BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c28391_g1_i1 len=2831 path=[2809:0-2830]

Length=2831
                                                                      Score     E

ref|XP_004238395.1|  PREDICTED: phospholipase D delta-like             1364   0.0     
ref|XP_009776941.1|  PREDICTED: phospholipase D delta-like             1357   0.0     
ref|XP_009620056.1|  PREDICTED: phospholipase D delta-like             1355   0.0     
gb|EYU36813.1|  hypothetical protein MIMGU_mgv1a001300mg               1337   0.0     
ref|XP_008387895.1|  PREDICTED: phospholipase D delta-like             1332   0.0     
gb|EYU17554.1|  hypothetical protein MIMGU_mgv1a025612mg               1328   0.0     
ref|XP_011074721.1|  PREDICTED: phospholipase D delta-like             1326   0.0     
ref|XP_007017919.1|  Phospholipase D isoform 1                         1321   0.0     
ref|XP_008445312.1|  PREDICTED: phospholipase D delta-like             1320   0.0     
ref|XP_008221197.1|  PREDICTED: phospholipase D delta-like             1318   0.0     
ref|XP_002284764.2|  PREDICTED: phospholipase D delta-like             1316   0.0     Vitis vinifera
ref|XP_002510602.1|  phospholipase d delta, putative                   1315   0.0     Ricinus communis
ref|XP_011083417.1|  PREDICTED: phospholipase D delta-like isofor...   1315   0.0     
ref|XP_006435265.1|  hypothetical protein CICLE_v10000269mg            1315   0.0     
ref|XP_009334534.1|  PREDICTED: phospholipase D delta-like             1315   0.0     
gb|KGN62275.1|  hypothetical protein Csa_2G347140                      1313   0.0     
ref|XP_004143075.1|  PREDICTED: phospholipase D delta-like             1313   0.0     
ref|XP_010520828.1|  PREDICTED: phospholipase D delta-like             1312   0.0     
ref|XP_003523254.1|  PREDICTED: phospholipase D delta-like             1303   0.0     
ref|XP_003603842.1|  Phospholipase D delta                             1299   0.0     
gb|KDP36869.1|  hypothetical protein JCGZ_08160                        1289   0.0     
ref|XP_004500903.1|  PREDICTED: phospholipase D delta-like isofor...   1288   0.0     
ref|XP_010063288.1|  PREDICTED: phospholipase D delta-like             1282   0.0     
ref|XP_004292929.1|  PREDICTED: phospholipase D delta-like             1281   0.0     
ref|XP_011034954.1|  PREDICTED: phospholipase D delta-like             1280   0.0     
ref|XP_007136128.1|  hypothetical protein PHAVU_009G020200g            1280   0.0     
ref|XP_006581145.1|  PREDICTED: phospholipase D delta-like             1276   0.0     
ref|XP_011083418.1|  PREDICTED: phospholipase D delta-like isofor...   1270   0.0     
ref|XP_002270350.2|  PREDICTED: phospholipase D delta-like             1264   0.0     Vitis vinifera
ref|XP_011003096.1|  PREDICTED: phospholipase D delta-like             1261   0.0     
gb|EPS73398.1|  hypothetical protein M569_01343                        1253   0.0     
ref|XP_010266912.1|  PREDICTED: phospholipase D delta                  1245   0.0     
ref|XP_009107633.1|  PREDICTED: phospholipase D delta-like             1238   0.0     
emb|CDY35793.1|  BnaA08g04540D                                         1222   0.0     
ref|XP_010266062.1|  PREDICTED: phospholipase D delta-like             1219   0.0     
emb|CBI18911.3|  unnamed protein product                               1217   0.0     
ref|XP_009386169.1|  PREDICTED: phospholipase D delta-like isofor...   1205   0.0     
ref|XP_004287764.1|  PREDICTED: phospholipase D delta-like             1204   0.0     
ref|XP_010941358.1|  PREDICTED: phospholipase D delta-like isofor...   1201   0.0     
ref|XP_009394033.1|  PREDICTED: phospholipase D delta-like             1201   0.0     
ref|XP_006828836.1|  hypothetical protein AMTR_s00001p00146970         1197   0.0     
ref|XP_008811755.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...   1196   0.0     
ref|XP_002301946.1|  hypothetical protein POPTR_0002s01750g            1195   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_006590738.1|  PREDICTED: phospholipase D delta-like             1192   0.0     
ref|XP_007157859.1|  hypothetical protein PHAVU_002G104200g            1192   0.0     
ref|XP_008242003.1|  PREDICTED: phospholipase D delta                  1191   0.0     
ref|XP_003516537.1|  PREDICTED: phospholipase D delta-like isofor...   1186   0.0     
ref|XP_007204285.1|  hypothetical protein PRUPE_ppa001300mg            1183   0.0     
ref|XP_010935183.1|  PREDICTED: phospholipase D delta-like             1182   0.0     
ref|XP_008806154.1|  PREDICTED: phospholipase D delta                  1181   0.0     
gb|AAN34820.1|  phospholipase D delta isoform                          1178   0.0     Gossypium hirsutum [American cotton]
gb|AAN05432.1|  phospholipase D delta isoform 1b                       1178   0.0     Gossypium hirsutum [American cotton]
gb|KDP43704.1|  hypothetical protein JCGZ_22331                        1176   0.0     
ref|XP_010113283.1|  Phospholipase D delta                             1176   0.0     
ref|XP_008651006.1|  PREDICTED: uncharacterized protein LOC100217...   1176   0.0     
ref|XP_010683033.1|  PREDICTED: phospholipase D delta                  1173   0.0     
ref|XP_010666738.1|  PREDICTED: phospholipase D delta-like             1172   0.0     
ref|XP_008337963.1|  PREDICTED: phospholipase D delta                  1172   0.0     
ref|XP_011099892.1|  PREDICTED: phospholipase D delta                  1172   0.0     
ref|XP_009788032.1|  PREDICTED: phospholipase D delta-like isofor...   1170   0.0     
ref|XP_006425355.1|  hypothetical protein CICLE_v10024876mg            1170   0.0     
ref|XP_011022230.1|  PREDICTED: phospholipase D delta                  1170   0.0     
ref|XP_010526824.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...   1169   0.0     
ref|XP_009363437.1|  PREDICTED: phospholipase D delta-like             1168   0.0     
gb|AEI99558.1|  phospholipase D delta                                  1168   0.0     
ref|XP_007017920.1|  Phospholipase D isoform 2                         1167   0.0     
ref|XP_006467032.1|  PREDICTED: phospholipase D delta-like             1166   0.0     
gb|AES95217.2|  phospholipase D alpha 1                                1165   0.0     
gb|KDO38440.1|  hypothetical protein CISIN_1g002960mg                  1164   0.0     
ref|XP_008440879.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...   1163   0.0     
ref|XP_006340788.1|  PREDICTED: phospholipase D delta-like             1163   0.0     
ref|XP_010531126.1|  PREDICTED: phospholipase D delta-like             1163   0.0     
ref|XP_004134840.1|  PREDICTED: phospholipase D delta-like             1162   0.0     
ref|XP_006660920.1|  PREDICTED: phospholipase D delta-like             1162   0.0     
ref|NP_001063826.1|  Os09g0543100                                      1162   0.0     Oryza sativa Japonica Group [Japonica rice]
gb|KEH36266.1|  phospholipase D alpha 1                                1162   0.0     
ref|XP_008670360.1|  PREDICTED: phospholipase D delta-like             1161   0.0     
ref|XP_002460594.1|  hypothetical protein SORBIDRAFT_02g031540         1161   0.0     Sorghum bicolor [broomcorn]
ref|XP_011007499.1|  PREDICTED: phospholipase D delta-like             1160   0.0     
ref|XP_006858490.1|  hypothetical protein AMTR_s00071p00126030         1160   0.0     
ref|XP_010238440.1|  PREDICTED: phospholipase D delta                  1159   0.0     
ref|XP_004957519.1|  PREDICTED: phospholipase D delta-like             1159   0.0     
ref|XP_004232528.1|  PREDICTED: phospholipase D delta                  1159   0.0     
gb|AEF58504.1|  phospholipase D delta                                  1156   0.0     
ref|XP_009150166.1|  PREDICTED: phospholipase D delta                  1155   0.0     
ref|XP_007046580.1|  Phospholipase D delta isoform 2                   1155   0.0     
ref|XP_002867053.1|  atplddelta                                        1155   0.0     
ref|XP_006412059.1|  hypothetical protein EUTSA_v10024382mg            1155   0.0     
ref|XP_009768465.1|  PREDICTED: phospholipase D delta-like             1154   0.0     
ref|XP_003612259.1|  Phospholipase D delta isoform                     1153   0.0     
ref|XP_010432230.1|  PREDICTED: phospholipase D delta-like isofor...   1153   0.0     
ref|XP_008802877.1|  PREDICTED: phospholipase D delta-like             1152   0.0     
ref|XP_010437424.1|  PREDICTED: phospholipase D delta isoform X2       1149   0.0     
emb|CDX69166.1|  BnaC01g02870D                                         1149   0.0     
ref|NP_849501.1|  phospholipase D delta                                1149   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010446878.1|  PREDICTED: phospholipase D delta                  1148   0.0     
ref|XP_009344820.1|  PREDICTED: phospholipase D delta isoform X1       1148   0.0     
pir||T04689  hypothetical protein F4B14.60 - Arabidopsis thaliana      1147   0.0  
ref|XP_009594603.1|  PREDICTED: phospholipase D delta isoform X1       1147   0.0     
ref|XP_008354617.1|  PREDICTED: phospholipase D delta-like             1145   0.0     
ref|XP_006285074.1|  hypothetical protein CARUB_v10006387mg            1145   0.0     
ref|XP_007046579.1|  Phospholipase D delta isoform 1                   1145   0.0     
gb|EEE70149.1|  hypothetical protein OsJ_30197                         1144   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_010432229.1|  PREDICTED: phospholipase D delta-like isofor...   1143   0.0     
ref|XP_002310718.2|  phospholipase D delta family protein              1143   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_002530642.1|  phospholipase d delta, putative                   1143   0.0     Ricinus communis
ref|XP_009623492.1|  PREDICTED: phospholipase D delta-like             1141   0.0     
emb|CDX75527.1|  BnaA01g01750D                                         1141   0.0     
gb|EYU30820.1|  hypothetical protein MIMGU_mgv1a001201mg               1140   0.0     
ref|XP_004500904.1|  PREDICTED: phospholipase D delta-like isofor...   1140   0.0     
ref|NP_567989.1|  phospholipase D delta                                1140   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010437423.1|  PREDICTED: phospholipase D delta isoform X1       1139   0.0     
gb|EEC84978.1|  hypothetical protein OsI_32238                         1139   0.0     Oryza sativa Indica Group [Indian rice]
gb|AAL11625.1|AF424632_1  AT4g35790/F4B14_60                           1139   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_004289065.1|  PREDICTED: phospholipase D delta-like             1137   0.0     
ref|XP_011007871.1|  PREDICTED: phospholipase D delta-like             1135   0.0     
ref|XP_006367166.1|  PREDICTED: phospholipase D delta-like             1134   0.0     
ref|XP_009138388.1|  PREDICTED: phospholipase D delta-like             1133   0.0     
gb|AHA10981.1|  PLDdelta                                               1133   0.0     
ref|XP_002266693.2|  PREDICTED: phospholipase D delta-like isofor...   1128   0.0     Vitis vinifera
ref|XP_010244835.1|  PREDICTED: phospholipase D delta-like isofor...   1124   0.0     
gb|KFK30199.1|  hypothetical protein AALP_AA7G231200                   1123   0.0     
ref|XP_010658068.1|  PREDICTED: phospholipase D delta-like isofor...   1122   0.0     
ref|XP_007042278.1|  Phospholipase D                                   1121   0.0     
ref|XP_010911814.1|  PREDICTED: phospholipase D delta-like isofor...   1121   0.0     
emb|CDX72557.1|  BnaC07g45790D                                         1120   0.0     
ref|XP_004233571.1|  PREDICTED: phospholipase D delta-like             1120   0.0     
ref|XP_010244834.1|  PREDICTED: phospholipase D delta-like isofor...   1119   0.0     
gb|KDP38812.1|  hypothetical protein JCGZ_04969                        1119   0.0     
ref|XP_009410696.1|  PREDICTED: phospholipase D delta-like             1118   0.0     
gb|KHG15292.1|  Phospholipase D delta -like protein                    1117   0.0     
ref|XP_010911813.1|  PREDICTED: phospholipase D delta-like isofor...   1116   0.0     
emb|CDY47037.1|  BnaAnng08250D                                         1116   0.0     
gb|ABR17779.1|  unknown                                                1113   0.0     Picea sitchensis
ref|XP_002530670.1|  phospholipase d beta, putative                    1110   0.0     Ricinus communis
ref|XP_007227049.1|  hypothetical protein PRUPE_ppa001322mg            1109   0.0     
ref|XP_010943480.1|  PREDICTED: phospholipase D delta-like             1108   0.0     
emb|CDP01838.1|  unnamed protein product                               1108   0.0     
ref|XP_010244833.1|  PREDICTED: phospholipase D delta-like isofor...   1108   0.0     
ref|XP_010065450.1|  PREDICTED: phospholipase D delta-like             1106   0.0     
ref|XP_008218590.1|  PREDICTED: phospholipase D delta-like             1104   0.0     
ref|XP_010244830.1|  PREDICTED: phospholipase D delta-like isofor...   1103   0.0     
emb|CBI29771.3|  unnamed protein product                               1103   0.0     
ref|XP_008785061.1|  PREDICTED: phospholipase D delta-like             1096   0.0     
ref|XP_010029629.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...   1095   0.0     
gb|AAN05433.1|  phospholipase D delta isoform 1a                       1095   0.0     Gossypium hirsutum [American cotton]
ref|XP_009355262.1|  PREDICTED: phospholipase D delta-like             1095   0.0     
gb|KHG21987.1|  Phospholipase D delta -like protein                    1094   0.0     
ref|XP_008357632.1|  PREDICTED: phospholipase D delta-like             1094   0.0     
ref|XP_004504195.1|  PREDICTED: phospholipase D delta-like             1091   0.0     
ref|XP_003629955.1|  Phospholipase D2                                  1089   0.0     
ref|XP_009382050.1|  PREDICTED: phospholipase D delta-like isofor...   1089   0.0     
ref|XP_009382051.1|  PREDICTED: phospholipase D delta-like isofor...   1087   0.0     
ref|XP_009382053.1|  PREDICTED: phospholipase D delta-like isofor...   1085   0.0     
gb|KCW62830.1|  hypothetical protein EUGRSUZ_G00422                    1084   0.0     
gb|EEC76498.1|  hypothetical protein OsI_14257                         1082   0.0     Oryza sativa Indica Group [Indian rice]
gb|AAF78756.1|AF271358_1  phospholipase D                              1081   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_009109270.1|  PREDICTED: phospholipase D delta-like isofor...   1080   0.0     
ref|XP_009382054.1|  PREDICTED: phospholipase D delta-like isofor...   1080   0.0     
gb|KCW62953.1|  hypothetical protein EUGRSUZ_G00554                    1078   0.0     
ref|XP_006431754.1|  hypothetical protein CICLE_v10003162mg            1078   0.0     
ref|XP_009109271.1|  PREDICTED: phospholipase D delta-like isofor...   1078   0.0     
ref|XP_003524234.1|  PREDICTED: phospholipase D delta-like isofor...   1077   0.0     
ref|XP_006471246.1|  PREDICTED: phospholipase D delta-like             1075   0.0     
gb|AAT77001.1|  phospholipase D                                        1075   0.0     Oryza sativa Japonica Group [Japonica rice]
gb|KHG15087.1|  Phospholipase D delta -like protein                    1075   0.0     
emb|CDY67335.1|  BnaCnng54530D                                         1075   0.0     
gb|AER41566.1|  phospholipase+D                                        1069   0.0     
ref|XP_006657599.1|  PREDICTED: phospholipase D delta-like             1068   0.0     
ref|XP_004986130.1|  PREDICTED: phospholipase D delta-like             1068   0.0     
gb|AER41647.1|  phospholipase+D                                        1068   0.0     
ref|XP_003532794.1|  PREDICTED: phospholipase D delta-like isofor...   1068   0.0     
gb|EEC81825.1|  hypothetical protein OsI_25571                         1066   0.0     Oryza sativa Indica Group [Indian rice]
ref|NP_001059324.1|  Os07g0260400                                      1066   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_008670089.1|  PREDICTED: phospholipase D delta-like isofor...   1065   0.0     
gb|EMS67406.1|  Phospholipase D delta                                  1064   0.0     
ref|XP_006650874.1|  PREDICTED: phospholipase D delta-like             1063   0.0     
ref|XP_002461794.1|  hypothetical protein SORBIDRAFT_02g008130         1061   0.0     Sorghum bicolor [broomcorn]
gb|KFK29154.1|  hypothetical protein AALP_AA7G096000                   1061   0.0     
dbj|BAK05685.1|  predicted protein                                     1060   0.0     
ref|XP_004956880.1|  PREDICTED: phospholipase D delta-like isofor...   1059   0.0     
emb|CDY41630.1|  BnaC03g62540D                                         1056   0.0     
gb|KHN33827.1|  Phospholipase D delta                                  1053   0.0     
ref|XP_009600603.1|  PREDICTED: phospholipase D delta-like             1051   0.0     
gb|KHN41861.1|  Phospholipase D delta                                  1051   0.0     
ref|XP_003557320.1|  PREDICTED: phospholipase D delta-like isofor...   1047   0.0     
gb|AER41581.1|  phospholipase+D                                        1046   0.0     
ref|XP_010029628.1|  PREDICTED: phospholipase D delta-like isofor...   1046   0.0     
ref|XP_010029627.1|  PREDICTED: phospholipase D delta-like isofor...   1043   0.0     
ref|XP_006425352.1|  hypothetical protein CICLE_v10024876mg            1040   0.0     
ref|XP_009796632.1|  PREDICTED: phospholipase D delta-like             1039   0.0     
ref|XP_010315479.1|  PREDICTED: phospholipase D delta-like             1036   0.0     
ref|XP_002306960.2|  hypothetical protein POPTR_0005s26730g            1036   0.0     Populus trichocarpa [western balsam poplar]
gb|KDO38443.1|  hypothetical protein CISIN_1g002960mg                  1033   0.0     
gb|KDP43703.1|  hypothetical protein JCGZ_22330                        1032   0.0     
gb|KDO38441.1|  hypothetical protein CISIN_1g002960mg                  1031   0.0     
ref|XP_009602808.1|  PREDICTED: phospholipase D delta-like             1029   0.0     
gb|KDO38442.1|  hypothetical protein CISIN_1g002960mg                  1029   0.0     
dbj|BAC79202.1|  putative phospholipase D beta 1                       1029   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_006349430.1|  PREDICTED: phospholipase D delta-like             1028   0.0     
ref|XP_009776072.1|  PREDICTED: phospholipase D delta-like             1027   0.0     
ref|XP_006341816.1|  PREDICTED: phospholipase D delta-like isofor...   1026   0.0     
gb|KHN35993.1|  Phospholipase D delta                                  1024   0.0     
gb|EEE60272.1|  hypothetical protein OsJ_13309                         1021   0.0     Oryza sativa Japonica Group [Japonica rice]
gb|KCW56568.1|  hypothetical protein EUGRSUZ_I02299                    1019   0.0     
ref|XP_010029625.1|  PREDICTED: phospholipase D delta-like             1018   0.0     
ref|XP_004248600.1|  PREDICTED: phospholipase D delta-like             1018   0.0     
ref|XP_006341817.1|  PREDICTED: phospholipase D delta-like isofor...   1016   0.0     
ref|XP_010029630.1|  PREDICTED: phospholipase D delta-like             1014   0.0     
ref|XP_002304050.2|  hypothetical protein POPTR_0003s01070g            1010   0.0     Populus trichocarpa [western balsam poplar]
gb|AER41636.1|  phospholipase+D                                        1006   0.0     
gb|AER41632.1|  phospholipase+D                                        1000   0.0     
gb|AER41602.1|  phospholipase+D                                        1000   0.0     
gb|EYU24262.1|  hypothetical protein MIMGU_mgv1a021891mg                996   0.0     
gb|EYU41069.1|  hypothetical protein MIMGU_mgv1a026439mg                994   0.0     
gb|KCW56569.1|  hypothetical protein EUGRSUZ_I02300                     992   0.0     
gb|KCW56570.1|  hypothetical protein EUGRSUZ_I02302                     972   0.0     
ref|XP_001759244.1|  predicted protein                                  970   0.0     
ref|XP_010941360.1|  PREDICTED: phospholipase D delta-like isofor...    964   0.0     
gb|KHN20136.1|  Phospholipase D delta                                   962   0.0     
ref|XP_002979744.1|  hypothetical protein SELMODRAFT_153581             957   0.0     
gb|KHN06490.1|  Phospholipase D delta                                   956   0.0     
ref|XP_009386170.1|  PREDICTED: phospholipase D delta-like isofor...    956   0.0     
gb|AAL02150.1|AF274239_1  phospholipase D-like protein p98              953   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|KHN48093.1|  Phospholipase D delta                                   951   0.0     
ref|XP_006573536.1|  PREDICTED: phospholipase D delta-like isofor...    949   0.0     
emb|CBI24451.3|  unnamed protein product                                946   0.0     
ref|XP_002988389.1|  hypothetical protein SELMODRAFT_269402             939   0.0     
ref|XP_010523062.1|  PREDICTED: phospholipase D beta 1                  926   0.0     
gb|KDO38444.1|  hypothetical protein CISIN_1g002960mg                   924   0.0     
ref|NP_849502.1|  phospholipase D delta                                 924   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_006857964.1|  hypothetical protein AMTR_s00069p00174350          924   0.0     
gb|KDO38445.1|  hypothetical protein CISIN_1g002960mg                   923   0.0     
gb|EYU20517.1|  hypothetical protein MIMGU_mgv1a018363mg                920   0.0     
ref|XP_002511773.1|  phospholipase d beta, putative                     918   0.0     Ricinus communis
ref|XP_009418303.1|  PREDICTED: phospholipase D delta-like              916   0.0     
ref|XP_010529524.1|  PREDICTED: phospholipase D gamma 1                 915   0.0     
ref|XP_002275783.1|  PREDICTED: phospholipase D beta 1-like             915   0.0     Vitis vinifera
gb|KDP28706.1|  hypothetical protein JCGZ_14477                         911   0.0     
ref|XP_007040091.1|  Phospholipase D beta 1                             910   0.0     
ref|NP_565963.2|  phospholipase D beta 1                                910   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|EPS67301.1|  hypothetical protein M569_07474                         910   0.0     
gb|AAB63542.2|  phospholipase D                                         910   0.0     Arabidopsis thaliana [mouse-ear cress]
emb|CDX90066.1|  BnaA10g00160D                                          909   0.0     
ref|XP_002881817.1|  phospholipase D beta 1                             908   0.0     
ref|XP_009119747.1|  PREDICTED: phospholipase D beta 1                  907   0.0     
gb|KDP25544.1|  hypothetical protein JCGZ_20700                         907   0.0     
ref|XP_006295936.1|  hypothetical protein CARUB_v10025073mg             907   0.0     
ref|XP_006418468.1|  hypothetical protein EUTSA_v10006647mg             907   0.0     
emb|CDY15144.1|  BnaC05g00230D                                          906   0.0     
emb|CBI34767.3|  unnamed protein product                                906   0.0     
ref|XP_010508631.1|  PREDICTED: phospholipase D beta 1 isoform X2       904   0.0     
ref|XP_003520025.1|  PREDICTED: phospholipase D beta 1-like             904   0.0     
ref|XP_010272588.1|  PREDICTED: phospholipase D gamma 1-like            904   0.0     
gb|KHG24518.1|  Phospholipase D beta 1                                  902   0.0     
ref|XP_007051965.1|  Phospholipase D beta 1 isoform 1                   902   0.0     
ref|XP_010058437.1|  PREDICTED: phospholipase D gamma 1                 902   0.0     
gb|KCW72878.1|  hypothetical protein EUGRSUZ_E01326                     902   0.0     
gb|AAD43343.1|AF159139_1  phospholipase D                               902   0.0     Gossypium hirsutum [American cotton]
ref|XP_008232842.1|  PREDICTED: phospholipase D beta 1                  901   0.0     
ref|XP_011023456.1|  PREDICTED: phospholipase D beta 2-like isofo...    900   0.0     
ref|XP_010255577.1|  PREDICTED: phospholipase D beta 2-like isofo...    900   0.0     
ref|XP_007218907.1|  hypothetical protein PRUPE_ppa000580mg             900   0.0     
ref|XP_010517711.1|  PREDICTED: phospholipase D beta 1-like             899   0.0     
ref|XP_011035015.1|  PREDICTED: phospholipase D beta 2-like             899   0.0     
ref|XP_002509685.1|  phospholipase d beta, putative                     899   0.0     Ricinus communis
gb|EYU32034.1|  hypothetical protein MIMGU_mgv1a000642mg                899   0.0     
ref|XP_002301317.2|  PHOSPHOLIPASE D BETA 1 family protein              898   0.0     Populus trichocarpa [western balsam poplar]
gb|AAC49656.2|  phospholipase D                                         898   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010540447.1|  PREDICTED: phospholipase D gamma 1-like            897   0.0     
ref|XP_009398075.1|  PREDICTED: phospholipase D gamma 1-like isof...    897   0.0     
ref|XP_009128477.1|  PREDICTED: phospholipase D beta 2 isoform X1       897   0.0     
ref|XP_004306869.1|  PREDICTED: phospholipase D beta 1-like             897   0.0     
ref|XP_003517450.1|  PREDICTED: phospholipase D beta 1-like isofo...    897   0.0     
ref|XP_010933911.1|  PREDICTED: phospholipase D gamma 1-like            897   0.0     
ref|XP_010508627.1|  PREDICTED: phospholipase D beta 1 isoform X1       896   0.0     
ref|XP_006396843.1|  hypothetical protein EUTSA_v10028422mg             896   0.0     
ref|XP_006441123.1|  hypothetical protein CICLE_v10018583mg             896   0.0     
emb|CDY54926.1|  BnaAnng13600D                                          895   0.0     
gb|ADV31547.1|  phospholipase D beta                                    895   0.0     
ref|XP_003623811.1|  Phospholipase D                                    894   0.0     
ref|XP_010272591.1|  PREDICTED: phospholipase D beta 1-like isofo...    894   0.0     
ref|XP_004145051.1|  PREDICTED: phospholipase D beta 1-like             894   0.0     
ref|XP_011029151.1|  PREDICTED: phospholipase D beta 1-like             893   0.0     
ref|XP_010272589.1|  PREDICTED: phospholipase D beta 1-like isofo...    893   0.0     
ref|NP_001234108.1|  phospholipase PLDb2                                893   0.0     
ref|XP_006491998.1|  PREDICTED: phospholipase D beta 1-like isofo...    893   0.0     
ref|XP_002320087.2|  hypothetical protein POPTR_0014s07070g             893   0.0     
gb|EMS50329.1|  Phospholipase D delta                                   893   0.0     
ref|XP_003551823.1|  PREDICTED: phospholipase D beta 1-like isofo...    893   0.0     
gb|KHN13886.1|  Phospholipase D beta 2                                  892   0.0     
gb|ADY75749.1|  phospholipase D beta                                    892   0.0     
ref|XP_009398073.1|  PREDICTED: phospholipase D gamma 1-like isof...    892   0.0     
gb|KFK30609.1|  hypothetical protein AALP_AA6G003800                    892   0.0     
ref|XP_009386171.1|  PREDICTED: phospholipase D delta-like isofor...    892   0.0     
ref|XP_008238759.1|  PREDICTED: phospholipase D beta 1-like             892   0.0     
ref|XP_007211141.1|  hypothetical protein PRUPE_ppa026639mg             892   0.0     
ref|XP_011091260.1|  PREDICTED: phospholipase D gamma 1-like            891   0.0     
emb|CDX86742.1|  BnaA09g21320D                                          891   0.0     
ref|XP_008460150.1|  PREDICTED: phospholipase D beta 2-like             891   0.0     
ref|XP_009593225.1|  PREDICTED: phospholipase D beta 1-like             891   0.0     
ref|XP_009102711.1|  PREDICTED: phospholipase D gamma 1                 891   0.0     
ref|XP_010272594.1|  PREDICTED: phospholipase D beta 1-like             890   0.0     
emb|CDY52961.1|  BnaCnng23890D                                          890   0.0     
ref|XP_010323957.1|  PREDICTED: phospholipase PLDb2 isoform X1          890   0.0     
ref|XP_004510892.1|  PREDICTED: phospholipase D beta 1-like             890   0.0     
ref|XP_004248573.2|  PREDICTED: phospholipase D gamma 1-like            890   0.0     
ref|XP_009377896.1|  PREDICTED: phospholipase D beta 1-like isofo...    890   0.0     
ref|XP_006339497.1|  PREDICTED: phospholipase D beta 1-like             890   0.0     
emb|CDP08909.1|  unnamed protein product                                889   0.0     
ref|XP_004492672.1|  PREDICTED: phospholipase D beta 1-like isofo...    889   0.0     
ref|XP_010434095.1|  PREDICTED: phospholipase D gamma 1                 889   0.0     
ref|XP_009766427.1|  PREDICTED: phospholipase D beta 1-like             889   0.0     
ref|XP_004492671.1|  PREDICTED: phospholipase D beta 1-like isofo...    888   0.0     
ref|XP_010496901.1|  PREDICTED: phospholipase D beta 2 isoform X2       887   0.0     
ref|XP_006341798.1|  PREDICTED: phospholipase D beta 1-like             887   0.0     
ref|XP_010692336.1|  PREDICTED: phospholipase D gamma 1                 887   0.0     
ref|XP_010455598.1|  PREDICTED: phospholipase D gamma 1-like            887   0.0     
ref|XP_010426771.1|  PREDICTED: phospholipase D beta 2-like             887   0.0     
ref|XP_009627346.1|  PREDICTED: phospholipase D gamma 1-like            887   0.0     
ref|XP_006440507.1|  hypothetical protein CICLE_v10018726mg             887   0.0     
ref|XP_010496900.1|  PREDICTED: phospholipase D beta 2 isoform X1       887   0.0     
ref|XP_010419560.1|  PREDICTED: phospholipase D beta 2-like             887   0.0     
gb|ADM21349.1|  phospholipase D                                         887   0.0     
ref|XP_009772650.1|  PREDICTED: phospholipase D beta 2-like             886   0.0     
ref|XP_010108055.1|  Phospholipase D beta 1                             886   0.0     
ref|XP_010422137.1|  PREDICTED: phospholipase D gamma 1-like            886   0.0     
gb|KFK31940.1|  hypothetical protein AALP_AA6G179600                    886   0.0     
gb|KEH18997.1|  phospholipase D alpha 1                                 886   0.0     
ref|XP_011072042.1|  PREDICTED: phospholipase D beta 1-like             885   0.0     
gb|ACB98704.1|  phospholipase D gamma 1                                 885   0.0     
gb|AAN05431.1|  phospholipase D beta 1 isoform 1b                       885   0.0     
ref|XP_002306535.2|  hypothetical protein POPTR_0005s10770g             885   0.0     
ref|XP_001773645.1|  predicted protein                                  885   0.0     
ref|XP_010325304.1|  PREDICTED: phospholipase PLDb1 isoform X2          884   0.0     
gb|AES94127.2|  phospholipase D alpha 1                                 884   0.0     
ref|NP_567160.1|  phospholipase D beta 2                                884   0.0     
ref|NP_001275852.1|  phospholipase D gamma                              884   0.0     
ref|NP_192922.1|  phospholipase D gamma 1                               884   0.0     
ref|XP_007139245.1|  hypothetical protein PHAVU_008G013400g             884   0.0     
gb|KDO63612.1|  hypothetical protein CISIN_1g003057mg                   883   0.0     
gb|KHN04601.1|  Phospholipase D beta 1                                  882   0.0     
ref|XP_008348788.1|  PREDICTED: phospholipase D beta 1-like             882   0.0     
ref|XP_003529972.1|  PREDICTED: phospholipase D beta 1-like             882   0.0     
gb|KHG08188.1|  Phospholipase D beta 1 -like protein                    882   0.0     
ref|XP_003611170.1|  Phospholipase D                                    882   0.0     
ref|XP_010325303.1|  PREDICTED: phospholipase PLDb1 isoform X1          881   0.0     
gb|AAN05430.1|  phospholipase D beta 1 isoform 1a                       880   0.0     
ref|XP_009411445.1|  PREDICTED: phospholipase D gamma 1-like            880   0.0     
ref|XP_008375890.1|  PREDICTED: phospholipase D gamma 1-like            880   0.0     
ref|XP_009350598.1|  PREDICTED: phospholipase D gamma 1-like            879   0.0     
ref|XP_001755745.1|  predicted protein                                  879   0.0     
ref|XP_009128478.1|  PREDICTED: phospholipase D beta 2 isoform X2       878   0.0     
ref|XP_003611169.1|  Phospholipase D                                    878   0.0     
gb|EAY79266.1|  hypothetical protein OsI_34382                          878   0.0     
ref|XP_010234931.1|  PREDICTED: phospholipase D beta 1-like             877   0.0     
gb|EEE51295.1|  hypothetical protein OsJ_32215                          877   0.0     
ref|NP_001065108.1|  Os10g0524400                                       876   0.0     
tpg|DAA46011.1|  TPA: phospholipase D family protein                    875   0.0     
ref|XP_009402071.1|  PREDICTED: phospholipase D gamma 1-like            875   0.0     
ref|XP_002874727.1|  PLDGAMMA1                                          874   0.0     
ref|XP_006425351.1|  hypothetical protein CICLE_v10024876mg             873   0.0     
ref|NP_192921.1|  phospholipase D gamma 3                               872   0.0     
gb|EYU39008.1|  hypothetical protein MIMGU_mgv1a025768mg                871   0.0     
ref|XP_002874728.1|  PLDGAMMA1                                          870   0.0     
ref|XP_008650173.1|  PREDICTED: phospholipase D beta 1 isoform X1       870   0.0     
ref|XP_004987207.1|  PREDICTED: phospholipase D beta 1-like             869   0.0     
gb|KHN25737.1|  Phospholipase D beta 1                                  868   0.0     
ref|XP_004298731.1|  PREDICTED: phospholipase D beta 1-like             868   0.0     
gb|EYU36937.1|  hypothetical protein MIMGU_mgv1a001270mg                868   0.0     
ref|XP_006425353.1|  hypothetical protein CICLE_v10024876mg             868   0.0     
ref|NP_001048777.1|  Os03g0119100                                       867   0.0     
ref|NP_192920.3|  phospholipase D gamma 2                               867   0.0     
gb|KDO38447.1|  hypothetical protein CISIN_1g002960mg                   865   0.0     
ref|XP_007159572.1|  hypothetical protein PHAVU_002G2487000g            864   0.0     
ref|XP_007046581.1|  Phospholipase D delta isoform 3                    861   0.0     
ref|XP_007046582.1|  Phospholipase D delta isoform 4                    859   0.0     
ref|XP_004983867.1|  PREDICTED: phospholipase D beta 1-like             874   0.0     
ref|XP_002272857.1|  PREDICTED: phospholipase D beta 2                  875   0.0     
ref|XP_009377897.1|  PREDICTED: phospholipase D beta 1-like isofo...    864   0.0     
emb|CAD11899.1|  phospholipase D                                        865   0.0     
gb|AAL78821.1|AF411221_1  phospholipase D beta 2                        867   0.0     
gb|EEE58223.1|  hypothetical protein OsJ_09194                          864   0.0     
gb|EEC74402.1|  hypothetical protein OsI_09757                          864   0.0     
ref|XP_002872960.1|  PLDBETA2                                           869   0.0     
ref|NP_001234509.1|  phospholipase PLDb1                                863   0.0     
ref|XP_010053353.1|  PREDICTED: phospholipase D beta 1-like             863   0.0     
ref|XP_007134946.1|  hypothetical protein PHAVU_010G088900g             870   0.0     
ref|XP_002465043.1|  hypothetical protein SORBIDRAFT_01g031100          868   0.0     
ref|XP_004298738.1|  PREDICTED: phospholipase D beta 1-like             862   0.0     
gb|KCW77623.1|  hypothetical protein EUGRSUZ_D01933                     864   0.0     
gb|EMT16220.1|  Phospholipase D beta 1                                  859   0.0     
ref|XP_007158450.1|  hypothetical protein PHAVU_002G153400g             859   0.0     
gb|KHG24517.1|  Phospholipase D beta 1                                  871   0.0     
ref|XP_008670092.1|  PREDICTED: phospholipase D delta-like isofor...    851   0.0     
gb|KHG24516.1|  Phospholipase D beta 1                                  872   0.0     
ref|NP_849539.1|  phospholipase D gamma 2                               854   0.0     
ref|XP_003562179.1|  PREDICTED: phospholipase D beta 1-like             852   0.0     
ref|XP_011081056.1|  PREDICTED: phospholipase D beta 1-like             851   0.0     
emb|CDP09827.1|  unnamed protein product                                851   0.0     
ref|XP_010255578.1|  PREDICTED: phospholipase D beta 2-like isofo...    859   0.0     
ref|XP_008448951.1|  PREDICTED: phospholipase D beta 1-like             848   0.0     
gb|EMT06052.1|  Phospholipase D delta                                   847   0.0     
dbj|BAK05371.1|  predicted protein                                      846   0.0     
gb|KGN55946.1|  hypothetical protein Csa_3G038190                       845   0.0     
ref|XP_004147966.1|  PREDICTED: phospholipase D beta 1-like             844   0.0     
gb|KCW56571.1|  hypothetical protein EUGRSUZ_I02303                     839   0.0     
ref|XP_010506009.1|  PREDICTED: phospholipase D beta 1 isoform X1       838   0.0     
gb|KDO38446.1|  hypothetical protein CISIN_1g002960mg                   834   0.0     
ref|XP_001782222.1|  predicted protein                                  840   0.0     
dbj|BAJ91145.1|  predicted protein                                      841   0.0     
ref|XP_004159494.1|  PREDICTED: phospholipase D beta 1-like             843   0.0     
ref|XP_010100114.1|  Phospholipase D delta                              828   0.0     
ref|XP_010676577.1|  PREDICTED: phospholipase D beta 1-like             838   0.0     
ref|XP_004298735.1|  PREDICTED: phospholipase D beta 1-like             837   0.0     
ref|XP_002976163.1|  hypothetical protein SELMODRAFT_175410             833   0.0     
emb|CDP07339.1|  unnamed protein product                                823   0.0     
pir||T01547  probable phospholipase D (EC 3.1.4.4) A_IG005I10.13 ...    835   0.0  
ref|XP_002968214.1|  hypothetical protein SELMODRAFT_89049              832   0.0     
gb|AAB87672.1|  phospholipase D-gamma                                   835   0.0     
ref|XP_010234932.1|  PREDICTED: phospholipase D beta 1-like             833   0.0     
gb|EMT00669.1|  Phospholipase D beta 1                                  828   0.0     
emb|CDX90807.1|  BnaA03g24870D                                          825   0.0     
ref|XP_010678653.1|  PREDICTED: phospholipase D gamma 1-like            825   0.0     
ref|XP_009337116.1|  PREDICTED: phospholipase D delta-like              816   0.0     
ref|XP_010068095.1|  PREDICTED: phospholipase D delta-like              814   0.0     
ref|XP_010272593.1|  PREDICTED: phospholipase D beta 1-like isofo...    820   0.0     
gb|KDO38449.1|  hypothetical protein CISIN_1g002960mg                   807   0.0     
ref|XP_004158899.1|  PREDICTED: phospholipase D delta-like              808   0.0     
ref|XP_010233724.1|  PREDICTED: phospholipase D delta-like              815   0.0     
ref|XP_006396841.1|  hypothetical protein EUTSA_v10028438mg             812   0.0     
emb|CDY64184.1|  BnaC03g73050D                                          811   0.0     
ref|XP_009135779.1|  PREDICTED: phospholipase D gamma 1-like            808   0.0     
ref|XP_008645181.1|  PREDICTED: phospholipase D delta-like              810   0.0     
gb|AEQ02416.1|  phospholipase D                                         787   0.0     
ref|XP_004300742.1|  PREDICTED: phospholipase D beta 1-like             796   0.0     
emb|CBI38833.3|  unnamed protein product                                798   0.0     
gb|AEQ02414.1|  phospholipase D                                         777   0.0     
gb|AEQ02415.1|  phospholipase D                                         776   0.0     
emb|CDX92932.1|  BnaA03g36540D                                          808   0.0     
ref|XP_011023457.1|  PREDICTED: phospholipase D beta 2-like isofo...    791   0.0     
ref|XP_004300743.1|  PREDICTED: phospholipase D beta 1-like             783   0.0     
ref|XP_002453201.1|  hypothetical protein SORBIDRAFT_04g001600          781   0.0     
gb|EMT09210.1|  Phospholipase D delta                                   768   0.0     
gb|EPS66999.1|  hypothetical protein M569_07777                         765   0.0     
gb|EMS45543.1|  Phospholipase D beta 1                                  769   0.0     
ref|NP_001051849.1|  Os03g0840800                                       749   0.0     
emb|CDX90808.1|  BnaA03g24880D                                          757   0.0     
ref|XP_010279406.1|  PREDICTED: phospholipase D beta 1-like             759   0.0     
ref|XP_010106764.1|  Phospholipase D beta 1                             766   0.0     
ref|XP_010228187.1|  PREDICTED: phospholipase D delta-like isofor...    745   0.0     
ref|XP_008670093.1|  PREDICTED: phospholipase D delta-like isofor...    744   0.0     
ref|XP_004956882.1|  PREDICTED: phospholipase D delta-like isofor...    740   0.0     
gb|EYU36939.1|  hypothetical protein MIMGU_mgv1a026090mg                746   0.0     
gb|KCW62820.1|  hypothetical protein EUGRSUZ_G00410                     736   0.0     
gb|AFW69862.1|  phospholipase D family protein                          744   0.0     
emb|CAN71413.1|  hypothetical protein VITISV_029215                     718   0.0     
gb|KDO38448.1|  hypothetical protein CISIN_1g002960mg                   699   0.0     
ref|XP_010457031.1|  PREDICTED: phospholipase D beta 2-like             685   0.0     
ref|XP_006396842.1|  hypothetical protein EUTSA_v10029240mg             686   0.0     
ref|XP_004172078.1|  PREDICTED: phospholipase D beta 1-like             686   0.0     
gb|EYU38375.1|  hypothetical protein MIMGU_mgv1a0212841mg               671   0.0     
ref|XP_010541603.1|  PREDICTED: phospholipase D zeta                    682   0.0     
ref|XP_003603407.1|  Phospholipase D alpha                              681   0.0     
ref|XP_004287315.1|  PREDICTED: phospholipase D alpha 1-like            680   0.0     
ref|XP_001762942.1|  predicted protein                                  679   0.0     
ref|XP_009625689.1|  PREDICTED: phospholipase D alpha 1                 679   0.0     
ref|XP_009799916.1|  PREDICTED: phospholipase D alpha 1                 676   0.0     
gb|KDP32412.1|  hypothetical protein JCGZ_13337                         676   0.0     
ref|XP_002515518.1|  phopholipase d alpha, putative                     676   0.0     
ref|XP_010101275.1|  Phospholipase D alpha 1                            675   0.0     
gb|AEQ02410.1|  phospholipase D                                         667   0.0     
gb|AEQ02412.1|  phospholipase D                                         670   0.0     
gb|KHN07080.1|  Phospholipase D alpha 1                                 675   0.0     
sp|P93400.2|PLDA1_TOBAC  RecName: Full=Phospholipase D alpha 1; S...    674   0.0     
ref|XP_010691149.1|  PREDICTED: phospholipase D alpha 1-like            674   0.0     
ref|XP_009151064.1|  PREDICTED: phospholipase D zeta                    674   0.0     
ref|XP_006581357.1|  PREDICTED: phospholipase D alpha 1-like            674   0.0     
ref|XP_002972515.1|  hypothetical protein SELMODRAFT_441825             673   0.0     
ref|XP_004235964.1|  PREDICTED: phospholipase D alpha 1                 672   0.0     
ref|XP_002992572.1|  hypothetical protein SELMODRAFT_186850             671   0.0     
emb|CAB43062.1|  phospholipase D2                                       671   0.0     
ref|XP_004138856.1|  PREDICTED: phospholipase D alpha 2-like            671   0.0     
ref|XP_009613360.1|  PREDICTED: phospholipase D alpha 1-like            670   0.0     
ref|XP_004160794.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    671   0.0     
gb|KGN62948.1|  hypothetical protein Csa_2G381740                       669   0.0     
ref|NP_001105686.1|  phospholipase D alpha 1                            669   0.0     
ref|NP_001234102.1|  phospholipase PLDa1                                669   0.0     
gb|EYU32345.1|  hypothetical protein MIMGU_mgv1a001383mg                669   0.0     
ref|XP_009787006.1|  PREDICTED: phospholipase D alpha 1-like isof...    666   0.0     
gb|AAN04576.1|  phospholipase D beta 1 isoform                          659   0.0     
ref|XP_010322318.1|  PREDICTED: phospholipase PLDa1 isoform X1          667   0.0     
gb|ACR35730.1|  unknown                                                 668   0.0     
ref|XP_008673445.1|  PREDICTED: phospholipase D alpha 1 isoform X1      668   0.0     
ref|XP_009787005.1|  PREDICTED: phospholipase D alpha 1-like isof...    667   0.0     
ref|XP_006356207.1|  PREDICTED: phospholipase D alpha 1-like isof...    667   0.0     
gb|EEC70024.1|  hypothetical protein OsI_00588                          667   0.0     
ref|XP_010687988.1|  PREDICTED: phospholipase D alpha 1-like            667   0.0     
ref|XP_003603403.1|  Phospholipase D alpha                              667   0.0     
ref|XP_004486668.1|  PREDICTED: phospholipase D alpha 1-like isof...    667   0.0     



>ref|XP_004238395.1| PREDICTED: phospholipase D delta-like [Solanum lycopersicum]
Length=839

 Score =  1364 bits (3530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 662/842 (79%), Positives = 738/842 (88%), Gaps = 4/842 (0%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQGNKVRRH  2519
             M+D   ENVVYLHGD DLKI+EARRLPNMD+V+ER+ + FTA D CRKP TR+  K  R 
Sbjct  1     MADENCENVVYLHGDFDLKIIEARRLPNMDLVTERLSRCFTALDICRKPFTRRRRKGHR-  59

Query  2518  TRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGA  2339
              +IITSDPYV VCL GATVARTRVISN QDPVW EHFKIP+AHPVS VEF VKDNDVFGA
Sbjct  60    RKIITSDPYVTVCLTGATVARTRVISNCQDPVWNEHFKIPLAHPVSVVEFLVKDNDVFGA  119

Query  2338  DFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTE  2159
             D+IGVA V A+KI SGE I+DWFPIIG +GKPPKPDCAIRL M+F  C  NP Y GG++E
Sbjct  120   DYIGVATVLAEKIKSGELIDDWFPIIGPYGKPPKPDCAIRLQMRFIHCDGNPSYNGGISE  179

Query  2158  DYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHM  1979
             D+GLK SYFP+RHGG+VTLYQDAHVP+G LPEIK+DD K F H  CWEDICHAILEAHH+
Sbjct  180   DFGLKASYFPVRHGGSVTLYQDAHVPDGMLPEIKLDDDKIFEHSKCWEDICHAILEAHHL  239

Query  1978  VYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFI  1799
             VY+VGWSI+HKVKLVREP++PLP+GG+L LGELLKYKS+EGVRVLLLVWDDKTSHSKFFI
Sbjct  240   VYVVGWSIFHKVKLVREPSKPLPSGGDLTLGELLKYKSEEGVRVLLLVWDDKTSHSKFFI  299

Query  1798  NTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQA  1619
              T GVM THDEETRKFFKHSSV CVLAPRYASSKLS  KQQVVGTLYTHHQKCVIVDTQA
Sbjct  300   QTDGVMQTHDEETRKFFKHSSVNCVLAPRYASSKLSIFKQQVVGTLYTHHQKCVIVDTQA  359

Query  1618  QGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDL  1439
              GNNRK++AF+GGLDLCDGRYDTP+HRLF D DTVF+ D++NPTF   G K PRQPWHDL
Sbjct  360   SGNNRKVSAFLGGLDLCDGRYDTPEHRLFRDLDTVFKDDFHNPTF-STGTKAPRQPWHDL  418

Query  1438  HCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSV  1259
             HCKIEGPAAYD+LTNFEQRWRKA+KW+E GRR KKISHWHDDAL+KIERISWITSP+ SV
Sbjct  419   HCKIEGPAAYDVLTNFEQRWRKATKWSEFGRRLKKISHWHDDALIKIERISWITSPSSSV  478

Query  1258  PNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQM  1079
             PNDD SLWVS E DP+NWHVQVFRSIDSGSLKGFPKDV  AE+QNLVCAK+LVIDRSIQM
Sbjct  479   PNDDQSLWVSKEEDPENWHVQVFRSIDSGSLKGFPKDVLLAESQNLVCAKNLVIDRSIQM  538

Query  1078  AYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVY  899
             AYI+AIR+AQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKI SKIR +ERFAVY
Sbjct  539   AYIQAIRQAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIASKIRAKERFAVY  598

Query  898   IVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNR  719
             IVIPMWPEGVP+SA VQ+ILYWQ QT++MMY IIA+ELKS +++D H  DYLNFYCLGNR
Sbjct  599   IVIPMWPEGVPTSASVQEILYWQRQTMKMMYGIIAQELKSSQLQDVHLSDYLNFYCLGNR  658

Query  718   EEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSR  539
             EE H ES S+      + ++ SQK GRFMIYVHAKGM+VDDEYVI+GSANINQRSMAGSR
Sbjct  659   EELHGESKSNYASN-GDLISASQKFGRFMIYVHAKGMIVDDEYVILGSANINQRSMAGSR  717

Query  538   DTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEI  359
             DTEIAMGAYQPHHTWA  + HPH QVYGYRMSLWAEH+G +D+   + E L CVK VNE+
Sbjct  718   DTEIAMGAYQPHHTWAMKKRHPHGQVYGYRMSLWAEHMGKLDDIFTKPESLNCVKHVNEV  777

Query  358   AEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDAL  179
             AE+NWKR+TA +F PLQGHLLKYP+QV ++G+VS L G EYFPDVGGK+LG+RT LPDAL
Sbjct  778   AEDNWKRFTAHEFKPLQGHLLKYPVQVGTDGQVSSLPGHEYFPDVGGKILGARTNLPDAL  837

Query  178   TT  173
             TT
Sbjct  838   TT  839



>ref|XP_009776941.1| PREDICTED: phospholipase D delta-like [Nicotiana sylvestris]
Length=840

 Score =  1357 bits (3512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 664/842 (79%), Positives = 744/842 (88%), Gaps = 3/842 (0%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQGNKVRRH  2519
             M+D   ENV++LHGDLDLKILEARRLPNMD+V+ER+R+ FTA D CRKP TR+  K    
Sbjct  1     MADENCENVIHLHGDLDLKILEARRLPNMDLVTERLRRCFTALDVCRKPFTRRRRKGHH-  59

Query  2518  TRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGA  2339
              +IITSDPYV VCL+GATVARTRVISN QDPVW EHFKIP+AHPVS VEFQVKDNDVFGA
Sbjct  60    RKIITSDPYVTVCLSGATVARTRVISNCQDPVWNEHFKIPLAHPVSVVEFQVKDNDVFGA  119

Query  2338  DFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTE  2159
             D+IGVA V AQKI SGE I+DWFPIIG +GKPPKPDCAIRL MKFT C  NP Y  G++E
Sbjct  120   DYIGVATVPAQKIKSGELIDDWFPIIGPYGKPPKPDCAIRLQMKFTHCNGNPVYNSGISE  179

Query  2158  DYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHM  1979
             DYGLKESYFP+RHGG+VTLYQDAHVP+G LPEIK+DD K F H  CWEDICHAILEAHH+
Sbjct  180   DYGLKESYFPVRHGGSVTLYQDAHVPDGMLPEIKLDDNKVFEHSKCWEDICHAILEAHHL  239

Query  1978  VYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFI  1799
             VYIVGWSI+HKVKLVREP++PLP+GG+L LG+LLKYKS+EGVRVLLLVWDDKTSHSKFFI
Sbjct  240   VYIVGWSIFHKVKLVREPSKPLPSGGDLTLGDLLKYKSEEGVRVLLLVWDDKTSHSKFFI  299

Query  1798  NTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQA  1619
              T G+M THDEETRKFFKHSSVTCVL+PRYASSKLS  KQQVVGTLYTHHQKCVIVDTQA
Sbjct  300   QTDGLMCTHDEETRKFFKHSSVTCVLSPRYASSKLSIFKQQVVGTLYTHHQKCVIVDTQA  359

Query  1618  QGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDL  1439
              GNNRKITAF+GGLDLCDGRYDTP+HRLF D DTVF+ DY+NPTF   G KGPRQPWHDL
Sbjct  360   SGNNRKITAFLGGLDLCDGRYDTPEHRLFCDLDTVFKDDYHNPTFC-AGTKGPRQPWHDL  418

Query  1438  HCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSV  1259
             HCK+EGPAAYD+LTNFEQRWRKA+KW+ELGRR K+ISHWHDDAL+KIERISWI SP+ SV
Sbjct  419   HCKVEGPAAYDVLTNFEQRWRKATKWSELGRRLKRISHWHDDALIKIERISWIISPSSSV  478

Query  1258  PNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQM  1079
             PNDD SLWVS E DP+NWHVQVFRSIDSGSLKGFPKDV  AE+QNLVCAK+LVID+SIQM
Sbjct  479   PNDDQSLWVSKEEDPENWHVQVFRSIDSGSLKGFPKDVFLAESQNLVCAKNLVIDKSIQM  538

Query  1078  AYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVY  899
              YI+AIR+AQHFIYIENQYFLGSSYAW SYK+AGADNLIPMELALKI SKIR +ERF+VY
Sbjct  539   GYIQAIRQAQHFIYIENQYFLGSSYAWHSYKDAGADNLIPMELALKIASKIREKERFSVY  598

Query  898   IVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNR  719
             +VIPMWPEGVP+SA VQ+ILYWQ QT++MMY IIA+ELKS +++D HP DYLNFYCLGNR
Sbjct  599   VVIPMWPEGVPTSASVQEILYWQRQTMKMMYGIIAQELKSSQLKDVHPSDYLNFYCLGNR  658

Query  718   EEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSR  539
             EE H  S  +P     + ++ SQK GRFMIYVHAKGM+VDDEYVI+GSANINQRSMAGSR
Sbjct  659   EELHGGSKPNPASSNGDVISASQKFGRFMIYVHAKGMIVDDEYVILGSANINQRSMAGSR  718

Query  538   DTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEI  359
             DTEIAMGAYQPHHTWA  + HPH QVYGYRMSLWAEH+G +D+   + E L+CVK VN++
Sbjct  719   DTEIAMGAYQPHHTWANKKKHPHGQVYGYRMSLWAEHMGKLDDCFTKPESLDCVKHVNKV  778

Query  358   AEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDAL  179
             AE+NW R+TAE+F PLQGHLLKYP++VDS+GKVS L G EYFPDVGGKVLG+RT LPDAL
Sbjct  779   AEDNWNRFTAEEFKPLQGHLLKYPVKVDSDGKVSSLPGHEYFPDVGGKVLGARTNLPDAL  838

Query  178   TT  173
             TT
Sbjct  839   TT  840



>ref|XP_009620056.1| PREDICTED: phospholipase D delta-like [Nicotiana tomentosiformis]
Length=840

 Score =  1355 bits (3508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 664/842 (79%), Positives = 743/842 (88%), Gaps = 3/842 (0%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQGNKVRRH  2519
             M+D   ENV++LHGDLDLKILEARRLPNMD+V+ER+R+ FTA D CRKP TR+  K    
Sbjct  1     MADENCENVIHLHGDLDLKILEARRLPNMDLVTERLRRCFTALDVCRKPFTRRRRKGHH-  59

Query  2518  TRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGA  2339
              +IITSDPYV VCL+GATVARTRVISN QDPVW EHFKIP+AHPVS VEFQVKDNDVFGA
Sbjct  60    RKIITSDPYVTVCLSGATVARTRVISNCQDPVWNEHFKIPLAHPVSVVEFQVKDNDVFGA  119

Query  2338  DFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTE  2159
             D+IGVA V AQKI SGE I+DWFPIIG +GKPPKPDCAIRL MKF  C  NP Y  G++E
Sbjct  120   DYIGVATVPAQKINSGELIDDWFPIIGPYGKPPKPDCAIRLQMKFRHCNGNPLYNSGISE  179

Query  2158  DYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHM  1979
             DYGLKESYFP+RHGG+VTLYQDAHVP+G LPEIK+DD K F H  CWEDICHAILEAHH+
Sbjct  180   DYGLKESYFPVRHGGSVTLYQDAHVPDGMLPEIKLDDNKVFEHSKCWEDICHAILEAHHL  239

Query  1978  VYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFI  1799
             VYIVGWSI+HKVKLVREP++PLP+GG+L LGELLKYKS+EGVRVLLLVWDDKTSHSKFFI
Sbjct  240   VYIVGWSIFHKVKLVREPSKPLPSGGDLTLGELLKYKSEEGVRVLLLVWDDKTSHSKFFI  299

Query  1798  NTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQA  1619
              T GVM THDEETRKFFKHSSVTCVL+PRYASSKLS  KQQVVGTLYTHHQKCVIVD+QA
Sbjct  300   QTDGVMCTHDEETRKFFKHSSVTCVLSPRYASSKLSIFKQQVVGTLYTHHQKCVIVDSQA  359

Query  1618  QGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDL  1439
              GNNRKITAF+GGLDLCDGRYDTP+HRLF D DTVF+ DY+NPTF   G KGPRQPWHDL
Sbjct  360   SGNNRKITAFLGGLDLCDGRYDTPEHRLFRDLDTVFKDDYHNPTF-GAGTKGPRQPWHDL  418

Query  1438  HCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSV  1259
             HCK+EGPAAYD+LTNFEQRWRKA+KW+ELGRR KKISHWHDDAL+KIERISWI SP+ SV
Sbjct  419   HCKVEGPAAYDVLTNFEQRWRKATKWSELGRRLKKISHWHDDALIKIERISWIISPSSSV  478

Query  1258  PNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQM  1079
             PNDD SLWVS E DP+NWHVQVFRSIDSGSLKGFPKDV  AE+QNLVCAK+LVID+SIQM
Sbjct  479   PNDDQSLWVSKEEDPENWHVQVFRSIDSGSLKGFPKDVFLAESQNLVCAKNLVIDKSIQM  538

Query  1078  AYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVY  899
              YI+AIR+AQHFIYIENQYFLGSSYAW SYK+AGADNLIPMELALKI SKIR +ERF+VY
Sbjct  539   GYIQAIRQAQHFIYIENQYFLGSSYAWHSYKDAGADNLIPMELALKIASKIREKERFSVY  598

Query  898   IVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNR  719
             +VIPMWPEGVP+SA VQ+ILYWQ QT++MMY IIA+ELKS +++D HP DYLNFYCLGNR
Sbjct  599   VVIPMWPEGVPTSASVQEILYWQRQTMKMMYGIIAQELKSSQLKDVHPSDYLNFYCLGNR  658

Query  718   EEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSR  539
             EE H ES  +P     + ++ SQK GRFMIYVHAKGM+VDDEYVI+GSANINQRSMAGSR
Sbjct  659   EELHGESKPNPASSNGDMISASQKFGRFMIYVHAKGMIVDDEYVILGSANINQRSMAGSR  718

Query  538   DTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEI  359
             DTEIAMGAYQPHHTWA  + HPH QVYGYRMSLWAEH+  +D+   + E L+C+K VN++
Sbjct  719   DTEIAMGAYQPHHTWAIKKKHPHGQVYGYRMSLWAEHMAKLDDCFTKPESLDCLKHVNKV  778

Query  358   AEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDAL  179
             AE+NW R+TAE+F PLQGHLLKYP++VDS+GKVS L G EYFPDVGGKVLG+RT LPDAL
Sbjct  779   AEDNWNRFTAEEFKPLQGHLLKYPVKVDSDGKVSSLPGHEYFPDVGGKVLGARTNLPDAL  838

Query  178   TT  173
             TT
Sbjct  839   TT  840



>gb|EYU36813.1| hypothetical protein MIMGU_mgv1a001300mg [Erythranthe guttata]
Length=844

 Score =  1337 bits (3460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 643/837 (77%), Positives = 735/837 (88%), Gaps = 4/837 (0%)
 Frame = -2

Query  2674  NVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRRHT-RIITSD  2498
             +V+YLHG+LDLKI+EAR LPNMD++SER+R+ FTAFDCRKP T    +   H  +IITSD
Sbjct  9     DVIYLHGNLDLKIIEARCLPNMDLLSERLRRCFTAFDCRKPFTSNRRRDHHHHRKIITSD  68

Query  2497  PYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVAK  2318
             PYV VCL GA VARTRVISNSQ+P+W E+FKIP+AHPVS+VEFQVKDND+FGA+ IG+A 
Sbjct  69    PYVTVCLGGARVARTRVISNSQNPIWKENFKIPLAHPVSQVEFQVKDNDMFGAELIGIAT  128

Query  2317  VSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTEDYGLKES  2138
             V A++I +G+ I++WFP+IG++GKP KPD AIRL M FTPC ++P Y  G++++YGLK+S
Sbjct  129   VPAKRIAAGQVIDEWFPVIGSNGKPSKPDSAIRLQMTFTPCHKDPVYLSGISDNYGLKDS  188

Query  2137  YFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYIVGWS  1958
             YFP RHGG +TLYQDAHV +G LP+IK+DDGK F HE CWEDICH+ILEAHH+VYIVGWS
Sbjct  189   YFPWRHGGKLTLYQDAHVIDGMLPDIKLDDGKNFEHEQCWEDICHSILEAHHLVYIVGWS  248

Query  1957  IYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTSGVMG  1778
             IYHKVKLVREPT+PLPNGG+LNLGELLKYKSQEGVRVLLLVWDDKTSH+KFF+ T GVM 
Sbjct  249   IYHKVKLVREPTKPLPNGGDLNLGELLKYKSQEGVRVLLLVWDDKTSHNKFFLKTDGVMQ  308

Query  1777  THDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQGNNRKI  1598
             THDEETRKFFKHSSVTCVLAPRYASSKLS  KQQVVGTLYTHHQKCVIVDTQ  GNNRKI
Sbjct  309   THDEETRKFFKHSSVTCVLAPRYASSKLSIFKQQVVGTLYTHHQKCVIVDTQHHGNNRKI  368

Query  1597  TAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCKIEGP  1418
             TAFIGGLDLCDGRYDTP+HRLF+D DTVF+ DY+NPTFP G  KGPRQPWHDLHCKIEGP
Sbjct  369   TAFIGGLDLCDGRYDTPEHRLFTDLDTVFKDDYHNPTFPPGK-KGPRQPWHDLHCKIEGP  427

Query  1417  AAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPNDDPSL  1238
             AAYD+L NFEQRWRKA+KW+E G+RF++IS WHDDALLKIERISWITSPT +VPND PSL
Sbjct  428   AAYDVLINFEQRWRKATKWSEFGQRFRRISRWHDDALLKIERISWITSPTTTVPNDHPSL  487

Query  1237  WVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAIR  1058
             WV NE DP+NWHVQ+FRSIDSGSLKGFPK+VH AE QNLVCAK+LVID+SIQMAYIEAIR
Sbjct  488   WVCNENDPENWHVQIFRSIDSGSLKGFPKNVHEAEEQNLVCAKNLVIDKSIQMAYIEAIR  547

Query  1057  RAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPMWP  878
              AQHFIYIENQYFLGSSYAWPSYK AGADNLIPMELALKI SKIR  ERF VY+VIPMWP
Sbjct  548   SAQHFIYIENQYFLGSSYAWPSYKNAGADNLIPMELALKIASKIRANERFTVYVVIPMWP  607

Query  877   EGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREEW--HE  704
             EGVP SA VQ+ILYWQGQT+QMMYEIIA+ELKS  IE+AHP DYLNFYCLGNREE    E
Sbjct  608   EGVPDSASVQEILYWQGQTMQMMYEIIAQELKSANIENAHPTDYLNFYCLGNREECPGDE  667

Query  703   ESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIA  524
              +++ PT       T S+K GRFMIYVHAKGMVVDDEYVI+GSANINQRSMAGSRDTEIA
Sbjct  668   SNSNGPTTSNGNSDTASKKYGRFMIYVHAKGMVVDDEYVIIGSANINQRSMAGSRDTEIA  727

Query  523   MGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENW  344
             MGAYQP++TW K + HPH QVYGYRMSLW+EH+G +D+  +  + LECVK VN +AE+NW
Sbjct  728   MGAYQPNYTWTKKKEHPHGQVYGYRMSLWSEHIGRIDDCFNNPDELECVKYVNSVAEDNW  787

Query  343   KRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALTT  173
             KRYT+E+F+ LQGH+LKYPL++D +GKV+PL G E FPDVGGK++G+ T LPDALTT
Sbjct  788   KRYTSEEFNLLQGHILKYPLEIDIDGKVNPLPGYETFPDVGGKIIGAPTNLPDALTT  844



>ref|XP_008387895.1| PREDICTED: phospholipase D delta-like [Malus domestica]
Length=847

 Score =  1332 bits (3447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 648/840 (77%), Positives = 728/840 (87%), Gaps = 11/840 (1%)
 Frame = -2

Query  2671  VVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRRHTRIITSDPY  2492
             VVYLHGDLDLKILEAR LPNMD+VSER+R+FF+A  C KP TR       H +IITSDPY
Sbjct  12    VVYLHGDLDLKILEARCLPNMDMVSERLRRFFSA--CSKPFTRPAAH-HSHGKIITSDPY  68

Query  2491  VKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVAKVS  2312
             V VCLAGATVARTRVISNSQ+PVW EHFKIP+AHPVS+VEF VKDND+FGAD IGVA VS
Sbjct  69    VTVCLAGATVARTRVISNSQNPVWKEHFKIPLAHPVSQVEFYVKDNDMFGADLIGVASVS  128

Query  2311  AQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED---YGLKE  2141
             A +I+SGETI+DWFPIIG  GKPPKPD A++L M+FT C +NP YR G++ D   +G++ 
Sbjct  129   AVRILSGETISDWFPIIGPLGKPPKPDAAVKLEMRFTKCEDNPMYRHGISNDPDHFGIRN  188

Query  2140  SYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYIVGW  1961
              YFP+R GG VTLYQDAHVPE  L EI++DDG  F H  CWEDICHAILEAHH+VYIVGW
Sbjct  189   CYFPVRQGGHVTLYQDAHVPEAMLEEIELDDGVTFQHGRCWEDICHAILEAHHLVYIVGW  248

Query  1960  SIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTSGVM  1781
             SIYH+VKLVREPT+PLP+GGNLNLGELLKYKS+EG+RVLLLVWDDKTSHSKFFINT+GVM
Sbjct  249   SIYHQVKLVREPTKPLPSGGNLNLGELLKYKSEEGLRVLLLVWDDKTSHSKFFINTNGVM  308

Query  1780  GTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQGNNRK  1601
              THDEETRKFFKHSSV+CVLAPRYASSKLS  KQQVVGTL+THHQKCVIVDTQA GNNRK
Sbjct  309   QTHDEETRKFFKHSSVSCVLAPRYASSKLSIFKQQVVGTLFTHHQKCVIVDTQASGNNRK  368

Query  1600  ITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCKIEG  1421
             ITAFIGGLDLCDGRYDTP+HRLF D D+VF+ DY+NPT   GG KGPRQPWHDLHCKIEG
Sbjct  369   ITAFIGGLDLCDGRYDTPEHRLFRDLDSVFQDDYHNPTL-SGGTKGPRQPWHDLHCKIEG  427

Query  1420  PAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPNDDPS  1241
             PAAYD+LTNFEQRWRKA+KW+ELG+RFK++S WHDDAL+K+ERISWI SP+PS   DDP+
Sbjct  428   PAAYDVLTNFEQRWRKATKWSELGQRFKRVSRWHDDALIKLERISWILSPSPSTAKDDPA  487

Query  1240  LWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAI  1061
             LWVS+E DPQNWHVQVFRSIDSGSLKGFPKDV+ AE QNLVCAK+LV+D+SIQ AYI+AI
Sbjct  488   LWVSDENDPQNWHVQVFRSIDSGSLKGFPKDVYKAEAQNLVCAKNLVVDKSIQTAYIDAI  547

Query  1060  RRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPMW  881
             R AQHFIYIENQYF+GSSY WP+YKEAGADNLIPMELALKI SKIR  ERFAVYIVIPMW
Sbjct  548   RSAQHFIYIENQYFVGSSYGWPAYKEAGADNLIPMELALKIASKIRADERFAVYIVIPMW  607

Query  880   PEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREEWHEE  701
             PEGVPSSA VQ+ILYWQGQT+QMMYE++AKELK+ K+E+AHP DYLNFYCLGNRE   + 
Sbjct  608   PEGVPSSASVQEILYWQGQTMQMMYEVVAKELKAMKVENAHPHDYLNFYCLGNRETLPDT  667

Query  700   SA----SSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDT  533
              +     +   G S  ++ SQK  RFMIYVHAKGMVVDDEYVI+GSANINQRSMAGSRDT
Sbjct  668   LSCHVNQTDRNGESHTVSASQKFQRFMIYVHAKGMVVDDEYVIIGSANINQRSMAGSRDT  727

Query  532   EIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAE  353
             EIAMGAYQPHHTW K + HP  QVYGYRMSLWAEHLGM+D+   EAE L+CVK VN IA 
Sbjct  728   EIAMGAYQPHHTWGKKKRHPRGQVYGYRMSLWAEHLGMVDKCFKEAETLDCVKCVNAIAG  787

Query  352   ENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALTT  173
             +NW R+ A+ F+PLQGHL+KYP+ VD NGKVS + G E FPDVGGK+LG RTTLPDALTT
Sbjct  788   DNWTRFVADDFAPLQGHLMKYPVAVDVNGKVSAIPGRESFPDVGGKILGGRTTLPDALTT  847



>gb|EYU17554.1| hypothetical protein MIMGU_mgv1a025612mg [Erythranthe guttata]
Length=853

 Score =  1328 bits (3436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 649/850 (76%), Positives = 726/850 (85%), Gaps = 19/850 (2%)
 Frame = -2

Query  2674  NVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQ--GNKVRRHTR-IIT  2504
             N VYLHGDLDLKI+EAR LPNMD+++ER+R+FF AF CR+       G   + H++ IIT
Sbjct  7     NNVYLHGDLDLKIIEARCLPNMDLLTERLRRFFAAFACRQTNHHHHDGTDHKHHSKKIIT  66

Query  2503  SDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGV  2324
             SDPYV VCLAGA VARTR+ISNSQ+PVW EHFKIP+AHPVS+VEF+VKDNDVFGAD IGV
Sbjct  67    SDPYVTVCLAGARVARTRIISNSQNPVWNEHFKIPLAHPVSQVEFEVKDNDVFGADLIGV  126

Query  2323  AKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTEDYGLK  2144
             A V+A +I +GETI++W P+IG +GKP KPD A+RL +KFTPC  NP Y  G++ED+ LK
Sbjct  127   ATVAASRIAAGETIDEWVPVIGPYGKPHKPDSAVRLEIKFTPCHTNPTYLNGISEDHELK  186

Query  2143  ESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYIVG  1964
             ESYFP+RHGG VTLYQDAHVPEG LPEI +D+ + F HE CWEDICHAILEAHH+VYIVG
Sbjct  187   ESYFPLRHGGKVTLYQDAHVPEGMLPEIGLDEQRRFEHEQCWEDICHAILEAHHLVYIVG  246

Query  1963  WSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTSGV  1784
             WSIYHKVKLVREPTRPLP GGNLNLGELLKYKSQEGVRVLLLVWDDKTSHSKFFINT+GV
Sbjct  247   WSIYHKVKLVREPTRPLPKGGNLNLGELLKYKSQEGVRVLLLVWDDKTSHSKFFINTTGV  306

Query  1783  MGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQ----------VVGTLYTHHQKCVI  1634
             M THDEETRKFFKHSSV CVLAPRYASSKLS  KQQ          VVG+LYTHHQKCVI
Sbjct  307   MQTHDEETRKFFKHSSVNCVLAPRYASSKLSIFKQQACFFLLLLSYVVGSLYTHHQKCVI  366

Query  1633  VDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQ  1454
             VDTQ  GNNRKIT+FIGGLDLCDGRYDTP HRLF D +TVF  D++NPTF  G  K PRQ
Sbjct  367   VDTQGNGNNRKITSFIGGLDLCDGRYDTPDHRLFRDLNTVFHDDFHNPTFAPG-TKAPRQ  425

Query  1453  PWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITS  1274
             PWHDLHCKIEGPAAYD+LTNFEQRW+KA+KW+E G+RFK+ISHWHDDAL+KIERISWITS
Sbjct  426   PWHDLHCKIEGPAAYDVLTNFEQRWKKATKWSEFGQRFKRISHWHDDALIKIERISWITS  485

Query  1273  PTPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVID  1094
             P+ ++PND PSL VS E DP+NWHVQVFRSIDSGSL GFPK VH AE QNLVCAK LVID
Sbjct  486   PSSTLPNDHPSLRVSKEDDPENWHVQVFRSIDSGSLTGFPKTVHAAEQQNLVCAKSLVID  545

Query  1093  RSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRE  914
             RSIQMAYI+AIR AQHFIYIENQYFLGSSYAWPSYK AGADNLIPMELALKIVSKIR +E
Sbjct  546   RSIQMAYIQAIRSAQHFIYIENQYFLGSSYAWPSYKNAGADNLIPMELALKIVSKIRAKE  605

Query  913   RFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFY  734
             RF VYIVIPMWPEG P SA VQ+ILYWQGQT+QMMYEIIAKE+K+ K+++AHP DYLNFY
Sbjct  606   RFTVYIVIPMWPEGAPDSASVQEILYWQGQTMQMMYEIIAKEIKTAKLKNAHPTDYLNFY  665

Query  733   CLGNREEWHEE---SASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANIN  563
             CLGNREE   E   +  S + G +E  + SQKSGRFMIYVHAKGMVVDDEYVIVGSANIN
Sbjct  666   CLGNREEPLNEPNKNGVSSSNGSTE--SASQKSGRFMIYVHAKGMVVDDEYVIVGSANIN  723

Query  562   QRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLE  383
             QRSMAGSRDTEIAMGAYQP +TW KN+ HPH QVYGYR+SLWAEHLG +D +  +   LE
Sbjct  724   QRSMAGSRDTEIAMGAYQPRYTWIKNKEHPHGQVYGYRLSLWAEHLGKVDNRFKDPASLE  783

Query  382   CVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGS  203
             CVK VN +AE NWKR+T EKF+PLQGHLLKYP+++D +GKV+ L G E FPDVGGKVLG+
Sbjct  784   CVKSVNCVAENNWKRFTGEKFAPLQGHLLKYPVEIDGDGKVNALSGYETFPDVGGKVLGA  843

Query  202   RTTLPDALTT  173
              T LPDALTT
Sbjct  844   PTNLPDALTT  853



>ref|XP_011074721.1| PREDICTED: phospholipase D delta-like [Sesamum indicum]
Length=845

 Score =  1326 bits (3432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 643/844 (76%), Positives = 734/844 (87%), Gaps = 7/844 (1%)
 Frame = -2

Query  2689  DGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETR--QGNKVRRH  2519
             D    N++YLHGDLDLKI+EAR LPNMD+VSER+R+   AFD CRKP T   +GN    H
Sbjct  4     DNPDSNLIYLHGDLDLKIIEARCLPNMDLVSERLRRCLAAFDLCRKPCTSSTRGNH-HHH  62

Query  2518  TRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGA  2339
              +IITSDPYV VCLAGA VARTR+ISNSQ+PVW EHFKIP+AHPVS+VEF+VKDNDVFGA
Sbjct  63    RKIITSDPYVTVCLAGARVARTRIISNSQNPVWEEHFKIPLAHPVSQVEFEVKDNDVFGA  122

Query  2338  DFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTE  2159
             D IG+A + A++I SGE I++WFP+IG++GKPPKPD AIRL M F PC +NP Y  G++E
Sbjct  123   DLIGIAILPAKRIASGELIDEWFPVIGSNGKPPKPDTAIRLQMIFIPCQQNPIYLNGISE  182

Query  2158  DYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHM  1979
             +YGL++SYFP+RHGG VTLYQDAHV +G LPEI +D+G+ F HE CWEDICHAILEAHH+
Sbjct  183   NYGLEKSYFPLRHGGKVTLYQDAHVIDGMLPEIGLDNGRNFEHEKCWEDICHAILEAHHL  242

Query  1978  VYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFI  1799
             VYIVGWSIYHKVKLVREPT+PLPNGG+LNLGELLKYKSQEGVRVLLLVWDDKTSH+KFFI
Sbjct  243   VYIVGWSIYHKVKLVREPTKPLPNGGDLNLGELLKYKSQEGVRVLLLVWDDKTSHNKFFI  302

Query  1798  NTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQA  1619
              T GVM THDEETRKFFK SSVTCVL+PRYASSKLS  KQQVVGTLYTHHQKCVIVDTQ 
Sbjct  303   KTEGVMQTHDEETRKFFKRSSVTCVLSPRYASSKLSIFKQQVVGTLYTHHQKCVIVDTQG  362

Query  1618  QGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDL  1439
              GNNRKIT+FIGGLDLCDGRYDTP+HRLF D DTVF+ D++NPTFP G  KGPRQPWHDL
Sbjct  363   HGNNRKITSFIGGLDLCDGRYDTPEHRLFCDLDTVFKDDFHNPTFPPGK-KGPRQPWHDL  421

Query  1438  HCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSV  1259
             HCK+EGPAAYD+L NFEQRWRKA+KW+E G++FK+ISHWHDDALLKIERISWI SP+ +V
Sbjct  422   HCKLEGPAAYDVLKNFEQRWRKATKWSEFGQKFKRISHWHDDALLKIERISWIISPSTTV  481

Query  1258  PNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQM  1079
             P+D PSLWVS E DP+NWHVQVFRSIDSGSLKGFPK+VH A+ QNLV AK+LVIDRSIQM
Sbjct  482   PSDHPSLWVSQEDDPENWHVQVFRSIDSGSLKGFPKNVHAADAQNLVWAKNLVIDRSIQM  541

Query  1078  AYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVY  899
             AYI+AIR AQHFIYIENQYFLGSSYAWPSYK AGADNLIPMELALKI SKIR +ERF VY
Sbjct  542   AYIQAIRSAQHFIYIENQYFLGSSYAWPSYKNAGADNLIPMELALKIASKIRAKERFTVY  601

Query  898   IVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNR  719
             +VIPMWPEG P SA VQ+ILYWQGQT+QMMY+IIA+E+KS ++E+AHP DYLNFYCLGNR
Sbjct  602   VVIPMWPEGAPESASVQEILYWQGQTMQMMYDIIAREIKSSQLENAHPTDYLNFYCLGNR  661

Query  718   EEWH-EESASSPTPGCS-EFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAG  545
             EE H EES ++  P  +    T S+K GRFMIYVHAKGM+VDDEYVI+GSANINQRSMAG
Sbjct  662   EECHEEESKANGQPSSNGNTDTASKKFGRFMIYVHAKGMIVDDEYVILGSANINQRSMAG  721

Query  544   SRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVN  365
             SRDTEIAMGAYQPH+TW K + HP  Q+YGYRMSLWAEH+G +D    E E L+CV+ VN
Sbjct  722   SRDTEIAMGAYQPHYTWTKKKEHPRGQIYGYRMSLWAEHIGKIDRCFHEPEDLDCVRYVN  781

Query  364   EIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPD  185
              IAEENW RYTAE+F+PLQGH+LKYP++V + GKV+ L G E FPDVGG+VLG+ T+LPD
Sbjct  782   NIAEENWMRYTAEEFTPLQGHILKYPVEVSAEGKVNSLPGYENFPDVGGRVLGAPTSLPD  841

Query  184   ALTT  173
             ALTT
Sbjct  842   ALTT  845



>ref|XP_007017919.1| Phospholipase D isoform 1 [Theobroma cacao]
 gb|EOY15144.1| Phospholipase D isoform 1 [Theobroma cacao]
Length=845

 Score =  1321 bits (3418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 641/847 (76%), Positives = 737/847 (87%), Gaps = 8/847 (1%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQGNKVRRH  2519
             M+D +S+++V LHG+LDLKI+EAR LPNMD++SER+R+  TAFD CR P +R+  K   H
Sbjct  1     MADDISDSIVRLHGELDLKIIEARCLPNMDLLSERLRRCLTAFDTCRAPFSRR-KKNHHH  59

Query  2518  TRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGA  2339
              +IITSDPYV VCLAGATVARTRVISNSQ+P+W E FKIP+AHP S VEF VKDNDVFGA
Sbjct  60    RKIITSDPYVTVCLAGATVARTRVISNSQNPIWNERFKIPLAHPASHVEFHVKDNDVFGA  119

Query  2338  DFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTE  2159
             DFIGVA VSA K+++GET++ WFPII ++GKPPKPDCA+RL M+F  C E P YR G+  
Sbjct  120   DFIGVATVSAVKVLAGETVSGWFPIISSYGKPPKPDCAVRLEMRFIKCEEIPFYRYGMAA  179

Query  2158  ---DYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEA  1988
                ++G+   YFP+RHGG+VTLYQDAHV E  LP+I++++G  F HE CWEDICHAILEA
Sbjct  180   NPTEFGIGNCYFPVRHGGSVTLYQDAHVKESMLPDIELENGTVFKHEPCWEDICHAILEA  239

Query  1987  HHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSK  1808
             HH+VYIVGWSI+H+VKLVREPTRPLP+GGNL+LG+LLKYKSQEGVRVLLLVWDDKTSHSK
Sbjct  240   HHLVYIVGWSIFHEVKLVREPTRPLPSGGNLSLGDLLKYKSQEGVRVLLLVWDDKTSHSK  299

Query  1807  FFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVD  1628
             FFINTSGVM THDEETRKFFKHSSV+CVL+PRYASSKLS  KQQVVGTL+THHQKCVIVD
Sbjct  300   FFINTSGVMQTHDEETRKFFKHSSVSCVLSPRYASSKLSIFKQQVVGTLFTHHQKCVIVD  359

Query  1627  TQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPW  1448
             +QA GNNRKITAFIGGLDLCDGRYDTP+HRLF D +TVFR DY+NPTF   G KGPRQPW
Sbjct  360   SQASGNNRKITAFIGGLDLCDGRYDTPEHRLFQDLNTVFRDDYHNPTF-SAGTKGPRQPW  418

