  85

Query  350  GMAYFIVADKTILATARRNSFKNGSVSGNIQ  442
              +YFI ADKTIL  AR+N+    ++  N Q
Sbjct  86   IASYFITADKTILECARKNAKLEDALRHNQQ  116



>gb|EPS65341.1| hypothetical protein M569_09436 [Genlisea aurea]
Length=101

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNS  409
            PTL +VR +PWA+ANLN TAQALIVS+A+  AYFI ADKTILA AR+N+
Sbjct  48   PTLMAVRRIPWAKANLNYTAQALIVSSASVAAYFIAADKTILACARKNT  96



>ref|XP_002325832.2| hypothetical protein POPTR_0019s04930g [Populus trichocarpa]
 gb|ABK93223.1| unknown [Populus trichocarpa]
 gb|EEF00214.2| hypothetical protein POPTR_0019s04930g [Populus trichocarpa]
Length=129

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +2

Query  170  DQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIVSTAA  349
            +QK+  A+  + EGV AG KAAV   +ATA+PTL +VR++PWA+ANLN TAQALI+S A+
Sbjct  44   EQKILQARLCTQEGVRAGVKAAVITCVATAVPTLTAVRVIPWAKANLNYTAQALIISAAS  103

Query  350  GMAYFIVADKTILATARRNSFKN  418
              AYFI  DKTIL  ARRN+  N
Sbjct  104  IAAYFITVDKTILECARRNAHYN  126



>ref|XP_006366687.1| PREDICTED: early nodulin-93-like [Solanum tuberosum]
Length=113

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSFKNGS  424
            PTL +VR +PWA+ANLN TAQALI+S A+  AYFI ADKTIL  ARRN+  + S
Sbjct  59   PTLVAVRTIPWAKANLNYTAQALIISAASIAAYFITADKTILECARRNTHYDKS  112



>ref|XP_009796123.1| PREDICTED: early nodulin-93 [Nicotiana sylvestris]
 ref|XP_009796124.1| PREDICTED: early nodulin-93 [Nicotiana sylvestris]
Length=111

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSFKNGS  424
            PTL +VR +PWA+ANLN TAQALI+S A+  AYFI ADKTIL  ARRN+  + S
Sbjct  57   PTLVAVRTIPWAKANLNYTAQALIISAASIAAYFITADKTILECARRNTHYDKS  110



>ref|XP_011010128.1| PREDICTED: early nodulin-93-like [Populus euphratica]
Length=129

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +2

Query  170  DQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIVSTAA  349
            +QK+  A+  + EGV AG KAAV   +ATA+PTL +VR++PWA+ANLN TAQALI+S A+
Sbjct  44   EQKILQARLCTQEGVRAGVKAAVITCVATAVPTLTAVRVIPWAKANLNYTAQALIISAAS  103

Query  350  GMAYFIVADKTILATARRNSFKN  418
              AYFI  DKTIL  ARRN+  N
Sbjct  104  IAAYFITVDKTILECARRNAHYN  126



>ref|NP_197966.1| early nodulin-related protein [Arabidopsis thaliana]
 gb|AAD40124.1|AF149413_5 contains similarity to soybean early nodulin 93 (N-93) (SW:Q02921) 
[Arabidopsis thaliana]
 gb|AAP04129.1| putative nodulin protein [Arabidopsis thaliana]
 gb|AAP40397.1| putative nodulin protein [Arabidopsis thaliana]
 dbj|BAF01524.1| nodulin - like protein [Arabidopsis thaliana]
 gb|AED93503.1| early nodulin-related protein [Arabidopsis thaliana]
Length=115

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNS  409
            PT+A+VRM PWA+ANLN TAQALI+S+A+  A+FI ADKTIL  ARRN+
Sbjct  55   PTVAAVRMFPWAKANLNYTAQALIISSASIAAFFITADKTILQGARRNT  103



>ref|XP_009602784.1| PREDICTED: early nodulin-93 [Nicotiana tomentosiformis]
Length=111

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSFKNGS  424
            PTL +VR +PWA+ANLN TAQALI+S A+  AYFI ADKTIL  ARRN+  + S
Sbjct  57   PTLVAVRTIPWAKANLNYTAQALIISAASIAAYFITADKTILECARRNTHYDKS  110