Query  1447  HDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPT  1268
             HDLHCK+EGPAAYDIL NFEQRWRKA KW+E G RF++++ WHDD+L+K+ERISWI SP+
Sbjct  419   HDLHCKVEGPAAYDILANFEQRWRKAIKWSEFGLRFQRVTRWHDDSLIKLERISWILSPS  478

Query  1267  PSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRS  1088
              SV NDDP+LWVS EGDP+NWHVQVFRSIDSGS+KGFPKDV+ AE+QNLVCAK+LVID+S
Sbjct  479   ASVSNDDPALWVSKEGDPENWHVQVFRSIDSGSVKGFPKDVYQAESQNLVCAKNLVIDKS  538

Query  1087  IQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERF  908
             +Q AYI+AIR AQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKI SKIR +ERF
Sbjct  539   LQTAYIQAIRCAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIASKIRAKERF  598

Query  907   AVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCL  728
             AVY+VIPMWPEGVPSSA VQ+IL+WQGQTIQMMY IIA+ELKS ++E++HP DYLNFYCL
Sbjct  599   AVYVVIPMWPEGVPSSASVQEILFWQGQTIQMMYGIIAQELKSMRMENSHPQDYLNFYCL  658

Query  727   GNREEWHEE--SASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRS  554
             GNREE  +E   +SS      + ++ SQK  RFMIYVHAKGM+VDDEYVI+GSANINQRS
Sbjct  659   GNREEIPKEFSGSSSSLSNNGDSVSASQKFQRFMIYVHAKGMIVDDEYVILGSANINQRS  718

Query  553   MAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVK  374
             +AGSRDTEIAMGAYQPH+TW + + HP  QVYGYRMSLWAEH+G +D    E E L CVK
Sbjct  719   LAGSRDTEIAMGAYQPHYTWGERKRHPRGQVYGYRMSLWAEHMGKVDYFFKEPESLGCVK  778

Query  373   MVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTT  194
              VN IAEENWKRY+AE F+ LQGHLLKYP++VDS+GKVSPL G E FPDVGGKVLGSRTT
Sbjct  779   SVNNIAEENWKRYSAESFTQLQGHLLKYPIEVDSSGKVSPLPGQETFPDVGGKVLGSRTT  838

Query  193   LPDALTT  173
             LPDALTT
Sbjct  839   LPDALTT  845



>ref|XP_008445312.1| PREDICTED: phospholipase D delta-like [Cucumis melo]
Length=848

 Score =  1320 bits (3417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 637/848 (75%), Positives = 731/848 (86%), Gaps = 8/848 (1%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQGNKV--R  2525
             M+   +E +VY+HGDLDLKI+EAR LPNMD+++ERIR+FFT F  CRKP +++ +K   +
Sbjct  2     MNGHDAEPLVYVHGDLDLKIIEARHLPNMDLLTERIRRFFTVFSSCRKPFSKKKDKEDHQ  61

Query  2524  RHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVF  2345
              H +IITSDPYV VCLAGATVARTRVISNSQ+P+W EHF IP+AHPVS+VEF VKDNDVF
Sbjct  62    HHRKIITSDPYVTVCLAGATVARTRVISNSQNPIWNEHFNIPLAHPVSQVEFHVKDNDVF  121

Query  2344  GADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGV  2165
             GAD IG+A V A++++SGETI+DWFPIIG  GKPPKPD A+RL MKFT C +NP YR G+
Sbjct  122   GADLIGIATVPARRVLSGETIDDWFPIIGTFGKPPKPDSAVRLEMKFTKCEDNPLYRYGI  181

Query  2164  TED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAIL  1994
               D   +G++  YFP+RHGG+VTLYQDAHVPE  L +I+++ G  + HENCWEDICHAIL
Sbjct  182   AADPEHFGVRNCYFPVRHGGSVTLYQDAHVPESMLEKIELEKGNLYQHENCWEDICHAIL  241

Query  1993  EAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSH  1814
             EAHH+VYI GWSIYHKVKLVREP++PLPNGG+LNLGELLKYKSQEGVRVLLLVWDDKTSH
Sbjct  242   EAHHLVYIAGWSIYHKVKLVREPSKPLPNGGDLNLGELLKYKSQEGVRVLLLVWDDKTSH  301

Query  1813  SKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVI  1634
             SKFFINT+GVM THDEETRKFFKHSSV+CVL+PRYASSKLS  KQQVVGTL+THHQKCVI
Sbjct  302   SKFFINTTGVMQTHDEETRKFFKHSSVSCVLSPRYASSKLSIFKQQVVGTLFTHHQKCVI  361

Query  1633  VDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQ  1454
             VDTQA GN RKIT+FIGGLDLCDGRYDTP+HRL  D DTVF  DY+NPTF  GG +GPRQ
Sbjct  362   VDTQASGNYRKITSFIGGLDLCDGRYDTPEHRLLKDLDTVFNEDYHNPTF-SGGTRGPRQ  420

Query  1453  PWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITS  1274
             PWHDLHCKIEGPAAYD+LTNFEQRWRKA+KW+ELG+RFK++SHWH+DAL+K+ERISWI S
Sbjct  421   PWHDLHCKIEGPAAYDVLTNFEQRWRKATKWSELGQRFKRVSHWHEDALIKLERISWILS  480

Query  1273  PTPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVID  1094
             P+ SVPNDDP LWVS E DP NWHVQVFRSIDSGSLKGFPKDV  AE QNLVCAK+LVID
Sbjct  481   PSQSVPNDDPLLWVSKENDPGNWHVQVFRSIDSGSLKGFPKDVFQAELQNLVCAKNLVID  540

Query  1093  RSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRE  914
             +SIQ AY++AIR AQHFIYIENQYFLGSS+AWPSYKEAGADNLIPMELALKI SKIR  E
Sbjct  541   KSIQTAYVQAIRSAQHFIYIENQYFLGSSFAWPSYKEAGADNLIPMELALKIASKIRANE  600

Query  913   RFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFY  734
             RFAVY+VIPMWPEG PSS  VQ+IL+WQGQTIQMMYE+I +ELK + +E+AHP DYLNFY
Sbjct  601   RFAVYVVIPMWPEGAPSSVSVQEILFWQGQTIQMMYEVIGRELKYKNLENAHPSDYLNFY  660

Query  733   CLGNREEWHEESASSPTPGCSE-FLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQR  557
             CLGNRE   + + SS     SE  ++ SQK  RFMIYVHAKGM+VDDEYVIVGSANINQR
Sbjct  661   CLGNRESHDDLTCSSGHSSKSEDLVSDSQKFRRFMIYVHAKGMIVDDEYVIVGSANINQR  720

Query  556   SMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECV  377
             SMAGSRDTEIAMGAYQP +TW K + HP  QVYGYRMSLWAEHLG +D+   E E L CV
Sbjct  721   SMAGSRDTEIAMGAYQPSYTWGKMKRHPRGQVYGYRMSLWAEHLGNIDDCFKEPESLPCV  780

Query  376   KMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRT  197
             K VN+IAE+NWK+YTA +++PLQGHLLKYP++V  +GK+ PL G E FPD GGKVLG+R+
Sbjct  781   KAVNKIAEDNWKKYTATEYAPLQGHLLKYPIEVSQSGKIGPLTGHETFPDFGGKVLGARS  840

Query  196   TLPDALTT  173
              LPDALTT
Sbjct  841   NLPDALTT  848



>ref|XP_008221197.1| PREDICTED: phospholipase D delta-like [Prunus mume]
Length=846

 Score =  1318 bits (3412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 645/840 (77%), Positives = 726/840 (86%), Gaps = 11/840 (1%)
 Frame = -2

Query  2671  VVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRRHTRIITSDPY  2492
             VVYLHGDLDLKILEAR LPNMD+VSER+R+FF+A  CRKP +  G     H  IITSDPY
Sbjct  11    VVYLHGDLDLKILEARCLPNMDMVSERLRRFFSA--CRKPFS-SGTPHHSHHNIITSDPY  67

Query  2491  VKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVAKVS  2312
             V VCLAGATVARTRVISNSQ+PVW EHF IP+AHPVS+V+F VKDND+FGAD IG+A VS
Sbjct  68    VTVCLAGATVARTRVISNSQNPVWKEHFTIPLAHPVSQVDFYVKDNDMFGADLIGIATVS  127

Query  2311  AQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED---YGLKE  2141
             AQ+I+SGETI+DWFPIIG  GKPPKPD A++L M+FT C +NP Y+ G++ D    G++ 
Sbjct  128   AQRILSGETISDWFPIIGPLGKPPKPDAAVKLEMRFTKCEDNPMYQQGISNDPDRIGIRN  187

Query  2140  SYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYIVGW  1961
              YFP+R GG VTLYQDAHVP+  L EI++DDG  F H  CWEDICHAILEAHH+VYIVGW
Sbjct  188   CYFPVRQGGHVTLYQDAHVPDSMLGEIELDDGVVFEHGKCWEDICHAILEAHHLVYIVGW  247

Query  1960  SIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTSGVM  1781
             SI+HKVKLVREPT+PLP+GGNLNLGELLKYKS+EG+RVLLLVWDDKTSHSKFFINT+GVM
Sbjct  248   SIFHKVKLVREPTKPLPSGGNLNLGELLKYKSEEGLRVLLLVWDDKTSHSKFFINTNGVM  307

Query  1780  GTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQGNNRK  1601
              THDEETRKFFKHSSV+CVL+PRYASSKLS  KQQVVGTL+THHQKCVIVDTQA GNNRK
Sbjct  308   QTHDEETRKFFKHSSVSCVLSPRYASSKLSIFKQQVVGTLFTHHQKCVIVDTQASGNNRK  367

Query  1600  ITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCKIEG  1421
             ITAFIGGLDLCDGRYDTP+HRLF D DTVF+ D++NPTF  GG +GPRQPWHDLHCKIEG
Sbjct  368   ITAFIGGLDLCDGRYDTPEHRLFRDLDTVFQDDFHNPTF-SGGTRGPRQPWHDLHCKIEG  426

Query  1420  PAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPNDDPS  1241
             PAAYD+LTNFEQRWR+A+KW+ELG+RFKK+S WHDDAL+K+ERISWI SP+ S  NDDP+
Sbjct  427   PAAYDVLTNFEQRWRRATKWSELGQRFKKVSRWHDDALIKLERISWILSPSSSTSNDDPA  486

Query  1240  LWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAI  1061
             L VS+E DPQNWHVQVFRSIDSGSLKGFPKDV+ AE QNLVCAK+LVID+SIQ AYIEAI
Sbjct  487   LRVSHEDDPQNWHVQVFRSIDSGSLKGFPKDVYEAEAQNLVCAKNLVIDKSIQTAYIEAI  546

Query  1060  RRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPMW  881
             R AQHFIYIENQYFLGSSY WP+YKEAGADNLIPMELALKI SKI+  ERFAVYIVIPMW
Sbjct  547   RSAQHFIYIENQYFLGSSYGWPTYKEAGADNLIPMELALKIASKIKANERFAVYIVIPMW  606

Query  880   PEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREEWHE-  704
             PEGVPSSA VQ+IL+WQGQT+QMMYEIIAKELKS  +E+ HP DYLNFYCLGNRE+  + 
Sbjct  607   PEGVPSSASVQEILFWQGQTMQMMYEIIAKELKSMNLENVHPHDYLNFYCLGNREKIPDT  666

Query  703   -ESASSPTPGCSE--FLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDT  533
                A + T G  E   ++ SQK  RFMIYVHAKGMVVDDEYVI+GSANINQRSMAGSRDT
Sbjct  667   VSCAVNKTSGNGECHTVSASQKFQRFMIYVHAKGMVVDDEYVIIGSANINQRSMAGSRDT  726

Query  532   EIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAE  353
             EIAMGAYQPHHTW K + HP  QVYGYRMSLWAEHLGM+D    EA  LECVK VN IAE
Sbjct  727   EIAMGAYQPHHTWGKKKRHPRGQVYGYRMSLWAEHLGMVDSCFKEAGSLECVKRVNSIAE  786

Query  352   ENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALTT  173
             ENW ++  ++F+ LQGHL+KYP++VD NGKV  L G E FPDVGGK+LG+RTTLPDALTT
Sbjct  787   ENWTKFVGDEFAALQGHLIKYPVEVDVNGKVGALPGRESFPDVGGKILGTRTTLPDALTT  846



>ref|XP_002284764.2| PREDICTED: phospholipase D delta-like [Vitis vinifera]
Length=873

 Score =  1316 bits (3406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 641/846 (76%), Positives = 734/846 (87%), Gaps = 7/846 (1%)
 Frame = -2

Query  2701  VKMSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQGNKVR  2525
             + M+D  SE +VYLHGDLDL I+EAR LPNMD++SERIR+ FTAFD CR P +  G K  
Sbjct  32    LTMADD-SETIVYLHGDLDLNIIEARYLPNMDLMSERIRRCFTAFDSCRAPFS-GGRKKG  89

Query  2524  RHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVF  2345
             RH +IITSDPYV VCLAGATVARTRVISNSQ PVW EH KIP+AHPVS VEFQVKDNDVF
Sbjct  90    RHHKIITSDPYVTVCLAGATVARTRVISNSQHPVWNEHLKIPLAHPVSCVEFQVKDNDVF  149

Query  2344  GADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGV  2165
             GAD IG A VSA++I +G++I+DWFPI+G +GKPPKPD AI L M+F     NP Y  G+
Sbjct  150   GADMIGTATVSAERIRTGDSISDWFPILGFNGKPPKPDSAIYLKMRFISSEINPLYTRGI  209

Query  2164  TE--DYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILE  1991
             T+   +G+K+SYFP+R GG+VTLYQDAHVP G LPE+++DDG  + H  CWEDICH+ILE
Sbjct  210   TDPDHFGVKQSYFPVRLGGSVTLYQDAHVPNGMLPELELDDGVVYQHGKCWEDICHSILE  269

Query  1990  AHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHS  1811
             AHH+VYIVGWS+YHKVKLVREPTRPLP+GGNLNLGELLKYKSQEGVRVLLLVWDDKTSHS
Sbjct  270   AHHLVYIVGWSVYHKVKLVREPTRPLPSGGNLNLGELLKYKSQEGVRVLLLVWDDKTSHS  329

Query  1810  KFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIV  1631
             +F +NT GVM THDEETRKFFKHSSV CVL+PRYASSKLS  KQQVVGTL+THHQKCVIV
Sbjct  330   RFLVNTVGVMQTHDEETRKFFKHSSVLCVLSPRYASSKLSIFKQQVVGTLFTHHQKCVIV  389

Query  1630  DTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQP  1451
             DTQA GNNRKITAF+GGLDLCDGRYDTP+HRL  D DTVF+ DY+NPTF     KGPRQP
Sbjct  390   DTQASGNNRKITAFLGGLDLCDGRYDTPEHRLCHDLDTVFQNDYHNPTFSAVS-KGPRQP  448

Query  1450  WHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSP  1271
             WHDLHCKIEGPAAYD+LTNFEQRWRKA+KW+E GRRFK+I+HWH+DAL+K+ERISWI SP
Sbjct  449   WHDLHCKIEGPAAYDVLTNFEQRWRKATKWSEFGRRFKRITHWHEDALIKLERISWILSP  508

Query  1270  TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDR  1091
             +PSVP DDPSLWVS E DP+NWHVQVFRSIDSGSL+GFPKDV +AE QNLVCAK+LVID+
Sbjct  509   SPSVPYDDPSLWVSEENDPENWHVQVFRSIDSGSLRGFPKDVPSAEAQNLVCAKNLVIDK  568

Query  1090  SIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRER  911
             SIQ AYI+AIR AQHFIYIENQYF+GSSYAWPSYK AGADNLIPMELALKI SKIR +ER
Sbjct  569   SIQTAYIQAIRSAQHFIYIENQYFIGSSYAWPSYKNAGADNLIPMELALKIASKIRAKER  628

Query  910   FAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYC  731
             F+VY+VIPMWPEG PS A VQ+IL+WQGQT+QMMY+IIA+EL+S ++EDAHP DYLNFYC
Sbjct  629   FSVYVVIPMWPEGNPSCASVQEILFWQGQTMQMMYDIIAQELQSMQLEDAHPQDYLNFYC  688

Query  730   LGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSM  551
             LGNREE  +E +SS T   S+ ++ S+K  RFMIYVHAKGM+VDDEYVI+GSANINQRSM
Sbjct  689   LGNREEPPKEVSSSNTQA-SDGVSTSKKFHRFMIYVHAKGMIVDDEYVILGSANINQRSM  747

Query  550   AGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKM  371
             AGSRDTEIAMGAYQP HTWAK + HPH Q+YGYRMSLWAEHLGM++    E + L+CVK 
Sbjct  748   AGSRDTEIAMGAYQPRHTWAKKKKHPHGQIYGYRMSLWAEHLGMINNSFKEPQTLDCVKN  807

Query  370   VNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTL  191
             VN++AEENWKR+T++ ++PLQGHLLKYP+QVD +GKV PL G E FPD GGKVLG+R  L
Sbjct  808   VNKMAEENWKRFTSDAYTPLQGHLLKYPIQVDVDGKVRPLPGHETFPDFGGKVLGTRCNL  867

Query  190   PDALTT  173
             PDALTT
Sbjct  868   PDALTT  873



>ref|XP_002510602.1| phospholipase d delta, putative [Ricinus communis]
 gb|EEF52789.1| phospholipase d delta, putative [Ricinus communis]
Length=847

 Score =  1315 bits (3404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 636/843 (75%), Positives = 726/843 (86%), Gaps = 12/843 (1%)
 Frame = -2

Query  2677  ENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQGNKVRRHTRIITS  2501
             +  +YL+GDLDLKI+EAR+LPNMDIV+ER+R+   AFD CRKP  ++ +K  R  RIITS
Sbjct  9     DTAMYLYGDLDLKIIEARQLPNMDIVTERVRRCLLAFDGCRKPCIKE-HKSERQRRIITS  67

Query  2500  DPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVA  2321
             DPYV VCL+GATVARTRVISNSQ P W EHFKIPVAHP + VEF VKDNDVFGAD IGVA
Sbjct  68    DPYVTVCLSGATVARTRVISNSQHPYWNEHFKIPVAHPATHVEFHVKDNDVFGADLIGVA  127

Query  2320  KVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT---EDYG  2150
              V  ++IISGET++DW PI   +GKPPKPDCAIR+ MKF  C ENP Y+ G+     ++G
Sbjct  128   TVPVKRIISGETVSDWLPITDPYGKPPKPDCAIRVEMKFMQCEENPLYQYGIAASPNEFG  187

Query  2149  LKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYI  1970
             ++  YFP+RHG +VTLYQDAHVP+  LPEIK+++   + HE CWEDICHAILEAHH+VY+
Sbjct  188   IQNCYFPVRHGSSVTLYQDAHVPDSFLPEIKLENDIVYRHEKCWEDICHAILEAHHLVYV  247

Query  1969  VGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTS  1790
             VGWSIYHKVKLVREPT+PLP+GGNLNLG+LLKYKSQEGVRVLLLVWDDKTSHSKFFINT+
Sbjct  248   VGWSIYHKVKLVREPTKPLPSGGNLNLGDLLKYKSQEGVRVLLLVWDDKTSHSKFFINTT  307

Query  1789  GVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQGN  1610
             GVM THDEETRKFFKHSSV CVL+PRYASSKLS  KQQVVGTL+THHQKCVIVD+QA GN
Sbjct  308   GVMQTHDEETRKFFKHSSVNCVLSPRYASSKLSIFKQQVVGTLFTHHQKCVIVDSQASGN  367

Query  1609  NRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCK  1430
             NRKITAFIGGLDLCDGRYDTP+HRLF D DTVF+ DY+NPTFP  G KGPRQPWHD HCK
Sbjct  368   NRKITAFIGGLDLCDGRYDTPEHRLFRDLDTVFQDDYHNPTFP-AGTKGPRQPWHDWHCK  426

Query  1429  IEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPND  1250
             IEGPAAYDIL NFEQRW+KASKW+E GRR K+++HWHDD+L+K+ERISWI SP PSVPND
Sbjct  427   IEGPAAYDILKNFEQRWKKASKWSEFGRRVKRVTHWHDDSLIKLERISWILSPGPSVPND  486

Query  1249  DPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYI  1070
             DP LWVS+E  P+NWHVQVFRSIDSGSLKGFPK VH AE QNLVCAK+LVID+SIQ AYI
Sbjct  487   DPKLWVSSEDSPENWHVQVFRSIDSGSLKGFPKYVHQAEAQNLVCAKNLVIDKSIQTAYI  546

Query  1069  EAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVI  890
             +AIR AQHFIYIENQYF+GSSYAWPSYKEAGADNLIPMELALKI SKIR +ERFAVY+VI
Sbjct  547   QAIRSAQHFIYIENQYFIGSSYAWPSYKEAGADNLIPMELALKINSKIRAKERFAVYVVI  606

Query  889   PMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREEW  710
             PMWPEG PSSA VQ+IL+WQGQT+QMMY++IAKEL+S  +E +HP DYLNFYCLGNREE 
Sbjct  607   PMWPEGAPSSASVQEILFWQGQTMQMMYDVIAKELESMNLEHSHPQDYLNFYCLGNREEL  666

Query  709   HEESASS----PTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGS  542
              +E ++S      PG  + ++ SQK  RFMIYVHAKGM+VDDEYVI+GSANINQRSMAGS
Sbjct  667   PKEMSASSDKLSQPG--DVVSTSQKHQRFMIYVHAKGMIVDDEYVIMGSANINQRSMAGS  724

Query  541   RDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNE  362
             RDTEIAMGAYQP+HTW   + HP  QVYGYRMSLWAEHLG++D   DE E L+CVK VN+
Sbjct  725   RDTEIAMGAYQPNHTWGNKKRHPRGQVYGYRMSLWAEHLGLVDSLFDEPETLDCVKTVNK  784

Query  361   IAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDA  182
             IAE+NW+R+T E F+PLQG LLKYPL+VD NGKVSPL G E FPDVGGKVLG+R+T PD+
Sbjct  785   IAEDNWRRFTEEDFTPLQGFLLKYPLEVDRNGKVSPLTGQENFPDVGGKVLGARSTFPDS  844

Query  181   LTT  173
             LTT
Sbjct  845   LTT  847



>ref|XP_011083417.1| PREDICTED: phospholipase D delta-like isoform X1 [Sesamum indicum]
Length=844

 Score =  1315 bits (3403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 636/842 (76%), Positives = 726/842 (86%), Gaps = 6/842 (1%)
 Frame = -2

Query  2686  GMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKP--ETRQGNKVRRHT  2516
              ++ N+VYLHGDLDLKI+EAR LPNMD+VSER R+  T FD CRKP    R GN  + H 
Sbjct  5     ALNNNIVYLHGDLDLKIIEARSLPNMDLVSERFRRLCTVFDVCRKPFAPPRNGNH-KHHH  63

Query  2515  RIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGAD  2336
             +IITSDPYV VCLAGA VARTR+I+NSQ+PVW E+FKIP+AHPVS+VEF+VKDND+FGAD
Sbjct  64    KIITSDPYVIVCLAGARVARTRIINNSQNPVWNENFKIPLAHPVSQVEFEVKDNDMFGAD  123

Query  2335  FIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED  2156
              IGVA V A++I +GE I++W P+IG +GKP KPD A+RL + FTPC  NP Y+ G++E+
Sbjct  124   LIGVASVHAKRIAAGELIDEWIPVIGPNGKPHKPDSALRLRISFTPCYANPLYQKGISEN  183

Query  2155  YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMV  1976
             Y LKESYFP+RHG  VTLYQDAH+ +  +PEI +D+ + + HE CWEDICHAILEAHHMV
Sbjct  184   YALKESYFPLRHGSKVTLYQDAHLDDEMMPEIGLDEKRHYEHEKCWEDICHAILEAHHMV  243

Query  1975  YIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFIN  1796
             YIVGWSIYHKVKLVREPT+PLP GG+L LGELLKYKSQEGVRVLLLVWDDKTSHSKFFIN
Sbjct  244   YIVGWSIYHKVKLVREPTKPLPIGGDLTLGELLKYKSQEGVRVLLLVWDDKTSHSKFFIN  303

Query  1795  TSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQ  1616
             T+GVM THDEETR++FKHSSVTCVLAPRYASSKLS  KQQVVGT+YTHHQKCVIVDTQ  
Sbjct  304   TTGVMDTHDEETRRYFKHSSVTCVLAPRYASSKLSIFKQQVVGTIYTHHQKCVIVDTQGP  363

Query  1615  GNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLH  1436
             GNNRKITAFIGGLDLCDGRYDTP+HRLF D +TVF+ DY+NPTF   G K PRQPWHDLH
Sbjct  364   GNNRKITAFIGGLDLCDGRYDTPEHRLFRDLNTVFKDDYHNPTFAP-GTKAPRQPWHDLH  422

Query  1435  CKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVP  1256
             CKIEGPAAYD+LTNFEQRWRKA+KW+ELG+RFK+ISHWHDDALLKIERISWI SP+ ++P
Sbjct  423   CKIEGPAAYDVLTNFEQRWRKATKWSELGQRFKRISHWHDDALLKIERISWIISPSDTIP  482

Query  1255  NDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMA  1076
              D PSLWVS E DP+NWHVQVFRSIDSGSLKGFPK  H AE QNLVCAK+LVIDRSIQMA
Sbjct  483   GDHPSLWVSEEDDPENWHVQVFRSIDSGSLKGFPKTAHEAEQQNLVCAKNLVIDRSIQMA  542

Query  1075  YIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYI  896
             YI+AIR AQ+FIYIENQYFLGSSYAWPSYK AGADNLIPMELALKI SKIR +ERF VY+
Sbjct  543   YIQAIRSAQNFIYIENQYFLGSSYAWPSYKNAGADNLIPMELALKIASKIRAKERFTVYV  602

Query  895   VIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNRE  716
             VIPMWPEG P+SA VQ+ILYWQGQT+Q MYEIIA+E+K+ ++E+AHP DYLNFYCLGNRE
Sbjct  603   VIPMWPEGAPNSASVQEILYWQGQTMQTMYEIIAREIKAAQLENAHPTDYLNFYCLGNRE  662

Query  715   EWHEE-SASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSR  539
                EE + S  +     +++ SQK+GRFMIYVHAKGMVVDDEYVI+GSANINQRSMAGSR
Sbjct  663   PHAEESNGSGQSSSSGSYVSASQKAGRFMIYVHAKGMVVDDEYVILGSANINQRSMAGSR  722

Query  538   DTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEI  359
             DTEIAMGAYQPHHTWA+ +  PH QVYGYRMSLWAEH G +D++    EGL+CVK VN +
Sbjct  723   DTEIAMGAYQPHHTWARKKGRPHGQVYGYRMSLWAEHWGRIDQRFKAPEGLDCVKYVNRV  782

Query  358   AEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDAL  179
             A +NW RY A+ F+PLQGH+LKYPLQVD+NGKV PL G E FPDVGGKVLG+ T LPDAL
Sbjct  783   AADNWMRYIADHFTPLQGHILKYPLQVDANGKVKPLAGYETFPDVGGKVLGAPTNLPDAL  842

Query  178   TT  173
             TT
Sbjct  843   TT  844



>ref|XP_006435265.1| hypothetical protein CICLE_v10000269mg [Citrus clementina]
 ref|XP_006473725.1| PREDICTED: phospholipase D delta-like [Citrus sinensis]
 gb|ESR48505.1| hypothetical protein CICLE_v10000269mg [Citrus clementina]
 gb|KDO84975.1| hypothetical protein CISIN_1g003153mg [Citrus sinensis]
Length=843

 Score =  1315 bits (3403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 632/841 (75%), Positives = 723/841 (86%), Gaps = 7/841 (1%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQGNKVRRHTRIIT  2504
             SE +VYLHGDLDLKI+EARRLPNMD+V+ RIR+ F AFD CR P T    +V  H ++IT
Sbjct  5     SETIVYLHGDLDLKIVEARRLPNMDLVTARIRRCFAAFDTCRIPFTNSKKRVS-HRKMIT  63

Query  2503  SDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGV  2324
             SDPYV VCL GATVARTRVISN Q+P+W EHFKIP+AHPVS++EF VKDNDVFGAD IGV
Sbjct  64    SDPYVTVCLGGATVARTRVISNCQNPIWNEHFKIPLAHPVSQIEFYVKDNDVFGADLIGV  123

Query  2323  AKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT---EDY  2153
             A + A +I SGE+I+DWFPI+G +GKPPK + A+ + M+F PC ENP YR G+    + +
Sbjct  124   ATIPAARIKSGESISDWFPILGLYGKPPKSETAVFMEMRFLPCEENPLYRYGIAANPDSF  183

Query  2152  GLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVY  1973
             G+  SYFP+R+GG VTLYQDAHVPE  LPEI+++ G  + HE CWEDICHAILEAHH+VY
Sbjct  184   GVNNSYFPVRNGGHVTLYQDAHVPESMLPEIELEKGIQYKHERCWEDICHAILEAHHLVY  243

Query  1972  IVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINT  1793
             IVGWS++HKVKLVREPT+PLP+GGNL+LG+LLKYKSQEGVRVLLLVWDDKTSHSKFFINT
Sbjct  244   IVGWSVFHKVKLVREPTKPLPSGGNLSLGDLLKYKSQEGVRVLLLVWDDKTSHSKFFINT  303

Query  1792  SGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQG  1613
             +GVM THDEETRKFFKHSSV CVL+PRYASSKLS  KQQVVGTL+THHQKCVIVDTQA G
Sbjct  304   AGVMQTHDEETRKFFKHSSVHCVLSPRYASSKLSIFKQQVVGTLFTHHQKCVIVDTQASG  363

Query  1612  NNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHC  1433
             NNRKITAFIGGLDLCDGRYDTP+HRLF D DTVF+ DY+NPTF   G KGPRQPWHDLHC
Sbjct  364   NNRKITAFIGGLDLCDGRYDTPEHRLFRDLDTVFQDDYHNPTF-SAGTKGPRQPWHDLHC  422

Query  1432  KIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPN  1253
             KIEGPAAYD+LTNFEQRWRKA+KW+E G+RFK+++ WHDDAL+K+ERISWI SP+ SVPN
Sbjct  423   KIEGPAAYDVLTNFEQRWRKATKWSEFGQRFKRVTRWHDDALIKLERISWILSPSSSVPN  482

Query  1252  DDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAY  1073
             D P LWVS E DPQNWHVQVFRSIDSGS+KGFPKDV+ AE QNLVCAK+LVID+SIQ AY
Sbjct  483   DHPKLWVSEEDDPQNWHVQVFRSIDSGSVKGFPKDVYQAELQNLVCAKNLVIDKSIQTAY  542

Query  1072  IEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIV  893
             I+AIR AQHFIYIENQYFLGSSYAWP YK+AGADN IPMELALKI SKIR +ERFAVY+V
Sbjct  543   IQAIRSAQHFIYIENQYFLGSSYAWPDYKDAGADNTIPMELALKIASKIRAKERFAVYVV  602

Query  892   IPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREE  713
             +PMWPEG PSSA VQ+ILYWQGQT QMMYEIIA+EL S ++E++HP DYLNFYCLGNREE
Sbjct  603   MPMWPEGAPSSASVQEILYWQGQTRQMMYEIIAQELNSMQMENSHPQDYLNFYCLGNREE  662

Query  712   WHE-ESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRD  536
               + E   +      E ++ SQK  RFMIYVHAKGMVVDDEYVI+GSANINQRS+AG RD
Sbjct  663   VPQGEPGLNNQTSNGELISASQKFQRFMIYVHAKGMVVDDEYVILGSANINQRSLAGGRD  722

Query  535   TEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIA  356
             TEIAMGAYQPHHTW K + HPH QVYGYRMSLWAEH+GM+D+   E E LECVK VN IA
Sbjct  723   TEIAMGAYQPHHTWGKKKEHPHGQVYGYRMSLWAEHMGMLDDCFREPESLECVKFVNTIA  782

Query  355   EENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALT  176
             E+NWK++TA+ F+PLQGH+LKYP++V SNGK SPL G E FPDVGGKV G+R+ LPDALT
Sbjct  783   EDNWKKFTADAFTPLQGHILKYPVEVKSNGKESPLPGHETFPDVGGKVQGARSNLPDALT  842

Query  175   T  173
             T
Sbjct  843   T  843



>ref|XP_009334534.1| PREDICTED: phospholipase D delta-like [Pyrus x bretschneideri]
Length=854

 Score =  1315 bits (3402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 645/853 (76%), Positives = 728/853 (85%), Gaps = 18/853 (2%)
 Frame = -2

Query  2689  DGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRRHTRI  2510
             D     VVYLHGDLDLKILEAR LPNMD+VSER+R+FF+A  C KP TR       H +I
Sbjct  6     DKSQTKVVYLHGDLDLKILEARCLPNMDMVSERLRRFFSA--CSKPFTRPAAH-HSHGKI  62

Query  2509  ITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFI  2330
             ITSDPYV VCLAGATVARTRVISNSQ+PVW EHFKIP+AHPVS+VEF +KDND+FGAD I
Sbjct  63    ITSDPYVTVCLAGATVARTRVISNSQNPVWKEHFKIPLAHPVSQVEFYIKDNDMFGADLI  122

Query  2329  GVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED--  2156
             GVA VSA +I SGETI+DWFPIIG  GKPPKPD A++L M+FT C +NP YR G++ D  
Sbjct  123   GVASVSAIRIHSGETISDWFPIIGPLGKPPKPDAAVKLEMRFTKCEDNPMYRHGISNDPD  182

Query  2155  -YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHM  1979
              +G++  YFP+R GG VTLYQDAH PE  L EI++DDG  F H  CWEDICHAILEAHH+
Sbjct  183   HFGIRNCYFPVRQGGHVTLYQDAHGPEAMLEEIELDDGVTFQHGRCWEDICHAILEAHHL  242

Query  1978  VYIVGWSIYHKVKLVREPTRplp-------nggnlnlgelLKYKSQEGVRVLLLVWDDKT  1820
             VYIVGWSIYH+VKLVREPT+PLP       +GGNLNLGELLKYKS+EG+RVLLLVWDDKT
Sbjct  243   VYIVGWSIYHQVKLVREPTKPLPRGGGPLPSGGNLNLGELLKYKSEEGLRVLLLVWDDKT  302

Query  1819  SHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKC  1640
             SHSKFFINT+GVM THDEETRKFFKHSSV+CVLAPRYASSKLS  KQQVVGTL+THHQKC
Sbjct  303   SHSKFFINTNGVMQTHDEETRKFFKHSSVSCVLAPRYASSKLSIFKQQVVGTLFTHHQKC  362

Query  1639  VIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGP  1460
             VIVDTQA GNNRKITAFIGGLDLCDGRYDTP+HRLF D D+VF+ DY+NPTF  GG KGP
Sbjct  363   VIVDTQASGNNRKITAFIGGLDLCDGRYDTPEHRLFRDLDSVFQDDYHNPTF-SGGTKGP  421

Query  1459  RQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWI  1280
             RQPWHDLHCKIEGPAAYD+LTNFEQRWRK++KW+ELG+RFK++S WHDDAL+K+ERISWI
Sbjct  422   RQPWHDLHCKIEGPAAYDVLTNFEQRWRKSTKWSELGQRFKRVSRWHDDALIKLERISWI  481

Query  1279  TSPTPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLV  1100
              SP+PS   DDP+L VS+E DPQNWHVQVFRSIDSGSLKGFPKDV+ AE QNLVCAK+LV
Sbjct  482   LSPSPSTAKDDPALRVSDENDPQNWHVQVFRSIDSGSLKGFPKDVYKAEAQNLVCAKNLV  541

Query  1099  IDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRN  920
             +D+SIQ AYI+AIR AQHFIYIENQYF+GSSY WP+YKEAGADNLIPMELALKI SKIR 
Sbjct  542   VDKSIQTAYIDAIRSAQHFIYIENQYFVGSSYGWPAYKEAGADNLIPMELALKIASKIRA  601

Query  919   RERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLN  740
              ERFAVYIVIPMWPEGVPSSA VQ+ILYWQGQT+QMMYE++AKELK+ K+E+AHP DYLN
Sbjct  602   DERFAVYIVIPMWPEGVPSSASVQEILYWQGQTMQMMYEVVAKELKAMKVENAHPQDYLN  661

Query  739   FYCLGNREEWHEESA----SSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSA  572
             FYCLGNRE+  +  +     +   G S  ++ SQK  RFMIYVHAKGMVVDDEYVI+GSA
Sbjct  662   FYCLGNREKVPDTLSCHVNQANRNGESHTVSASQKFQRFMIYVHAKGMVVDDEYVIIGSA  721

Query  571   NINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAE  392
             NINQRSMAGSRDTEIAMGAYQPHHTW K + HP  QVYGYR+SLWAEHLGM+D+   EAE
Sbjct  722   NINQRSMAGSRDTEIAMGAYQPHHTWGKKKRHPRGQVYGYRISLWAEHLGMVDKCFKEAE  781

Query  391   GLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKV  212
              L+CVK VN IA +NW R+ A+ F+PLQGHL+KYP+ VD NGKVS + G E FPDVGGK+
Sbjct  782   TLDCVKRVNAIAGDNWTRFVADDFAPLQGHLMKYPVAVDVNGKVSAIPGRESFPDVGGKI  841

Query  211   LGSRTTLPDALTT  173
             LG RTTLPDALTT
Sbjct  842   LGGRTTLPDALTT  854



>gb|KGN62275.1| hypothetical protein Csa_2G347140 [Cucumis sativus]
Length=848

 Score =  1313 bits (3398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 636/843 (75%), Positives = 726/843 (86%), Gaps = 8/843 (1%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAF-DCRKPETRQGNKVRRHTR--I  2510
             +E +VY+HGDLDLKI+EARRLPNMD++SERIR+FFT F  C+ P +++ +K     R  I
Sbjct  7     TEPLVYVHGDLDLKIIEARRLPNMDMLSERIRRFFTVFTSCQTPFSKKKDKEDHQHRRKI  66

Query  2509  ITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFI  2330
             ITSDPYV VCLAG+TVARTRVISNSQ+PVW EHF IP+AHPVS+VEF VKDNDVFGAD I
Sbjct  67    ITSDPYVTVCLAGSTVARTRVISNSQNPVWNEHFNIPLAHPVSQVEFHVKDNDVFGADLI  126

Query  2329  GVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED--  2156
             G+A V A++++SGE I+DWFP+IG+ GKPPKPD A+RL MKFT C +NP YR G+  D  
Sbjct  127   GIATVPARRVLSGEIIDDWFPLIGSFGKPPKPDSAVRLEMKFTKCEDNPLYRYGIAADPE  186

Query  2155  -YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHM  1979
              +G++  YFP+RHGG+VTLYQDAHVPE  L +I+++ G  + HENCWEDICHAILEAHH+
Sbjct  187   HFGVRNCYFPVRHGGSVTLYQDAHVPESMLEKIELEKGNLYQHENCWEDICHAILEAHHL  246

Query  1978  VYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFI  1799
             VYI GWSIYHKVKLVREP++PLPNGGNLNLGELLKYKSQEGVRVLLLVWDDKTSHSKFFI
Sbjct  247   VYIAGWSIYHKVKLVREPSKPLPNGGNLNLGELLKYKSQEGVRVLLLVWDDKTSHSKFFI  306

Query  1798  NTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQA  1619
             NT+GVM THDEETRKFFKHSSV+CVL+PRYASSKLS  KQQVVGTL+THHQKCVIVDTQA
Sbjct  307   NTTGVMQTHDEETRKFFKHSSVSCVLSPRYASSKLSIFKQQVVGTLFTHHQKCVIVDTQA  366

Query  1618  QGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDL  1439
              GN RKIT+FIGGLDLCDGRYDTP+HRL  D DTVF  DY+NPTF  GG KGPRQPWHDL
Sbjct  367   SGNYRKITSFIGGLDLCDGRYDTPEHRLLKDLDTVFNEDYHNPTF-SGGTKGPRQPWHDL  425

Query  1438  HCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSV  1259
             HCKIEGPAAYD+LTNFEQRWRKA+KW+ELG+RFK++SHWH+DAL+K+ERISWI SP+ SV
Sbjct  426   HCKIEGPAAYDVLTNFEQRWRKATKWSELGQRFKRVSHWHEDALIKLERISWILSPSQSV  485

Query  1258  PNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQM  1079
             PNDDP LWVS E DP NWHVQVFRSIDSGSLKGFPKDV  AE QNLVCAK+LVID+SIQ 
Sbjct  486   PNDDPLLWVSKENDPGNWHVQVFRSIDSGSLKGFPKDVFQAELQNLVCAKNLVIDKSIQT  545

Query  1078  AYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVY  899
             AYI+AIR AQHFIYIENQYFLGSS+AWPSYKEAGADNLIPMELALKI SKIR  ERFAVY
Sbjct  546   AYIQAIRSAQHFIYIENQYFLGSSFAWPSYKEAGADNLIPMELALKIASKIRANERFAVY  605

Query  898   IVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNR  719
             +VIPMWPEG PSS  VQ+IL+WQGQTIQMMYEII +ELK +  E+AHP DYLNFYCLGNR
Sbjct  606   VVIPMWPEGAPSSVSVQEILFWQGQTIQMMYEIIGRELKYKNFENAHPSDYLNFYCLGNR  665

Query  718   EEWHEESASSPTPGCSE-FLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGS  542
             E   + + SS     SE  ++ SQK  RFMIYVHAKGM+VDDEYV+VGSANINQRSMAGS
Sbjct  666   EPHDDLACSSGHSSKSEDLVSDSQKFRRFMIYVHAKGMIVDDEYVVVGSANINQRSMAGS  725

Query  541   RDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNE  362
             RDTEIAMGAYQP +TW K + HP  QVYGYRMSLWAEHLG +D+   E E L CVK VN+
Sbjct  726   RDTEIAMGAYQPSYTWGKMKRHPRGQVYGYRMSLWAEHLGNIDDCFKEPESLTCVKTVNK  785

Query  361   IAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDA  182
             +AE+NWK+YTA +++PLQGHLLKYP++V  +GK+ PL G E FPD GGKVLG+R+ LPDA
Sbjct  786   MAEDNWKKYTAMEYAPLQGHLLKYPIEVSQSGKIGPLRGHETFPDFGGKVLGARSNLPDA  845

Query  181   LTT  173
             LTT
Sbjct  846   LTT  848



>ref|XP_004143075.1| PREDICTED: phospholipase D delta-like [Cucumis sativus]
 ref|XP_004161093.1| PREDICTED: phospholipase D delta-like [Cucumis sativus]
Length=847

 Score =  1313 bits (3398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 637/848 (75%), Positives = 728/848 (86%), Gaps = 8/848 (1%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAF-DCRKPETRQGNKVRRH  2519
             M+   +E +VY+HGDLDLKI+EARRLPNMD++SERIR+FFT F  C+ P +++ +K    
Sbjct  1     MNGHDTEPLVYVHGDLDLKIIEARRLPNMDMLSERIRRFFTVFTSCQTPFSKKKDKEDHQ  60

Query  2518  TR--IITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVF  2345
              R  IITSDPYV VCLAG+TVARTRVISNSQ+PVW EHF IP+AHPVS+VEF VKDNDVF
Sbjct  61    HRRKIITSDPYVTVCLAGSTVARTRVISNSQNPVWNEHFNIPLAHPVSQVEFHVKDNDVF  120

Query  2344  GADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGV  2165
             GAD IG+A V A++++SGE I+DWFP+IG+ GKPPKPD A+RL MKFT C +NP YR G+
Sbjct  121   GADLIGIATVPARRVLSGEIIDDWFPLIGSFGKPPKPDSAVRLEMKFTKCEDNPLYRYGI  180

Query  2164  TED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAIL  1994
               D   +G++  YFP+RHGG+VTLYQDAHVPE  L +I+++ G  + HENCWEDICHAIL
Sbjct  181   AADPEHFGVRNCYFPVRHGGSVTLYQDAHVPESMLEKIELEKGNLYQHENCWEDICHAIL  240

Query  1993  EAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSH  1814
             EAHH+VYI GWSIYHKVKLVREP++PLPNGGNLNLGELLKYKSQEGVRVLLLVWDDKTSH
Sbjct  241   EAHHLVYIAGWSIYHKVKLVREPSKPLPNGGNLNLGELLKYKSQEGVRVLLLVWDDKTSH  300

Query  1813  SKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVI  1634
             SKFFINT+GVM THDEETRKFFKHSSV+CVL+PRYASSKLS  KQQVVGTL+THHQKCVI
Sbjct  301   SKFFINTTGVMQTHDEETRKFFKHSSVSCVLSPRYASSKLSIFKQQVVGTLFTHHQKCVI  360

Query  1633  VDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQ  1454
             VDTQA GN RKIT+FIGGLDLCDGRYDTP+HRL  D DTVF  DY+NPTF  GG KGPRQ
Sbjct  361   VDTQASGNYRKITSFIGGLDLCDGRYDTPEHRLLKDLDTVFNEDYHNPTF-SGGTKGPRQ  419

Query  1453  PWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITS  1274
             PWHDLHCKIEGPAAYD+LTNFEQRWRKA+KW+ELG+RFK++SHWH+DAL+K+ERISWI S
Sbjct  420   PWHDLHCKIEGPAAYDVLTNFEQRWRKATKWSELGQRFKRVSHWHEDALIKLERISWILS  479

Query  1273  PTPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVID  1094
             P+ SVPNDDP LWVS E DP NWHVQVFRSIDSGSLKGFPKDV  AE QNLVCAK+LVID
Sbjct  480   PSQSVPNDDPLLWVSKENDPGNWHVQVFRSIDSGSLKGFPKDVFQAELQNLVCAKNLVID  539

Query  1093  RSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRE  914
             +SIQ AYI+AIR AQHFIYIENQYFLGSS+AWPSYKEAGADNLIPMELALKI SKIR  E
Sbjct  540   KSIQTAYIQAIRSAQHFIYIENQYFLGSSFAWPSYKEAGADNLIPMELALKIASKIRANE  599

Query  913   RFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFY  734
             RFAVY+VIPMWPEG PSS  VQ+IL+WQGQTIQMMYEII +ELK +  E+AHP DYLNFY
Sbjct  600   RFAVYVVIPMWPEGAPSSVSVQEILFWQGQTIQMMYEIIGRELKYKNFENAHPSDYLNFY  659

Query  733   CLGNREEWHEESASSPTPGCSE-FLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQR  557
             CLGNRE   + + SS     SE  ++ SQK  RFMIYVHAKGM+VDDEYV+VGSANINQR
Sbjct  660   CLGNREPHDDLACSSGHSSKSEDLVSDSQKFRRFMIYVHAKGMIVDDEYVVVGSANINQR  719

Query  556   SMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECV  377
             SMAGSRDTEIAMGAYQP +TW K + HP  QVYGYRMSLWAEHLG +D+   E E L CV
Sbjct  720   SMAGSRDTEIAMGAYQPSYTWGKMKRHPRGQVYGYRMSLWAEHLGNIDDCFKEPESLTCV  779

Query  376   KMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRT  197
             K VN++AE+NWK+YTA +++PLQGHLLKYP++V  +GK+ PL G E FPD GGKVLG+R+
Sbjct  780   KTVNKMAEDNWKKYTAMEYAPLQGHLLKYPIEVSQSGKIGPLRGHETFPDFGGKVLGARS  839

Query  196   TLPDALTT  173
              LPDALTT
Sbjct  840   NLPDALTT  847



>ref|XP_010520828.1| PREDICTED: phospholipase D delta-like [Tarenaya hassleriana]
Length=839

 Score =  1312 bits (3395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 631/844 (75%), Positives = 726/844 (86%), Gaps = 8/844 (1%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKP-ETRQGNKVRR  2522
             M+D  +  +VYLHGDL+L+I+EARRLPNMD++SERIR+ FTAFD CRKP  + + +++R+
Sbjct  1     MADEKNSTLVYLHGDLELRIIEARRLPNMDLLSERIRRIFTAFDACRKPCSSTKNSRIRK  60

Query  2521  HTR-IITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVF  2345
             H + IITSDPYV VCLAGATVARTRVISNSQ PVW E+FKIP+AHPVS++EF VKDNDVF
Sbjct  61    HNKNIITSDPYVTVCLAGATVARTRVISNSQSPVWNENFKIPLAHPVSQIEFCVKDNDVF  120

Query  2344  GADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGV  2165
             GAD IGVA VSA KI SG+ I+DWFPIIG  G PPKPD A+RL M+F PC  N  Y  GV
Sbjct  121   GADLIGVASVSAVKIRSGDLISDWFPIIGTFGNPPKPDSAVRLEMRFVPCESNALYTRGV  180

Query  2164  TEDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAH  1985
             T   G+   YFP R GG VTLYQDAHVPE  +PEI+++DG  + HE CWEDICHAILEAH
Sbjct  181   TS-LGVANCYFPERPGGQVTLYQDAHVPE-EMPEIELEDGVLYQHERCWEDICHAILEAH  238

Query  1984  HMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKF  1805
             H+VY+VGWSI+H+VKLVREPTRPLP+GGNL+LG+LLKYKSQEGVRVLLLVWDDKTSHSKF
Sbjct  239   HLVYVVGWSIFHQVKLVREPTRPLPSGGNLSLGDLLKYKSQEGVRVLLLVWDDKTSHSKF  298

Query  1804  FINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDT  1625
             FINT+GVM THDEETRKFFKHSSVTCVL+PRYASSKLS  KQQVVGTL+THHQKCV+VDT
Sbjct  299   FINTAGVMQTHDEETRKFFKHSSVTCVLSPRYASSKLSIFKQQVVGTLFTHHQKCVLVDT  358

Query  1624  QAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWH  1445
             QA GNNRKITAFIGGLDLCDGRYDTP+HRLF   DTVF+ DY+NPTF   G + PRQPWH
Sbjct  359   QASGNNRKITAFIGGLDLCDGRYDTPEHRLFKGLDTVFQDDYHNPTF-SAGTRAPRQPWH  417

Query  1444  DLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTP  1265
             DLHCK+EGPAAYDILTNFEQRWRKA++W+E+G +FK+++ WHDDAL+K+ERISWI SP+ 
Sbjct  418   DLHCKVEGPAAYDILTNFEQRWRKATRWSEIGMKFKRVTRWHDDALIKLERISWILSPSA  477

Query  1264  SVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSI  1085
             S P DDPSLWVSNE +P NWHVQVFRSIDSGS+KGFPKDV  AE QNL+CAK+LVID+SI
Sbjct  478   STPVDDPSLWVSNEREPHNWHVQVFRSIDSGSVKGFPKDVFKAEEQNLICAKNLVIDKSI  537

Query  1084  QMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFA  905
             Q AYI+AIR AQHFIYIENQYFLGSSYAWP+YKEAGADNLIPMELALKI SKIR +ERFA
Sbjct  538   QTAYIQAIRSAQHFIYIENQYFLGSSYAWPNYKEAGADNLIPMELALKIASKIRAKERFA  597

Query  904   VYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLG  725
             VYIVIPMWPEGVPSSA VQ+ILYWQGQT+QMMYEIIA+E+++  +E+ HP DYLNFYCLG
Sbjct  598   VYIVIPMWPEGVPSSASVQEILYWQGQTMQMMYEIIAREIRAMHVENFHPQDYLNFYCLG  657

Query  724   NREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAG  545
             NRE+      + PT    E ++ SQKS RFMIYVHAKGMVVDDEYV++GSANINQRS+AG
Sbjct  658   NREQ--RVGDAKPTSNSGEMVSASQKSQRFMIYVHAKGMVVDDEYVLLGSANINQRSLAG  715

Query  544   SRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVN  365
             SRDTEIAMGAYQP  TW   + HP  QVYGYRMSLWAEH+G +D+   E E ++CV  VN
Sbjct  716   SRDTEIAMGAYQPLQTWNHRKQHPRGQVYGYRMSLWAEHMGAVDDAFKEPETIDCVTKVN  775

Query  364   EIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPD  185
             +IAE+NW +YTAE F+PLQGHLLKYPL VD +GKV+PL G + FPDVGGK+LG+RTTLPD
Sbjct  776   KIAEDNWNKYTAENFTPLQGHLLKYPLSVDISGKVTPLPGFDTFPDVGGKILGARTTLPD  835

Query  184   ALTT  173
             ALTT
Sbjct  836   ALTT  839



>ref|XP_003523254.1| PREDICTED: phospholipase D delta-like [Glycine max]
Length=847

 Score =  1303 bits (3371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 634/843 (75%), Positives = 727/843 (86%), Gaps = 11/843 (1%)
 Frame = -2

Query  2674  NVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKP---ETRQGNKVRRHTRII  2507
              VVYLHG LDL I EAR LPNMD++SER+R+FF+A + C      + +Q     RH +II
Sbjct  7     TVVYLHGTLDLVIEEARFLPNMDMLSERVRRFFSALNTCSASISGKRKQQQARHRHRKII  66

Query  2506  TSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIG  2327
             TSDPYV VCLAGATVARTRVISNSQDP W EHFKIP+AHP S+VEF VKDND+FGAD IG
Sbjct  67    TSDPYVTVCLAGATVARTRVISNSQDPTWNEHFKIPLAHPASQVEFYVKDNDMFGADLIG  126

Query  2326  VAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED---  2156
             VA VSA++I+SGE I+DWFPIIG  GKPPKPDCA+RL MKFT C ++P YR G   D   
Sbjct  127   VATVSAERILSGEAISDWFPIIGTFGKPPKPDCAVRLAMKFTRCEDSPMYRAGTESDPDR  186

Query  2155  YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMV  1976
             + ++ESYFP+R GG+VTLYQDAHVP+  LPE++++DG  F H  CWEDICHAILEAHH+V
Sbjct  187   FVVRESYFPVRRGGSVTLYQDAHVPDSMLPEVELEDGVVFEHGKCWEDICHAILEAHHLV  246

Query  1975  YIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFIN  1796
             YIVGWSIYHKVKLVREPT+PLP+GGNL+LGELLKYKSQEG+RVLLLVWDDKTSHSKFFIN
Sbjct  247   YIVGWSIYHKVKLVREPTKPLPSGGNLSLGELLKYKSQEGLRVLLLVWDDKTSHSKFFIN  306

Query  1795  TSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQ  1616
             TSGVM THDEETRKFFKHSSV C+L+PRYASSKLS  +QQVVGTL+THHQKCVIVDTQA 
Sbjct  307   TSGVMQTHDEETRKFFKHSSVRCLLSPRYASSKLSIFRQQVVGTLFTHHQKCVIVDTQAH  366

Query  1615  GNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLH  1436
             GNNRKITAFIGGLDLCDGRYDTP+HR+  D DTV++ DY+NPTF   G KGPRQPWHDLH
Sbjct  367   GNNRKITAFIGGLDLCDGRYDTPEHRILRDIDTVYQDDYHNPTFC-AGTKGPRQPWHDLH  425

Query  1435  CKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVP  1256
             CKIEGPAAYDILTNFEQRWRKA++W+ELGR+ K++SHW+DD+L+K+ERISWI SP+ S P
Sbjct  426   CKIEGPAAYDILTNFEQRWRKATRWSELGRKLKRVSHWNDDSLIKLERISWILSPSESTP  485

Query  1255  NDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMA  1076
              DDP LWVS E DP+NWHVQVFRSIDSGSLKGFPKDV  AETQNLVCAK+LVID+SIQ A
Sbjct  486   IDDPELWVSKEDDPENWHVQVFRSIDSGSLKGFPKDVVVAETQNLVCAKNLVIDKSIQTA  545

Query  1075  YIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYI  896
             YI AIR AQHFIYIENQYF+GSS+AWP+YKEAGADNLIP+ELALKIVSKIR++ERFAVYI
Sbjct  546   YIHAIRSAQHFIYIENQYFIGSSFAWPAYKEAGADNLIPVELALKIVSKIRSKERFAVYI  605

Query  895   VIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNRE  716
             VIPMWPEG PSS  VQ+IL+WQGQT++MMYEIIA+ELKS ++ D+HP DYLNFYCLGNRE
Sbjct  606   VIPMWPEGSPSSTSVQEILFWQGQTMKMMYEIIARELKSMQL-DSHPQDYLNFYCLGNRE  664

Query  715   EWHEE--SASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGS  542
             +   E  S+SS      E ++ SQK  RFMIYVHAKGM+VDDEYVI+GSANINQRS+AGS
Sbjct  665   QLTTEVSSSSSSPSDNGETVSASQKFRRFMIYVHAKGMIVDDEYVILGSANINQRSLAGS  724

Query  541   RDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNE  362
             RDTEIAMGAYQPHHTW++ + HPH QVYGYRMSLWAEH G ++    E E LECVK VN+
Sbjct  725   RDTEIAMGAYQPHHTWSQKKGHPHGQVYGYRMSLWAEHTGTIEACFKEPECLECVKSVNK  784

Query  361   IAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDA  182
             IAE+NWK+YTA+ +SPLQGHL+KYP+ V++NGKV  L G E FPDVGGKVLGSR+TLPDA
Sbjct  785   IAEDNWKKYTADDYSPLQGHLMKYPVSVNANGKVKSLPGFESFPDVGGKVLGSRSTLPDA  844

Query  181   LTT  173
             LTT
Sbjct  845   LTT  847



>ref|XP_003603842.1| Phospholipase D delta [Medicago truncatula]
 gb|AES74093.1| phospholipase D alpha 1 [Medicago truncatula]
Length=851

 Score =  1299 bits (3362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 634/846 (75%), Positives = 730/846 (86%), Gaps = 11/846 (1%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQGNK---VRRHTR  2513
             SE VVYLHG+LDLKI+EAR LPNMD++SER R+FF+AF+ C    T +G       RH +
Sbjct  7     SEAVVYLHGNLDLKIVEARYLPNMDMLSERFRRFFSAFNSCSANITTKGKNHLTRHRHHK  66

Query  2512  IITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADF  2333
             IITSDPYV VCLAGATVARTRVISNSQ P W EHFKIP+AHPVS+VEF VKDND+FGAD 
Sbjct  67    IITSDPYVTVCLAGATVARTRVISNSQSPKWEEHFKIPLAHPVSQVEFYVKDNDMFGADL  126

Query  2332  IGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT---  2162
             IG+A VSA++I+SGE I+DWFPIIG+ GKPPKPDCA+ L MKFT C ENP YR GV    
Sbjct  127   IGIATVSAKRILSGEDISDWFPIIGSFGKPPKPDCAVFLEMKFTRCDENPMYRSGVIPGP  186

Query  2161  EDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHH  1982
             + + +++SYFP+R GG+VTLYQDAHVP+  LPEI++DDG  F    CWEDICHAILEAHH
Sbjct  187   DRFAVQDSYFPVRRGGSVTLYQDAHVPDSMLPEIELDDGVEFQQGKCWEDICHAILEAHH  246

Query  1981  MVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFF  1802
             +VYIVGWSI+HKVKLVREPT+PLPNGGNLNLGELLKYKSQEG+RVLLLVWDDKTSHSKFF
Sbjct  247   LVYIVGWSIFHKVKLVREPTKPLPNGGNLNLGELLKYKSQEGLRVLLLVWDDKTSHSKFF  306

Query  1801  INTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQ  1622
             INT+G+M THDEETRKFFKHSSV+CVL+PRYASSKLS  KQQVVGTL+THHQKCVIVD+Q
Sbjct  307   INTNGIMQTHDEETRKFFKHSSVSCVLSPRYASSKLSIFKQQVVGTLFTHHQKCVIVDSQ  366

Query  1621  AQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDT-VFRGDYNNPTFPEGGLKGPRQPWH  1445
             A GNNRKITAFIGGLDLCDGRYDTP+HRLF D DT V++ DY+NPTF   G KGPRQPWH
Sbjct  367   AHGNNRKITAFIGGLDLCDGRYDTPEHRLFRDLDTHVYKDDYHNPTF-SAGTKGPRQPWH  425

Query  1444  DLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTP  1265
             DLHCKIEGPAAYDILTNFEQRW+KA++W+ELG++ K++S WHDD+L+K+ERISWI SP+ 
Sbjct  426   DLHCKIEGPAAYDILTNFEQRWKKATRWSELGQKLKRVSSWHDDSLIKLERISWILSPSE  485

Query  1264  SVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSI  1085
             S+ NDDP LWVS E DPQNWH+QVFRSIDSGSLKGFPK+ + A  QNLVCAK+LVID+SI
Sbjct  486   SMSNDDPELWVSKEDDPQNWHIQVFRSIDSGSLKGFPKNTYEAGAQNLVCAKNLVIDKSI  545

Query  1084  QMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFA  905
             Q AYI AIR AQHFIYIENQYF+GSS+AWPSYKEAGADNLIPMELALKIVSKIR+RERF 
Sbjct  546   QTAYIHAIRSAQHFIYIENQYFIGSSFAWPSYKEAGADNLIPMELALKIVSKIRSRERFT  605

Query  904   VYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLG  725
             VYIVIPMWPEGVPSS  VQ+ILY+QGQT+QMMYEIIA+EL+  K+ D+HP DYLNFYCLG
Sbjct  606   VYIVIPMWPEGVPSSGSVQEILYFQGQTMQMMYEIIARELRFMKLNDSHPQDYLNFYCLG  665

Query  724   NREEWHEE--SASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSM  551
             NRE++  E  S +S   G  + ++ SQK  RFMIYVHAKGMVVDDEY +VGSANINQRS+
Sbjct  666   NREKFATEVSSPNSSPSGNGDTVSASQKFQRFMIYVHAKGMVVDDEYAMVGSANINQRSL  725

Query  550   AGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKM  371
             AGSRDTEIAMGAYQPHHTW+K   HP  QVYGYRMSLWAEHLG + E   E E LECV+ 
Sbjct  726   AGSRDTEIAMGAYQPHHTWSKKNGHPRGQVYGYRMSLWAEHLGTIHECFKEPESLECVES  785

Query  370   VNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTL  191
             VN+IAE+NW+++T + F PLQGH++KYP++V++NGKVS L G E FPDVGGKVLGSR+TL
Sbjct  786   VNKIAEDNWRKFTDDDFKPLQGHIMKYPIKVNANGKVSSLPGYESFPDVGGKVLGSRSTL  845

Query  190   PDALTT  173
             P+ALTT
Sbjct  846   PNALTT  851



>gb|KDP36869.1| hypothetical protein JCGZ_08160 [Jatropha curcas]
Length=854

 Score =  1289 bits (3336),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 629/850 (74%), Positives = 718/850 (84%), Gaps = 23/850 (3%)
 Frame = -2

Query  2668  VYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQGNKVRRHTRIITSDPY  2492
             +Y+HGDLDLKI+EARRLPNMD+++ERIR+   AFD CRKP   +      H RIITSDPY
Sbjct  10    MYIHGDLDLKIIEARRLPNMDLLTERIRRCLLAFDNCRKPCLEETKHEPPH-RIITSDPY  68

Query  2491  VKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVAKVS  2312
             V VCLAGATVARTRVISN+Q+P W EHFKIPVAHP   VEF VKDNDVFGAD IG+A V 
Sbjct  69    VTVCLAGATVARTRVISNTQNPFWNEHFKIPVAHPADHVEFHVKDNDVFGADLIGIASVP  128

Query  2311  AQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT---EDYGLKE  2141
              +K+ISGETI++W  IIG +GKPPKPD AIR+ M F  C ENP Y+ G+     ++G++ 
Sbjct  129   VEKLISGETISEWLSIIGPYGKPPKPDSAIRIEMNFMQCQENPLYQYGIAASPNNFGIEN  188

Query  2140  SYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYIVGW  1961
              YFP+R G +VTLYQDAHVP+   PEIK+++G  F H+ CWEDICHAILEAHH+VYIVGW
Sbjct  189   CYFPVRRGSSVTLYQDAHVPDSFSPEIKLENGDVFKHDTCWEDICHAILEAHHLVYIVGW  248

Query  1960  SIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTSGVM  1781
             SIYHKVKLVREPTRPLP+GGNLNLG+LLKYKSQEGVRVL+LVWDDKTSHSKFFINTSGVM
Sbjct  249   SIYHKVKLVREPTRPLPSGGNLNLGDLLKYKSQEGVRVLMLVWDDKTSHSKFFINTSGVM  308

Query  1780  GTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQ----------VVGTLYTHHQKCVIV  1631
              THDEETRKFFKHSSV CVL+PRYASSKLS  KQQ          VVGTL+THHQKCVIV
Sbjct  309   QTHDEETRKFFKHSSVNCVLSPRYASSKLSIFKQQACLYSVPLTVVVGTLFTHHQKCVIV  368

Query  1630  DTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQP  1451
             D+QA GNNRKITAFIGGLDLCDGRYDTP+HRLF D DTVF+ D++NPTF  G  KGPRQP
Sbjct  369   DSQASGNNRKITAFIGGLDLCDGRYDTPEHRLFRDLDTVFQDDFHNPTFSAGS-KGPRQP  427

Query  1450  WHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSP  1271
             WHD HCKIEGPAAYDILTNFEQRW+KASKW+E GRRFK+++HWHDD+L+++ERISWI SP
Sbjct  428   WHDWHCKIEGPAAYDILTNFEQRWKKASKWSEFGRRFKRVTHWHDDSLIRLERISWILSP  487

Query  1270  TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDR  1091
              PS+PNDD  LWV+   DP+NWHVQVFRSIDSGSLKGFPKDV  AE QNLVCAK+LVID+
Sbjct  488   APSIPNDDLKLWVTTSDDPENWHVQVFRSIDSGSLKGFPKDVFNAEAQNLVCAKNLVIDK  547

Query  1090  SIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRER  911
             SIQ AYI+AIR AQHFIYIENQYF+GSSYAWPSYKEAGADNLIPMELALKI SKIR +ER
Sbjct  548   SIQTAYIQAIRSAQHFIYIENQYFIGSSYAWPSYKEAGADNLIPMELALKIASKIRAKER  607

Query  910   FAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYC  731
             FAVY+VIPMWPEGVP+S  VQ+IL+WQGQT+QMMYE+IA ELKS  ++D+HP +YLNFYC
Sbjct  608   FAVYVVIPMWPEGVPTSVSVQEILFWQGQTMQMMYELIANELKSMNLQDSHPREYLNFYC  667

Query  730   LGNREEWHEE----SASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANIN  563
             LGNREE  ++    S  SP+ G +     SQK  RFMIYVHAKGM+VDDEYVI+GSANIN
Sbjct  668   LGNREELPKDLTDLSDKSPSSGEA---AASQKYQRFMIYVHAKGMIVDDEYVILGSANIN  724

Query  562   QRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLE  383
             QRS+AGSRDTEIAMGAYQP++TW K   HP  QVYGYRMSLWAEHLG++D   +E E L+
Sbjct  725   QRSLAGSRDTEIAMGAYQPNYTWGKKYKHPRGQVYGYRMSLWAEHLGLVDSLFEEPETLD  784

Query  382   CVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGS  203
             CVK VN+IAE+NW+R+T E+FS LQGHLL+YPL+VD NGKVS L G E FPDVGGKVLG+
Sbjct  785   CVKTVNKIAEDNWRRFTDEEFSLLQGHLLQYPLEVDINGKVSALPGHENFPDVGGKVLGA  844

Query  202   RTTLPDALTT  173
             RTTLPDALTT
Sbjct  845   RTTLPDALTT  854



>ref|XP_004500903.1| PREDICTED: phospholipase D delta-like isoform X1 [Cicer arietinum]
Length=849

 Score =  1288 bits (3332),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 625/850 (74%), Positives = 728/850 (86%), Gaps = 10/850 (1%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQGNK---V  2528
             M+      V+YLHG+L LKI+EAR LPNMD+ SER R+FF+A + C      +G      
Sbjct  1     MTHKSDPTVIYLHGNLHLKIVEARFLPNMDMFSERFRRFFSAINACSASIGGKGKNHPPR  60

Query  2527  RRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDV  2348
               H +IITSDPYV VCLAGATVARTRVISNSQ P W EHFKIP+AHPVS+VEF VKDND+
Sbjct  61    HHHHKIITSDPYVTVCLAGATVARTRVISNSQSPKWEEHFKIPLAHPVSQVEFYVKDNDM  120

Query  2347  FGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGG  2168
             FGAD IG+A VSA++I+SGE I+DWFPIIG  GK PKPDCA+RL MKFT C ++P +R G
Sbjct  121   FGADLIGIATVSAKRILSGEDISDWFPIIGPCGKTPKPDCAVRLEMKFTRCDDSPLFRSG  180

Query  2167  VT---EDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAI  1997
             +    + + +++SYFP+R GGAVTLYQDAHVP+  LP IK+DDG  F H  CWEDICHAI
Sbjct  181   LAPEPDRFVVRDSYFPVRRGGAVTLYQDAHVPDSMLPGIKLDDGVEFQHGKCWEDICHAI  240

Query  1996  LEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTS  1817
             LEAHHMVYIVGWSIYHKVKLVREPT+PLP+GGNLNLGELLKYKSQEG+RVL+LVWDDKTS
Sbjct  241   LEAHHMVYIVGWSIYHKVKLVREPTKPLPSGGNLNLGELLKYKSQEGLRVLMLVWDDKTS  300

Query  1816  HSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCV  1637
             H+KFF  T+G+M THDEETRKFFKHSSVTCVL+PRYASSKLS  KQQVVGTL+THHQKCV
Sbjct  301   HNKFFFKTNGIMQTHDEETRKFFKHSSVTCVLSPRYASSKLSIFKQQVVGTLFTHHQKCV  360

Query  1636  IVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPR  1457
             IVDTQA GN+RKITAFIGGLDLCDGRYDTP+HR+F D DTV++ DY+NPTFP  G KGPR
Sbjct  361   IVDTQAHGNHRKITAFIGGLDLCDGRYDTPEHRIFHDLDTVYKDDYHNPTFP-AGTKGPR  419

Query  1456  QPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWIT  1277
             QPWHDLHCKIEGPAAYDILTNFEQRWR+A+KW++LG++FK++SHW DD+L+K++RISWI 
Sbjct  420   QPWHDLHCKIEGPAAYDILTNFEQRWRRATKWSDLGQKFKRVSHWVDDSLIKLDRISWIL  479

Query  1276  SPTPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVI  1097
             SP+ S+PNDDP LWVS E DP+NWHVQVFRSIDSGSLKGFPKDVH AE QNL+CAK+LVI
Sbjct  480   SPSESLPNDDPELWVSKEDDPENWHVQVFRSIDSGSLKGFPKDVHEAEAQNLICAKNLVI  539

Query  1096  DRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNR  917
             D+SIQ AYI AIR AQHFIYIENQYF+GSS+AWPSYKEAGADNLIP+ELALKIVSKIR  
Sbjct  540   DKSIQTAYIHAIRSAQHFIYIENQYFIGSSFAWPSYKEAGADNLIPIELALKIVSKIRAN  599

Query  916   ERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNF  737
             ERF VYIVIPMWPEGVPSSA VQ+ILY+QGQT++MMYEIIA+ELK   IE+ +P DYLNF
Sbjct  600   ERFTVYIVIPMWPEGVPSSAAVQEILYFQGQTMEMMYEIIARELKLHNIENRNPQDYLNF  659

Query  736   YCLGNREEWHEESASSPTPGC--SEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANIN  563
             YCLGNRE++  E +++        + ++ SQK  RFMIYVHAKGMVVDDEYV+VGSANIN
Sbjct  660   YCLGNREKFATEVSTTNNSHSDNGDTVSASQKFQRFMIYVHAKGMVVDDEYVMVGSANIN  719

Query  562   QRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLE  383
             QRS+AGSRDTEIAMGAYQP HTW+K + +PH QVYGYRMSLWAEHLG + +  +E E LE
Sbjct  720   QRSLAGSRDTEIAMGAYQPRHTWSKKKGYPHGQVYGYRMSLWAEHLGTIHDCFNEPESLE  779

Query  382   CVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGS  203
             C+K VN+IAE+NWK++T++ F+ LQGHLLKYP++V++NGKVS L G E FPDVGGKVLGS
Sbjct  780   CLKSVNKIAEDNWKKFTSDDFTSLQGHLLKYPIKVNANGKVSSLPGFESFPDVGGKVLGS  839

Query  202   RTTLPDALTT  173
             R+TLPDALTT
Sbjct  840   RSTLPDALTT  849



>ref|XP_010063288.1| PREDICTED: phospholipase D delta-like [Eucalyptus grandis]
 gb|KCW70497.1| hypothetical protein EUGRSUZ_F03706 [Eucalyptus grandis]
Length=877

 Score =  1282 bits (3317),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 633/875 (72%), Positives = 724/875 (83%), Gaps = 37/875 (4%)
 Frame = -2

Query  2689  DGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTA----FDC-------------  2561
             D  S+ V+ LHGDL+L+ILEAR LPNMD+VSER+R+ FTA    FDC             
Sbjct  4     DKKSDPVLLLHGDLELQILEARSLPNMDMVSERLRRIFTACRQPFDCQPPDAAAPASGAA  63

Query  2560  ---RKPETRQGNKVRRHTR--IITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPV  2396
                R    RQG   R H R  +ITSDPYV VCLAGATVART VISNSQDP W E F++P+
Sbjct  64    VSARAGGDRQGQGHRHHHRGKVITSDPYVTVCLAGATVARTAVISNSQDPTWNERFRVPL  123

Query  2395  AHPVSEVEFQVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRL  2216
             AHPV+ +EF VKDND+FGAD IG A V A+++ISGE I DWFPIIG +GK PKPDCAIR+
Sbjct  124   AHPVASIEFNVKDNDIFGADKIGTASVPARRVISGEAIEDWFPIIGDNGKQPKPDCAIRV  183

Query  2215  MMKFTPCAENPRYRGGVT---EDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDG  2045
              ++FTPC EN  Y+ G+    E++G++  YFPMR G  VTLYQDAHVP+  LPEIK++ G
Sbjct  184   RIEFTPCDENDLYKVGIGADPENFGIQNCYFPMRKGCNVTLYQDAHVPDSMLPEIKLEKG  243

Query  2044  KAFHHENCWEDICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKS  1865
               + HE CWEDICHAILEAHH+VYIVGWSI+HKVKLVREP++PLPNGGNL LGELLKYKS
Sbjct  244   NVYRHEKCWEDICHAILEAHHLVYIVGWSIFHKVKLVREPSKPLPNGGNLTLGELLKYKS  303

Query  1864  QEGVRVLLLVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFV  1685
             +EGVRVLLLVWDDKTSHSKFFI T+GVM THDEETRKFFKHSSVTCVL+PRYASSKLS  
Sbjct  304   EEGVRVLLLVWDDKTSHSKFFIETAGVMQTHDEETRKFFKHSSVTCVLSPRYASSKLSIF  363

Query  1684  KQQVVGTLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRG  1505
             KQQVVGTL+THHQKCVIVDTQA GNNRKITAF+GGLDLCDGRYDTP+HRLF D  TVF  
Sbjct  364   KQQVVGTLFTHHQKCVIVDTQAHGNNRKITAFLGGLDLCDGRYDTPEHRLFRDLGTVFDN  423

Query  1504  DYNNPTFPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISH  1325
             DY+NPTFP G  KGPRQPWHDLHCKIEGPAAYD+L NFEQRWR+A+KW+E G+RFK+ISH
Sbjct  424   DYHNPTFPVG-TKGPRQPWHDLHCKIEGPAAYDVLKNFEQRWRRATKWSEFGQRFKRISH  482

Query  1324  WHDDALLKIERISWITSPTPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDV  1145
             WHDDAL+KIERISWI SP+ S P DDPSL VS E D ++WHVQ+FRSIDSGSLKGFPKDV
Sbjct  483   WHDDALIKIERISWILSPSASTPVDDPSLQVSRESDRESWHVQIFRSIDSGSLKGFPKDV  542

Query  1144  HTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNL  965
             + AE+ NLVCAK+LVID+SIQ AYI+AIR AQHFIYIENQYFLGSSYAWPSY+ AGADNL
Sbjct  543   YEAESLNLVCAKNLVIDKSIQTAYIQAIRSAQHFIYIENQYFLGSSYAWPSYRSAGADNL  602

Query  964   IPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKEL  785
             IPMELALKIVSKIR  ERFAVY+VIPMWPEGVPS+  VQ+ILYWQ QT+Q+MYEIIAKEL
Sbjct  603   IPMELALKIVSKIRANERFAVYVVIPMWPEGVPSTNAVQEILYWQRQTMQLMYEIIAKEL  662

Query  784   KSEKIEDAHPCDYLNFYCLGNREEWHEESA--SSPTPGCSEFLTGSQKSGRFMIYVHAKG  611
              S+ +E+AHPCDYLNFYCLGNREE  +E +  ++  P     ++ SQK  RFMIYVHAKG
Sbjct  663   NSKGLENAHPCDYLNFYCLGNREELPKELSEPANQPPSDGVKVSASQKFQRFMIYVHAKG  722

Query  610   MVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWA---------KNQNHPHAQVY  458
             M+VDDEYVI+GSANINQRSMAGSRDTEIAMGAYQPH+TW          K + HPH Q+Y
Sbjct  723   MIVDDEYVILGSANINQRSMAGSRDTEIAMGAYQPHYTWGEKKKHLLGKKEKKHPHGQIY  782

Query  457   GYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQV  278
             GYRMSLWAEHL M+D+  +E E L CV+ VN+IAEENWK++T E+F+PLQGHLLKYP++V
Sbjct  783   GYRMSLWAEHLDMVDDYFEEPEDLSCVRSVNKIAEENWKKFTIEEFTPLQGHLLKYPIEV  842

Query  277   DSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALTT  173
             D+NGKVS L   E FPDVGG+VLGSRT LPDALTT
Sbjct  843   DTNGKVSALPRQECFPDVGGRVLGSRTNLPDALTT  877



>ref|XP_004292929.1| PREDICTED: phospholipase D delta-like [Fragaria vesca subsp. 
vesca]
Length=854

 Score =  1281 bits (3315),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 624/844 (74%), Positives = 724/844 (86%), Gaps = 18/844 (2%)
 Frame = -2

Query  2674  NVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRRHTRIITSDP  2495
             +VV+LHG+LDLKI+EAR LPNMD++SER R+ F+A  CRKP     +K   H +IITSDP
Sbjct  19    SVVHLHGNLDLKIIEARCLPNMDMLSERFRRLFSA--CRKPFA--NSKHHHHHKIITSDP  74

Query  2494  YVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVAKV  2315
             YV VCLAGATVARTRVISNSQ+P W EHF IP+AHPVS+VEF VKDND+FGAD IGVA V
Sbjct  75    YVTVCLAGATVARTRVISNSQNPEWKEHFTIPLAHPVSQVEFYVKDNDMFGADLIGVASV  134

Query  2314  SAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTEDY---GLK  2144
             SA++I+SGETI+DWFPIIG  GKPPKPD A++L M+FT C +NP Y+ G+  +    G++
Sbjct  135   SAKRILSGETISDWFPIIGPLGKPPKPDAAVKLEMRFTKCEDNPLYKDGIISNERVGGVE  194

Query  2143  ESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYIVG  1964
               YFP R GG VTLYQDAHVP+G L EI++D+G  F H  CWEDICHAILEAHH+VYIVG
Sbjct  195   NCYFPARQGGHVTLYQDAHVPDGMLEEIELDEGVKFEHGKCWEDICHAILEAHHLVYIVG  254

Query  1963  WSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTSGV  1784
             WSI+HK+KLVREP++PLP+GGNLNLGELLKYKSQEG+RVLLLVWDDKTSHSKFFINT+GV
Sbjct  255   WSIFHKIKLVREPSKPLPSGGNLNLGELLKYKSQEGLRVLLLVWDDKTSHSKFFINTAGV  314

Query  1783  MGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQGNNR  1604
             M THDEETRKFFKHSSV+CVL+PRYASSKLS  KQQVVGTL+THHQKCVIVDTQA GNNR
Sbjct  315   MQTHDEETRKFFKHSSVSCVLSPRYASSKLSIFKQQVVGTLFTHHQKCVIVDTQASGNNR  374

Query  1603  KITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCKIE  1424
             K+TAFIGGLDLCDGRYDTP+HRLFSD DTVF+GD++NPT    G KGPRQPWHDLHCKIE
Sbjct  375   KLTAFIGGLDLCDGRYDTPEHRLFSDLDTVFQGDFHNPTL--AGSKGPRQPWHDLHCKIE  432

Query  1423  GPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPNDDP  1244
             GPAAYD+LTNFEQRW+KA+KW+E G+RFK++S WHDDAL+K++RISWI SP P   NDDP
Sbjct  433   GPAAYDVLTNFEQRWKKATKWSEFGQRFKRVSRWHDDALIKLDRISWILSPPPGSSNDDP  492

Query  1243  SLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEA  1064
              L VS+E DPQNW+VQ+FRSIDSGS+KGFPKDV+ AE QNL CAK+LVID+SIQ AYIEA
Sbjct  493   ILRVSDEADPQNWNVQIFRSIDSGSVKGFPKDVYEAENQNLFCAKNLVIDKSIQTAYIEA  552

Query  1063  IRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPM  884
             IR AQHFIYIENQYFLGSSYAWP+YKEAGADNLIPMELALKI SKIR +ERFAVY+VIPM
Sbjct  553   IRSAQHFIYIENQYFLGSSYAWPTYKEAGADNLIPMELALKIASKIRAKERFAVYVVIPM  612

Query  883   WPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREEW--  710
             WPEGVPSSA VQ+IL+WQGQT+QMMYEIIAKELKS  IE+AHP DYLNFYCLGNRE+   
Sbjct  613   WPEGVPSSASVQEILFWQGQTMQMMYEIIAKELKSMNIENAHPQDYLNFYCLGNREKLPG  672

Query  709   -----HEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAG  545
                    +++ + +PG +  ++ SQK  RFMIYVHAKGMVVDDEYV++GSANINQRSMAG
Sbjct  673   TVTSTTNQTSKTGSPGHT--VSASQKYQRFMIYVHAKGMVVDDEYVMIGSANINQRSMAG  730

Query  544   SRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVN  365
             SRDTEIAMGAYQPHHTW K + HPH QVYGYRMSLW EH+G ++    E + LECVK VN
Sbjct  731   SRDTEIAMGAYQPHHTWGKKKRHPHGQVYGYRMSLWTEHMGKVENCFKEPQTLECVKRVN  790

Query  364   EIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPD  185
             +I+++NW R+ +E+F  LQGHL+KYP++V +NGKV  L G E FPDVGGK+LG+RT LPD
Sbjct  791   DISKDNWSRFVSEEFIELQGHLIKYPVEVHANGKVGALPGRESFPDVGGKILGARTNLPD  850