>ref|XP_010047293.1| PREDICTED: early nodulin-93 [Eucalyptus grandis]
 gb|KCW79178.1| hypothetical protein EUGRSUZ_C00614 [Eucalyptus grandis]
Length=113

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNS  409
            PTLA+ RMVPWA+ANLN TAQALI+S A+  AYFI ADKTIL  ARRN+
Sbjct  59   PTLAACRMVPWAKANLNYTAQALIISAASIAAYFITADKTILECARRNT  107



>gb|AAM63333.1| nodulin-like protein [Arabidopsis thaliana]
Length=109

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNS  409
            PT+A+VRM PWA+ANLN TAQALI+S+A+  A+FI ADKTIL  ARRN+
Sbjct  49   PTVAAVRMFPWAKANLNYTAQALIISSASIAAFFITADKTILQGARRNT  97



>ref|XP_009129938.1| PREDICTED: early nodulin-93 [Brassica rapa]
 emb|CDY05510.1| BnaA02g31810D [Brassica napus]
Length=109

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNS  409
            PTLA+VR+ PWA+ANLN TAQALI+S+A+  A+FI ADKTIL  ARRN+
Sbjct  49   PTLAAVRVFPWAKANLNYTAQALIISSASIAAFFITADKTILQGARRNT  97



>ref|XP_010325064.1| PREDICTED: early nodulin-93 [Solanum lycopersicum]
 ref|XP_010325065.1| PREDICTED: early nodulin-93 [Solanum lycopersicum]
Length=113

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNS  409
            PTL +VR +PWA+ANLN TAQALI+S A+  AYFI ADKTIL  ARRN+
Sbjct  59   PTLVAVRTIPWAKANLNYTAQALIISAASIAAYFITADKTILECARRNT  107



>gb|EAY99599.1| hypothetical protein OsI_21577 [Oryza sativa Indica Group]
 gb|EAZ35783.1| hypothetical protein OsJ_20074 [Oryza sativa Japonica Group]
Length=111

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = +2

Query  167  LDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANL-NPTAQALIVST  343
            ++QK AMAK+ SHE  +AG KAA    + TAIPT ASVRM  WA+ANL NP A+ +I++ 
Sbjct  12   IEQKFAMAKQSSHEAAIAGLKAAAVTAVCTAIPTFASVRMSKWAKANLGNPVAKTVIITY  71

Query  344  AAGMAYFIVADKTILATARRNSFK  415
            AAGMAYFI  +K ++  +R++S +
Sbjct  72   AAGMAYFIAGEKKVVELSRKHSLE  95



>ref|XP_004291153.1| PREDICTED: early nodulin-93-like [Fragaria vesca subsp. vesca]
Length=119

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNS  409
            PTL +VRM+PWA+ANLN TAQALI+S A+  AYFI ADKTIL  AR+N+
Sbjct  61   PTLTAVRMIPWAKANLNYTAQALIISAASIAAYFITADKTILECARKNA  109



>gb|AFK35976.1| unknown [Lotus japonicus]
Length=120

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +2

Query  170  DQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIVSTAA  349
            + KL  +K+ ++EGV AG KAA  A +++A+PTLA+VR++PWA+ANLN TAQALI+S A+
Sbjct  27   ESKLLRSKQCTNEGVRAGFKAATIACVSSAVPTLAAVRIIPWAKANLNYTAQALIISAAS  86

Query  350  GMAYFIVADKTILATARRNS  409
              +YFI ADKTIL  AR+N+
Sbjct  87   IASYFIAADKTILECARKNA  106



>ref|XP_011081751.1| PREDICTED: early nodulin-93-like [Sesamum indicum]
Length=94

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNS  409
            PTLA+VR +PWA+ANLN T QALI+S A+  AYFI ADKTIL TAR+N+
Sbjct  38   PTLAAVRTIPWAKANLNYTGQALIISGASIAAYFITADKTILETARKNA  86



>ref|XP_011081738.1| PREDICTED: early nodulin-93-like isoform X2 [Sesamum indicum]
Length=149

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +2

Query  170  DQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIVSTAA  349
            D+K+   ++ + EGV AGAKAA  A +A+A+PTL +VR +PWA+ANLN TAQALI+S A+
Sbjct  65   DEKMLRTRQCTQEGVRAGAKAAAVACVASAVPTLVAVRTIPWAKANLNYTAQALIISAAS  124

Query  350  GMAYFIVADKTILATARRNS  409
              AYFI ADKTIL  ARRN+
Sbjct  125  IAAYFITADKTILECARRNA  144



>emb|CDY05336.1| BnaC02g40440D [Brassica napus]
Length=109

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNS  409
            PTLA+VR+ PWA+ NLN TAQALI+S+A+  A+FI ADKTIL  ARRN+
Sbjct  49   PTLAAVRVFPWAKVNLNYTAQALIISSASIAAFFITADKTILQGARRNT  97



>gb|AFR46651.1| ENOD93-like protein [Chimonanthus praecox]
Length=110

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = +2

Query  170  DQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIVSTAA  349
            ++++  AKR   EGV AG +AA  A +A+A+PTL  VR++PWA+ANLN TAQALI+S A+
Sbjct  25   EERILRAKRCQDEGVRAGLRAAAIACVASAVPTLVGVRVIPWAKANLNYTAQALIISAAS  84

Query  350  GMAYFIVADKTILATARRNSF  412
              AYFI ADKTIL  AR+N+ 
Sbjct  85   ISAYFITADKTILECARKNAI  105



>emb|CDP08196.1| unnamed protein product [Coffea canephora]
Length=112

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNS  409
            PTL +VR +PWA+ANLN TAQALI+S A+  AYFI ADKTIL  ARRN+
Sbjct  58   PTLTAVRTIPWAKANLNYTAQALIISGASIAAYFITADKTILECARRNT  106



>ref|XP_004517223.1| PREDICTED: early nodulin-93-like [Cicer arietinum]
Length=81

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +2

Query  269  LASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSF  412
            LASVRM+PWA+ANLN TAQALI+S A+  ++F+VA+KTILA AR+ S 
Sbjct  24   LASVRMIPWAKANLNYTAQALIISAASVASFFVVAEKTILACARKQSL  71



>ref|XP_007161502.1| hypothetical protein PHAVU_001G074600g [Phaseolus vulgaris]
 gb|ESW33496.1| hypothetical protein PHAVU_001G074600g [Phaseolus vulgaris]
Length=116

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNS  409
            PTL +VR++PWA+ANLN TAQALI+S A+  AYFI ADKTIL  AR+N+
Sbjct  57   PTLTAVRVIPWAKANLNYTAQALIISAASIAAYFITADKTILECARKNA  105



>ref|XP_006394840.1| hypothetical protein EUTSA_v10005156mg [Eutrema salsugineum]
 gb|ESQ32126.1| hypothetical protein EUTSA_v10005156mg [Eutrema salsugineum]
Length=115

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNS  409
            PT+A+VR+ PWA+ANLN TAQALIVS A+  A+FI ADKTIL  ARRN+
Sbjct  55   PTIAAVRVFPWAKANLNYTAQALIVSAASIAAFFITADKTILQGARRNT  103



>gb|ADE77942.1| unknown [Picea sitchensis]
Length=128

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +2

Query  170  DQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIVSTAA  349
            ++K   AKR S EGV  G KAA  A +A+AIPTL  VR++PWA+ANLN  AQALI+S A+
Sbjct  39   EEKAVRAKRCSDEGVKEGLKAAGIACVASAIPTLTVVRVIPWAKANLNYVAQALIISAAS  98

Query  350  GMAYFIVADKTILATARRNSFKN  418
              +YFIVA+KTIL  +R+N+ K 
Sbjct  99   IASYFIVAEKTILKCSRQNTIKQ  121



>emb|CAB65283.1| Enod93 protein [Medicago sativa subsp. x varia]
Length=117

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSF  412
            PTL +VRM+PWA+ANLN TAQALI+S  + +++F+ ADKTILA AR+ S 
Sbjct  58   PTLVAVRMIPWAKANLNYTAQALIISAVSVVSFFVAADKTILACARKQSL  107