Query  184   ALTT  173
             ALTT
Sbjct  851   ALTT  854



>ref|XP_011034954.1| PREDICTED: phospholipase D delta-like [Populus euphratica]
Length=833

 Score =  1280 bits (3313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 614/832 (74%), Positives = 708/832 (85%), Gaps = 15/832 (2%)
 Frame = -2

Query  2662  LHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQGNKVRRHT-RIITSDPYV  2489
             LHGDL+LKI+EARRLPNMD+VSER+R+ F+AFD CR P +++  K + H  +IITSDPYV
Sbjct  15    LHGDLELKIIEARRLPNMDLVSERLRRCFSAFDPCRHPFSKERKKQQNHRHKIITSDPYV  74

Query  2488  KVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVAKVSA  2309
              VC++GATVARTRVISN+Q+PVW EHFKIP+AHP  +++F VKDND+FGA+ IG A V  
Sbjct  75    TVCVSGATVARTRVISNNQNPVWNEHFKIPLAHPAEKIDFYVKDNDMFGAELIGTASVEV  134

Query  2308  QKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTEDYGLKESYFP  2129
             ++I+SGETI+ WFPIIG +GKPPK DCA+ + M+FT C E P       +  G++  YFP
Sbjct  135   EEILSGETISAWFPIIGMYGKPPKTDCALHVEMRFTKC-EQP------DDKLGVENCYFP  187

Query  2128  MRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYIVGWSIYH  1949
             +RHGG VTLYQDAHVP+  LPEI++++G  F H  CWEDICHAI+EAHH+VYI GWSI+H
Sbjct  188   VRHGGNVTLYQDAHVPDSGLPEIELENGNVFRHGKCWEDICHAIVEAHHLVYIAGWSIFH  247

Query  1948  KVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTSGVMGTHD  1769
             KVKLVREP++PLP GG+LNLGELLKYKSQEGVRVLLLVWDDKTSH+KFF+ T+GVM THD
Sbjct  248   KVKLVREPSKPLPRGGDLNLGELLKYKSQEGVRVLLLVWDDKTSHNKFFLRTNGVMQTHD  307

Query  1768  EETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQGNNRKITAF  1589
             EETRKFFKHSSV CVL+PRYASSKLS  +QQV+GTLYTHHQKCV+VDTQA GNNRKITAF
Sbjct  308   EETRKFFKHSSVNCVLSPRYASSKLSIFRQQVIGTLYTHHQKCVLVDTQASGNNRKITAF  367

Query  1588  IGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCKIEGPAAY  1409
             IGGLDLCDGRYDTP+HRLF D DTVF+ DY+NPTFP  G KGPRQPWHDLHCKIEGPAAY
Sbjct  368   IGGLDLCDGRYDTPEHRLFRDLDTVFQDDYHNPTFP-AGTKGPRQPWHDLHCKIEGPAAY  426

Query  1408  DILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPNDDPSLWVS  1229
             D+LTNFEQRWRKASKW+E GR FK+ +HW DDAL+K+ERISWI  P+PSVPNDDP+ WVS
Sbjct  427   DVLTNFEQRWRKASKWSEFGRSFKRATHWRDDALIKLERISWILGPSPSVPNDDPTFWVS  486

Query  1228  NEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQ  1049
              E DP+NWHVQVFRSIDSGSLKGFPKDV+ AE QNLVCAK+LVID+SIQ AYI+AIR AQ
Sbjct  487   EEDDPENWHVQVFRSIDSGSLKGFPKDVYQAEKQNLVCAKNLVIDKSIQTAYIQAIRSAQ  546

Query  1048  HFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEGV  869
             HFIYIENQYFLGSS+AW  YK AGA+NLIPMELALKI SKIR +ERF VY+VIPMWPEGV
Sbjct  547   HFIYIENQYFLGSSFAWSDYKNAGAENLIPMELALKIASKIRAKERFTVYVVIPMWPEGV  606

Query  868   PSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREEWHEESASS  689
             P+SA VQ+IL+WQGQT+QMMYE+IA ELKS  +E++HP DYLNFYCLGNREE        
Sbjct  607   PTSASVQEILFWQGQTMQMMYEVIANELKSMNLENSHPQDYLNFYCLGNREE-----VQG  661

Query  688   PTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQ  509
              T    + ++ SQK  RFMIYVHAKGMVVDD YVI+GSANINQRSMAGSRDTEIAMGAYQ
Sbjct  662   STNSGDQTVSISQKFQRFMIYVHAKGMVVDDAYVILGSANINQRSMAGSRDTEIAMGAYQ  721

Query  508   PHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTA  329
             PHHTW+  + HP  QVYGYRMSLWAEHLG++D    E E L+CVK VN+IAE+NWK++TA
Sbjct  722   PHHTWSNKKRHPRGQVYGYRMSLWAEHLGLVDNSFKEPESLDCVKSVNKIAEDNWKKFTA  781

Query  328   EKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALTT  173
             E F+ LQGHLLKYP+QVD NGKVSP  G E FPDVGGKVLG RT LPDALTT
Sbjct  782   ENFTLLQGHLLKYPVQVDGNGKVSPFPGQETFPDVGGKVLGVRTNLPDALTT  833



>ref|XP_007136128.1| hypothetical protein PHAVU_009G020200g [Phaseolus vulgaris]
 gb|ESW08122.1| hypothetical protein PHAVU_009G020200g [Phaseolus vulgaris]
Length=847

 Score =  1280 bits (3312),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 617/843 (73%), Positives = 726/843 (86%), Gaps = 11/843 (1%)
 Frame = -2

Query  2674  NVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPET--RQGNKVR-RHTRII  2507
              VVYLHG LDL I+EAR LPNMD++SER+R+FF+A + C    T  R+ ++ R RH +II
Sbjct  7     TVVYLHGTLDLVIVEARFLPNMDLLSERVRRFFSALNTCSASITGKRKLHRARHRHRKII  66

Query  2506  TSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIG  2327
             TSDPYV VCLAGATVARTRVISNSQ+P W EHFKIP+AHP ++V+F VKDND+FGAD IG
Sbjct  67    TSDPYVTVCLAGATVARTRVISNSQNPTWDEHFKIPLAHPAAQVDFFVKDNDMFGADLIG  126

Query  2326  VAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED---  2156
             V  VSA++I+S E I+DWFPIIG+ GKPPKPDCA+RL MKFT C +N  +R     D   
Sbjct  127   VVTVSAERILSCEPISDWFPIIGSFGKPPKPDCALRLAMKFTRCEDNRMFRSIDEPDPDR  186

Query  2155  YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMV  1976
             + +++SYFP+RHGGAVTLYQDAHVPEG LPE+++D+G  F H  CWEDICHAILEAHH+V
Sbjct  187   FVVRDSYFPVRHGGAVTLYQDAHVPEGMLPEVELDEGVVFEHGKCWEDICHAILEAHHLV  246

Query  1975  YIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFIN  1796
             YIVGWSIYHKV+LVREPT+PLP+GG+LNLGELLKYKSQEG+RVLLLVWDDKTSHSKFFIN
Sbjct  247   YIVGWSIYHKVRLVREPTKPLPSGGSLNLGELLKYKSQEGLRVLLLVWDDKTSHSKFFIN  306

Query  1795  TSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQ  1616
             T+GVM THDEETRKFFKHSSV C+L+PRYASSKLS  +QQVVGTL+THHQKCVIVDTQA 
Sbjct  307   TTGVMQTHDEETRKFFKHSSVRCLLSPRYASSKLSIFRQQVVGTLFTHHQKCVIVDTQAH  366

Query  1615  GNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLH  1436
             GNNRKITAFIGGLDLCDGRYDTP+HR+F D DTV++ D++NPTF  G  KGPRQPWHDLH
Sbjct  367   GNNRKITAFIGGLDLCDGRYDTPEHRIFRDVDTVYQDDFHNPTFCTG-TKGPRQPWHDLH  425

Query  1435  CKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVP  1256
             CKIEGPAAYDILTNFEQRW+KA++W+ELGR+ K++SHWHDD+L+K+ERISWI SP+ S+ 
Sbjct  426   CKIEGPAAYDILTNFEQRWKKATRWSELGRKLKRVSHWHDDSLIKLERISWILSPSESIQ  485

Query  1255  NDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMA  1076
              DDP LWVS E DP+NWHVQVFRSIDSGSLKGFPKDV  AE+QNLVCAK+LV+D+SIQ A
Sbjct  486   TDDPELWVSKEDDPKNWHVQVFRSIDSGSLKGFPKDVFEAESQNLVCAKNLVVDKSIQTA  545

Query  1075  YIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYI  896
             YI AIR AQHFIYIENQYF+GSS+AWP+YK+AGADNLIPMELALKIVSKIR++ERF VYI
Sbjct  546   YIHAIRSAQHFIYIENQYFVGSSFAWPAYKDAGADNLIPMELALKIVSKIRSKERFTVYI  605

Query  895   VIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNRE  716
             VIPMWPEG PSSA VQ+IL+WQGQT+QMMY++IA+E+K+ ++ D+HP DYLNFYCLGNRE
Sbjct  606   VIPMWPEGTPSSATVQEILFWQGQTMQMMYDVIAREIKAMQL-DSHPLDYLNFYCLGNRE  664

Query  715   EWHEE--SASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGS  542
              +  +  S+S+  P   E ++ SQK  RFMIYVHAKGMVVDDEYVI+GSANINQRSMAGS
Sbjct  665   PFKTDFLSSSNLPPDNGETISASQKFRRFMIYVHAKGMVVDDEYVILGSANINQRSMAGS  724

Query  541   RDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNE  362
             RDTEIAMGAYQP HTW+  + HPH QVYGYRMSLWAEH G ++    + E LECVK VN 
Sbjct  725   RDTEIAMGAYQPRHTWSAKKGHPHGQVYGYRMSLWAEHTGSIEGCFKDPESLECVKSVNN  784

Query  361   IAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDA  182
             IAEENW++Y A+ ++PL+GHL+KYP+ ++ NGKV  + G E FPDVGGKVLGSR+ LPDA
Sbjct  785   IAEENWRKYIADDYTPLKGHLIKYPVNININGKVKSIPGFESFPDVGGKVLGSRSNLPDA  844

Query  181   LTT  173
             LTT
Sbjct  845   LTT  847



>ref|XP_006581145.1| PREDICTED: phospholipase D delta-like [Glycine max]
Length=847

 Score =  1276 bits (3303),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 623/844 (74%), Positives = 720/844 (85%), Gaps = 11/844 (1%)
 Frame = -2

Query  2677  ENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPET---RQGNKVRRHTRI  2510
             + VVYLHG LDL I +AR LPNMD++SER+R+FF+A + C    T   +Q +   RH +I
Sbjct  6     DTVVYLHGTLDLVIEDARFLPNMDMLSERVRRFFSALNTCSASITGKRKQRHARHRHRKI  65

Query  2509  ITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFI  2330
             ITSDPYV VCLAGATVARTRVISNSQ+P W EHFKIP+AHP S+VEF VKDND+FGAD I
Sbjct  66    ITSDPYVTVCLAGATVARTRVISNSQNPTWDEHFKIPLAHPASQVEFYVKDNDMFGADLI  125

Query  2329  GVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED--  2156
             GVA VSA++I+SGE I DWFPIIG  GKPPKPDCA+RL MKFT C ++  YR     D  
Sbjct  126   GVATVSAERILSGEAIRDWFPIIGTFGKPPKPDCAVRLAMKFTRCEDSFMYRSRTETDPD  185

Query  2155  -YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHM  1979
              + +++SYFP+RHGG+VTLYQDAHVP+  LPE++++DG  F H  CWEDICHAIL AHH+
Sbjct  186   RFVVRDSYFPVRHGGSVTLYQDAHVPDSMLPEVELEDGVVFEHGKCWEDICHAILGAHHL  245

Query  1978  VYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFI  1799
             VYIVGWSIYHKVKLVREPT+ LP+GGNLNLGELLKYKSQEG+RVLLLVWDDKTSHSKF I
Sbjct  246   VYIVGWSIYHKVKLVREPTKALPSGGNLNLGELLKYKSQEGLRVLLLVWDDKTSHSKFGI  305

Query  1798  NTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQA  1619
             NTSGVM THDEETRKFFKHSSV C+L+PRYASSKLS  KQQVVGTL+THHQKCVIVDTQA
Sbjct  306   NTSGVMQTHDEETRKFFKHSSVRCLLSPRYASSKLSIFKQQVVGTLFTHHQKCVIVDTQA  365

Query  1618  QGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDL  1439
              GNNRKITAFIGGLDLCDGRYDTP+HR+  D DTV++ DY+NPTF   G KGPRQPWHDL
Sbjct  366   HGNNRKITAFIGGLDLCDGRYDTPEHRILRDIDTVYQDDYHNPTFC-AGTKGPRQPWHDL  424

Query  1438  HCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSV  1259
             HCKIEGPAAYDILTNFEQRWRKA+KW+ELGR+ K++SHW+DD+L+K+ERI WI SP+ S 
Sbjct  425   HCKIEGPAAYDILTNFEQRWRKATKWSELGRKLKRVSHWNDDSLIKLERIFWILSPSEST  484

Query  1258  PNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQM  1079
             P DDP LWVS E DP+NWHVQVFRSIDSGSLKGFPKDV  AETQNLVCAK+LVID+SIQ 
Sbjct  485   PVDDPELWVSKEDDPENWHVQVFRSIDSGSLKGFPKDVVVAETQNLVCAKNLVIDKSIQT  544

Query  1078  AYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVY  899
             AYI AIR AQHFIYIENQYF+GSS+AWP+YKEAGADNLIP+ELALKIVSKIR++ERF VY
Sbjct  545   AYIHAIRSAQHFIYIENQYFIGSSFAWPAYKEAGADNLIPVELALKIVSKIRSKERFTVY  604

Query  898   IVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNR  719
             IVIPMWPEG PSS  VQ+IL+WQGQT++MMYEIIA ELKS ++ D+HP DYLNFYCLGNR
Sbjct  605   IVIPMWPEGSPSSTSVQEILFWQGQTMKMMYEIIALELKSMQL-DSHPQDYLNFYCLGNR  663

Query  718   EEWHEE--SASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAG  545
             E+   E  S+S+      E ++ SQK  RFMIYVHAKGM+VDDEYVI+GSANINQRS+AG
Sbjct  664   EQLTTEVSSSSNSPSDNGETVSASQKFRRFMIYVHAKGMIVDDEYVILGSANINQRSLAG  723

Query  544   SRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVN  365
             SRDTEIAMGA+QPHHTW++ + HPH QVYGYRMSLWAEH+  ++    E E LECVK VN
Sbjct  724   SRDTEIAMGAHQPHHTWSQKKRHPHGQVYGYRMSLWAEHMETIEACFKEPESLECVKSVN  783

Query  364   EIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPD  185
             +IAE+NWK+YTA+ ++PLQGH++KYP+ V++ GKV  L G E FPDVGGKVLGSR+TLPD
Sbjct  784   KIAEDNWKKYTADDYTPLQGHIMKYPVCVNAYGKVKSLTGFESFPDVGGKVLGSRSTLPD  843

Query  184   ALTT  173
             ALTT
Sbjct  844   ALTT  847



>ref|XP_011083418.1| PREDICTED: phospholipase D delta-like isoform X2 [Sesamum indicum]
Length=829

 Score =  1270 bits (3286),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 613/813 (75%), Positives = 703/813 (86%), Gaps = 6/813 (1%)
 Frame = -2

Query  2686  GMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKP--ETRQGNKVRRHT  2516
              ++ N+VYLHGDLDLKI+EAR LPNMD+VSER R+  T FD CRKP    R GN  + H 
Sbjct  5     ALNNNIVYLHGDLDLKIIEARSLPNMDLVSERFRRLCTVFDVCRKPFAPPRNGNH-KHHH  63

Query  2515  RIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGAD  2336
             +IITSDPYV VCLAGA VARTR+I+NSQ+PVW E+FKIP+AHPVS+VEF+VKDND+FGAD
Sbjct  64    KIITSDPYVIVCLAGARVARTRIINNSQNPVWNENFKIPLAHPVSQVEFEVKDNDMFGAD  123

Query  2335  FIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED  2156
              IGVA V A++I +GE I++W P+IG +GKP KPD A+RL + FTPC  NP Y+ G++E+
Sbjct  124   LIGVASVHAKRIAAGELIDEWIPVIGPNGKPHKPDSALRLRISFTPCYANPLYQKGISEN  183

Query  2155  YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMV  1976
             Y LKESYFP+RHG  VTLYQDAH+ +  +PEI +D+ + + HE CWEDICHAILEAHHMV
Sbjct  184   YALKESYFPLRHGSKVTLYQDAHLDDEMMPEIGLDEKRHYEHEKCWEDICHAILEAHHMV  243

Query  1975  YIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFIN  1796
             YIVGWSIYHKVKLVREPT+PLP GG+L LGELLKYKSQEGVRVLLLVWDDKTSHSKFFIN
Sbjct  244   YIVGWSIYHKVKLVREPTKPLPIGGDLTLGELLKYKSQEGVRVLLLVWDDKTSHSKFFIN  303

Query  1795  TSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQ  1616
             T+GVM THDEETR++FKHSSVTCVLAPRYASSKLS  KQQVVGT+YTHHQKCVIVDTQ  
Sbjct  304   TTGVMDTHDEETRRYFKHSSVTCVLAPRYASSKLSIFKQQVVGTIYTHHQKCVIVDTQGP  363

Query  1615  GNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLH  1436
             GNNRKITAFIGGLDLCDGRYDTP+HRLF D +TVF+ DY+NPTF   G K PRQPWHDLH
Sbjct  364   GNNRKITAFIGGLDLCDGRYDTPEHRLFRDLNTVFKDDYHNPTFAP-GTKAPRQPWHDLH  422

Query  1435  CKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVP  1256
             CKIEGPAAYD+LTNFEQRWRKA+KW+ELG+RFK+ISHWHDDALLKIERISWI SP+ ++P
Sbjct  423   CKIEGPAAYDVLTNFEQRWRKATKWSELGQRFKRISHWHDDALLKIERISWIISPSDTIP  482

Query  1255  NDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMA  1076
              D PSLWVS E DP+NWHVQVFRSIDSGSLKGFPK  H AE QNLVCAK+LVIDRSIQMA
Sbjct  483   GDHPSLWVSEEDDPENWHVQVFRSIDSGSLKGFPKTAHEAEQQNLVCAKNLVIDRSIQMA  542

Query  1075  YIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYI  896
             YI+AIR AQ+FIYIENQYFLGSSYAWPSYK AGADNLIPMELALKI SKIR +ERF VY+
Sbjct  543   YIQAIRSAQNFIYIENQYFLGSSYAWPSYKNAGADNLIPMELALKIASKIRAKERFTVYV  602

Query  895   VIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNRE  716
             VIPMWPEG P+SA VQ+ILYWQGQT+Q MYEIIA+E+K+ ++E+AHP DYLNFYCLGNRE
Sbjct  603   VIPMWPEGAPNSASVQEILYWQGQTMQTMYEIIAREIKAAQLENAHPTDYLNFYCLGNRE  662

Query  715   EWHEE-SASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSR  539
                EE + S  +     +++ SQK+GRFMIYVHAKGMVVDDEYVI+GSANINQRSMAGSR
Sbjct  663   PHAEESNGSGQSSSSGSYVSASQKAGRFMIYVHAKGMVVDDEYVILGSANINQRSMAGSR  722

Query  538   DTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEI  359
             DTEIAMGAYQPHHTWA+ +  PH QVYGYRMSLWAEH G +D++    EGL+CVK VN +
Sbjct  723   DTEIAMGAYQPHHTWARKKGRPHGQVYGYRMSLWAEHWGRIDQRFKAPEGLDCVKYVNRV  782

Query  358   AEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKV  260
             A +NW RY A+ F+PLQGH+LKYPLQVD+NGK+
Sbjct  783   AADNWMRYIADHFTPLQGHILKYPLQVDANGKM  815



>ref|XP_002270350.2| PREDICTED: phospholipase D delta-like [Vitis vinifera]
Length=872

 Score =  1264 bits (3270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 613/873 (70%), Positives = 721/873 (83%), Gaps = 33/873 (4%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPET---------  2546
             M+D  S+ V+YLHGDLDLKIL+AR LPNMD+V+E +R+ FT  D C+ P           
Sbjct  1     MADTASQRVIYLHGDLDLKILKARDLPNMDLVTEHVRRCFTLCDACKTPSAGKDVSTPDT  60

Query  2545  -------RQGNK-VRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAH  2390
                    + G+K +  H +IITSDPYV VC+  ATVARTRVISN+Q+P W E+F I +AH
Sbjct  61    DDRPARHKPGDKRLDHHRKIITSDPYVTVCVPQATVARTRVISNTQNPYWNENFYISLAH  120

Query  2389  PVSEVEFQVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMM  2210
             PV+ +EFQVKDND+FGA+ IGVA++ A++I +GE I+ WFP+IGA+GK PKP  A+++ +
Sbjct  121   PVANLEFQVKDNDLFGAEVIGVARIPAERIATGEHISGWFPVIGANGKQPKPTTALQIEI  180

Query  2209  KFTPCAENPRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKA  2039
             KFTP  +NP YR G+  D    G++ +YFP+R GG  TLYQDAHVPEG LP+I++D G+ 
Sbjct  181   KFTPFEQNPFYRTGIAGDPEHLGVRHTYFPLRKGGLATLYQDAHVPEGLLPDIEVDGGQV  240

Query  2038  FHHENCWEDICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQE  1859
             + HE CWEDICHAI+EAHHMVYIVGWSIYHKVKL+REPTRPLP GG+L LG+LLKYKS+E
Sbjct  241   YRHETCWEDICHAIVEAHHMVYIVGWSIYHKVKLIREPTRPLPRGGDLTLGDLLKYKSEE  300

Query  1858  GVRVLLLVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQ  1679
             GVRVL+LVWDD+TSH KFFINT GVM THDEETRKFFKHSSV CVL+PRYASSKLSF+KQ
Sbjct  301   GVRVLMLVWDDRTSHDKFFINTKGVMETHDEETRKFFKHSSVICVLSPRYASSKLSFIKQ  360

Query  1678  QVVGTLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDY  1499
             QVVGT++THHQKCV+VD+QA GNNRKITAF+GG+DLCDGRYDTP+HRLF D DTVF  D+
Sbjct  361   QVVGTIFTHHQKCVLVDSQAHGNNRKITAFLGGIDLCDGRYDTPEHRLFKDLDTVFNEDF  420

Query  1498  NNPTFPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWH  1319
             +NPTFP G  K PRQPWHDLHCKIEGPAAYD+L NFEQRW+KA+KW E G   KKISHWH
Sbjct  421   HNPTFPAGS-KAPRQPWHDLHCKIEGPAAYDVLINFEQRWKKATKWTEFGLHLKKISHWH  479

Query  1318  DDALLKIERISWITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLK  1163
             DDAL+KI+RISWI SP          SVP DDPSLWV+ E DP+NWHVQVFRSIDSGSLK
Sbjct  480   DDALIKIDRISWILSPPSGSDGDDVTSVPKDDPSLWVTKEDDPENWHVQVFRSIDSGSLK  539

Query  1162  GFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKE  983
             GFPK V TAE QNL+CAK+LVID+SIQ AYI+AIR AQHFIYIENQYFLGSSYAWPSYK+
Sbjct  540   GFPKTVDTAENQNLICAKNLVIDKSIQTAYIQAIRSAQHFIYIENQYFLGSSYAWPSYKD  599

Query  982   AGADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYE  803
             AGADNLIPMELALKI SKIR +ERFAVYIVIPMWPEG P S  VQ+IL+WQ QT+QMMYE
Sbjct  600   AGADNLIPMELALKIASKIRAKERFAVYIVIPMWPEGDPKSNTVQEILFWQAQTMQMMYE  659

Query  802   IIAKELKSEKIEDAHPCDYLNFYCLGNREEWHEESA--SSPTPGCSEFLTGSQKSGRFMI  629
             +IAKELKS ++ED+HP DYLNFYCLGNRE   +E +  +SPTP  ++ +  S K  RFMI
Sbjct  660   VIAKELKSMQLEDSHPLDYLNFYCLGNREGVTKEMSEKASPTPANADAVLASAKFRRFMI  719

Query  628   YVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYR  449
             YVHAKGM+VDDEY+I+GSANINQRSMAG++DTEIAMGAYQ HHTWA+ + HPH QVYGYR
Sbjct  720   YVHAKGMIVDDEYLIMGSANINQRSMAGTKDTEIAMGAYQRHHTWAEKKKHPHGQVYGYR  779

Query  448   MSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSN  269
             MSLWAEHLGM+++   E E LECV+ VNE+AEENWKR+TAE+F+PLQGHLLKYP+QVD++
Sbjct  780   MSLWAEHLGMVNKLFKEPENLECVRTVNEMAEENWKRFTAEEFTPLQGHLLKYPMQVDAD  839

Query  268   GKVSPLGGCEYFPDVGGKVLGSR-TTLPDALTT  173
             GKVS   G E FPDVGG  LG   TTLPD+LTT
Sbjct  840   GKVSSKPGHENFPDVGGYALGCHSTTLPDSLTT  872



>ref|XP_011003096.1| PREDICTED: phospholipase D delta-like [Populus euphratica]
Length=833

 Score =  1261 bits (3263),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 607/833 (73%), Positives = 709/833 (85%), Gaps = 17/833 (2%)
 Frame = -2

Query  2662  LHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKP--ETRQGNKVRRHTRIITSDPY  2492
             LHGDLDL+I+EARRLPNMD+VS+R+R+ FT FD CR P  + R+  + RRH +IITSDPY
Sbjct  15    LHGDLDLRIIEARRLPNMDLVSDRLRRCFTVFDTCRDPCSKERKEQQHRRH-KIITSDPY  73

Query  2491  VKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVAKVS  2312
             V V ++GA VARTRVISN+Q+P+W EHFKIP+AHP  ++EF VKD+D+FGA+FIG+A V 
Sbjct  74    VMVGVSGARVARTRVISNNQNPIWNEHFKIPLAHPAEKIEFYVKDDDMFGAEFIGIASVE  133

Query  2311  AQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTEDYGLKESYF  2132
              +KI+SGETI DWFPIIG +GKPPK  CA+ + MKFT C +       +    G++  YF
Sbjct  134   VEKILSGETIKDWFPIIGLYGKPPKTGCALHVEMKFTKCEQ-------IDNKLGVENCYF  186

Query  2131  PMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYIVGWSIY  1952
             P+RHGG VTLYQDAHV + SLPEI++++G +F HE CWEDICHAI+EAHH+VYIVGWSIY
Sbjct  187   PVRHGGNVTLYQDAHVLDSSLPEIELENGNSFRHEKCWEDICHAIVEAHHLVYIVGWSIY  246

Query  1951  HKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTSGVMGTH  1772
             HKV+LVREP++PLP GG+LNLGELLKYKSQEGVRVLLLVWDDKTSH+KFFI T+GVM TH
Sbjct  247   HKVRLVREPSKPLPRGGDLNLGELLKYKSQEGVRVLLLVWDDKTSHNKFFIRTTGVMQTH  306

Query  1771  DEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQGNNRKITA  1592
             DEETRKFFKHSSV CVL+PRY SSKLS  KQQVVGTLYTHHQKCVIVD QA GNNRKITA
Sbjct  307   DEETRKFFKHSSVNCVLSPRYPSSKLSIFKQQVVGTLYTHHQKCVIVDAQASGNNRKITA  366

Query  1591  FIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCKIEGPAA  1412
             FIGGLDLCDGRYDTP+HRLF D DTVF+ DY+NPTFP G + GPRQPWHDLHCKIEGPAA
Sbjct  367   FIGGLDLCDGRYDTPEHRLFQDLDTVFQDDYHNPTFPAGTM-GPRQPWHDLHCKIEGPAA  425

Query  1411  YDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPNDDPSLWV  1232
             YD+LTNFEQRWRKASKW+E GR FK+ + W DD+L+K+ERISWI SP+PSVP DDP LWV
Sbjct  426   YDVLTNFEQRWRKASKWSEFGRSFKRSTPWRDDSLIKLERISWIHSPSPSVPGDDPKLWV  485

Query  1231  SNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRA  1052
             S E DP+NWHVQVFRSIDSGSLKGFPKDV+ A+ QNLVCAK++VID+SIQ AY++AIR A
Sbjct  486   SKEDDPENWHVQVFRSIDSGSLKGFPKDVYRAQKQNLVCAKNMVIDKSIQTAYVQAIRLA  545

Query  1051  QHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEG  872
             QHFIYIENQYFLGSS+AW  YK AGA+NLIPMELALKI SKIR +ERFAVY+VIPMWPEG
Sbjct  546   QHFIYIENQYFLGSSFAWSEYKNAGAENLIPMELALKIASKIRAKERFAVYVVIPMWPEG  605

Query  871   VPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREEWHEESAS  692
              P+SA VQ+IL+WQGQT+QMMYE+IAKELKS  +E++HP DYLNFYCLGNRE+      S
Sbjct  606   APTSASVQEILFWQGQTMQMMYEVIAKELKSMNLENSHPQDYLNFYCLGNREQVPGSDGS  665

Query  691   SPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAY  512
                    + ++ SQ+  RFM+YVHAKGMVVDDEY+I+GSANIN+RSMAGSRDTEIAMGAY
Sbjct  666   G-----DQTVSMSQQFQRFMVYVHAKGMVVDDEYIILGSANINERSMAGSRDTEIAMGAY  720

Query  511   QPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYT  332
             QPHHTW+  + HP  QVYGYRMSLWAEHLG++D    E   L+CVK VN+IAE+NWK++T
Sbjct  721   QPHHTWSNKKRHPLGQVYGYRMSLWAEHLGLVDNLFKEPGSLDCVKSVNKIAEDNWKKFT  780

Query  331   AEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALTT  173
             AE F+ LQGHLLKYP++VD +GKVSPL G E FPDVGGKVLG+RT LPDALTT
Sbjct  781   AEDFTLLQGHLLKYPVEVDGDGKVSPLPGQETFPDVGGKVLGARTNLPDALTT  833



>gb|EPS73398.1| hypothetical protein M569_01343, partial [Genlisea aurea]
Length=846

 Score =  1253 bits (3243),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 618/859 (72%), Positives = 716/859 (83%), Gaps = 36/859 (4%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQGNKVRRHTRIIT  2504
             + + +YLHGDL LKI+EARRLPNMDIV+  +R+ F A   CR+P     +K R+  +I+T
Sbjct  1     NNDTIYLHGDLHLKIIEARRLPNMDIVTSHLRRLFAAMTVCRRPTASDNHKHRK--KIVT  58

Query  2503  SDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGV  2324
             SDPYV VCLA A VARTR+ISNSQ+PVW E FKIPV+HPVS+VEF+VKDNDVFGAD IGV
Sbjct  59    SDPYVTVCLARARVARTRIISNSQNPVWNEDFKIPVSHPVSQVEFEVKDNDVFGADLIGV  118

Query  2323  AKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTEDYGLK  2144
             A VSA++I +G  I +W P+IGA GKP KP+ A+RL ++FTPC++NP +  G+T+DY LK
Sbjct  119   ASVSARRIAAGNLIEEWVPLIGAWGKPHKPNSALRLRIEFTPCSQNPLFLKGITDDYSLK  178

Query  2143  ESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYIVG  1964
             ESYFP+RHG ++TLYQDAH+P+G LPEI +++G  F HE CWEDICHAI+EAHH+VYIVG
Sbjct  179   ESYFPLRHGCSLTLYQDAHLPDGMLPEIPLENGGNFQHEKCWEDICHAIVEAHHLVYIVG  238

Query  1963  WSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTSGV  1784
             WSIYHKV+LVREPTRPLP GG+LNLG+LLKYKSQEGVRVLLLVWDDKTSH+KFFINTSGV
Sbjct  239   WSIYHKVRLVREPTRPLPRGGDLNLGDLLKYKSQEGVRVLLLVWDDKTSHNKFFINTSGV  298

Query  1783  MGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQ------------------VVGTLY  1658
             M THDEET+KFFKHSSVTCVLAPRYASSKLS  KQQ                  VVGT+Y
Sbjct  299   MQTHDEETKKFFKHSSVTCVLAPRYASSKLSIFKQQACNSWDHTNFYLIYIYMLVVGTIY  358

Query  1657  THHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPE  1478
             THHQKCVIVDTQ  GNNRKITAF+GGLDLCDGRYDTP+HRLF D DTVF  DY+NPTF  
Sbjct  359   THHQKCVIVDTQGPGNNRKITAFLGGLDLCDGRYDTPEHRLFRDLDTVFEDDYHNPTFSP  418

Query  1477  GGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKI  1298
              G KGPRQPWHDLHCKIEGPAA+D+L NFEQRW+KA+KW   GRRFKKISHWHDD+LLK+
Sbjct  419   -GTKGPRQPWHDLHCKIEGPAAHDVLANFEQRWKKAAKW---GRRFKKISHWHDDSLLKV  474

Query  1297  ERISWITSPTPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLV  1118
             ERISWI SP+ S PND PSLWV +E DP+NWHVQ+FRSIDSGSLKGFPK    AE QNLV
Sbjct  475   ERISWINSPSSSTPNDHPSLWVCSEDDPENWHVQIFRSIDSGSLKGFPKTAQAAEQQNLV  534

Query  1117  CAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKI  938
              AK+LVID+SIQMAYI+AIR AQH+IYIENQYFLGSSYAWPSYK AGADN IPMELALKI
Sbjct  535   FAKNLVIDKSIQMAYIQAIRSAQHYIYIENQYFLGSSYAWPSYKNAGADNSIPMELALKI  594

Query  937   VSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAH  758
              SKI+++ERFAVYIVIPMWPEG PSSA VQ+ILYWQ QT+QMMYE+IA+ELKS  ++D  
Sbjct  595   ASKIKSKERFAVYIVIPMWPEGSPSSASVQEILYWQTQTMQMMYEVIARELKSGGMKDGR  654

Query  757   PCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVG  578
             P DYLNFYCLGNRE+   ES+     G  E +  S++ GRFMIYVHAKG++VDDEYVI+G
Sbjct  655   PTDYLNFYCLGNREDRSTESS-----GMVESV--SERRGRFMIYVHAKGLIVDDEYVILG  707

Query  577   SANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMM--DEKL  404
             SANINQRSMAGSRDTEIAMG YQPH+TW + + HP  QVYGYRMSLWAEHLG +  +E+L
Sbjct  708   SANINQRSMAGSRDTEIAMGGYQPHYTWRRKKKHPVGQVYGYRMSLWAEHLGTVENEERL  767

Query  403   DEAEGLECVKMVNEIAEENWKRYTAEKFS-PLQGHLLKYPLQVDS-NGKVSPLGGCEYFP  230
              EAE LECV+ VN++AE NW+ YTA K+S PLQGH+LKYP+ VD  +GKVSPL G E FP
Sbjct  768   MEAEDLECVRYVNQVAESNWRIYTAAKYSRPLQGHILKYPITVDGDDGKVSPLVGYENFP  827

Query  229   DVGGKVLGSRTTLPDALTT  173
             DVGGKVLG+ + +PDALTT
Sbjct  828   DVGGKVLGAPSNIPDALTT  846



>ref|XP_010266912.1| PREDICTED: phospholipase D delta [Nelumbo nucifera]
Length=861

 Score =  1245 bits (3221),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 604/844 (72%), Positives = 704/844 (83%), Gaps = 11/844 (1%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAF-DCRKPETRQGNKVRRHTRIIT  2504
             S+ ++YLHGDLDLKIL AR LPNMD++ ER R+ FT    C  P   +  + + H ++IT
Sbjct  21    SDQIIYLHGDLDLKILGARSLPNMDLLFERCRRCFTVCGTCLHPAAPKQPRDQEHRKMIT  80

Query  2503  SDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGV  2324
             SD YV V L+GATVARTRVI NS++P W E F IP+AHP + VEF VKDND+FGA  IGV
Sbjct  81    SDSYVTVSLSGATVARTRVIPNSENPQWNEEFNIPLAHPAAHVEFHVKDNDMFGAQVIGV  140

Query  2323  AKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED---Y  2153
               + AQ+I SGE I++WF +IG  GKPPKP+ A+ L MKFTP   NP YR G+  D    
Sbjct  141   VSIPAQRIKSGELISEWFSVIGPSGKPPKPNSALNLEMKFTPIESNPLYRHGIAADPKHL  200

Query  2152  GLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVY  1973
             G++++YFP+R GG+VTLYQDAHVP+G LPEIK+++G+ F H  CW DICHAILEAHH+VY
Sbjct  201   GVRDTYFPVRKGGSVTLYQDAHVPDGMLPEIKLENGEVFRHNKCWGDICHAILEAHHLVY  260

Query  1972  IVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINT  1793
             IVGWS+YHKVKLVRE TRPLP+GG+L LGELLKYKSQEGVRVLLL+WDDKTSHS   INT
Sbjct  261   IVGWSVYHKVKLVRESTRPLPSGGDLTLGELLKYKSQEGVRVLLLLWDDKTSHSNILINT  320

Query  1792  SGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQG  1613
             +GVM THDEETRKFFKHSSV CVLAPRYASSKLS VKQQVVGTL+THHQKCV+VDTQA G
Sbjct  321   AGVMETHDEETRKFFKHSSVICVLAPRYASSKLSIVKQQVVGTLFTHHQKCVLVDTQASG  380

Query  1612  NNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHC  1433
             NNRKITAFIGGLDLC GRYDTP+HRLFSD DTVFR DY+NPTFP    KGPRQPWHDLHC
Sbjct  381   NNRKITAFIGGLDLCVGRYDTPEHRLFSDLDTVFRDDYHNPTFP-AETKGPRQPWHDLHC  439

Query  1432  KIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPN  1253
             KIEGPAAYD+L NFEQRWRKA+KW E G+RFK++S W DDAL+K+ERISWI SP+P + N
Sbjct  440   KIEGPAAYDVLKNFEQRWRKATKWTEFGKRFKRVSRWDDDALIKLERISWILSPSPYIAN  499

Query  1252  DDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFP-KDVHTAETQNLVCAKDLVIDRSIQMA  1076
             DDP LWVS EGD +NWHVQVFRSIDSGS+KGFP KDV  A  Q L+C K+LVID+SIQ  
Sbjct  500   DDPILWVSKEGDAENWHVQVFRSIDSGSVKGFPTKDVQLAHDQKLICEKNLVIDKSIQTG  559

Query  1075  YIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYI  896
             Y++AIR AQHFIYIENQYFLGSSY WPSYK AGADNLIPMELALKI SKIR +ERFAVYI
Sbjct  560   YVQAIRSAQHFIYIENQYFLGSSYGWPSYKNAGADNLIPMELALKIASKIRVKERFAVYI  619

Query  895   VIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNRE  716
             VIPMWPEG P+ A VQ+ILYWQGQT+QMMYE++AKELKS ++E+++P DYLNFYCLGNRE
Sbjct  620   VIPMWPEGFPTDASVQEILYWQGQTMQMMYEVVAKELKSMQLENSYPQDYLNFYCLGNRE  679

Query  715   EWHE---ESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAG  545
             +  +   ES SS T G +   + +QK+ RFMIYVHAKGM+VDDEYVI+GSANIN+RSM+G
Sbjct  680   QIPKDIPESISSSTNGGAA--SAAQKNRRFMIYVHAKGMIVDDEYVILGSANINERSMSG  737

Query  544   SRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVN  365
             +RDTEIAMGAYQPHHTWA  + HPH QVYGYRMSLWAEHLG+++E   E + LECV+ VN
Sbjct  738   ARDTEIAMGAYQPHHTWAVKKKHPHGQVYGYRMSLWAEHLGVVNESFLEPQRLECVRTVN  797

Query  364   EIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPD  185
              IAE+NWK++TAE+ +PL GHLLKYP+ V+++GKVSPL G E FPDVGGKVLGS T+LPD
Sbjct  798   GIAEDNWKKFTAEEVTPLCGHLLKYPILVEADGKVSPLPGHENFPDVGGKVLGSYTSLPD  857

Query  184   ALTT  173
             ALTT
Sbjct  858   ALTT  861



>ref|XP_009107633.1| PREDICTED: phospholipase D delta-like [Brassica rapa]
Length=833

 Score =  1238 bits (3204),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 600/843 (71%), Positives = 699/843 (83%), Gaps = 12/843 (1%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDC--RKPETRQGNKVRR  2522
             M++     +VYLHGDL+L+I+EAR LPNMD+  ERIR+ F   +   +   + +G+  R 
Sbjct  1     MANVKQSGLVYLHGDLELQIIEARYLPNMDLHFERIRRVFNTLNLFDKHSSSPKGSHRRT  60

Query  2521  HTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFG  2342
                IITSDPYV VCLAGATVARTRVISNSQ+PVW EHFKIP+AHPVS++EF VKDNDVFG
Sbjct  61    RNNIITSDPYVTVCLAGATVARTRVISNSQNPVWSEHFKIPLAHPVSQIEFYVKDNDVFG  120

Query  2341  ADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT  2162
             AD IG+A VS  KI  GETIN WFPIIG+    PKPD A+RL M+F P  +NP Y  G+T
Sbjct  121   ADLIGIATVSTAKIKLGETINGWFPIIGS----PKPDSAVRLEMRFVPYEKNPLYNHGIT  176

Query  2161  EDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHH  1982
                G+   YFP+R GG VTLYQDAHV + ++PEI+++DG  + HE CWEDICH+ILEAHH
Sbjct  177   ST-GVANCYFPVRTGGHVTLYQDAHVHD-NMPEIELEDGVLYQHERCWEDICHSILEAHH  234

Query  1981  MVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFF  1802
             MVY++GWSI+HKVKLVR+ +R LPNGG+L+LG+LLKYKSQEGVRVLLLVWDD+TSHSKFF
Sbjct  235   MVYVIGWSIFHKVKLVRDQSRKLPNGGDLSLGDLLKYKSQEGVRVLLLVWDDRTSHSKFF  294

Query  1801  INTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQ  1622
             INT+GVM THDEETRKFF+ SSVTCVL+PRYASSKLS  KQQVVGT+++HHQKCVIVDTQ
Sbjct  295   INTTGVMQTHDEETRKFFRRSSVTCVLSPRYASSKLSIFKQQVVGTVFSHHQKCVIVDTQ  354

Query  1621  AQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHD  1442
             A GNNRKI AFIGGLDLCDGRYDTP+HRLF   DTVF+GDY+NPTF  GG K PRQPWHD
Sbjct  355   ASGNNRKIAAFIGGLDLCDGRYDTPEHRLFKGLDTVFQGDYHNPTF-SGGTKAPRQPWHD  413

Query  1441  LHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPS  1262
             LHCKIEGPAAYDIL NFEQRW+KA+KW+E+G++FK+++ WHDD+L+K+ERISWI SP+ +
Sbjct  414   LHCKIEGPAAYDILINFEQRWKKATKWSEIGQKFKRVTRWHDDSLIKLERISWILSPSTA  473

Query  1261  VPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQ  1082
             VP +D +LWVS + D QNWHVQVFRSIDSGSLKGFPKDVH A  QNLVCAK+LVI++SIQ
Sbjct  474   VPTND-TLWVSKDDDKQNWHVQVFRSIDSGSLKGFPKDVHKAHAQNLVCAKNLVIEKSIQ  532

Query  1081  MAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAV  902
              AYI+AIR AQHFIYIENQYF+GSS+ WP+YKEAGADNL+P+ELALKI +KIR RERFAV
Sbjct  533   TAYIQAIRSAQHFIYIENQYFIGSSFVWPNYKEAGADNLVPIELALKIATKIRARERFAV  592

Query  901   YIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGN  722
             YIVIPMWPEG PSSAPVQ+ILYWQGQT+QMMYEIIA+E+K   +E+ +P DYLNFYCLGN
Sbjct  593   YIVIPMWPEGDPSSAPVQEILYWQGQTMQMMYEIIAREIKHMDLENVNPQDYLNFYCLGN  652

Query  721   REEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGS  542
             REE   +     + G  E +  SQK GRFMIYVHAKGMVVDDEYV++GSANINQRSMAGS
Sbjct  653   REELPSDQNCVSSSG--EMVPASQKWGRFMIYVHAKGMVVDDEYVLLGSANINQRSMAGS  710

Query  541   RDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNE  362
             RDTEIAMGAYQ H TW     HP  QVYGYRMSLWAEH+G +D+   E E LECVK VN 
Sbjct  711   RDTEIAMGAYQNHQTWGHRNKHPRGQVYGYRMSLWAEHMGKIDDIFKEPETLECVKRVNM  770

Query  361   IAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDA  182
             I+E+NWK+YT + F PLQGHLLKYPL VD  GKV PL G   FPDVGGK+LG+RT LPD 
Sbjct  771   ISEDNWKKYTDDSFVPLQGHLLKYPLSVDHTGKVIPLSGFNSFPDVGGKILGTRTNLPDV  830

Query  181   LTT  173
             LTT
Sbjct  831   LTT  833



>emb|CDY35793.1| BnaA08g04540D [Brassica napus]
Length=865

 Score =  1222 bits (3161),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/837 (71%), Positives = 694/837 (83%), Gaps = 12/837 (1%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDC--RKPETRQGNKVRR  2522
             M++     +VYLHGDL+L+I+EAR LPNMD+  ERIR+ F   +   +   + +G+  R 
Sbjct  1     MANVKQSGLVYLHGDLELQIIEARYLPNMDLHFERIRRVFNTLNLFDKHSSSPKGSHRRT  60

Query  2521  HTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFG  2342
                IITSDPYV VCLAGATVARTRVISNSQ+PVW EHFKIP+AHPVS++EF VKDNDVFG
Sbjct  61    RNNIITSDPYVTVCLAGATVARTRVISNSQNPVWSEHFKIPLAHPVSQIEFYVKDNDVFG  120

Query  2341  ADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT  2162
             AD IG+A VS  KI  GETIN WFPIIG+    PKPD A+RL M+F P  +NP Y  G+T
Sbjct  121   ADLIGIATVSTAKIKLGETINGWFPIIGS----PKPDSAVRLEMRFVPYEKNPLYNHGIT  176

Query  2161  EDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHH  1982
                G+   YFP+R GG VTLYQDAHV + ++PEI+++DG  + HE CWEDICH+ILEAHH
Sbjct  177   ST-GVANCYFPVRTGGHVTLYQDAHVHD-NMPEIELEDGVLYQHERCWEDICHSILEAHH  234

Query  1981  MVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFF  1802
             MVY++GWSI+HKVKLVR+ +R LPNGG+L+LG+LLKYKSQEGVRVLLLVWDD+TSHSKFF
Sbjct  235   MVYVIGWSIFHKVKLVRDQSRKLPNGGDLSLGDLLKYKSQEGVRVLLLVWDDRTSHSKFF  294

Query  1801  INTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQ  1622
             INT+GVM THDEETRKFF+ SSVTCVL+PRYASSKLS  KQQVVGT+++HHQKCVIVDTQ
Sbjct  295   INTTGVMQTHDEETRKFFRRSSVTCVLSPRYASSKLSIFKQQVVGTVFSHHQKCVIVDTQ  354

Query  1621  AQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHD  1442
             A GNNRKI AFIGGLDLCDGRYDTP+HRLF   DTVF+GDY+NPTF  GG K PRQPWHD
Sbjct  355   ASGNNRKIAAFIGGLDLCDGRYDTPEHRLFKGLDTVFQGDYHNPTF-SGGTKAPRQPWHD  413

Query  1441  LHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPS  1262
             LHCKIEGPAAYDIL NFEQRW+KA+KW+E+G++FK+++ WHDD+L+K+ERISWI SP+ +
Sbjct  414   LHCKIEGPAAYDILINFEQRWKKATKWSEIGQKFKRVTRWHDDSLIKLERISWILSPSTA  473

Query  1261  VPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQ  1082
             VP +D +LWVS + D QNWHVQVFRSIDSGSLKGFPKDVH A  QNLVCAK+LVI++SIQ
Sbjct  474   VPTND-TLWVSKDDDKQNWHVQVFRSIDSGSLKGFPKDVHKAHAQNLVCAKNLVIEKSIQ  532

Query  1081  MAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAV  902
              AYI+AIR AQHFIYIENQYF+GSS+ WP+YKEAGADNL+P+ELALKI +KIR RERFAV
Sbjct  533   TAYIQAIRSAQHFIYIENQYFIGSSFVWPNYKEAGADNLVPIELALKIATKIRARERFAV  592

Query  901   YIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGN  722
             YIVIPMWPEG PSSAPVQ+ILYWQGQT+QMMYEIIA+E+K   +E+ +P DYLNFYCLGN
Sbjct  593   YIVIPMWPEGDPSSAPVQEILYWQGQTMQMMYEIIAREIKHMDLENVNPQDYLNFYCLGN  652

Query  721   REEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGS  542
             REE   +     + G  E +  SQK GRFMIYVHAKGMVVDDEYV++GSANINQRS+AGS
Sbjct  653   REELPSDQNCVSSSG--EMVPASQKWGRFMIYVHAKGMVVDDEYVLLGSANINQRSIAGS  710

Query  541   RDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNE  362
             RDTEIAMGAYQ H TW+    HP  QVYGYRMSLWAEH+G +D+   E E LECVK VN 
Sbjct  711   RDTEIAMGAYQNHQTWSHRSKHPRGQVYGYRMSLWAEHMGKIDDIFKEPETLECVKRVNM  770

Query  361   IAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTL  191
             I+E+NWK+YT + F PLQGHLLKYPL VD  GKV PL G   FPDVGGK+LG++  L
Sbjct  771   ISEDNWKKYTDDSFVPLQGHLLKYPLSVDHTGKVIPLSGFNSFPDVGGKILGTQRLL  827



>ref|XP_010266062.1| PREDICTED: phospholipase D delta-like [Nelumbo nucifera]
Length=863

 Score =  1219 bits (3155),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 593/858 (69%), Positives = 703/858 (82%), Gaps = 16/858 (2%)
 Frame = -2

Query  2704  DVKMSDGMSEN-VVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQGNK  2531
             +V+ S  M+ N ++YLHGDL LKI+ A  LPNMD++SER+R+ FTA D CR P   + +K
Sbjct  8     NVEDSASMASNQIIYLHGDLKLKIVNAENLPNMDLISERLRRCFTACDTCRHPSASEDSK  67

Query  2530  VRRHTR-IITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDN  2354
              RRH R IITSDPYV V LAGATVARTRVI NSQDP W E F I +AHP + VEF VKDN
Sbjct  68    QRRHHRKIITSDPYVTVSLAGATVARTRVIPNSQDPCWNEEFNISLAHPTANVEFHVKDN  127

Query  2353  DVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYR  2174
             D+FGA  IGV  VSAQ+IISGE IN+ F +IG +GKPPKP   + L M+FTP   NP YR
Sbjct  128   DIFGAQLIGVVLVSAQRIISGEFINEPFSVIGPNGKPPKPGSVLYLQMQFTPVETNPLYR  187

Query  2173  GGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICH  2003
              G+  D    G++ +YFP++ GG+VTLYQDAHVP+G LPEI++++G  F    CWEDICH
Sbjct  188   HGIAADPDHLGVRHTYFPLKKGGSVTLYQDAHVPDGKLPEIELENGNIFRQGKCWEDICH  247

Query  2002  AILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDK  1823
             AI+EAHH++YIVGWS+YHKVKL+REPT+PLP  G+L LGELL+YKSQEGVRVLLLVWDDK
Sbjct  248   AIVEAHHLIYIVGWSVYHKVKLLREPTQPLPRSGDLTLGELLRYKSQEGVRVLLLVWDDK  307

Query  1822  TSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQK  1643
             TSHS  FINT+GVM THDEET+KFFKHSSV CVL+PRYAS+KLS VKQQVVGTL+THHQK
Sbjct  308   TSHSNLFINTAGVMQTHDEETKKFFKHSSVICVLSPRYASNKLSVVKQQVVGTLFTHHQK  367

Query  1642  CVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKG  1463
             CV+VDTQ  GNNRKITAFIGGLDLCDGRYDTP HRLF D D+VF+ DY+NPTFP  G K 
Sbjct  368   CVLVDTQGPGNNRKITAFIGGLDLCDGRYDTPDHRLFRDLDSVFQDDYHNPTFP-AGTKA  426

Query  1462  PRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISW  1283
             PRQPWHDLHCKIEGP AYD+L NFEQRWR+A KW+E GRRFK++SHWHDD+L+KIERISW
Sbjct  427   PRQPWHDLHCKIEGPVAYDVLKNFEQRWRRARKWSEFGRRFKRVSHWHDDSLIKIERISW  486

Query  1282  ITSP-----TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFP-KDVHTAETQNL  1121
             I SP     + SV  DD +LWVS E DP+ WHVQVFRSIDSGSLKGFP K+VH A  QNL
Sbjct  487   ILSPRGDPNSQSVSPDDSTLWVSGEDDPETWHVQVFRSIDSGSLKGFPTKNVHQAHEQNL  546

Query  1120  VCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALK  941
             VC K+LVI++SIQ AYI+AIR AQHFIYIENQYF+GSSY WPSYK AGADNLIPMELALK
Sbjct  547   VCEKNLVIEKSIQTAYIQAIRSAQHFIYIENQYFVGSSYGWPSYKSAGADNLIPMELALK  606

Query  940   IVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDA  761
             I SKIR +ERFAVY+VIPMWPEG+P+SA VQ+ILYWQGQT+QMMYEIIAKELKS ++E++
Sbjct  607   IASKIRAKERFAVYVVIPMWPEGIPTSASVQEILYWQGQTMQMMYEIIAKELKSVQLENS  666

Query  760   HPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGS--QKSGRFMIYVHAKGMVVDDEYV  587
                DYLNFYCLG REE  ++   S +   +   T S  Q+S RFMIYVHAKGM+VDDEYV
Sbjct  667   QVNDYLNFYCLGKREELPKDMLGSSSLASTNGDTASAAQRSRRFMIYVHAKGMIVDDEYV  726

Query  586   IVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEK  407
             I+GSANIN+RS+AG+RDTEIAMGAYQPHHTWA  +  P  Q++GYRMSLW EHLG++ + 
Sbjct  727   ILGSANINERSLAGNRDTEIAMGAYQPHHTWAV-KKRPRGQIHGYRMSLWVEHLGVVKDC  785

Query  406   LDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPD  227
               E E ++CV+ VN +AE+NWK++TAE+ + ++ HLL+YP+QV+++GKV PL G E FPD
Sbjct  786   FLEPESVDCVRTVNSMAEDNWKKFTAEEVTEMRAHLLRYPIQVEADGKVGPLPGYENFPD  845

Query  226   VGGKVLGSRTTLPDALTT  173
             VGGKVLG+ T+LPDALTT
Sbjct  846   VGGKVLGNYTSLPDALTT  863



>emb|CBI18911.3| unnamed protein product [Vitis vinifera]
Length=823

 Score =  1217 bits (3150),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 610/866 (70%), Positives = 695/866 (80%), Gaps = 77/866 (9%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQGNKVRRHTRIIT  2504
             SE +VYLHGDLDL I+EAR LPNMD++SERIR+ FTAFD CR P +  G K  RH +IIT
Sbjct  5     SETIVYLHGDLDLNIIEARYLPNMDLMSERIRRCFTAFDSCRAPFS-GGRKKGRHHKIIT  63

Query  2503  SDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGV  2324
             SDPYV VCLAGATVARTRVISNSQ PVW EH KIP+AHPVS VEFQVKDNDVFGAD IG 
Sbjct  64    SDPYVTVCLAGATVARTRVISNSQHPVWNEHLKIPLAHPVSCVEFQVKDNDVFGADMIGT  123

Query  2323  AKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTEDYGLK  2144
             A VSA++I                                             T+ +G+K
Sbjct  124   ATVSAERI--------------------------------------------RTDHFGVK  139

Query  2143  ESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYIVG  1964
             +SYFP+R GG+VTLYQDAHVP G LPE+++DDG  + H  CWEDICH+ILEAHH+VYIVG
Sbjct  140   QSYFPVRLGGSVTLYQDAHVPNGMLPELELDDGVVYQHGKCWEDICHSILEAHHLVYIVG  199

Query  1963  WSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTSGV  1784
             WS+YHKVKLVREPTRPLP+GGNLNLGELLKYKSQEGVRVLLLVWDDKTSHS+F +NT GV
Sbjct  200   WSVYHKVKLVREPTRPLPSGGNLNLGELLKYKSQEGVRVLLLVWDDKTSHSRFLVNTVGV  259

Query  1783  MGTHDEETRKFFKHSSVTCVLAPRYASS-KLSFVKQQ-----------------------  1676
             M THDEETRKFFKHSSV CVL+PRYAS  K    K++                       
Sbjct  260   MQTHDEETRKFFKHSSVLCVLSPRYASKRKFKIAKERVGPDGAFIFYQVGWQRWTSHLGI  319

Query  1675  -----VVGTLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVF  1511
                  VVGTL+THHQKCVIVDTQA GNNRKITAF+GGLDLCDGRYDTP+HRL  D DTVF
Sbjct  320   PTYISVVGTLFTHHQKCVIVDTQASGNNRKITAFLGGLDLCDGRYDTPEHRLCHDLDTVF  379

Query  1510  RGDYNNPTFPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKI  1331
             + DY+NPTF     KGPRQPWHDLHCKIEGPAAYD+LTNFEQRWRKA+KW+E GRRFK+I
Sbjct  380   QNDYHNPTFSAVS-KGPRQPWHDLHCKIEGPAAYDVLTNFEQRWRKATKWSEFGRRFKRI  438

Query  1330  SHWHDDALLKIERISWITSPTPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPK  1151
             +HWH+DAL+K+ERISWI SP+PSVP DDPSLWVS E DP+NWHVQVFRSIDSGSL+GFPK
Sbjct  439   THWHEDALIKLERISWILSPSPSVPYDDPSLWVSEENDPENWHVQVFRSIDSGSLRGFPK  498

Query  1150  DVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGAD  971
             DV +AE QNLVCAK+LVID+SIQ AYI+AIR AQHFIYIENQYF+GSSYAWPSYK AGAD
Sbjct  499   DVPSAEAQNLVCAKNLVIDKSIQTAYIQAIRSAQHFIYIENQYFIGSSYAWPSYKNAGAD  558

Query  970   NLIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAK  791
             NLIPMELALKI SKIR +ERF+VY+VIPMWPEG PS A VQ+IL+WQGQT+QMMY+IIA+
Sbjct  559   NLIPMELALKIASKIRAKERFSVYVVIPMWPEGNPSCASVQEILFWQGQTMQMMYDIIAQ  618

Query  790   ELKSEKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKG  611
             EL+S ++EDAHP DYLNFYCLGNREE  +E +SS T   S+ ++ S+K  RFMIYVHAKG
Sbjct  619   ELQSMQLEDAHPQDYLNFYCLGNREEPPKEVSSSNTQA-SDGVSTSKKFHRFMIYVHAKG  677

Query  610   MVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAE  431
             M+VDDEYVI+GSANINQRSMAGSRDTEIAMGAYQP HTWAK + HPH Q+YGYRMSLWAE
Sbjct  678   MIVDDEYVILGSANINQRSMAGSRDTEIAMGAYQPRHTWAKKKKHPHGQIYGYRMSLWAE  737

Query  430   HLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPL  251
             HLGM++    E + L+CVK VN++AEENWKR+T++ ++PLQGHLLKYP+QVD +GKV PL
Sbjct  738   HLGMINNSFKEPQTLDCVKNVNKMAEENWKRFTSDAYTPLQGHLLKYPIQVDVDGKVRPL  797

Query  250   GGCEYFPDVGGKVLGSRTTLPDALTT  173
              G E FPD GGKVLG+R  LPDALTT
Sbjct  798   PGHETFPDFGGKVLGTRCNLPDALTT  823



>ref|XP_009386169.1| PREDICTED: phospholipase D delta-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=858

 Score =  1205 bits (3117),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 584/844 (69%), Positives = 683/844 (81%), Gaps = 12/844 (1%)
 Frame = -2

Query  2677  ENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTA-------FDCRKPETRQGNKVRRH  2519
             + VV LHGDL L ++EARRLPNMD+ SE +R+ FT+       + C     +Q +    H
Sbjct  16    DGVVLLHGDLVLTVIEARRLPNMDMFSEHLRRCFTSCGPPFSNYSCGAVRHQQHHHHHHH  75

Query  2518  TRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGA  2339
              +IITSDPYV  CLA ATVARTRVISNS+DP+W EHFKIP+AH  + +   VKDNDVFGA
Sbjct  76    RKIITSDPYVTACLAEATVARTRVISNSEDPIWNEHFKIPLAHRAAALVLHVKDNDVFGA  135

Query  2338  DFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT-  2162
               IG   V   +I SG+ I  WFPI+GA+GKP K D A+ L M+FT   + P Y+ G+T 
Sbjct  136   QLIGTVSVPTARIASGKKIQGWFPILGANGKPYKRDTALHLSMEFTAVEKKPEYQHGITG  195

Query  2161  --EDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEA  1988
               E  G++++YFP+R GG+VTLYQDAHV EG LPE+ ++ G  F HENCWEDICHAILEA
Sbjct  196   DPEKLGVRDTYFPLRQGGSVTLYQDAHVREGELPEVNLEKGAMFKHENCWEDICHAILEA  255

Query  1987  HHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSK  1808
             HHM+Y+VGWSIYHKVKLVREPTRPLPNGG L LG+LLKYKSQEGVRV +LVWDDKTSH K
Sbjct  256   HHMIYLVGWSIYHKVKLVREPTRPLPNGGALTLGDLLKYKSQEGVRVCMLVWDDKTSHDK  315

Query  1807  FFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVD  1628
              F+ T GVM THDEETRKFFKHSSV CVL+PRYASSKLS VKQQVVGTL+THHQKCV+VD
Sbjct  316   LFLKTGGVMQTHDEETRKFFKHSSVICVLSPRYASSKLSIVKQQVVGTLFTHHQKCVLVD  375

Query  1627  TQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPW  1448
             TQA GN RKITAFIGGLDLCDGRYDTP HRLF D DTVF  D +NPTF   G KGPRQPW
Sbjct  376   TQASGNKRKITAFIGGLDLCDGRYDTPDHRLFCDMDTVFLNDIHNPTF-AAGTKGPRQPW  434

Query  1447  HDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPT  1268
             HDLHCKIEGPAAYDIL NFEQRWRKA+KW E   RF+K S WHDDAL+ +ERISWI SP+
Sbjct  435   HDLHCKIEGPAAYDILKNFEQRWRKATKWREFSLRFRKASRWHDDALIHLERISWILSPS  494

Query  1267  PSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRS  1088
              SVP+ DPSLWVS E DP+NWHVQ+FRSIDSGS+KGFP +V  +   NLVC K+LVID+S
Sbjct  495   LSVPDGDPSLWVSQEEDPENWHVQIFRSIDSGSVKGFPSNVQESLKMNLVCRKNLVIDKS  554

Query  1087  IQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERF  908
             I  AY++AIR AQHFIYIENQYFLGSS+AWPSYK +GADNLIP+ELALKI SKIR +ERF
Sbjct  555   IHTAYVKAIRSAQHFIYIENQYFLGSSFAWPSYKNSGADNLIPVELALKIASKIRAKERF  614

Query  907   AVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCL  728
             AVY+VIPMWPEG P+S  VQ+IL+WQGQT++MMYEI+A+ELKS  +E+AHP D+LNFYCL
Sbjct  615   AVYVVIPMWPEGDPTSNAVQEILFWQGQTMKMMYEIVAQELKSMNLENAHPQDFLNFYCL  674

Query  727   GNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMA  548
             GNRE   +E+    +   S  ++ SQK  RFMIYVHAKGM+VDDEYV++GSANINQRS+A
Sbjct  675   GNREIAPKENLQQQSLDKSP-MSLSQKFRRFMIYVHAKGMIVDDEYVMIGSANINQRSLA  733

Query  547   GSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMV  368
             GSRDTEIAMGAYQP+HTW KN+ HPH QVYGYRMSLWAEHLGM+D++ ++ +  ECV  V
Sbjct  734   GSRDTEIAMGAYQPNHTWTKNKRHPHGQVYGYRMSLWAEHLGMVDDRFEKPDSTECVNFV  793

Query  367   NEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLP  188
             N IAE+NW RYTA++  PL+GHLLKYP++VDS+GKV PL   EYFPDVGGK+LG+ T LP
Sbjct  794   NRIAEDNWSRYTADEIIPLKGHLLKYPIKVDSDGKVRPLPNHEYFPDVGGKILGAPTALP  853

Query  187   DALT  176
             D LT
Sbjct  854   DTLT  857



>ref|XP_004287764.1| PREDICTED: phospholipase D delta-like [Fragaria vesca subsp. 
vesca]
Length=856

 Score =  1204 bits (3116),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 582/862 (68%), Positives = 693/862 (80%), Gaps = 27/862 (3%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDC--------RKPETRQ  2540
             M+D  SE ++YLHGDLDL+I+EARRLPNMDIVSER R+ FTA D            ++ +
Sbjct  1     MADPTSEQIIYLHGDLDLQIIEARRLPNMDIVSERFRRCFTACDTINCGSHSEEAQQSAE  60

Query  2539  GNKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVK  2360
               K+  H ++ITSD YV VC+  ATVARTRVI N+Q+P W E F IP+AHPV+++EFQVK
Sbjct  61    DGKISHHRKLITSDSYVSVCVPQATVARTRVIKNAQNPQWGETFCIPLAHPVAKLEFQVK  120

Query  2359  DNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPR  2180
             DNDVFGA  IG A +SA KI +GE I+ WF I+G  GKPPKP CAI + +KFTP  +NP 
Sbjct  121   DNDVFGAQIIGTASISAAKIATGEVISGWFDIVGPAGKPPKPQCAINVELKFTPVEKNPA  180

Query  2179  YRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDI  2009
             Y+ G+  D    G+  +YFP+R G  V LYQDAHVPEG LP+I++D  K +  ENCWEDI
Sbjct  181   YKHGIAGDPERKGVPNTYFPLRKGSHVRLYQDAHVPEGLLPQIELDGRKVYKSENCWEDI  240

Query  2008  CHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWD  1829
             C+AI EAHHM+Y+ GWSIYHKV+LVREP+RPLP GG L LG++LKYKS+EGVRVL+LVWD
Sbjct  241   CYAISEAHHMIYVAGWSIYHKVRLVREPSRPLPRGGELTLGDMLKYKSEEGVRVLMLVWD  300

Query  1828  DKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHH  1649
             DKTSH KF++ ++G+MGTHDEETRKFFK+SSVTCVLAPRYASSKLS +KQQVVGTL+THH
Sbjct  301   DKTSHDKFYLKSAGMMGTHDEETRKFFKNSSVTCVLAPRYASSKLSIMKQQVVGTLFTHH  360

Query  1648  QKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGL  1469
             QKCVIVDTQA GNNRKIT+F+GGLDLCDGRYDTP+HRLF D DTVF+ D++ PTFP  G 
Sbjct  361   QKCVIVDTQASGNNRKITSFLGGLDLCDGRYDTPEHRLFRDVDTVFKEDFHQPTFP-AGT  419

Query  1468  KGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERI  1289
             K PRQPWHDLHC+I+GPAAYD+L NFEQRWRKA++W E G R KK+SHWHDDAL+KI RI
Sbjct  420   KAPRQPWHDLHCRIDGPAAYDVLINFEQRWRKATQWREFGLR-KKVSHWHDDALIKIGRI  478

Query  1288  SWITSPT---------PSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTA  1136
             SWI SP            +P +D ++WV  E DP+NWHVQ+FRSIDSGSLKGFPKDV  A
Sbjct  479   SWILSPEIPVSKDSKFTVIPKNDTAVWVQREDDPENWHVQIFRSIDSGSLKGFPKDVIVA  538

Query  1135  ETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPM  956
             E+QNL+C+KDLVID+SIQ AYI+AIR AQHFIYIENQYFLGSSYAWP YK AGADNLIPM
Sbjct  539   ESQNLICSKDLVIDKSIQTAYIKAIRSAQHFIYIENQYFLGSSYAWPDYKNAGADNLIPM  598

Query  955   ELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSE  776
             ELALKI SKIR  ERFAVY+V+PMWPEG P +A +Q+ILYWQ QT+Q MY+++A+ELK+ 
Sbjct  599   ELALKIASKIRANERFAVYVVLPMWPEGDPKTAAMQEILYWQSQTMQAMYDVVARELKAL  658

Query  775   KIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDD  596
             +++  HP DYLNFYCLGNRE+  EE    P+      ++ + K  RFMIYVHAKGM+VDD
Sbjct  659   QLKGVHPQDYLNFYCLGNREKLSEE----PSNINGSTISDAYKYQRFMIYVHAKGMIVDD  714

Query  595   EYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMM  416
             EYVIVGSANINQRSMAG++DTEIAMG+YQPHHTWA+ + HP  Q+YGYRMSLWAEHLGM 
Sbjct  715   EYVIVGSANINQRSMAGTKDTEIAMGSYQPHHTWAEKKRHPCGQIYGYRMSLWAEHLGMF  774

Query  415   DEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEY  236
             D    EA  LE V+ VN IAEENWKRYT+  F+ LQGHLL+YPL VD++GKV PL G E 
Sbjct  775   DPCFKEAGSLETVRTVNGIAEENWKRYTSPDFTELQGHLLRYPLLVDADGKVKPLPGYEI  834

Query  235   FPDVGGKVLGSRT-TLPDALTT  173
             FPDVGGKV+G+ + TLPD LTT
Sbjct  835   FPDVGGKVIGAHSATLPDQLTT  856



>ref|XP_010941358.1| PREDICTED: phospholipase D delta-like isoform X1 [Elaeis guineensis]
Length=875

 Score =  1201 bits (3108),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 593/876 (68%), Positives = 682/876 (78%), Gaps = 37/876 (4%)
 Frame = -2

Query  2722  PFCIISDVKMSDGMS-----ENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCR  2558
             P   I   +M+ G       E  V LHGDLDL IL+ARRLPNMD+ SE +R+ F A  CR
Sbjct  9     PTSAIPTAEMTAGADGCFSEEQTVLLHGDLDLWILKARRLPNMDMFSEHLRRCFVA--CR  66

Query  2557  KPETRQGNKVRR----------HTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHF  2408
              P      +  R          H +IITSDPYV + LAGATVARTRVISNS+DP W EHF
Sbjct  67    PPSPSSCTRFHRPHHHDHHHHHHRKIITSDPYVTISLAGATVARTRVISNSEDPNWNEHF  126

Query  2407  KIPVAHPVSEVEFQVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDC  2228
             KIP+AH    ++F VKDNDVFGA  IG   + A  + SGE + DWFPI+   GKPPKP+ 
Sbjct  127   KIPLAHRSRFIDFHVKDNDVFGAQLIGTVSIPATLVASGELVRDWFPILDPSGKPPKPET  186

Query  2227  AIRLMMKFTPCAENPRYRGGVT---EDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIK  2057
             A+ + +++ P   NP Y  G+    E  G++++YFPMR GG VTLYQDAHV EG LPEI+
Sbjct  187   ALLVSLQYKPVGSNPIYDHGIPGDPEKLGVRDTYFPMRKGGLVTLYQDAHVREGELPEIE  246

Query  2056  IDDGKAFHHENCWEDICHAILEAHHMVYIVGWSIYHKVKLVREPTRplp-nggnlnlgel  1880
             ++ G  F H  CWEDICHAILEAHH++YIVGWS+YHKVKLVREPTRPLP    N  LGEL
Sbjct  247   LEKGTKFEHNRCWEDICHAILEAHHLIYIVGWSVYHKVKLVREPTRPLPPEVENFTLGEL  306

Query  1879  LKYKSQEGVRVLLLVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASS  1700
             LKYKSQEGVRV LLVWDDKTSH K    T GVM THDE+TRKFFKHSSV CVL+PRYASS
Sbjct  307   LKYKSQEGVRVCLLVWDDKTSHDKLCFKTEGVMQTHDEDTRKFFKHSSVICVLSPRYASS  366

Query  1699  KLSFVKQQVVGTLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRD  1520
             KLS  KQQVVGTL+THHQKCV+VDTQA  NNRKI+AFIGGLDLCDGRYDTPQHR+FSD D
Sbjct  367   KLSIFKQQVVGTLFTHHQKCVLVDTQASLNNRKISAFIGGLDLCDGRYDTPQHRIFSDLD  426

Query  1519  TVFRGDYNNPTFPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRF  1340
             +VF  D++NPTFP    KGPRQPWHDLHCKIEGPAAYD+LTNFEQRWRKA+KW E G RF
Sbjct  427   SVFLNDFHNPTFP-AVTKGPRQPWHDLHCKIEGPAAYDVLTNFEQRWRKATKWREFGERF  485

Query  1339  KKISHWHDDALLKIERISWITSPTPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKG  1160
             K++SHW DDAL+K+ERISWI SP+ +VPN+DPSLWVS E D + WHVQ+FRSIDSGS+KG
Sbjct  486   KRVSHWSDDALIKLERISWILSPSSTVPNNDPSLWVSKEEDSETWHVQIFRSIDSGSVKG  545

Query  1159  FPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEA  980
             FPKDVH A  +NLVC K+LVID+SI  AY++AIR AQHFIYIENQYFLGSSY WPSYK A
Sbjct  546   FPKDVHEALEKNLVCQKNLVIDKSIHTAYVKAIRSAQHFIYIENQYFLGSSYGWPSYKNA  605

Query  979   GADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEI  800
             GADNLIPMELALK+ SKIR  ERFAVYIVIPMWPEGVP++A VQ+IL+WQGQTIQMMYEI
Sbjct  606   GADNLIPMELALKVASKIRAGERFAVYIVIPMWPEGVPTAASVQEILFWQGQTIQMMYEI  665

Query  799   IAKELKSEKIEDAHPCDYLNFYCLGNREEW--------HEESASSPTPGCSEFLTGSQKS  644
             I +ELKS  +E+AHP DYLNFYCLGNREE          E S  S    C       QK 
Sbjct  666   IGQELKSMNVENAHPQDYLNFYCLGNREEKPKGDLPLDDEPSEKSAAALC-------QKF  718

Query  643   GRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQ  464
              RFMIYVHAKGM+VDDEYVI+GSANINQRS++GSRDTEIA+GAYQPHH WA+ + HPH Q
Sbjct  719   RRFMIYVHAKGMIVDDEYVILGSANINQRSLSGSRDTEIAVGAYQPHHAWAEKKRHPHGQ  778

Query  463   VYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPL  284
             VYGYRMSLWAEHLGM+D++  E   +ECVK VNEIA+ENW +Y AE+  PL+GHLLKYP+
Sbjct  779   VYGYRMSLWAEHLGMVDDRFKEPNSIECVKFVNEIADENWAKYLAEEVRPLRGHLLKYPI  838

Query  283   QVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALT  176
             +V+ +GKV PL   E FPDVGG++LGS TTLPD LT
Sbjct  839   KVEVDGKVGPLPNQECFPDVGGRILGSPTTLPDTLT  874



>ref|XP_009394033.1| PREDICTED: phospholipase D delta-like [Musa acuminata subsp. 
malaccensis]
Length=853

 Score =  1201 bits (3107),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/848 (69%), Positives = 677/848 (80%), Gaps = 16/848 (2%)
 Frame = -2

Query  2686  GMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFT--AFDCRKPETRQGNKVRRHTR  2513
             G +E  V LHGDL L +++ARRLPNMD+ SERIR+ F   A  C K ++        H R
Sbjct  10    GGTEEDVLLHGDLVLTVIQARRLPNMDMFSERIRRCFAPCATLCTKSDSVAPRDQHHHRR  69

Query  2512  -IITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGAD  2336
              IITSDPYV   LA ATVARTRVISNS+DPVW E FKIP+AH    +   VKD+DVFGA+
Sbjct  70    KIITSDPYVTASLADATVARTRVISNSEDPVWNEQFKIPLAHRAPALVLHVKDDDVFGAE  129

Query  2335  FIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED  2156
              IG   +SA  I SGE I DWFPI+G +G+PPKPD A+ L ++FTP A+ P Y+ G+T D
Sbjct  130   HIGTVSISAVHIASGEKIRDWFPILGPNGEPPKPDTALHLSIEFTPVAKKPEYQHGITGD  189

Query  2155  ---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAH  1985
                 G++++YFP+R GG+V LYQDA V +  LPE++++ G  F HENCWEDICHAILEAH
Sbjct  190   PNKLGVRDTYFPLRRGGSVKLYQDAQVRKDELPEVRLERGAVFKHENCWEDICHAILEAH  249

Query  1984  HMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKF  1805
             H++Y+VGWSIYH++KLVREPTR LPN G L LGELLKYKSQEGVRV +LVWDDKTSH KF
Sbjct  250   HLIYLVGWSIYHEIKLVREPTRSLPNAGKLTLGELLKYKSQEGVRVCMLVWDDKTSHDKF  309

Query  1804  FINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDT  1625
             F+ T GVM THDEETRKFFKHSSV CVL+PRYASSKLS  KQQVVGTL+THHQKCV+VDT
Sbjct  310   FLKTGGVMQTHDEETRKFFKHSSVICVLSPRYASSKLSIFKQQVVGTLFTHHQKCVLVDT  369

Query  1624  QAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWH  1445
             QA GN RKITAFIGGLDLCDGRYDTP+HRLF D DTVF  D +NPTF   G  GPRQPWH
Sbjct  370   QASGNERKITAFIGGLDLCDGRYDTPEHRLFRDLDTVFLNDVHNPTF-SAGTNGPRQPWH  428

Query  1444  DLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTP  1265
             DLHCKIEGPAAYDIL NFEQRWRKA+KW E   RF+K S W DDAL+K+ERISWI SP+P
Sbjct  429   DLHCKIEGPAAYDILKNFEQRWRKATKWREFSLRFRKTSRWQDDALIKLERISWILSPSP  488

Query  1264  SVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSI  1085
             SVP+DDPSLWVS E D  +WHVQVFRSIDSGS+KGFP +V  A   NLVC K+LVID+SI
Sbjct  489   SVPDDDPSLWVSREEDSDHWHVQVFRSIDSGSVKGFPSNVQEAMNVNLVCQKNLVIDKSI  548

Query  1084  QMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFA  905
               AY++AIR AQHFIYIENQYFLGSS+AWPSYK  GADNLIPMELALK+ SKIR  ERFA
Sbjct  549   HTAYVKAIRSAQHFIYIENQYFLGSSFAWPSYKNPGADNLIPMELALKVASKIRANERFA  608

Query  904   VYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLG  725
             VY+V+PMWPEG P+S  VQ+IL+WQGQTIQMMYEI+A+ELKS  +E+AHP DYLNFYCLG
Sbjct  609   VYVVMPMWPEGDPNSNAVQEILFWQGQTIQMMYEIVAQELKSMNLENAHPQDYLNFYCLG  668

Query  724   NREEWHEESASSPTPGCSEFL-----TGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQ  560
             NR    EE+ +       +FL     T SQK  RFMIYVHAKGM+VDDEYVIVGSANINQ
Sbjct  669   NR----EETPADKLQQDDQFLEKSPATLSQKFRRFMIYVHAKGMIVDDEYVIVGSANINQ  724

Query  559   RSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLEC  380
             RS+AGSRDTEIAMGAYQPHHTW KN+ HPH QVYGYRMSLWAEH+GM+D++ +E   LEC
Sbjct  725   RSLAGSRDTEIAMGAYQPHHTWTKNRRHPHGQVYGYRMSLWAEHMGMLDDRFEEPNSLEC  784

Query  379   VKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSR  200
             VK VN+ AE+NW RYTA++ + L GHLL+YP+QV+++G V PL   E FPDVGGKVLG+ 
Sbjct  785   VKFVNKTAEDNWSRYTADEMTALTGHLLRYPIQVEADGNVGPLPNHECFPDVGGKVLGAP  844

Query  199   TTLPDALT  176
               LPD LT
Sbjct  845   NALPDTLT  852



>ref|XP_006828836.1| hypothetical protein AMTR_s00001p00146970 [Amborella trichopoda]
 gb|ERM96252.1| hypothetical protein AMTR_s00001p00146970 [Amborella trichopoda]
Length=856

 Score =  1197 bits (3096),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 589/843 (70%), Positives = 686/843 (81%), Gaps = 7/843 (1%)
 Frame = -2

Query  2683  MSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQGNKVRRHTRII  2507
             +S+ ++ LHGDLDL I EAR LPNMD+ SE +R+  T  + CR P  ++  +  RH +II
Sbjct  15    VSDKIIMLHGDLDLWINEARSLPNMDMFSEHLRKCLTICEPCRAPFEKREKRRHRHRKII  74

Query  2506  TSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIG  2327
             TSDPYV V L GATVARTRVI NSQ+P W EHF IPVAHPVS +EFQVKDND+FGA  IG
Sbjct  75    TSDPYVSVSLGGATVARTRVIPNSQNPEWKEHFLIPVAHPVSRIEFQVKDNDIFGAQLIG  134

Query  2326  VAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGV---TED  2156
             +A VS  K++  ETI++WFPI  ++GKPPKPD A+ L +KF P  +NP YR GV   T+ 
Sbjct  135   IAGVSLHKLVPNETISEWFPIFDSYGKPPKPDSALHLSIKFRPALQNPLYRHGVGAGTDY  194

Query  2155  YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMV  1976
              G+  +YFP+R GG VTLYQDAHV +G LPEIK+D GK F HE CWEDICHAILEAHH++
Sbjct  195   PGVPNTYFPLRRGGLVTLYQDAHVIDGQLPEIKLDGGKMFEHEKCWEDICHAILEAHHLI  254

Query  1975  YIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFIN  1796
             YIVGWS+ HKVKLVREPTRPLP GG+L LG+LLKYKSQEGVRV LLVWDDKTSH K F+ 
Sbjct  255   YIVGWSVNHKVKLVREPTRPLPEGGDLTLGDLLKYKSQEGVRVCLLVWDDKTSHDKLFLR  314

Query  1795  TSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQ  1616
             + GVM THDEETRKFFKHSSV CVL+PRY SSKLS  KQQVVGTL+THHQKCV+VDTQA 
Sbjct  315   SEGVMQTHDEETRKFFKHSSVNCVLSPRYGSSKLSIFKQQVVGTLFTHHQKCVLVDTQAS  374

Query  1615  GNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLH  1436
              N RKITAFIGGLDLCDGRYDTP+HRLF D DTVF+ D++NPTFP G +KGPRQPWHDLH
Sbjct  375   WNKRKITAFIGGLDLCDGRYDTPEHRLFKDLDTVFKDDFHNPTFPVG-VKGPRQPWHDLH  433