>ref|XP_002874285.1| hypothetical protein ARALYDRAFT_910661 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50544.1| hypothetical protein ARALYDRAFT_910661 [Arabidopsis lyrata subsp. 
lyrata]
Length=115

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNS  409
            PT+A+VR+ PWA+ANLN TAQALI+S A+  A+FI ADKTIL  ARRN+
Sbjct  55   PTVAAVRVFPWAKANLNYTAQALIISAASIAAFFITADKTILQGARRNT  103



>ref|XP_008220129.1| PREDICTED: early nodulin-93-like [Prunus mume]
Length=116

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNS  409
            PTLA+VRM+PWA+ NLN TAQALI+  A+  +YFI ADKTILA AR+N+
Sbjct  57   PTLAAVRMIPWAKHNLNYTAQALIICGASIASYFITADKTILACARKNA  105



>ref|XP_007225829.1| hypothetical protein PRUPE_ppa011550mg [Prunus persica]
 gb|EMJ27028.1| hypothetical protein PRUPE_ppa011550mg [Prunus persica]
Length=206

 Score = 70.9 bits (172),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNS  409
            PTLA+VRM+PWA+ NLN TAQALI+  A+  +YFI ADKTILA AR+N+
Sbjct  147  PTLAAVRMIPWAKHNLNYTAQALIICGASIASYFITADKTILACARKNA  195



>gb|EYU20409.1| hypothetical protein MIMGU_mgv1a023606mg, partial [Erythranthe 
guttata]
Length=75

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNS  409
            PTLA+VR +PWA+ANLN T QALI+S A+  AYFI ADKTIL   R+N+
Sbjct  19   PTLAAVRTIPWAKANLNYTGQALIISGASIAAYFITADKTILEATRKNA  67



>gb|EPS59458.1| hypothetical protein M569_15348 [Genlisea aurea]
Length=101

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +2

Query  170  DQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIVSTAA  349
            D+K+  +++ + EGV AGAKAA  A +A A+PTL  VR + WA+ANLN TAQALI+S A+
Sbjct  14   DEKILRSRQCTQEGVRAGAKAAAIAGVAAAVPTLIGVRKIAWAKANLNYTAQALIISGAS  73

Query  350  GMAYFIVADKTILATARRNS  409
              AYFI ADKTILA AR+N+
Sbjct  74   IAAYFITADKTILACARKNT  93



>ref|XP_010495507.1| PREDICTED: uncharacterized protein LOC104772610 [Camelina sativa]
Length=147

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  LASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNS  409
            LA+VRM+PWA+ANLN TAQALIVS+A+  A+FI ADKTIL  AR+N+
Sbjct  89   LAAVRMIPWAKANLNYTAQALIVSSASIAAFFITADKTILHGARKNT  135



>ref|XP_010668768.1| PREDICTED: early nodulin-93-like [Beta vulgaris subsp. vulgaris]
Length=110

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNS  409
            PTL   R++PWA++NLN TAQALI+S A+  AYFI ADKTIL  ARRN+
Sbjct  56   PTLVGCRVIPWAKSNLNYTAQALIISGASIAAYFITADKTILECARRNA  104



>ref|XP_008799774.1| PREDICTED: early nodulin-93-like [Phoenix dactylifera]
Length=112

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSFK  415
            PTL   R++PWA+ANLN TAQALI+S+A+   +FI AD+TIL +AR NSF+
Sbjct  56   PTLVGCRVIPWAKANLNYTAQALIISSASIAGFFIAADQTILESARENSFQ  106



>emb|CAN71779.1| hypothetical protein VITISV_015688 [Vitis vinifera]
Length=107

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 61/75 (81%), Gaps = 8/75 (11%)
 Frame = +2

Query  143  AKNVS--------LASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWA  298
            AKNV+        LAS DQKLAMAKR SHEGVVAGAKAAV A+IATAIPT+AS R +PWA
Sbjct  2    AKNVAGSPLERNGLASFDQKLAMAKRCSHEGVVAGAKAAVVASIATAIPTMASARWLPWA  61