Query  1435  CKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVP  1256
             CKI+GPAAYD+LTNFEQRWRKA+K  E GR FK++SHWHDD L+K+ERISWI SP+ SVP
Sbjct  434   CKIDGPAAYDVLTNFEQRWRKATKGWEFGRGFKRVSHWHDDTLIKLERISWIISPSKSVP  493

Query  1255  NDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMA  1076
             N  PSLWVS E DP+ WHVQVFRSIDSGS+ GFP DVH  E QNLVC K+LVID+SI  A
Sbjct  494   NGHPSLWVSKEEDPECWHVQVFRSIDSGSVHGFPNDVHECEAQNLVCEKNLVIDKSIHTA  553

Query  1075  YIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYI  896
             Y++AIR AQHFIYIENQYFLGSSYAWPSY+ AGADNLIPMELALKIV KI+ +ERFAVY+
Sbjct  554   YVKAIRSAQHFIYIENQYFLGSSYAWPSYRNAGADNLIPMELALKIVGKIKAKERFAVYV  613

Query  895   VIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKI-EDAHPCDYLNFYCLGNR  719
             VIP+WPEGVP+SA VQ+IL+WQGQT++MMYEIIA+ LK E + E +HP DYLNF+CLG R
Sbjct  614   VIPIWPEGVPTSASVQEILFWQGQTMEMMYEIIARALKDEGLSESSHPQDYLNFFCLGKR  673

Query  718   EEWHEESASSPTPGCSEFLTG-SQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGS  542
             E    +   +          G +QK  RFMIYVHAKGM+VDDEYVI+GSANIN+RS+AGS
Sbjct  674   EGDPRDMLPTTEQAPDNSAAGLAQKFRRFMIYVHAKGMIVDDEYVILGSANINERSLAGS  733

Query  541   RDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNE  362
             RDTEIAMGAYQPHHTW KN  HP  QVYGYRMSLWAEHLG  ++   E   L CVK VN+
Sbjct  734   RDTEIAMGAYQPHHTWGKNDRHPRGQVYGYRMSLWAEHLGHPEDLFYEPSSLGCVKSVNK  793

Query  361   IAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDA  182
             IAE+NW +YTAE+F  L+GHLLKYP++V+++GK+ PL G E FPDVGG+VLG+ T+LPD 
Sbjct  794   IAEDNWGKYTAEEFVELRGHLLKYPIKVEADGKIGPLPGHENFPDVGGRVLGAHTSLPDT  853

Query  181   LTT  173
             LTT
Sbjct  854   LTT  856



>ref|XP_008811755.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase D delta-like [Phoenix 
dactylifera]
Length=867

 Score =  1196 bits (3094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/853 (69%), Positives = 680/853 (80%), Gaps = 17/853 (2%)
 Frame = -2

Query  2692  SDGMS--ENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCR-------KPETRQ  2540
             SDG S  E  V LHGDLDL ILEARRLPNMD+ SE +R+ FTA  CR         +   
Sbjct  17    SDGCSSKEQSVLLHGDLDLWILEARRLPNMDMFSEHLRRCFTA--CRPPPPPPASAQRPH  74

Query  2539  GNKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVK  2360
              +  RRH +IITSDPYV V LA ATVARTRVISNSQDP W EHFKIP+AH    + F+VK
Sbjct  75    HHHHRRHPKIITSDPYVTVSLADATVARTRVISNSQDPKWNEHFKIPLAHRSLFIVFRVK  134

Query  2359  DNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPR  2180
             DNDVFGAD IG   + A  + SGE + DWFP++G  G+P KP+ A+ + +++ P   NP 
Sbjct  135   DNDVFGADLIGTVSIPAALVASGELVRDWFPVLGPSGQPHKPETALLVSLQYKPVGGNPI  194

Query  2179  YRGGVT---EDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDI  2009
             Y  G+    E  G++++YFP+R GG VTLYQDAHV EG LPEI+++ G  F H  CWEDI
Sbjct  195   YDHGIPGDPEKLGVRDTYFPIREGGLVTLYQDAHVREGELPEIELEKGTKFEHNRCWEDI  254

Query  2008  CHAILEAHHMVYIVGWSIYHKVKLVREPTRplp-nggnlnlgelLKYKSQEGVRVLLLVW  1832
             CHAILEAHH++YIVGWS+Y KVKLVREPTRPLP    N  LGELLKYKSQEGVRV LLVW
Sbjct  255   CHAILEAHHLIYIVGWSVYDKVKLVREPTRPLPPGVENFTLGELLKYKSQEGVRVCLLVW  314

Query  1831  DDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTH  1652
             DDKTSH KF   T GVM THDE+TRKFFKHSSV CVL+PRYASSKLS  KQQVVGTL+TH
Sbjct  315   DDKTSHDKFCFKTEGVMQTHDEDTRKFFKHSSVICVLSPRYASSKLSIFKQQVVGTLFTH  374

Query  1651  HQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGG  1472
             HQKC++VDTQA  NNRKI AFIGGLDLCDGRYDTPQHR+FSD D+VF  D++NPTF    
Sbjct  375   HQKCLLVDTQASRNNRKIAAFIGGLDLCDGRYDTPQHRIFSDLDSVFLNDFHNPTF-AAA  433

Query  1471  LKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIER  1292
              KGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKA+KW E G+RFK++SHW DDAL+K+ER
Sbjct  434   TKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKATKWQEFGKRFKRVSHWSDDALIKLER  493

Query  1291  ISWITSPTPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCA  1112
             ISWI SP+P+VPN+DP LWVS E D +NWHVQ+FRSIDSGS+KGFPKDVH A  +NLVC 
Sbjct  494   ISWILSPSPTVPNNDPKLWVSEEEDSENWHVQIFRSIDSGSVKGFPKDVHEALEKNLVCR  553

Query  1111  KDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVS  932
             K+LVID+SI  AY++AIR AQHFIYIENQYFLGSSY WPSYK AGADNLIPMELALK+ S
Sbjct  554   KNLVIDKSIHTAYVKAIRSAQHFIYIENQYFLGSSYGWPSYKNAGADNLIPMELALKVAS  613

Query  931   KIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPC  752
             KIR  ERFAVYIVIPMWPEGVP++A VQ+IL+WQGQT+QMMYEII +ELKS  +E+AHP 
Sbjct  614   KIRAGERFAVYIVIPMWPEGVPTAASVQEILFWQGQTMQMMYEIIGQELKSMNVENAHPQ  673

Query  751   DYLNFYCLGNREEWHE-ESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGS  575
             DYLNFYCLGNREE  + +      P         QK  RFM+YVHAKGM+VDDEYVI+GS
Sbjct  674   DYLNFYCLGNREELPKGDLPLDDQPSEKSAAALCQKFRRFMVYVHAKGMIVDDEYVILGS  733

Query  574   ANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEA  395
             ANINQRS++GSRDTEIAMGAYQPHHT A+ + HPH QVYGYRMSLWAEHLGM+DE   E 
Sbjct  734   ANINQRSLSGSRDTEIAMGAYQPHHTRAETKRHPHGQVYGYRMSLWAEHLGMVDEHFKEP  793

Query  394   EGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGK  215
               +ECVK VNEIA+ENW RY+AE+  PL GHLLKYP++V+ +GKV PL   E FPDVGG+
Sbjct  794   NSIECVKFVNEIADENWGRYSAEEVRPLTGHLLKYPVKVEVDGKVGPLPNQECFPDVGGR  853

Query  214   VLGSRTTLPDALT  176
             +LGS T+LPD LT
Sbjct  854   ILGSPTSLPDTLT  866



>ref|XP_002301946.1| hypothetical protein POPTR_0002s01750g [Populus trichocarpa]
 gb|EEE81219.1| hypothetical protein POPTR_0002s01750g [Populus trichocarpa]
Length=794

 Score =  1195 bits (3092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/832 (70%), Positives = 676/832 (81%), Gaps = 54/832 (6%)
 Frame = -2

Query  2662  LHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQGNKVRRHTR-IITSDPYV  2489
             LHGDL+LKI+EARRLPNMD+VSER+R+ F+AFD CR P +++  K + H R IITSDPYV
Sbjct  15    LHGDLELKIIEARRLPNMDLVSERLRRCFSAFDPCRHPFSKERKKQQNHRRKIITSDPYV  74

Query  2488  KVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVAKVSA  2309
              VC++GA VARTRVISN+Q+PVW EHFKIP+AHP  +++F VKDND+FGA+ IG A V  
Sbjct  75    TVCVSGARVARTRVISNTQNPVWNEHFKIPLAHPAEKIDFYVKDNDMFGAELIGTASVEV  134

Query  2308  QKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTEDYGLKESYFP  2129
             +KI+SGETI+ WFPIIG +GKPPK DCA+ + M+FT C E P       +  G++  YFP
Sbjct  135   EKILSGETISAWFPIIGLYGKPPKTDCALHVEMRFTKC-EQP------DDKLGVENCYFP  187

Query  2128  MRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYIVGWSIYH  1949
             +RHGG VTLYQDAHVP+  LPEI++++G  F H  CWEDICHAI+EAHH+VYI GWSI+H
Sbjct  188   VRHGGNVTLYQDAHVPDSGLPEIELENGNVFRHGKCWEDICHAIVEAHHLVYIAGWSIFH  247

Query  1948  KVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTSGVMGTHD  1769
             KVKLVREP++PLP GG+LNLGELLKYKSQEGVRVLLLVWDDKTSH+KFF+ T        
Sbjct  248   KVKLVREPSKPLPRGGDLNLGELLKYKSQEGVRVLLLVWDDKTSHNKFFLRT--------  299

Query  1768  EETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQGNNRKITAF  1589
                                            V+GTLYTHHQKCV+VDTQA GNNRKITAF
Sbjct  300   -------------------------------VIGTLYTHHQKCVLVDTQASGNNRKITAF  328

Query  1588  IGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCKIEGPAAY  1409
             IGGLDLCDGRYDTP+HRLF   DTVF+ DY+NPTFP  G KGPRQPWHDLHCKIEGPAAY
Sbjct  329   IGGLDLCDGRYDTPEHRLFRGLDTVFQDDYHNPTFP-AGTKGPRQPWHDLHCKIEGPAAY  387

Query  1408  DILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPNDDPSLWVS  1229
             D+LTNFEQRWRKASKW+E GR FK+ +HW DDAL+K+ERISWI  P+PSVPNDDP+LWVS
Sbjct  388   DVLTNFEQRWRKASKWSEFGRSFKRATHWRDDALIKLERISWILGPSPSVPNDDPTLWVS  447

Query  1228  NEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQ  1049
              E DP+NWHVQVFRSIDSGSLKGFPKDV+ AE QNLVCAK+LVID+SIQ AYI+AIR AQ
Sbjct  448   EEDDPENWHVQVFRSIDSGSLKGFPKDVYQAEKQNLVCAKNLVIDKSIQTAYIQAIRSAQ  507

Query  1048  HFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEGV  869
             HFIYIENQYFLGSS+AW  YK AGA+NLIPMELALKI SKIR +ERFAVY+VIPMWPEGV
Sbjct  508   HFIYIENQYFLGSSFAWSDYKNAGAENLIPMELALKIASKIRAKERFAVYVVIPMWPEGV  567

Query  868   PSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREEWHEESASS  689
             P+SA VQ+IL+WQGQT+QMMYE+IA ELKS  +E++HP DYLNFYCLGNREE    + S 
Sbjct  568   PTSASVQEILFWQGQTMQMMYEVIANELKSMNLENSHPQDYLNFYCLGNREEVPGSNNSG  627

Query  688   PTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQ  509
                   + ++ SQK  RFMIYVHAKGMVVDDEYVI+GSANINQRSMAGSRDTEIAMGAYQ
Sbjct  628   -----DQTVSMSQKFQRFMIYVHAKGMVVDDEYVILGSANINQRSMAGSRDTEIAMGAYQ  682

Query  508   PHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTA  329
             PHHTW+  + HP  QVYGYRMSLWAEHLG++D    E E L+CVK VN+IAE+NWK++TA
Sbjct  683   PHHTWSNKKRHPLGQVYGYRMSLWAEHLGLVDNLFKEPESLDCVKSVNKIAEDNWKKFTA  742

Query  328   EKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALTT  173
             E F+ LQGHLLKYP+QVD NGKVSPL G E FPDVGGKVLG RT LPDALTT
Sbjct  743   ENFTLLQGHLLKYPVQVDGNGKVSPLPGQETFPDVGGKVLGVRTNLPDALTT  794



>ref|XP_006590738.1| PREDICTED: phospholipase D delta-like [Glycine max]
Length=866

 Score =  1192 bits (3083),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 581/871 (67%), Positives = 699/871 (80%), Gaps = 35/871 (4%)
 Frame = -2

Query  2695  MSDGMSEN-VVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRK-----PETRQGN  2534
             M+D   +N V YLHGDLDLKI+EAR LPNMDI SER+R+  TA D  K     P    G+
Sbjct  1     MADTGDDNGVTYLHGDLDLKIIEARHLPNMDIFSERLRRCVTACDTIKFHSDAPAAADGD  60

Query  2533  ------KVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVE  2372
                   +   H RIITSDPYV V +  ATVARTRV+ N+Q+PVW E F IP+AHPV ++E
Sbjct  61    GGSQRTRTHHHRRIITSDPYVTVSVPQATVARTRVLKNAQNPVWKEQFHIPLAHPVVDLE  120

Query  2371  FQVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCA  2192
             F+VKD+DVFGA  +G  KV A++I +G  I++WFP++   GKPPKPD A+ + M+FTP +
Sbjct  121   FRVKDDDVFGAQSMGTVKVPARRIATGAKISEWFPVLLPSGKPPKPDTALHVEMQFTPVS  180

Query  2191  ENPRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPE---GSLPEIKIDDGKAFHH  2030
             EN  Y+ G+  D    G++ +YFP+R G +V LYQDAH  E   G +PEIK+++G  + H
Sbjct  181   ENLLYQRGIAADPEHNGVRHTYFPVRKGSSVRLYQDAHCTESGEGKIPEIKLENGNVYRH  240

Query  2029  ENCWEDICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVR  1850
               CWEDIC+AI EAHHMVY+VGWSIYHKV+LVREPTRPLP GG+L LGELLKYKS+EGVR
Sbjct  241   GKCWEDICYAISEAHHMVYLVGWSIYHKVRLVREPTRPLPRGGDLTLGELLKYKSEEGVR  300

Query  1849  VLLLVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVV  1670
             VLLLVWDDKTSH K F+ T+GVMGTHDEETRKFFKHSSV CVL+PRYASSK+SF+KQQVV
Sbjct  301   VLLLVWDDKTSHDKVFLKTAGVMGTHDEETRKFFKHSSVMCVLSPRYASSKMSFLKQQVV  360

Query  1669  GTLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNP  1490
             GT++THHQKCVIVDTQA GNNRKITAFIGGLDLCDGRYDTP+HRLF + D VF GD++NP
Sbjct  361   GTVFTHHQKCVIVDTQAAGNNRKITAFIGGLDLCDGRYDTPEHRLFRNLDDVFDGDFHNP  420

Query  1489  TFPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDA  1310
             TFP  G + PRQPWHDLHC+I+GPAAYD+L NFEQRWRKA+KW E    FKK S WHDDA
Sbjct  421   TFP-AGTRVPRQPWHDLHCRIDGPAAYDVLINFEQRWRKATKWKEFAILFKKTSQWHDDA  479

Query  1309  LLKIERISWITSPTP-----------SVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLK  1163
             L++IERISWI SP+            +VP DDP +WVS+E DP+NWHVQ+FRSIDSGSLK
Sbjct  480   LIRIERISWILSPSGAATLKDKSDYYTVPEDDPLVWVSSEDDPENWHVQIFRSIDSGSLK  539

Query  1162  GFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKE  983
             GFPK V  A +QNL+CAK+LVID+SIQ AYI+AIR AQHFIYIENQYF+GSSYAWP+YK+
Sbjct  540   GFPKRVDIALSQNLICAKNLVIDKSIQTAYIQAIRSAQHFIYIENQYFIGSSYAWPAYKD  599

Query  982   AGADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYE  803
             AGADNLIPMELALKI SKIR +ERFAVYI++PMWPEG P +  +Q+IL+WQGQT+QMMY+
Sbjct  600   AGADNLIPMELALKIASKIRAKERFAVYIILPMWPEGDPKTGAMQEILFWQGQTMQMMYD  659

Query  802   IIAKELKSEKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYV  623
             ++A+ELKS ++ D HP +YLNFYCLGNRE ++E+S+S  T G    ++ + K  RFMIYV
Sbjct  660   VVARELKSMQLTDVHPQEYLNFYCLGNREHFNEDSSS--TNGAQ--VSTAYKYRRFMIYV  715

Query  622   HAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMS  443
             HAKGM+VDDEYVI+GSANINQRSMAG++DTEIAMGAYQPH+TW+  + HPH Q+YGYRMS
Sbjct  716   HAKGMIVDDEYVIIGSANINQRSMAGTKDTEIAMGAYQPHYTWSAKKRHPHGQIYGYRMS  775

Query  442   LWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGK  263
             LW EHLGM+DE  +E   LECV+ VNEIAE NWK + +E FS LQGHLLKYP+QVDS+GK
Sbjct  776   LWGEHLGMLDETFEEPGRLECVEKVNEIAENNWKLFASEDFSLLQGHLLKYPVQVDSDGK  835

Query  262   VSPLGGCEYFPDVGGKVLGSR-TTLPDALTT  173
             +  L  CE FPD GGK+LG+  TT+PD LTT
Sbjct  836   IRSLPDCENFPDAGGKILGAHSTTIPDILTT  866



>ref|XP_007157859.1| hypothetical protein PHAVU_002G104200g [Phaseolus vulgaris]
 gb|ESW29853.1| hypothetical protein PHAVU_002G104200g [Phaseolus vulgaris]
Length=859

 Score =  1192 bits (3083),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 579/859 (67%), Positives = 691/859 (80%), Gaps = 26/859 (3%)
 Frame = -2

Query  2686  GMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPET-------RQGNKV  2528
             G  + V YLHGDLDLKI+EAR LPNMDI SER+R+  TA D  K  +        Q ++ 
Sbjct  6     GDDKGVTYLHGDLDLKIIEARHLPNMDIFSERLRRCVTACDTIKFHSDDPADGGSQRSRQ  65

Query  2527  RRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDV  2348
               H RIITSDPYV V +  ATVARTRV+ NS +PVW E F IP+AHPV ++EF+VKD+DV
Sbjct  66    HHHRRIITSDPYVAVSVPQATVARTRVLKNSSNPVWNERFHIPLAHPVVDLEFRVKDDDV  125

Query  2347  FGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGG  2168
             FGA  IG  K+ AQ+I +G+ I+ WF ++G  GKP K + A+ + MKFTP  +N  Y+ G
Sbjct  126   FGAQTIGTVKIPAQQIATGQLISGWFSVVGPSGKPVKANTALHVDMKFTPVEKNLLYQRG  185

Query  2167  VTED---YGLKESYFPMRHGGAVTLYQDAHVPE---GSLPEIKIDDGKAFHHENCWEDIC  2006
             +  D    G++ +YFP+R G +V LYQDAH P+   G LPE+K+D+G+ + H  CWEDIC
Sbjct  186   IAADPEHRGVRNTYFPVRKGSSVRLYQDAHCPDSGGGKLPEVKLDNGEVYRHGKCWEDIC  245

Query  2005  HAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDD  1826
             +AI EAHHMVY+VGWSIYHK+KLVREPTRPLP GG+L LGELLKYKS+EGVRVLLLVWDD
Sbjct  246   YAISEAHHMVYLVGWSIYHKIKLVREPTRPLPRGGDLTLGELLKYKSEEGVRVLLLVWDD  305

Query  1825  KTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQ  1646
             KTSH K F+ T+GVM THDEETRKFFKHSSV CVL+PRYASSK+SF+KQQVVGT++THHQ
Sbjct  306   KTSHDKVFLKTTGVMQTHDEETRKFFKHSSVMCVLSPRYASSKMSFLKQQVVGTVFTHHQ  365

Query  1645  KCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLK  1466
             KCVIVDTQA GNNRKITAFIGGLDLCDGRYDTP+HRLF + DTVF GD++NPTFP   L+
Sbjct  366   KCVIVDTQAMGNNRKITAFIGGLDLCDGRYDTPEHRLFRNLDTVFSGDFHNPTFP-AALR  424

Query  1465  GPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERIS  1286
              PRQPWHDLHC+I+GPAAYD+L NFEQRW+KA+KW E    FKK S WHDDAL++IERIS
Sbjct  425   APRQPWHDLHCRIDGPAAYDVLINFEQRWKKATKWREFAILFKKSSQWHDDALIRIERIS  484

Query  1285  WITSPTPS-------VPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQ  1127
             WI SP+ S       VP DDP +WVS+E DP+NWHVQ+FRSIDSGSLKGFPK V  A  Q
Sbjct  485   WILSPSVSTKENYTVVPEDDPLVWVSSEDDPENWHVQIFRSIDSGSLKGFPKHVDVALAQ  544

Query  1126  NLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELA  947
             NL+CAKDLVID+SIQ AYIEAIR AQHFIYIENQYF+GSSYAWPSYK+AGADNLIPMELA
Sbjct  545   NLICAKDLVIDKSIQTAYIEAIRSAQHFIYIENQYFIGSSYAWPSYKDAGADNLIPMELA  604

Query  946   LKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIE  767
             LKI SKIR +ERFAVY+V+PMWPEG P +  +Q+IL+WQGQT+Q MY+ IA+ELK+ +I 
Sbjct  605   LKITSKIRAKERFAVYVVLPMWPEGDPKTGAMQEILFWQGQTMQAMYDTIARELKAMQIS  664

Query  766   DAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYV  587
             D +P DYLNFYCLGNRE+ +EE++S  T G    ++G+ K  RFMIYVHAKGM+VDDEYV
Sbjct  665   DVYPQDYLNFYCLGNREDLNEENSS--TNGAQ--VSGAYKHRRFMIYVHAKGMIVDDEYV  720

Query  586   IVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEK  407
             I+GSANINQRSMAG++DTEIAMGAYQPH+TW+  Q HP  Q+YGYRMSLW EHL M+DE 
Sbjct  721   IIGSANINQRSMAGTKDTEIAMGAYQPHYTWSAKQRHPRGQIYGYRMSLWGEHLDMLDET  780

Query  406   LDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPD  227
              +E E LECV+ VN IAE+NWK +T+E FS LQGHLLKYP+ VDS+GK+  L  CE FPD
Sbjct  781   FEEPESLECVRKVNAIAEDNWKLFTSEDFSLLQGHLLKYPILVDSDGKIKSLSDCENFPD  840

Query  226   VGGKVLGSRTT-LPDALTT  173
              GGK+LG+ +T +PD LTT
Sbjct  841   AGGKILGAHSTAIPDILTT  859



>ref|XP_008242003.1| PREDICTED: phospholipase D delta [Prunus mume]
Length=853

 Score =  1191 bits (3081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 584/860 (68%), Positives = 695/860 (81%), Gaps = 26/860 (3%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDC------RKPETRQGN  2534
             M++   E V YLHGDLDL I+EARRLPNMD+VSER R+ FT  D       R  E+    
Sbjct  1     MAEMTLELVTYLHGDLDLHIIEARRLPNMDLVSERFRRCFTPRDTLTIPHSRHTESDGEE  60

Query  2533  KVRRHTR--IITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVK  2360
                +H+R  IITSD YV V +   TVARTRVI NSQ+P W  HF IP+AHPV  +EFQVK
Sbjct  61    HKPQHSRPKIITSDSYVTVLVPETTVARTRVIKNSQNPKWNAHFFIPLAHPVINLEFQVK  120

Query  2359  DNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPR  2180
             DND+FGA+ IG AK+SA+KI +GE I+ WFPIIG+ G PPKPD AIR+ +KFTP  +NP 
Sbjct  121   DNDLFGAELIGTAKISAEKIATGELISGWFPIIGSSGTPPKPDSAIRVELKFTPFEKNPL  180

Query  2179  YRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDI  2009
             Y+ G+  D    G++ +YFP+R G ++ LYQDAHVP+G LPEI++D  K +  ENCWEDI
Sbjct  181   YKHGIAGDPEHRGVRHTYFPLRKGSSLRLYQDAHVPDGLLPEIELDGRKVYRPENCWEDI  240

Query  2008  CHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWD  1829
             C+AI EAHH++YIVGWS++HKV+L+REP+RPLP GG+L LG+LLKYKS+EGVRVLLLVWD
Sbjct  241   CYAISEAHHLIYIVGWSVFHKVRLIREPSRPLPRGGDLTLGDLLKYKSEEGVRVLLLVWD  300

Query  1828  DKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHH  1649
             DKTSH KFF  T+G+MGTHDEETRKFFKHSSV CVLA RYASSKLS +KQQVVGTL+THH
Sbjct  301   DKTSHDKFFFKTAGMMGTHDEETRKFFKHSSVNCVLATRYASSKLSIIKQQVVGTLFTHH  360

Query  1648  QKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGL  1469
             QKCV+VDTQA+GNNRKITAFIGGLDLCDGRYDTP+HRLF D +TVF+ D++ PTFP  G 
Sbjct  361   QKCVLVDTQARGNNRKITAFIGGLDLCDGRYDTPEHRLFRDLNTVFKDDFHQPTFP-AGT  419

Query  1468  KGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERI  1289
             K PRQPWHDLHC+I+GPAAYD+L NFEQRWRKA++W E G + K+ SHWHDDAL+KI RI
Sbjct  420   KAPRQPWHDLHCRIDGPAAYDVLINFEQRWRKATQWREFGLK-KRASHWHDDALIKINRI  478

Query  1288  SWITSPTPSV-------PNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAET  1130
             SWI SP  SV       P DDP+LWV  E DP++WHVQ+FRSIDSGSLKGFPK +  AE 
Sbjct  479   SWILSPPLSVSKDGTTIPEDDPALWVQREDDPEDWHVQIFRSIDSGSLKGFPKAIPNAEA  538

Query  1129  QNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMEL  950
             QNL+C+K+LVID+SIQ AYI+AIR AQHFIYIENQYFLGSSYAWP Y+ AGADNLIP+EL
Sbjct  539   QNLICSKNLVIDKSIQTAYIQAIRSAQHFIYIENQYFLGSSYAWPDYRNAGADNLIPVEL  598

Query  949   ALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKI  770
             ALKI SKI+ +ERFAVY+V+PMWPEG P SA +Q+IL+WQ QT+Q MY+I+AK LKSE++
Sbjct  599   ALKIASKIKAKERFAVYVVLPMWPEGDPKSAAMQEILFWQSQTMQAMYDIVAKALKSEQL  658

Query  769   EDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEY  590
             +D+HP DYLNFYCLGNRE+  EE+++      S+    + K  RFMIYVHAKGMVVDDEY
Sbjct  659   QDSHPQDYLNFYCLGNREKLSEETSNDNGASVSD----AYKYQRFMIYVHAKGMVVDDEY  714

Query  589   VIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDE  410
             VI+GSANINQRSMAGS+DTEIAMGAYQPH+TWA+ + HP  Q+YGYRMSLWAEHLG  D 
Sbjct  715   VILGSANINQRSMAGSKDTEIAMGAYQPHYTWAERRKHPFGQIYGYRMSLWAEHLG-KDP  773

Query  409   KLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFP  230
               +E E LECV+ VN IAEENWKR+T+  F+ LQGHLLKYPLQVD++GKV PL G E FP
Sbjct  774   CFEEPESLECVRTVNGIAEENWKRFTSPDFTLLQGHLLKYPLQVDADGKVGPLPGHENFP  833

Query  229   DVGGKVLGSRT-TLPDALTT  173
             DVGGKV+G  +  LPD LTT
Sbjct  834   DVGGKVIGGHSAALPDTLTT  853



>ref|XP_003516537.1| PREDICTED: phospholipase D delta-like isoform X1 [Glycine max]
Length=864

 Score =  1186 bits (3068),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 583/863 (68%), Positives = 692/863 (80%), Gaps = 30/863 (3%)
 Frame = -2

Query  2686  GMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRK-----PETRQGNKVRR  2522
             G    V YLHGDLDLKI+EAR LPNMDI SER+R+  TA D  K     P    G   R+
Sbjct  7     GDDNGVTYLHGDLDLKIIEARHLPNMDIFSERLRRCVTACDTIKFHSEAPAGGGGAGQRK  66

Query  2521  H--TRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDV  2348
             H   RIITSDPYV V +  ATVARTRV+ NS +PVW E F IP+AHPV ++EF+VKD+DV
Sbjct  67    HHHPRIITSDPYVTVSVPQATVARTRVLKNSPNPVWEEQFNIPLAHPVVDLEFRVKDDDV  126

Query  2347  FGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGG  2168
             FGA  +G  KV A++I +G  I++WFPI+   GKPPKPD A+ + MKFTP  EN  Y+ G
Sbjct  127   FGAQTMGTVKVPARRIATGAKISEWFPILLPSGKPPKPDTALHVEMKFTPVWENLLYQRG  186

Query  2167  VTED---YGLKESYFPMRHGGAVTLYQDAHVPE---GSLPEIKIDDGKAFHHENCWEDIC  2006
             +  D    G++ +YFP+R G +V LYQDAH  E   G LPEIK+++G  + HE CWEDIC
Sbjct  187   IAADPEHNGVRHTYFPVRKGSSVRLYQDAHCTESGEGKLPEIKLENGNVYRHEKCWEDIC  246

Query  2005  HAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDD  1826
             +AI EAHHMVY+VGWSIYHKV+LVREPTRPLP GG+L LGELLKYKS+EGVRVLLLVWDD
Sbjct  247   YAISEAHHMVYLVGWSIYHKVRLVREPTRPLPRGGDLTLGELLKYKSEEGVRVLLLVWDD  306

Query  1825  KTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQ  1646
             KTSH K F+ T+GVMGTHDEETRKFFKHSSV CVL+PRYAS+K+SF+KQQVVGT++THHQ
Sbjct  307   KTSHDKVFLKTAGVMGTHDEETRKFFKHSSVMCVLSPRYASNKMSFLKQQVVGTVFTHHQ  366

Query  1645  KCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLK  1466
             KCVIVDTQA GNNRKITAFIGGLDLCDGRYDTP+HRLF + D VF GD++NPTF   G +
Sbjct  367   KCVIVDTQAAGNNRKITAFIGGLDLCDGRYDTPEHRLFRNLDDVFDGDFHNPTF-SAGTR  425

Query  1465  GPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERIS  1286
              PRQPWHDLHC+I+GPAAYD+L NFEQRWRKA+KW E    FKK S WHDDAL++IERIS
Sbjct  426   VPRQPWHDLHCRIDGPAAYDVLINFEQRWRKATKWKEFAILFKKSSQWHDDALIRIERIS  485

Query  1285  WITSPTP-----------SVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHT  1139
             WI SP+            +VP DDP +WVS+E DP+NWHVQ+FRSIDSGSLKGFPK V  
Sbjct  486   WILSPSGAATLKDKSDDYTVPEDDPLVWVSSEDDPENWHVQIFRSIDSGSLKGFPKRVDV  545

Query  1138  AETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIP  959
             A +QNL+CAK+LVID+SIQ AYI+AIR AQHFIYIENQYF+GSSYAWP+YK+AGADNLIP
Sbjct  546   ALSQNLICAKNLVIDKSIQTAYIQAIRSAQHFIYIENQYFIGSSYAWPAYKDAGADNLIP  605

Query  958   MELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKS  779
             MELALKI SKIR +ERFAVYIV+PMWPEG P +  +Q+IL+WQGQT+QMMY+ +A+ELKS
Sbjct  606   MELALKIASKIRAKERFAVYIVLPMWPEGDPKTGAMQEILFWQGQTMQMMYDAVARELKS  665

Query  778   EKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVD  599
              ++ D HP DYLNFYCLGNRE ++E+S+S  T G    ++ + K  RFMIYVHAKGM+VD
Sbjct  666   MQLTDVHPQDYLNFYCLGNREHFNEDSSS--TNGAQ--VSTAYKYRRFMIYVHAKGMIVD  721

Query  598   DEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGM  419
             DEYVI+GSANINQRSMAG++DTEIAMGAYQPH+TW+  + HPH Q+YGYRMSLW EHLGM
Sbjct  722   DEYVIIGSANINQRSMAGTKDTEIAMGAYQPHYTWSAKKRHPHGQIYGYRMSLWGEHLGM  781

Query  418   MDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCE  239
             +DE  +E E LECV  VN+IA+ NWK + +E FS LQGHLLKYP+QVDS+GK+  L  CE
Sbjct  782   LDETFEEPERLECVHKVNKIADNNWKLFASEDFSLLQGHLLKYPVQVDSDGKIRSLPDCE  841

Query  238   YFPDVGGKVLGSR-TTLPDALTT  173
              FPD GGK+LG+  TT+PD LTT
Sbjct  842   NFPDAGGKILGAHSTTIPDILTT  864



>ref|XP_007204285.1| hypothetical protein PRUPE_ppa001300mg [Prunus persica]
 gb|EMJ05484.1| hypothetical protein PRUPE_ppa001300mg [Prunus persica]
Length=859

 Score =  1183 bits (3061),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 584/866 (67%), Positives = 694/866 (80%), Gaps = 32/866 (4%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDC---------RKPETR  2543
             M++   E V YLHGDLDL I+EARRLPNMD+VSER R+ FTA D          R  E+ 
Sbjct  1     MAEMTLELVTYLHGDLDLHIIEARRLPNMDLVSERFRRCFTACDTITIPHSSHSRHTESD  60

Query  2542  QGNKVRRHTR--IITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEF  2369
              G    +H+R  IITSD YV V +   TVARTRVI NSQ+P W EHF IP+AHPV  +EF
Sbjct  61    GGEHKPQHSRPKIITSDSYVTVMVPETTVARTRVIKNSQNPQWNEHFFIPLAHPVINLEF  120

Query  2368  QVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAE  2189
             QVKDND+FGA+ IG AK+SA+KI +GE I+ WFPIIG+ G PPKPD AIR+ +KFTP  +
Sbjct  121   QVKDNDLFGAELIGTAKISAEKIATGELISGWFPIIGSSGTPPKPDSAIRVELKFTPFEK  180

Query  2188  NPRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCW  2018
             NP Y+ G+  D    G++ +YFP+R G ++ LYQDAHVP G LPEI++D  K +  ENCW
Sbjct  181   NPLYKHGIAGDPEHRGVRHTYFPLRKGSSLRLYQDAHVPHGLLPEIELDGRKVYRPENCW  240

Query  2017  EDICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLL  1838
             EDIC+AI EAHH++YIVGWS++HKV+L+REP+RPLP GG L LG+LLKYKS+EGVRVLLL
Sbjct  241   EDICYAISEAHHLIYIVGWSVFHKVRLIREPSRPLPRGGELTLGDLLKYKSEEGVRVLLL  300

Query  1837  VWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLY  1658
             VWDDKTSH KFF  T+G+MGTHDEETRKFFKHSSV CVLA RYASSKLS +KQQVVGTL+
Sbjct  301   VWDDKTSHDKFFFKTAGMMGTHDEETRKFFKHSSVNCVLATRYASSKLSIIKQQVVGTLF  360

Query  1657  THHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPE  1478
             THHQKCV+VDTQA GNNRKITAFIGGLDLCDGRYDTP+HRLF D +TVF+ D++ PTFP 
Sbjct  361   THHQKCVLVDTQAHGNNRKITAFIGGLDLCDGRYDTPEHRLFRDVNTVFKDDFHQPTFP-  419

Query  1477  GGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKI  1298
              G K PRQPWHDLHC+I+GPAAYD+L NFEQRWRKA++W E G + K+ SHWHDDAL+KI
Sbjct  420   AGTKAPRQPWHDLHCRIDGPAAYDVLINFEQRWRKATQWREFGLK-KRASHWHDDALIKI  478

Query  1297  ERISWITSPTPSV-------PNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHT  1139
             +RISWI SP  SV       P DDP+LWV  E DP++WHVQ+FRSIDSGSLKGFPK   +
Sbjct  479   DRISWILSPPLSVSKDRTTIPEDDPALWVQREDDPEDWHVQIFRSIDSGSLKGFPKAGPS  538

Query  1138  AETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIP  959
             AE QNL+C+K+L+ID+SIQ AYI+AIR AQHFIYIENQYFLGSSYAWP Y+ AGADNLIP
Sbjct  539   AEAQNLICSKNLLIDKSIQTAYIQAIRSAQHFIYIENQYFLGSSYAWPDYRNAGADNLIP  598

Query  958   MELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKS  779
             +ELALKI SKI+ +ERFAVY+V+PMWPEG P SA +Q+IL+WQ QT+Q MY+I+AK LKS
Sbjct  599   VELALKIASKIKAKERFAVYVVLPMWPEGDPKSAAMQEILFWQSQTMQAMYDIVAKALKS  658

Query  778   EKIED---AHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGM  608
              +++D   +HP DYLNFYCLGNRE+  EE+++      S+    + K  RFMIYVHAKGM
Sbjct  659   VQLQDSHHSHPQDYLNFYCLGNREKLSEETSNDNGASVSD----AYKYQRFMIYVHAKGM  714

Query  607   VVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEH  428
             VVDDEYVI+GSANINQRSMAG++DTEIAMGAYQPH+TWA+ + HP  Q+YGYRMSLWAEH
Sbjct  715   VVDDEYVILGSANINQRSMAGTKDTEIAMGAYQPHYTWAERRKHPFGQIYGYRMSLWAEH  774

Query  427   LGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLG  248
             LG  D    E E LECV+ VN IAEENWKR+T+  F+ LQGHLLKYPLQVD++GKV PL 
Sbjct  775   LG-KDPCFGEPESLECVRTVNGIAEENWKRFTSPDFTQLQGHLLKYPLQVDADGKVGPLP  833

Query  247   GCEYFPDVGGKVLGSRT-TLPDALTT  173
             G E FPDVGGKV+G  +  LPD LTT
Sbjct  834   GHENFPDVGGKVIGGHSAALPDTLTT  859



>ref|XP_010935183.1| PREDICTED: phospholipase D delta-like [Elaeis guineensis]
Length=873

 Score =  1182 bits (3057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/852 (69%), Positives = 673/852 (79%), Gaps = 17/852 (2%)
 Frame = -2

Query  2689  DGMS--ENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNK-----  2531
             DG S  E  V LHGDLDL ILEARRLPNMD++SE +R+ F A  CR P      +     
Sbjct  24    DGSSPKEPPVLLHGDLDLWILEARRLPNMDMLSEHLRRCFAA--CRPPSPASCTRSRRPP  81

Query  2530  --VRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKD  2357
                 RH +IITSD YV V LAGATVARTRVI NSQDP W EHFKIP+AH    + F VKD
Sbjct  82    RHHHRHPKIITSDSYVTVSLAGATVARTRVIPNSQDPKWNEHFKIPLAHRSPFIVFHVKD  141

Query  2356  NDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRY  2177
             NDVFGA  IG   +    + SG+ + DW+P++   GKPPKP+ A+ + +++ P   NP Y
Sbjct  142   NDVFGAQVIGTVSIPTALVASGDLVRDWYPVLDPSGKPPKPETALLVSLQYRPVDGNPIY  201

Query  2176  RGGVT---EDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDIC  2006
               G+    E  G++++YFP+R GG VTLYQDAHV EG LPEI+++ G  F H  CWEDIC
Sbjct  202   AHGIAGDPEKLGVRDTYFPVRKGGLVTLYQDAHVREGELPEIELEKGMNFEHHRCWEDIC  261

Query  2005  HAILEAHHMVYIVGWSIYHKVKLVREPTRplp-nggnlnlgelLKYKSQEGVRVLLLVWD  1829
             HAILEAHH++YIVGWS+Y KVKLVREPTRPLP    N  LGELLKYKSQEGVRV LLVWD
Sbjct  262   HAILEAHHLIYIVGWSVYDKVKLVREPTRPLPPGVENFTLGELLKYKSQEGVRVCLLVWD  321

Query  1828  DKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHH  1649
             DKTSH KFF+ T GVM THDE+TRKFFKHSSV CVL+PRYASSKLS  KQQVVGTL+THH
Sbjct  322   DKTSHDKFFVRTGGVMQTHDEDTRKFFKHSSVICVLSPRYASSKLSIFKQQVVGTLFTHH  381

Query  1648  QKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGL  1469
             QKC++VDTQA  NNRKITAFIGGLDLCDGRYDTPQHR+FSD DTVF  D++NPTF E   
Sbjct  382   QKCLLVDTQASQNNRKITAFIGGLDLCDGRYDTPQHRIFSDLDTVFLNDFHNPTFAEA-T  440

Query  1468  KGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERI  1289
             KGPRQPWHDLHCKIEGPAAYDILTNFEQRW+KA+KW ELG+ F+KISHW DDAL+K+ERI
Sbjct  441   KGPRQPWHDLHCKIEGPAAYDILTNFEQRWQKATKWRELGKHFRKISHWGDDALIKLERI  500

Query  1288  SWITSPTPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAK  1109
             SWI SP+P+VPNDDPSLWVS E D + WHVQVFRSIDSGS+KGFP+ VH A  +NLVC K
Sbjct  501   SWILSPSPTVPNDDPSLWVSKEEDSETWHVQVFRSIDSGSVKGFPRGVHEALEKNLVCRK  560

Query  1108  DLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSK  929
             +LVID+SI  AY++AIR AQHFIYIENQYFLGSSY W SYK A ADNLIPMELALK+ SK
Sbjct  561   NLVIDKSIHTAYVKAIRSAQHFIYIENQYFLGSSYGWTSYKNADADNLIPMELALKVASK  620

Query  928   IRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCD  749
             IR  ERFAVYIVIPMWPEGVP++  VQ+IL+WQGQTIQMMYEII +ELKS  +E+AHP D
Sbjct  621   IRAGERFAVYIVIPMWPEGVPTAYSVQEILFWQGQTIQMMYEIIGQELKSMNVENAHPQD  680

Query  748   YLNFYCLGNREE-WHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSA  572
             YLNFYCLG REE   ++  S   P         Q+  RFMIYVHAKGM+VDDEYVI+GSA
Sbjct  681   YLNFYCLGKREELLKDDLPSDDQPSEKNAAALCQRYRRFMIYVHAKGMIVDDEYVILGSA  740

Query  571   NINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAE  392
             NINQRS+AGSRDTEIAMGAYQPHHTW + + HPH QVYGYRMSLWAEHLG++D+   E  
Sbjct  741   NINQRSLAGSRDTEIAMGAYQPHHTWVEKKRHPHGQVYGYRMSLWAEHLGIVDDLYKEPS  800

Query  391   GLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKV  212
              LECVK VN+IA+ENW RY AE+  PL GHLLKYP++V+ +GKV PL   E FPDVGGK+
Sbjct  801   SLECVKFVNKIADENWARYAAEEVRPLTGHLLKYPIKVEVDGKVGPLPNQECFPDVGGKI  860

Query  211   LGSRTTLPDALT  176
             LG+ T+LPD LT
Sbjct  861   LGAPTSLPDTLT  872



>ref|XP_008806154.1| PREDICTED: phospholipase D delta [Phoenix dactylifera]
Length=869

 Score =  1181 bits (3055),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/852 (69%), Positives = 676/852 (79%), Gaps = 17/852 (2%)
 Frame = -2

Query  2689  DGMS--ENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNK-----  2531
             DG S  E  V LHGDLDL ILEARRLPNMD++SE +R+ F A  CR P      +     
Sbjct  20    DGSSPEEPPVLLHGDLDLWILEARRLPNMDMLSEHLRRCFAA--CRPPSPTSCTRSHRPP  77

Query  2530  --VRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKD  2357
                RRH +IITSDPYV V +AGATVARTRVI NSQDP W EHFKIP+AH    + F VKD
Sbjct  78    HHHRRHPKIITSDPYVTVSIAGATVARTRVILNSQDPKWNEHFKIPLAHRSPFIVFHVKD  137

Query  2356  NDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRY  2177
             NDVFGA+ IG   +    + SG+ + DW+P++G  GKPPK + A+ +  ++ P   NP Y
Sbjct  138   NDVFGAELIGTVFIPTALVASGDLVRDWYPVLGPSGKPPKLETALLVSFQYRPVDGNPIY  197

Query  2176  RGGVT---EDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDIC  2006
               GV    E  G++++YFP+R GG V LYQDAHV EG LPEI+++    F H  CWEDIC
Sbjct  198   DHGVAGDPEKLGVRDTYFPVRKGGLVRLYQDAHVREGELPEIELEKETNFEHNRCWEDIC  257

Query  2005  HAILEAHHMVYIVGWSIYHKVKLVREPTRplp-nggnlnlgelLKYKSQEGVRVLLLVWD  1829
             HAILEAHH++YIVGWS+Y KVKLVREPTRPLP    N  LGELLKYKSQEGVRV LLVWD
Sbjct  258   HAILEAHHLIYIVGWSVYDKVKLVREPTRPLPPGVENFTLGELLKYKSQEGVRVCLLVWD  317

Query  1828  DKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHH  1649
             DKTSH KFFI T GVM THDE+TRKFFKHSSV CVL+PRYASSKLS  KQQVVGTL+THH
Sbjct  318   DKTSHDKFFIRTGGVMQTHDEDTRKFFKHSSVICVLSPRYASSKLSMFKQQVVGTLFTHH  377

Query  1648  QKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGL  1469
             QKC++VDTQA  NNRKITAF+GGLDLCDGRYDTPQHR+FS+ D+VF  D++NPTF +   
Sbjct  378   QKCLLVDTQASRNNRKITAFMGGLDLCDGRYDTPQHRIFSELDSVFLNDFHNPTFADA-T  436

Query  1468  KGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERI  1289
             KGPRQPWHDLHCKIEGPAAYDILTNFEQRWR+A+KW E G+ F+K+S W DDAL+K+ERI
Sbjct  437   KGPRQPWHDLHCKIEGPAAYDILTNFEQRWRRATKWREFGKHFRKVSRWSDDALIKLERI  496

Query  1288  SWITSPTPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAK  1109
             SWI SP+P+VPNDDP+LWVS E D +NWHVQVFRSIDSGS+KGFPKDVH A  +NLVC K
Sbjct  497   SWIVSPSPTVPNDDPNLWVSEEEDSENWHVQVFRSIDSGSVKGFPKDVHEALEKNLVCQK  556

Query  1108  DLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSK  929
             +LVID+SI  AY+ AIR AQHFIYIENQYFLGSSY+W SYK A ADNLIPMELALK+ SK
Sbjct  557   NLVIDKSIHTAYVRAIRSAQHFIYIENQYFLGSSYSWSSYKNADADNLIPMELALKVASK  616

Query  928   IRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCD  749
             IR+ ERFAVYIVIPMWPEGVP+++ VQ+IL+WQGQTIQMMYEII +ELKS  +E+AHP D
Sbjct  617   IRDGERFAVYIVIPMWPEGVPTASSVQEILFWQGQTIQMMYEIIGQELKSMNVENAHPQD  676

Query  748   YLNFYCLGNREEWHE-ESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSA  572
             YLNFYCLGNREE  + +S S   P         Q+  RFMIYVHAKGM+VDDEYVI+GSA
Sbjct  677   YLNFYCLGNREELPKGDSPSDDQPSKQSAAALCQRYRRFMIYVHAKGMIVDDEYVILGSA  736

Query  571   NINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAE  392
             NINQRS+AGSRDTEIAMGAYQPHHTW +   HPH QVYGYRMSLWAEHLG +D+   E  
Sbjct  737   NINQRSLAGSRDTEIAMGAYQPHHTWLEKNRHPHGQVYGYRMSLWAEHLGTVDDLFKEPS  796

Query  391   GLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKV  212
              LECVK VNEIA+ENW RY+AE+  PL GHLLKYP++V+ +GKV PL   E FPDVGGK+
Sbjct  797   SLECVKSVNEIADENWARYSAEEARPLTGHLLKYPIKVEIDGKVGPLPNQECFPDVGGKI  856

Query  211   LGSRTTLPDALT  176
             LG+ T+LPD LT
Sbjct  857   LGAATSLPDTLT  868



>gb|AAN34820.1| phospholipase D delta isoform [Gossypium hirsutum]
Length=849

 Score =  1178 bits (3048),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 576/852 (68%), Positives = 683/852 (80%), Gaps = 23/852 (3%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPE---TRQGN-KVRRHTR  2513
             S+  +YLHGDLDL I+EARRLPNMD +   +R   T   C+ P     ++G+ K+R H +
Sbjct  5     SKQQIYLHGDLDLTIVEARRLPNMDFMVNHLRSCLTCEPCKSPAQTAAKEGDSKIRGHRK  64

Query  2512  IITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADF  2333
             IITSDPYV VCL  ATVARTRV+ NSQ+P W EHF IP+AHPV+E++  VKDND+FGAD 
Sbjct  65    IITSDPYVTVCLPQATVARTRVLKNSQNPKWNEHFIIPLAHPVTELDINVKDNDLFGADA  124

Query  2332  IGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED-  2156
             IG AK+ A +I +GE I  WFP+IG  GKPPKPD AI L MKFTPC  NP Y+ GV  D 
Sbjct  125   IGTAKIPASRIATGEHITGWFPLIGPSGKPPKPDSAIYLDMKFTPCENNPLYKQGVASDP  184

Query  2155  --YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHH  1982
                G++ +YFP+R G  VTLYQDAHV +  LP+I++DDGK +    CWEDIC+AI EAHH
Sbjct  185   EQAGVRHTYFPLRKGSQVTLYQDAHVTDDLLPKIELDDGKVYSPAKCWEDICYAISEAHH  244

Query  1981  MVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFF  1802
             +VYIVGWS++HKVKLVREPTRP P GG+L LGELLKYKS+EGVRVLLLVWDDKTSH KF 
Sbjct  245   LVYIVGWSVFHKVKLVREPTRPFPRGGDLTLGELLKYKSEEGVRVLLLVWDDKTSHDKFG  304

Query  1801  INTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQ  1622
             I T+GVM THDEET KFFKHSSVTCVLAPRYASSKL + KQQVVGT++THHQKCV+VDTQ
Sbjct  305   IRTAGVMQTHDEETLKFFKHSSVTCVLAPRYASSKLGYFKQQVVGTMFTHHQKCVLVDTQ  364

Query  1621  AQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHD  1442
             A GNNRKITAF+GG+DLCDGRYDTP+HR+  D DTVF+ D++NPTFP G +  PRQPWHD
Sbjct  365   AAGNNRKITAFVGGIDLCDGRYDTPEHRILRDLDTVFKDDFHNPTFPVGTM-APRQPWHD  423

Query  1441  LHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSP---  1271
             LH KIEGPAAYD+L NFEQRWRK++KW E    FK  SHW DDA+++IERISWI SP   
Sbjct  424   LHSKIEGPAAYDVLINFEQRWRKSTKWKEFSLLFKGKSHWSDDAMIRIERISWIQSPPLA  483

Query  1270  -----TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKD  1106
                  T  VP+DDP + V ++ + +NW+VQ+FRSIDSGSLKGFPK +  AE QN  CAK+
Sbjct  484   VTDDGTTIVPDDDPKVHVLSKDNRENWNVQIFRSIDSGSLKGFPKYIKKAENQNFFCAKN  543

Query  1105  LVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKI  926
             LVID+SIQ AYI+AIR AQH+IYIENQYFLGSSYAWPSYK AGADNLIPMELALK+ SKI
Sbjct  544   LVIDKSIQAAYIQAIRSAQHYIYIENQYFLGSSYAWPSYKNAGADNLIPMELALKVASKI  603

Query  925   RNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDY  746
             R  ERFAVYI+IP+WPEG P +A VQ+ILYWQ QT+QMMY+++A+ELKS +I+D+HP DY
Sbjct  604   RAGERFAVYIIIPLWPEGDPKTATVQEILYWQSQTMQMMYDVVAQELKSMQIKDSHPRDY  663

Query  745   LNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANI  566
             LNFYCLG REE  +E  S       + ++ S K GRFMIYVHAKGM+VDDEYVIVGSANI
Sbjct  664   LNFYCLGKREEVSQEMLSG-----KDSVSDSAKFGRFMIYVHAKGMIVDDEYVIVGSANI  718

Query  565   NQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGL  386
             NQRSMAG++DTEIAMGAYQPH+TWAK + +P  QV+GYRMSLWAEHLG +++   E E +
Sbjct  719   NQRSMAGTKDTEIAMGAYQPHYTWAK-KKYPRGQVHGYRMSLWAEHLGELNKLFKEPESV  777

Query  385   ECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLG  206
             ECVKMVN IAEENWK++T  ++SPLQGHLL YPLQVD +GKV+PL   E FPDVGGKV+G
Sbjct  778   ECVKMVNSIAEENWKKFTDAEYSPLQGHLLMYPLQVDMDGKVNPLPEHENFPDVGGKVIG  837

Query  205   SRTT-LPDALTT  173
             + +  LPD LTT
Sbjct  838   AHSIQLPDVLTT  849



>gb|AAN05432.1| phospholipase D delta isoform 1b [Gossypium hirsutum]
Length=849

 Score =  1178 bits (3047),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 576/852 (68%), Positives = 683/852 (80%), Gaps = 23/852 (3%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPE---TRQGN-KVRRHTR  2513
             S+  +YLHGDLDL I+EARRLPNMD +   +R   T   C+ P     ++G+ K+R H +
Sbjct  5     SKQQIYLHGDLDLTIVEARRLPNMDFMVNHLRSCLTCEPCKSPAQTAAKEGDSKIRGHRK  64

Query  2512  IITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADF  2333
             IITSDPYV VCL  ATVARTRV+ NSQ+P W EHF IP+AHPV+E++  VKDND+FGAD 
Sbjct  65    IITSDPYVTVCLPQATVARTRVLKNSQNPKWNEHFIIPLAHPVTELDINVKDNDLFGADA  124

Query  2332  IGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED-  2156
             IG AK+ A +I +GE I  WFP+IG  GKPPKPD AI L MKFTPC  NP Y+ GV  D 
Sbjct  125   IGTAKIPASRIATGEHITGWFPLIGPSGKPPKPDSAIYLDMKFTPCENNPLYKQGVASDP  184

Query  2155  --YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHH  1982
                G++ +YFP+R G  VTLYQDAHV +  LP+I++DDGK +    CWEDIC+AI EAHH
Sbjct  185   EQAGVRHTYFPLRKGSQVTLYQDAHVTDDLLPKIELDDGKVYSPAKCWEDICYAISEAHH  244

Query  1981  MVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFF  1802
             +VYIVGWS++HKVKLVREPTRP P GG+L LGELLKYKS+EGVRVLLLVWDDKTSH KF 
Sbjct  245   LVYIVGWSVFHKVKLVREPTRPFPRGGDLTLGELLKYKSEEGVRVLLLVWDDKTSHDKFG  304

Query  1801  INTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQ  1622
             I T+GVM THDEET KFFKHSSVTCVLAPRYASSKL + KQQVVGT++THHQKCV+VDTQ
Sbjct  305   IRTAGVMQTHDEETLKFFKHSSVTCVLAPRYASSKLGYFKQQVVGTMFTHHQKCVLVDTQ  364

Query  1621  AQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHD  1442
             A GNNRKITAF+GG+DLCDGRYDTP+HR+  D DTVF+ D++NPTFP G +  PRQPWHD
Sbjct  365   AAGNNRKITAFVGGIDLCDGRYDTPEHRILRDLDTVFKDDFHNPTFPVGTM-APRQPWHD  423

Query  1441  LHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSP---  1271
             LH KIEGPAAYD+L NFEQRWRK++KW E    FK  SHW DDA+++IERISWI SP   
Sbjct  424   LHSKIEGPAAYDVLINFEQRWRKSTKWKEFSLLFKGKSHWSDDAMIRIERISWIQSPPLA  483

Query  1270  -----TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKD  1106
                  T  VP+DDP + V ++ + +NW+VQ+FRSIDSGSLKGFPK +  AE QNL CAK+
Sbjct  484   VTDDGTTIVPDDDPKVHVLSKDNRENWNVQIFRSIDSGSLKGFPKYIKKAENQNLFCAKN  543

Query  1105  LVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKI  926
             LVID+SIQ  YI+AIR AQH+IYIENQYFLGSSYAWPSYK AGADNLIPMELALK+ SKI
Sbjct  544   LVIDKSIQAVYIQAIRSAQHYIYIENQYFLGSSYAWPSYKNAGADNLIPMELALKVASKI  603

Query  925   RNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDY  746
             R  ERFAVYI+IP+WPEG P +A VQ+ILYWQ QT+QMMY+++A+ELKS +I+D+HP DY
Sbjct  604   RAGERFAVYIIIPLWPEGDPKTATVQEILYWQSQTMQMMYDVVAQELKSMQIKDSHPRDY  663

Query  745   LNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANI  566
             LNFYCLG REE  +E  S       + ++ S K GRFMIYVHAKGM+VDDEYVIVGSANI
Sbjct  664   LNFYCLGKREEVSQEMLSG-----KDSVSDSAKFGRFMIYVHAKGMIVDDEYVIVGSANI  718

Query  565   NQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGL  386
             NQRSMAG++DTEIAMGAYQPH+TWAK + +P  QV+GYRMSLWAEHLG +++   E E +
Sbjct  719   NQRSMAGTKDTEIAMGAYQPHYTWAK-KKYPRGQVHGYRMSLWAEHLGELNKLFKEPESV  777

Query  385   ECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLG  206
             ECVKMVN IAEENWK++T  ++SPLQGHLL YPLQVD +GKV+PL   E FPDVGGKV+G
Sbjct  778   ECVKMVNSIAEENWKKFTDAEYSPLQGHLLMYPLQVDMDGKVNPLPEHENFPDVGGKVIG  837

Query  205   SRTT-LPDALTT  173
             + +  LPD LTT
Sbjct  838   AHSIQLPDVLTT  849



>gb|KDP43704.1| hypothetical protein JCGZ_22331 [Jatropha curcas]
Length=863

 Score =  1176 bits (3041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/856 (66%), Positives = 681/856 (80%), Gaps = 29/856 (3%)
 Frame = -2

Query  2668  VYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPET-------------RQGNKV  2528
             +YLHGDLDL I++AR LPNMDIVS RIR  FTA   +   +              + +K+
Sbjct  13    IYLHGDLDLYIIQARSLPNMDIVSTRIRSCFTACTPQSNTSAAATTTTDDEETGNEDDKI  72

Query  2527  RRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDV  2348
               H  I+TSDPYV V +  ATVAR+RVI N+++P W + F IP+AHP+ ++EF VKDND+
Sbjct  73    HHHRNIVTSDPYVTVVVPQATVARSRVIKNAKNPKWKQRFYIPLAHPLIDLEFHVKDNDL  132

Query  2347  FGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGG  2168
             FGA+ IG+ K+ A++I++GE I++WFPII + GKPPKPD A+ L MKFTPC +NP Y  G
Sbjct  133   FGAELIGIVKIPARRIVTGEFIDEWFPIISSSGKPPKPDTALHLEMKFTPCEKNPLYWHG  192

Query  2167  VTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAI  1997
             +  D    G+  +YFP+R G  VT+YQDAHV +  LPEI+IDDGK F  + CWEDIC+AI
Sbjct  193   IAGDPEHRGVTNTYFPLRKGSKVTMYQDAHVLDNELPEIRIDDGKVFKQQKCWEDICYAI  252

Query  1996  LEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTS  1817
              EAHH++YIVGWS+++K+KLVREPTRPLP GG+L LGELLKYKS+EGVRVLLL+WDDKTS
Sbjct  253   SEAHHLIYIVGWSVFYKIKLVREPTRPLPRGGDLTLGELLKYKSEEGVRVLLLIWDDKTS  312

Query  1816  HSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCV  1637
             H KF I+T+G+M THDEETRKFFKHSSV CVLAPRY SSKL F+KQQ+VGT +THHQKCV
Sbjct  313   HDKFGISTAGLMQTHDEETRKFFKHSSVICVLAPRYGSSKLGFLKQQIVGTAFTHHQKCV  372

Query  1636  IVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPR  1457
             +VDTQA GNNRKITAF+GG+DLCDGRYDTP+HRLF D DTVF+ D++NPTFP  G K PR
Sbjct  373   LVDTQAFGNNRKITAFLGGIDLCDGRYDTPEHRLFRDLDTVFKEDFHNPTFP-AGTKAPR  431

Query  1456  QPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWIT  1277
             QPWHDLHC+I+GPA YD+L NFEQRWRKA+KW E G RFK++SHWHDDALLKIERISWI 
Sbjct  432   QPWHDLHCRIDGPAVYDVLINFEQRWRKATKWTEFGLRFKRVSHWHDDALLKIERISWIL  491

Query  1276  SP-------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLV  1118
             SP          VP DDP + VSNE DP+NWHVQ+FRSIDSGSLKGFPK VH  + QNL+
Sbjct  492   SPPFTVKDGMTVVPPDDPIVHVSNEEDPENWHVQIFRSIDSGSLKGFPKSVHQCQAQNLI  551

Query  1117  CAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKI  938
              AKD VI+RSIQ AYI+AIR AQH+IYIENQYFLGSSYAWPSYK AG DNLIPMELALK+
Sbjct  552   TAKDQVIERSIQTAYIQAIRSAQHYIYIENQYFLGSSYAWPSYKNAGVDNLIPMELALKV  611

Query  937   VSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAH  758
              SKIR  ERFAVYIV+PMWPEG P S  +Q+ILYWQ QT+QMMY I+A E++S ++ D+H
Sbjct  612   ASKIRANERFAVYIVLPMWPEGDPKSETMQEILYWQSQTMQMMYSIVANEIESMQLVDSH  671

Query  757   PCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVG  578
             P DYLNFYCLG REE  +++ S+      E ++ SQK  RFMIYVHAKGM+VDDEY I+G
Sbjct  672   PRDYLNFYCLGKREENAQQTGST----NGEVVSDSQKFQRFMIYVHAKGMIVDDEYAIIG  727

Query  577   SANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDE  398
             SANINQRSMAGS+DTEIAMGAYQPH+TWA  + HPH QVYG+RMSLWAEHLG + E   E
Sbjct  728   SANINQRSMAGSKDTEIAMGAYQPHYTWAAKKKHPHGQVYGHRMSLWAEHLGGVQELFME  787

Query  397   AEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGG  218
              E LECV+ VN+IAE+NWK++T   F  LQGHLL+YPL+VD+ GKV  L G E FPDVGG
Sbjct  788   PESLECVRTVNKIAEDNWKKFTDPDFKVLQGHLLRYPLEVDARGKVGALPGFENFPDVGG  847

Query  217   KVLGSRT-TLPDALTT  173
             KV+G+ +  +PD LTT
Sbjct  848   KVIGAHSLKVPDILTT  863



>ref|XP_010113283.1| Phospholipase D delta [Morus notabilis]
 gb|EXC35290.1| Phospholipase D delta [Morus notabilis]
Length=891

 Score =  1176 bits (3041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/899 (66%), Positives = 695/899 (77%), Gaps = 66/899 (7%)
 Frame = -2

Query  2695  MSDGMSENV-VYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRK--PET-------  2546
             M+D  SE+  VYLHGDLDL+I+EARRLPNMD+V+  +R+ FTA    K  P T       
Sbjct  1     MADSASESQPVYLHGDLDLRIIEARRLPNMDVVTNHLRRCFTACGTIKCPPLTSAAAGDP  60

Query  2545  ------RQGNKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPV  2384
                   R   K+  H RIITSDPYV V +  ATVARTRVI NSQ+P W E F IP+AHPV
Sbjct  61    SDSEGGRSDRKIHHHARIITSDPYVTVNVPQATVARTRVIKNSQNPHWNERFHIPLAHPV  120

Query  2383  SEVEFQVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKF  2204
               +EF VKDNDVFGAD IG A++ A +I +GETI+ W+PI+ + GKPPKP+ A+RL M+F
Sbjct  121   VNLEFYVKDNDVFGADMIGSARIPAGEIATGETISGWYPILNSSGKPPKPETALRLEMQF  180

Query  2203  TPCAENPRYRGGVT---EDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFH  2033
             TPC +NP YR G+    E+ G++ SYFP+R GG+V LYQDAHV +  LP+I++D GK F 
Sbjct  181   TPCEKNPLYRHGIAGDPEEKGVRHSYFPLRKGGSVRLYQDAHVLDHMLPKIELDGGKVFT  240

Query  2032  HENCWEDICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGV  1853
              E CWEDICHAI EAHHM+Y+ GWSIYHKVKLVREPTRPLP GG+L LGELLKYKSQEGV
Sbjct  241   QEKCWEDICHAITEAHHMIYMTGWSIYHKVKLVREPTRPLPRGGDLTLGELLKYKSQEGV  300

Query  1852  RVLLLVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQ-  1676
             RVLLLVWDDKTSH K+FINT GVM THDEETRKFFKHSSV CVLAPRYASSK+S++KQQ 
Sbjct  301   RVLLLVWDDKTSHDKYFINTVGVMQTHDEETRKFFKHSSVICVLAPRYASSKMSYIKQQA  360

Query  1675  ----------------VVGTLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQ  1544
                             +VGTL+THHQKCV+VDTQA GNNRKITAF+GGLDLCDGRYDTP+
Sbjct  361   EADKLAKSTCLMGLLQIVGTLFTHHQKCVLVDTQAYGNNRKITAFLGGLDLCDGRYDTPE  420

Query  1543  HRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASK  1364
             HRLF D DTV++ D++NPTFP  G K PRQPWHDLHC+IEGP AYD+L NFEQRWR+A+K
Sbjct  421   HRLFRDLDTVYKEDFHNPTFP-AGHKAPRQPWHDLHCRIEGPTAYDVLINFEQRWRRATK  479

Query  1363  WAELGRRFKKISHWHDDALLKIERISWITSPT-PS--------------------VPNDD  1247
             W E    FK +S WHDDAL+KI RISWI SP  P+                    VP+DD
Sbjct  480   WTER-LHFKTVSRWHDDALIKIGRISWILSPNMPASKDSDDGVLSRSKDRDSVTIVPDDD  538

Query  1246  PSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIE  1067
             P LWV    D ++WHVQ+ RSIDSGS+KGFP+DV  A  Q+L+CAK+LVID+SIQ  YI+
Sbjct  539   PKLWVYT--DEESWHVQIMRSIDSGSVKGFPRDVVAAAAQHLICAKNLVIDKSIQTGYIQ  596

Query  1066  AIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIP  887
             AIR AQHFIYIENQYFLGSSYAWP YK AGADNLIPMELALKI SKIR  ERFAVYIVIP
Sbjct  597   AIRSAQHFIYIENQYFLGSSYAWPDYKNAGADNLIPMELALKIASKIRANERFAVYIVIP  656

Query  886   MWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREEWH  707
             +WPEG P S PVQ+ILYWQ QT+Q MY+I+A ELKS ++ D+ P DYLNFYCLGNRE+  
Sbjct  657   LWPEGDPKSGPVQEILYWQSQTMQTMYDIVAGELKSMQLADSTPQDYLNFYCLGNREQNF  716

Query  706   EESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEI  527
             ++++++     +  +T + K  RFMIYVHAKGMVVDDEYVI+GSANINQRSMAG++DTEI
Sbjct  717   DKNSNAD----AAMVTDAYKFQRFMIYVHAKGMVVDDEYVIMGSANINQRSMAGTKDTEI  772

Query  526   AMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEEN  347
             AMG+YQPHHTWA+   HP  QVYGYRMSLWAEHLG +D + +E E LECV+ VNEIAE N
Sbjct  773   AMGSYQPHHTWARRNRHPRGQVYGYRMSLWAEHLGDLDSRYEEPETLECVRKVNEIAEHN  832

Query  346   WKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRT-TLPDALTT  173
             WKR+T++ F+ LQGHLLKYPLQVD+ GKV PL G E FPDVGGK++G+ + TLPD LTT
Sbjct  833   WKRFTSDSFTSLQGHLLKYPLQVDAAGKVGPLPGYENFPDVGGKIIGAHSATLPDTLTT  891



>ref|XP_008651006.1| PREDICTED: uncharacterized protein LOC100217111 isoform X1 [Zea 
mays]
 tpg|DAA64273.1| TPA: phospholipase D family protein [Zea mays]
Length=855

 Score =  1176 bits (3041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 576/855 (67%), Positives = 680/855 (80%), Gaps = 38/855 (4%)
 Frame = -2

Query  2668  VYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNK-----------VRR  2522
             V LHGDLDL ILEAR LPNMD+ SE +R+ F A  CR P +  G K              
Sbjct  14    VLLHGDLDLWILEARLLPNMDMFSEHVRRCFAA--CRPPSS-CGTKHPPPAAAGRRHHHH  70

Query  2521  HTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFG  2342
             H  IITSDPYV + ++GA VART VI NSQDPVW E F +P+AH  +++EFQVKDND FG
Sbjct  71    HRNIITSDPYVTLSVSGAVVARTAVIPNSQDPVWEERFAVPLAHRAADLEFQVKDNDTFG  130

Query  2341  ADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT  2162
             A  IG   V A +++SG+ + DWFP+IG +GKP KPD A+RL  KF P A+NP YR G+ 
Sbjct  131   AQLIGTVAVPADRVVSGDEVEDWFPVIGTNGKPYKPDTALRLRFKFQPIADNPAYRHGIA  190

Query  2161  ED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILE  1991
              D    G+++SYFP+RHGG +TLYQDAHV EG LPEI++D+GK F H  CWEDICHAILE
Sbjct  191   GDPDHRGIQDSYFPLRHGGQLTLYQDAHVREGDLPEIELDNGKTFQHNACWEDICHAILE  250

Query  1990  AHHMVYIVGWSIYHKVKLVREPT--RplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTS  1817
             AHHM+YIVGWS+Y KV+LVREP+  RPLP GG+L LG+LLK+KSQEGVRV LLVWDDKTS
Sbjct  251   AHHMIYIVGWSVYDKVRLVREPSPSRPLPEGGDLTLGDLLKFKSQEGVRVCLLVWDDKTS  310

Query  1816  HSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCV  1637
             H KFFI T GVM THDEETRKFFKHSSV CVL+PRYAS+KLS  KQQVVGTL+THHQKCV
Sbjct  311   HDKFFIKTGGVMATHDEETRKFFKHSSVICVLSPRYASNKLSIFKQQVVGTLFTHHQKCV  370

Query  1636  IVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPR  1457
             +VDTQA+GN RKITAFIGGLDLCDGRYDTP+HRLF D DTVF+ DY+NPTF   G KGPR
Sbjct  371   LVDTQARGNKRKITAFIGGLDLCDGRYDTPEHRLFKDLDTVFQNDYHNPTF-SAGAKGPR  429

Query  1456  QPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWIT  1277
             QPWHDLHC+I+GPAAYD+LTNFEQRWRKA+KW +   RF+++SHW DDAL+K+ERISWI 
Sbjct  430   QPWHDLHCRIDGPAAYDVLTNFEQRWRKATKWRD---RFRRVSHWKDDALIKLERISWIL  486

Query  1276  SPTPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVI  1097
             SP+P+VPN+ PSLWVS E D +NWHVQVFRSIDSGSLKGFP D   A   NLVC K+LVI
Sbjct  487   SPSPNVPNNHPSLWVSKEEDHENWHVQVFRSIDSGSLKGFPSDCKAASKLNLVCRKNLVI  546

Query  1096  DRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNR  917
             D+SI  AY+ AIR AQHFIYIENQYFLGSSYAWPSY  +GADNL+P+ELALKI SKI+  
Sbjct  547   DKSIHTAYVRAIRSAQHFIYIENQYFLGSSYAWPSYVNSGADNLVPIELALKIASKIKAG  606

Query  916   ERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNF  737
             ERFAVY+VIPMWPEGVP++A VQ+IL++Q QT++MMY+IIA ELK+   +D HP DYLNF
Sbjct  607   ERFAVYVVIPMWPEGVPTAASVQEILFFQAQTMEMMYKIIADELKATDNKDMHPEDYLNF  666

Query  736   YCLGNREEWHEESASSPTPGCSEFLTGSQKSG--------RFMIYVHAKGMVVDDEYVIV  581
             +CLGNREE        P+ G  E    + KS         RFMIYVHAKGM+VDDEYVI+
Sbjct  667   FCLGNREE-------PPSNGSPESEKSTDKSAAALASKYRRFMIYVHAKGMIVDDEYVIL  719

Query  580   GSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLD  401
             GSANINQRS+AGSRDTEIAMGAYQPH+ W+    HPH QVYGYR SLWAEHLG +D++  
Sbjct  720   GSANINQRSLAGSRDTEIAMGAYQPHYAWSTKNGHPHGQVYGYRTSLWAEHLGTVDDRFK  779

Query  400   EAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVG  221
             +   LECV+ VN+IA ENW+R+TAE+ S LQGHLLKYP++V+++GK+SPL   E FPDVG
Sbjct  780   DPSSLECVRFVNQIAVENWQRFTAEEMSTLQGHLLKYPVKVEADGKISPLSDQECFPDVG  839

Query  220   GKVLGSRTTLPDALT  176
             GK+LG+ T+LPD+LT
Sbjct  840   GKILGAPTSLPDSLT  854



>ref|XP_010683033.1| PREDICTED: phospholipase D delta [Beta vulgaris subsp. vulgaris]
Length=852

 Score =  1173 bits (3034),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 579/853 (68%), Positives = 684/853 (80%), Gaps = 24/853 (3%)
 Frame = -2

Query  2677  ENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDC----RKPETRQGNKV----RR  2522
             E +VYLHGDLDLKI EAR LPNMD+ SER+R  F+A  C    + PE R         R 
Sbjct  6     EKLVYLHGDLDLKIHEARHLPNMDLTSERLRLCFSACACVPSRKSPEARPSEDSSTHHRP  65

Query  2521  HTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFG  2342
             H RIITSDPYV V +  AT+ARTRVI NSQ+P + E F I +A+P   +EFQVKD+DVFG
Sbjct  66    HPRIITSDPYVAVVVPQATIARTRVIPNSQNPHFNEQFHIQMAYPAFNLEFQVKDDDVFG  125

Query  2341  ADFIGVAKVSAQKIISGETINDWFPIIG-AHGKPPKPDCAIRLMMKFTPCAENPRYRGGV  2165
             A  IG+  +SA ++++GE I+ WF I+  + GKPPKPD AIR+ MKFTPC +       V
Sbjct  126   AQIIGIFTLSASRVLTGELISGWFSILSPSSGKPPKPDAAIRIEMKFTPCDKITDL--SV  183

Query  2164  TEDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAH  1985
             T+  G+K +YFP+R G +V LYQDAH  +  LPEI++D G+ +    CWEDIC+AI EAH
Sbjct  184   TKK-GVKATYFPLRIGSSVKLYQDAHGRDDLLPEIRLDGGEVYKQGKCWEDICYAISEAH  242

Query  1984  HMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKF  1805
             H++YIVGWS++HKVKLVREPT+PLP GG+L LGELLKYKS+EGVRVLLLVWDDKTSHSK+
Sbjct  243   HLIYIVGWSVFHKVKLVREPTKPLPRGGDLTLGELLKYKSEEGVRVLLLVWDDKTSHSKY  302

Query  1804  FINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDT  1625
             FINT GVM THDEETRKFFKHSSV CVL+PRY SSKLS+ KQQVVGTL+THHQKCV+VDT
Sbjct  303   FINTEGVMATHDEETRKFFKHSSVMCVLSPRYGSSKLSYFKQQVVGTLFTHHQKCVLVDT  362

Query  1624  QAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWH  1445
             Q  GNNR+ITAF+GGLDLCDGRYDTP+HRLF D DTVF+ D++NPTFP    + PRQPWH
Sbjct  363   QGYGNNRRITAFLGGLDLCDGRYDTPEHRLFRDLDTVFQDDFHNPTFP-AATRAPRQPWH  421

Query  1444  DLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSP--  1271
             DLHCK++GPAAYD+L NFEQRWRKA+KW E G R KK+SHWHDDAL+KI+RISWI SP  
Sbjct  422   DLHCKVDGPAAYDVLINFEQRWRKATKWKEFGWR-KKMSHWHDDALIKIDRISWILSPQR  480

Query  1270  ------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAK  1109
                      +P DDP+LWVS E   +NWHVQVFRSIDSGSL+GFPK V  A+ QNL CAK
Sbjct  481   EATDDDVTVIPEDDPALWVSKEEHQENWHVQVFRSIDSGSLRGFPKTVQLAKAQNLQCAK  540

Query  1108  DLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSK  929
             +LVID+SIQ AYI+AIR A+HFIYIENQYF+GSSYAWPSYK+AGADNLIPMELALKI SK
Sbjct  541   NLVIDKSIQTAYIQAIRSAEHFIYIENQYFIGSSYAWPSYKDAGADNLIPMELALKIASK  600

Query  928   IRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCD  749
             IR +ERFAVY++IPMWPEG P SA VQ+ILYWQGQT+Q MYE++A+ELK+ +I D +P D
Sbjct  601   IRAKERFAVYVIIPMWPEGDPKSAAVQEILYWQGQTMQAMYEVVARELKTMQITDLNPQD  660

Query  748   YLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSAN  569
             YLNFYCLGNREE  E+  +  +   S+ ++ S K GRFMIYVHAKGMVVDDEYVIVGSAN
Sbjct  661   YLNFYCLGNREEISEDMLNE-SDQSSDKVSDSYKYGRFMIYVHAKGMVVDDEYVIVGSAN  719

Query  568   INQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEG  389
             INQRS+AG++DTEIAMGAYQPHHTW+  + HP  Q+YGYR SLWAEHLGM+ E  DE E 
Sbjct  720   INQRSLAGTKDTEIAMGAYQPHHTWSNKKRHPRGQIYGYRTSLWAEHLGMLHECFDEPES  779

Query  388   LECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVL  209
             LECV+ VN+IAE+NW ++TAE FS LQGHLLKYPLQVD++GKV PL   E FPDVGGKV+
Sbjct  780   LECVRKVNDIAEDNWNKFTAEGFSTLQGHLLKYPLQVDADGKVEPLPNYESFPDVGGKVI  839

Query  208   GS-RTTLPDALTT  173
             G+   TLPD LTT
Sbjct  840   GAPSNTLPDVLTT  852



>ref|XP_010666738.1| PREDICTED: phospholipase D delta-like [Beta vulgaris subsp. vulgaris]
Length=848

 Score =  1172 bits (3032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 584/864 (68%), Positives = 682/864 (79%), Gaps = 33/864 (4%)
 Frame = -2

Query  2713  IISDVKMSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGN  2534
             +I +VK   G  +  +YLHGDLDL I+EAR LPNMD+ SE  R+ F++  CR P +R+  
Sbjct  1     MIENVK---GSFKRSIYLHGDLDLHIIEARCLPNMDLFSENFRRIFSS--CRAPFSRKKK  55

Query  2533  --------------KVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPV  2396
                           K+ ++ +IITSDPYV V L+GATVARTRVI N Q+P+W EHF IP+
Sbjct  56    VSTTTEGKNHGPDLKLPKNKKIITSDPYVTVNLSGATVARTRVIPNCQNPIWEEHFSIPL  115

Query  2395  AHPVSEVEFQVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRL  2216
             AH ++++EF+VKD+DV GAD IGVA + A  I S E I+DWFPI+  +GKPPKP+ AI L
Sbjct  116   AHELADIEFKVKDDDVLGADMIGVATIPALSICSAEEIDDWFPILMDNGKPPKPNAAIHL  175

Query  2215  MMKFTPCAENPRYRGGVTEDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAF  2036
              ++F  C  N    G    D+ ++ SYFP R GG VTLYQDAHV +  LP+I+++ G  +
Sbjct  176   RLRFLSCNAN---LGIADGDHSVRRSYFPARPGGRVTLYQDAHVADNELPKIELEQGVEY  232

Query  2035  HHENCWEDICHAILEAHHMVYIVGWSIYHKVKLVREPTR---plpnggnlnlgelLKYKS  1865
              H  CWEDICHAI EAHH+VYIVGWS+YHKV+LVREPT     LPN G L+LG+LLKYKS
Sbjct  233   QHGKCWEDICHAIAEAHHLVYIVGWSVYHKVRLVREPTPGRPILPNDGELSLGDLLKYKS  292

Query  1864  QEGVRVLLLVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFV  1685
             QEGVRVLLLVWDDKTSHSKFFINT GVM THDEETR+FFKHSSV C L+PRYASSKLS +
Sbjct  293   QEGVRVLLLVWDDKTSHSKFFINTQGVMQTHDEETRRFFKHSSVICTLSPRYASSKLSII  352

Query  1684  KQQVVGTLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRG  1505
             KQQVVGTLYTHHQKCVIVDTQA GNNRKITAF+GGLDLCDGRYDTP HRLF D DTV++ 
Sbjct  353   KQQVVGTLYTHHQKCVIVDTQAPGNNRKITAFLGGLDLCDGRYDTPGHRLFRDLDTVYKN  412

Query  1504  DYNNPTFPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISH  1325
             DY+NPT    G KGPR+PWHDLHCKIEGPAAYD+LTNFEQRWRKA+K        +KI H
Sbjct  413   DYHNPTL--DGSKGPREPWHDLHCKIEGPAAYDVLTNFEQRWRKATK----SSIRRKIKH  466

Query  1324  WHDDALLKIERISWITSPTPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDV  1145
             WHDDALLKI+RISWI SP+ S   +D SL    E DP+ W VQVFRSIDSGS++GFPKDV
Sbjct  467   WHDDALLKIDRISWILSPSQSASPNDLSLRACEENDPEGWQVQVFRSIDSGSVEGFPKDV  526

Query  1144  HTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNL  965
               AE+QNLVCAK+LVID+SIQ AYIEAIR AQHFIYIENQYFLGSSYAWPSYK AGAD+L
Sbjct  527   QVAESQNLVCAKNLVIDKSIQTAYIEAIRSAQHFIYIENQYFLGSSYAWPSYKNAGADHL  586

Query  964   IPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKEL  785
             IPMELALKI SKIR +ERFAVYIVIPMWPEGVPSSA  Q+IL+WQGQT+QMMY IIA+E+
Sbjct  587   IPMELALKIASKIRAKERFAVYIVIPMWPEGVPSSASAQEILFWQGQTMQMMYNIIAQEI  646

Query  784   KSEKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMV  605
             K+  ++DAHP DYLNFYCLGNRE   +   S      S  L+ SQK  RFMIYVHAKGM+
Sbjct  647   KAMNLDDAHPRDYLNFYCLGNREPTLDLVDSGHQ--SSNGLSPSQKHRRFMIYVHAKGMI  704

Query  604   VDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHL  425
             VDDEYVI+GSANINQRSMAGSRDTEIAMGAYQPHHTW+  + HP  QVYGYRMSLWAEHL
Sbjct  705   VDDEYVILGSANINQRSMAGSRDTEIAMGAYQPHHTWSSKKGHPFGQVYGYRMSLWAEHL  764