Query  299  RANLNPTAQALIVST  343
            +ANLN TAQALI+ST
Sbjct  62   KANLNHTAQALIIST  76



>ref|XP_010914922.1| PREDICTED: early nodulin-93-like [Elaeis guineensis]
Length=112

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSFK  415
            PTL   R++PWA+ANLN TAQALI+S A+   +FI AD+TIL +AR NSF+
Sbjct  56   PTLVGCRVIPWAKANLNYTAQALIISAASIAGFFIAADQTILESARENSFQ  106



>gb|AFK34546.1| unknown [Medicago truncatula]
Length=122

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSF  412
            PTL +VRM+PWA+ANLN TAQALI+S  +  ++F+ ADK ILA AR+ S 
Sbjct  58   PTLVAVRMIPWAKANLNYTAQALIISAVSVASFFVAADKIILACARKQSL  107



>gb|KEH36097.1| early nodulin 93 [Medicago truncatula]
Length=122

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSF  412
            PTL +VRM+PWA+ANLN TAQALI+S  +  ++F+ ADK ILA AR+ S 
Sbjct  58   PTLVAVRMIPWAKANLNYTAQALIISAVSVASFFVAADKIILACARKQSL  107



>gb|AFK33958.1| unknown [Medicago truncatula]
 gb|KEH36098.1| early nodulin 93 [Medicago truncatula]
Length=121

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSF  412
            PTL +VRM+PWA+ANLN TAQALI+S  +  ++F+ ADK ILA AR+ S 
Sbjct  57   PTLVAVRMIPWAKANLNYTAQALIISAVSVASFFVAADKIILACARKQSL  106



>gb|KHG26243.1| Early nodulin-93 [Gossypium arboreum]
Length=115

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +2

Query  170  DQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIVSTAA  349
            DQK   A++ S EG+ AG KAA    + TA+PTL +VR V WA+ANLN TAQALI++ A+
Sbjct  27   DQKKLRAQQSSQEGIRAGLKAAAITGVFTAVPTLIAVRKVVWAKANLNHTAQALIINGAS  86

Query  350  GMAYFIVADKTILATARRNS  409
              AYFI  DKT+L +AR+NS
Sbjct  87   IAAYFITVDKTVLESARKNS  106



>ref|XP_010536217.1| PREDICTED: early nodulin-93 [Tarenaya hassleriana]
Length=104

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRN  406
            PTL +VR +PWA+ NLN TAQALI+S A+   +FI ADKTIL  ARRN
Sbjct  44   PTLVAVRKIPWAKKNLNYTAQALIISAASIAGFFITADKTILEGARRN  91



>ref|XP_011081737.1| PREDICTED: uncharacterized protein LOC105164713 isoform X1 [Sesamum 
indicum]
Length=162

 Score = 67.8 bits (164),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  LASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNS  409
            L +VR +PWA+ANLN TAQALI+S A+  AYFI ADKTIL  ARRN+
Sbjct  111  LVAVRTIPWAKANLNYTAQALIISAASIAAYFITADKTILECARRNA  157



>ref|XP_006475988.1| PREDICTED: early nodulin-93-like isoform X1 [Citrus sinensis]
 ref|XP_006475989.1| PREDICTED: early nodulin-93-like isoform X2 [Citrus sinensis]
 gb|KDO79932.1| hypothetical protein CISIN_1g033692mg [Citrus sinensis]
Length=113

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNS  409
            PTL +VR +PWA+ANLN T QALI+S  +  +YFI  DKTIL  ARRN+
Sbjct  59   PTLVAVRKIPWAKANLNYTGQALIISAVSIASYFITVDKTILECARRNA  107



>ref|XP_009415371.1| PREDICTED: early nodulin-93-like [Musa acuminata subsp. malaccensis]
Length=116

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSF  412
            PTL   R++PWA+ANLN TAQALI+S A+   +FI ADKTIL  AR NS 
Sbjct  60   PTLVGCRVIPWAKANLNYTAQALIISAASVAGFFITADKTILQNARGNSI  109



>ref|XP_008357372.1| PREDICTED: early nodulin-93-like [Malus domestica]
Length=117

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +2

Query  266  TLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSFKNGSV  427
            TL +VR VPWA+ NLN TAQALI+S A    YFI  DKTILA AR+N+    S+
Sbjct  58   TLGAVRTVPWAKYNLNYTAQALIISAATISTYFITVDKTILACARKNALLQDSL  111



>ref|XP_009350245.1| PREDICTED: early nodulin-93-like [Pyrus x bretschneideri]
Length=117

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +2

Query  266  TLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSFKNGSV  427
            TL +VR VPWA+ NLN TAQALI+S A    YFI  DKTILA AR+N+    S+
Sbjct  58   TLGAVRTVPWAKYNLNYTAQALIISAATISTYFITVDKTILACARKNALLQDSL  111



>gb|ABQ42021.1| Enod93 protein [Sonneratia alba]
 gb|ABQ42022.1| Enod93 protein [Sonneratia caseolaris]
 gb|ABQ42023.1| Enod93 protein [Sonneratia ovata]
 gb|ACS68675.1| Enod93 protein [Sonneratia alba]
 gb|ACS68745.1| Enod93 protein [Sonneratia alba]
Length=82

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = +2

Query  164  SLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIVST  343
            S +QK+  A+  + EGV AG KAA  A +A+A+PTL +VR+VPWA+ANLN TAQALI+  
Sbjct  8    SEEQKVLNARNCTQEGVRAGVKAAAIAGVASAVPTLVAVRVVPWAKANLNYTAQALIICA  67

Query  344  AAGMAYFIVADKTIL  388
            A+  AYFI ADKTIL
Sbjct  68   ASIAAYFITADKTIL  82



>gb|ACG23999.1| early nodulin 93 [Zea mays]
 gb|ACG32802.1| early nodulin 93 [Zea mays]
Length=97

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSF  412
            PTL   R++PWA+ANLN TAQALI+S A    +FI ADKTIL  AR+N+ 
Sbjct  41   PTLVGCRVLPWAKANLNYTAQALIISAACIAGFFITADKTILRNARQNTI  90



>ref|NP_001150497.1| early nodulin 93 [Zea mays]
 gb|ACF83725.1| unknown [Zea mays]
 gb|ACG39282.1| early nodulin 93 [Zea mays]
 gb|AFW66007.1| early nodulin 93 [Zea mays]
Length=97

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSF  412
            PTL   R++PWA+ANLN TAQALI+S A    +FI ADKTIL  AR+N+ 
Sbjct  41   PTLVGCRVLPWAKANLNYTAQALIISAACIAGFFITADKTILRNARQNTI  90



>ref|XP_002453560.1| hypothetical protein SORBIDRAFT_04g008090 [Sorghum bicolor]
 gb|EES06536.1| hypothetical protein SORBIDRAFT_04g008090 [Sorghum bicolor]
Length=97

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSF  412
            PTL   R++PWA+ANLN TAQALI+S A    +FI ADKTIL  AR+N+ 
Sbjct  41   PTLVGCRVLPWAKANLNYTAQALIISAACISGFFITADKTILRNARQNTI  90



>ref|XP_008804878.1| PREDICTED: uncharacterized protein LOC103718023 isoform X2 [Phoenix 
dactylifera]
Length=147

 Score = 64.3 bits (155),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSF  412
            PTL   R++PWA+ANLN TAQALI+S A+   +FI AD+TIL  AR N+ 
Sbjct  91   PTLIGCRVIPWAKANLNHTAQALIISAASIAGFFITADRTILQNARENTM  140



>ref|XP_010917653.1| PREDICTED: early nodulin-93-like isoform X1 [Elaeis guineensis]
Length=149

 Score = 64.3 bits (155),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNS  409
            PTL   R++PWA+ANLN TAQALI+S A+   +FI AD+TIL  AR N+
Sbjct  93   PTLIGCRVIPWAKANLNHTAQALIISAASIAGFFITADRTILQNARENT  141



>ref|XP_004951404.1| PREDICTED: early nodulin-93-like [Setaria italica]
Length=97