Query  424   GMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGG  245
             G +D+   EAE L+CV+ VN IA+ENWK++ A+++SP+QGHLL+YP+ V  +G V  L G
Sbjct  765   GGLDDLFKEAENLDCVRTVNYIADENWKKFVADEYSPMQGHLLRYPIFVGKDGTVQSLRG  824

Query  244   CEYFPDVGGKVLGSRTTLPDALTT  173
              E FPDVGGKVLG+  +LPDALTT
Sbjct  825   HENFPDVGGKVLGAANSLPDALTT  848



>ref|XP_008337963.1| PREDICTED: phospholipase D delta [Malus domestica]
Length=855

 Score =  1172 bits (3032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 575/860 (67%), Positives = 685/860 (80%), Gaps = 24/860 (3%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-----CRKPETRQGNK  2531
             M++  SE V YLHGDLDL I+EAR LPNMDIVSER R+ FTA D     C +     G  
Sbjct  1     MAEKTSERVTYLHGDLDLTIIEARHLPNMDIVSERFRRCFTACDTINISCNRSAEDDGRD  60

Query  2530  VRRH---TRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVK  2360
              + H    +IITSDPYV V +   TVARTRV+ NSQ+P W EHF IP+AHPV+ +EFQVK
Sbjct  61    RKPHGPHRKIITSDPYVTVVVPQTTVARTRVMKNSQNPQWKEHFFIPLAHPVTNLEFQVK  120

Query  2359  DNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPR  2180
             DNDVFGA+ IG AK+ A+KI +GE I+ WFPIIG  GKPPKP  AIR+ ++FTP  +NP 
Sbjct  121   DNDVFGAEIIGTAKIPAEKIATGEPISGWFPIIGPSGKPPKPASAIRVELQFTPFEKNPL  180

Query  2179  YRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDI  2009
             Y+ G+  D    G+  +YFP+R G +V LYQDAH PEG LPEI++D GK +  EN WEDI
Sbjct  181   YKRGIAGDPEHKGVPHTYFPLRKGSSVRLYQDAHCPEGLLPEIQLDGGKVYKQENTWEDI  240

Query  2008  CHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWD  1829
             C+AI EAHH++YIVGWS++HKV+L+REP+RPLP GGNL LG+LLKYKS+EGVRVLLLVWD
Sbjct  241   CYAISEAHHLIYIVGWSVFHKVRLIREPSRPLPRGGNLTLGDLLKYKSEEGVRVLLLVWD  300

Query  1828  DKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHH  1649
             DKTSH KF   T+G+M THDEETR+FFKHSSV CVLA RYASSKLS +KQQVVGTL+THH
Sbjct  301   DKTSHDKFCFKTAGMMATHDEETRRFFKHSSVNCVLATRYASSKLSIIKQQVVGTLFTHH  360

Query  1648  QKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGL  1469
             QKCV+VDTQA GNNRKITAF+GGLDLCDGRYDTP+HRLF D +TVF GD++ PTFP  G 
Sbjct  361   QKCVLVDTQAYGNNRKITAFLGGLDLCDGRYDTPEHRLFRDLNTVFEGDFHQPTFP-AGT  419

Query  1468  KGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERI  1289
             K PR+PWHDLHC+I+GPAAYD+L NFEQRWRKA++W E G   KK+SHWHDDAL+KI+RI
Sbjct  420   KAPREPWHDLHCRIDGPAAYDVLINFEQRWRKATQWKEFGLLRKKVSHWHDDALIKIDRI  479

Query  1288  SWITSP-------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAET  1130
             SWI SP       + ++P DDPSLWV+ E DP++WHVQ+FRSIDSGSLKGFPK    AE 
Sbjct  480   SWILSPPLSVSKDSTTIPEDDPSLWVNREEDPEDWHVQIFRSIDSGSLKGFPKAGRAAEA  539

Query  1129  QNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMEL  950
             QNL+C+K+LVID+SIQ AYI AIR AQHFIYIENQYFLGSSYAWP Y+ AGADNLIPMEL
Sbjct  540   QNLICSKNLVIDKSIQTAYIHAIRSAQHFIYIENQYFLGSSYAWPDYENAGADNLIPMEL  599

Query  949   ALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKI  770
             ALKIVSKI+  ERF VY+V+PMWPEG P +A +Q+IL+WQ QT+Q MY ++A+ LKS ++
Sbjct  600   ALKIVSKIKANERFTVYVVLPMWPEGDPKTAAMQEILFWQSQTMQAMYGVVAQALKSAQL  659

Query  769   EDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEY  590
             +D+HP DYL+FYCLG RE   E+ A+      S+    S K  RFMIYVHAKGMVVDDEY
Sbjct  660   QDSHPQDYLSFYCLGKREIPPEDMANDNASSVSD----SFKYKRFMIYVHAKGMVVDDEY  715

Query  589   VIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDE  410
             V++GSANINQRSMAG++DTEIAMGAYQPHHTWA  + HP  Q++GYRMSLWAEHLGM+D 
Sbjct  716   VMLGSANINQRSMAGTKDTEIAMGAYQPHHTWAARKKHPFGQIFGYRMSLWAEHLGMLDP  775

Query  409   KLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFP  230
                E E LEC++ VN IA+ENWKR+T   F+ LQGHLLKYP+QVD +GKV PL G E FP
Sbjct  776   CFQEPESLECMRKVNAIADENWKRFTTPDFTLLQGHLLKYPIQVDVDGKVGPLPGHENFP  835

Query  229   DVGGKVLGSR-TTLPDALTT  173
             D+GGKVLG+   T+PD LTT
Sbjct  836   DLGGKVLGAHAATVPDMLTT  855



>ref|XP_011099892.1| PREDICTED: phospholipase D delta [Sesamum indicum]
Length=862

 Score =  1172 bits (3031),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 564/862 (65%), Positives = 684/862 (79%), Gaps = 30/862 (3%)
 Frame = -2

Query  2677  ENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPET-------------RQG  2537
             E V+YLHGDL+L I EAR LPNMD+VSER+R+ FTA D  +P               R  
Sbjct  4     EPVLYLHGDLELHIFEARSLPNMDLVSERLRRCFTACDVCRPTADSGGDGSDGGGSSRHE  63

Query  2536  NKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKD  2357
              K+  H +IITSDPYV V +   T+ARTRV+SNSQ+P W E F IP+AHP++ ++ +VKD
Sbjct  64    RKLHHHRKIITSDPYVTVSVPQTTLARTRVMSNSQNPKWNERFHIPLAHPLAFLDIRVKD  123

Query  2356  NDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRY  2177
             ND+FGAD +G   + A KI SGE I+ WFP+I + GKPPKPD A+RL MKF PC +NP Y
Sbjct  124   NDIFGADTVGKVLIPAGKIASGEVISGWFPVISSSGKPPKPDTALRLEMKFVPCDKNPLY  183

Query  2176  RGGVTED---YGLKESYFPMRHGGAVTLYQDAHVP-EGSLPEIKIDDGKAFHHENCWEDI  2009
             + G+  D    G++ +YFP+R G +V LYQDAH+  E  +PEI++D+G   HH  CWEDI
Sbjct  184   KHGIAGDPSHRGVRNTYFPLRKGSSVILYQDAHISNEDKMPEIELDNGLVRHHAKCWEDI  243

Query  2008  CHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWD  1829
             C+AI EAHH++YIVGWS++HK+KL+REPTRPLP GG+L LGELLKYKSQEGVRVLLLVWD
Sbjct  244   CYAIAEAHHLIYIVGWSVFHKIKLIREPTRPLPRGGDLTLGELLKYKSQEGVRVLLLVWD  303

Query  1828  DKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHH  1649
             DKTSH KFFINT+GVM THDEET+KFF+HSSV CVL+PRY SSKLS++KQQVVG L+THH
Sbjct  304   DKTSHDKFFINTAGVMKTHDEETKKFFRHSSVICVLSPRYGSSKLSYMKQQVVGNLFTHH  363

Query  1648  QKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGL  1469
             QKCV+VDTQA GNNRKITAF+GG+DLCDGRYDTP+HRLF D +TVF+ D++ PTFPE G 
Sbjct  364   QKCVLVDTQAHGNNRKITAFLGGIDLCDGRYDTPEHRLFRDLETVFKDDFHQPTFPE-GT  422

Query  1468  KGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERI  1289
             K PRQPWHDLHC+I+GPAAYD+L NF QRWRK +KW E     KK+SHWHDDA++KIERI
Sbjct  423   KAPRQPWHDLHCRIDGPAAYDVLINFAQRWRKTTKWREFSLLRKKMSHWHDDAMIKIERI  482

Query  1288  SWITSPT---------PSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTA  1136
             SWI SP           S P DDP L+V+ E +P+NWHVQ+FRSIDSGS++GFPK    A
Sbjct  483   SWILSPAFFVSKDGTYRSSPEDDPKLYVNREENPENWHVQIFRSIDSGSVRGFPKFYDEA  542

Query  1135  ETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPM  956
             + QNL+C+K+LVIDRSIQ AYI+AIR AQHFIYIENQYFLGSSYAWP+YK+AG D+LIPM
Sbjct  543   QAQNLICSKNLVIDRSIQTAYIQAIRSAQHFIYIENQYFLGSSYAWPAYKDAGVDHLIPM  602

Query  955   ELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSE  776
             ELALKI SKIR  ERFAVY+V+PMWPEG P    +Q+IL+WQGQT+QMMY++IA E+KS 
Sbjct  603   ELALKIASKIRANERFAVYVVLPMWPEGNPKDNVMQEILFWQGQTMQMMYQVIANEIKSM  662

Query  775   KIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDD  596
             ++ D+HP DYLNF+CLGNRE +   +A     G ++ ++ SQK  RFMIYVHAKGM+VDD
Sbjct  663   QLLDSHPLDYLNFFCLGNREPFTNTAAQ--VSGDADKVSDSQKFQRFMIYVHAKGMIVDD  720

Query  595   EYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMM  416
             EYVI+GSANINQRSMAG++DTEIAMGAYQPHHTW   Q HPH +VYGYRMSLWAEHLG +
Sbjct  721   EYVIIGSANINQRSMAGTKDTEIAMGAYQPHHTWTGKQRHPHGEVYGYRMSLWAEHLGTV  780

Query  415   DEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEY  236
             +    E E LECVK VNE+ E+NWKRY ++ F+ LQGHLLKYP+ VD +G VSPL G E 
Sbjct  781   ESCFKEPETLECVKRVNEVGEDNWKRYASDDFTLLQGHLLKYPVAVDVDGNVSPLPGYEN  840

Query  235   FPDVGGKVLGSRT-TLPDALTT  173
             FPDVGG+VLG+ + T+PD LTT
Sbjct  841   FPDVGGRVLGAHSPTIPDVLTT  862



>ref|XP_009788032.1| PREDICTED: phospholipase D delta-like isoform X1 [Nicotiana sylvestris]
Length=869

 Score =  1170 bits (3028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 566/866 (65%), Positives = 689/866 (80%), Gaps = 33/866 (4%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPET--------------  2546
             +E+++ LHGDL+L I++AR LPNMD+ SER+R+ FTA D CR P T              
Sbjct  7     TEDLICLHGDLELHIVQARHLPNMDLTSERLRRCFTACDVCRNPPTDSTAADHDGDYDVP  66

Query  2545  ---RQGNKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEV  2375
                +  ++   H RIITSDPYV V      +ARTRV+ NSQ+PVW EHF IP+AHP+  +
Sbjct  67    NVKKNPDQKIHHRRIITSDPYVTVSAPHTALARTRVLPNSQNPVWDEHFHIPLAHPIDCL  126

Query  2374  EFQVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPC  2195
             EF+VKD+DVFGA  +G  ++ A+KI +GE I+ WF +IGA GKPPKP+ A++L MKF P 
Sbjct  127   EFRVKDDDVFGAQVMGKVRIPAEKIATGEIISGWFSVIGASGKPPKPNTALQLWMKFVPY  186

Query  2194  AENPRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEG-SLPEIKIDDGKAFHHE  2027
               NP Y+ G+  D    G++ +YFP+R G +V LYQDAH+     LPEI++++ + + + 
Sbjct  187   DTNPLYKQGIASDPQHLGVRNTYFPLRKGSSVKLYQDAHISNSFKLPEIELENNRVYENN  246

Query  2026  NCWEDICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRV  1847
              CWEDIC+AI EAHH+VYIVGWS++HK+KL+REPTRPLP GG+L LGELLKYKSQEGVRV
Sbjct  247   RCWEDICYAISEAHHLVYIVGWSVFHKIKLIREPTRPLPRGGDLTLGELLKYKSQEGVRV  306

Query  1846  LLLVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVG  1667
             LLLVWDDKTSH KFFINT+GVMGTHDEET+KFFKHSSV CVL+PRYASSKLS +KQQVVG
Sbjct  307   LLLVWDDKTSHDKFFINTAGVMGTHDEETKKFFKHSSVICVLSPRYASSKLSIIKQQVVG  366

Query  1666  TLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPT  1487
             T++THHQKCV+VDTQA GNNRK+TAF+GGLDLCDGRYDTP+HRLF D DTVF+ D++ PT
Sbjct  367   TMFTHHQKCVLVDTQASGNNRKVTAFLGGLDLCDGRYDTPEHRLFRDLDTVFKDDFHQPT  426

Query  1486  FPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDAL  1307
             FP  G K PRQPWHDLHC+I+GPA YD+L NF QRWRKA+KW E     K +SHWHDDA+
Sbjct  427   FPP-GTKAPRQPWHDLHCRIDGPAVYDVLINFAQRWRKATKWREFKLFKKTMSHWHDDAM  485

Query  1306  LKIERISWITSPTPSV-------PNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKD  1148
             +KIERISWI SP  +V       P DDP L V  EG  +NWH Q+FRSIDSGS++GFPK 
Sbjct  486   IKIERISWILSPAFAVLREGTEIPGDDPKLHVYGEGHSENWHAQIFRSIDSGSVQGFPKR  545

Query  1147  VHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADN  968
             +  A+ QNLVC+K+L++D+SI+ AYI+AIR AQHFIYIENQYFLGSSYAW SYK+AGAD+
Sbjct  546   IDVAQAQNLVCSKNLIVDKSIEAAYIQAIRSAQHFIYIENQYFLGSSYAWESYKDAGADH  605

Query  967   LIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKE  788
             LIPMELALKI SKIR RERF VY+V+PMWPEG P S  +Q+IL+WQ QT+QMMY++IA E
Sbjct  606   LIPMELALKITSKIRARERFCVYVVMPMWPEGDPKSITMQEILFWQSQTVQMMYQVIATE  665

Query  787   LKSEKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGM  608
             LKS ++ D+HP DYLNFYCLGNREE    S S P+ G  + ++ S K  RFMIYVHAKGM
Sbjct  666   LKSMQLLDSHPLDYLNFYCLGNREEI-PSSISQPS-GNGDKVSDSYKFQRFMIYVHAKGM  723

Query  607   VVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEH  428
             +VDDEYVIVGSANINQRS+AGS+DTEIAMGAYQPHHTWA+NQ HP  Q+YGYRMSLWAEH
Sbjct  724   IVDDEYVIVGSANINQRSLAGSKDTEIAMGAYQPHHTWAENQRHPRGQIYGYRMSLWAEH  783

Query  427   LGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLG  248
             LG ++E  +E E L CV+ VNE+AE+NWKR+ AE F+PLQGHLLKYP+QVD++GKV PL 
Sbjct  784   LGRIEECFEEPEALTCVRRVNEVAEDNWKRFAAESFTPLQGHLLKYPMQVDADGKVGPLP  843

Query  247   GCEYFPDVGGKVLGSRT-TLPDALTT  173
             GCE FPDVGGK+LG+   T+PD LTT
Sbjct  844   GCECFPDVGGKILGNHAPTIPDVLTT  869



>ref|XP_006425355.1| hypothetical protein CICLE_v10024876mg [Citrus clementina]
 gb|ESR38595.1| hypothetical protein CICLE_v10024876mg [Citrus clementina]
Length=862

 Score =  1170 bits (3028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 566/863 (66%), Positives = 685/863 (79%), Gaps = 30/863 (3%)
 Frame = -2

Query  2689  DGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPE-----------T  2546
             D   E V+YLHGDLDLKI+ ARRLPNMD++SE +R+ FTA D C+ P             
Sbjct  6     DSDKEKVIYLHGDLDLKIIRARRLPNMDMMSEHLRRCFTACDACKTPAPTHETFQDDDGV  65

Query  2545  RQGNKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQ  2366
             R  +K+ R ++IITSDPYV V +  ATVARTRV+ NSQ+PVW EHF IP+AHP+  +E Q
Sbjct  66    RHTSKIIRKSKIITSDPYVTVVVPQATVARTRVLKNSQEPVWNEHFIIPLAHPLVNLEIQ  125

Query  2365  VKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAEN  2186
             VKD+DVFGA  IG A + A  I +GE I+ W+ II   G PPKP  +I+L +KFTPC +N
Sbjct  126   VKDDDVFGAQIIGTAAIPADTIATGEFISRWYDIIAPSGSPPKPGASIQLELKFTPCDKN  185

Query  2185  PRYRGGVT---EDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWE  2015
             P YR G+    E  G++ +YFP+R G  V LYQDAHV EG LPEI +DDGK +    CWE
Sbjct  186   PLYRHGIAGDPEQKGVRNTYFPLRKGSHVRLYQDAHVTEGILPEIPLDDGKLYKPGTCWE  245

Query  2014  DICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLV  1835
             DICHAI EAHH++YIVGWS++HK+KL+REPTRPLP GG+L LGELLKYKS+EGVRVLLL+
Sbjct  246   DICHAISEAHHLIYIVGWSVFHKIKLIREPTRPLPRGGDLTLGELLKYKSEEGVRVLLLI  305

Query  1834  WDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYT  1655
             WDDKTSH K  + T+GVM THDEET+KFFKHSSV CVLAPRYASSKLS+ KQQ+VGT++T
Sbjct  306   WDDKTSHDKLGVKTAGVMATHDEETKKFFKHSSVNCVLAPRYASSKLSYFKQQIVGTIFT  365

Query  1654  HHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEG  1475
             HHQKCV+VDTQA GNNRKITAFIGG+DLCDGRYDTP+HRLF D DTVF+ D++NPT+P  
Sbjct  366   HHQKCVLVDTQASGNNRKITAFIGGIDLCDGRYDTPEHRLFRDLDTVFKDDFHNPTYPI-  424

Query  1474  GLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIE  1295
             G K PR+PWHDLHC+++GPAAYD+L NFEQRWRKA+K  EL  +FK++SHW DD L+KI 
Sbjct  425   GTKAPREPWHDLHCRLDGPAAYDVLINFEQRWRKATKLTELTFKFKRVSHWRDDYLIKIG  484

Query  1294  RISWITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHT  1139
             RISWI SP        T  VP DD  + VS E DP+NWHVQ+FRSIDSGS+KGFPK +  
Sbjct  485   RISWILSPELSLKTNGTTIVPRDDNVVRVSKEDDPENWHVQIFRSIDSGSVKGFPKSIED  544

Query  1138  AETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIP  959
              + Q+L+CAKD+VID+SIQ AYI+AIR AQHFIYIENQYFLGSSYAWPSYK AGADNLIP
Sbjct  545   IDDQSLICAKDVVIDKSIQTAYIQAIRSAQHFIYIENQYFLGSSYAWPSYKNAGADNLIP  604

Query  958   MELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKS  779
             MELALKI SKIR  ERFAVY++IPMWPEG P +  VQ+IL+WQ QT+QMMY ++A+EL+ 
Sbjct  605   MELALKIASKIRANERFAVYVIIPMWPEGDPKTNTVQEILFWQSQTMQMMYSVVAQELRE  664

Query  778   EKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVD  599
              ++ DAHP DYL+FYCLG REE  ++  ++     S+    SQK+ RFMIYVHAKGM+VD
Sbjct  665   MQV-DAHPQDYLSFYCLGKREEAPKDVLANNGDKVSD----SQKNQRFMIYVHAKGMIVD  719

Query  598   DEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGM  419
             DEYVI+GSANINQRSMAGS+DTEIAMG+YQPHHTWA+ Q HPH Q+YGYR SLW+EHLGM
Sbjct  720   DEYVIMGSANINQRSMAGSKDTEIAMGSYQPHHTWARKQKHPHGQIYGYRKSLWSEHLGM  779

Query  418   MDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCE  239
             +D   +E E L+C++ VN+IA ENW R+TA +F+PLQGHLL+YPLQVD++G VSPL G E
Sbjct  780   LDNCFEEPESLDCIRKVNQIAGENWGRFTATEFTPLQGHLLRYPLQVDADGTVSPLPGYE  839

Query  238   YFPDVGGKVLGSRT-TLPDALTT  173
              FPD GGK++G  + +LPD LTT
Sbjct  840   QFPDAGGKIIGVHSMSLPDMLTT  862



>ref|XP_011022230.1| PREDICTED: phospholipase D delta [Populus euphratica]
Length=867

 Score =  1170 bits (3026),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 579/872 (66%), Positives = 683/872 (78%), Gaps = 36/872 (4%)
 Frame = -2

Query  2695  MSDGMSEN-VVYLHGDLDLKILEARRLPNMDIVSERIRQFF-----TAFDCRKPETRQ--  2540
             M++  S N ++YLHGDLDL I++AR LPNMD++S+  RQFF     ++    KP      
Sbjct  1     MAESSSHNHLIYLHGDLDLLIVKARSLPNMDVISKNFRQFFNVCIPSSAATTKPTDHDRD  60

Query  2539  -----------GNKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVA  2393
                         +K   H  IITSD YV V +   T+ARTRV+ N+  PVW + F IP+A
Sbjct  61    HRDRGHRHHSDADKKIHHRHIITSDAYVTVTVPQVTLARTRVLKNAATPVWEQRFNIPLA  120

Query  2392  HPVSEVEFQVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLM  2213
             HPV  +EF VKDND+FGA+ IG  K+ A  +++G+ I  WFPII A GKPPKPD A+ L 
Sbjct  121   HPVKNIEFHVKDNDLFGAELIGTVKIPASTVLAGQFIQGWFPIIAASGKPPKPDTALYLE  180

Query  2212  MKFTPCAENPRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGK  2042
             +KFTP  +NP Y+ G   D    G++ +YFP+R GG VTLYQDAHV +  LPEI+ID GK
Sbjct  181   LKFTPVEKNPLYQNGFGGDPGVNGVRGTYFPVRKGGHVTLYQDAHVKDHDLPEIEIDGGK  240

Query  2041  AFHHENCWEDICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQ  1862
              F  E CWEDIC+AI EAHHM+YIVGWS+++K+KLVREPTRPLP GG+L LGELLKYKS+
Sbjct  241   VFKQEKCWEDICYAISEAHHMIYIVGWSVFYKIKLVREPTRPLPRGGDLTLGELLKYKSE  300

Query  1861  EGVRVLLLVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVK  1682
             EGVRVLLLVWDD+TSH KF I T+GVM THDEETR+FFKHSSVTCVLAPRYASSKLSF+K
Sbjct  301   EGVRVLLLVWDDRTSHDKFGIRTAGVMATHDEETRRFFKHSSVTCVLAPRYASSKLSFLK  360

Query  1681  QQVVGTLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGD  1502
             QQ+VGT++THHQKCV+VDTQA GNNRKIT FIGG+DLCDGRYDTP+HRLF D +TVF+ D
Sbjct  361   QQIVGTMFTHHQKCVLVDTQASGNNRKITTFIGGIDLCDGRYDTPEHRLFQDLNTVFQDD  420

Query  1501  YNNPTFPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHW  1322
             ++NPTFP  G K PRQPWHDLHCKI+GPAAYD L NFEQRWRKA+KW ELG RFK+ISHW
Sbjct  421   FHNPTFP-AGTKAPRQPWHDLHCKIDGPAAYDALINFEQRWRKATKWTELGLRFKRISHW  479

Query  1321  HDDALLKIERISWITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSL  1166
              DD+L+KIERISWI SP        T  VP DDP+++VS+E  P+NWHVQ+FRSIDSGSL
Sbjct  480   SDDSLIKIERISWILSPPLSEKKDGTTIVPPDDPTVYVSSEEGPENWHVQIFRSIDSGSL  539

Query  1165  KGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYK  986
             KGFPK +   + QNLV AKDLV+D+SIQ AYI+AIR AQHFIYIENQYFLGSSYAWPSYK
Sbjct  540   KGFPKTIDECQDQNLVVAKDLVVDKSIQTAYIQAIRSAQHFIYIENQYFLGSSYAWPSYK  599

Query  985   EAGADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMY  806
             +AGADNLIPMELALKIVSKIR +ERFAVY+VIP+WPEG P +  VQ+IL+WQ QT+Q MY
Sbjct  600   DAGADNLIPMELALKIVSKIRAKERFAVYVVIPLWPEGDPKTNTVQEILFWQSQTMQAMY  659

Query  805   EIIAKELKSEKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIY  626
             E IA+ELKS  + D+HP DYLNFYC+G REE  +E +S+     SE    S KS RFMIY
Sbjct  660   EKIAQELKSMDLVDSHPLDYLNFYCIGKREEIPQELSSANGGMVSE----SFKSQRFMIY  715

Query  625   VHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRM  446
             VHAKGM+VDDEYVI+GSANINQRSMAGS+DTEIAMG+YQP HTWA  + HP  Q+YGYRM
Sbjct  716   VHAKGMIVDDEYVIMGSANINQRSMAGSKDTEIAMGSYQPQHTWATRKKHPRGQIYGYRM  775

Query  445   SLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNG  266
             SLW EHLG +DE   E E L CVK VN+IAE+NW+++T   F  LQGHLLKYPL VD++G
Sbjct  776   SLWVEHLGGIDELFMEPEDLHCVKKVNKIAEDNWRKFTDPNFKLLQGHLLKYPLLVDADG  835

Query  265   KVSPLGGCEYFPDVGGKVLGSR-TTLPDALTT  173
             KV PL G E FPDVGGKVLG+  TTLPD LTT
Sbjct  836   KVCPLPGHENFPDVGGKVLGAHSTTLPDVLTT  867



>ref|XP_010526824.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase D delta-like [Tarenaya 
hassleriana]
Length=859

 Score =  1169 bits (3025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 582/864 (67%), Positives = 680/864 (79%), Gaps = 28/864 (3%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETR-------Q  2540
             M+D  SE V+ LHGDLDLKI++ARRLPNMD+ SE +R+ FTA D C  P           
Sbjct  1     MADKASEEVMLLHGDLDLKIVKARRLPNMDLFSENLRRCFTACDACTTPSANVDSAGNGD  60

Query  2539  GNKVRR-----HTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEV  2375
             G+ VR      H +IITSDPYV V +  +T+ARTRV+ NS+DP W EHF + +AHP+  +
Sbjct  61    GDGVRDRDSHGHRKIITSDPYVTVVVPQSTLARTRVLKNSEDPHWNEHFVVCLAHPLPYL  120

Query  2374  EFQVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPC  2195
             EFQVKD+DVFGA+ IG AK+ A++I SG+ I+ WFP++ A GKPPK D AI L M+FTP 
Sbjct  121   EFQVKDDDVFGAELIGSAKIPAKEIASGQRISGWFPVLDASGKPPKKDTAIYLEMQFTPF  180

Query  2194  AENPRYRGGVTEDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWE  2015
               NP YR G+T D G   +YFP+R G  V LYQDAHV +G LPEI++DDGK F  E CWE
Sbjct  181   DRNPTYRRGITGDKG---TYFPLRKGSHVRLYQDAHVMDGMLPEIELDDGKVFRQEKCWE  237

Query  2014  DICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLV  1835
             DIC+AI EAHHM+YIVGWS++HKVKLVREPTRPLP GG+L LGELLKYKS+EGVRVLLLV
Sbjct  238   DICYAISEAHHMIYIVGWSVFHKVKLVREPTRPLPRGGDLTLGELLKYKSEEGVRVLLLV  297

Query  1834  WDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYT  1655
             WDDKTSH KF   T+GVM THDEETRKFFKHSSV CVL+PRYASSKL   KQQVVGTL+T
Sbjct  298   WDDKTSHDKFGFRTAGVMQTHDEETRKFFKHSSVICVLSPRYASSKLGLFKQQVVGTLFT  357

Query  1654  HHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEG  1475
             HHQKCV+VDTQA GNNRKITAFIGG+DLCDGRYDTP+HRLF D DTVF+ D++NPTFP  
Sbjct  358   HHQKCVLVDTQAAGNNRKITAFIGGIDLCDGRYDTPEHRLFRDLDTVFKDDFHNPTFPN-  416

Query  1474  GLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIE  1295
             G K PRQPWHDLHC+I+GPAAYD+L NFEQRWRKA++W E   RFK    W DDAL++I 
Sbjct  417   GTKAPRQPWHDLHCRIDGPAAYDVLINFEQRWRKATRWKEFSFRFKGKRRWKDDALIRIG  476

Query  1294  RISWITSP--------TPSVPNDD-PSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVH  1142
             RISWI SP        T  VP DD P +WVS E DP+NWHVQ+FRSIDSGS+KGFPK   
Sbjct  477   RISWILSPAFSNLKDGTTVVPKDDGPIVWVSKEDDPENWHVQIFRSIDSGSVKGFPKYTD  536

Query  1141  TAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLI  962
              AE  NLVCAK LV+D+SIQ AYI+AIR AQHFIYIENQYFLGSSYAWPSYK+AGADNL+
Sbjct  537   EAEAVNLVCAKRLVVDKSIQTAYIQAIRSAQHFIYIENQYFLGSSYAWPSYKDAGADNLV  596

Query  961   PMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELK  782
             PMELALKI +KIR RERFAVYIVIP+WPEG P S PVQ+ILYWQ QT+QMMY +IAKEL 
Sbjct  597   PMELALKIATKIRARERFAVYIVIPLWPEGDPKSGPVQEILYWQSQTMQMMYGVIAKELT  656

Query  781   SEKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVV  602
             S ++ DAHP DYLNFY LG RE+   ES      G    +  S K  RFMIYVHAKGM+V
Sbjct  657   SMQMLDAHPLDYLNFYFLGKREQL-PESLMDNNGGNGNSVPDSYKFKRFMIYVHAKGMIV  715

Query  601   DDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLG  422
             DD+YVI+GSANINQRS+AG++DTEIAMGAYQPH TW+ N+ HP  QVYGYRMSLWAEHLG
Sbjct  716   DDQYVIIGSANINQRSLAGTKDTEIAMGAYQPHRTWSANRKHPRGQVYGYRMSLWAEHLG  775

Query  421   MMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGC  242
                    EAE +ECV+ VN+IAE+NW ++TAE+F+ L+GHL+KYPLQVDS+G+VS L   
Sbjct  776   GTSRHFVEAEDVECVRAVNQIAEDNWNKFTAEEFAELKGHLIKYPLQVDSDGRVSSLPDF  835

Query  241   EYFPDVGGKVLGSRTT-LPDALTT  173
             E FPDVGGK++G+ +  LPDALTT
Sbjct  836   EDFPDVGGKIIGAHSVALPDALTT  859



>ref|XP_009363437.1| PREDICTED: phospholipase D delta-like [Pyrus x bretschneideri]
Length=855

 Score =  1168 bits (3022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 576/860 (67%), Positives = 684/860 (80%), Gaps = 24/860 (3%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-----CRKPETRQGNK  2531
             M++  SE V YLHGDLDL I+EA  LPNMDI+SER R+ FTA D     C +     G  
Sbjct  1     MAEKTSERVTYLHGDLDLTIVEACHLPNMDIISERFRRCFTACDTINISCHRSAEDDGRD  60

Query  2530  VRRH---TRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVK  2360
              + H    +IITSDPYV V +   TVARTRVI NSQ+P W EHF IP+AHPV+ +EFQVK
Sbjct  61    RKPHGPHRKIITSDPYVTVVVPQTTVARTRVIKNSQNPQWKEHFFIPLAHPVTNLEFQVK  120

Query  2359  DNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPR  2180
             DNDVFGA+ IG AK+ A+KI +GE I+ WFPIIG  GKPPKPD AIR+ ++FTP  +NP 
Sbjct  121   DNDVFGAEIIGTAKIPAEKIATGEPISGWFPIIGPSGKPPKPDSAIRVELQFTPFEKNPL  180

Query  2179  YRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDI  2009
             Y+ G+  D    G+  +YFP+R G +V LYQDAH PEG LP+I++D GK +  EN WEDI
Sbjct  181   YKQGIAGDPEHKGVPHTYFPLRKGSSVRLYQDAHCPEGLLPKIQLDGGKVYKQENTWEDI  240

Query  2008  CHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWD  1829
             C+AI EAHH++YIVGWS++HKV+L+REP+RPLP GGNL LG+LLKYKS+EGVRVLLLVWD
Sbjct  241   CYAISEAHHLIYIVGWSVFHKVRLIREPSRPLPRGGNLMLGDLLKYKSEEGVRVLLLVWD  300

Query  1828  DKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHH  1649
             DKTSH KF   T+G+M THDEETRKFFKHSSV CVLA RYAS+KLS +KQQVVGTL+THH
Sbjct  301   DKTSHDKFCFKTAGMMATHDEETRKFFKHSSVNCVLATRYASNKLSIIKQQVVGTLFTHH  360

Query  1648  QKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGL  1469
             QKCV+VDTQA GNNRKITAF+GGLDLCDGRYDTP+HRLF D +TVF GD++ PTFP  G 
Sbjct  361   QKCVLVDTQAYGNNRKITAFLGGLDLCDGRYDTPEHRLFHDLNTVFEGDFHQPTFP-AGT  419

Query  1468  KGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERI  1289
             K PRQPWHDLHC+I+GPAAYD+L NFEQRWRKA++W E G   KK+SHWHDDAL+KI+RI
Sbjct  420   KAPRQPWHDLHCRIDGPAAYDVLINFEQRWRKATQWKEFGLLRKKVSHWHDDALIKIDRI  479

Query  1288  SWITSPTPSV-------PNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAET  1130
             SWI SP  SV       P DDPSLWV+ E DP++WHVQ+FRSIDSGSLKGFPK    AE 
Sbjct  480   SWILSPPLSVSKDGTTIPEDDPSLWVTREEDPEDWHVQIFRSIDSGSLKGFPKAGRAAEA  539

Query  1129  QNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMEL  950
             QNL+C+K+LVID+SIQ AYI AIR AQHFIYIENQYFLGSSYAWP Y+ AGADNLIPMEL
Sbjct  540   QNLICSKNLVIDKSIQTAYIHAIRSAQHFIYIENQYFLGSSYAWPDYENAGADNLIPMEL  599

Query  949   ALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKI  770
             ALKIVSKI+  ERF VY+V+PMWPEG P +A +Q+IL+WQ QT+Q MY ++A+ LKS ++
Sbjct  600   ALKIVSKIKANERFTVYVVLPMWPEGDPKTAAMQEILFWQSQTMQAMYSVVAQALKSAQL  659

Query  769   EDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEY  590
             +D+HP DYL+FYCLG RE   E+ A+      S+    S K  RFMIYVHAKGMVVDDEY
Sbjct  660   QDSHPQDYLSFYCLGKREIPPEDMANDNASSVSD----SFKYKRFMIYVHAKGMVVDDEY  715

Query  589   VIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDE  410
             V++GSANINQRSMAG++DTEIAMGAYQPHHTWA  + HP  Q+YGYR SLWAEHLG++D 
Sbjct  716   VLLGSANINQRSMAGTKDTEIAMGAYQPHHTWAARKKHPFGQIYGYRRSLWAEHLGILDP  775

Query  409   KLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFP  230
                E E LEC++ VN IA+ENWKR+T  +F+ LQGHLLKYP+QVD +GKV PL G E FP
Sbjct  776   CFQEPESLECMRKVNAIADENWKRFTTPEFTLLQGHLLKYPIQVDVDGKVGPLPGHENFP  835

Query  229   DVGGKVLGSRT-TLPDALTT  173
             DVGGKVLG+ +  +PD LTT
Sbjct  836   DVGGKVLGAHSAAVPDMLTT  855



>gb|AEI99558.1| phospholipase D delta [Litchi chinensis]
Length=865

 Score =  1168 bits (3022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 575/856 (67%), Positives = 682/856 (80%), Gaps = 29/856 (3%)
 Frame = -2

Query  2668  VYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETR--------QGNKVRRHT  2516
              YLHGDLDLKI+ ARRLPNMD+V+   R+ FTA D CR P            G+  + H 
Sbjct  15    TYLHGDLDLKIIAARRLPNMDVVASNFRRCFTACDACRPPHPSSRPPSVHGDGDNKKSHH  74

Query  2515  RIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGAD  2336
             +IIT+DPYV V +  ATVARTRV+ N+Q P W EHF IP+AHPV ++EFQVKD+DVFGA+
Sbjct  75    KIITTDPYVTVVVPQATVARTRVLKNTQSPHWDEHFVIPLAHPVVDLEFQVKDDDVFGAE  134

Query  2335  FIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT--  2162
              IG AK+ A  I +G+ I+DWFPII A G+PP+ D AIRL MKFTPC ENP YR GV   
Sbjct  135   LIGKAKIPASLIAAGDVISDWFPIINAKGQPPRLDAAIRLEMKFTPCEENPLYRHGVAGD  194

Query  2161  -EDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAH  1985
              E  G++ +YFP+R G  +TLYQDAHV  G LPE+K+D    +  + CWEDIC+AI EAH
Sbjct  195   PEQSGVRRTYFPLRKGCQLTLYQDAHVKPGQLPEVKLDGHVDYKADTCWEDICYAISEAH  254

Query  1984  HMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKF  1805
             H+VYIVGWS+++K+KL+REPTR LP GG+L LGELLKYKS+EGVR+LLLVWDDKTSH KF
Sbjct  255   HLVYIVGWSVFYKIKLIREPTRQLPRGGDLTLGELLKYKSEEGVRILLLVWDDKTSHDKF  314

Query  1804  FINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDT  1625
              + T GVMGTHDEETRKFFKHSSV CVLAPRYASSKL   KQQVVGT++THHQKCVIVDT
Sbjct  315   GVKTGGVMGTHDEETRKFFKHSSVNCVLAPRYASSKLGIFKQQVVGTMFTHHQKCVIVDT  374

Query  1624  QAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWH  1445
             QA GNNRKITAFIGG+DLCDGRYDTP+HRLF D +T+F GD++NPT+P   +K PRQPWH
Sbjct  375   QASGNNRKITAFIGGIDLCDGRYDTPEHRLFRDLNTIFEGDFHNPTYP-STVKAPRQPWH  433

Query  1444  DLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSP--  1271
             DLHC+I+GPAAYD+L NFEQRWRK++KW E   +FKK+SHWHDD+L+KIERISWI SP  
Sbjct  434   DLHCRIDGPAAYDVLINFEQRWRKSTKWKEFSLKFKKVSHWHDDSLIKIERISWILSPEL  493

Query  1270  ------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTA--ETQNLVC  1115
                   T  VP DD  + VS+E +P+NWHVQVFRSIDSGSLKGFPK ++    E QNL+C
Sbjct  494   SSTREGTTIVPTDDRIVRVSDEKNPENWHVQVFRSIDSGSLKGFPKSINIKQIEEQNLLC  553

Query  1114  AKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIV  935
             AKDLVI++SIQ AYI+AIR AQH+IYIENQYFLGSSYAWPSYK+AGADNLIPMELALKI 
Sbjct  554   AKDLVIEKSIQAAYIQAIRSAQHYIYIENQYFLGSSYAWPSYKDAGADNLIPMELALKIA  613

Query  934   SKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIE-DAH  758
             SKIR +ERFAVYI+IPMWPEG P    VQ+IL+WQ QT+QMMY I+A+ LK  +++ D+H
Sbjct  614   SKIRAKERFAVYIIIPMWPEGDPKDNTVQEILFWQSQTMQMMYNIVAQALKDMQMDMDSH  673

Query  757   PCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVG  578
             P DYLNFYCLGNREE  ++++++     SE    SQK+ RFMIYVHAKG++VDDEYVIVG
Sbjct  674   PQDYLNFYCLGNREELPKDASNTNGATVSE----SQKNRRFMIYVHAKGIIVDDEYVIVG  729

Query  577   SANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDE  398
             SANINQRSMAG++DTEIAMGAYQPHHTWAK +  P  QVYGYRMSLWAEHLG ++    E
Sbjct  730   SANINQRSMAGTKDTEIAMGAYQPHHTWAKKKKRPFGQVYGYRMSLWAEHLGELESHFKE  789

Query  397   AEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGG  218
              E LECVK VN+IA+ENWKR+TA  F+ LQGHLLKYPL +  +GKV PL G E FPD GG
Sbjct  790   PESLECVKRVNDIADENWKRFTAPDFTLLQGHLLKYPLHICKDGKVEPLPGHENFPDAGG  849

Query  217   KVLGSRTT-LPDALTT  173
             +V+G  +  LPD LTT
Sbjct  850   RVIGIHSMRLPDVLTT  865



>ref|XP_007017920.1| Phospholipase D isoform 2 [Theobroma cacao]
 gb|EOY15145.1| Phospholipase D isoform 2 [Theobroma cacao]
Length=750

 Score =  1167 bits (3020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 566/751 (75%), Positives = 656/751 (87%), Gaps = 8/751 (1%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQGNKVRRH  2519
             M+D +S+++V LHG+LDLKI+EAR LPNMD++SER+R+  TAFD CR P +R+  K   H
Sbjct  1     MADDISDSIVRLHGELDLKIIEARCLPNMDLLSERLRRCLTAFDTCRAPFSRR-KKNHHH  59

Query  2518  TRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGA  2339
              +IITSDPYV VCLAGATVARTRVISNSQ+P+W E FKIP+AHP S VEF VKDNDVFGA
Sbjct  60    RKIITSDPYVTVCLAGATVARTRVISNSQNPIWNERFKIPLAHPASHVEFHVKDNDVFGA  119

Query  2338  DFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTE  2159
             DFIGVA VSA K+++GET++ WFPII ++GKPPKPDCA+RL M+F  C E P YR G+  
Sbjct  120   DFIGVATVSAVKVLAGETVSGWFPIISSYGKPPKPDCAVRLEMRFIKCEEIPFYRYGMAA  179

Query  2158  ---DYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEA  1988
                ++G+   YFP+RHGG+VTLYQDAHV E  LP+I++++G  F HE CWEDICHAILEA
Sbjct  180   NPTEFGIGNCYFPVRHGGSVTLYQDAHVKESMLPDIELENGTVFKHEPCWEDICHAILEA  239

Query  1987  HHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSK  1808
             HH+VYIVGWSI+H+VKLVREPTRPLP+GGNL+LG+LLKYKSQEGVRVLLLVWDDKTSHSK
Sbjct  240   HHLVYIVGWSIFHEVKLVREPTRPLPSGGNLSLGDLLKYKSQEGVRVLLLVWDDKTSHSK  299

Query  1807  FFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVD  1628
             FFINTSGVM THDEETRKFFKHSSV+CVL+PRYASSKLS  KQQVVGTL+THHQKCVIVD
Sbjct  300   FFINTSGVMQTHDEETRKFFKHSSVSCVLSPRYASSKLSIFKQQVVGTLFTHHQKCVIVD  359

Query  1627  TQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPW  1448
             +QA GNNRKITAFIGGLDLCDGRYDTP+HRLF D +TVFR DY+NPTF   G KGPRQPW
Sbjct  360   SQASGNNRKITAFIGGLDLCDGRYDTPEHRLFQDLNTVFRDDYHNPTF-SAGTKGPRQPW  418

Query  1447  HDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPT  1268
             HDLHCK+EGPAAYDIL NFEQRWRKA KW+E G RF++++ WHDD+L+K+ERISWI SP+
Sbjct  419   HDLHCKVEGPAAYDILANFEQRWRKAIKWSEFGLRFQRVTRWHDDSLIKLERISWILSPS  478

Query  1267  PSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRS  1088
              SV NDDP+LWVS EGDP+NWHVQVFRSIDSGS+KGFPKDV+ AE+QNLVCAK+LVID+S
Sbjct  479   ASVSNDDPALWVSKEGDPENWHVQVFRSIDSGSVKGFPKDVYQAESQNLVCAKNLVIDKS  538

Query  1087  IQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERF  908
             +Q AYI+AIR AQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKI SKIR +ERF
Sbjct  539   LQTAYIQAIRCAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIASKIRAKERF  598

Query  907   AVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCL  728
             AVY+VIPMWPEGVPSSA VQ+IL+WQGQTIQMMY IIA+ELKS ++E++HP DYLNFYCL
Sbjct  599   AVYVVIPMWPEGVPSSASVQEILFWQGQTIQMMYGIIAQELKSMRMENSHPQDYLNFYCL  658

Query  727   GNREEWHEE--SASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRS  554
             GNREE  +E   +SS      + ++ SQK  RFMIYVHAKGM+VDDEYVI+GSANINQRS
Sbjct  659   GNREEIPKEFSGSSSSLSNNGDSVSASQKFQRFMIYVHAKGMIVDDEYVILGSANINQRS  718

Query  553   MAGSRDTEIAMGAYQPHHTWAKNQNHPHAQV  461
             +AGSRDTEIAMGAYQPH+TW + + HP  Q+
Sbjct  719   LAGSRDTEIAMGAYQPHYTWGERKRHPRGQI  749



>ref|XP_006467032.1| PREDICTED: phospholipase D delta-like [Citrus sinensis]
Length=862

 Score =  1166 bits (3017),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 564/863 (65%), Positives = 683/863 (79%), Gaps = 30/863 (3%)
 Frame = -2

Query  2689  DGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPE-----------T  2546
             D   E V+YLHGDLDLKI+ ARRLPNMD++SE +R+ FTA D C+ P             
Sbjct  6     DSDKEKVIYLHGDLDLKIIRARRLPNMDMMSEHLRRCFTACDACKTPAPTHETFQDDDGV  65

Query  2545  RQGNKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQ  2366
             R  +K+ R ++IITSDPYV V +  ATVARTRV+ NSQ+PVW EHF IP+AHP+  +E Q
Sbjct  66    RHTSKIIRKSKIITSDPYVTVVVPQATVARTRVLKNSQEPVWNEHFIIPLAHPLVNLEIQ  125

Query  2365  VKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAEN  2186
             VKD+DVFGA  IG A + A  I +GE I+ W+ II   G PPKP  +I+L +KFTPC +N
Sbjct  126   VKDDDVFGAQIIGTAAIPADTIATGEFISRWYDIIAPSGSPPKPGASIQLELKFTPCDKN  185

Query  2185  PRYRGGVT---EDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWE  2015
             P YR G+    E  G++ +YFP+R G  V LYQDAHV EG  PEI +DDGK +    CWE
Sbjct  186   PLYRHGIAGDPEQKGVRNTYFPLRKGSHVRLYQDAHVSEGIFPEIPLDDGKLYKPGTCWE  245

Query  2014  DICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLV  1835
             DICHAI EAHH++YIVGWS++HK+KL+REPTRPLP GG+L LGELLKYKS+EGVRVLLL+
Sbjct  246   DICHAISEAHHLIYIVGWSVFHKIKLIREPTRPLPRGGDLTLGELLKYKSEEGVRVLLLI  305

Query  1834  WDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYT  1655
             WDDKTSH K  + T+GVM THDEET+KFFKHSSV CVLAPRYASSKLS+ KQQ+VGT++T
Sbjct  306   WDDKTSHDKLGVKTAGVMATHDEETKKFFKHSSVNCVLAPRYASSKLSYFKQQIVGTIFT  365

Query  1654  HHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEG  1475
             HHQKCV+VDTQA GNNRKITAFIGG+DLCDGRYDTP+HRLF D DTVF+ D++NPT+P  
Sbjct  366   HHQKCVLVDTQASGNNRKITAFIGGIDLCDGRYDTPEHRLFRDLDTVFKDDFHNPTYPI-  424

Query  1474  GLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIE  1295
             G K PR+PWHDLHC+++GPAAYD+L NFEQRWRKA+K  EL  +FK++SHW DD L+KI 
Sbjct  425   GTKAPREPWHDLHCRLDGPAAYDVLINFEQRWRKATKLTELTFKFKRVSHWRDDYLIKIG  484

Query  1294  RISWITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHT  1139
             RISWI SP        T  VP DD  + VS E DP+NWHVQ+FRSIDSGS+KGFPK +  
Sbjct  485   RISWILSPELSLKTNGTTIVPRDDNVVRVSKEDDPENWHVQIFRSIDSGSVKGFPKSIED  544

Query  1138  AETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIP  959
              + Q+L+CAKD+VID+SIQ AYI+AIR AQHFIYIENQYFLGSSYAWPSYK AGADNLIP
Sbjct  545   IDDQSLICAKDVVIDKSIQTAYIQAIRSAQHFIYIENQYFLGSSYAWPSYKNAGADNLIP  604

Query  958   MELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKS  779
             MELALKI SKIR  ERFAVY++IPMWPEG P +  VQ+IL+WQ QT+QMMY ++A+EL+ 
Sbjct  605   MELALKIASKIRANERFAVYVIIPMWPEGDPKTNTVQEILFWQSQTMQMMYSVVAQELRE  664

Query  778   EKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVD  599
              ++ DAHP DYL+FYCLG REE  ++  ++     S+    SQK+ RFMIYVHAKGM+VD
Sbjct  665   MQV-DAHPQDYLSFYCLGKREEAPKDVLANNGDKVSD----SQKNQRFMIYVHAKGMIVD  719

Query  598   DEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGM  419
             DEYVI+GSANINQRSMAGS+DTEIAMG+YQPHHTWA+   HPH Q+YGYR SLW+EHLGM
Sbjct  720   DEYVIMGSANINQRSMAGSKDTEIAMGSYQPHHTWARKLKHPHGQIYGYRKSLWSEHLGM  779

Query  418   MDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCE  239
             +D   +E E L+C++ VN+IA ENW R+TA +F+PLQGHLL+YPLQVD++G VSPL G E
Sbjct  780   LDNCFEEPESLDCIRKVNQIAGENWGRFTAMEFTPLQGHLLRYPLQVDADGTVSPLPGYE  839

Query  238   YFPDVGGKVLGSRT-TLPDALTT  173
              FPD GGK++G  + +LPD LTT
Sbjct  840   QFPDAGGKIIGVHSMSLPDMLTT  862



>gb|AES95217.2| phospholipase D alpha 1 [Medicago truncatula]
Length=872

 Score =  1165 bits (3014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 564/867 (65%), Positives = 682/867 (79%), Gaps = 37/867 (4%)
 Frame = -2

Query  2677  ENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKV----------  2528
             +   YLHGDLDL I+ ARRLPNMD+ SER  +  TA D  K  +   +            
Sbjct  11    DGFTYLHGDLDLTIISARRLPNMDMFSERFCRCITACDTIKFHSPPSDSTTTAADGGTTT  70

Query  2527  -RRH---TRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVK  2360
              R H    +II SDPYV V +  ATVARTRV+ NS +P W E F IP+AHPV ++E +VK
Sbjct  71    HREHHHRRKIIRSDPYVTVSVPQATVARTRVLKNSLNPEWKERFHIPLAHPVIDLEIRVK  130

Query  2359  DNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPR  2180
             D+DVFGA+ +G+ K+ A++I +GE I+ WFPI+ + GKPPKPD A+ + MKFTP  ENP 
Sbjct  131   DDDVFGAEVMGMVKIPAKRIATGELISGWFPIVASSGKPPKPDTALNIEMKFTPVDENPL  190

Query  2179  YRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDI  2009
             Y  G+  D    G++ +YFP+R G +V LYQDAH PEG++PEI++D+GK +  ENCWEDI
Sbjct  191   YLRGIAADPEHGGVRHTYFPVRKGSSVRLYQDAHCPEGTVPEIQLDNGKVYRAENCWEDI  250

Query  2008  CHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWD  1829
             C+AI EAHHMVY+ GWSIY KVKLVREP+RPLP GG+L LG+LLKYKS+EGVRVLLLVWD
Sbjct  251   CYAITEAHHMVYLAGWSIYDKVKLVREPSRPLPKGGDLTLGDLLKYKSEEGVRVLLLVWD  310

Query  1828  DKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHH  1649
             DKTSH K F  T+GVM THDEETRKFFKHSSV CVLAPRYASSK+SF+KQQVVGT++THH
Sbjct  311   DKTSHDKLFFKTTGVMETHDEETRKFFKHSSVMCVLAPRYASSKMSFIKQQVVGTVFTHH  370

Query  1648  QKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGL  1469
             QKCVIVD QA GNNR++  FIGGLDLCDGRYDTP+HRLF D DTVF GD++NPTFP  G 
Sbjct  371   QKCVIVDAQAAGNNRRVATFIGGLDLCDGRYDTPEHRLFRDLDTVFAGDFHNPTFP-SGT  429

Query  1468  KGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERI  1289
             + PRQPWHDLHC+I+GPAAYD+L NFEQRWRKA+KW E    FKK S W+DDAL++++RI
Sbjct  430   RAPRQPWHDLHCRIDGPAAYDVLINFEQRWRKATKWKEFAILFKKASQWNDDALIRVDRI  489

Query  1288  SWITS------PTPS--------VPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPK  1151
             SWI S      PTP         VP DDP LWVS+E DP+NWHVQ+FRSIDSGSLKGFPK
Sbjct  490   SWILSPSLPTLPTPKESKEGYTIVPGDDPLLWVSSENDPENWHVQIFRSIDSGSLKGFPK  549

Query  1150  DVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGAD  971
                 A +QNL+CAK+L I++SIQ  YI+AIR AQHFIYIENQYF+GSSYAWPSY  AGAD
Sbjct  550   RADQALSQNLICAKNLTIEKSIQTGYIQAIRSAQHFIYIENQYFIGSSYAWPSYNNAGAD  609

Query  970   NLIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAK  791
             NLIPMELALKI SKI+ +ERFA+YIV+PMWPEG P S  VQ+IL+WQ QT+QMMY ++AK
Sbjct  610   NLIPMELALKIASKIKAKERFAIYIVLPMWPEGDPKSGAVQEILFWQAQTMQMMYNVVAK  669

Query  790   ELKSEKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKG  611
             ELKS ++ D HP DYLNFYCLGNRE ++EES+ S     S  ++G+ K  R MIYVHAKG
Sbjct  670   ELKSMQLSDVHPQDYLNFYCLGNREHFNEESSGS----NSAPVSGAFKYRRNMIYVHAKG  725

Query  610   MVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAE  431
             M+VDDEYVI+GSANINQRSMAG++DTEIAMG+YQPH+TW+  + HPH Q+YGYRMSLWAE
Sbjct  726   MIVDDEYVILGSANINQRSMAGTKDTEIAMGSYQPHYTWSARKKHPHGQIYGYRMSLWAE  785

Query  430   HLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPL  251
             HLGM+DE   E E LECV+ VNEIA++NW++Y +E+ S LQGHLLKYP+Q+DS+G+VS L
Sbjct  786   HLGMLDETFKEPERLECVRKVNEIADDNWRKYASEEMSLLQGHLLKYPVQIDSDGQVSSL  845

Query  250   GGCEYFPDVGGKVLGSRT-TLPDALTT  173
               C+ FPD GGK+LG+ + T+PD LTT
Sbjct  846   PDCDSFPDAGGKILGAHSATIPDILTT  872



>gb|KDO38440.1| hypothetical protein CISIN_1g002960mg [Citrus sinensis]
Length=862

 Score =  1164 bits (3012),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 565/863 (65%), Positives = 682/863 (79%), Gaps = 30/863 (3%)
 Frame = -2

Query  2689  DGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPE-----------T  2546
             D   E V+YLHGDLDLKI+ ARRLPNMD++SE +R+ FTA D C+ P             
Sbjct  6     DSDKEKVIYLHGDLDLKIIRARRLPNMDMMSEHLRRCFTACDVCKTPAPTHETFQDDDGV  65

Query  2545  RQGNKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQ  2366
             R  +K+ R ++IITSDPYV V +  ATVARTRV+ NSQ+PVW EHF IP+AHP+S +E Q
Sbjct  66    RHTSKIIRKSKIITSDPYVTVVVPQATVARTRVLKNSQEPVWNEHFNIPLAHPLSNLEIQ  125

Query  2365  VKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAEN  2186
             VKD+DVFGA  IG A + A  I +GE I+ W+ II   G PPKP  +I+L +KFTPC +N
Sbjct  126   VKDDDVFGAQIIGTAAIPAHTIATGELISRWYDIIAPSGSPPKPGASIQLELKFTPCDKN  185

Query  2185  PRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWE  2015
             P YR G+  D    G++ +YFP+R G  V LYQDAHV EG LPEI +D GK +    CWE
Sbjct  186   PLYRQGIAGDPEHKGVRNAYFPLRKGSHVRLYQDAHVTEGILPEIPLDGGKLYKPGTCWE  245

Query  2014  DICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLV  1835
             DICHAI EAHH++YIVGWS++HK+KL+RE TRPLP GG+L LGELLKYKS+EGVRVLLLV
Sbjct  246   DICHAISEAHHLIYIVGWSVFHKIKLIREQTRPLPRGGDLTLGELLKYKSEEGVRVLLLV  305

Query  1834  WDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYT  1655
             WDDKTSH K  + T GVM THDEET+KFFKHSSV CVLAPRYASSKLS+ KQQ+VGT++T
Sbjct  306   WDDKTSHDKLGVKTPGVMATHDEETKKFFKHSSVNCVLAPRYASSKLSYFKQQIVGTIFT  365

Query  1654  HHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEG  1475
             HHQKCV+VDTQA GNNRKITAFIGG+DLCDGRYDTP+HRLF D DTVF+ D++NPT+P  
Sbjct  366   HHQKCVLVDTQASGNNRKITAFIGGIDLCDGRYDTPEHRLFRDLDTVFKDDFHNPTYPI-  424

Query  1474  GLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIE  1295
             G K PR+PWHDLHC+++GPAAYD+L NFEQRWRKA+K  EL  +FK++SHW DD L+KI 
Sbjct  425   GTKAPREPWHDLHCRLDGPAAYDVLINFEQRWRKATKLTELTFKFKRVSHWRDDYLIKIG  484

Query  1294  RISWITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHT  1139
             RISWI SP        T  VP DD  + VS E DP+NWHVQ+FRSIDSGS+KGFPK +  
Sbjct  485   RISWILSPELSLKTNGTTIVPRDDNVVRVSKEDDPENWHVQIFRSIDSGSVKGFPKSIED  544

Query  1138  AETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIP  959
              + Q+L+CAKD+VID+SIQ AYI+AIR AQHFIYIENQYFLGSSYAWPSYK AGADNLIP
Sbjct  545   IDDQSLICAKDVVIDKSIQTAYIQAIRSAQHFIYIENQYFLGSSYAWPSYKNAGADNLIP  604

Query  958   MELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKS  779
             MELALKI SKIR  ERFAVY++IPMWPEG P +  VQ+IL+WQ QT+QMMY ++A+EL+ 
Sbjct  605   MELALKIASKIRANERFAVYVIIPMWPEGDPKTNTVQEILFWQSQTMQMMYSVVAQELRE  664

Query  778   EKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVD  599
              ++ DAHP DYL+FYCLG REE  ++  ++     S+    SQK+ RFMIYVHAKGM+VD
Sbjct  665   MQV-DAHPQDYLSFYCLGKREEAPKDVLANNGDKVSD----SQKNQRFMIYVHAKGMIVD  719

Query  598   DEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGM  419
             DEYVI+GSANINQRSMAGS+DTEIAMG+YQPHHTWA+   HPH Q+YGYR SLW+EHLGM
Sbjct  720   DEYVIMGSANINQRSMAGSKDTEIAMGSYQPHHTWARKLKHPHGQIYGYRKSLWSEHLGM  779

Query  418   MDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCE  239
             +D   +E E L+C++ VN+IA ENW R+TA +F+PLQGHLL+YPLQVD++G VSPL G E
Sbjct  780   LDNCFEEPESLDCIRKVNQIAGENWGRFTAMEFTPLQGHLLRYPLQVDADGTVSPLPGYE  839

Query  238   YFPDVGGKVLGSRT-TLPDALTT  173
              FPD GGK++G  + +LPD LTT
Sbjct  840   QFPDAGGKIIGVHSMSLPDMLTT  862



>ref|XP_008440879.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase D delta [Cucumis 
melo]
Length=857

 Score =  1163 bits (3009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 564/865 (65%), Positives = 685/865 (79%), Gaps = 32/865 (4%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTA-----FDCRKPETRQGNK  2531
             M++ + E  VYLHGDLDLKI+ A  LPNMDIVS+ +R+ FTA     +   K    +   
Sbjct  1     MAESLEE--VYLHGDLDLKIIAAVHLPNMDIVSDNLRRCFTACGTVNYSAIKSVATKSRS  58

Query  2530  V-------RRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVE  2372
             V         H +IITSDPYV V +  ATVARTRVI NSQ+P W EHF IP+A  ++E+E
Sbjct  59    VAGEAKAHHGHGKIITSDPYVTVRVPQATVARTRVIKNSQNPHWNEHFVIPLAQKMAELE  118

Query  2371  FQVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCA  2192
             FQVKD+DVFGA+ +G  K+ AQ I SG+TI+ W+ +IG++GKPPKPD A+R+ MKFT   
Sbjct  119   FQVKDDDVFGAEVMGTVKIPAQDIASGKTISGWYTVIGSNGKPPKPDTALRIEMKFTSVE  178

Query  2191  ENPRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENC  2021
             ENP YR G+  D    G++ +YFP+R G ++ LYQDAHVP+G LP+I++D G  +  E C
Sbjct  179   ENPIYRHGIAGDPEHRGVQHTYFPVRKGSSMRLYQDAHVPDGLLPQIELDGGNVYRQEKC  238

Query  2020  WEDICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLL  1841
             WEDIC+AI EAHHM+YIVGWS++HKVKLVREPTRPLP GG+L LG+LLKYKS+EGVRVL+
Sbjct  239   WEDICYAISEAHHMIYIVGWSVFHKVKLVREPTRPLPRGGDLTLGDLLKYKSEEGVRVLM  298

Query  1840  LVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTL  1661
             ++WDDKTSH KFFINT G+M THDEET KFFKHSSV CVL+PRY S KLS+VKQ+VVGT+
Sbjct  299   MIWDDKTSHDKFFINTEGLMQTHDEETXKFFKHSSVICVLSPRYPSGKLSYVKQKVVGTV  358

Query  1660  YTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFP  1481
             +THHQKCV+VDTQ  GNNRKITAF+GGLDLCDGRYDTP+HRLF D DTVF+ D++NPT P
Sbjct  359   FTHHQKCVLVDTQGYGNNRKITAFLGGLDLCDGRYDTPEHRLFHDLDTVFKDDFHNPTIP  418

Query  1480  EGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLK  1301
              G  K PRQPWHDLHC+I+GPAAYD+L NFEQRW KA++W E G R ++I+HWH DAL+K
Sbjct  419   PGA-KAPRQPWHDLHCRIDGPAAYDLLINFEQRWNKATRWTEFGLRCRRITHWH-DALIK  476

Query  1300  IERISWITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDV  1145
             IERISWI SP        +  VP DDP ++VS E DP+NWHVQ+FRSIDSGS+KGFPKDV
Sbjct  477   IERISWILSPHVTLLEDGSTKVPEDDPKVYVSKEEDPENWHVQIFRSIDSGSVKGFPKDV  536

Query  1144  HTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNL  965
             H AE+QNLVCAK+L I++SI+MAYI+AIR AQHFIYIENQYF+GSSY WP YK AGADNL
Sbjct  537   HLAESQNLVCAKNLAIEKSIEMAYIQAIRSAQHFIYIENQYFIGSSYGWPGYKNAGADNL  596

Query  964   IPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKEL  785
             IPMELALKI SKIR +ERF VYI+IPMWPEG P+S P+Q+ILYWQGQT+QMMY+I+A EL
Sbjct  597   IPMELALKIASKIRAKERFVVYIIIPMWPEGDPNSGPMQEILYWQGQTMQMMYDIVASEL  656

Query  784   KSEKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMV  605
             KS    D HP D+LNFYCLG REE  E   ++  P     L    K+ RFMIYVHAKGM+
Sbjct  657   KSSGQPDLHPQDFLNFYCLGKREEIPENGPTTDDPTACNSL----KNRRFMIYVHAKGMI  712

Query  604   VDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHL  425
             VDDEYVI+GSANINQRSMAG++DTEIA GAYQPHHTWAK + HPH Q+YGYRMSLW+EHL
Sbjct  713   VDDEYVIIGSANINQRSMAGTKDTEIATGAYQPHHTWAKKKKHPHGQIYGYRMSLWSEHL  772

Query  424   GMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGG  245
             GM++   +E E LECV+ +N IAE+NW R+   +F  LQGHLL+YP+ VD +GK++PL G
Sbjct  773   GMLNPCFEEPETLECVRKINGIAEDNWNRFVDNEFRTLQGHLLRYPVLVDDDGKINPLPG  832

Query  244   CEYFPDVGGKVLGSRT-TLPDALTT  173
              E FPDVGGK++GS +  +PD +TT
Sbjct  833   HENFPDVGGKIIGSHSAAIPDVVTT  857



>ref|XP_006340788.1| PREDICTED: phospholipase D delta-like [Solanum tuberosum]
Length=866

 Score =  1163 bits (3009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/862 (66%), Positives = 676/862 (78%), Gaps = 30/862 (3%)
 Frame = -2

Query  2677  ENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPET--------------R  2543
             EN + LHGDL+L I++AR LPNMD+ SERIR+ FTA D CRKP+T              +
Sbjct  8     ENFICLHGDLELHIIQARHLPNMDLTSERIRRCFTACDVCRKPQTESTADDGNGELPNVK  67

Query  2542  QGNKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQV  2363
               ++   H  IITSDPYV VC     +ARTRV+ NSQ+PVW EHF+IP+AHP+  ++F+V
Sbjct  68    STDQKIHHRSIITSDPYVTVCAPHTALARTRVLPNSQNPVWDEHFRIPLAHPMDCLDFRV  127

Query  2362  KDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENP  2183
             KD+DVFGA  +G   + A+KI SGE ++ WFP+IGA GK PKPD A+RL MKF P   NP
Sbjct  128   KDDDVFGAQVMGKVTIPAEKIASGEVVSGWFPVIGASGKSPKPDTALRLWMKFVPYDTNP  187

Query  2182  RYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEG-SLPEIKIDDGKAFHHENCWE  2015
              Y+ G+  D    G++ +YFP+R G +V LYQDAHV +   LPEI++++   F H  CWE
Sbjct  188   LYKRGIASDPQYLGVRNAYFPLRKGSSVKLYQDAHVSDKFKLPEIQLENNTTFEHNKCWE  247

Query  2014  DICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLV  1835
             DIC+AI EAHH++YIVGWS++HKVKLVREPTRPLP GG+L LGELLKYKSQEGVRVLLLV
Sbjct  248   DICYAITEAHHLIYIVGWSVFHKVKLVREPTRPLPRGGDLTLGELLKYKSQEGVRVLLLV  307

Query  1834  WDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYT  1655
             WDDKTSH KFFINT+GVMGTHDEETRKFFKHSSV CVL+PRYASSKLS +KQQVVGT++T
Sbjct  308   WDDKTSHDKFFINTAGVMGTHDEETRKFFKHSSVICVLSPRYASSKLSLIKQQVVGTMFT  367

Query  1654  HHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEG  1475
             HHQKCV+VDTQA GNNRK+TAF+GGLDLCDGRYDTP+HRLF D DTVF+ D + PTFP  
Sbjct  368   HHQKCVLVDTQAPGNNRKVTAFLGGLDLCDGRYDTPEHRLFRDLDTVFKDDVHQPTFP-A  426

Query  1474  GLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIE  1295
             G K PRQPWHDLHC+I+GPA YD+L NF QRWRKA+KW E     K +SHWHDDA+LKIE
Sbjct  427   GTKAPRQPWHDLHCRIDGPAVYDVLINFAQRWRKATKWREFKFFKKTMSHWHDDAMLKIE  486

Query  1294  RISWITSP-------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTA  1136
             RISWI SP       + ++P DDP L V  E   +NWHVQ+FRSIDSGS++GFPK +  A
Sbjct  487   RISWILSPALAVLKDSTAIPEDDPKLHVYGEDHSENWHVQIFRSIDSGSVQGFPKTIDVA  546

Query  1135  ETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPM  956
               QNLVC+K+L++D+SI+ AYI+AIR AQHFIYIENQYFLGSSYAW SYK+AGAD+LIPM
Sbjct  547   HAQNLVCSKNLIVDKSIEAAYIQAIRSAQHFIYIENQYFLGSSYAWESYKDAGADHLIPM  606

Query  955   ELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSE  776
             ELALKI SKIR RERF VY+V+PMWPEG P S  VQ+IL+WQ QTIQMMY++IA ELKS 
Sbjct  607   ELALKITSKIRARERFCVYVVMPMWPEGDPKSITVQEILFWQSQTIQMMYQVIATELKSM  666

Query  775   KIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDD  596
             +I D+HP DYLNFYCLGNREE     A S   G  + ++ S K  RFMIYVHAKGM+VDD
Sbjct  667   QILDSHPQDYLNFYCLGNREEIPGSIAQS--SGNGDKVSDSYKFQRFMIYVHAKGMIVDD  724

Query  595   EYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMM  416
             EYVIVGSANINQRS+AGS+DTEIAMGAYQPH+ W + Q HP  Q+YGYRMSLWAEHLG +
Sbjct  725   EYVIVGSANINQRSLAGSKDTEIAMGAYQPHYAWTEKQRHPQGQIYGYRMSLWAEHLGRI  784

Query  415   DEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEY  236
             +E   E E L CV+ VNE+AEENWK YTAE F+ LQGHLLKYP+ V ++G V PL   E 
Sbjct  785   EECFKEPEALTCVRKVNEVAEENWKSYTAENFTQLQGHLLKYPIHVGADGNVGPLPEYEN  844

Query  235   FPDVGGKVLGSRT-TLPDALTT  173
             FPDVGG++LG+   T+PD LTT
Sbjct  845   FPDVGGRILGNHAPTIPDVLTT  866



>ref|XP_010531126.1| PREDICTED: phospholipase D delta-like [Tarenaya hassleriana]
Length=862

 Score =  1163 bits (3008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 571/863 (66%), Positives = 677/863 (78%), Gaps = 23/863 (3%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETR--------  2543
             M+D  SE V+ LHGDLDLKI++ARRLPNMD+ SE +R+ FTA D C  P           
Sbjct  1     MADKASEEVMLLHGDLDLKIVKARRLPNMDMFSENLRRCFTACDACSTPSANAGDGDGGG  60

Query  2542  -QGNKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQ  2366
              +  ++  H +IITSDPYV V +  AT+ARTRV+ NSQDP W EHF + +AHP++ +EFQ
Sbjct  61    VKDREIHTHRKIITSDPYVTVVVPQATLARTRVVKNSQDPHWDEHFVVCLAHPLAYLEFQ  120

Query  2365  VKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAEN  2186
             VKD+D FGA  IG AK+  ++I SG+ I+ WFP++GA GKPPK + AI + M+FTP   +
Sbjct  121   VKDDDTFGAQVIGSAKIPVKEIASGDLISGWFPLLGASGKPPKKETAIYIEMQFTPFDRH  180

Query  2185  PRYRGGVT---EDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWE  2015
             P Y  G+    E  G+K +YFP+R G  V LYQDAHV +G LPEI +DDGK +  E CWE
Sbjct  181   PIYHRGIPGDPEQDGVKGTYFPLRKGSQVRLYQDAHVIDGMLPEIDLDDGKVYRQEKCWE  240

Query  2014  DICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLV  1835
             DIC+AI EAHHM+YIVGWS++HKVKLVREPTRPLP GG+L LG+LLKYKS+EGVRVLLLV
Sbjct  241   DICYAISEAHHMIYIVGWSVFHKVKLVREPTRPLPRGGDLTLGDLLKYKSEEGVRVLLLV  300

Query  1834  WDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYT  1655
             WDDKTSH KF I+T+GVM THDEETRKFFKHSSV CVL+PRYASSKL   KQQVVGTL+T
Sbjct  301   WDDKTSHDKFGISTAGVMQTHDEETRKFFKHSSVICVLSPRYASSKLGLFKQQVVGTLFT  360

Query  1654  HHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEG  1475
             HHQKCV+VDTQA GNNRK+TAFIGG+DLCDGRYDTP+HRLF D DTVF+ D++NPTFP  
Sbjct  361   HHQKCVLVDTQAAGNNRKVTAFIGGIDLCDGRYDTPEHRLFRDLDTVFKDDFHNPTFP-N  419

Query  1474  GLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIE  1295
             G K PRQPWHDLH +I+GPAAYD+L NFEQRWRKA++W E   RFK  S W DDAL++I 
Sbjct  420   GTKAPRQPWHDLHSRIDGPAAYDVLLNFEQRWRKATRWKEFSLRFKGKSRWQDDALIRIG  479

Query  1294  RISWITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHT  1139
             RISWI SP        T  VP DDP +WVS E +P+NWHVQ+FRSIDSGS+KGFP     
Sbjct  480   RISWILSPAFSILKDGTSVVPKDDPLIWVSKEDNPENWHVQIFRSIDSGSVKGFPNYPDE  539

Query  1138  AETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIP  959
             AE  NLVCAK LV+D+SIQ AYI+AIR AQHFIYIENQYFLGSSYAWPSYK+AGADNLIP
Sbjct  540   AEALNLVCAKRLVVDKSIQTAYIQAIRSAQHFIYIENQYFLGSSYAWPSYKDAGADNLIP  599

Query  958   MELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKS  779
             MELALKI SKIR RERFAVY+VIP+WPEG P S PVQ+ILYWQ QT+QMMY++IA+ELKS
Sbjct  600   MELALKIASKIRARERFAVYVVIPLWPEGDPKSGPVQEILYWQSQTMQMMYDVIARELKS  659

Query  778   EKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVD  599
              +I DAHP DYLNFYCLG RE+  +   +    G    +  S K  RFMIYVHAKGM+VD
Sbjct  660   MQISDAHPLDYLNFYCLGKREQLPDNMTNGNGNGNGNSVPDSFKFQRFMIYVHAKGMIVD  719

Query  598   DEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGM  419
             DEYVI+GSANINQRS+AG++DTEIAMGAYQPH TW+    HP  QVYGYRMSLWAEH+G+
Sbjct  720   DEYVIIGSANINQRSLAGTKDTEIAMGAYQPHQTWSSKGKHPRGQVYGYRMSLWAEHMGV  779

Query  418   MDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCE  239
                   EA  +ECVK VN IAE+NW+++ + +F+ LQGHL+KYPL VDS+GKVSPL   E
Sbjct  780   TGNHFVEAGEVECVKSVNRIAEDNWRKFISPEFTELQGHLIKYPLLVDSDGKVSPLPDYE  839

Query  238   YFPDVGGKVLGSRT-TLPDALTT  173
              FPDVGGK++G+ + TLPD LTT
Sbjct  840   NFPDVGGKIIGAHSMTLPDTLTT  862



>ref|XP_004134840.1| PREDICTED: phospholipase D delta-like [Cucumis sativus]
 gb|KGN48960.1| hypothetical protein Csa_6G507330 [Cucumis sativus]
Length=857

 Score =  1162 bits (3007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 564/865 (65%), Positives = 686/865 (79%), Gaps = 32/865 (4%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD----------CRKPET  2546
             M++ + E  VYLHGDLDLKI+ A  LPNMDIVSE +R+ FTA              K  +
Sbjct  1     MAESLEE--VYLHGDLDLKIIAAVHLPNMDIVSEHLRRCFTACGTVNYSAIKSVATKSRS  58

Query  2545  RQGNKVRRHTR--IITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVE  2372
               G +   H+R  IITSDPYV V +  ATVARTRVI NSQ+P W EHF IP+A  ++E+E
Sbjct  59    ADGEEKAHHSRGKIITSDPYVTVRVPQATVARTRVIKNSQNPHWNEHFIIPLAQKMAELE  118

Query  2371  FQVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCA  2192
             FQVKD+DVFGA+ +G  K+ AQ I SG+ I+ W+ +IG++GKPPKPD A+R+ MKFT   
Sbjct  119   FQVKDDDVFGAEVMGTVKIPAQDIASGKIISGWYTVIGSNGKPPKPDTALRIEMKFTSVE  178

Query  2191  ENPRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENC  2021
             ENP YR G+  D    G++ +YFP+R G ++ LYQDAHVP+G LP+I++D+G  +  E C
Sbjct  179   ENPIYRHGIAGDPEHRGVQHTYFPVRKGSSMRLYQDAHVPDGLLPQIELDEGNVYRQEKC  238

Query  2020  WEDICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLL  1841
             WEDIC+AI EAHHM+YIVGWS++HKVKLVREPTRPLP GG+L LGELLKYKS+EGVRVL+
Sbjct  239   WEDICYAISEAHHMIYIVGWSVFHKVKLVREPTRPLPRGGDLTLGELLKYKSEEGVRVLM  298

Query  1840  LVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTL  1661
             ++WDDKTSH KFFINT G+M THDEETRKFFKHSSV CVL+PRY S KLS+VKQ+VVGT+
Sbjct  299   MIWDDKTSHDKFFINTEGLMQTHDEETRKFFKHSSVICVLSPRYPSGKLSYVKQKVVGTV  358

Query  1660  YTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFP  1481
             +THHQKCV+VDTQ  GNNRKITAF+GGLDLCDGRYDTP+HRLF D DTVF+ D++NPT P
Sbjct  359   FTHHQKCVLVDTQGYGNNRKITAFLGGLDLCDGRYDTPEHRLFHDLDTVFKDDFHNPTIP  418

Query  1480  EGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLK  1301
              G  K PRQPWHDLHC+++GPAAYD+L NFEQRW +A++W E G R ++I+HWH DAL+K
Sbjct  419   PGA-KAPRQPWHDLHCRLDGPAAYDLLINFEQRWNRATRWTEFGLRCRRITHWH-DALIK  476

Query  1300  IERISWITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDV  1145
             IERISWI SP        +  VP DDP ++VS E DP+NWHVQ+FRSIDSGS+KGFPKDV
Sbjct  477   IERISWILSPQVILLEDGSIKVPEDDPKVYVSKEEDPENWHVQIFRSIDSGSVKGFPKDV  536

Query  1144  HTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNL  965
             H AE+ NLVCAK+L I++SI+MAYI+AIR AQHFIYIENQYF+GSSY WP YK AGADNL
Sbjct  537   HLAESLNLVCAKNLAIEKSIEMAYIQAIRSAQHFIYIENQYFIGSSYGWPGYKNAGADNL  596

Query  964   IPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKEL  785
             IPMELALKI SKIR +ERF VYIVIPMWPEG P+S P+Q+ILYWQGQT+QMMY+I+A EL
Sbjct  597   IPMELALKIASKIRAKERFVVYIVIPMWPEGDPNSGPMQEILYWQGQTMQMMYDIVASEL  656

Query  784   KSEKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMV  605
             KS    D HP D+LNFYCLG REE  E   ++  P     L    K+ RFMIYVHAKGM+
Sbjct  657   KSSGQPDLHPQDFLNFYCLGKREEIPENGPTTDDPTACNSL----KNRRFMIYVHAKGMI  712

Query  604   VDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHL  425
             VDDEYVI+GSANINQRSMAG++DTEIA GAYQPHHTW K + HPH Q+YGYRMSLW+EHL
Sbjct  713   VDDEYVIIGSANINQRSMAGTKDTEIATGAYQPHHTWVKKKKHPHGQIYGYRMSLWSEHL  772

Query  424   GMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGG  245
             GM++   +E E L+CV+ +N IAE+NW R+   +F  LQGHLL+YP+ VD++GK++PL G
Sbjct  773   GMLNPCFEEPENLDCVRKINGIAEDNWNRFADNEFRTLQGHLLRYPVLVDNDGKINPLPG  832

Query  244   CEYFPDVGGKVLGSRT-TLPDALTT  173
              E FPDVGGK++GS +  +PD LTT
Sbjct  833   HENFPDVGGKIIGSHSAAIPDVLTT  857



>ref|XP_006660920.1| PREDICTED: phospholipase D delta-like [Oryza brachyantha]
Length=862

 Score =  1162 bits (3006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 577/852 (68%), Positives = 671/852 (79%), Gaps = 31/852 (4%)
 Frame = -2

Query  2668  VYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKP---ETRQ-------------G  2537
             V LHGDLDL +LEAR LPNMD+ SE++R+ F A  C+ P    T+Q             G
Sbjct  20    VLLHGDLDLWVLEARLLPNMDMFSEQVRRCFAA--CKPPTSCATKQPPHQRGGSQGGGGG  77

Query  2536  NKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKD  2357
                + H +IITSDPYV + +AGA VARTRVI N+QDPVW E F +P+AH  + +EF VKD
Sbjct  78    RGQQHHRKIITSDPYVTLSIAGAVVARTRVIPNNQDPVWDEQFAVPLAHYATALEFHVKD  137

Query  2356  NDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRY  2177
             ND FGA  IG   + A K +S + ++DWFPIIG +GKP KPD A+RL  +F P A NP Y
Sbjct  138   NDTFGAQLIGTVTIPADKAVSCQEVDDWFPIIGTNGKPYKPDTALRLRFRFNPAAANPLY  197

Query  2176  RGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDIC  2006
             R G+  D    G+K+SYFP+RHGG +TLYQDAHV EG LPEI+++ GK F H  CWEDIC
Sbjct  198   RHGIPGDPDKQGIKDSYFPLRHGGRLTLYQDAHVREGDLPEIELEKGKRFEHNACWEDIC  257

Query  2005  HAILEAHHMVYIVGWSIYHKVKLVREPT--RplpnggnlnlgelLKYKSQEGVRVLLLVW  1832
             HAILEAHHM+YIVGWS+Y KV+LVREP+  RPLP GG+L LGELLK+KSQEGVRV LLVW
Sbjct  258   HAILEAHHMIYIVGWSVYDKVRLVREPSPSRPLPEGGDLTLGELLKFKSQEGVRVCLLVW  317

Query  1831  DDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTH  1652
             DDKTSH K FI T GVM THDEETRKFFKHSSV CVL+PRYASSKLS  KQQVVGTL+TH
Sbjct  318   DDKTSHDKLFIKTGGVMATHDEETRKFFKHSSVICVLSPRYASSKLSIFKQQVVGTLFTH  377