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSF  412
            PTL   R++PWA+ANLN TAQALI+S A    +FI ADKTIL  AR+N+ 
Sbjct  41   PTLIGCRVLPWAKANLNYTAQALIISAACIAGFFITADKTILRNARQNTI  90



>dbj|BAJ94955.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=97

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSF  412
            PTL S R++PWA+ NLN TAQALI+S A    +FI ADKTIL  AR+N+ 
Sbjct  41   PTLVSCRVLPWAKHNLNYTAQALIISAACIAGFFITADKTILRNARQNTI  90



>gb|EMT24869.1| hypothetical protein F775_32597 [Aegilops tauschii]
Length=97

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSF  412
            PT  + R++PWA+ NLN TAQALI+STA    +FI ADKTIL  AR+N+ 
Sbjct  41   PTFVACRVLPWAKHNLNYTAQALIISTACVAGFFITADKTILRNARQNTI  90



>gb|EMT14561.1| hypothetical protein F775_30178 [Aegilops tauschii]
Length=94

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSF  412
            PT  + R++PWA+ NLN TAQALI+STA    +FI ADKTIL  AR+N+ 
Sbjct  41   PTFVACRVLPWAKHNLNYTAQALIISTACVAGFFITADKTILRNARQNTI  90



>gb|EMS46857.1| hypothetical protein TRIUR3_07600 [Triticum urartu]
Length=121

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSF  412
            PT  + R++PWA+ NLN TAQALI+STA    +FI ADKTIL  AR+N+ 
Sbjct  65   PTFVACRVLPWAKHNLNYTAQALIISTACVAGFFITADKTILRNARQNTI  114



>gb|ABQ42024.1| Enod93 protein [Sonneratia apetala]
Length=82

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +2

Query  164  SLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQALIVST  343
            S +QK+  A+  + EGV AG KAA  A +A+A+PTL +VR+VPWA+ANL  TAQALI+  
Sbjct  8    SEEQKVLNARNCTQEGVRAGVKAAAIAGVASAVPTLVAVRVVPWAKANLKYTAQALIICA  67

Query  344  AAGMAYFIVADKTIL  388
            A+  AYFI ADKTIL
Sbjct  68   ASIAAYFITADKTIL  82



>ref|XP_001761950.1| predicted protein [Physcomitrella patens]
 gb|EDQ73391.1| predicted protein [Physcomitrella patens]
Length=69

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSFKN  418
            PTL +VRMVPW +AN+N T QALI+S A    YF+VA++TIL  +R+ +  N
Sbjct  15   PTLTAVRMVPWVKANVNYTGQALIISGATIATYFVVAEQTILECSRKQNATN  66



>gb|AFW75468.1| hypothetical protein ZEAMMB73_751741 [Zea mays]
Length=83

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +2

Query  152  VSLASLDQKLAMAKRYSHEgvvagakaavaatiataiPTLASVRMVPWARANLNPTAQAL  331
            V+ ASLDQ L +AK+ S E  +AG KAA  AT+A+A+PTL SVRM+PWA+AN+NP  QAL
Sbjct  5    VNSASLDQNLELAKQCSREAALAGFKAAAVATVASAVPTLVSVRMLPWAKANINPAGQAL  64

Query  332  IVSTAAGMAYFIV  370
            IVST   +   ++
Sbjct  65   IVSTGRSLNLSLI  77



>ref|NP_001046351.1| Os02g0227200 [Oryza sativa Japonica Group]
 dbj|BAA33815.1| early nodulin [Oryza sativa Japonica Group]
 dbj|BAD25664.1| early nodulin [Oryza sativa Japonica Group]
 dbj|BAD25860.1| early nodulin [Oryza sativa Japonica Group]
 dbj|BAF08265.1| Os02g0227200 [Oryza sativa Japonica Group]
 dbj|BAG92969.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00214.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC72776.1| hypothetical protein OsI_06438 [Oryza sativa Indica Group]
 gb|EEE56598.1| hypothetical protein OsJ_05958 [Oryza sativa Japonica Group]
Length=96

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSF  412
            PTL   R++PWA+ANLN TAQALI+S A    +FI ADK IL  AR+N+ 
Sbjct  40   PTLVGCRVLPWAKANLNYTAQALIISAACIAGFFITADKAILRNARQNTI  89