Query  1651  HQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGG  1472
             HQKCV+VDTQA GN RKITAFIGGLDLCDGRYDTP+HRLF D DTVF  DY+NPTF    
Sbjct  378   HQKCVLVDTQAWGNKRKITAFIGGLDLCDGRYDTPEHRLFKDLDTVFDNDYHNPTFSSSA  437

Query  1471  LKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIER  1292
              KGPRQPWHDLHC+I+GPAAYD+L NFEQRWRKA+KW E   RF+++SHW DDAL+K+ER
Sbjct  438   -KGPRQPWHDLHCRIDGPAAYDVLKNFEQRWRKATKWRE---RFRRVSHWKDDALIKLER  493

Query  1291  ISWITSPTPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCA  1112
             ISWI SP+P+VPND  SL VS E DP+NWHVQVFRSIDSGSLKGFP D   A  QNL+C 
Sbjct  494   ISWILSPSPTVPNDHISLRVSKEEDPENWHVQVFRSIDSGSLKGFPSDCKEASKQNLICR  553

Query  1111  KDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVS  932
             KDL+ID+SI  AY+ AIR AQHFIYIENQYFLGSSYAWPSY  +GADNL+P+ELALKI S
Sbjct  554   KDLIIDKSIHTAYVRAIRSAQHFIYIENQYFLGSSYAWPSYVNSGADNLVPIELALKIAS  613

Query  931   KIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPC  752
             KIR  ERFAVY+VIPMWPEGVP++A VQ+IL++  QT++MMY IIA+ELK+  IEDAHP 
Sbjct  614   KIRAGERFAVYVVIPMWPEGVPTTASVQEILFF--QTMEMMYRIIAQELKTMNIEDAHPQ  671

Query  751   DYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSA  572
             DYLNFYCLGNREE    S  SP          ++K  RFMIYVHAKGM+VDDEYVI+GSA
Sbjct  672   DYLNFYCLGNREEL--SSNESPESNDKSAAALARKYRRFMIYVHAKGMIVDDEYVILGSA  729

Query  571   NINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAE  392
             NINQRS+AGSRDTEIAMGAYQPHH W+   +HP  QVYGYR SLWAEHLGM+D+   +  
Sbjct  730   NINQRSLAGSRDTEIAMGAYQPHHAWSTKGSHPRGQVYGYRTSLWAEHLGMVDDLFKDPS  789

Query  391   GLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKV  212
              L+CV  VN+IAEENW R+TAE+   LQGHLLKYP++V+++GKV PL   E FPDVGGK+
Sbjct  790   SLDCVNFVNQIAEENWNRFTAEELIMLQGHLLKYPVKVEADGKVGPLPDQETFPDVGGKI  849

Query  211   LGSRTTLPDALT  176
             LG+ T+LPD LT
Sbjct  850   LGAPTSLPDTLT  861



>ref|NP_001063826.1| Os09g0543100 [Oryza sativa Japonica Group]
 dbj|BAF25740.1| Os09g0543100 [Oryza sativa Japonica Group]
 dbj|BAG94664.1| unnamed protein product [Oryza sativa Japonica Group]
Length=854

 Score =  1162 bits (3006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 579/843 (69%), Positives = 674/843 (80%), Gaps = 20/843 (2%)
 Frame = -2

Query  2668  VYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPET----RQGNKVRRHTR--II  2507
             V LHGDLDL ++EAR LPNMD+ SE +R+ F A  C+ P +    RQ    R H R  II
Sbjct  19    VLLHGDLDLWVVEARLLPNMDMFSEHVRRCFAA--CKPPTSCATARQPRHARGHHRRKII  76

Query  2506  TSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIG  2327
             TSDPYV + +AGA VARTRVI N QDPVW E F +P+AH  + +EF VKDND FGA  IG
Sbjct  77    TSDPYVTLSVAGAVVARTRVIPNDQDPVWDERFAVPLAHYAAALEFHVKDNDTFGAQLIG  136

Query  2326  VAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED---  2156
                + A ++ S + + DWFPIIG +G+P KPD A+RL ++F P A+NP YR G+  D   
Sbjct  137   TVTIPADRVASCQEVEDWFPIIGNNGRPYKPDTALRLRLRFNPAADNPLYRRGIPGDPDH  196

Query  2155  YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDG-KAFHHENCWEDICHAILEAHHM  1979
              G+K+SYFP+RHGG VTLYQDAH  EG LPEI++D+G K F H  CWEDICHAILEAHHM
Sbjct  197   QGIKDSYFPLRHGGRVTLYQDAHYREGDLPEIELDEGGKVFDHNACWEDICHAILEAHHM  256

Query  1978  VYIVGWSIYHKVKLVREPT--RplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKF  1805
             +YIVGWS+Y KV+LVREP+  RPLP GG+LNLGELLK+KSQEGVRV LLVWDDKTSH K 
Sbjct  257   IYIVGWSVYDKVRLVREPSPSRPLPEGGDLNLGELLKFKSQEGVRVCLLVWDDKTSHDKL  316

Query  1804  FINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDT  1625
             FI T GVM THDEETRKFFKHSSV CVL+PRYASSKLS  KQQVVGTL+THHQKCV+VDT
Sbjct  317   FIKTGGVMATHDEETRKFFKHSSVICVLSPRYASSKLSIFKQQVVGTLFTHHQKCVLVDT  376

Query  1624  QAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWH  1445
             QA GN RKITAFIGGLDLCDGRYDTP+HRLF D DTVF  DY+NPTFP G   GPRQPWH
Sbjct  377   QAWGNKRKITAFIGGLDLCDGRYDTPEHRLFKDLDTVFDNDYHNPTFPSGAKGGPRQPWH  436

Query  1444  DLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTP  1265
             DLHC+I+GPAAYD+L NFEQRWRKA+KW E   RF+K+SHW DDAL+K+ERISWI SP+P
Sbjct  437   DLHCRIDGPAAYDVLKNFEQRWRKATKWRE---RFRKVSHWKDDALIKLERISWILSPSP  493

Query  1264  SVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSI  1085
             ++PNDD SL VS E DP+NWHVQVFRSIDSGSLKGFP D   A  QNL+C KDL+ID+SI
Sbjct  494   TIPNDDISLRVSKEEDPENWHVQVFRSIDSGSLKGFPSDCKEASKQNLICRKDLIIDKSI  553

Query  1084  QMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFA  905
               AY+ AIR AQHFIYIENQYFLGSSYAWPSY  +GADNL+P+ELALKI SKIR  ERFA
Sbjct  554   HTAYVRAIRSAQHFIYIENQYFLGSSYAWPSYVNSGADNLVPIELALKIASKIRAGERFA  613

Query  904   VYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLG  725
             VY+VIPMWPEGVP++A VQ+IL++  QT++MMY IIA+ELK+  I++AHP DYLNFYCLG
Sbjct  614   VYVVIPMWPEGVPTAASVQEILFF--QTMEMMYRIIAQELKAMNIKNAHPQDYLNFYCLG  671

Query  724   NREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAG  545
             NREE    + S  +   S     ++K  RFMIYVHAKGM+VDDEYVI+GSANINQRS+AG
Sbjct  672   NREESSSSNGSPESNDKSAAAL-ARKYRRFMIYVHAKGMIVDDEYVILGSANINQRSLAG  730

Query  544   SRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVN  365
             SRDTEIAMGAYQPHHTW+    HP  QVYGYR SLWAEHLGM+D+   +   LECV  VN
Sbjct  731   SRDTEIAMGAYQPHHTWSTKGGHPRGQVYGYRTSLWAEHLGMVDDLFKDPSSLECVNYVN  790

Query  364   EIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPD  185
             EIAEENW+R+TAE+   LQGHLLKYP++V+++GKV PL   E FPDVGGK+LG+ T+LPD
Sbjct  791   EIAEENWRRFTAEQLITLQGHLLKYPVKVEADGKVGPLPEHECFPDVGGKILGAPTSLPD  850

Query  184   ALT  176
              LT
Sbjct  851   TLT  853



>gb|KEH36266.1| phospholipase D alpha 1 [Medicago truncatula]
Length=799

 Score =  1162 bits (3005),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 569/759 (75%), Positives = 655/759 (86%), Gaps = 11/759 (1%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQGNK---VRRHTR  2513
             SE VVYLHG+LDLKI+EAR LPNMD++SER R+FF+AF+ C    T +G       RH +
Sbjct  7     SEAVVYLHGNLDLKIVEARYLPNMDMLSERFRRFFSAFNSCSANITTKGKNHLTRHRHHK  66

Query  2512  IITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADF  2333
             IITSDPYV VCLAGATVARTRVISNSQ P W EHFKIP+AHPVS+VEF VKDND+FGAD 
Sbjct  67    IITSDPYVTVCLAGATVARTRVISNSQSPKWEEHFKIPLAHPVSQVEFYVKDNDMFGADL  126

Query  2332  IGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT---  2162
             IG+A VSA++I+SGE I+DWFPIIG+ GKPPKPDCA+ L MKFT C ENP YR GV    
Sbjct  127   IGIATVSAKRILSGEDISDWFPIIGSFGKPPKPDCAVFLEMKFTRCDENPMYRSGVIPGP  186

Query  2161  EDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHH  1982
             + + +++SYFP+R GG+VTLYQDAHVP+  LPEI++DDG  F    CWEDICHAILEAHH
Sbjct  187   DRFAVQDSYFPVRRGGSVTLYQDAHVPDSMLPEIELDDGVEFQQGKCWEDICHAILEAHH  246

Query  1981  MVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFF  1802
             +VYIVGWSI+HKVKLVREPT+PLPNGGNLNLGELLKYKSQEG+RVLLLVWDDKTSHSKFF
Sbjct  247   LVYIVGWSIFHKVKLVREPTKPLPNGGNLNLGELLKYKSQEGLRVLLLVWDDKTSHSKFF  306

Query  1801  INTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQ  1622
             INT+G+M THDEETRKFFKHSSV+CVL+PRYASSKLS  KQQVVGTL+THHQKCVIVD+Q
Sbjct  307   INTNGIMQTHDEETRKFFKHSSVSCVLSPRYASSKLSIFKQQVVGTLFTHHQKCVIVDSQ  366

Query  1621  AQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDT-VFRGDYNNPTFPEGGLKGPRQPWH  1445
             A GNNRKITAFIGGLDLCDGRYDTP+HRLF D DT V++ DY+NPTF   G KGPRQPWH
Sbjct  367   AHGNNRKITAFIGGLDLCDGRYDTPEHRLFRDLDTHVYKDDYHNPTF-SAGTKGPRQPWH  425

Query  1444  DLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTP  1265
             DLHCKIEGPAAYDILTNFEQRW+KA++W+ELG++ K++S WHDD+L+K+ERISWI SP+ 
Sbjct  426   DLHCKIEGPAAYDILTNFEQRWKKATRWSELGQKLKRVSSWHDDSLIKLERISWILSPSE  485

Query  1264  SVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSI  1085
             S+ NDDP LWVS E DPQNWH+QVFRSIDSGSLKGFPK+ + A  QNLVCAK+LVID+SI
Sbjct  486   SMSNDDPELWVSKEDDPQNWHIQVFRSIDSGSLKGFPKNTYEAGAQNLVCAKNLVIDKSI  545

Query  1084  QMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFA  905
             Q AYI AIR AQHFIYIENQYF+GSS+AWPSYKEAGADNLIPMELALKIVSKIR+RERF 
Sbjct  546   QTAYIHAIRSAQHFIYIENQYFIGSSFAWPSYKEAGADNLIPMELALKIVSKIRSRERFT  605

Query  904   VYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLG  725
             VYIVIPMWPEGVPSS  VQ+ILY+QGQT+QMMYEIIA+EL+  K+ D+HP DYLNFYCLG
Sbjct  606   VYIVIPMWPEGVPSSGSVQEILYFQGQTMQMMYEIIARELRFMKLNDSHPQDYLNFYCLG  665

Query  724   NREEWHEE--SASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSM  551
             NRE++  E  S +S   G  + ++ SQK  RFMIYVHAKGMVVDDEY +VGSANINQRS+
Sbjct  666   NREKFATEVSSPNSSPSGNGDTVSASQKFQRFMIYVHAKGMVVDDEYAMVGSANINQRSL  725

Query  550   AGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWA  434
             AGSRDTEIAMGAYQPHHTW+K   HP  QV+  +++ ++
Sbjct  726   AGSRDTEIAMGAYQPHHTWSKKNGHPRGQVWKIKLTKYS  764



>ref|XP_008670360.1| PREDICTED: phospholipase D delta-like [Zea mays]
 tpg|DAA40666.1| TPA: phospholipase D family protein [Zea mays]
Length=856

 Score =  1161 bits (3004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 572/855 (67%), Positives = 670/855 (78%), Gaps = 37/855 (4%)
 Frame = -2

Query  2668  VYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPET-----------RQGNKVRR  2522
             V LHGDLDL ILEAR LPNMD+ SE++R+      CR P +             G +   
Sbjct  14    VLLHGDLDLWILEARLLPNMDMFSEQVRRCLAV--CRPPTSCGTNHPPAAARGGGGRQHH  71

Query  2521  HTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFG  2342
             H +IIT  PYV + ++GA VART VI NSQDPVW E F +P+AH  +E+EFQVKDND FG
Sbjct  72    HRKIITRGPYVTLSVSGAVVARTAVIPNSQDPVWEERFAVPLAHRAAELEFQVKDNDTFG  131

Query  2341  ADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT  2162
             A  IG   V A  ++SG    DWFP+ G +GKP KPD A+RL   F P A NP YR G+ 
Sbjct  132   AQLIGTVTVPADCVVSGTEAEDWFPVKGTNGKPYKPDTALRLRFTFHPIANNPAYRHGIP  191

Query  2161  ED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILE  1991
              D    G+ ESY+P+RHGG VTLYQDAH+ EG LPEI++DDGK F H +CWEDICHAILE
Sbjct  192   GDPGHRGIGESYYPLRHGGQVTLYQDAHIREGDLPEIELDDGKTFQHNSCWEDICHAILE  251

Query  1990  AHHMVYIVGWSIYHKVKLVREPT--RplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTS  1817
             AHHM+YIVGWS+Y KV+LVREP+  RPLP+GG+L LG+LLK+KSQEGVRV LLVWDDKTS
Sbjct  252   AHHMIYIVGWSVYDKVRLVREPSPSRPLPDGGDLTLGDLLKFKSQEGVRVCLLVWDDKTS  311

Query  1816  HSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCV  1637
             H KFFI T GVM THDEETRKFFKHSSV CVL+PRYAS+KLS  KQQVVGTL+THHQKCV
Sbjct  312   HDKFFIKTGGVMATHDEETRKFFKHSSVICVLSPRYASNKLSIFKQQVVGTLFTHHQKCV  371

Query  1636  IVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPR  1457
             +VDTQA+GN RK+TAFIGGLDLCDGRYDTP+HRLF D DTVF+ DY+NPTF  G  KGPR
Sbjct  372   LVDTQARGNKRKVTAFIGGLDLCDGRYDTPKHRLFKDLDTVFQNDYHNPTFSSGA-KGPR  430

Query  1456  QPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWIT  1277
             QPWHDLHC+I+GPAAYD+LTNFEQRWRKA+KW     RF+++SHW DDAL+K+ERISWI 
Sbjct  431   QPWHDLHCRIDGPAAYDVLTNFEQRWRKATKWRG---RFRRVSHWKDDALIKLERISWII  487

Query  1276  SPTPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVI  1097
             SP+P+VPND PSLWVS E D +NWHVQVFRSIDSGSLKGFP D   A   NLVC K+LVI
Sbjct  488   SPSPNVPNDHPSLWVSKEEDRENWHVQVFRSIDSGSLKGFPSDCKEASKLNLVCRKNLVI  547

Query  1096  DRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNR  917
             D+SI  AY+ AIR AQHFIYIENQYFLGSSYAWPSY  +GADNLIP+ELALKI SKIR +
Sbjct  548   DKSIHTAYVRAIRSAQHFIYIENQYFLGSSYAWPSYVNSGADNLIPIELALKIASKIRAQ  607

Query  916   ERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNF  737
             ERFAVY+VIPMWPEGVP++A VQ+IL++Q QT++MMY IIA ELKS   +D  P DYL+F
Sbjct  608   ERFAVYVVIPMWPEGVPTAASVQEILFFQAQTMEMMYTIIADELKSMDNKDMRPEDYLSF  667

Query  736   YCLGNREEWHEESASSPTPGCSEFLTGSQKSG--------RFMIYVHAKGMVVDDEYVIV  581
             +CLGNREE        P+ G  E    + KS         RFMIYVHAKGM+VDDEYVI+
Sbjct  668   FCLGNREE-------PPSNGSPESEKSTDKSAVGLATKYRRFMIYVHAKGMIVDDEYVIL  720

Query  580   GSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLD  401
             GSANINQRS+AGSRDTEIAMGAYQPH+ W+    HP  QVYGYR SLWAEHLG +D++  
Sbjct  721   GSANINQRSLAGSRDTEIAMGAYQPHYAWSTKNGHPDGQVYGYRTSLWAEHLGTIDDRFK  780

Query  400   EAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVG  221
             +   LECV+ VN+IA ENW+RYTAE+ S LQGHLLKYP++V+++GK+SPL   E FPDVG
Sbjct  781   DPSSLECVRFVNQIAVENWRRYTAEEMSTLQGHLLKYPVKVEADGKISPLPDQECFPDVG  840

Query  220   GKVLGSRTTLPDALT  176
             GK+LG+ T+LPD+LT
Sbjct  841   GKILGASTSLPDSLT  855



>ref|XP_002460594.1| hypothetical protein SORBIDRAFT_02g031540 [Sorghum bicolor]
 gb|EER97115.1| hypothetical protein SORBIDRAFT_02g031540 [Sorghum bicolor]
Length=857

 Score =  1161 bits (3003),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 575/864 (67%), Positives = 674/864 (78%), Gaps = 42/864 (5%)
 Frame = -2

Query  2686  GMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPET-------------  2546
             G     V LHGDLDL ILEAR LPNMD+ SE +R+   A  CR P +             
Sbjct  8     GSPAKPVLLHGDLDLWILEARLLPNMDMFSEHVRRCLAA--CRPPSSCGTKHPTAAARGP  65

Query  2545  -RQGNKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEF  2369
                      H +IITSDPYV + ++GA VART VI NSQDPVW E F +P+AH  +E+EF
Sbjct  66    GGGRGGRHHHRKIITSDPYVTLSVSGAVVARTAVIPNSQDPVWEERFAVPLAHRAAELEF  125

Query  2368  QVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAE  2189
             QVKDND FGA  IG   V A++++SG+ + DWFP+IG +GKP KPD A+RL  KF P A 
Sbjct  126   QVKDNDTFGAQAIGTVTVPAERVVSGDEVEDWFPVIGTNGKPYKPDTALRLRFKFQPIAN  185

Query  2188  NPRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCW  2018
             NP YR G+  D    G+++SYFP+RHGG VTLYQDAHV EG LPEI++DDGK F H  CW
Sbjct  186   NPAYRHGIAGDPDHRGIEDSYFPLRHGGQVTLYQDAHVREGDLPEIELDDGKTFQHNACW  245

Query  2017  EDICHAILEAHHMVYIVGWSIYHKVKLVREPT--RplpnggnlnlgelLKYKSQEGVRVL  1844
             EDICHAILEAHHM+YIVGWS+Y KV+LVREP+  RPLP GG+L LG+LLK+KSQEGVRV 
Sbjct  246   EDICHAILEAHHMIYIVGWSVYDKVRLVREPSPSRPLPEGGDLTLGDLLKFKSQEGVRVC  305

Query  1843  LLVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGT  1664
             LLVWDDKTSH KFFI T GVM THDEETRKFFKHSSV CVL+PRYAS+KLS  KQQVVGT
Sbjct  306   LLVWDDKTSHDKFFIKTGGVMATHDEETRKFFKHSSVICVLSPRYASNKLSIFKQQVVGT  365

Query  1663  LYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTF  1484
             L+THHQKCV+VDTQA+GN RKITAFIGGLDLCDGRYDTP+HRLF D DTVF+ DY+NPTF
Sbjct  366   LFTHHQKCVLVDTQARGNKRKITAFIGGLDLCDGRYDTPEHRLFKDLDTVFQNDYHNPTF  425

Query  1483  PEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALL  1304
                G KGPRQPWHDLHC+I+GPAAYD+L NFEQRWRKA+KW +   RF+++SHW DDAL+
Sbjct  426   -SAGAKGPRQPWHDLHCRIDGPAAYDVLLNFEQRWRKATKWRD---RFRRVSHWKDDALI  481

Query  1303  KIERISWITSPTPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQN  1124
             K+ERISWI SP+P+VPND PSLWVS E D + WHVQVFRSIDSGSLKGFP D   A   N
Sbjct  482   KLERISWILSPSPNVPNDHPSLWVSKEEDHEKWHVQVFRSIDSGSLKGFPSDSKEASKLN  541

Query  1123  LVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELAL  944
             LVC K+LVID+SI  AY+ AIR AQHFIYIENQYFLGSSYAWPSY  +GADNLIP+ELAL
Sbjct  542   LVCRKNLVIDKSIHTAYVRAIRSAQHFIYIENQYFLGSSYAWPSYVNSGADNLIPIELAL  601

Query  943   KIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIED  764
             KI SKIR  ERFAVY+VIPMWPEGVP++A VQ+IL++  QT++MMY+IIA ELK+  I+D
Sbjct  602   KIASKIRAGERFAVYVVIPMWPEGVPTAASVQEILFF--QTMEMMYKIIADELKAMDIKD  659

Query  763   AHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSG--------RFMIYVHAKGM  608
                 DYLNF+CLGNREE        P+ G  E    + KS         RFMIYVHAKGM
Sbjct  660   MQLEDYLNFFCLGNREE-------PPSNGSPESEKSTDKSAAGLATKYRRFMIYVHAKGM  712

Query  607   VVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEH  428
             +VDDEYVI+GSANINQRS+AGSRDTEIAMGAYQPH+ W+    HPH QVYGYR SLWAEH
Sbjct  713   IVDDEYVILGSANINQRSLAGSRDTEIAMGAYQPHYAWSTKNGHPHGQVYGYRTSLWAEH  772

Query  427   LGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLG  248
             LG +D++  +   LECV+ VN+IA ENW+R+TAE+ S LQGHLLKYP++V+++GK+S L 
Sbjct  773   LGTVDDRFKDPSSLECVRRVNQIAVENWQRFTAEEMSTLQGHLLKYPVKVEADGKISSLP  832

Query  247   GCEYFPDVGGKVLGSRTTLPDALT  176
               E FPDVGGK+LG+ T+LPD+LT
Sbjct  833   DQECFPDVGGKILGASTSLPDSLT  856



>ref|XP_011007499.1| PREDICTED: phospholipase D delta-like [Populus euphratica]
Length=864

 Score =  1160 bits (3002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 577/869 (66%), Positives = 675/869 (78%), Gaps = 37/869 (4%)
 Frame = -2

Query  2683  MSENV-----VYLHGDLDLKILEARRLPNMDIVSERIRQFF------------TAFDCRK  2555
             M+EN      +YLHGDLDL I++AR LPNMD++S+ IRQ F            T      
Sbjct  1     MAENSSHKQHIYLHGDLDLFIVQARSLPNMDVISKNIRQCFGVCTPSSTSTTSTTKSIDH  60

Query  2554  PE---TRQGNKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPV  2384
             P    +    K+R H RIITSD YV V +   T+ARTRV+ N+  P+W + F IP+AHPV
Sbjct  61    PHHHPSDAAKKIRHHRRIITSDAYVTVTVPQVTLARTRVLKNATSPIWEQRFNIPLAHPV  120

Query  2383  SEVEFQVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKF  2204
              ++EF VKDND+FGA+ IG A + A  +  GE I  WFPII   GKPPKPD A+ L MKF
Sbjct  121   KDIEFHVKDNDLFGAELIGTANIPASTVALGEDIKGWFPIIAPSGKPPKPDTALYLEMKF  180

Query  2203  TPCAENPRYR---GGVTEDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFH  2033
              P  +NP YR   GG  E  G++ +YFP+R GG VTLYQDAH  +  LPEI+ID GK + 
Sbjct  181   IPFEKNPLYRNGFGGDPEVKGVRRTYFPVRKGGHVTLYQDAHGKDHDLPEIEIDGGKVYK  240

Query  2032  HENCWEDICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGV  1853
              E CWEDIC+AI EAHHM+YIVGWS+++K+KLVREPTRPLP GG+L LGELL+YKS+EGV
Sbjct  241   QEKCWEDICYAISEAHHMIYIVGWSVFYKIKLVREPTRPLPRGGDLTLGELLRYKSEEGV  300

Query  1852  RVLLLVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQV  1673
             RVLLLVWDD+TSH KF I T+GVM THDEETR+FFKHSSVTCVLAPRYASSKLSF+KQQ 
Sbjct  301   RVLLLVWDDRTSHDKFGIETAGVMATHDEETRRFFKHSSVTCVLAPRYASSKLSFLKQQT  360

Query  1672  VGTLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNN  1493
             VGT++THHQKCVIVDTQA GNNRKITAFIGG+DLCDGRYDTP+HRLF D +TVF+ D++N
Sbjct  361   VGTIFTHHQKCVIVDTQACGNNRKITAFIGGIDLCDGRYDTPEHRLFHDLNTVFKDDFHN  420

Query  1492  PTFPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDD  1313
             PTF   G K PRQPWHDLHCKI+GPAAYD+L NFEQRWRKA+KW ELG  FK+ SHW DD
Sbjct  421   PTF-TAGTKAPRQPWHDLHCKIDGPAAYDVLINFEQRWRKATKWTELGLHFKRTSHWSDD  479

Query  1312  ALLKIERISWITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGF  1157
             +L+KIERISWI SP        T +VP DDP+++VS+E DP +WHVQ+FRSIDSGSLKGF
Sbjct  480   SLIKIERISWILSPPLSKTKAGTTTVPGDDPTVFVSSEEDPDHWHVQIFRSIDSGSLKGF  539

Query  1156  PKDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAG  977
             PK +   + QNLV AKDLV+D+SIQ AYI+AIR AQHFIYIENQYFLGSSYAWPSYK+AG
Sbjct  540   PKTIDDCQAQNLVVAKDLVVDKSIQTAYIQAIRSAQHFIYIENQYFLGSSYAWPSYKDAG  599

Query  976   ADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEII  797
             ADNLIPMELALKI SKIR +ERFAVY+VIP+WPEG P +  VQ+IL+WQ QT+Q MYE I
Sbjct  600   ADNLIPMELALKIASKIRAKERFAVYVVIPLWPEGDPKTNTVQEILFWQSQTMQAMYEKI  659

Query  796   AKELKSEKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHA  617
             A+ELKS  + D+HP DYLNFYC+G REE  +E +S      SE      KS RFMIYVHA
Sbjct  660   AQELKSMDLVDSHPLDYLNFYCIGKREEIPQELSSDNGGLISEAF----KSQRFMIYVHA  715

Query  616   KGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLW  437
             KGM+VDDEYVIVGSANINQRSMAGS+DTEIAMG+YQPHHTW   + HP  QVYGYRMSLW
Sbjct  716   KGMIVDDEYVIVGSANINQRSMAGSKDTEIAMGSYQPHHTWGTKKKHPRGQVYGYRMSLW  775

Query  436   AEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVS  257
              EHLG +DE   E E L CVK VN  AEENWK++T   F  L+GHLLKYPL+VD++GKV 
Sbjct  776   REHLGEVDELFMEPENLLCVKRVNHTAEENWKKFTDPNFKLLKGHLLKYPLKVDADGKVG  835

Query  256   PLGGCEYFPDVGGKVLGSRT-TLPDALTT  173
             PL G E FPDVGGKVLG+ + T+PDALTT
Sbjct  836   PLPGSENFPDVGGKVLGAHSATIPDALTT  864



>ref|XP_006858490.1| hypothetical protein AMTR_s00071p00126030 [Amborella trichopoda]
 gb|ERN19957.1| hypothetical protein AMTR_s00071p00126030 [Amborella trichopoda]
Length=848

 Score =  1160 bits (3002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 569/843 (67%), Positives = 673/843 (80%), Gaps = 11/843 (1%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVR--RHTRII  2507
             SE V++LHGDLDL ILEA+ LPNMD+VSER+R+ FT F   K   + G K +  +H +II
Sbjct  10    SEKVIFLHGDLDLSILEAKSLPNMDLVSERMRKCFTMFGTCKIPCKHGEKHKGSKH-KII  68

Query  2506  TSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIG  2327
             TSDPYV VCLAGATVA+TR+ISN +DP W E F + +AHPVS+VEFQVKDNDV GA+ IG
Sbjct  69    TSDPYVSVCLAGATVAQTRIISNCEDPSWDEQFHVSIAHPVSKVEFQVKDNDVLGAELIG  128

Query  2326  VAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTE--DY  2153
             V  +SA+KI +G TI  WFPI+G +G P KP   + L M+F P   NP Y+ GV    DY
Sbjct  129   VVSISAEKIQTGNTITGWFPILGQYGNPFKPYPELHLSMQFRPVENNPLYKDGVGAGPDY  188

Query  2152  -GLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMV  1976
              G+  +YFP+R GG VTLYQDAHVP+  LPEI++D GK   H  CWEDICHAILEAHH++
Sbjct  189   LGVPNTYFPLRRGGKVTLYQDAHVPDELLPEIQLDGGKLLQHNKCWEDICHAILEAHHLI  248

Query  1975  YIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFIN  1796
             YI+GWSI+HKVKLVREPTRPLPNGG L+LG+LLK+KSQEGVRV+LL+WDDKTSH    + 
Sbjct  249   YIIGWSIFHKVKLVREPTRPLPNGGELSLGDLLKFKSQEGVRVVLLIWDDKTSHDMLLLK  308

Query  1795  TSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQ  1616
             T GVM THDE+T KFFKHSSV C L+PRYAS+KLS  KQQVVGTL+THHQKCV+VDTQA 
Sbjct  309   TEGVMQTHDEQTLKFFKHSSVHCALSPRYASNKLSIFKQQVVGTLFTHHQKCVLVDTQAS  368

Query  1615  GNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLH  1436
             GNNRKITAFIGGLDLCDGRYDTP+HRLF D D+VF  D++NPTF     +GPRQPWHDLH
Sbjct  369   GNNRKITAFIGGLDLCDGRYDTPEHRLFRDLDSVFANDFHNPTFAT-CTRGPRQPWHDLH  427

Query  1435  CKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVP  1256
             CKIEGPAAYDILTNFEQRWRKA+KW E   + KK++HWHDDAL+K+ERISWI SP+ SVP
Sbjct  428   CKIEGPAAYDILTNFEQRWRKATKWREF--KLKKVTHWHDDALIKLERISWILSPSTSVP  485

Query  1255  NDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMA  1076
             +DD +LWVS+E D + WHVQVFRSIDSGS+KGFPK    AE +NLVC K+LVID+SI  A
Sbjct  486   SDDFNLWVSHEDDGECWHVQVFRSIDSGSVKGFPKVGQEAEAKNLVCGKNLVIDKSIHAA  545

Query  1075  YIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYI  896
             Y++AIR AQHFIYIENQYFLGSSY WPSYK AGADNLIPMELALKI SKI   ERFAVYI
Sbjct  546   YVKAIRSAQHFIYIENQYFLGSSYHWPSYKNAGADNLIPMELALKIASKIVANERFAVYI  605

Query  895   VIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIE-DAHPCDYLNFYCLGNR  719
             VIPMWPEGVP+SA VQ+IL+WQGQT+ MMY II + L+   +   +HP DYLNFYCLGNR
Sbjct  606   VIPMWPEGVPASASVQEILFWQGQTMDMMYRIIGQALQQAGLAGKSHPQDYLNFYCLGNR  665

Query  718   EEW-HEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGS  542
             E    E  AS+  P  +  L  +QK  RFM+YVH+KGM+VDDEYVI+GSANINQRSM GS
Sbjct  666   ERGPRERLASTSQPSENSVLGLTQKFRRFMVYVHSKGMIVDDEYVILGSANINQRSMDGS  725

Query  541   RDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNE  362
             RDTEIAMGAYQPHH WA ++  PH QVYGYR+SLWAEHLG ++E     E +ECV  VN 
Sbjct  726   RDTEIAMGAYQPHHKWAGSKGPPHGQVYGYRVSLWAEHLGFLEECFHTPESMECVTRVNH  785

Query  361   IAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDA  182
              AE NW+ + +E+   ++GHL++YP++VDS G+V PL G E FPDVGG++LGS  +LPD+
Sbjct  786   FAEYNWRTFISEEVKDMKGHLMRYPIKVDSEGRVGPLPGHECFPDVGGRILGSHNSLPDS  845

Query  181   LTT  173
             LTT
Sbjct  846   LTT  848



>ref|XP_010238440.1| PREDICTED: phospholipase D delta [Brachypodium distachyon]
Length=858

 Score =  1159 bits (2999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 574/855 (67%), Positives = 672/855 (79%), Gaps = 35/855 (4%)
 Frame = -2

Query  2668  VYLHGDLDLKILEARRLPNMDIVSERIRQFF----TAFDC---RKPETR--QGNKVRRHT  2516
             + LHGDLDL I+EAR LPNMD+ SE IR+ F    TA  C   + P TR  +G   R H 
Sbjct  14    ILLHGDLDLWIIEARLLPNMDMFSEHIRRCFATCGTASSCAPKQPPRTRGGEGPNRRHHR  73

Query  2515  RIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGAD  2336
             +IITSDPYV + +AGA VART VI NS++P W E F +P+AH  + +EFQVKDND FGA 
Sbjct  74    KIITSDPYVTLSVAGAVVARTAVIPNSEEPRWGEQFFVPLAHRAAMLEFQVKDNDTFGAQ  133

Query  2335  FIGVAKVSAQKIISG--ETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT  2162
              IG A + A ++ S   E +++WFPI+G  G+P KP  A+ L  +F P   NP Y+ G+ 
Sbjct  134   LIGTASIPADRVTSACEEEVDEWFPIVGPSGRPYKPRTALHLRFRFRPLDTNPMYKHGIP  193

Query  2161  ---EDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILE  1991
                E  G+++SYFP+RHGG VTLYQDAHV EG LP I+++ GK F H NCWEDICHAILE
Sbjct  194   GDPEKQGVQDSYFPLRHGGRVTLYQDAHVNEGDLPGIELERGKQFEHNNCWEDICHAILE  253

Query  1990  AHHMVYIVGWSIYHKVKLVREPT--RplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTS  1817
             AHHM+YIVGWS+Y KVKLVREP+  RPLP GG+L LG+LLK+KSQEGVRV LLVWDDKTS
Sbjct  254   AHHMIYIVGWSVYDKVKLVREPSPSRPLPEGGDLTLGDLLKFKSQEGVRVCLLVWDDKTS  313

Query  1816  HSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCV  1637
             H K FI T GVMGTHDEETRKFFKHSSV CVL+PRYASSKLS  KQQVVGTL+THHQKCV
Sbjct  314   HDKLFIKTGGVMGTHDEETRKFFKHSSVICVLSPRYASSKLSIFKQQVVGTLFTHHQKCV  373

Query  1636  IVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPR  1457
             +VDTQA GN RK+TAF+GGLDLCDGRYDTPQHRLF D DTVF  DY+NPTF   G KGPR
Sbjct  374   LVDTQASGNKRKVTAFVGGLDLCDGRYDTPQHRLFKDLDTVFENDYHNPTF-SAGAKGPR  432

Query  1456  QPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWIT  1277
             QPWHDLHCKI+GPAAYD+L NFEQRWRKASK+ E   RF+KISHW DDAL+K+ERISWI 
Sbjct  433   QPWHDLHCKIDGPAAYDVLKNFEQRWRKASKFRE---RFRKISHWKDDALIKLERISWIL  489

Query  1276  SPTPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVI  1097
             SP+P++PND  SL VS E DP+NWHVQVFRSIDSGSLKGFP D   A  QNLVC K+L+I
Sbjct  490   SPSPNIPNDHASLRVSKEEDPENWHVQVFRSIDSGSLKGFPSDCKEASKQNLVCRKNLII  549

Query  1096  DRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNR  917
             D+SI  AY+ AIR AQHFIYIENQYFLGSSY WPSY  +GADNLIPMELALKI SKIR  
Sbjct  550   DKSIHTAYVRAIRSAQHFIYIENQYFLGSSYGWPSYVNSGADNLIPMELALKIASKIRAG  609

Query  916   ERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNF  737
             ERFAVY+VIPMWPEGVP++A VQ+ILY+Q QT++MMY ++A+ELK+  IE+AHP DYLNF
Sbjct  610   ERFAVYVVIPMWPEGVPTAASVQEILYFQAQTMEMMYRVVAQELKTMNIENAHPQDYLNF  669

Query  736   YCLGNREEWHEESASSPTPGCSEFLTGSQKSG--------RFMIYVHAKGMVVDDEYVIV  581
             YCLGNREE       S T G  E    + KS         RFMIYVHAKGM+VDDEYVI+
Sbjct  670   YCLGNREE-------SSTNGSPESDKSTDKSAAALARKYRRFMIYVHAKGMIVDDEYVIL  722

Query  580   GSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLD  401
             GSANINQRS+AGSRDTEIAMGAYQPHH+W+K   HPH QVYGYR SLWAEHLGM+D++  
Sbjct  723   GSANINQRSLAGSRDTEIAMGAYQPHHSWSKKGAHPHGQVYGYRSSLWAEHLGMVDDRFK  782

Query  400   EAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVG  221
             +   L+CV+ VN+IAEENW R+TAE+   LQGHLL+YP++V+ +G + PL   E FPDVG
Sbjct  783   DPSSLDCVRFVNQIAEENWNRFTAEEMKTLQGHLLRYPVKVEPDGNIGPLPDQECFPDVG  842

Query  220   GKVLGSRTTLPDALT  176
             GK+ G+ T+LPD+LT
Sbjct  843   GKICGAPTSLPDSLT  857



>ref|XP_004957519.1| PREDICTED: phospholipase D delta-like [Setaria italica]
Length=861

 Score =  1159 bits (2998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 576/856 (67%), Positives = 669/856 (78%), Gaps = 34/856 (4%)
 Frame = -2

Query  2671  VVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNK-------------  2531
              V LHGDLDL I EAR LPNMD+ SE++R+ F A  CR P T  G K             
Sbjct  15    TVLLHGDLDLWIKEARLLPNMDLFSEQVRRCFAA--CRPP-TSCGPKHPPAAAVPRGGSG  71

Query  2530  --VRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKD  2357
                  H +IITSDPYV + ++GA VART VI N+QDPVW E F +P+AH  + +EFQVKD
Sbjct  72    GRHHHHRKIITSDPYVTLSVSGAVVARTAVIPNNQDPVWEERFAVPLAHRAAALEFQVKD  131

Query  2356  NDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRY  2177
             ND FGA  IG   V A  + SGE + DW+PIIG +GKP KPD A+ L  +F P AENP Y
Sbjct  132   NDTFGAQLIGTVTVPADIVASGEEVEDWYPIIGTNGKPYKPDTALCLRFRFQPIAENPAY  191

Query  2176  RGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDIC  2006
             R G+  D    G+K+SYFP+RHGG VTLYQDAHV EG LPEI+++DGK F H  CWEDIC
Sbjct  192   RRGIPGDPERKGIKDSYFPLRHGGQVTLYQDAHVREGDLPEIELEDGKMFEHNACWEDIC  251

Query  2005  HAILEAHHMVYIVGWSIYHKVKLVRE--PTRplpnggnlnlgelLKYKSQEGVRVLLLVW  1832
             HAILEAHHM+YIVGWS+Y KV+LVRE  P+RPLP GG+L LGELLK+KSQEGVRV LLVW
Sbjct  252   HAILEAHHMIYIVGWSVYDKVRLVRERSPSRPLPEGGDLTLGELLKFKSQEGVRVCLLVW  311

Query  1831  DDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTH  1652
             DDKTSH KF   T GVM THDE+TRKFFKHSSV CVL+PRYAS+KLS  KQQVVGTL+TH
Sbjct  312   DDKTSHDKFLFKTGGVMATHDEDTRKFFKHSSVICVLSPRYASNKLSIFKQQVVGTLFTH  371

Query  1651  HQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGG  1472
             HQKCV+VDTQA GN RK+TAFIGGLDLCDGRYDTP+HRLF D DTVF  DY+NPTF   G
Sbjct  372   HQKCVLVDTQAWGNKRKVTAFIGGLDLCDGRYDTPEHRLFKDLDTVFHNDYHNPTF-SAG  430

Query  1471  LKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIER  1292
              KGPRQPWHDLHC+I+GPAAYD+LTNFEQRWRKA+KW +   RF+++SHW DDAL+K+ER
Sbjct  431   AKGPRQPWHDLHCRIDGPAAYDVLTNFEQRWRKATKWRD---RFRRVSHWKDDALIKLER  487

Query  1291  ISWITSPTPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCA  1112
             ISWI SP+ +VPND PSLWVS E D +NWHVQVFRSIDSGSLKGFP D   A   NLVC 
Sbjct  488   ISWILSPSRNVPNDHPSLWVSKEEDRENWHVQVFRSIDSGSLKGFPSDCKEASKLNLVCR  547

Query  1111  KDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVS  932
             K+LVID+SI  AY+ AIR AQHFIYIENQYFLGSSYAWPSY  +GADNLIP+ELALKI S
Sbjct  548   KNLVIDKSIHTAYVRAIRSAQHFIYIENQYFLGSSYAWPSYVNSGADNLIPIELALKIAS  607

Query  931   KIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPC  752
             KIR  ERFAVY+VIPMWPEGVP++A VQ+IL++Q QT++MMY+IIA ELK+  I+D HP 
Sbjct  608   KIRAGERFAVYVVIPMWPEGVPTAASVQEILFFQAQTMEMMYKIIADELKAMDIKDMHPQ  667

Query  751   DYLNFYCLGNREE----WHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVI  584
             DYLNF+CLGNREE       ES  S     +   T   K  RFMIYVHAKGM+VDDEYVI
Sbjct  668   DYLNFFCLGNREEPSSNGSPESEKSTDKSAAALAT---KYRRFMIYVHAKGMIVDDEYVI  724

Query  583   VGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKL  404
             +GSANINQRS+AGSRDTEIAMGAYQPHH W+    HPH QVYGYR SLWAEHLGM+D++ 
Sbjct  725   LGSANINQRSLAGSRDTEIAMGAYQPHHAWSTKNRHPHGQVYGYRTSLWAEHLGMVDDRF  784

Query  403   DEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDV  224
              +   L+CV+ VN+IA ENW+R+TAE+   LQGHLLKYP+ V+ +GK+ PL   E FPDV
Sbjct  785   KDPSSLDCVRFVNQIAVENWQRFTAEEIRTLQGHLLKYPVNVEDDGKIGPLPDQENFPDV  844

Query  223   GGKVLGSRTTLPDALT  176
             GGK+LG+ T+LPD+LT
Sbjct  845   GGKILGAPTSLPDSLT  860



>ref|XP_004232528.1| PREDICTED: phospholipase D delta [Solanum lycopersicum]
Length=866

 Score =  1159 bits (2998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 566/862 (66%), Positives = 676/862 (78%), Gaps = 30/862 (3%)
 Frame = -2

Query  2677  ENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPET--------------R  2543
             EN + LHGDL+L I++AR LPNMD+ SERIR+ FTA D CRKP+T              +
Sbjct  8     ENFICLHGDLELHIIQARHLPNMDLTSERIRRCFTACDVCRKPQTGSTADDGNGELPNVK  67

Query  2542  QGNKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQV  2363
               ++   H  IITSDPYV VC     +ARTRVI NSQ+PVW EHF+IP+AHP+  ++F+V
Sbjct  68    STDQKIHHRSIITSDPYVAVCAPHTALARTRVIPNSQNPVWDEHFRIPLAHPMDCLDFRV  127

Query  2362  KDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENP  2183
             KD+DVFGA  +G   + A+KI SGE ++ WFP+IGA GK PKPD A+RL MKF P   NP
Sbjct  128   KDDDVFGAQVMGKVTIPAEKIASGEVVSGWFPVIGASGKSPKPDTALRLWMKFVPYDTNP  187

Query  2182  RYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEG-SLPEIKIDDGKAFHHENCWE  2015
              Y+ G+  D    G++ +YFP+R G +V LYQDAHV +   LPEI++++   F H  CWE
Sbjct  188   LYKRGIASDPQYLGVRNTYFPLRKGSSVKLYQDAHVSDKFKLPEIQLENNTTFEHNKCWE  247

Query  2014  DICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLV  1835
             DIC+AI EAHH++YIVGWS++HKVKLVREPTRPLP GG+L LGELLKYKSQEGVRVLLLV
Sbjct  248   DICYAITEAHHLIYIVGWSVFHKVKLVREPTRPLPRGGDLTLGELLKYKSQEGVRVLLLV  307

Query  1834  WDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYT  1655
             WDDKTSH KFFINT+GVMGTHDEETRKFFKHSSV CVL+PRYASSKLS +KQQVVGT++T
Sbjct  308   WDDKTSHDKFFINTAGVMGTHDEETRKFFKHSSVICVLSPRYASSKLSLIKQQVVGTMFT  367

Query  1654  HHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEG  1475
             HHQKCV+VDTQA GNNRK+TAF+GGLDLCDGRYDTP+HRLF D DTVF+ D + PTFP  
Sbjct  368   HHQKCVLVDTQAPGNNRKVTAFLGGLDLCDGRYDTPEHRLFHDLDTVFKDDVHQPTFP-A  426

Query  1474  GLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIE  1295
             G K PRQPWHDLHC+I+GPA YD+L NF QRWRKA+KW E     K +SHWHDDA+LKIE
Sbjct  427   GTKAPRQPWHDLHCRIDGPAVYDVLINFAQRWRKATKWREFKFFKKTMSHWHDDAMLKIE  486

Query  1294  RISWITSP-------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTA  1136
             RISWI SP       + ++P DDP L V  E   +NWHVQ+FRSIDSGS++GFPK +  A
Sbjct  487   RISWILSPAFAVLKDSTAIPEDDPKLHVYGEDHSENWHVQIFRSIDSGSVQGFPKTIDVA  546

Query  1135  ETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPM  956
             + QNLVC+K+L++D+SI+ AYI+AIR AQHFIYIENQYFLGSSYAW SYK+AGAD+LIPM
Sbjct  547   QAQNLVCSKNLMVDKSIEAAYIQAIRSAQHFIYIENQYFLGSSYAWESYKDAGADHLIPM  606

Query  955   ELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSE  776
             ELALKI SKIR RERF VY+V+PMWPEG P S  +Q+IL+WQ QTIQMMY++IA ELKS 
Sbjct  607   ELALKITSKIRARERFCVYVVVPMWPEGDPKSITMQEILFWQSQTIQMMYQVIATELKSM  666

Query  775   KIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDD  596
             +I D+HP DYLNFYCLGNREE     A S   G  + ++ S K  RFMIYVHAKGM+VDD
Sbjct  667   QILDSHPQDYLNFYCLGNREEIPGSIAQS--SGNGDKVSDSYKFQRFMIYVHAKGMIVDD  724

Query  595   EYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMM  416
             EYVI+GSANINQRS+AGS+DTEIAMGAYQPH+ W + Q  P  Q+YGYRMSLWAEHLG +
Sbjct  725   EYVIMGSANINQRSLAGSKDTEIAMGAYQPHYAWTEKQRRPRGQIYGYRMSLWAEHLGRI  784

Query  415   DEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEY  236
             +E   E E L CV+ VNE+AE NWK YTAEKF+ L GHLLKYP+ V ++GKV PL   E 
Sbjct  785   EECFKEPEALTCVRKVNEVAEGNWKSYTAEKFTQLHGHLLKYPIHVGADGKVGPLAEYEN  844

Query  235   FPDVGGKVLGSRT-TLPDALTT  173
             FPDVGG++LG+   T+PD LTT
Sbjct  845   FPDVGGRILGNHAPTIPDVLTT  866



>gb|AEF58504.1| phospholipase D delta [Dimocarpus longan]
Length=865

 Score =  1156 bits (2991),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 571/858 (67%), Positives = 678/858 (79%), Gaps = 29/858 (3%)
 Frame = -2

Query  2674  NVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETR--------QGNKVRR  2522
              V+YLHGDLDLKI+ ARRLPNMD+V+  +R+ FTA D C  P+           G   + 
Sbjct  13    QVIYLHGDLDLKIIGARRLPNMDVVANSLRRCFTACDACTPPQPSSRSPSIDGDGYDKKS  72

Query  2521  HTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFG  2342
             H +IIT+DPYV V +  ATVARTRV+ N+Q P W EHF IP+AHPV +VEFQVKD+DVFG
Sbjct  73    HRKIITTDPYVTVVVPQATVARTRVLKNTQSPHWDEHFVIPLAHPVVDVEFQVKDDDVFG  132

Query  2341  ADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT  2162
             A+ IG+AK+ A KI +GE I+ WFPII A G+PPK D AIRL MKFTPC ENP YR GV 
Sbjct  133   AELIGMAKIPASKIAAGEHISGWFPIINAKGQPPKLDSAIRLEMKFTPCEENPLYRHGVA  192

Query  2161  ---EDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILE  1991
                E  G++ +YFP+R G  + LYQDAHV  G LPE+K++    +    CWEDIC+AI E
Sbjct  193   GDPEQSGVRRTYFPLRKGCQLKLYQDAHVKPGQLPEVKLNGHVDYTAGTCWEDICYAISE  252

Query  1990  AHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHS  1811
             AHH+VYIVGWS+++K+KL+REPTR LP GG+L LGELLKYKS+EGVR+LLLVWDDKTSH 
Sbjct  253   AHHLVYIVGWSVFYKIKLIREPTRELPRGGDLTLGELLKYKSEEGVRILLLVWDDKTSHD  312

Query  1810  KFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIV  1631
             KF I T GVMGTHDEET K+FKHSSV CVLAPRYASSKL   KQQVVGT++THHQKCV+V
Sbjct  313   KFGIKTGGVMGTHDEETLKYFKHSSVNCVLAPRYASSKLGIFKQQVVGTMFTHHQKCVLV  372

Query  1630  DTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQP  1451
             DTQA GNNRKITAFIGG+DLCDGRYDTP+HRLF D +T+F GD++NPT+P   +K PRQP
Sbjct  373   DTQAFGNNRKITAFIGGIDLCDGRYDTPEHRLFRDLNTIFEGDFHNPTYP-STVKAPRQP  431

Query  1450  WHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSP  1271
             W DLHC+I+GPAAYD+L NFEQRWRK++KW E   +FKK+SHWHDD+L+KIERISWI SP
Sbjct  432   WRDLHCRIDGPAAYDVLINFEQRWRKSTKWKEFSLKFKKVSHWHDDSLIKIERISWILSP  491

Query  1270  --------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAET--QNL  1121
                     T  VP DD  + VS+E +P+NWHVQVFRSIDSGS+KGFPK ++  +   QNL
Sbjct  492   ELSSTREGTTIVPTDDRIVRVSDEKNPENWHVQVFRSIDSGSVKGFPKSINIKQIGEQNL  551

Query  1120  VCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALK  941
             +CAKDLVI++SIQ AYI+AIR AQH+IYIENQYFLGSSYAWPSYK AGADNLIPMELALK
Sbjct  552   LCAKDLVIEKSIQAAYIQAIRSAQHYIYIENQYFLGSSYAWPSYKFAGADNLIPMELALK  611

Query  940   IVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIE-D  764
             I SKIR +ERFAVYI+IPMWPEG P    VQ+IL+WQ QT+QMMY IIA+ LK  +++ D
Sbjct  612   IASKIRAKERFAVYIIIPMWPEGDPKDNTVQEILFWQSQTMQMMYSIIAQALKDMQMDTD  671

Query  763   AHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVI  584
             +HP DYLNFYCLGNREE  ++++++     SE    SQK+ RFMIYVHAKGM+VDDEYVI
Sbjct  672   SHPQDYLNFYCLGNREELPDDASNTNGATVSE----SQKNRRFMIYVHAKGMIVDDEYVI  727

Query  583   VGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKL  404
             VGSANINQRSMAG++DTEIAMGAYQPHHTWAK +  P  QVYGYRMSLWAEHLG ++   
Sbjct  728   VGSANINQRSMAGTKDTEIAMGAYQPHHTWAKKKKRPFGQVYGYRMSLWAEHLGKLERHF  787

Query  403   DEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDV  224
             +E E LECVK VN+IA+ENWK +TA  F+ LQGHLL YPL +  +GKV PL G E FPD 
Sbjct  788   EEPESLECVKRVNQIADENWKHFTAPDFTLLQGHLLMYPLHIRKDGKVEPLPGQENFPDA  847

Query  223   GGKVLGSRTT-LPDALTT  173
             GG+V+G     LPD LTT
Sbjct  848   GGRVIGVHALRLPDVLTT  865



>ref|XP_009150166.1| PREDICTED: phospholipase D delta [Brassica rapa]
Length=857

 Score =  1155 bits (2989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/863 (66%), Positives = 677/863 (78%), Gaps = 28/863 (3%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKP-------ETRQ  2540
             M++ +S++V+ LHGDLDLKI++ARRLPNMD+ S+R+R+ FTA + C KP         R 
Sbjct  1     MAEKVSDDVMLLHGDLDLKIVQARRLPNMDLFSDRMRRCFTACNSCAKPPEDDEDPRNRD  60

Query  2539  GN--KVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQ  2366
             G    +R H ++ITSDPYV V +  AT+ARTRV+ NSQDP+W EHF I VAHP+  +EFQ
Sbjct  61    GGDRNIRGHRKVITSDPYVTVVVPQATLARTRVLKNSQDPLWDEHFNISVAHPMPHLEFQ  120

Query  2365  VKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAEN  2186
             VKD+DVFGA  IG AK+   +I SG+ I+ WFP++GA GKPPK + A+ + MKFTP  + 
Sbjct  121   VKDDDVFGAQIIGTAKIPVHQIASGQRISGWFPVLGASGKPPKKETALYVDMKFTPFHQI  180

Query  2185  PRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWE  2015
               YR G+  D    G+K +YFP+R G  V LYQDAHV +G+LPE+ +D+GK + H  CWE
Sbjct  181   EAYRNGIAGDPDRRGVKRTYFPVRKGSKVRLYQDAHVMDGTLPEVGLDNGKVYKHGKCWE  240

Query  2014  DICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLV  1835
             DIC+A+ EAHHM+YIVGWS++HKV+LVREPTR LP GG+L LGELLKYKS+EGVRVLLLV
Sbjct  241   DICYAVSEAHHMIYIVGWSVFHKVRLVREPTRKLPRGGDLTLGELLKYKSEEGVRVLLLV  300

Query  1834  WDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYT  1655
             WDDKTSH KF I+T GVMGTHDEETRKFFKHSSV CVL+PRYASSKL   KQQVVGTL+T
Sbjct  301   WDDKTSHDKFGISTPGVMGTHDEETRKFFKHSSVICVLSPRYASSKLGLFKQQVVGTLFT  360

Query  1654  HHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEG  1475
             HHQKCV+VDTQA GNNRKITAFIGG+DLCDGRYDTP HR+  D DTVF+ D++NPTFP  
Sbjct  361   HHQKCVLVDTQAVGNNRKITAFIGGIDLCDGRYDTPDHRILHDLDTVFKDDFHNPTFP-A  419

Query  1474  GLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIE  1295
               K PRQPWHDLHC+++GPAAYD+L NFEQRWRKA++W E   R K  +HW DDAL++I 
Sbjct  420   ATKAPRQPWHDLHCRLDGPAAYDVLINFEQRWRKATRWKEFSLRLKGKTHWQDDALIRIG  479

Query  1294  RISWITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHT  1139
             RISWI SP        T  VP DDP ++VS E DP+NWH QVFRSIDSGS+KGFPK    
Sbjct  480   RISWILSPVFKFLKDGTSIVPEDDPVVYVSKEDDPENWHAQVFRSIDSGSVKGFPKYEDE  539

Query  1138  AETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIP  959
             AE QNL CAK LV+D+SIQ AYI+ IR AQHFIYIENQYFLGSSYAW +YK+AGADNLIP
Sbjct  540   AEAQNLECAKRLVVDKSIQTAYIQTIRSAQHFIYIENQYFLGSSYAWLNYKDAGADNLIP  599

Query  958   MELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKS  779
             MELALKIVSKIR +ERFAVY+VIP+WPEG P S PVQ+ILYWQ QT+QMMY++I +ELK+
Sbjct  600   MELALKIVSKIRAKERFAVYVVIPLWPEGDPKSGPVQEILYWQSQTMQMMYDVIVRELKA  659

Query  778   EKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVD  599
              +  DAHP DYLNFYCLG RE+  E   ++     S+    S K  RFMIYVHAKGM+VD
Sbjct  660   VQ-SDAHPLDYLNFYCLGKREQLPENMPATNGSAVSD----SYKFQRFMIYVHAKGMIVD  714

Query  598   DEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGM  419
             DEYV++GSANINQRSMAG++DTEIAMGAYQPHHTW     HP  QVYGYRMSLWAEHLG 
Sbjct  715   DEYVLMGSANINQRSMAGTKDTEIAMGAYQPHHTWTNKGRHPRGQVYGYRMSLWAEHLGK  774

Query  418   MDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCE  239
               ++  E   LECVK VNEIAE NWK++T  +FS LQGHL+KYPLQVDS+GKVS L   +
Sbjct  775   TGDEFVEPSDLECVKNVNEIAEGNWKKFTNIEFSELQGHLIKYPLQVDSDGKVSSLPDYD  834

Query  238   YFPDVGGKVLGSRT-TLPDALTT  173
              FPDVGGK++G+ +  LPD LTT
Sbjct  835   SFPDVGGKIIGAHSMALPDTLTT  857



>ref|XP_007046580.1| Phospholipase D delta isoform 2 [Theobroma cacao]
 gb|EOX90737.1| Phospholipase D delta isoform 2 [Theobroma cacao]
Length=853

 Score =  1155 bits (2988),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/859 (66%), Positives = 682/859 (79%), Gaps = 24/859 (3%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPE----TRQGN-  2534
             M +G S+ V+YLHGDLDL I+EAR LPNMD ++  +R+  T  + C+ P       +G+ 
Sbjct  1     MEEG-SKQVIYLHGDLDLTIIEARSLPNMDSLTNHLRRCVTVCEACKTPSQATTVEEGDT  59

Query  2533  KVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDN  2354
             K+R+H +IITSDPYV V +  ATVART V+ N+Q+P W + F IP+AHPV E+E  VKD+
Sbjct  60    KIRQHRKIITSDPYVTVSVPQATVARTSVLKNAQNPRWDQSFVIPLAHPVCELEITVKDD  119

Query  2353  DVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYR  2174
             D+FGA+ IGVAK+ AQKI  GE I+ WF +IG  GKPPKPD AI + MKF PC +NP Y+
Sbjct  120   DLFGAEMIGVAKIPAQKIAMGEPISGWFQLIGPSGKPPKPDTAINVSMKFMPCEKNPLYK  179

Query  2173  GGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICH  2003
               +  D    G++ +YFP+R GG VTLYQDAHVP+  LP+I++DDGK ++   CWEDIC+
Sbjct  180   QSIASDPEQAGVRHTYFPLRKGGQVTLYQDAHVPDNMLPKIELDDGKVYNQGQCWEDICY  239

Query  2002  AILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDK  1823
             AI EAHHMVYIVGWS++HK+KLVREPTRPLP GG+L LG+LLKYKS+EGVRVLLLVWDDK
Sbjct  240   AISEAHHMVYIVGWSVFHKIKLVREPTRPLPRGGDLTLGDLLKYKSEEGVRVLLLVWDDK  299

Query  1822  TSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQK  1643
             TSH KF I+T GVM THDEET KFFKHSSVTCVLAPRYASSKL + KQQVVGT++THHQK
Sbjct  300   TSHDKFGISTVGVMETHDEETFKFFKHSSVTCVLAPRYASSKLGYFKQQVVGTMFTHHQK  359

Query  1642  CVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKG  1463
             CV+VDTQA GNNRKITAF+GG+DLCDGRYDTP+HRL  D +T F+ D++NPTFP    K 
Sbjct  360   CVLVDTQAAGNNRKITAFVGGIDLCDGRYDTPEHRLLRDLETTFKDDFHNPTFPVAA-KA  418

Query  1462  PRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISW  1283
             PRQPWHDLH KIEGPAAYD+L NFEQRWRK++KW E    F+  S W+DDAL++IERISW
Sbjct  419   PRQPWHDLHSKIEGPAAYDVLINFEQRWRKSTKWKEFSLLFRGKSRWNDDALIRIERISW  478

Query  1282  ITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQ  1127
             I SP        T  VP DDP + V ++ D ++W VQ+FRSIDSGS+KGFPK +  A+ Q
Sbjct  479   IQSPPLTATEDDTTIVPEDDPKVHVHSKDDRESWDVQIFRSIDSGSVKGFPKYIKRAQNQ  538

Query  1126  NLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELA  947
             +L  AKDL ID+SIQ AYI+AIR AQH+IYIENQYFLGSSYAWPSYK AGADNLIPMELA
Sbjct  539   HLSYAKDLAIDKSIQTAYIQAIRSAQHYIYIENQYFLGSSYAWPSYKNAGADNLIPMELA  598

Query  946   LKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIE  767
             LK+VSKIR RERFAVYIVIP+WPEG P SA VQ+ILYWQ QT++MMY++IA+ELKS +I+
Sbjct  599   LKVVSKIRARERFAVYIVIPLWPEGDPKSATVQEILYWQSQTMRMMYDVIARELKSMEIK  658

Query  766   DAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYV  587
             D+HP DYLNFYCLG REE  +E       G    +  S K GRFMIYVHAKGM++DDEYV
Sbjct  659   DSHPQDYLNFYCLGKREEVSKELLG----GNGNTVPDSTKFGRFMIYVHAKGMIIDDEYV  714

Query  586   IVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEK  407
             I+GSANINQRSMAG++DTEIAMGAYQPH+TWA+ + HP  QVYGYRMSLWAEHL  +++ 
Sbjct  715   ILGSANINQRSMAGTKDTEIAMGAYQPHYTWAEKKKHPRGQVYGYRMSLWAEHLDELNKC  774

Query  406   LDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPD  227
               E E L CVK VNEIA+ENWK++T   +SPLQGHLL YP+QVD +GKV+PL G E FPD
Sbjct  775   FKEPESLACVKTVNEIAQENWKKFTNTDYSPLQGHLLMYPVQVDVDGKVNPLPGHENFPD  834

Query  226   VGGKVLGSRTT-LPDALTT  173
             VGGKVLG+ +  LPD LTT
Sbjct  835   VGGKVLGAHSIQLPDILTT  853



>ref|XP_002867053.1| atplddelta [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43312.1| atplddelta [Arabidopsis lyrata subsp. lyrata]
Length=869

 Score =  1155 bits (2988),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 571/875 (65%), Positives = 682/875 (78%), Gaps = 40/875 (5%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKP----ETRQGNK  2531
             M++  SE+V+ LHGDLDLKI++ARRLPNMD+ SE +R+ FTA + C +P    + R G +
Sbjct  1     MAEKASEDVMLLHGDLDLKIVKARRLPNMDMFSEHLRRVFTACNACARPTDDVDPRDGGE  60

Query  2530  V-----RRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQ  2366
             V     R H ++ITSDPYV V +  AT+ARTRV+ NSQDP+W EHF I VAHP++ +EFQ
Sbjct  61    VGDKNIRSHRKVITSDPYVTVVVPQATLARTRVLKNSQDPLWDEHFNISVAHPLAYLEFQ  120

Query  2365  VKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAEN  2186
             VKD+DVFGA  IG AK+  + I SGE I+ WFPI+GA GKPPK + A+ + MKFTP  + 
Sbjct  121   VKDDDVFGAQIIGTAKIPVRDIASGERISGWFPILGASGKPPKAETALFIDMKFTPFDQI  180

Query  2185  PRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWE  2015
               YR G+  D    G+K +YFP+R G  V LYQDAHV +G LPEI +D+GK + H  CWE
Sbjct  181   HSYRCGIAGDPDRKGVKRTYFPLRKGSQVRLYQDAHVMDGMLPEIGLDNGKVYQHGKCWE  240

Query  2014  DICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLV  1835
             DIC+A+ EAHHM+Y+VGWS++HK+KLVREPTR LP GG+L LGELLKYKS+EGVRVLLLV
Sbjct  241   DICYAVSEAHHMIYVVGWSVFHKIKLVREPTRKLPRGGDLTLGELLKYKSEEGVRVLLLV  300

Query  1834  WDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQ-------  1676
             WDDKTSH KF I+T GVMGTHDEETRKFFKHSSV CVL+PRYASSKL   KQQ       
Sbjct  301   WDDKTSHDKFGISTPGVMGTHDEETRKFFKHSSVICVLSPRYASSKLGLFKQQASPIFSI  360

Query  1675  -----VVGTLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVF  1511
                  VVGTL+THHQKCV+VDTQA GNNRK+TAFIGGLDLCDGRYDTP+HR+  D DTVF
Sbjct  361   YMVMTVVGTLFTHHQKCVLVDTQAVGNNRKVTAFIGGLDLCDGRYDTPEHRILKDLDTVF  420

Query  1510  RGDYNNPTFPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKI  1331
             + D++NPTFP  G K PRQPWHDLHC+I+GPAAYD+L NFEQRWRKA++W E   R K  
Sbjct  421   KDDFHNPTFP-AGTKAPRQPWHDLHCRIDGPAAYDVLINFEQRWRKATRWKEFSLRLKGK  479

Query  1330  SHWHDDALLKIERISWITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDS  1175
             +HW DDAL++I RISWI SP        T  +P DDP +WVS E DP+NWHVQ+FRSIDS
Sbjct  480   THWQDDALIRIGRISWILSPVFKFLKDGTTIIPEDDPCVWVSKEDDPENWHVQIFRSIDS  539

Query  1174  GSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWP  995
             GS+KGFPK    AE Q+L CAK LV+D+SIQ AYI+ IR AQHFIYIENQYFLGSSYAWP
Sbjct  540   GSVKGFPKYEDEAEAQHLECAKRLVVDKSIQTAYIQTIRSAQHFIYIENQYFLGSSYAWP  599

Query  994   SYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQ  815
             SY++AGADNLIPMELALKIVSKIR +ERFAVY+VIP+WPEG P S PVQ+ILYWQ QT+Q
Sbjct  600   SYRDAGADNLIPMELALKIVSKIRAKERFAVYVVIPLWPEGDPKSGPVQEILYWQSQTMQ  659

Query  814   MMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRF  635
             MMY++IAKELK+ +  DAHP DYLNFYCLG RE+  ++  ++        ++ S K  RF
Sbjct  660   MMYDVIAKELKAVQ-SDAHPLDYLNFYCLGKREKLPDDMPAT----NGNVVSDSYKFQRF  714

Query  634   MIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYG  455
             MIYVHAKGMVVDDEYV++GSANINQRSMAG++DTEIAMGAYQP+HTWA    HP  QVYG
Sbjct  715   MIYVHAKGMVVDDEYVLMGSANINQRSMAGTKDTEIAMGAYQPNHTWAHKGKHPRGQVYG  774

Query  454   YRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVD  275
             YRMSLWAEHLG   ++  E   LECVK VN+I+E NWK++   +F  LQGHL+KYPLQVD
Sbjct  775   YRMSLWAEHLGKTGDEFVEPADLECVKNVNKISEGNWKKFIDSEFKELQGHLIKYPLQVD  834

Query  274   SNGKVSPLGGCEYFPDVGGKVLGSRT-TLPDALTT  173
              +GKVSPL   E FPDVGGK++G+ +  LPD LTT
Sbjct  835   VDGKVSPLPDYESFPDVGGKIIGAHSMALPDTLTT  869



>ref|XP_006412059.1| hypothetical protein EUTSA_v10024382mg [Eutrema salsugineum]
 dbj|BAJ34379.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53512.1| hypothetical protein EUTSA_v10024382mg [Eutrema salsugineum]
Length=860

 Score =  1155 bits (2987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/866 (66%), Positives = 678/866 (78%), Gaps = 31/866 (4%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTA-------FDCRKPETRQG  2537
             M++ +S++V+ LHGDLDLKI++ARRLPNMD+ SE +R+ FT         D   P  R G
Sbjct  1     MAEKVSDDVMLLHGDLDLKIVQARRLPNMDMFSEHMRRCFTVCNSCTTPTDDEDPRDRDG  60

Query  2536  N------KVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEV  2375
                     +R H ++ITSDPYV V +  AT+ARTRV+ N+QDP+W EHF I VAHP+S +
Sbjct  61    GAKSGDRNIRGHRKVITSDPYVTVVVPQATLARTRVLKNAQDPLWDEHFVISVAHPLSYL  120

Query  2374  EFQVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPC  2195
             EFQVKD+DVFGA  IG AK+  + I SGE I+ WFP++GA GKPPK + A+ + MKFTP 
Sbjct  121   EFQVKDDDVFGAQIIGTAKIPVRDIASGERISGWFPVLGASGKPPKKETALFIDMKFTPF  180

Query  2194  AENPRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHEN  2024
              +   YR G+  D    G+K +YFP+R G  V LYQDAHV +G LPEI +D+GK + H  
Sbjct  181   DQIHTYRTGIAGDPDRKGVKRTYFPVRKGSQVRLYQDAHVMDGMLPEIGLDNGKVYQHGK  240

Query  2023  CWEDICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVL  1844
             CWEDIC+A+ EAHHM+YIVGWS++HKVKLVREPTR LP GG+L LGELLKYKS+EGVRVL
Sbjct  241   CWEDICYAVSEAHHMIYIVGWSVFHKVKLVREPTRKLPRGGDLTLGELLKYKSEEGVRVL  300

Query  1843  LLVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGT  1664
             LLVWDDKTSH KF I+T+GVMGTHDEETRKFFKHSSV CVL+PRYASSKL   KQQVVGT
Sbjct  301   LLVWDDKTSHDKFGISTAGVMGTHDEETRKFFKHSSVICVLSPRYASSKLGLFKQQVVGT  360

Query  1663  LYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTF  1484
             L+THHQKCV+VDTQA GNNRK+TAFIGG+DLCDGRYDTP+HR+  D D+VF+ D++NPTF
Sbjct  361   LFTHHQKCVLVDTQAVGNNRKVTAFIGGIDLCDGRYDTPEHRILRDLDSVFKDDFHNPTF  420

Query  1483  PEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALL  1304
             P  G K PRQPWHDLHC++EGPAAYD+L NFEQRWRKA++W E   R K  +HW DDAL+
Sbjct  421   P-AGTKAPRQPWHDLHCRLEGPAAYDVLINFEQRWRKATRWKEFSLRLKGKTHWQDDALI  479

Query  1303  KIERISWITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKD  1148
             +I RISWI SP        T  VP DDP ++VS E DP+NWHVQVFRSIDSGS+KGFPK 
Sbjct  480   RIGRISWILSPVFKYLKDGTSIVPEDDPVVYVSKEDDPENWHVQVFRSIDSGSVKGFPKY  539

Query  1147  VHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADN  968
                AE Q+L CAK LV+D+SIQ AYI+ IR AQHFIYIENQYFLGSSYAWPSYK+AGADN
Sbjct  540   EDEAEAQHLECAKRLVVDKSIQTAYIQTIRSAQHFIYIENQYFLGSSYAWPSYKDAGADN  599

Query  967   LIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKE  788
             LIPMELALKIVSKIR +ERFAVY+VIP+WPEG P S PVQ+ILYWQ QT+QMMY++IA+E
Sbjct  600   LIPMELALKIVSKIRAKERFAVYVVIPLWPEGDPKSGPVQEILYWQSQTMQMMYDVIARE  659

Query  787   LKSEKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGM  608
             LKS +  DAHP DYLNFYCLG RE+  ++  ++        ++ S K  RFMIYVHAKGM
Sbjct  660   LKSVQ-SDAHPLDYLNFYCLGKREQLPDDMPAT----NGSVVSDSYKFQRFMIYVHAKGM  714

Query  607   VVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEH  428
             +VDDEYV++GSANINQRSMAG++DTEIAMGAYQPHHTWA    HP  QVYGYRMSLWAEH
Sbjct  715   IVDDEYVLMGSANINQRSMAGTKDTEIAMGAYQPHHTWANKGRHPRGQVYGYRMSLWAEH  774

Query  427   LGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLG  248
             LG   ++  +   LECVK VN IAE NWK++   +F+ LQGHL+KYPLQVD +GKVS L 
Sbjct  775   LGKTGDEFMKPADLECVKHVNGIAEGNWKKFIDSEFAELQGHLIKYPLQVDIDGKVSSLP  834

Query  247   GCEYFPDVGGKVLGSRT-TLPDALTT  173
               E FPDVGGK++G+ +  LPD LTT
Sbjct  835   DYESFPDVGGKIIGAHSMALPDTLTT  860



>ref|XP_009768465.1| PREDICTED: phospholipase D delta-like [Nicotiana sylvestris]
Length=856

 Score =  1154 bits (2984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 562/863 (65%), Positives = 681/863 (79%), Gaps = 33/863 (4%)
 Frame = -2

Query  2683  MSE-NVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKP------------ET  2546
             MSE   + LHGDL+L I++AR LPNMDI S R+R+ FT    CRKP             T
Sbjct  1     MSEPKKLILHGDLELHIIQARHLPNMDITSARLRRCFTLGGICRKPPDSTVDGGDDGDRT  60

Query  2545  RQGNKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQ  2366
              Q +K  +H +IITSDPYV V      +ARTR+I NSQ PVW EHF+IP+AHP++ +EF+
Sbjct  61    SQPDKKNQHRKIITSDPYVTVSAPQTALARTRIIPNSQYPVWDEHFRIPLAHPMAFLEFR  120

Query  2365  VKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAEN  2186
             VKD+D+FGA+ +G  K+ A+ I +G+ I+ WFPIIG  GKPPKP+ A+++ MKF P   N
Sbjct  121   VKDDDLFGAEIMGKVKIPAESIATGDVISGWFPIIGPSGKPPKPNSALKVQMKFFPYDTN  180

Query  2185  PRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEG-SLPEIKIDDGKAFHHENCW  2018
               Y  G+  D    G++ +YFP+R G +V LYQDAHV      P+IK++ G  F H  CW
Sbjct  181   SLYTRGIASDPQHLGVRNTYFPLRKGSSVKLYQDAHVSNNVKFPDIKLEKGTNFEHNKCW  240

Query  2017  EDICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLL  1838
             EDIC+AI EAHH++YIVGWS+YHK+KL+REPTRPLP GG+L LGELLKYKSQEGVRVLLL
Sbjct  241   EDICYAISEAHHLIYIVGWSVYHKIKLIREPTRPLPRGGDLTLGELLKYKSQEGVRVLLL  300

Query  1837  VWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLY  1658
             VWDDKTSH KFFINT+GVMGTHDEET+KFFKHSSV CVL+PRYASSKLS +KQQVVGT++
Sbjct  301   VWDDKTSHDKFFINTAGVMGTHDEETKKFFKHSSVICVLSPRYASSKLSIMKQQVVGTMF  360

Query  1657  THHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPE  1478
             THHQKC++VDTQA GNNRKITAF+GGLDLCDGRYDTP+HRLF D DTVF+ D++ P FP 
Sbjct  361   THHQKCILVDTQAPGNNRKITAFLGGLDLCDGRYDTPEHRLFRDLDTVFKDDFHQPQFPP  420

Query  1477  GGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKI  1298
              G K PR+PWHDLHC+I+GPAAYD+L NF QRWR+A+KW E     K +S W+DDA+LKI
Sbjct  421   -GTKAPREPWHDLHCRIDGPAAYDVLINFAQRWRRATKWREFAFFKKTMSRWNDDAMLKI  479

Query  1297  ERISWITSPTPSV-------PNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHT  1139
             ERISWI SP  +V       P DDP L+V+ E  P+NWHVQ+FRSIDSGS++GFPK +  
Sbjct  480   ERISWILSPAFAVFKVGTEIPADDPKLYVAGEDHPENWHVQIFRSIDSGSVQGFPKSIDV  539

Query  1138  AETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIP  959
             A+ QNL+ +KDLV+D+SI+ AYI+AIR AQHFIYIENQYFLGSSYAWPSYK+AGAD+L+P
Sbjct  540   AKAQNLISSKDLVVDKSIESAYIQAIRSAQHFIYIENQYFLGSSYAWPSYKDAGADHLVP  599

Query  958   MELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKS  779
             MELALKI SKIR RERF VY+V+PMWPEG P S   Q+ILYWQ QT+QMMY++IA+ELKS
Sbjct  600   MELALKIASKIRARERFCVYVVLPMWPEGDPKSVTGQEILYWQSQTMQMMYQVIARELKS  659

Query  778   EKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVD  599
              ++ D+HP DYLNFYCLGNRE      A+      ++ ++ S K  RFMIYVHAKGM+VD
Sbjct  660   MQLVDSHPLDYLNFYCLGNRE------ANGQFANDADKVSDSYKFQRFMIYVHAKGMIVD  713

Query  598   DEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGM  419
             DEYVI+GSANINQRS+AGS+DTEIAMGAYQPHH+WAK Q HP  QVYGYRMSLWAEHLGM
Sbjct  714   DEYVILGSANINQRSLAGSKDTEIAMGAYQPHHSWAKKQQHPRGQVYGYRMSLWAEHLGM  773

Query  418   MDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCE  239
             +++   E E  ECVK VNE+AE+NWKRYTAE F+ LQGHLLKYP+QVD++GKV PL   E
Sbjct  774   LEDSFQEPEAFECVKRVNEVAEDNWKRYTAEIFTELQGHLLKYPIQVDADGKVCPLPDYE  833

Query  238   YFPDVGGKVLGSRT-TLPDALTT  173
              FPDVGGK+LG+ + T+PD LTT
Sbjct  834   CFPDVGGKILGNPSPTIPDVLTT  856



>ref|XP_003612259.1| Phospholipase D delta isoform [Medicago truncatula]
Length=1102

 Score =  1153 bits (2983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 564/896 (63%), Positives = 681/896 (76%), Gaps = 66/896 (7%)
 Frame = -2

Query  2677  ENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKV----------  2528
             +   YLHGDLDL I+ ARRLPNMD+ SER  +  TA D  K  +   +            
Sbjct  11    DGFTYLHGDLDLTIISARRLPNMDMFSERFCRCITACDTIKFHSPPSDSTTTAADGGTTT  70

Query  2527  -RRH---TRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVK  2360
              R H    +II SDPYV V +  ATVARTRV+ NS +P W E F IP+AHPV ++E +VK
Sbjct  71    HREHHHRRKIIRSDPYVTVSVPQATVARTRVLKNSLNPEWKERFHIPLAHPVIDLEIRVK  130

Query  2359  DNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPR  2180
             D+DVFGA+ +G+ K+ A++I +GE I+ WFPI+ + GKPPKPD A+ + MKFTP  ENP 
Sbjct  131   DDDVFGAEVMGMVKIPAKRIATGELISGWFPIVASSGKPPKPDTALNIEMKFTPVDENPL  190

Query  2179  YRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDI  2009
             Y  G+  D    G++ +YFP+R G +V LYQDAH PEG++PEI++D+GK +  ENCWEDI
Sbjct  191   YLRGIAADPEHGGVRHTYFPVRKGSSVRLYQDAHCPEGTVPEIQLDNGKVYRAENCWEDI  250

Query  2008  CHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWD  1829
             C+AI EAHHMVY+ GWSIY KVKLVREP+RPLP GG+L LG+LLKYKS+EGVRVLLLVWD
Sbjct  251   CYAITEAHHMVYLAGWSIYDKVKLVREPSRPLPKGGDLTLGDLLKYKSEEGVRVLLLVWD  310

Query  1828  DKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHH  1649
             DKTSH K F  T+GVM THDEETRKFFKHSSV CVLAPRYASSK+SF+KQQVVGT++THH
Sbjct  311   DKTSHDKLFFKTTGVMETHDEETRKFFKHSSVMCVLAPRYASSKMSFIKQQVVGTVFTHH  370

Query  1648  QKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGL  1469
             QKCVIVD QA GNNR++  FIGGLDLCDGRYDTP+HRLF D DTVF GD++NPTFP  G 
Sbjct  371   QKCVIVDAQAAGNNRRVATFIGGLDLCDGRYDTPEHRLFRDLDTVFAGDFHNPTFP-SGT  429

Query  1468  KGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERI  1289
             + PRQPWHDLHC+I+GPAAYD+L NFEQRWRKA+KW E    FKK S W+DDAL++++RI
Sbjct  430   RAPRQPWHDLHCRIDGPAAYDVLINFEQRWRKATKWKEFAILFKKASQWNDDALIRVDRI  489

Query  1288  SWITS------PTPS--------VPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPK  1151
             SWI S      PTP         VP DDP LWVS+E DP+NWHVQ+FRSIDSGSLKGFPK
Sbjct  490   SWILSPSLPTLPTPKESKEGYTIVPGDDPLLWVSSENDPENWHVQIFRSIDSGSLKGFPK  549

Query  1150  DVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAG--  977
                 A +QNL+CAK+L I++SIQ  YI+AIR AQHFIYIENQYF+GSSYAWPSY  AG  
Sbjct  550   RADQALSQNLICAKNLTIEKSIQTGYIQAIRSAQHFIYIENQYFIGSSYAWPSYNNAGGL  609

Query  976   ---------------------------ADNLIPMELALKIVSKIRNRERFAVYIVIPMWP  878
                                        ADNLIPMELALKI SKI+ +ERFA+YIV+PMWP
Sbjct  610   NVNTFEKQDNCLYLSEVVSFVVDKRNCADNLIPMELALKIASKIKAKERFAIYIVLPMWP  669

Query  877   EGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREEWHEES  698
             EG P S  VQ+IL+WQ QT+QMMY ++AKELKS ++ D HP DYLNFYCLGNRE ++EES
Sbjct  670   EGDPKSGAVQEILFWQAQTMQMMYNVVAKELKSMQLSDVHPQDYLNFYCLGNREHFNEES  729

Query  697   ASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMG  518
             + S +   S    G+ K  R MIYVHAKGM+VDDEYVI+GSANINQRSMAG++DTEIAMG
Sbjct  730   SGSNSAPVS----GAFKYRRNMIYVHAKGMIVDDEYVILGSANINQRSMAGTKDTEIAMG  785

Query  517   AYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKR  338
             +YQPH+TW+  + HPH Q+YGYRMSLWAEHLGM+DE   E E LECV+ VNEIA++NW++
Sbjct  786   SYQPHYTWSARKKHPHGQIYGYRMSLWAEHLGMLDETFKEPERLECVRKVNEIADDNWRK  845

Query  337   YTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRT-TLPDALTT  173
             Y +E+ S LQGHLLKYP+Q+DS+G+VS L  C+ FPD GGK+LG+ + T+PD LTT
Sbjct  846   YASEEMSLLQGHLLKYPVQIDSDGQVSSLPDCDSFPDAGGKILGAHSATIPDILTT  901



>ref|XP_010432230.1| PREDICTED: phospholipase D delta-like isoform X2 [Camelina sativa]
Length=857

 Score =  1153 bits (2982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 566/863 (66%), Positives = 677/863 (78%), Gaps = 28/863 (3%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPET--------R  2543
             M+    E  + LHGDLDLKI++ARRLPNMD+ SE +R+FFTA + C  P T         
Sbjct  1     MAAKSPEATMLLHGDLDLKIVQARRLPNMDMFSEHMRRFFTACNACTTPATDDDPRDRGE  60

Query  2542  QGNK-VRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQ  2366
              G+K +R H ++ITSDPYV V +  +T+ARTRV+ NSQDP W E+FKI +AHP+S +EFQ
Sbjct  61    HGDKNIRSHRKVITSDPYVTVVVPQSTLARTRVLKNSQDPTWNENFKISIAHPLSHLEFQ  120

Query  2365  VKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAEN  2186
             VKD+DVFGA  IG AK+  + I++GE I+ WFP++GA GKPPK + A+ + MKFTP  + 
Sbjct  121   VKDDDVFGAQIIGTAKIPVRDIVTGERISGWFPVLGASGKPPKKETALYIDMKFTPFDQI  180

Query  2185  PRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWE  2015
               YR G+  D    G+K +YFP+R G  V LYQDAHV +G LPEI +D+G  + H  CWE
Sbjct  181   HNYRFGIAGDPERKGVKRTYFPVRKGSQVRLYQDAHVMDGMLPEIALDNGNVYQHGKCWE  240

Query  2014  DICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLV  1835
             DIC+A+ EAHHM+YIVGWS++HK+KLVREPTR LP GG+L LGELLKYKS+EGVRVLLLV
Sbjct  241   DICYAVSEAHHMIYIVGWSVFHKIKLVREPTRKLPRGGDLTLGELLKYKSEEGVRVLLLV  300

Query  1834  WDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYT  1655
             WDDKTSH KF I+T GVMGTHDEETRKFFKHSSV CVL+PRYASSKL   KQQVVGTL+T
Sbjct  301   WDDKTSHDKFGISTPGVMGTHDEETRKFFKHSSVICVLSPRYASSKLGLFKQQVVGTLFT  360

Query  1654  HHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEG  1475
             HHQKCV+VDTQA GNNRK+TAFIGGLDLCDGRYDTP+HR+ +D DTVF+ D++NPTFP  
Sbjct  361   HHQKCVLVDTQAVGNNRKVTAFIGGLDLCDGRYDTPEHRILNDLDTVFKDDFHNPTFP-A  419

Query  1474  GLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIE  1295
             G K PRQPWHDLHC+I+GPAAYD+L NFEQRWRKA++W E   R K  +HW DDAL++I 
Sbjct  420   GTKAPRQPWHDLHCRIDGPAAYDVLMNFEQRWRKATRWKEFSLRLKGKTHWQDDALIRIG  479

Query  1294  RISWITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHT  1139
             RISWI SP        T  VP D+P +WVS E DP+NWH QVFRSIDSGS+KGFPK    
Sbjct  480   RISWILSPVFKFLKDGTSIVPEDEPCVWVSKEDDPENWHCQVFRSIDSGSVKGFPKYEDE  539

Query  1138  AETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIP  959
             AE Q+L CAK LV+D+SIQ AYI+ IR AQHFIYIENQYFLGSSYAWPSYK+AGADNLIP
Sbjct  540   AEVQHLECAKRLVVDKSIQTAYIQTIRSAQHFIYIENQYFLGSSYAWPSYKDAGADNLIP  599

Query  958   MELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKS  779
             MELALKIVSKIR +ERFAVY+VIP+WPEG P S PVQ+ILYWQ QT+QMMY++IAKELK+
Sbjct  600   MELALKIVSKIRAKERFAVYVVIPLWPEGDPKSGPVQEILYWQSQTMQMMYDVIAKELKA  659

Query  778   EKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVD  599
              +  DAHP DYLNFYCLG RE+  ++  ++     S+    S K  RFMIYVHAKGM+VD
Sbjct  660   VQ-SDAHPLDYLNFYCLGKREQLPDDMPATNGNTVSD----SYKFQRFMIYVHAKGMIVD  714

Query  598   DEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGM  419
             DEYV++GSANINQRSMAG++DTEIAMGAYQPH+TW     HP  QVYGYRMSLWAEHLG 
Sbjct  715   DEYVLMGSANINQRSMAGTKDTEIAMGAYQPHYTWNHKGKHPRGQVYGYRMSLWAEHLGK  774

Query  418   MDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCE  239
               ++  +   LECVK VNEI+E NWK++   +F+ LQGHL+KYPL VD +GKVSPL   E
Sbjct  775   TGDEFVKPSDLECVKNVNEISEGNWKKFIDTEFAELQGHLIKYPLLVDIDGKVSPLPDYE  834

Query  238   YFPDVGGKVLGSRT-TLPDALTT  173
              FPDVGGK++G+ +  LPD LTT
Sbjct  835   TFPDVGGKIIGAHSMALPDTLTT  857



>ref|XP_008802877.1| PREDICTED: phospholipase D delta-like [Phoenix dactylifera]
Length=860

 Score =  1152 bits (2981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 556/848 (66%), Positives = 677/848 (80%), Gaps = 20/848 (2%)
 Frame = -2

Query  2677  ENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAF-DCRKP-------ETRQGNKVRR  2522
             ENV +LHGDLD+ ILEAR LPNMDI ++R+ + FT +  C  P       + +Q ++ + 
Sbjct  20    ENVKFLHGDLDIWILEARSLPNMDIFTDRMIKCFTIYGTCTTPCGKTDKLKDKQKDRHKS  79

Query  2521  HTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFG  2342
               +IITSDPYV VC+AGAT+A+TRVI N ++P W EHF++PVAHPVS++EFQVKDNDVFG
Sbjct  80    MRKIITSDPYVSVCVAGATIAQTRVIPNCENPKWEEHFRVPVAHPVSKIEFQVKDNDVFG  139

Query  2341  ADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT  2162
             A  IGVA ++  KI+ G T+N WFP++G +G P KP   + L +KF P  +NP Y+ GV 
Sbjct  140   AQLIGVAAIAVDKILPGVTVNGWFPVVGPYGNPMKPYPELHLSLKFRPMEDNPLYKDGVG  199

Query  2161  ---EDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILE  1991
                E  G+  +YFP+R GG VTLYQDAHVP+  LP I++D GK + H  CWEDICHAILE
Sbjct  200   AGPEYLGVPNAYFPLRTGGNVTLYQDAHVPDNMLPAIQLDGGKTYGHNKCWEDICHAILE  259

Query  1990  AHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHS  1811
             AHH++Y++GWSIYH VKLVREPTR LPNGG L+LGELLKYK+QEGVRV++L+WDDKTSH 
Sbjct  260   AHHLIYVIGWSIYHPVKLVREPTRTLPNGGELSLGELLKYKTQEGVRVVMLIWDDKTSHD  319

Query  1810  KFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIV  1631
             KF++ T GVM THDEETRKFFKHSSV CVLAPRYAS+KLS  KQQVVGTL+THHQKCV+V
Sbjct  320   KFYLKTDGVMHTHDEETRKFFKHSSVHCVLAPRYASNKLSIFKQQVVGTLFTHHQKCVLV  379

Query  1630  DTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQP  1451
             DTQA GNNRKITAFIGGLDLCDGRYDTP+H+LF + D+VF  D++NPTFP     GPRQP
Sbjct  380   DTQAGGNNRKITAFIGGLDLCDGRYDTPEHQLFQNLDSVFVKDFHNPTFPVNSY-GPRQP  438

Query  1450  WHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSP  1271
             WHDLHCKIEGPAA+DILTNFEQRWRKA+KW +   R  K++HWHDDAL+KIERISWI +P
Sbjct  439   WHDLHCKIEGPAAHDILTNFEQRWRKATKWRDF--RLSKVAHWHDDALIKIERISWIITP  496

Query  1270  TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDR  1091
                  N +    VS+E +P+NWHVQ+FRSIDSGS+KGFPK V  AE++NLVCAK+L ID+
Sbjct  497   VSDKSNTN----VSDEQNPENWHVQIFRSIDSGSVKGFPKVVQEAESKNLVCAKNLKIDK  552

Query  1090  SIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRER  911
             SI  AY++AIR AQHFIY+ENQYF+GSSY WPSYK AGADNLIPMELALKIVSKI+ RER
Sbjct  553   SIHSAYVKAIRSAQHFIYVENQYFIGSSYCWPSYKNAGADNLIPMELALKIVSKIKARER  612

Query  910   FAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDA-HPCDYLNFY  734
             F+VYIVIPMWPEG+P++A +Q+IL+WQGQT+ MMY+ + + L+ E + D  HP DYLNFY
Sbjct  613   FSVYIVIPMWPEGIPTAAAMQEILFWQGQTMAMMYKFVGEALQEESLSDKYHPQDYLNFY  672

Query  733   CLGNREEWHEESASSPTPGC-SEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQR  557
             CLG RE   +E ASSP     +  L  +QKS RFMIYVH+KGM+VDDEYVI+GSANINQR
Sbjct  673   CLGRREPIPKEKASSPKISSDNTALRSAQKSRRFMIYVHSKGMIVDDEYVIIGSANINQR  732

Query  556   SMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECV  377
             SM GSRDTEIAMGAYQPHH WA    HPH QVYGYRMSLWAEHLGM+++     + LEC+
Sbjct  733   SMEGSRDTEIAMGAYQPHHKWAGKGTHPHGQVYGYRMSLWAEHLGMVEDCFHGPQSLECI  792

Query  376   KMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRT  197
             + VN++AE+NW  Y   +   ++GHL++YP++V+ NGK+ PL G E FPDVGGKVLG+ +
Sbjct  793   RRVNKLAEDNWNSYVDPEIKEMKGHLMRYPIKVERNGKIGPLPGHECFPDVGGKVLGAHS  852

Query  196   TLPDALTT  173
             TLPD LTT
Sbjct  853   TLPDVLTT  860



>ref|XP_010437424.1| PREDICTED: phospholipase D delta isoform X2 [Camelina sativa]
Length=857

 Score =  1149 bits (2972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 567/863 (66%), Positives = 676/863 (78%), Gaps = 28/863 (3%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPET--------R  2543
             M+    E  + LHGDLDLKI++ARRLPNMD+ SE +R+ FT+ + C  P T         
Sbjct  1     MAAKSPEPTMLLHGDLDLKIVQARRLPNMDMFSEHMRRCFTSCNACTTPATDDDPRDRGE  60

Query  2542  QGNK-VRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQ  2366
              G+K +R H ++ITSDPYV V +  +T+ARTRV+ NSQDP W E+FKI +AHP+S +EFQ
Sbjct  61    PGDKNIRSHRKVITSDPYVTVVVPQSTLARTRVLKNSQDPTWNENFKISIAHPLSHLEFQ  120

Query  2365  VKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAEN  2186
             VKD+DVFGA  IG AK+  + I SGE I+ WFP++GA GKPPK + A+ + MKFTP  + 
Sbjct  121   VKDDDVFGAQIIGTAKIPVRDIASGERISGWFPVLGASGKPPKKETALYIDMKFTPFDQI  180

Query  2185  PRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWE  2015
               YR G+  D    G+K +YFP+R G  V LYQDAHV +G LPEI +D+GK + H  CWE
Sbjct  181   HNYRIGIAGDPERKGVKRTYFPVRKGSQVRLYQDAHVMDGMLPEIGLDNGKVYQHGKCWE  240

Query  2014  DICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLV  1835
             DIC+A+ EAHHM+YIVGWS++HK+KLVREPTR LP GG+L LGELLKYKS+EGVRVLLLV
Sbjct  241   DICYAVSEAHHMIYIVGWSVFHKIKLVREPTRKLPRGGDLTLGELLKYKSEEGVRVLLLV  300

Query  1834  WDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYT  1655
             WDDKTSH KF I+T GVMGTHDEETRKFFKHSSV CVL+PRYASSKL   KQQVVGTL+T
Sbjct  301   WDDKTSHDKFGISTPGVMGTHDEETRKFFKHSSVICVLSPRYASSKLGLFKQQVVGTLFT  360

Query  1654  HHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEG  1475
             HHQKCV+VDTQA GNNRK+TAFIGGLDLCDGRYDTP+HR+ +D DTVF+ D++NPTFP  
Sbjct  361   HHQKCVLVDTQAVGNNRKVTAFIGGLDLCDGRYDTPEHRILNDLDTVFKDDFHNPTFP-A  419

Query  1474  GLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIE  1295
             G K PRQPWHDLHC+I+GPAAYD+L NFEQRWRKA++W E   R K  +HW DDAL++I 
Sbjct  420   GTKAPRQPWHDLHCRIDGPAAYDVLMNFEQRWRKATRWKEFSLRLKGKTHWQDDALIRIG  479

Query  1294  RISWITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHT  1139
             RISWI SP        T  VP D+P +WVS E DP+NWH QVFRSIDSGS+KGFPK    
Sbjct  480   RISWILSPVFKFLKDGTSIVPEDEPCVWVSKEDDPENWHCQVFRSIDSGSVKGFPKYEDE  539

Query  1138  AETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIP  959
             AE Q+L CAK LV+D+SIQ AYI+ IR AQHFIYIENQYFLGSSYAWPSYK+AGADNLIP
Sbjct  540   AEVQHLECAKRLVVDKSIQTAYIQTIRSAQHFIYIENQYFLGSSYAWPSYKDAGADNLIP  599

Query  958   MELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKS  779
             MELALKIVSKIR +ERFAVY+VIP+WPEG P S PVQ+ILYWQ QT+QMMY++IAKELK+
Sbjct  600   MELALKIVSKIRAKERFAVYVVIPLWPEGDPKSGPVQEILYWQSQTMQMMYDVIAKELKA  659

Query  778   EKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVD  599
              +  DAHP DYLNFYCLG RE+  +   ++     S+    S K  RFMIYVHAKGM+VD
Sbjct  660   VQ-SDAHPLDYLNFYCLGKREKLPDNMPATNGNTVSD----SYKFQRFMIYVHAKGMIVD  714

Query  598   DEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGM  419
             DEYV++GSANINQRSMAG++DTEIAMGAYQPH+TW     HP  QVYGYRMSLWAEHLG 
Sbjct  715   DEYVLMGSANINQRSMAGTKDTEIAMGAYQPHYTWNHKGKHPRGQVYGYRMSLWAEHLGK  774

Query  418   MDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCE  239
               ++  +   LECVK VNEI+E NWK++   +F+ LQGHL+KYPLQVD +GKVSPL   E
Sbjct  775   TGDEFVKPSDLECVKNVNEISEGNWKKFIDTEFAELQGHLIKYPLQVDVDGKVSPLPDYE  834

Query  238   YFPDVGGKVLGSRT-TLPDALTT  173
              FPDVGGK++G+ +  LPD LTT
Sbjct  835   SFPDVGGKIIGAHSMALPDTLTT  857



>emb|CDX69166.1| BnaC01g02870D [Brassica napus]
Length=2640

 Score =  1149 bits (2972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 565/880 (64%), Positives = 677/880 (77%), Gaps = 43/880 (5%)
 Frame = -2

Query  2701  VKMSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKP-------ET  2546
             + M++ +S++V+ LHGDLDLKI++ARRLPNMD+ S+R+R+ FTA + C KP         
Sbjct  1767  LAMAEKVSDDVMLLHGDLDLKIVQARRLPNMDLFSDRMRRCFTACNSCAKPPEVDEDPRN  1826

Query  2545  RQGN--KVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVE  2372
             R G    +R H ++ITSDPYV V +  AT+ARTRV+ NSQDP+W EHF I VAHP+  +E
Sbjct  1827  RDGGDRNIRGHRKVITSDPYVTVVVPQATLARTRVLKNSQDPLWDEHFNISVAHPMPHLE  1886

Query  2371  FQVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCA  2192
             FQVKD+DVFGA  IG AK+   +I SG+ I+ WFP++GA GKPPK + A+ + MKFTP  
Sbjct  1887  FQVKDDDVFGAQIIGTAKIPVHQIASGQRISGWFPVLGASGKPPKKETALYVDMKFTPFH  1946

Query  2191  ENPRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENC  2021
             +   YR G+  D    G+K +YFP+R G  V LYQDAHV +G+LPE+ +D+GK + H  C
Sbjct  1947  QIETYRSGIAGDPDRRGVKRTYFPVRKGSKVRLYQDAHVMDGTLPEVGLDNGKVYKHGKC  2006

Query  2020  WEDICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLL  1841
             WEDIC+A+ EAHHM+YIVGWS++HKV+LVREPTR LP GG+L LGELLKYKS+EGVRVLL
Sbjct  2007  WEDICYAVSEAHHMIYIVGWSVFHKVRLVREPTRKLPRGGDLTLGELLKYKSEEGVRVLL  2066

Query  1840  LVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLS----------  1691
             LVWDDKTSH KF I+T GVMGTHDEETRKFFKHSSV CVL+PRYAS+++S          
Sbjct  2067  LVWDDKTSHDKFGISTPGVMGTHDEETRKFFKHSSVICVLSPRYASNRISEYVCLRSIIR  2126

Query  1690  ----FVKQQVVGTLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDR  1523
                      VVGTL+THHQKCV+VDTQA GNNRKITAFIGG+DLCDGRYDTP HR+  D 
Sbjct  2127  DVLGNALNLVVGTLFTHHQKCVLVDTQAVGNNRKITAFIGGIDLCDGRYDTPDHRILHDL  2186

Query  1522  DTVFRGDYNNPTFPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRR  1343
             DTVF+ D++NPTFP    K PRQPWHDLHC+++GPAAYD+L NFEQRWRKA++W E   R
Sbjct  2187  DTVFKDDFHNPTFP-AATKAPRQPWHDLHCRLDGPAAYDVLINFEQRWRKATRWKEFSLR  2245

Query  1342  FKKISHWHDDALLKIERISWITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFR  1187
              K  +HW DDAL++I RISWI SP        T  VP DDP ++VS E DP+NWH QVFR
Sbjct  2246  LKGKTHWQDDALIRIGRISWILSPVFKFLKDGTSIVPEDDPVVYVSKEDDPENWHAQVFR  2305

Query  1186  SIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSS  1007
             SIDSGS+KGFPK    AE QNL CAK LV+D+SIQ AYI+ IR AQHFIYIENQYFLGSS
Sbjct  2306  SIDSGSVKGFPKYEDEAEAQNLECAKRLVVDKSIQTAYIQTIRSAQHFIYIENQYFLGSS  2365

Query  1006  YAWPSYKEA-GADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQ  830
             YAWP+YK+A GADNLIPMELALKIVSKIR +ERFAVY+VIP+WPEG P S PVQ+ILYWQ
Sbjct  2366  YAWPNYKDAAGADNLIPMELALKIVSKIRAKERFAVYVVIPLWPEGDPKSGPVQEILYWQ  2425

Query  829   GQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQ  650
              QT+QMMY++I +ELK+ +  DAHP DYLNFYCLG RE+  E   ++     S+    S 
Sbjct  2426  SQTMQMMYDVIVRELKAVQ-SDAHPLDYLNFYCLGKREQLPENMPATNGSAVSD----SY  2480

Query  649   KSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPH  470
             K  RFMIYVHAKGM+VDDEYV++GSANINQRSMAG++DTEIAMGAYQPHHTW     HP 
Sbjct  2481  KFQRFMIYVHAKGMIVDDEYVLMGSANINQRSMAGTKDTEIAMGAYQPHHTWTNKGRHPR  2540

Query  469   AQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKY  290
              QVYGYRMSLWAEHLG   ++  E   LECVK VNEIAE NWK++T  KFS LQGHL+KY
Sbjct  2541  GQVYGYRMSLWAEHLGKTADEFVEPSDLECVKNVNEIAEGNWKKFTNTKFSELQGHLIKY  2600

Query  289   PLQVDSNGKVSPLGGCEYFPDVGGKVLGSRT-TLPDALTT  173
             PLQVDS+GKVS L   + FPDVGGK++G+ +  LPD LTT
Sbjct  2601  PLQVDSDGKVSSLPDYDSFPDVGGKIIGAHSMALPDTLTT  2640



>ref|NP_849501.1| phospholipase D delta [Arabidopsis thaliana]
 gb|AAG53975.1|AF322228_1 phospholipase D delta [Arabidopsis thaliana]
 gb|AAL11978.1|AF306345_1 phospholipase D [Arabidopsis thaliana]
 dbj|BAE99251.1| phospholipase D [Arabidopsis thaliana]
 gb|AEE86571.1| phospholipase D delta [Arabidopsis thaliana]
Length=857

 Score =  1149 bits (2972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 563/865 (65%), Positives = 674/865 (78%), Gaps = 32/865 (4%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQ-------  2540
             M++ +SE+V+ LHGDLDLKI++ARRLPNMD+ SE +R+ FTA + C +P           
Sbjct  1     MAEKVSEDVMLLHGDLDLKIVKARRLPNMDMFSEHLRRLFTACNACARPTDTDDVDPRDK  60

Query  2539  ---GNK-VRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVE  2372
                G+K +R H ++ITSDPYV V +  AT+ARTRV+ NSQ+P+W E F I +AHP + +E
Sbjct  61    GEFGDKNIRSHRKVITSDPYVTVVVPQATLARTRVLKNSQEPLWDEKFNISIAHPFAYLE  120

Query  2371  FQVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCA  2192
             FQVKD+DVFGA  IG AK+  + I SGE I+ WFP++GA GKPPK + AI + MKFTP  
Sbjct  121   FQVKDDDVFGAQIIGTAKIPVRDIASGERISGWFPVLGASGKPPKAETAIFIDMKFTPFD  180

Query  2191  ENPRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENC  2021
             +   YR G+  D    G++ +YFP+R G  V LYQDAHV +G+LP I +D+GK + H  C
Sbjct  181   QIHSYRCGIAGDPERRGVRRTYFPVRKGSQVRLYQDAHVMDGTLPAIGLDNGKVYEHGKC  240

Query  2020  WEDICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLL  1841
             WEDIC+AI EAHHM+YIVGWSI+HK+KLVRE    +P   ++ LGELLKYKSQEGVRVLL
Sbjct  241   WEDICYAISEAHHMIYIVGWSIFHKIKLVRE--TKVPRDKDMTLGELLKYKSQEGVRVLL  298

Query  1840  LVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTL  1661
             LVWDDKTSH KF I T GVMGTHDEETRKFFKHSSV CVL+PRYASSKL   KQQVVGTL
Sbjct  299   LVWDDKTSHDKFGIKTPGVMGTHDEETRKFFKHSSVICVLSPRYASSKLGLFKQQVVGTL  358

Query  1660  YTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFP  1481
             +THHQKCV+VDTQA GNNRK+TAFIGGLDLCDGRYDTP+HR+  D DTVF+ D++NPTFP
Sbjct  359   FTHHQKCVLVDTQAVGNNRKVTAFIGGLDLCDGRYDTPEHRILHDLDTVFKDDFHNPTFP  418

Query  1480  EGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLK  1301
               G K PRQPWHDLHC+I+GPAAYD+L NFEQRWRKA++W E   R K  +HW DDAL++
Sbjct  419   -AGTKAPRQPWHDLHCRIDGPAAYDVLINFEQRWRKATRWKEFSLRLKGKTHWQDDALIR  477

Query  1300  IERISWITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDV  1145
             I RISWI SP        T  +P DDP +WVS E DP+NWHVQ+FRSIDSGS+KGFPK  
Sbjct  478   IGRISWILSPVFKFLKDGTSIIPEDDPCVWVSKEDDPENWHVQIFRSIDSGSVKGFPKYE  537

Query  1144  HTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNL  965
               AE Q+L CAK LV+D+SIQ AYI+ IR AQHFIYIENQYFLGSSYAWPSY++AGADNL
Sbjct  538   DEAEAQHLECAKRLVVDKSIQTAYIQTIRSAQHFIYIENQYFLGSSYAWPSYRDAGADNL  597

Query  964   IPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKEL  785
             IPMELALKIVSKIR +ERFAVY+VIP+WPEG P S PVQ+ILYWQ QT+QMMY++IAKEL
Sbjct  598   IPMELALKIVSKIRAKERFAVYVVIPLWPEGDPKSGPVQEILYWQSQTMQMMYDVIAKEL  657

Query  784   KSEKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMV  605
             K+ +  DAHP DYLNFYCLG RE+  ++  ++        ++ S    RFMIYVHAKGM+
Sbjct  658   KAVQ-SDAHPLDYLNFYCLGKREQLPDDMPAT----NGSVVSDSYNFQRFMIYVHAKGMI  712

Query  604   VDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHL  425
             VDDEYV++GSANINQRSMAG++DTEIAMGAYQP+HTWA    HP  QVYGYRMSLWAEHL
Sbjct  713   VDDEYVLMGSANINQRSMAGTKDTEIAMGAYQPNHTWAHKGRHPRGQVYGYRMSLWAEHL  772

Query  424   GMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGG  245
             G   ++  E   LEC+K VN I+EENWKR+   KFS LQGHL+KYPLQVD +GKVSPL  
Sbjct  773   GKTGDEFVEPSDLECLKKVNTISEENWKRFIDPKFSELQGHLIKYPLQVDVDGKVSPLPD  832

Query  244   CEYFPDVGGKVLGSRT-TLPDALTT  173
              E FPDVGGK++G+ +  LPD LTT
Sbjct  833   YETFPDVGGKIIGAHSMALPDTLTT  857



>ref|XP_010446878.1| PREDICTED: phospholipase D delta [Camelina sativa]
Length=857

 Score =  1148 bits (2970),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 566/863 (66%), Positives = 676/863 (78%), Gaps = 28/863 (3%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPET--------R  2543
             M+    E  + LHGDLDLKI++ARRLPNMD+ SE +R+ FTA + C  P T         
Sbjct  1     MAAKSPEPTMLLHGDLDLKIVQARRLPNMDMFSEHMRRCFTACNACTTPATDDDPRDRGE  60

Query  2542  QGNK-VRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQ  2366
              G+K +R H ++ITSDPYV V +  AT+ARTRV+ NSQDP W E+FKI +AHP+S +EFQ
Sbjct  61    TGDKNIRSHRKVITSDPYVTVVVPQATLARTRVLKNSQDPTWNENFKISIAHPLSHLEFQ  120

Query  2365  VKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAEN  2186
             VKD+DVFGA  IG AK+  + I++GE I+ WFP++GA GKPPK + A+ + MKFTP  + 
Sbjct  121   VKDDDVFGAQIIGSAKIPVRDIVTGERISGWFPVLGASGKPPKKETALYIDMKFTPFDQI  180

Query  2185  PRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWE  2015
               YR G+  D    G+K +YFP+R G  V LYQDAHV +G LPEI +D+GK + H  CWE
Sbjct  181   HNYRIGIAGDPERKGVKRTYFPVRKGSQVRLYQDAHVMDGMLPEIGLDNGKVYQHGKCWE  240

Query  2014  DICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLV  1835
             DIC+A+ EAHHM+YIVGWS++HK+KLVREPTR LP GG+L LGELLKYKS+EGVRVLLLV
Sbjct  241   DICYAVSEAHHMIYIVGWSVFHKIKLVREPTRKLPRGGDLTLGELLKYKSEEGVRVLLLV  300

Query  1834  WDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYT  1655
             WDDKTSH KF I+T GVMGTHDEETRKFFKHSSV CVL+PRYASSKL   KQQVVGTL+T
Sbjct  301   WDDKTSHDKFGISTPGVMGTHDEETRKFFKHSSVICVLSPRYASSKLGLFKQQVVGTLFT  360

Query  1654  HHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEG  1475
             HHQKCV+VDTQA GNNRK+TAFIGG+DLCDGRYDTP+HR+  D DTVF+ D++NPTFP  
Sbjct  361   HHQKCVLVDTQAVGNNRKVTAFIGGIDLCDGRYDTPEHRILHDLDTVFKDDFHNPTFP-A  419

Query  1474  GLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIE  1295
             G K PRQPWHDLHC+I+GPAAYD+L NFEQRWRKA++W E   R K  +HW DDAL++I 
Sbjct  420   GTKAPRQPWHDLHCRIDGPAAYDVLMNFEQRWRKATRWKEFSLRLKGKTHWQDDALIRIG  479

Query  1294  RISWITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHT  1139
             RISWI SP        T  VP D+P +WVS E DP+NWH QVFRSIDSGS+KGFPK    
Sbjct  480   RISWILSPVFKFLKDGTSIVPEDEPCVWVSKEDDPENWHCQVFRSIDSGSVKGFPKYEDE  539

Query  1138  AETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIP  959
             AE Q+L CAK LV+D+SIQ AYI+ IR AQHFIYIENQYFLGSSYAWPSYK+AGADNLIP
Sbjct  540   AEVQHLECAKRLVVDKSIQTAYIQTIRSAQHFIYIENQYFLGSSYAWPSYKDAGADNLIP  599

Query  958   MELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKS  779
             MELALKIVSKIR +ERFAVY+VIP+WPEG P S PVQ+ILYWQ QT+QMMY++IAKELK+
Sbjct  600   MELALKIVSKIRAKERFAVYVVIPLWPEGDPKSGPVQEILYWQSQTMQMMYDVIAKELKA  659

Query  778   EKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVD  599
              +  DAHP DYLNFYCLG RE+  ++  ++     S+    S K  RFMIYVHAKGM+VD
Sbjct  660   VQ-SDAHPLDYLNFYCLGKREQLPDDMPATNGNTVSD----SYKFQRFMIYVHAKGMIVD  714

Query  598   DEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGM  419
             DEYV++GSANINQRSMAG++DTEIAMGAYQPH+TW     HP  QVYGYRMSLWAEHLG 
Sbjct  715   DEYVLMGSANINQRSMAGTKDTEIAMGAYQPHYTWNHKGKHPRGQVYGYRMSLWAEHLGK  774

Query  418   MDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCE  239
               ++  +   LECVK VNEI+E NWK++   +F+ LQGHL+KYPL VD +GKVSPL   E
Sbjct  775   TGDEFAKPSDLECVKNVNEISEGNWKKFIDTEFAELQGHLIKYPLLVDIDGKVSPLPDYE  834

Query  238   YFPDVGGKVLGSRT-TLPDALTT  173
              FPDVGGK++G+ +  LPD LTT
Sbjct  835   TFPDVGGKIIGAHSMALPDTLTT  857



>ref|XP_009344820.1| PREDICTED: phospholipase D delta isoform X1 [Pyrus x bretschneideri]
 ref|XP_009344821.1| PREDICTED: phospholipase D delta isoform X2 [Pyrus x bretschneideri]
Length=855

 Score =  1148 bits (2970),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 562/854 (66%), Positives = 676/854 (79%), Gaps = 25/854 (3%)
 Frame = -2

Query  2677  ENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDC----RKPETRQGNKVRRH---  2519
             E ++YLHGDLDL I EARRLPNMD+ SER R+ FTA D       P        R+H   
Sbjct  8     ERMIYLHGDLDLTIYEARRLPNMDMFSERFRRCFTACDTINISSTPSAEDDGGERKHHVP  67

Query  2518  -TRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFG  2342
               +IITSD YV V +   TVARTRV+ NSQ+P W EHF +P+AHP   +EF VKD+DVFG
Sbjct  68    HRKIITSDSYVTVTVPQTTVARTRVMKNSQNPQWKEHFFVPLAHPAINLEFHVKDDDVFG  127

Query  2341  ADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT  2162
             A+ IG AK+ A+ I +GE I+ WFPI G  GKPPKPD AIRL ++FTP  +NP Y+ G+ 
Sbjct  128   AEIIGTAKIPAETIATGELISGWFPIYGPSGKPPKPDSAIRLELQFTPFEKNPVYKQGIA  187

Query  2161  ED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILE  1991
              D    G++ +YFP+R G +V LYQDAH P G L EI++D GK +  EN WEDIC+AI E
Sbjct  188   GDPEHKGVRNTYFPLRKGSSVRLYQDAHCPAG-LREIQLDGGKVYKAENTWEDICYAITE  246

Query  1990  AHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHS  1811
             AHH+VYIVGWS++HKV+L+REP+RPLP GG+L LG+LLKYKS+EGVRVLLLVWDDK+SH 
Sbjct  247   AHHLVYIVGWSVFHKVRLIREPSRPLPRGGDLMLGDLLKYKSEEGVRVLLLVWDDKSSHD  306

Query  1810  KFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIV  1631
             KF   T+G+MGTHDEETRKFFKHSSV CVL+ RYASSKLS +KQQVVGTL+THHQKCV+V
Sbjct  307   KFGFKTAGMMGTHDEETRKFFKHSSVNCVLSTRYASSKLSIIKQQVVGTLFTHHQKCVLV  366

Query  1630  DTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQP  1451
             DTQA GNNRKITAF+GGLDLCDGRYDTP+HRLF + DTVF+GD + PTFP  G K PRQP
Sbjct  367   DTQADGNNRKITAFLGGLDLCDGRYDTPEHRLFRNLDTVFKGDVHQPTFP-AGTKAPRQP  425

Query  1450  WHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSP  1271
             WHDLHC+++GPAAYD+L NFEQRWRKA++W E     KK+SHWHDDAL+KI+RISWI SP
Sbjct  426   WHDLHCRVDGPAAYDVLINFEQRWRKATRWKEFALLSKKVSHWHDDALIKIDRISWILSP  485

Query  1270  TPSV-------PNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCA  1112
              PSV       P D+PSLWVS+E DP+NWHVQ+FRSIDSGSLKGFPK  H AE ++L+C+
Sbjct  486   PPSVSKDSTIIPEDEPSLWVSDEKDPENWHVQIFRSIDSGSLKGFPKAGHAAEAKHLICS  545

Query  1111  KDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVS  932
             K+LVID+SIQ AYI+AIR AQHFIYIENQYFLGSSYAWP YK AGADNLIPMELALKIVS
Sbjct  546   KNLVIDKSIQTAYIQAIRSAQHFIYIENQYFLGSSYAWPDYKNAGADNLIPMELALKIVS  605

Query  931   KIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPC  752
             KI+  ERF VY+++PMWPEG P +  +Q+IL+WQ QT+Q MY  +A+ LKS +I+ +HP 
Sbjct  606   KIKANERFTVYVILPMWPEGDPKTLAMQEILFWQRQTMQAMYSTVAEALKSAQIQGSHPQ  665

Query  751   DYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSA  572
             DYL+FYCLGNRE   E++A+      S+    SQK+ RFMIYVHAKGMVVDDEYVI+GSA
Sbjct  666   DYLSFYCLGNREALPEDTANDDASSVSD----SQKNRRFMIYVHAKGMVVDDEYVILGSA  721

Query  571   NINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAE  392
             NINQRSMAG++DTEIAMGAYQPH+TWA  + HP  Q+YGYRMSLWAEHL  +    +E E
Sbjct  722   NINQRSMAGTKDTEIAMGAYQPHYTWAARKKHPLGQIYGYRMSLWAEHLDTLHPCFEEPE  781

Query  391   GLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKV  212
              LEC++ VNE+A+ NWKR+T+ +F+ LQGHL+KYP+ VD +G V PL G E FPDVGGKV
Sbjct  782   SLECMRKVNEVADNNWKRFTSPEFTLLQGHLMKYPIHVDVDGTVGPLPGHENFPDVGGKV  841

Query  211   LGSRTT-LPDALTT  173
             LGS +  +PD LTT
Sbjct  842   LGSHSVKIPDMLTT  855



>pir||T04689 hypothetical protein F4B14.60 - Arabidopsis thaliana
 emb|CAA21465.1| putative protein [Arabidopsis thaliana]
 emb|CAB81488.1| putative protein [Arabidopsis thaliana]
Length=1071

 Score =  1147 bits (2967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 563/876 (64%), Positives = 674/876 (77%), Gaps = 43/876 (5%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQ-------  2540
             M++ +SE+V+ LHGDLDLKI++ARRLPNMD+ SE +R+ FTA + C +P           
Sbjct  1     MAEKVSEDVMLLHGDLDLKIVKARRLPNMDMFSEHLRRLFTACNACARPTDTDDVDPRDK  60

Query  2539  ---GNK-VRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVE  2372
                G+K +R H ++ITSDPYV V +  AT+ARTRV+ NSQ+P+W E F I +AHP + +E
Sbjct  61    GEFGDKNIRSHRKVITSDPYVTVVVPQATLARTRVLKNSQEPLWDEKFNISIAHPFAYLE  120

Query  2371  FQVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCA  2192
             FQVKD+DVFGA  IG AK+  + I SGE I+ WFP++GA GKPPK + AI + MKFTP  
Sbjct  121   FQVKDDDVFGAQIIGTAKIPVRDIASGERISGWFPVLGASGKPPKAETAIFIDMKFTPFD  180

Query  2191  ENPRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENC  2021
             +   YR G+  D    G++ +YFP+R G  V LYQDAHV +G+LP I +D+GK + H  C
Sbjct  181   QIHSYRCGIAGDPERRGVRRTYFPVRKGSQVRLYQDAHVMDGTLPAIGLDNGKVYEHGKC  240

Query  2020  WEDICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLL  1841
             WEDIC+AI EAHHM+YIVGWSI+HK+KLVRE    +P   ++ LGELLKYKSQEGVRVLL
Sbjct  241   WEDICYAISEAHHMIYIVGWSIFHKIKLVRET--KVPRDKDMTLGELLKYKSQEGVRVLL  298

Query  1840  LVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQ-----  1676
             LVWDDKTSH KF I T GVMGTHDEETRKFFKHSSV CVL+PRYASSKL   KQQ     
Sbjct  299   LVWDDKTSHDKFGIKTPGVMGTHDEETRKFFKHSSVICVLSPRYASSKLGLFKQQASPSS  358

Query  1675  ------VVGTLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTV  1514
                   VVGTL+THHQKCV+VDTQA GNNRK+TAFIGGLDLCDGRYDTP+HR+  D DTV
Sbjct  359   SIYIMTVVGTLFTHHQKCVLVDTQAVGNNRKVTAFIGGLDLCDGRYDTPEHRILHDLDTV  418

Query  1513  FRGDYNNPTFPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKK  1334
             F+ D++NPTFP  G K PRQPWHDLHC+I+GPAAYD+L NFEQRWRKA++W E   R K 
Sbjct  419   FKDDFHNPTFP-AGTKAPRQPWHDLHCRIDGPAAYDVLINFEQRWRKATRWKEFSLRLKG  477

Query  1333  ISHWHDDALLKIERISWITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSID  1178
              +HW DDAL++I RISWI SP        T  +P DDP +WVS E DP+NWHVQ+FRSID
Sbjct  478   KTHWQDDALIRIGRISWILSPVFKFLKDGTSIIPEDDPCVWVSKEDDPENWHVQIFRSID  537

Query  1177  SGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAW  998
             SGS+KGFPK    AE Q+L CAK LV+D+SIQ AYI+ IR AQHFIYIENQYFLGSSYAW
Sbjct  538   SGSVKGFPKYEDEAEAQHLECAKRLVVDKSIQTAYIQTIRSAQHFIYIENQYFLGSSYAW  597

Query  997   PSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTI  818
             PSY++AGADNLIPMELALKIVSKIR +ERFAVY+VIP+WPEG P S PVQ+ILYWQ QT+
Sbjct  598   PSYRDAGADNLIPMELALKIVSKIRAKERFAVYVVIPLWPEGDPKSGPVQEILYWQSQTM  657

Query  817   QMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGR  638
             QMMY++IAKELK+ +  DAHP DYLNFYCLG RE+  ++  ++        ++ S    R
Sbjct  658   QMMYDVIAKELKAVQ-SDAHPLDYLNFYCLGKREQLPDDMPAT----NGSVVSDSYNFQR  712

Query  637   FMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVY  458
             FMIYVHAKGM+VDDEYV++GSANINQRSMAG++DTEIAMGAYQP+HTWA    HP  QVY
Sbjct  713   FMIYVHAKGMIVDDEYVLMGSANINQRSMAGTKDTEIAMGAYQPNHTWAHKGRHPRGQVY  772

Query  457   GYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQV  278
             GYRMSLWAEHLG   ++  E   LEC+K VN I+EENWKR+   KFS LQGHL+KYPLQV
Sbjct  773   GYRMSLWAEHLGKTGDEFVEPSDLECLKKVNTISEENWKRFIDPKFSELQGHLIKYPLQV  832

Query  277   DSNGKVSPLGGCEYFPDVGGKVLGSRT-TLPDALTT  173
             D +GKVSPL   E FPDVGGK++G+ +  LPD LTT
Sbjct  833   DVDGKVSPLPDYETFPDVGGKIIGAHSMALPDTLTT  868



>ref|XP_009594603.1| PREDICTED: phospholipase D delta isoform X1 [Nicotiana tomentosiformis]
Length=868

 Score =  1147 bits (2966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 557/865 (64%), Positives = 680/865 (79%), Gaps = 32/865 (4%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPET--------------  2546
             +E  + LHGDL+L I++AR LPNMD+ S+R+R+ FTA D CRKP T              
Sbjct  7     TEGFMCLHGDLELHIVQARHLPNMDLTSDRLRRCFTACDVCRKPPTESTADDDGESGVPN  66

Query  2545  --RQGNKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVE  2372
               +  ++   H RIITSDPYV V      +ARTRV++NSQ+PV+ EHF IP+AHP+  +E
Sbjct  67    VKKNPDQKIHHRRIITSDPYVTVSAPHTALARTRVVTNSQNPVFDEHFHIPLAHPIDCLE  126

Query  2371  FQVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCA  2192
             F+VKD+DVFGA  +G  ++ A+KI +GE I  WFP+IGA GK PKP+ A+RL MKF P  
Sbjct  127   FRVKDDDVFGAQVMGKVRIPAEKIAAGEIIAGWFPVIGASGKSPKPNTALRLWMKFVPYD  186

Query  2191  ENPRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEG-SLPEIKIDDGKAFHHEN  2024
              NP Y+ G+  D    G++ +YFP+R G +V LYQDAH+     LPE+++++   + H  
Sbjct  187   TNPLYKQGIASDPQHLGVRNTYFPLRKGSSVKLYQDAHMSNSFKLPEVELENNGVYQHNR  246

Query  2023  CWEDICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVL  1844
             CWEDIC+AI EAHH++YIVGWS++HK+KL+RE TRPLP GG+L LGELLKYKSQEGVRVL
Sbjct  247   CWEDICYAISEAHHLIYIVGWSVFHKIKLIRELTRPLPRGGDLTLGELLKYKSQEGVRVL  306

Query  1843  LLVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGT  1664
             LLVWDDKTSH KF INT+GVMGTHDEET+KFFKHSSV CVL+PRYASSKLS +KQQVVGT
Sbjct  307   LLVWDDKTSHDKFLINTAGVMGTHDEETKKFFKHSSVICVLSPRYASSKLSIIKQQVVGT  366

Query  1663  LYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTF  1484
             ++THHQKCV+VDTQA GNNRK+TAF+GGLDLCDGRYDTP+HRLF D DTVF+ D++ PTF
Sbjct  367   MFTHHQKCVLVDTQASGNNRKVTAFLGGLDLCDGRYDTPEHRLFRDLDTVFKDDFHQPTF  426

Query  1483  PEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALL  1304
             P  G K PRQPWHDLHC+I+GPA YD+L NF QRWRKA+KW E     K +S WHDDA++
Sbjct  427   PP-GTKAPRQPWHDLHCRIDGPAVYDVLINFAQRWRKATKWREFKLFKKTMSRWHDDAMI  485

Query  1303  KIERISWITSPTPSV-------PNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDV  1145
             KIERISWI SP  +V       P DDP L V  E   +NWHVQ+FRSIDSGS++GFPK +
Sbjct  486   KIERISWILSPAFAVFREGTEIPGDDPKLHVYGEDHSENWHVQIFRSIDSGSVQGFPKRI  545

Query  1144  HTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNL  965
               A+ QNLVC+K+L++D+SI+ AYI+AIR AQHFIYIENQYFLGSSYAW SYK+AGAD+L
Sbjct  546   DVAQAQNLVCSKNLIVDKSIEAAYIQAIRSAQHFIYIENQYFLGSSYAWGSYKDAGADHL  605

Query  964   IPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKEL  785
             IPMELALKI SKIR  ERF VY+V+PMWPEG P S  +Q+IL+WQ QT+QMMY++IA EL
Sbjct  606   IPMELALKITSKIRAGERFCVYVVMPMWPEGDPKSITMQEILFWQSQTVQMMYQVIATEL  665

Query  784   KSEKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMV  605
             KS ++ D+HP DYLNFYCLGNREE    S+ S + G  + ++ S K  RFMIYVHAKGM+
Sbjct  666   KSMQLLDSHPLDYLNFYCLGNREEI--PSSISQSSGNGDKVSDSYKFQRFMIYVHAKGMI  723

Query  604   VDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHL  425
             VDDEYVIVGSANINQRS+AGS+DTEIAMG+YQPHHTWA NQ HP  Q+YGYRMSLWAEHL
Sbjct  724   VDDEYVIVGSANINQRSLAGSKDTEIAMGSYQPHHTWAGNQRHPRGQIYGYRMSLWAEHL  783

Query  424   GMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGG  245
             G ++E  +E E L CV+ VNE+AE+NWKR+ AE F+PLQGHLLKYP+QVD++GKV  L G
Sbjct  784   GRIEECFEEPEALTCVRRVNEVAEDNWKRFAAETFTPLQGHLLKYPMQVDADGKVGSLPG  843

Query  244   CEYFPDVGGKVLGSRT-TLPDALTT  173
              E FPDVGGK+LG+   T+PD LTT
Sbjct  844   YECFPDVGGKILGNHAPTIPDVLTT  868



>ref|XP_008354617.1| PREDICTED: phospholipase D delta-like [Malus domestica]
Length=860

 Score =  1145 bits (2963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 558/858 (65%), Positives = 676/858 (79%), Gaps = 28/858 (3%)
 Frame = -2

Query  2677  ENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPET---------RQGNKVR  2525
             E ++YLHGDLDL I EARRLPNMD+ SER R+ FTA D     +           G + +
Sbjct  8     ERMIYLHGDLDLTIFEARRLPNMDMFSERFRRCFTACDTINISSTPSAEDDGGHDGGERK  67

Query  2524  RHT---RIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDN  2354
              H    +IITSD YV V +   TVARTRV+ NSQ+P W EHF +P+AHP   +EF VKD+
Sbjct  68    NHVPHRKIITSDSYVTVTVPQTTVARTRVMKNSQNPQWKEHFFVPLAHPAINLEFHVKDD  127

Query  2353  DVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYR  2174
             DVFGA+ IG A++ A++I +GE I+ WFPI G  GKPPKPD AI+L ++FTP  +NP Y+
Sbjct  128   DVFGAETIGTAEIPAERIATGELISGWFPIYGPSGKPPKPDSAIKLELQFTPFEKNPVYK  187

Query  2173  GGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICH  2003
              G+  D    G++ +YFP+R G +V LYQDAH P G LPEI++D GK +  EN WEDIC+
Sbjct  188   QGIAGDPEHKGVQNTYFPLRKGSSVRLYQDAHCPAGLLPEIQLDGGKVYKAENTWEDICY  247

Query  2002  AILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDK  1823
             AI EAHH+VYIVGWS++HKV+L+REP+RPLP GG+L LG+LLKYKS+EGVRVLLLVWDDK
Sbjct  248   AITEAHHLVYIVGWSVFHKVRLIREPSRPLPRGGDLLLGDLLKYKSEEGVRVLLLVWDDK  307

Query  1822  TSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQK  1643
             +SH KF   T+G+MGTHDEETRKFFKHSSV CVL+ RYASSKLS +KQQVVGTL+THHQK
Sbjct  308   SSHDKFGFKTAGMMGTHDEETRKFFKHSSVNCVLSTRYASSKLSIIKQQVVGTLFTHHQK  367

Query  1642  CVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKG  1463
             CV VDTQA GNNRKITAF+GGLDLCDGRYDTP+HRLF + DTVF+GD + PTFP  G K 
Sbjct  368   CVJVDTQADGNNRKITAFLGGLDLCDGRYDTPEHRLFRNLDTVFKGDVHQPTFP-AGTKA  426

Query  1462  PRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISW  1283
             PRQPWHDLHC+++GPAAYD+L NFEQRWRKA++W E     KK+SHWHDDAL+KI+RISW
Sbjct  427   PRQPWHDLHCRVDGPAAYDVLINFEQRWRKATRWKEFALLSKKVSHWHDDALIKIDRISW  486

Query  1282  ITSPT-------PSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQN  1124
             I SP         ++P D+P LWV+NE DP+NWHVQ+FRSIDSGSLKGFPK    AE ++
Sbjct  487   ILSPPXXVSKDGTTIPEDEPXLWVNNEKDPENWHVQIFRSIDSGSLKGFPKAGRAAEAKH  546

Query  1123  LVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELAL  944
             L+C+K+LVID+SIQ AYI+AIR AQHFIYIENQYFLGSSYAWP YK AGADNLIPMELAL
Sbjct  547   LICSKNLVIDKSIQTAYIQAIRSAQHFIYIENQYFLGSSYAWPDYKNAGADNLIPMELAL  606

Query  943   KIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIED  764
             KIVSKI+  ERF VY+V+PMWPEG P +  +Q+IL+WQ QT+Q MY  +A  LKS +I+D
Sbjct  607   KIVSKIKANERFTVYVVLPMWPEGDPKTLAMQEILFWQRQTMQAMYSTVAAALKSVQIQD  666

Query  763   AHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVI  584
             +HP DYL+FYCLGNRE   E++A+      S+    SQK+ RFMIYVHAKGMVVDDEYVI
Sbjct  667   SHPQDYLSFYCLGNREILPEDTANDDASSVSD----SQKNQRFMIYVHAKGMVVDDEYVI  722

Query  583   VGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKL  404
             +GSANINQRSMAG++DTEIAMGAYQPH+TWA  + HP  Q+YGYRMSLWAEHL M+D   
Sbjct  723   LGSANINQRSMAGTKDTEIAMGAYQPHYTWAARKKHPXGQIYGYRMSLWAEHLDMLDPCF  782

Query  403   DEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDV  224
             +E E L+C++ VNE+A ENW R+T+ +F+ LQGHL+KYP+ VD +GKV PL G E FPDV
Sbjct  783   EEPESLKCMRKVNEVAGENWTRFTSPEFTLLQGHLMKYPIDVDVDGKVGPLPGHENFPDV  842

Query  223   GGKVLGSRTT-LPDALTT  173
             GGK LGS +  +PD LTT
Sbjct  843   GGKXLGSHSNKIPDMLTT  860



>ref|XP_006285074.1| hypothetical protein CARUB_v10006387mg [Capsella rubella]
 gb|EOA17972.1| hypothetical protein CARUB_v10006387mg [Capsella rubella]
Length=888

 Score =  1145 bits (2963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 570/894 (64%), Positives = 675/894 (76%), Gaps = 59/894 (7%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQG------  2537
             M++   E V+ LHGDLDLKI++ARRLPNMD+ SE +R+ FTA + C  P T         
Sbjct  1     MAEKSPETVMLLHGDLDLKIVQARRLPNMDMFSEHMRRCFTACNSCTTPATDDDPRDRGE  60

Query  2536  ---NKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQ  2366
                  +R H ++ITSDPYV V +  AT+ARTRV+ NSQDP+W E F I +AHP+S +EFQ
Sbjct  61    AGDTNIRSHRKVITSDPYVTVVVPQATLARTRVLKNSQDPLWNESFNISIAHPLSYLEFQ  120

Query  2365  VKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAEN  2186
             VKD+DVFGA  IG AK+  + I SGE I+ WFP++GA GKPPK + A+ + MKFTP  + 
Sbjct  121   VKDDDVFGAQIIGTAKIPVRDIASGERISGWFPVLGASGKPPKKETALYIDMKFTPFDQI  180

Query  2185  PRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWE  2015
               YR G+  D    G+K +YFP+R G  V LYQDAHV +G LP I +D+GK + H  CWE
Sbjct  181   HSYRSGIAGDPERKGVKRTYFPVRKGSQVRLYQDAHVMDGMLPAIGLDNGKVYQHGKCWE  240

Query  2014  DICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLV  1835
             DIC+A+ EAHHM+YIVGWS++HK+KLVREPTR LP GG+L LGELLKYKS+EGVRVLLLV
Sbjct  241   DICYAVSEAHHMIYIVGWSVFHKIKLVREPTRKLPRGGDLTLGELLKYKSEEGVRVLLLV  300

Query  1834  WDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQ-------  1676
             WDDKTSH KF I+T+GVMGTHDEETRKFF+HSSV CVL+PRYASSKL   KQQ       
Sbjct  301   WDDKTSHDKFGISTAGVMGTHDEETRKFFRHSSVICVLSPRYASSKLGLFKQQASPDSLN  360

Query  1675  ------------------------VVGTLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLC  1568
                                     VVGTL+THHQKCV+VDTQA GNNRK+TAFIGG+DLC
Sbjct  361   ICFFPWKILSFFVSLRLSYLFTSQVVGTLFTHHQKCVLVDTQAVGNNRKVTAFIGGIDLC  420

Query  1567  DGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFE  1388
             DGRYDTP+HR+  D DTVF+ D++NPTFP G  K PRQPWHDLHC+I+GPAAYD+L NFE
Sbjct  421   DGRYDTPEHRILHDLDTVFKDDFHNPTFPTG-TKAPRQPWHDLHCRIDGPAAYDVLMNFE  479

Query  1387  QRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSP--------TPSVPNDDPSLWV  1232
             QRWRKA++W E   R K  +HW DDAL++I RISWI SP        T  VP DDP +WV
Sbjct  480   QRWRKATRWKEFSLRLKGKTHWQDDALIRIGRISWILSPVFKFLKDGTSIVPEDDPCVWV  539

Query  1231  SNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRA  1052
             S E DP+NWHVQVFRSIDSGS+KGFPK    AE QNL CAK LV+D+SIQ AYI+ IR A
Sbjct  540   SKEDDPENWHVQVFRSIDSGSVKGFPKYEDEAEVQNLECAKRLVVDKSIQTAYIQTIRSA  599

Query  1051  QHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEG  872
             QHFIYIENQYFLGSSYAWPSYK+AGADNLIPMELALKIVSKIR +ERFAVY+VIP+WPEG
Sbjct  600   QHFIYIENQYFLGSSYAWPSYKDAGADNLIPMELALKIVSKIRAKERFAVYVVIPLWPEG  659

Query  871   VPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREEWHEESAS  692
              P S PVQ+ILYWQ QT+QMMY++IAKELK+ +  DAHP DYLNFYCLG RE+  ++  +
Sbjct  660   DPKSGPVQEILYWQSQTMQMMYDVIAKELKAVQ-SDAHPLDYLNFYCLGKREQLPDDMPA  718

Query  691   SPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAY  512
             +     S+    S K  RFMIYVHAKGM+VDDEYV++GSANINQRSMAG++DTEIAMGAY
Sbjct  719   TNGNAVSD----SYKFQRFMIYVHAKGMIVDDEYVLMGSANINQRSMAGTKDTEIAMGAY  774

Query  511   QPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYT  332
             QPHHTW     HP  QVYGYRMSLWAEHLG   ++  E   LECVK VNEI+E NWK++ 
Sbjct  775   QPHHTWVHKGKHPRGQVYGYRMSLWAEHLGKTGDEFVEPADLECVKNVNEISEGNWKKFI  834

Query  331   AEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRT-TLPDALTT  173
               +FS LQGHL+KYPLQVD +GKVSPL   E FPDVGGK++G+ +  LPD LTT
Sbjct  835   DLEFSELQGHLIKYPLQVDIDGKVSPLPDYENFPDVGGKIIGAHSMALPDTLTT  888



>ref|XP_007046579.1| Phospholipase D delta isoform 1 [Theobroma cacao]
 gb|EOX90736.1| Phospholipase D delta isoform 1 [Theobroma cacao]
Length=877

 Score =  1145 bits (2961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/882 (64%), Positives = 682/882 (77%), Gaps = 46/882 (5%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPE----TRQGN-  2534
             M +G S+ V+YLHGDLDL I+EAR LPNMD ++  +R+  T  + C+ P       +G+ 
Sbjct  1     MEEG-SKQVIYLHGDLDLTIIEARSLPNMDSLTNHLRRCVTVCEACKTPSQATTVEEGDT  59

Query  2533  KVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDN  2354
             K+R+H +IITSDPYV V +  ATVART V+ N+Q+P W + F IP+AHPV E+E  VKD+
Sbjct  60    KIRQHRKIITSDPYVTVSVPQATVARTSVLKNAQNPRWDQSFVIPLAHPVCELEITVKDD  119

Query  2353  DVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYR  2174
             D+FGA+ IGVAK+ AQKI  GE I+ WF +IG  GKPPKPD AI + MKF PC +NP Y+
Sbjct  120   DLFGAEMIGVAKIPAQKIAMGEPISGWFQLIGPSGKPPKPDTAINVSMKFMPCEKNPLYK  179

Query  2173  GGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICH  2003
               +  D    G++ +YFP+R GG VTLYQDAHVP+  LP+I++DDGK ++   CWEDIC+
Sbjct  180   QSIASDPEQAGVRHTYFPLRKGGQVTLYQDAHVPDNMLPKIELDDGKVYNQGQCWEDICY  239

Query  2002  AILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDK  1823
             AI EAHHMVYIVGWS++HK+KLVREPTRPLP GG+L LG+LLKYKS+EGVRVLLLVWDDK
Sbjct  240   AISEAHHMVYIVGWSVFHKIKLVREPTRPLPRGGDLTLGDLLKYKSEEGVRVLLLVWDDK  299

Query  1822  TSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQK  1643
             TSH KF I+T GVM THDEET KFFKHSSVTCVLAPRYASSKL + KQQVVGT++THHQK
Sbjct  300   TSHDKFGISTVGVMETHDEETFKFFKHSSVTCVLAPRYASSKLGYFKQQVVGTMFTHHQK  359

Query  1642  CVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFP------  1481
             CV+VDTQA GNNRKITAF+GG+DLCDGRYDTP+HRL  D +T F+ D++NPTFP      
Sbjct  360   CVLVDTQAAGNNRKITAFVGGIDLCDGRYDTPEHRLLRDLETTFKDDFHNPTFPFLFMVI  419

Query  1480  -----------------EGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAEL  1352
                                  K PRQPWHDLH KIEGPAAYD+L NFEQRWRK++KW E 
Sbjct  420   CDDLETTFKDDFHNPTFPVAAKAPRQPWHDLHSKIEGPAAYDVLINFEQRWRKSTKWKEF  479

Query  1351  GRRFKKISHWHDDALLKIERISWITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQ  1196
                F+  S W+DDAL++IERISWI SP        T  VP DDP + V ++ D ++W VQ
Sbjct  480   SLLFRGKSRWNDDALIRIERISWIQSPPLTATEDDTTIVPEDDPKVHVHSKDDRESWDVQ  539

Query  1195  VFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFL  1016
             +FRSIDSGS+KGFPK +  A+ Q+L  AKDL ID+SIQ AYI+AIR AQH+IYIENQYFL
Sbjct  540   IFRSIDSGSVKGFPKYIKRAQNQHLSYAKDLAIDKSIQTAYIQAIRSAQHYIYIENQYFL  599

Query  1015  GSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILY  836
             GSSYAWPSYK AGADNLIPMELALK+VSKIR RERFAVYIVIP+WPEG P SA VQ+ILY
Sbjct  600   GSSYAWPSYKNAGADNLIPMELALKVVSKIRARERFAVYIVIPLWPEGDPKSATVQEILY  659

Query  835   WQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTG  656
             WQ QT++MMY++IA+ELKS +I+D+HP DYLNFYCLG REE  +E       G    +  
Sbjct  660   WQSQTMRMMYDVIARELKSMEIKDSHPQDYLNFYCLGKREEVSKELLG----GNGNTVPD  715

Query  655   SQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNH  476
             S K GRFMIYVHAKGM++DDEYVI+GSANINQRSMAG++DTEIAMGAYQPH+TWA+ + H
Sbjct  716   STKFGRFMIYVHAKGMIIDDEYVILGSANINQRSMAGTKDTEIAMGAYQPHYTWAEKKKH  775

Query  475   PHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLL  296
             P  QVYGYRMSLWAEHL  +++   E E L CVK VNEIA+ENWK++T   +SPLQGHLL
Sbjct  776   PRGQVYGYRMSLWAEHLDELNKCFKEPESLACVKTVNEIAQENWKKFTNTDYSPLQGHLL  835

Query  295   KYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTT-LPDALTT  173
              YP+QVD +GKV+PL G E FPDVGGKVLG+ +  LPD LTT
Sbjct  836   MYPVQVDVDGKVNPLPGHENFPDVGGKVLGAHSIQLPDILTT  877



>gb|EEE70149.1| hypothetical protein OsJ_30197 [Oryza sativa Japonica Group]
Length=846

 Score =  1144 bits (2959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 571/843 (68%), Positives = 666/843 (79%), Gaps = 28/843 (3%)
 Frame = -2

Query  2668  VYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPET----RQGNKVRRHTR--II  2507
             V LHGDLDL ++EAR LPNMD+ SE +R+ F A  C+ P +    RQ    R H R  II
Sbjct  19    VLLHGDLDLWVVEARLLPNMDMFSEHVRRCFAA--CKPPTSCATARQPRHARGHHRRKII  76

Query  2506  TSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIG  2327
             TSDPYV + +AGA VARTRVI N QDPVW E F +P+AH  + +EF VKDND FGA  IG
Sbjct  77    TSDPYVTLSVAGAVVARTRVIPNDQDPVWDERFAVPLAHYAAALEFHVKDNDTFGAQLIG  136

Query  2326  VAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED---  2156
                + A ++ S + + DWFPIIG +G+P KPD A+RL ++F P A+NP YR G+  D   
Sbjct  137   TVTIPADRVASCQEVEDWFPIIGNNGRPYKPDTALRLRLRFNPAADNPLYRRGIPGDPDH  196

Query  2155  YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDG-KAFHHENCWEDICHAILEAHHM  1979
              G+K+SYFP+RHGG VTLYQDAH  EG LPEI++D+G K F H  CWEDICHAILEAHHM
Sbjct  197   QGIKDSYFPLRHGGRVTLYQDAHYREGDLPEIELDEGGKVFDHNACWEDICHAILEAHHM  256

Query  1978  VYIVGWSIYHKVKLVREPT--RplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKF  1805
             +YIVGWS+Y KV+LVREP+  RPLP GG+LNLGELLK+KSQEGVRV LLVWDDKTSH K 
Sbjct  257   IYIVGWSVYDKVRLVREPSPSRPLPEGGDLNLGELLKFKSQEGVRVCLLVWDDKTSHDKL  316

Query  1804  FINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDT  1625
             FI T GVM THDEETRKFFKHSSV CVL+PR           QVVGTL+THHQKCV+VDT
Sbjct  317   FIKTGGVMATHDEETRKFFKHSSVICVLSPRL----------QVVGTLFTHHQKCVLVDT  366

Query  1624  QAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWH  1445
             QA GN RKITAFIGGLDLCDGRYDTP+HRLF D DTVF  DY+NPTFP G   GPRQPWH
Sbjct  367   QAWGNKRKITAFIGGLDLCDGRYDTPEHRLFKDLDTVFDNDYHNPTFPSGAKGGPRQPWH  426

Query  1444  DLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTP  1265
             DLHC+I+GPAAYD+L NFEQRWRKA+KW E   RF+K+SHW DDAL+K+ERISWI SP+P
Sbjct  427   DLHCRIDGPAAYDVLKNFEQRWRKATKWRE---RFRKVSHWKDDALIKLERISWILSPSP  483

Query  1264  SVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSI  1085
             ++PNDD SL VS E DP+NWHVQVFRSIDSGSLKGFP D   A  QNL+C KDL+ID+SI
Sbjct  484   TIPNDDISLRVSKEEDPENWHVQVFRSIDSGSLKGFPSDCKEASKQNLICRKDLIIDKSI  543

Query  1084  QMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFA  905
               AY+ AIR AQHFIYIENQYFLGSSYAWPSY  +GADNL+P+ELALKI SKIR  ERFA
Sbjct  544   HTAYVRAIRSAQHFIYIENQYFLGSSYAWPSYVNSGADNLVPIELALKIASKIRAGERFA  603

Query  904   VYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLG  725
             VY+VIPMWPEGVP++A VQ+IL++Q QT++MMY IIA+ELK+  I++AHP DYLNFYCLG
Sbjct  604   VYVVIPMWPEGVPTAASVQEILFFQAQTMEMMYRIIAQELKAMNIKNAHPQDYLNFYCLG  663

Query  724   NREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAG  545
             NREE    + S  +   S     ++K  RFMIYVHAKGM+VDDEYVI+GSANINQRS+AG
Sbjct  664   NREESSSSNGSPESNDKSAAAL-ARKYRRFMIYVHAKGMIVDDEYVILGSANINQRSLAG  722

Query  544   SRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVN  365
             SRDTEIAMGAYQPHHTW+    HP  QVYGYR SLWAEHLGM+D+   +   LECV  VN
Sbjct  723   SRDTEIAMGAYQPHHTWSTKGGHPRGQVYGYRTSLWAEHLGMVDDLFKDPSSLECVNYVN  782

Query  364   EIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPD  185
             EIAEENW+R+TAE+   LQGHLLKYP++V+++GKV PL   E FPDVGGK+LG+ T+LPD
Sbjct  783   EIAEENWRRFTAEQLITLQGHLLKYPVKVEADGKVGPLPEHECFPDVGGKILGAPTSLPD  842

Query  184   ALT  176
              LT
Sbjct  843   TLT  845



>ref|XP_010432229.1| PREDICTED: phospholipase D delta-like isoform X1 [Camelina sativa]
Length=887

 Score =  1143 bits (2957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 566/892 (63%), Positives = 678/892 (76%), Gaps = 56/892 (6%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPET--------R  2543
             M+    E  + LHGDLDLKI++ARRLPNMD+ SE +R+FFTA + C  P T         
Sbjct  1     MAAKSPEATMLLHGDLDLKIVQARRLPNMDMFSEHMRRFFTACNACTTPATDDDPRDRGE  60

Query  2542  QGNK-VRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQ  2366
              G+K +R H ++ITSDPYV V +  +T+ARTRV+ NSQDP W E+FKI +AHP+S +EFQ
Sbjct  61    HGDKNIRSHRKVITSDPYVTVVVPQSTLARTRVLKNSQDPTWNENFKISIAHPLSHLEFQ  120

Query  2365  VKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAEN  2186
             VKD+DVFGA  IG AK+  + I++GE I+ WFP++GA GKPPK + A+ + MKFTP  + 
Sbjct  121   VKDDDVFGAQIIGTAKIPVRDIVTGERISGWFPVLGASGKPPKKETALYIDMKFTPFDQI  180

Query  2185  PRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWE  2015
               YR G+  D    G+K +YFP+R G  V LYQDAHV +G LPEI +D+G  + H  CWE
Sbjct  181   HNYRFGIAGDPERKGVKRTYFPVRKGSQVRLYQDAHVMDGMLPEIALDNGNVYQHGKCWE  240

Query  2014  DICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLV  1835
             DIC+A+ EAHHM+YIVGWS++HK+KLVREPTR LP GG+L LGELLKYKS+EGVRVLLLV
Sbjct  241   DICYAVSEAHHMIYIVGWSVFHKIKLVREPTRKLPRGGDLTLGELLKYKSEEGVRVLLLV  300

Query  1834  WDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYT  1655
             WDDKTSH KF I+T GVMGTHDEETRKFFKHSSV CVL+PRYASSKL   KQQVVGTL+T
Sbjct  301   WDDKTSHDKFGISTPGVMGTHDEETRKFFKHSSVICVLSPRYASSKLGLFKQQVVGTLFT  360

Query  1654  HHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFP--  1481
             HHQKCV+VDTQA GNNRK+TAFIGGLDLCDGRYDTP+HR+ +D DTVF+ D++NPTFP  
Sbjct  361   HHQKCVLVDTQAVGNNRKVTAFIGGLDLCDGRYDTPEHRILNDLDTVFKDDFHNPTFPVS  420

Query  1480  ---------------------------EGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQR  1382
                                        + G K PRQPWHDLHC+I+GPAAYD+L NFEQR
Sbjct  421   VWLFTGYFQARILVSYIFPILIVFLLPQAGTKAPRQPWHDLHCRIDGPAAYDVLMNFEQR  480

Query  1381  WRKASKWAELGRRFKKISHWHDDALLKIERISWITSP--------TPSVPNDDPSLWVSN  1226
             WRKA++W E   R K  +HW DDAL++I RISWI SP        T  VP D+P +WVS 
Sbjct  481   WRKATRWKEFSLRLKGKTHWQDDALIRIGRISWILSPVFKFLKDGTSIVPEDEPCVWVSK  540

Query  1225  EGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQH  1046
             E DP+NWH QVFRSIDSGS+KGFPK    AE Q+L CAK LV+D+SIQ AYI+ IR AQH
Sbjct  541   EDDPENWHCQVFRSIDSGSVKGFPKYEDEAEVQHLECAKRLVVDKSIQTAYIQTIRSAQH  600

Query  1045  FIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEGVP  866
             FIYIENQYFLGSSYAWPSYK+AGADNLIPMELALKIVSKIR +ERFAVY+VIP+WPEG P
Sbjct  601   FIYIENQYFLGSSYAWPSYKDAGADNLIPMELALKIVSKIRAKERFAVYVVIPLWPEGDP  660

Query  865   SSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREEWHEESASSP  686
              S PVQ+ILYWQ QT+QMMY++IAKELK+ +  DAHP DYLNFYCLG RE+  ++  ++ 
Sbjct  661   KSGPVQEILYWQSQTMQMMYDVIAKELKAVQ-SDAHPLDYLNFYCLGKREQLPDDMPATN  719

Query  685   TPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQP  506
                 S+    S K  RFMIYVHAKGM+VDDEYV++GSANINQRSMAG++DTEIAMGAYQP
Sbjct  720   GNTVSD----SYKFQRFMIYVHAKGMIVDDEYVLMGSANINQRSMAGTKDTEIAMGAYQP  775

Query  505   HHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAE  326
             H+TW     HP  QVYGYRMSLWAEHLG   ++  +   LECVK VNEI+E NWK++   
Sbjct  776   HYTWNHKGKHPRGQVYGYRMSLWAEHLGKTGDEFVKPSDLECVKNVNEISEGNWKKFIDT  835

Query  325   KFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRT-TLPDALTT  173
             +F+ LQGHL+KYPL VD +GKVSPL   E FPDVGGK++G+ +  LPD LTT
Sbjct  836   EFAELQGHLIKYPLLVDIDGKVSPLPDYETFPDVGGKIIGAHSMALPDTLTT  887



>ref|XP_002310718.2| phospholipase D delta family protein [Populus trichocarpa]
 gb|EEE91168.2| phospholipase D delta family protein [Populus trichocarpa]
Length=859

 Score =  1143 bits (2957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 569/874 (65%), Positives = 667/874 (76%), Gaps = 52/874 (6%)
 Frame = -2

Query  2683  MSENV-----VYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPE----------  2549
             M+EN      +YLHGDLDL I++AR LPNMD++S+ IRQ F    C              
Sbjct  1     MAENSSHKQHIYLHGDLDLFIVQARSLPNMDVISKNIRQCFGV--CTPSSTTVTTTTTTT  58

Query  2548  ----------TRQGNKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIP  2399
                       +    K+R H  IITSD YV V +   T+ARTRV+ N+  P+W + F IP
Sbjct  59    KSIGHPHHHPSDAAKKIRNHRHIITSDAYVTVTVPQVTLARTRVLKNATSPIWEQRFNIP  118

Query  2398  VAHPVSEVEFQVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIR  2219
             +AHPV ++EF VKDND+FGA+ IG A + A  +  GE I  WFPII   GKPPKPD A+ 
Sbjct  119   LAHPVKDIEFHVKDNDLFGAELIGTANIPASTVALGEDIKGWFPIIAPSGKPPKPDTALY  178

Query  2218  LMMKFTPCAENPRYR---GGVTEDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDD  2048
             L MKFTP  +NP YR   GG  E  G++ +YFP+R G  VTLYQDAH  +  LPEI+ID 
Sbjct  179   LEMKFTPFEKNPLYRNGFGGDPEVKGVRHTYFPVRKGCHVTLYQDAHGKDHDLPEIEIDG  238

Query  2047  GKAFHHENCWEDICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYK  1868
             GK +  ENCWEDIC+AI EAHHM+YIVGWS++ K+KLVREPTRPLP GG+L LGELL+YK
Sbjct  239   GKVYKQENCWEDICYAISEAHHMIYIVGWSVFCKIKLVREPTRPLPRGGDLTLGELLRYK  298

Query  1867  SQEGVRVLLLVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSF  1688
             S+EGVRVLLLVWDD+TSH KF I T+GVM THDEETR+FFKHSSVTCVLAPRYASSKLSF
Sbjct  299   SEEGVRVLLLVWDDRTSHDKFGIETAGVMATHDEETRRFFKHSSVTCVLAPRYASSKLSF  358

Query  1687  VKQQVVGTLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFR  1508
             +KQQ VGT++THHQKCV+VDTQA GNNRKITAFIGG+DLCDGRYDTP+HRLF D +TVF+
Sbjct  359   LKQQTVGTIFTHHQKCVLVDTQAYGNNRKITAFIGGIDLCDGRYDTPEHRLFHDLNTVFK  418

Query  1507  GDYNNPTFPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKIS  1328
              D++NPTF   G K PRQPWHDLHCKI+GPAAYD+L NFEQRWRKA+KW ELG  FK+ S
Sbjct  419   DDFHNPTF-SAGTKAPRQPWHDLHCKIDGPAAYDVLINFEQRWRKATKWTELGLHFKRTS  477

Query  1327  HWHDDALLKIERISWITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSG  1172
             HW DD+L+KIERISWI SP        T  VP DDP+ +VS+E DP++WHVQ+FRSIDSG
Sbjct  478   HWSDDSLIKIERISWILSPPLSKTKAGTTIVPGDDPTAFVSSEEDPEHWHVQIFRSIDSG  537

Query  1171  SLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPS  992
             SLKGFPK +   + +NLV AKDLV+D+SIQ AYI+AIR AQHFIYIENQYFLGSSYAWPS
Sbjct  538   SLKGFPKTIDECQAKNLVVAKDLVVDKSIQTAYIQAIRSAQHFIYIENQYFLGSSYAWPS  597

Query  991   YKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQM  812
             Y +AGADNLIPMELALKI SKIR +ERFAVY+VIP+WPEG P +  VQ+IL+WQ QT+Q 
Sbjct  598   YNDAGADNLIPMELALKIASKIRAKERFAVYVVIPLWPEGDPKTNTVQEILFWQSQTMQA  657

Query  811   MYEIIAKELKSEKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFM  632
             MYE IA+ELKS  + D+HP DYLNFYC+G REE  +E            L+      RFM
Sbjct  658   MYEKIAQELKSMDLVDSHPQDYLNFYCIGKREEIPQE------------LSSDNGGLRFM  705

Query  631   IYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGY  452
             IYVHAKGM+VDDEYVIVGSANINQRSMAGS+DTEIAMG+YQPHHTW   + HP  QVYGY
Sbjct  706   IYVHAKGMIVDDEYVIVGSANINQRSMAGSKDTEIAMGSYQPHHTWVTKKKHPRGQVYGY  765

Query  451   RMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDS  272
             RMSLW EHLG +DE   E + L CVK VN  AEENWK++T   F  L+GHLLKYPL+VD+
Sbjct  766   RMSLWREHLGEVDELFMEPDNLLCVKRVNHTAEENWKKFTDPNFKLLKGHLLKYPLKVDA  825

Query  271   NGKVSPLGGCEYFPDVGGKVLGSR-TTLPDALTT  173
             +GKV PL G E FPDVGGKVLG+  TT+PDALTT
Sbjct  826   DGKVGPLPGSENFPDVGGKVLGAHSTTIPDALTT  859



>ref|XP_002530642.1| phospholipase d delta, putative [Ricinus communis]
 gb|EEF31750.1| phospholipase d delta, putative [Ricinus communis]
Length=857

 Score =  1143 bits (2956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 557/866 (64%), Positives = 676/866 (78%), Gaps = 35/866 (4%)
 Frame = -2

Query  2698  KMSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPET---------  2546
             ++S    +  + LHGDLDL I+EAR LPNMD+VS RIR  F+A +C K  T         
Sbjct  3     EISGSNDQQPIILHGDLDLYIIEARSLPNMDLVSTRIRGCFSACNCTKKSTSAASGGAST  62

Query  2545  ---RQGNKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEV  2375
                 +  K+  H  IITSDPYV V +  AT+ARTRV+ N+++P W + F IP+AHPV+ +
Sbjct  63    DEENEDQKLHHHRNIITSDPYVTVVVPQATLARTRVVKNAKNPKWKQRFFIPLAHPVTNL  122

Query  2374  EFQVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPC  2195
             EF VKDND+FGA+ +G+ K  A KI SGE+I  WF IIG+ GKPPKPD A+ L MKFTPC
Sbjct  123   EFHVKDNDLFGAEVMGIVKFPASKIASGESIAGWFSIIGSSGKPPKPDTALHLEMKFTPC  182

Query  2194  AENPRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHEN  2024
              +N  YR G+  D    G++ +YFP+R G  V  YQDAHV +G LP I++D+G  +  E 
Sbjct  183   EKNVLYRHGIAGDPEHKGVRNTYFPLRRGSRVKTYQDAHVTDGMLPNIELDNGMVYKQEK  242

Query  2023  CWEDICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVL  1844
             CWEDIC+AI EAHHM+YIVGWS+++K+KL+REPT+PLP GG+L LGELLKYKS+EGVRVL
Sbjct  243   CWEDICYAISEAHHMIYIVGWSVFYKIKLIREPTKPLPRGGDLTLGELLKYKSEEGVRVL  302

Query  1843  LLVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGT  1664
             LL+WDDKTS   F   T G+M THDEETRKFFKHSSVTCVLAPRYASSK   +KQ+VVGT
Sbjct  303   LLIWDDKTSRDIFGYQTVGLMDTHDEETRKFFKHSSVTCVLAPRYASSKTGLLKQKVVGT  362

Query  1663  LYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTF  1484
              +THHQK V+VDTQA GNNRK+TAF+GG+DLCDGRYDTP+HRLF D DTVF+GD++NPTF
Sbjct  363   AFTHHQKFVLVDTQASGNNRKVTAFLGGIDLCDGRYDTPEHRLFHDLDTVFKGDFHNPTF  422

Query  1483  PEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALL  1304
                 LK PRQPWHDLHC+I+GPA YD+L NFEQRWRK+++W+E G  FK+++HW DDAL+
Sbjct  423   -SATLKVPRQPWHDLHCRIDGPAVYDVLINFEQRWRKSTRWSEFGLSFKRVTHW-DDALI  480

Query  1303  KIERISWITSP-------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDV  1145
             KIERISWI SP          VP DDP++ VS+E DP+NWHVQ+FRSIDSGSLKGFPK+V
Sbjct  481   KIERISWILSPPLAVKDGVTVVPPDDPTVHVSSEDDPENWHVQIFRSIDSGSLKGFPKNV  540

Query  1144  HTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNL  965
             H  + QNL+ AK  VIDRSIQ AYI+AIR AQHFIYIENQYFLGSSYAWPSY+ AGADNL
Sbjct  541   HDCQAQNLISAKTQVIDRSIQTAYIQAIRSAQHFIYIENQYFLGSSYAWPSYENAGADNL  600

Query  964   IPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKEL  785
             IPMELALKIVSKIR  ERFAVYI++PMWPEG P +  +Q+ILYWQ QT+QMMY+++A+E+
Sbjct  601   IPMELALKIVSKIRANERFAVYIILPMWPEGDPKTETMQEILYWQSQTMQMMYDLVAREI  660

Query  784   KSEKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCS-EFLTGSQKSGRFMIYVHAKGM  608
             KS K+ D HP DYLNFYCLGNREE       +P P  + E ++ + K+ RFMIYVHAKGM
Sbjct  661   KSMKLVDTHPQDYLNFYCLGNREE-------NPQPSTNGETVSDAYKNQRFMIYVHAKGM  713

Query  607   VVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEH  428
             +VDDEY I+GSANINQRSMAGS+DTEIA+GAYQPH+TWA  + HP  Q+YGYRMSLWAEH
Sbjct  714   IVDDEYAIIGSANINQRSMAGSKDTEIALGAYQPHYTWAAKKKHPRGQIYGYRMSLWAEH  773

Query  427   LGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLG  248
             LG   + ++E E L+CVK VN IAEENWK+YT   F+ LQGHLL+YPLQVD++GKV PL 
Sbjct  774   LGQ--KLIEEPESLDCVKTVNNIAEENWKKYTDPDFTLLQGHLLRYPLQVDADGKVGPLP  831

Query  247   GCEYFPDVGGKVLGS-RTTLPDALTT  173
             G E FPD GG+VLG+    +PD LTT
Sbjct  832   GYETFPDAGGRVLGAPAIKVPDILTT  857



>ref|XP_009623492.1| PREDICTED: phospholipase D delta-like [Nicotiana tomentosiformis]
Length=852

 Score =  1141 bits (2951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 560/859 (65%), Positives = 676/859 (79%), Gaps = 29/859 (3%)
 Frame = -2

Query  2683  MSE-NVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPE--------TRQGN  2534
             MSE   + LHGDL+L I++AR LPNMDI S R+R+ FT    C KP         T   +
Sbjct  1     MSEPKKLILHGDLELHIIQARHLPNMDITSARLRRCFTLGGICGKPPDSTDDGSPTSPPD  60

Query  2533  KVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDN  2354
             K  +H +IITSDPYV V      +ARTRVI NSQ PVW EHF+IP+AHP++ +EF+VKD+
Sbjct  61    KKNQHRKIITSDPYVTVSAPQTALARTRVIPNSQYPVWDEHFRIPLAHPMAYLEFRVKDD  120

Query  2353  DVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYR  2174
             D+FGA+ +G  K+ A+ I +G  I+ WFPIIG  GKPPK + A+++ MKF P   N  Y 
Sbjct  121   DLFGAEIMGKVKIPAENIAAGNVISGWFPIIGPSGKPPKLNSALKVHMKFFPYDTNSLYT  180