>ref|XP_006647086.1| PREDICTED: early nodulin-93-like [Oryza brachyantha]
Length=97

 Score = 60.5 bits (145),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSF  412
            PTL   R++PWA+ANLN TAQALI+S A    +FI ADK IL  AR+N+ 
Sbjct  41   PTLVGCRVLPWAKANLNYTAQALIISAACIAGFFITADKAILRNARQNTI  90



>ref|XP_002532958.1| hypothetical protein RCOM_0639430 [Ricinus communis]
 gb|EEF29424.1| hypothetical protein RCOM_0639430 [Ricinus communis]
Length=75

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIV  370
            P LASVRM+PWARANLN TAQAL +ST AG A+FIV
Sbjct  22   PNLASVRMLPWARANLNHTAQALTISTVAGAAHFIV  57



>ref|XP_003571774.1| PREDICTED: early nodulin-93 [Brachypodium distachyon]
Length=97

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSF  412
            PTL   R+ PWA+ NLN TAQALI++ A    +FI ADKTIL  AR+N+ 
Sbjct  41   PTLVGCRVFPWAKRNLNYTAQALIITAACIAGFFITADKTILRNARQNTI  90



>ref|NP_001056760.1| Os06g0141400 [Oryza sativa Japonica Group]
 dbj|BAF18674.1| Os06g0141400, partial [Oryza sativa Japonica Group]
Length=119

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 39/52 (75%), Gaps = 1/52 (2%)
 Frame = +2

Query  263  PTLASVRMVPWARANL-NPTAQALIVSTAAGMAYFIVADKTILATARRNSFK  415
            PT ASVRM  WA+ANL NP A+ +I++ AAGMAYFI  +K ++  +R++S +
Sbjct  52   PTFASVRMSKWAKANLGNPVAKTVIITYAAGMAYFIAGEKKVVELSRKHSLE  103



>ref|XP_001780085.1| predicted protein [Physcomitrella patens]
 gb|EDQ55094.1| predicted protein [Physcomitrella patens]
Length=73

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  263  PTLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNSF  412
            PTL +VRM P  +A+LN T QALIVS A+  +YFIV+D+TI   +R++S+
Sbjct  19   PTLTAVRMFPKVKASLNYTGQALIVSAASIASYFIVSDQTIHECSRKSSY  68



>ref|XP_002275030.1| PREDICTED: early nodulin-93 [Vitis vinifera]
 emb|CBI20593.3| unnamed protein product [Vitis vinifera]
Length=108

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  266  TLASVRMVPWARANLNPTAQALIVSTAAGMAYFIVADKTILATARRNS  409
            TL +VR VPW + ++N T +ALI+S A+  A+FI ADKTIL   +RN+
Sbjct  55   TLGAVRYVPWVKQHINYTGRALIISAASVAAFFITADKTILECGKRNT  102



>gb|KDP32369.1| hypothetical protein JCGZ_13294 [Jatropha curcas]
Length=88

 Score = 39.3 bits (90),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +1

Query  277  CENGAMGKSQFKPNSTGTDSLNSCWDGLLHC  369
            C+N A+GKSQ +P+   + +L+SCW  L HC
Sbjct  57   CKNAALGKSQSQPHCPSSHNLHSCWSSLFHC  87


 Score = 36.6 bits (83),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +2

Query  146  KNVSLASLDQKLAMAKRYSHE  208
            +  SLASLDQKLAMAKR SHE
Sbjct  12   EKTSLASLDQKLAMAKRCSHE  32



>gb|ACN36680.1| unknown [Zea mays]
Length=122

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -1

Query  333  ISACAVGFKLALAHGTILTLANVGIavamvaataalapattPS*E*RLAMANFWSKEAKL  154
            +SA  VG  LALAHG+I TLA VGIA A+VA  AALAPA   S E RLA A+FWS++A+L
Sbjct  1    MSAWPVGLMLALAHGSIRTLARVGIAEAIVATAAALAPARVASREQRLARASFWSRDARL  60

Query  153  TFL  145
            T +
Sbjct  61   TVV  63



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 969971295884