Query  2173  GGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEG-SLPEIKIDDGKAFHHENCWEDIC  2006
              G+  D    G++ +YFP+R G +V LYQDAHV      P+IK++ G  F H  CWEDIC
Sbjct  181   RGLASDPQHLGVRNTYFPLRKGSSVKLYQDAHVSNHVKFPDIKLEKGTNFEHNKCWEDIC  240

Query  2005  HAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDD  1826
             +AI EAHH++YIVGWS+YHK+KL+REPTRPLP GG+L LGELLKYKSQEGVRVLLLVWDD
Sbjct  241   YAISEAHHLIYIVGWSVYHKIKLIREPTRPLPRGGDLTLGELLKYKSQEGVRVLLLVWDD  300

Query  1825  KTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQ  1646
             KTSH KFFINT+GVMGTHDEET+KFFKHSSV CVL+PRYASSKLS +KQQVVGT++THHQ
Sbjct  301   KTSHDKFFINTAGVMGTHDEETKKFFKHSSVICVLSPRYASSKLSIMKQQVVGTMFTHHQ  360

Query  1645  KCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLK  1466
             KC++VDTQA GNNRKITAF+GGLDLCDGRYDTP+HRLF D DTVF+ D++ P FP  G K
Sbjct  361   KCILVDTQAPGNNRKITAFLGGLDLCDGRYDTPEHRLFRDLDTVFKDDFHQPQFPP-GTK  419

Query  1465  GPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERIS  1286
              PR+PWHDLHC+++GPAAYD+L NF QRWR+A+KW E     K +S W+DDA+LKIERIS
Sbjct  420   APREPWHDLHCRVDGPAAYDVLINFAQRWRRATKWREFAFFKKTMSRWNDDAMLKIERIS  479

Query  1285  WITSPTPSV-------PNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQ  1127
             WI SP  +V       P DDP L+VS E    NWHVQ+FRSIDSGS++GFPK +  A+ Q
Sbjct  480   WILSPAFAVFKEGTEIPADDPKLYVSGEDRHDNWHVQIFRSIDSGSVQGFPKSIDVAKAQ  539

Query  1126  NLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELA  947
             NL+ +KDLV+D+SI+ AYI+AIR AQHFIYIENQYFLGSSYAWPSYK+AGAD+L+PMELA
Sbjct  540   NLISSKDLVVDKSIESAYIQAIRSAQHFIYIENQYFLGSSYAWPSYKDAGADHLVPMELA  599

Query  946   LKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIE  767
             LKI SKIR RERF VY+V+PMWPEG P S  VQ+ILYWQ QT+QMMY++IA+ELKS ++ 
Sbjct  600   LKIASKIRARERFCVYVVLPMWPEGDPKSVTVQEILYWQSQTMQMMYQVIARELKSMQLV  659

Query  766   DAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYV  587
             D+HP DYLNFYCLGNRE      A+      ++ ++ S K  RFMIYVHAKGM+VDDEYV
Sbjct  660   DSHPLDYLNFYCLGNRE------ANGQFANDADKVSDSYKFQRFMIYVHAKGMIVDDEYV  713

Query  586   IVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEK  407
             I+GSANINQRS+AGS+DTEIAMGAYQPHH+WAK Q HP  QVYGYRMSLWAEHLGM+++ 
Sbjct  714   ILGSANINQRSLAGSKDTEIAMGAYQPHHSWAKKQQHPRGQVYGYRMSLWAEHLGMLEDS  773

Query  406   LDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPD  227
                 E LECVK VNE+AE+NWKRYTAE F+ LQGHLLKYP+QVD++GKV PL   E FPD
Sbjct  774   FKVPEALECVKRVNEVAEDNWKRYTAENFTELQGHLLKYPIQVDADGKVGPLPEYECFPD  833

Query  226   VGGKVLGSRT-TLPDALTT  173
             VGGK+LG+ + T+PD LTT
Sbjct  834   VGGKILGNPSPTIPDVLTT  852



>emb|CDX75527.1| BnaA01g01750D [Brassica napus]
Length=2716

 Score =  1141 bits (2951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 562/860 (65%), Positives = 671/860 (78%), Gaps = 34/860 (4%)
 Frame = -2

Query  2683  MSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKP-------ETRQGN--  2534
             +S++V+ LHGDLDLKI++ARRLPNMD+ S+R+R+ FTA + C KP         R G   
Sbjct  1868  VSDDVMLLHGDLDLKIVQARRLPNMDLFSDRMRRCFTACNSCAKPPEDDEDPRNRDGGDR  1927

Query  2533  KVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDN  2354
              +R H ++ITSDPYV V +  AT+ARTRV+ NSQDP+W EHF I VAHP+  +EFQVKD+
Sbjct  1928  NIRGHRKVITSDPYVTVVVPQATLARTRVLKNSQDPLWDEHFNISVAHPMPHLEFQVKDD  1987

Query  2353  DVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYR  2174
             DVFGA  IG AK+   +I SG+ I+ WFP++GA GKPPK + A+ + MKFTP  +   YR
Sbjct  1988  DVFGAQIIGTAKIPVHQIASGQRISGWFPVLGASGKPPKKETALYVDMKFTPFHQIEAYR  2047

Query  2173  GGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICH  2003
              G+  D    G+K +YFP+R G  V LYQDAHV +G+LPE+ +D+GK + H  CWEDIC+
Sbjct  2048  NGIAGDPDRRGVKRTYFPVRKGSKVRLYQDAHVMDGTLPEVGLDNGKVYKHGKCWEDICY  2107

Query  2002  AILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDK  1823
             A+ EAHHM+YIVGWS++HKV+LVREPTR LP GG+L LGELLKYKS+EGVRVLLLVWDDK
Sbjct  2108  AVSEAHHMIYIVGWSVFHKVRLVREPTRKLPRGGDLTLGELLKYKSEEGVRVLLLVWDDK  2167

Query  1822  TSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQK  1643
             TSH KF I+T GVMGTHDEETRKFFKHSSV CVL+PRYA+  L  V    VGTL+THHQK
Sbjct  2168  TSHDKFGISTPGVMGTHDEETRKFFKHSSVICVLSPRYATD-LGLV----VGTLFTHHQK  2222

Query  1642  CVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKG  1463
             CV+VDTQA GNNRKITAFIGG+DLCDGRYDTP+HR+  D DTVF+ D++NPTFP    K 
Sbjct  2223  CVLVDTQAVGNNRKITAFIGGIDLCDGRYDTPEHRILHDLDTVFKDDFHNPTFP-AATKA  2281

Query  1462  PRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISW  1283
             PRQPWHDLHC+++GPAAYD+L NFEQRWRKA++W E   R K  +HW DDAL++I RISW
Sbjct  2282  PRQPWHDLHCRLDGPAAYDVLINFEQRWRKATRWKEFSLRLKGKTHWQDDALIRIGRISW  2341

Query  1282  ITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQ  1127
             I SP        T  VP DDP ++VS E DP+NWH QVFRSIDSGS+KGFPK    AE Q
Sbjct  2342  ILSPVFKFLKDGTSIVPEDDPVVYVSKEDDPENWHAQVFRSIDSGSVKGFPKYEDEAEAQ  2401

Query  1126  NLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEA-GADNLIPMEL  950
             NL CAK LV+D+SIQ AYI+ IR AQHFIYIENQYFLGSSYAWP+YK+A GADNLIPMEL
Sbjct  2402  NLECAKRLVVDKSIQTAYIQTIRSAQHFIYIENQYFLGSSYAWPNYKDAAGADNLIPMEL  2461

Query  949   ALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKI  770
             ALKIVSKIR +ERFAVY+VIP+WPEG P S PVQ+ILYWQ QT+QMMY++I +ELK+ + 
Sbjct  2462  ALKIVSKIRAKERFAVYVVIPLWPEGDPKSGPVQEILYWQSQTMQMMYDVIVRELKAVQ-  2520

Query  769   EDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEY  590
              DAHP DYLNFYCLG RE+  E   ++     S+    S K  RFMIYVHAKGM+VDDEY
Sbjct  2521  SDAHPLDYLNFYCLGKREQLPENMPATNGSAVSD----SYKFQRFMIYVHAKGMIVDDEY  2576

Query  589   VIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDE  410
             V++GSANINQRSMAG++DTEIAMGAYQPHHTW     HP  QVYGYRMSLWAEHLG   +
Sbjct  2577  VLMGSANINQRSMAGTKDTEIAMGAYQPHHTWTNKGRHPRGQVYGYRMSLWAEHLGKTGD  2636

Query  409   KLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFP  230
             +  E   LECVK VNEIAE NWK++T  +FS LQGHL+KYPLQVDS+GKVS L   + FP
Sbjct  2637  EFVEPSDLECVKNVNEIAEGNWKKFTNIEFSELQGHLIKYPLQVDSDGKVSSLPDYDSFP  2696

Query  229   DVGGKVLGSRT-TLPDALTT  173
             DVGGK++G+ +  LPD LTT
Sbjct  2697  DVGGKIIGAHSMALPDTLTT  2716



>gb|EYU30820.1| hypothetical protein MIMGU_mgv1a001201mg [Erythranthe guttata]
Length=867

 Score =  1140 bits (2950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 557/868 (64%), Positives = 677/868 (78%), Gaps = 38/868 (4%)
 Frame = -2

Query  2677  ENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPE-----------------  2549
             E V+YLHGDL+L I EAR LPNMD+V+ER+R+  T   CR  +                 
Sbjct  5     EPVIYLHGDLELHIFEARGLPNMDLVTERLRRCLTV--CRTADGDGVAVGDGDASERGSG  62

Query  2548  --TRQGNKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEV  2375
               ++   K+  H +IITSDPYV V    AT+ARTRV+SNSQ+P W E F IP+AHP+S +
Sbjct  63    RRSQHDRKLHHHRKIITSDPYVTVSAPQATLARTRVLSNSQNPKWNERFHIPLAHPLSCL  122

Query  2374  EFQVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPC  2195
             + ++KDND+FGAD IG   +SA KI SG+ I+ WF +I + GKPPKP  A+RL MKFTPC
Sbjct  123   DIRIKDNDMFGADTIGKVLISAAKIASGDEISGWFSVISSTGKPPKPHTALRLQMKFTPC  182

Query  2194  AENPRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVP-EGSLPEIKIDDGKAFHHE  2027
              ENP Y+ G+  D    G++ +Y P+R G +VTLYQDAHV  +  LP+I++DDG    H 
Sbjct  183   DENPLYKHGIAGDPLHRGVRNTYCPLRKGSSVTLYQDAHVKNDDKLPKIELDDGLVREHA  242

Query  2026  NCWEDICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRV  1847
              CWEDICHAI EAHH++YIVGWS++ KV+L+REPTRPLP GG+L LGELLKYKSQEGVRV
Sbjct  243   TCWEDICHAIAEAHHLIYIVGWSVFDKVRLIREPTRPLPRGGDLTLGELLKYKSQEGVRV  302

Query  1846  LLLVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVG  1667
             LLLVWDDKTSH K FINT+GVM THDEET+KFF+HSSV CVL+PRY SSKLS++KQQVVG
Sbjct  303   LLLVWDDKTSHDKLFINTAGVMRTHDEETKKFFRHSSVICVLSPRYGSSKLSYMKQQVVG  362

Query  1666  TLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPT  1487
              L+THHQKCV+VDTQA GNNRKITAF+GG+DLCDGRYDTP+HRLF D DTVF+ D + PT
Sbjct  363   NLFTHHQKCVLVDTQAHGNNRKITAFLGGIDLCDGRYDTPEHRLFCDLDTVFKNDIHQPT  422

Query  1486  FPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDAL  1307
             + E G+K PRQPWHDLH +++GPAAYD+L NF QRWRK +KW E     K++SHWHDDA+
Sbjct  423   YAE-GIKAPRQPWHDLHSRVDGPAAYDVLINFAQRWRKTTKWREFSFIKKRMSHWHDDAM  481

Query  1306  LKIERISWITSPTPSV---------PNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFP  1154
             LK+ERISWI SP  ++         P DDP L+VS E  P+NWHVQ+FRSIDSGS++GFP
Sbjct  482   LKVERISWILSPAIALSKDGTYKACPEDDPKLYVSKEEHPENWHVQIFRSIDSGSVRGFP  541

Query  1153  KDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGA  974
             K    A+ QNLVC+KDLVID SIQ AYI+AIR AQ+FIYIENQYFLGSSYAWPSYK+AGA
Sbjct  542   KFYDEAQAQNLVCSKDLVIDGSIQTAYIQAIRSAQNFIYIENQYFLGSSYAWPSYKDAGA  601

Query  973   DNLIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIA  794
             D+LIPMELA+KI SKIR  ERFAVY+VIPMWPEG P    VQ+IL+WQ QT++MMY+ IA
Sbjct  602   DHLIPMELAMKIASKIRANERFAVYVVIPMWPEGNPKDNVVQEILFWQAQTMEMMYQFIA  661

Query  793   KELKSEKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAK  614
             KE+KS  + D HP DYLNFYCLGNRE     +     P  ++ ++ S K  RFMIYVHAK
Sbjct  662   KEIKSMGLLDTHPQDYLNFYCLGNREA--VPTTVDEVPVNADKISESHKCQRFMIYVHAK  719

Query  613   GMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWA  434
             GMVVDDEYVI+GSANINQRSMAG++DTE+AMGAYQPHHTWAK Q HPH QVYGYRMSLWA
Sbjct  720   GMVVDDEYVIIGSANINQRSMAGTKDTELAMGAYQPHHTWAKKQQHPHGQVYGYRMSLWA  779

Query  433   EHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSP  254
             EHLGM+++  +E E +ECVK VNE+AEENWK YT ++ + LQGH+LKYP++V  +G +SP
Sbjct  780   EHLGMVEKCFNEPETMECVKRVNEVAEENWKSYTNDELTLLQGHILKYPMEVGIDGNLSP  839

Query  253   LGGCEYFPDVGGKVLGSRT-TLPDALTT  173
             L G E FPD+GG+VLG+ + ++PD LTT
Sbjct  840   LTGHENFPDLGGRVLGAHSPSMPDVLTT  867



>ref|XP_004500904.1| PREDICTED: phospholipase D delta-like isoform X2 [Cicer arietinum]
Length=764

 Score =  1140 bits (2950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 557/754 (74%), Positives = 644/754 (85%), Gaps = 10/754 (1%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQGNK---V  2528
             M+      V+YLHG+L LKI+EAR LPNMD+ SER R+FF+A + C      +G      
Sbjct  1     MTHKSDPTVIYLHGNLHLKIVEARFLPNMDMFSERFRRFFSAINACSASIGGKGKNHPPR  60

Query  2527  RRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDV  2348
               H +IITSDPYV VCLAGATVARTRVISNSQ P W EHFKIP+AHPVS+VEF VKDND+
Sbjct  61    HHHHKIITSDPYVTVCLAGATVARTRVISNSQSPKWEEHFKIPLAHPVSQVEFYVKDNDM  120

Query  2347  FGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGG  2168
             FGAD IG+A VSA++I+SGE I+DWFPIIG  GK PKPDCA+RL MKFT C ++P +R G
Sbjct  121   FGADLIGIATVSAKRILSGEDISDWFPIIGPCGKTPKPDCAVRLEMKFTRCDDSPLFRSG  180

Query  2167  VT---EDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAI  1997
             +    + + +++SYFP+R GGAVTLYQDAHVP+  LP IK+DDG  F H  CWEDICHAI
Sbjct  181   LAPEPDRFVVRDSYFPVRRGGAVTLYQDAHVPDSMLPGIKLDDGVEFQHGKCWEDICHAI  240

Query  1996  LEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTS  1817
             LEAHHMVYIVGWSIYHKVKLVREPT+PLP+GGNLNLGELLKYKSQEG+RVL+LVWDDKTS
Sbjct  241   LEAHHMVYIVGWSIYHKVKLVREPTKPLPSGGNLNLGELLKYKSQEGLRVLMLVWDDKTS  300

Query  1816  HSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCV  1637
             H+KFF  T+G+M THDEETRKFFKHSSVTCVL+PRYASSKLS  KQQVVGTL+THHQKCV
Sbjct  301   HNKFFFKTNGIMQTHDEETRKFFKHSSVTCVLSPRYASSKLSIFKQQVVGTLFTHHQKCV  360

Query  1636  IVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPR  1457
             IVDTQA GN+RKITAFIGGLDLCDGRYDTP+HR+F D DTV++ DY+NPTFP  G KGPR
Sbjct  361   IVDTQAHGNHRKITAFIGGLDLCDGRYDTPEHRIFHDLDTVYKDDYHNPTFP-AGTKGPR  419

Query  1456  QPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWIT  1277
             QPWHDLHCKIEGPAAYDILTNFEQRWR+A+KW++LG++FK++SHW DD+L+K++RISWI 
Sbjct  420   QPWHDLHCKIEGPAAYDILTNFEQRWRRATKWSDLGQKFKRVSHWVDDSLIKLDRISWIL  479

Query  1276  SPTPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVI  1097
             SP+ S+PNDDP LWVS E DP+NWHVQVFRSIDSGSLKGFPKDVH AE QNL+CAK+LVI
Sbjct  480   SPSESLPNDDPELWVSKEDDPENWHVQVFRSIDSGSLKGFPKDVHEAEAQNLICAKNLVI  539

Query  1096  DRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNR  917
             D+SIQ AYI AIR AQHFIYIENQYF+GSS+AWPSYKEAGADNLIP+ELALKIVSKIR  
Sbjct  540   DKSIQTAYIHAIRSAQHFIYIENQYFIGSSFAWPSYKEAGADNLIPIELALKIVSKIRAN  599

Query  916   ERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNF  737
             ERF VYIVIPMWPEGVPSSA VQ+ILY+QGQT++MMYEIIA+ELK   IE+ +P DYLNF
Sbjct  600   ERFTVYIVIPMWPEGVPSSAAVQEILYFQGQTMEMMYEIIARELKLHNIENRNPQDYLNF  659

Query  736   YCLGNREEWHEESASSPTPGC--SEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANIN  563
             YCLGNRE++  E +++        + ++ SQK  RFMIYVHAKGMVVDDEYV+VGSANIN
Sbjct  660   YCLGNREKFATEVSTTNNSHSDNGDTVSASQKFQRFMIYVHAKGMVVDDEYVMVGSANIN  719

Query  562   QRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQV  461
             QRS+AGSRDTEIAMGAYQP HTW+K + +PH Q 
Sbjct  720   QRSLAGSRDTEIAMGAYQPRHTWSKKKGYPHGQT  753



>ref|NP_567989.1| phospholipase D delta [Arabidopsis thaliana]
 sp|Q9C5Y0.2|PLDD1_ARATH RecName: Full=Phospholipase D delta; Short=AtPLDdelta; Short=PLD 
delta [Arabidopsis thaliana]
 dbj|BAB19130.1| phospholipase D [Arabidopsis thaliana]
 gb|AEE86572.1| phospholipase D delta [Arabidopsis thaliana]
Length=868

 Score =  1140 bits (2950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 563/876 (64%), Positives = 674/876 (77%), Gaps = 43/876 (5%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQ-------  2540
             M++ +SE+V+ LHGDLDLKI++ARRLPNMD+ SE +R+ FTA + C +P           
Sbjct  1     MAEKVSEDVMLLHGDLDLKIVKARRLPNMDMFSEHLRRLFTACNACARPTDTDDVDPRDK  60

Query  2539  ---GNK-VRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVE  2372
                G+K +R H ++ITSDPYV V +  AT+ARTRV+ NSQ+P+W E F I +AHP + +E
Sbjct  61    GEFGDKNIRSHRKVITSDPYVTVVVPQATLARTRVLKNSQEPLWDEKFNISIAHPFAYLE  120

Query  2371  FQVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCA  2192
             FQVKD+DVFGA  IG AK+  + I SGE I+ WFP++GA GKPPK + AI + MKFTP  
Sbjct  121   FQVKDDDVFGAQIIGTAKIPVRDIASGERISGWFPVLGASGKPPKAETAIFIDMKFTPFD  180

Query  2191  ENPRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENC  2021
             +   YR G+  D    G++ +YFP+R G  V LYQDAHV +G+LP I +D+GK + H  C
Sbjct  181   QIHSYRCGIAGDPERRGVRRTYFPVRKGSQVRLYQDAHVMDGTLPAIGLDNGKVYEHGKC  240

Query  2020  WEDICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLL  1841
             WEDIC+AI EAHHM+YIVGWSI+HK+KLVRE    +P   ++ LGELLKYKSQEGVRVLL
Sbjct  241   WEDICYAISEAHHMIYIVGWSIFHKIKLVRE--TKVPRDKDMTLGELLKYKSQEGVRVLL  298

Query  1840  LVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQ-----  1676
             LVWDDKTSH KF I T GVMGTHDEETRKFFKHSSV CVL+PRYASSKL   KQQ     
Sbjct  299   LVWDDKTSHDKFGIKTPGVMGTHDEETRKFFKHSSVICVLSPRYASSKLGLFKQQASPSS  358

Query  1675  ------VVGTLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTV  1514
                   VVGTL+THHQKCV+VDTQA GNNRK+TAFIGGLDLCDGRYDTP+HR+  D DTV
Sbjct  359   SIYIMTVVGTLFTHHQKCVLVDTQAVGNNRKVTAFIGGLDLCDGRYDTPEHRILHDLDTV  418

Query  1513  FRGDYNNPTFPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKK  1334
             F+ D++NPTFP  G K PRQPWHDLHC+I+GPAAYD+L NFEQRWRKA++W E   R K 
Sbjct  419   FKDDFHNPTFP-AGTKAPRQPWHDLHCRIDGPAAYDVLINFEQRWRKATRWKEFSLRLKG  477

Query  1333  ISHWHDDALLKIERISWITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSID  1178
              +HW DDAL++I RISWI SP        T  +P DDP +WVS E DP+NWHVQ+FRSID
Sbjct  478   KTHWQDDALIRIGRISWILSPVFKFLKDGTSIIPEDDPCVWVSKEDDPENWHVQIFRSID  537

Query  1177  SGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAW  998
             SGS+KGFPK    AE Q+L CAK LV+D+SIQ AYI+ IR AQHFIYIENQYFLGSSYAW
Sbjct  538   SGSVKGFPKYEDEAEAQHLECAKRLVVDKSIQTAYIQTIRSAQHFIYIENQYFLGSSYAW  597

Query  997   PSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTI  818
             PSY++AGADNLIPMELALKIVSKIR +ERFAVY+VIP+WPEG P S PVQ+ILYWQ QT+
Sbjct  598   PSYRDAGADNLIPMELALKIVSKIRAKERFAVYVVIPLWPEGDPKSGPVQEILYWQSQTM  657

Query  817   QMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGR  638
             QMMY++IAKELK+ +  DAHP DYLNFYCLG RE+  ++  ++        ++ S    R
Sbjct  658   QMMYDVIAKELKAVQ-SDAHPLDYLNFYCLGKREQLPDDMPAT----NGSVVSDSYNFQR  712

Query  637   FMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVY  458
             FMIYVHAKGM+VDDEYV++GSANINQRSMAG++DTEIAMGAYQP+HTWA    HP  QVY
Sbjct  713   FMIYVHAKGMIVDDEYVLMGSANINQRSMAGTKDTEIAMGAYQPNHTWAHKGRHPRGQVY  772

Query  457   GYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQV  278
             GYRMSLWAEHLG   ++  E   LEC+K VN I+EENWKR+   KFS LQGHL+KYPLQV
Sbjct  773   GYRMSLWAEHLGKTGDEFVEPSDLECLKKVNTISEENWKRFIDPKFSELQGHLIKYPLQV  832

Query  277   DSNGKVSPLGGCEYFPDVGGKVLGSRT-TLPDALTT  173
             D +GKVSPL   E FPDVGGK++G+ +  LPD LTT
Sbjct  833   DVDGKVSPLPDYETFPDVGGKIIGAHSMALPDTLTT  868



>ref|XP_010437423.1| PREDICTED: phospholipase D delta isoform X1 [Camelina sativa]
Length=887

 Score =  1139 bits (2946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 567/892 (64%), Positives = 677/892 (76%), Gaps = 56/892 (6%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPET--------R  2543
             M+    E  + LHGDLDLKI++ARRLPNMD+ SE +R+ FT+ + C  P T         
Sbjct  1     MAAKSPEPTMLLHGDLDLKIVQARRLPNMDMFSEHMRRCFTSCNACTTPATDDDPRDRGE  60

Query  2542  QGNK-VRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQ  2366
              G+K +R H ++ITSDPYV V +  +T+ARTRV+ NSQDP W E+FKI +AHP+S +EFQ
Sbjct  61    PGDKNIRSHRKVITSDPYVTVVVPQSTLARTRVLKNSQDPTWNENFKISIAHPLSHLEFQ  120

Query  2365  VKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAEN  2186
             VKD+DVFGA  IG AK+  + I SGE I+ WFP++GA GKPPK + A+ + MKFTP  + 
Sbjct  121   VKDDDVFGAQIIGTAKIPVRDIASGERISGWFPVLGASGKPPKKETALYIDMKFTPFDQI  180

Query  2185  PRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWE  2015
               YR G+  D    G+K +YFP+R G  V LYQDAHV +G LPEI +D+GK + H  CWE
Sbjct  181   HNYRIGIAGDPERKGVKRTYFPVRKGSQVRLYQDAHVMDGMLPEIGLDNGKVYQHGKCWE  240

Query  2014  DICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLV  1835
             DIC+A+ EAHHM+YIVGWS++HK+KLVREPTR LP GG+L LGELLKYKS+EGVRVLLLV
Sbjct  241   DICYAVSEAHHMIYIVGWSVFHKIKLVREPTRKLPRGGDLTLGELLKYKSEEGVRVLLLV  300

Query  1834  WDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYT  1655
             WDDKTSH KF I+T GVMGTHDEETRKFFKHSSV CVL+PRYASSKL   KQQVVGTL+T
Sbjct  301   WDDKTSHDKFGISTPGVMGTHDEETRKFFKHSSVICVLSPRYASSKLGLFKQQVVGTLFT  360

Query  1654  HHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFP--  1481
             HHQKCV+VDTQA GNNRK+TAFIGGLDLCDGRYDTP+HR+ +D DTVF+ D++NPTFP  
Sbjct  361   HHQKCVLVDTQAVGNNRKVTAFIGGLDLCDGRYDTPEHRILNDLDTVFKDDFHNPTFPVS  420

Query  1480  ---------------------------EGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQR  1382
                                        + G K PRQPWHDLHC+I+GPAAYD+L NFEQR
Sbjct  421   VWLFTGYFQARILVSYIFPILIVFLLPQAGTKAPRQPWHDLHCRIDGPAAYDVLMNFEQR  480

Query  1381  WRKASKWAELGRRFKKISHWHDDALLKIERISWITSP--------TPSVPNDDPSLWVSN  1226
             WRKA++W E   R K  +HW DDAL++I RISWI SP        T  VP D+P +WVS 
Sbjct  481   WRKATRWKEFSLRLKGKTHWQDDALIRIGRISWILSPVFKFLKDGTSIVPEDEPCVWVSK  540

Query  1225  EGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQH  1046
             E DP+NWH QVFRSIDSGS+KGFPK    AE Q+L CAK LV+D+SIQ AYI+ IR AQH
Sbjct  541   EDDPENWHCQVFRSIDSGSVKGFPKYEDEAEVQHLECAKRLVVDKSIQTAYIQTIRSAQH  600

Query  1045  FIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEGVP  866
             FIYIENQYFLGSSYAWPSYK+AGADNLIPMELALKIVSKIR +ERFAVY+VIP+WPEG P
Sbjct  601   FIYIENQYFLGSSYAWPSYKDAGADNLIPMELALKIVSKIRAKERFAVYVVIPLWPEGDP  660

Query  865   SSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREEWHEESASSP  686
              S PVQ+ILYWQ QT+QMMY++IAKELK+ +  DAHP DYLNFYCLG RE+  +   ++ 
Sbjct  661   KSGPVQEILYWQSQTMQMMYDVIAKELKAVQ-SDAHPLDYLNFYCLGKREKLPDNMPATN  719

Query  685   TPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQP  506
                 S+    S K  RFMIYVHAKGM+VDDEYV++GSANINQRSMAG++DTEIAMGAYQP
Sbjct  720   GNTVSD----SYKFQRFMIYVHAKGMIVDDEYVLMGSANINQRSMAGTKDTEIAMGAYQP  775

Query  505   HHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAE  326
             H+TW     HP  QVYGYRMSLWAEHLG   ++  +   LECVK VNEI+E NWK++   
Sbjct  776   HYTWNHKGKHPRGQVYGYRMSLWAEHLGKTGDEFVKPSDLECVKNVNEISEGNWKKFIDT  835

Query  325   KFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRT-TLPDALTT  173
             +F+ LQGHL+KYPLQVD +GKVSPL   E FPDVGGK++G+ +  LPD LTT
Sbjct  836   EFAELQGHLIKYPLQVDVDGKVSPLPDYESFPDVGGKIIGAHSMALPDTLTT  887



>gb|EEC84978.1| hypothetical protein OsI_32238 [Oryza sativa Indica Group]
Length=846

 Score =  1139 bits (2946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 569/843 (67%), Positives = 664/843 (79%), Gaps = 28/843 (3%)
 Frame = -2

Query  2668  VYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPET----RQGNKVRRHTR--II  2507
             V   GDLDL ++EAR LPNMD+ SE +R+ F A  C+ P +    RQ    R H R  II
Sbjct  19    VLRRGDLDLWVVEARLLPNMDMFSEHVRRCFAA--CKPPTSCATARQPRHARGHQRRKII  76

Query  2506  TSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIG  2327
             TSDPYV + +AGA VARTRVI N QDPVW E F +P+AH  + +EF VKDND FGA  IG
Sbjct  77    TSDPYVTLSVAGAVVARTRVIPNDQDPVWDERFAVPLAHYAAALEFHVKDNDTFGAQLIG  136

Query  2326  VAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED---  2156
                + A ++ S + + DWFPIIG +G+P KPD A+RL ++F P A+NP YR G+  D   
Sbjct  137   TVTIPADRVASCQEVEDWFPIIGNNGRPYKPDTALRLRLRFNPAADNPLYRRGIPGDPDH  196

Query  2155  YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDG-KAFHHENCWEDICHAILEAHHM  1979
              G+K+SYFP+RHGG VTLYQDAH  EG LPEI++D+G K F H  CWEDICHAILEAHHM
Sbjct  197   QGIKDSYFPLRHGGRVTLYQDAHYREGDLPEIELDEGGKVFDHNACWEDICHAILEAHHM  256

Query  1978  VYIVGWSIYHKVKLVREPT--RplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKF  1805
             +YIVGWS+Y KV+LVREP+  RPLP GG+LNLGELLK+KSQEGVRV LLVWDDKTSH K 
Sbjct  257   IYIVGWSVYDKVRLVREPSPSRPLPEGGDLNLGELLKFKSQEGVRVCLLVWDDKTSHDKL  316

Query  1804  FINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDT  1625
             FI T GVM THDEETRKFFKHSSV CVL+PR           QVVGTL+THHQKCV+VDT
Sbjct  317   FIKTGGVMATHDEETRKFFKHSSVICVLSPRL----------QVVGTLFTHHQKCVLVDT  366

Query  1624  QAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWH  1445
             QA GN RKITAFIGGLDLCDGRYDTP+HRLF D DTVF  DY+NPTFP G   GPRQPWH
Sbjct  367   QAWGNKRKITAFIGGLDLCDGRYDTPEHRLFKDLDTVFDNDYHNPTFPSGAKGGPRQPWH  426

Query  1444  DLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTP  1265
             DLHC+I+GPAAYD+L NFEQRWRKA+KW E   RF+K+SHW DDAL+K+ERISWI SP+P
Sbjct  427   DLHCRIDGPAAYDVLKNFEQRWRKATKWRE---RFRKVSHWKDDALIKLERISWILSPSP  483

Query  1264  SVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSI  1085
             ++PNDD SL VS E DP+NWHVQVFRSIDSGSLKGFP D   A  QNL+C KDL+ID+SI
Sbjct  484   TIPNDDISLRVSKEEDPENWHVQVFRSIDSGSLKGFPSDCKEASKQNLICRKDLIIDKSI  543

Query  1084  QMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFA  905
               AY+ AIR AQHFIYIENQYFLGSSYAWPSY  +GADNL+P+ELALKI SKIR  ERFA
Sbjct  544   HTAYVRAIRSAQHFIYIENQYFLGSSYAWPSYVNSGADNLVPIELALKIASKIRAGERFA  603

Query  904   VYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLG  725
             VY+VIPMWPEGVP++A VQ+IL++Q QT++MMY IIA+ELK+  I++AHP DYLNFYCLG
Sbjct  604   VYVVIPMWPEGVPTAASVQEILFFQAQTMEMMYRIIAQELKAMNIKNAHPQDYLNFYCLG  663

Query  724   NREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAG  545
             NREE    + S  +   S     ++K  RFMIYVHAKGM+VDDEYVI+GSANINQRS+AG
Sbjct  664   NREESSSSNGSPESNDKSAAAL-ARKYRRFMIYVHAKGMIVDDEYVILGSANINQRSLAG  722

Query  544   SRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVN  365
             SRDTEIAMGAYQPHHTW+    HP  QVYGYR SLWAEHLGM+D+   +   LECV  VN
Sbjct  723   SRDTEIAMGAYQPHHTWSTKGGHPRGQVYGYRTSLWAEHLGMVDDLFKDPSSLECVNYVN  782

Query  364   EIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPD  185
             EIAEENW+R+TAE+   LQGHLLKYP++V+++GKV PL   E FPDVGGK+LG+ T+LPD
Sbjct  783   EIAEENWRRFTAEQLITLQGHLLKYPVKVEADGKVGPLPEHECFPDVGGKILGAPTSLPD  842

Query  184   ALT  176
              LT
Sbjct  843   TLT  845



>gb|AAL11625.1|AF424632_1 AT4g35790/F4B14_60 [Arabidopsis thaliana]
 gb|AAM47353.1| AT4g35790/F4B14_60 [Arabidopsis thaliana]
Length=848

 Score =  1139 bits (2946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 559/856 (65%), Positives = 666/856 (78%), Gaps = 32/856 (4%)
 Frame = -2

Query  2668  VYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQ----------GNK-VR  2525
             + LHGDLDLKI++ARRLPNMD+ SE +R+ FTA + C +P              G+K +R
Sbjct  1     MLLHGDLDLKIVKARRLPNMDMFSEHLRRLFTACNACARPTDTDDVDPRDKGEFGDKNIR  60

Query  2524  RHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVF  2345
              H ++ITSDPYV V +  AT+ARTRV+ NSQ+P+W E F I +AHP + +EFQVKD+DVF
Sbjct  61    SHRKVITSDPYVTVVVPQATLARTRVLKNSQEPLWDEKFNISIAHPFAYLEFQVKDDDVF  120

Query  2344  GADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGV  2165
             GA  IG AK+  + I SGE I+ WFP++GA GKPPK + AI + MKFTP  +   YR G+
Sbjct  121   GAQIIGTAKIPVRDIASGERISGWFPVLGASGKPPKAETAIFIDMKFTPFDQIHSYRCGI  180

Query  2164  TED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAIL  1994
               D    G++ +YFP+R G  V LYQDAHV +G+LP I +D+GK + H  CWEDIC+AI 
Sbjct  181   AGDPERRGVRRTYFPVRKGSQVRLYQDAHVMDGTLPAIGLDNGKVYEHGKCWEDICYAIS  240

Query  1993  EAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSH  1814
             EAHHM+YIVGWSI+HK+KLVRE    +P   ++ LGELLKYKSQEGVRVLLLVWDDKTSH
Sbjct  241   EAHHMIYIVGWSIFHKIKLVRE--TKVPRDKDMTLGELLKYKSQEGVRVLLLVWDDKTSH  298

Query  1813  SKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVI  1634
              KF I T GVMGTHDEETRKFFKHSSV CVL+PRYASSKL   KQQVVGTL+THHQKCV+
Sbjct  299   DKFGIKTPGVMGTHDEETRKFFKHSSVICVLSPRYASSKLGLFKQQVVGTLFTHHQKCVL  358

Query  1633  VDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQ  1454
             VDTQA GNNRK+TAFIGGLDLCDGRYDTP+HR+  D DTVF+ D++NPTFP  G K PRQ
Sbjct  359   VDTQAVGNNRKVTAFIGGLDLCDGRYDTPEHRILHDLDTVFKDDFHNPTFP-AGTKAPRQ  417

Query  1453  PWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITS  1274
             PWHDLHC+I+GPAAYD+L NFEQRWRKA++W E   R K  +HW DDAL++I RISWI S
Sbjct  418   PWHDLHCRIDGPAAYDVLINFEQRWRKATRWKEFSLRLKGKTHWQDDALIRIGRISWILS  477

Query  1273  P--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLV  1118
             P        T  +P DDP +WVS E DP+NWHVQ+FRSIDSGS+KGFPK    AE Q+L 
Sbjct  478   PVFKFLKDGTSIIPEDDPCVWVSKEDDPENWHVQIFRSIDSGSVKGFPKYEDEAEAQHLE  537

Query  1117  CAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKI  938
             CAK LV+D+SIQ AYI+ IR AQHFIYIENQYFLGSSYAWPSY++AGADNLIPMELALKI
Sbjct  538   CAKRLVVDKSIQTAYIQTIRSAQHFIYIENQYFLGSSYAWPSYRDAGADNLIPMELALKI  597

Query  937   VSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAH  758
             VSKIR +ERFAVY+VIP+WPEG P S PVQ+ILYWQ QT+QMMY++IAKELK+ +  DAH
Sbjct  598   VSKIRAKERFAVYVVIPLWPEGDPKSGPVQEILYWQSQTMQMMYDVIAKELKAVQ-SDAH  656

Query  757   PCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVG  578
             P DYLNFYCLG RE+  ++  ++        ++ S    RFMIYVHAKGM+VDDEYV++G
Sbjct  657   PLDYLNFYCLGKREQLPDDMPAT----NGSVVSDSYNFQRFMIYVHAKGMIVDDEYVLMG  712

Query  577   SANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDE  398
             SANINQRSMAG++DTEIAMGAYQP+HTWA    HP  QVYGYRMSLWAEHLG   ++  E
Sbjct  713   SANINQRSMAGTKDTEIAMGAYQPNHTWAHKGRHPRGQVYGYRMSLWAEHLGKTGDEFVE  772

Query  397   AEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGG  218
                LEC+K VN I+EENWKR+   KFS LQGHL+KYPLQVD +GKVSPL   E FPDVGG
Sbjct  773   PSDLECLKKVNTISEENWKRFIDPKFSELQGHLIKYPLQVDVDGKVSPLPDYETFPDVGG  832

Query  217   KVLGSRT-TLPDALTT  173
             K++G+ +  LPD LTT
Sbjct  833   KIIGAHSMALPDTLTT  848



>ref|XP_004289065.1| PREDICTED: phospholipase D delta-like [Fragaria vesca subsp. 
vesca]
Length=848

 Score =  1137 bits (2942),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 563/859 (66%), Positives = 690/859 (80%), Gaps = 33/859 (4%)
 Frame = -2

Query  2683  MSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDC---------RKPETRQGNK  2531
             MSE +VYLHGDLDLKILEARRLPNMD+ SER+R+ FTA D          + P++   +K
Sbjct  1     MSEQIVYLHGDLDLKILEARRLPNMDLFSERLRRCFTACDTINCSRSRSKKPPQSVDDSK  60

Query  2530  VRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDND  2351
             +  H  I+TSD YVKVC+  ATVARTRVI NSQ+P W E F IP+AHP +++EFQVKDND
Sbjct  61    ISHHRNIMTSDSYVKVCVPQATVARTRVIKNSQNPQWRETFCIPLAHPAAKLEFQVKDND  120

Query  2350  VFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRG  2171
             VFGA  IG A +SA++I +GE I+ WF IIG  GKPPKP CAI++ +KFTP  +NP Y+ 
Sbjct  121   VFGAQMIGTASISAERIATGEVISGWFDIIGPTGKPPKPPCAIKVELKFTPFEKNPVYKH  180

Query  2170  GVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHA  2000
             G+  D    G+  +YFP+R G  V LYQDAHVPEG LP+I++D  K +  E+CWED+C+A
Sbjct  181   GIAGDPARKGVSNTYFPLRKGSHVRLYQDAHVPEGLLPQIELDGRKVYKPEHCWEDLCYA  240

Query  1999  ILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKT  1820
             I EAHHM+Y+VGWS++HKV+LVREPTRPLP GG+L LGE LKYKS+EGVRVL+LVW+DKT
Sbjct  241   ISEAHHMIYVVGWSVFHKVRLVREPTRPLPRGGDLTLGEFLKYKSEEGVRVLMLVWNDKT  300

Query  1819  SHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKC  1640
             S+  +   ++G+MGTHDEETRKFFK+SSVTCVLAPRY SSKLS +KQ+VVGT++THHQKC
Sbjct  301   SNDVY---SAGMMGTHDEETRKFFKNSSVTCVLAPRYGSSKLSIIKQKVVGTVFTHHQKC  357

Query  1639  VIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPE--GGLK  1466
             VIVDTQA GNNRKITAF+GGLD+CDGRYDT +HRLF D DTVF+ D++  + P    G K
Sbjct  358   VIVDTQASGNNRKITAFLGGLDICDGRYDTHEHRLFHDVDTVFKDDFHQISIPNLTAGTK  417

Query  1465  GPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERIS  1286
              PRQPWHDLHC+I+GPAAYD+L NFEQRWRK +++ + G+  K++SHWHD +LLKI RIS
Sbjct  418   APRQPWHDLHCRIDGPAAYDVLINFEQRWRKTTRFRDFGQ-CKRVSHWHD-SLLKIGRIS  475

Query  1285  WITSPTPS-------VPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQ  1127
             WI SP  S       +P +DP+LWV  E DP++W+VQ+FRSIDSGSL GFPKDV  A +Q
Sbjct  476   WILSPEMSDSEEFTIIPKEDPALWVQREDDPEDWNVQIFRSIDSGSLNGFPKDVIVAASQ  535

Query  1126  NLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELA  947
             NL+C+KDLVID+SIQ AYI+AIR AQHFIYIENQYFLGSSYAWP YK+AGADNLIP+ELA
Sbjct  536   NLICSKDLVIDKSIQTAYIKAIRSAQHFIYIENQYFLGSSYAWPDYKDAGADNLIPIELA  595

Query  946   LKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIE  767
             LKI SKIR  ERFAVYIV+PMWPEG P+S  +Q+ILYWQ QT+QMMY+I+A+ELK+ +++
Sbjct  596   LKIASKIRANERFAVYIVVPMWPEGHPNSGAMQEILYWQSQTMQMMYDIVARELKALQLQ  655

Query  766   DAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYV  587
             D+HP D+LNFYCLG RE+  +E++++        +  S K+ RFMIYVHAKGM+VDDEYV
Sbjct  656   DSHPQDFLNFYCLGKREKVPQETSNNKE------ICESYKNQRFMIYVHAKGMIVDDEYV  709

Query  586   IVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEK  407
             I+GSANINQRSMAG++DTEIAMGAYQPHHTWA+ Q HP  Q+YGYRMSLWAEHLGM+D  
Sbjct  710   ILGSANINQRSMAGTKDTEIAMGAYQPHHTWAEKQRHPCGQIYGYRMSLWAEHLGMLDTC  769

Query  406   LDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPD  227
               EAE LE V+ VN IAEENW+RYT+  F+ LQGHLL+YPL V ++GKV PL G E FPD
Sbjct  770   FKEAESLETVRTVNGIAEENWRRYTSPDFTELQGHLLRYPLLVRADGKVEPLPGYENFPD  829

Query  226   VGGKVLGSRTT-LPDALTT  173
             VGGKV+G+ T  +PD  TT
Sbjct  830   VGGKVIGAHTIKIPDQFTT  848



>ref|XP_011007871.1| PREDICTED: phospholipase D delta-like [Populus euphratica]
 ref|XP_011009390.1| PREDICTED: phospholipase D delta-like [Populus euphratica]
 ref|XP_011009392.1| PREDICTED: phospholipase D delta-like [Populus euphratica]
Length=853

 Score =  1135 bits (2937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 553/843 (66%), Positives = 667/843 (79%), Gaps = 15/843 (2%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRRHT---RI  2510
             S+  V+LHG+LD+ ILEA+ LPNMD+ SE +R+ FT      P    G+K   H+    I
Sbjct  19    SKESVFLHGELDIWILEAKSLPNMDLASENMRKCFTMCGSYSPLC--GHKPMTHSGKHSI  76

Query  2509  ITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFI  2330
             ITSDPYV VCLAGATVA+TRVI+N ++P+W EHF +PVAHPV +VEF VKDND  GA  I
Sbjct  77    ITSDPYVSVCLAGATVAQTRVIANCENPLWDEHFCVPVAHPVVKVEFHVKDNDFLGAQLI  136

Query  2329  GVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT---E  2159
             GV ++  +KI+SG TINDWFPII   G   KP   +   ++F P  +NP Y+ GV    E
Sbjct  137   GVVEIPVEKIVSGNTINDWFPIICTSGTCLKPYPELHFSIQFKPVEDNPLYKDGVGDGPE  196

Query  2158  DYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHM  1979
               G+  +YFP+R GG+VTLYQDAHVP+  LP+I +DDGK F H +CWEDICHAILEAH++
Sbjct  197   YKGVPNTYFPLRKGGSVTLYQDAHVPDAVLPKITLDDGKVFQHSSCWEDICHAILEAHNL  256

Query  1978  VYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFI  1799
             +YIVGWS+YH+VKLVREPT+PLP GG L LGELLKYKS+EGVRV++L+WDDKTSH  F++
Sbjct  257   IYIVGWSVYHRVKLVREPTKPLPAGGELTLGELLKYKSEEGVRVVMLLWDDKTSHDTFYL  316

Query  1798  NTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQA  1619
              T GVM THDEET+KFFKHSSV CVLAPRY S+KLS  KQQVVGTL++HHQKCVI+DTQ+
Sbjct  317   KTDGVMQTHDEETKKFFKHSSVHCVLAPRYGSNKLSVFKQQVVGTLFSHHQKCVILDTQS  376

Query  1618  QGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDL  1439
              GNNRKIT+FIGGLDLCDGRYDTP+HRLF D  TVF  D++NPTFP    K PRQPWHDL
Sbjct  377   SGNNRKITSFIGGLDLCDGRYDTPEHRLFRDLHTVFENDFHNPTFP-SNTKSPRQPWHDL  435

Query  1438  HCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSV  1259
             HCKIEGPAAYDILTNFEQRW+KA+KW    RR KK++ WHDDAL+K+ERISWI +P+ S 
Sbjct  436   HCKIEGPAAYDILTNFEQRWKKATKW----RRIKKVTRWHDDALIKLERISWILTPSSS-  490

Query  1258  PNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQM  1079
             P+ D  + V++EGDP+NWHVQVFRSIDSGS+KGFPK    A  QNL+C K+L +D+SI  
Sbjct  491   PDGDKIVHVTDEGDPENWHVQVFRSIDSGSVKGFPKSTQEAVDQNLLCGKNLKVDKSIHT  550

Query  1078  AYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVY  899
             AY++AIR AQHFIYIENQYFLGSSY WPSYK AGADNL+PMELALKI SKIR  ERF+VY
Sbjct  551   AYVKAIRSAQHFIYIENQYFLGSSYYWPSYKNAGADNLVPMELALKIASKIRANERFSVY  610

Query  898   IVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIE-DAHPCDYLNFYCLGN  722
             IVIPMWPEGVP+SAPVQ+ILYWQGQT+ MMY+IIAKEL+   +    HP  YLNFYCLG 
Sbjct  611   IVIPMWPEGVPTSAPVQEILYWQGQTMAMMYKIIAKELEKAGLSYRYHPQHYLNFYCLGK  670

Query  721   REEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGS  542
             RE    +S+       +  L  +QK  RFMIYVHAKGMVVDDEYVI+GSANINQRS+ GS
Sbjct  671   RENSPHDSSEINQQTENRSLAAAQKFRRFMIYVHAKGMVVDDEYVIMGSANINQRSLDGS  730

Query  541   RDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNE  362
             RDTEIAMGAYQP +TWA+  +HPH QVYGYRMSLWAEHLG++++  DE + LEC+K+VN+
Sbjct  731   RDTEIAMGAYQPTYTWARKNSHPHGQVYGYRMSLWAEHLGILEQAFDEPQNLECMKLVNK  790

Query  361   IAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDA  182
              +  NWK Y +E+   ++G+L++YP+QV  +G+VS + G E FPDVGGKVLG+ T LPD 
Sbjct  791   TSRHNWKAYVSEESKEMRGNLMQYPIQVSKSGEVSAIQGHETFPDVGGKVLGASTNLPDV  850

Query  181   LTT  173
             LTT
Sbjct  851   LTT  853



>ref|XP_006367166.1| PREDICTED: phospholipase D delta-like [Solanum tuberosum]
Length=856

 Score =  1134 bits (2933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 549/863 (64%), Positives = 678/863 (79%), Gaps = 33/863 (4%)
 Frame = -2

Query  2683  MSE-NVVYLHGDLDLKILEARRLPNMDIVSERIRQFFT-AFDCRKP------------ET  2546
             MSE   + LHGDL L I+EAR LPN DI S+R+R+ FT    C KP            + 
Sbjct  1     MSEPKTIILHGDLQLHIIEARHLPNFDITSDRLRRCFTFGGICGKPHHTTADRAGGGGDD  60

Query  2545  RQGNKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQ  2366
              + +K   H +IITSDPYV V      +ARTRVI NSQ P W EHF+IP+AHP++ +EF+
Sbjct  61    YRSDKKDHHRKIITSDPYVTVSAPQTALARTRVIPNSQYPFWDEHFRIPLAHPIAYLEFR  120

Query  2365  VKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAEN  2186
             VKD+D+FGA+ +G  K+ A++I +GE I+ WFPIIG+ GKP KPD A+R+ MKF P  +N
Sbjct  121   VKDDDLFGAEIMGKVKIPAERIATGEDISGWFPIIGSSGKPSKPDTALRVHMKFYPYEKN  180

Query  2185  PRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEG-SLPEIKIDDGKAFHHENCW  2018
             P Y+ G+  D    G++ SYFP+R G +V LYQDAHV      PEI++++G  F H  CW
Sbjct  181   PLYKQGIASDPQHLGVRNSYFPVRKGSSVKLYQDAHVSNNVKFPEIELENGTDFEHNKCW  240

Query  2017  EDICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLL  1838
             EDIC+AI EAHH++YIVGWS++HK+KL+REPTRPLP GG+L LGELLKYKSQEGVRVLLL
Sbjct  241   EDICYAISEAHHLIYIVGWSVFHKIKLIREPTRPLPRGGDLTLGELLKYKSQEGVRVLLL  300

Query  1837  VWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLY  1658
             +WDDKTSH KFFI T G+MGTHDEET+KFFKHSSV CVL+PRYASSKLS +KQQVVGT++
Sbjct  301   LWDDKTSHDKFFITTEGLMGTHDEETKKFFKHSSVICVLSPRYASSKLSIMKQQVVGTMF  360

Query  1657  THHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPE  1478
             THHQKC++VDTQA GNNRKITAF+GGLDLCDGRYDTP+HRLF D DTVF+ D++ P +P 
Sbjct  361   THHQKCILVDTQAPGNNRKITAFLGGLDLCDGRYDTPEHRLFRDLDTVFKDDFHQPNYPP  420

Query  1477  GGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKI  1298
              G K PR+PWHDLHC+I+GPAAYD+L NF QRWR+A+KW E     K ++ WHDDA+LKI
Sbjct  421   -GTKAPREPWHDLHCRIDGPAAYDMLINFAQRWRRATKWREFSFLKKTMARWHDDAMLKI  479

Query  1297  ERISWITSPTPSV-------PNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHT  1139
             ERISWI SP  +V       P DDP L+VS E  P+NWHVQ+FRSIDSGS++GFP+    
Sbjct  480   ERISWILSPAFAVSKERTEIPEDDPELYVSREDHPENWHVQIFRSIDSGSVQGFPRSTDV  539

Query  1138  AETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIP  959
             AE QNL+ +KDLV+D+SI+ AYI+AIR AQHFIYIENQYFLGSSYAWPSYK+AGAD+L+P
Sbjct  540   AEEQNLISSKDLVVDKSIEAAYIQAIRSAQHFIYIENQYFLGSSYAWPSYKDAGADHLVP  599

Query  958   MELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKS  779
             MELALKI SKIR++ERF VY+V+PMWPEG P S  +Q+ILYWQ QT+QMMY++IA+ELKS
Sbjct  600   MELALKIASKIRSKERFCVYVVMPMWPEGDPKSTTMQEILYWQSQTMQMMYQVIARELKS  659

Query  778   EKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVD  599
              ++ D+HP DYLNFYCLGNRE      A++ +   +E ++ S K  RFMIYVHAKGM+VD
Sbjct  660   MQLLDSHPLDYLNFYCLGNRE------ANAQSSCDAEKVSDSFKFQRFMIYVHAKGMIVD  713

Query  598   DEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGM  419
             DEYVI+GSANINQRS+AGS+DTEIAMGAYQPHH+W K Q HP  Q+YGYRMSLWAEHLG 
Sbjct  714   DEYVIMGSANINQRSLAGSKDTEIAMGAYQPHHSWGKKQQHPQGQIYGYRMSLWAEHLGT  773

Query  418   MDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCE  239
             +++   E E LECV+ VN +AE+NWKRYTA+ F+ L GHLLKYP+ VD++GKV  L   E
Sbjct  774   LEDCFQEPEALECVRRVNAVAEDNWKRYTADNFTELNGHLLKYPVLVDADGKVGSLPEYE  833

Query  238   YFPDVGGKVLGSRT-TLPDALTT  173
              FPD+GGK++G+ + T+PD LTT
Sbjct  834   CFPDLGGKIVGNPSPTIPDVLTT  856



>ref|XP_009138388.1| PREDICTED: phospholipase D delta-like [Brassica rapa]
Length=863

 Score =  1133 bits (2931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 563/871 (65%), Positives = 664/871 (76%), Gaps = 38/871 (4%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPET---------R  2543
             M++  S++V+ LHGDLDL I++AR+LPNMD  S  +R   T   C  P T         R
Sbjct  1     MAEKPSDDVMLLHGDLDLTIVQARKLPNMDTFSNHLRLCLTV--CTNPSTADEEEDRRAR  58

Query  2542  QG---------NKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAH  2390
              G         +  R H ++ITSDPYV V +  AT+ARTRV+ NSQDP W EHF I +AH
Sbjct  59    DGLPPPPQPQPSNARSHRKVITSDPYVTVVVPQATLARTRVLKNSQDPKWDEHFTISIAH  118

Query  2389  PVSEVEFQVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMM  2210
             P+S +EFQVKD+DVFGA  IG AK+  + I SG  +  WFPI+GA GKPPK + A+ + M
Sbjct  119   PMSHLEFQVKDDDVFGAQIIGTAKIPVKDIASGSPVKGWFPILGASGKPPKKETALYIEM  178

Query  2209  KFTPCAENPRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKA  2039
              FTP  +   YR G+  D    G+K +YFP+R G  V LYQDAHV +G LPEI +D GK 
Sbjct  179   TFTPFDQIHTYRSGIAGDPDRKGVKGTYFPVRKGSQVRLYQDAHVMDGMLPEIGLDGGKV  238

Query  2038  FHHENCWEDICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQE  1859
             + H  CWEDIC+A+ EAHHM+Y+VGWS++HKVKLVREPTR LP GG+L LGELLKYKS+E
Sbjct  239   YQHGKCWEDICYAVSEAHHMIYVVGWSVFHKVKLVREPTRKLPRGGDLTLGELLKYKSEE  298

Query  1858  GVRVLLLVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQ  1679
             GVRVLLLVWDDKTSH KF I T GVMGTHDEETRKFFKHSSV CVL+PRYASSKL   KQ
Sbjct  299   GVRVLLLVWDDKTSHDKFGIRTPGVMGTHDEETRKFFKHSSVICVLSPRYASSKLGLFKQ  358

Query  1678  QVVGTLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDY  1499
             QVVGTL+THHQKCV+VDTQA GNNRK+TAF+GG+DLCDGRYDTP+HR+  D DTVF+ D+
Sbjct  359   QVVGTLFTHHQKCVLVDTQAAGNNRKVTAFLGGIDLCDGRYDTPEHRILHDLDTVFKDDF  418

Query  1498  NNPTFPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWH  1319
             +NPT+P  G K PRQPWHDLHC++EGPAAYD+L NFEQRWRKA++W E   R K  +HW 
Sbjct  419   HNPTYPV-GTKAPRQPWHDLHCRLEGPAAYDVLMNFEQRWRKATRWKEFSLRLKGKTHWQ  477

Query  1318  DDALLKIERISWITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLK  1163
             DDAL++I RISWI SP        T  VP DDP ++VS E DP+NWHVQVFRSIDSGSLK
Sbjct  478   DDALIRIGRISWILSPVFKYLKDGTNMVPEDDPIVYVSKEDDPENWHVQVFRSIDSGSLK  537

Query  1162  GFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKE  983
             GFPK    A+ QNL  AK LV+D+SIQ AYI+ IR AQHFIYIENQYFLGSSYAWP+YK+
Sbjct  538   GFPKYEDEAKLQNLESAKRLVVDKSIQTAYIQTIRSAQHFIYIENQYFLGSSYAWPNYKD  597

Query  982   AGADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYE  803
             AGADNLIPMELALKIVSKIR +ERFAVY+VIP+WPEG P S PVQ+ILYWQ QT+QMMY+
Sbjct  598   AGADNLIPMELALKIVSKIRAKERFAVYVVIPLWPEGDPKSGPVQEILYWQSQTMQMMYD  657

Query  802   IIAKELKSEKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYV  623
             +IA+ELK+ +  DAHP DYLNFYCLG RE   E+ A   T G +E  + S +  RFMIYV
Sbjct  658   VIARELKAVQ-SDAHPLDYLNFYCLGKREPLPEDMAD--TNGSAE--SDSYRFRRFMIYV  712

Query  622   HAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMS  443
             HAKGM+VDDEYV++GSANINQRSMAG++DTEIAMGAYQPHHTW     HP  QVYGYRMS
Sbjct  713   HAKGMIVDDEYVLIGSANINQRSMAGTKDTEIAMGAYQPHHTWTNKGKHPRGQVYGYRMS  772

Query  442   LWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGK  263
             LWAEHLG   ++  E   LECV+ VNEIAE NWK +    FS LQGHL+KYPLQVD +GK
Sbjct  773   LWAEHLGKTGDEFVEPGDLECVRNVNEIAEGNWKTFIDSNFSELQGHLIKYPLQVDVDGK  832

Query  262   VSPLGGCEYFPDVGGKVLGSRT-TLPDALTT  173
             VS L   + FPDVGGK++G+ +  LPD LTT
Sbjct  833   VSSLPDYDSFPDVGGKIIGAHSMALPDTLTT  863



>gb|AHA10981.1| PLDdelta [Chorispora bungeana]
Length=863

 Score =  1133 bits (2930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 561/869 (65%), Positives = 671/869 (77%), Gaps = 34/869 (4%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKP-----------  2552
             M++  SE+V+ LHG+L+L I  AR LPNMD+ SE +R+ FTA + C +P           
Sbjct  1     MAEKASEDVMLLHGNLELTIFRARDLPNMDMFSEHMRRLFTACNACTRPPVDEDRRDREG  60

Query  2551  ----ETRQGNKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPV  2384
                     G K+  H ++ITSDPYV V +  AT+ARTRV+ NSQ+P W EHF I VAHP+
Sbjct  61    GGGGGGNPGEKIHTHRKVITSDPYVTVVVPQATLARTRVLKNSQNPEWKEHFIIAVAHPL  120

Query  2383  SEVEFQVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKF  2204
             + +EFQVKD+DVFGA  IG AK+  + I SGE I+ W+P++GA GK PK   AI + MKF
Sbjct  121   AYLEFQVKDDDVFGAQIIGTAKIPVRDIASGERISGWYPVLGASGKTPKKLTAIEIDMKF  180

Query  2203  TPCAENPRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFH  2033
              P  +  RYR GV  D    G++ +YFP+R G  + LYQDAHV +G LPEI +D+G+ + 
Sbjct  181   IPFDQIQRYRRGVAGDPKRKGVERTYFPVRKGSQMRLYQDAHVMDGMLPEIGLDNGEVYQ  240

Query  2032  HENCWEDICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGV  1853
             H  CWEDIC+A+ EAHHM+Y+VGWS++HKVKLVREPTR LP GG+L LGELLKYKS+EGV
Sbjct  241   HGKCWEDICYAVSEAHHMIYVVGWSVFHKVKLVREPTRKLPRGGDLTLGELLKYKSEEGV  300

Query  1852  RVLLLVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQV  1673
             RVLLLVWDDKTSH KF I+T GVMGTHDEETRKFFKHSSV CVL+PRYASSKL   KQQV
Sbjct  301   RVLLLVWDDKTSHDKFGISTPGVMGTHDEETRKFFKHSSVICVLSPRYASSKLGLFKQQV  360

Query  1672  VGTLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNN  1493
             VGTL+THHQKCV+VDTQA GNNRK+TAFIGG+DLCDGRYDTP+HR+  D DTVF+ D++N
Sbjct  361   VGTLFTHHQKCVLVDTQAVGNNRKVTAFIGGIDLCDGRYDTPEHRILHDLDTVFKDDFHN  420

Query  1492  PTFPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDD  1313
              TFP  G K PRQPWHDLHC+I+GPAAYD+L NFEQRWRKA++W E   R K  +HW DD
Sbjct  421   HTFP-AGTKAPRQPWHDLHCRIDGPAAYDVLINFEQRWRKATRWKEFSLRLKGKTHWQDD  479

Query  1312  ALLKIERISWITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGF  1157
             AL++I RISWI SP        T  VP DDP ++VS E DP+NWHVQVFRSIDSGS+KGF
Sbjct  480   ALIRIGRISWILSPVFKYLKDGTSIVPEDDPVVYVSKEDDPENWHVQVFRSIDSGSVKGF  539

Query  1156  PKDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAG  977
             PK    AE Q+L CAK LV+D+SIQ AYI+ IR AQHFIYIENQYFLGSSYAWPSYK+AG
Sbjct  540   PKYEDEAEAQHLECAKRLVVDKSIQTAYIQTIRSAQHFIYIENQYFLGSSYAWPSYKDAG  599

Query  976   ADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEII  797
             ADNLIPMELALKIVSKIR +ERFAVY+VIP+WPEG P S PVQ+ILYWQ QT+QMMY++I
Sbjct  600   ADNLIPMELALKIVSKIRAKERFAVYVVIPLWPEGDPKSGPVQEILYWQSQTMQMMYDVI  659

Query  796   AKELKSEKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHA  617
              +ELKS +  DAHP DYLNFYCLG RE+  E+  ++     S+    S K  RFMIYVHA
Sbjct  660   GRELKSVQ-SDAHPLDYLNFYCLGKREKLPEDMPATNGSTVSD----SYKFQRFMIYVHA  714

Query  616   KGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLW  437
             KGM+VDDEYV++GSANINQRSMAG++DTEIAMGAYQPHHTWA    HP  QVYGYRMSLW
Sbjct  715   KGMIVDDEYVLMGSANINQRSMAGTKDTEIAMGAYQPHHTWADRGKHPRGQVYGYRMSLW  774

Query  436   AEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVS  257
             AEHLG   ++  E   LECVK VNEIAE NWK++   +F+ LQGHL+KYPLQVD++G+VS
Sbjct  775   AEHLGKTGDEFVEPGELECVKNVNEIAEGNWKKFIDSEFAELQGHLIKYPLQVDADGQVS  834

Query  256   PLGGCEYFPDVGGKVLGSRT-TLPDALTT  173
              L   + FPDVGGK++G+ +  LPD LTT
Sbjct  835   SLPDYDSFPDVGGKIIGAHSMALPDTLTT  863



>ref|XP_002266693.2| PREDICTED: phospholipase D delta-like isoform X2 [Vitis vinifera]
Length=856

 Score =  1128 bits (2917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 546/844 (65%), Positives = 660/844 (78%), Gaps = 12/844 (1%)
 Frame = -2

Query  2683  MSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAF-DCRKPETRQGNKVRRHTRII  2507
             +S   V+LHG+LDL ILEA+ LPNMD+ +ER+R+ F  F  C  P   +     +H  II
Sbjct  18    VSGEAVFLHGELDLWILEAKSLPNMDLATERVRRCFNMFGSCTSPFKIRHKHSSKHHSII  77

Query  2506  TSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIG  2327
             TSDPYV VCLAGAT+A+TRVI NS++P W EHF +PVAHPV +VEF VKDND+ GA  IG
Sbjct  78    TSDPYVSVCLAGATIAQTRVIPNSENPSWGEHFCVPVAHPVMKVEFHVKDNDILGAQLIG  137

Query  2326  VAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED---  2156
             V  +S +K+ISG  ++ WFPI+G+ G P KP   + + ++F P  ENP Y+ GV      
Sbjct  138   VVGISVEKLISGNAVSGWFPIVGSQGNPLKPYPELHVSIQFRPVGENPLYKDGVGAGSGY  197

Query  2155  YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMV  1976
              G+  +YFP+  GG++TLYQDAHVP+G LPEI +D GK F    CWE+ICHA+LEAHH++
Sbjct  198   LGVPNTYFPLHKGGSITLYQDAHVPKGMLPEILLDGGKIFQQGQCWEEICHAMLEAHHLI  257

Query  1975  YIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFIN  1796
             YI+GWSI+H VKL+REPT+P+P GG L+LGELLKYKS+EGVRVL+L+WDDKTSH +    
Sbjct  258   YIIGWSIFHPVKLLREPTKPVPAGGELSLGELLKYKSEEGVRVLMLIWDDKTSHDRLLFK  317

Query  1795  TSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQ  1616
             T GVM THDEETRKFFKHS V CVL+PRYAS+KLS  KQQVVGTL+THHQKCV++DTQA 
Sbjct  318   TEGVMQTHDEETRKFFKHSGVHCVLSPRYASNKLSIFKQQVVGTLFTHHQKCVLLDTQAP  377

Query  1615  GNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLH  1436
             GNNRKITAFIGGLDLCDGRYDTP+HRLFSD DTVF  D++NPTFP    +GPRQPWHDLH
Sbjct  378   GNNRKITAFIGGLDLCDGRYDTPEHRLFSDLDTVFSNDFHNPTFPSRA-RGPRQPWHDLH  436

Query  1435  CKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVP  1256
             CK+EGPAAYDI+TNFEQRWRKA+KW +   R KK++HWH+DAL++++RISWI +P+ S P
Sbjct  437   CKVEGPAAYDIMTNFEQRWRKAAKWRDF--RLKKVTHWHEDALIRLDRISWIITPS-SGP  493

Query  1255  NDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMA  1076
               D ++ V+ E DP+ WHVQVFRSIDSGS++GFPK V  AE QNLVC K+L IDRSI  A
Sbjct  494   TGDHAVRVTTEEDPETWHVQVFRSIDSGSVRGFPKLVQDAEAQNLVCGKNLKIDRSIHAA  553

Query  1075  YIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYI  896
             Y++AIR AQHFIYIENQYFLGS+Y WPSYK AGADNLIPMELALKI SKI   E F VYI
Sbjct  554   YVKAIRSAQHFIYIENQYFLGSAYHWPSYKNAGADNLIPMELALKISSKISANEHFRVYI  613

Query  895   VIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDA-HPCDYLNFYCLGNR  719
             V+PMWPEGVP+SA VQ+IL+WQGQT+ MMY+II + +    + D  HP DYLNFYCLG R
Sbjct  614   VVPMWPEGVPTSASVQEILFWQGQTMSMMYQIIGQAIHKAGLSDTHHPQDYLNFYCLGKR  673

Query  718   EEWHEESASSPTPGCSE--FLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAG  545
             E    ES S+ T   SE   L  +QK  RFMIYVHAKGM+VDDEYV++GSANINQRS+ G
Sbjct  674   EASSTES-SAQTSNSSENRALGLAQKFRRFMIYVHAKGMIVDDEYVLIGSANINQRSLDG  732

Query  544   SRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVN  365
             SRDTEIAMGAYQP +TW+  + HPH QVYGYRMSLWAEHLG +++   + E LEC++ VN
Sbjct  733   SRDTEIAMGAYQPSYTWSGKKTHPHGQVYGYRMSLWAEHLGTLEDSFCQPESLECIRQVN  792

Query  364   EIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPD  185
              IA+ NW+ Y A++   + GHL++YP+QV  NG VS L G E FPDVGGKVLGS T LPD
Sbjct  793   SIAKNNWQIYAADENKEMTGHLMQYPIQVSKNGNVSTLPGHECFPDVGGKVLGSPTNLPD  852

Query  184   ALTT  173
             ALTT
Sbjct  853   ALTT  856



>ref|XP_010244835.1| PREDICTED: phospholipase D delta-like isoform X4 [Nelumbo nucifera]
Length=854

 Score =  1124 bits (2907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 534/841 (63%), Positives = 671/841 (80%), Gaps = 10/841 (1%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAF-DCRKPETRQGNKVRRHTRIIT  2504
             S+N ++LHG+L++ I EAR LPNMD+VSER+R+ FT F  C +P T++ ++ +   +IIT
Sbjct  19    SDNFIFLHGNLEIWIFEARSLPNMDLVSERMRKCFTMFGSCARP-TKKKDRDKSGRKIIT  77

Query  2503  SDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGV  2324
             SDPYV VC+AGATVA+TR+I+N +DP W EHF++PVAHP+++VEFQVKDND+ GA  IGV
Sbjct  78    SDPYVSVCMAGATVAQTRIIANCEDPSWDEHFRVPVAHPITKVEFQVKDNDILGAQLIGV  137

Query  2323  AKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED---Y  2153
              ++  +KI+ G+ IN WFPI+G +G P KP   + L ++F P  E+P Y+ G+       
Sbjct  138   VEIPIEKILPGDKINGWFPIVGPYGNPLKPYPELHLSLQFRPVEEDPLYKNGIGAGPNYI  197

Query  2152  GLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVY  1973
             G+  +YFP+R GG VTLYQDAHVP G+LP+I +D G+ F    CWEDICHAILEAHH++Y
Sbjct  198   GVPNTYFPLRKGGVVTLYQDAHVPHGALPDIILDGGRVFQQGQCWEDICHAILEAHHLIY  257

Query  1972  IVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINT  1793
             I+GWSIYH VKLVREPT+PLP GG+L LGELLKYKSQ+GVRV++LVWDDKTSH  F + T
Sbjct  258   IIGWSIYHPVKLVREPTKPLPEGGDLTLGELLKYKSQQGVRVMMLVWDDKTSHHNFLLKT  317

Query  1792  SGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQG  1613
              GVM THDEETR+FFKHS+V CVL+PRYAS+KLS  KQQVVGTL+THHQKCV+VDTQA G
Sbjct  318   EGVMHTHDEETRRFFKHSTVHCVLSPRYASNKLSIFKQQVVGTLFTHHQKCVLVDTQASG  377

Query  1612  NNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHC  1433
             N RK+TAFIGGLDLCDGRYDTP+HRLF D DTVF  D++NPTFP    +GPRQPWHDLHC
Sbjct  378   NYRKVTAFIGGLDLCDGRYDTPEHRLFIDLDTVFANDFHNPTFPSRA-RGPRQPWHDLHC  436

Query  1432  KIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPN  1253
             K+EGPAAYDI+TNFEQRWRK +KW +   + + +++WH+DAL+K++RISWI +PT    +
Sbjct  437   KVEGPAAYDIMTNFEQRWRKVAKWRDF--KIRNVTNWHEDALIKLDRISWILTPTVGA-D  493

Query  1252  DDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAY  1073
              D S+  + E DP+NWHVQVFRSIDSGS++GFPK V  AE QNL+C K+L ID+SI +AY
Sbjct  494   GDHSIHAATEDDPENWHVQVFRSIDSGSVRGFPKLVQEAEAQNLICGKNLKIDKSIHVAY  553

Query  1072  IEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIV  893
             ++AIR AQHFIYIENQYF+GSS+ WPSYK+AGADNL+P+ELALKI SKI   ERF+VY+V
Sbjct  554   VKAIRSAQHFIYIENQYFIGSSFYWPSYKDAGADNLVPIELALKIASKISANERFSVYVV  613

Query  892   IPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIED-AHPCDYLNFYCLGNRE  716
             IPMWPEGVP+SA VQ+IL+WQGQTI MMY I+ + L +  + +  HP D+LNFYCLG RE
Sbjct  614   IPMWPEGVPTSASVQEILFWQGQTIDMMYRIVGQALDNAGLSNKCHPQDFLNFYCLGKRE  673

Query  715   EWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRD  536
                 + +S   P  +     +QK  RFMIYVHAKGM+VDDEYVI+GSANINQRS+ GSRD
Sbjct  674   PGSPDRSSQTNPSENNAQGLAQKFHRFMIYVHAKGMIVDDEYVIMGSANINQRSLDGSRD  733

Query  535   TEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIA  356
             TEIAMGAYQP++TWA  + HP  QVYGYRMSLWAEHLGM+++   E + +EC++ VN +A
Sbjct  734   TEIAMGAYQPNYTWAMKKCHPRGQVYGYRMSLWAEHLGMLEDCFYEPQSIECIRRVNTLA  793

Query  355   EENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALT  176
             E NW+ Y +E+F  ++GHL+ YP+ V  +GK+ PL G E FPDVGGKVLG+ TTLPDALT
Sbjct  794   ESNWQSYVSEEFMDMKGHLMPYPIHVGWDGKIGPLPGFECFPDVGGKVLGAPTTLPDALT  853

Query  175   T  173
             T
Sbjct  854   T  854



>gb|KFK30199.1| hypothetical protein AALP_AA7G231200 [Arabis alpina]
Length=862

 Score =  1123 bits (2904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 557/862 (65%), Positives = 667/862 (77%), Gaps = 30/862 (3%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKP---ETRQG--------  2537
             +E+ + LHGDL+L I +AR LPNMD+ SE +R+ FT  + C KP   E R+         
Sbjct  5     TEDSMLLHGDLELTIKQARGLPNMDMFSEHLRRCFTPCNSCIKPSIDEDRRDRDIESNST  64

Query  2536  -NKVRRH-TRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQV  2363
               K+R H  ++ITSDPYV V +  AT+ARTRV+ N+QDPVW EHF + VAHP+S +EFQV
Sbjct  65    DKKLRTHRKKVITSDPYVTVVVPQATLARTRVLKNAQDPVWNEHFNVSVAHPLSYLEFQV  124

Query  2362  KDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENP  2183
             KD+DVFGA  IG AK+    I SG+ I+ WFP++GA GKPPK + AI + + FTP  +  
Sbjct  125   KDDDVFGAQIIGTAKIPVSDIASGKKISGWFPVLGASGKPPKKETAIEIDLTFTPLDQIH  184

Query  2182  RYRGGVT---EDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWED  2012
              Y+ G++   E  G++ +YFP+R G +V LYQDAHV +G LPEI +D+ K + H  CWED
Sbjct  185   TYKNGISGHVEKKGVEGTYFPLRKGSSVRLYQDAHVMDGMLPEIVLDNKKVYQHGKCWED  244

Query  2011  ICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVW  1832
             IC+AI EAHHM+YIVGWS++HKVKLVREPTR LP GG+L LGELLKYKS+EGVRVLLLVW
Sbjct  245   ICYAISEAHHMIYIVGWSVFHKVKLVREPTRKLPRGGDLTLGELLKYKSEEGVRVLLLVW  304

Query  1831  DDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTH  1652
             DDKTSH KF I+T GVMGTHDEETRKFFKHSSV CVL+PRYASSKL   KQ VVGTL+TH
Sbjct  305   DDKTSHDKFGISTPGVMGTHDEETRKFFKHSSVICVLSPRYASSKLGLFKQHVVGTLFTH  364

Query  1651  HQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGG  1472
             HQKCV++DTQA GNNRK+TAF+GG+DLCDGRYDTP+HR+  D DTVF+ D++NPTFP  G
Sbjct  365   HQKCVLLDTQAVGNNRKVTAFLGGIDLCDGRYDTPEHRILHDLDTVFKDDFHNPTFP-AG  423

Query  1471  LKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIER  1292
              K PRQPWHDLHC+++GPAAYD+L NFEQRWRKA++W E     K  +HW DDAL++I R
Sbjct  424   TKAPRQPWHDLHCRVDGPAAYDVLINFEQRWRKATRWKEFSLLLKGKTHWQDDALIRIGR  483

Query  1291  ISWITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTA  1136
             ISWI SP        T  VP DDP ++VS E DP+NWHVQVFRSIDSGS+KGFPK    A
Sbjct  484   ISWILSPVFEFLKDGTTIVPKDDPLVYVSKEDDPENWHVQVFRSIDSGSVKGFPKYEDEA  543

Query  1135  ETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPM  956
             + Q+L  AK LV+D+SIQ AYI+AIR AQHFIYIENQYFLGSSYAWPSYK AGADNLIPM
Sbjct  544   KAQHLESAKRLVVDKSIQTAYIQAIRSAQHFIYIENQYFLGSSYAWPSYKAAGADNLIPM  603

Query  955   ELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSE  776
             ELALKIVSKIR +ERFAVY+VIP+WPEG P S PVQ+ILYWQ QT+Q MY++IA+ELKS 
Sbjct  604   ELALKIVSKIRAKERFAVYVVIPLWPEGDPKSGPVQEILYWQSQTMQTMYDVIARELKSV  663

Query  775   KIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDD  596
             +  DAHP DYLNFYCLG RE+  E   +  T G    ++ S    RFMIYVHAKGM+VDD
Sbjct  664   Q-SDAHPLDYLNFYCLGKREKLPEGLPT--TNGNGNTVSDSYNFQRFMIYVHAKGMIVDD  720

Query  595   EYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMM  416
             EYV++GSANINQRSMAG++DTEIAMGAYQPHHTW++   HP  QVYGYRMSLWAEHLG  
Sbjct  721   EYVLMGSANINQRSMAGTKDTEIAMGAYQPHHTWSEKGRHPRGQVYGYRMSLWAEHLGKT  780

Query  415   DEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEY  236
              ++  E   LECVK VNEI EENWKR+   +FS LQGHL+KYPLQVD  G V+ L   + 
Sbjct  781   GDEYMEPSDLECVKNVNEITEENWKRFIDSEFSELQGHLIKYPLQVDIEGNVTSLPDYDS  840

Query  235   FPDVGGKVLGSRT-TLPDALTT  173
             FPDVGGK++G+ +  LPD LTT
Sbjct  841   FPDVGGKIIGAHSMALPDTLTT  862



>ref|XP_010658068.1| PREDICTED: phospholipase D delta-like isoform X1 [Vitis vinifera]
 ref|XP_010658069.1| PREDICTED: phospholipase D delta-like isoform X1 [Vitis vinifera]
 ref|XP_010658070.1| PREDICTED: phospholipase D delta-like isoform X1 [Vitis vinifera]
 ref|XP_010658071.1| PREDICTED: phospholipase D delta-like isoform X1 [Vitis vinifera]
 ref|XP_010658072.1| PREDICTED: phospholipase D delta-like isoform X1 [Vitis vinifera]
 ref|XP_010658073.1| PREDICTED: phospholipase D delta-like isoform X1 [Vitis vinifera]
 ref|XP_010658074.1| PREDICTED: phospholipase D delta-like isoform X1 [Vitis vinifera]
 ref|XP_010658075.1| PREDICTED: phospholipase D delta-like isoform X1 [Vitis vinifera]
 ref|XP_010658076.1| PREDICTED: phospholipase D delta-like isoform X1 [Vitis vinifera]
Length=862

 Score =  1122 bits (2902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 546/850 (64%), Positives = 660/850 (78%), Gaps = 18/850 (2%)
 Frame = -2

Query  2683  MSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAF-DCRKPETRQGNKVRRHTRII  2507
             +S   V+LHG+LDL ILEA+ LPNMD+ +ER+R+ F  F  C  P   +     +H  II
Sbjct  18    VSGEAVFLHGELDLWILEAKSLPNMDLATERVRRCFNMFGSCTSPFKIRHKHSSKHHSII  77

Query  2506  TSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIG  2327
             TSDPYV VCLAGAT+A+TRVI NS++P W EHF +PVAHPV +VEF VKDND+ GA  IG
Sbjct  78    TSDPYVSVCLAGATIAQTRVIPNSENPSWGEHFCVPVAHPVMKVEFHVKDNDILGAQLIG  137

Query  2326  VAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED---  2156
             V  +S +K+ISG  ++ WFPI+G+ G P KP   + + ++F P  ENP Y+ GV      
Sbjct  138   VVGISVEKLISGNAVSGWFPIVGSQGNPLKPYPELHVSIQFRPVGENPLYKDGVGAGSGY  197

Query  2155  YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMV  1976
              G+  +YFP+  GG++TLYQDAHVP+G LPEI +D GK F    CWE+ICHA+LEAHH++
Sbjct  198   LGVPNTYFPLHKGGSITLYQDAHVPKGMLPEILLDGGKIFQQGQCWEEICHAMLEAHHLI  257

Query  1975  YIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFIN  1796
             YI+GWSI+H VKL+REPT+P+P GG L+LGELLKYKS+EGVRVL+L+WDDKTSH +    
Sbjct  258   YIIGWSIFHPVKLLREPTKPVPAGGELSLGELLKYKSEEGVRVLMLIWDDKTSHDRLLFK  317

Query  1795  T------SGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVI  1634
             T       GVM THDEETRKFFKHS V CVL+PRYAS+KLS  KQQVVGTL+THHQKCV+
Sbjct  318   TVMLIHLEGVMQTHDEETRKFFKHSGVHCVLSPRYASNKLSIFKQQVVGTLFTHHQKCVL  377

Query  1633  VDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQ  1454
             +DTQA GNNRKITAFIGGLDLCDGRYDTP+HRLFSD DTVF  D++NPTFP    +GPRQ
Sbjct  378   LDTQAPGNNRKITAFIGGLDLCDGRYDTPEHRLFSDLDTVFSNDFHNPTFPSRA-RGPRQ  436

Query  1453  PWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITS  1274
             PWHDLHCK+EGPAAYDI+TNFEQRWRKA+KW +   R KK++HWH+DAL++++RISWI +
Sbjct  437   PWHDLHCKVEGPAAYDIMTNFEQRWRKAAKWRDF--RLKKVTHWHEDALIRLDRISWIIT  494

Query  1273  PTPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVID  1094
             P+ S P  D ++ V+ E DP+ WHVQVFRSIDSGS++GFPK V  AE QNLVC K+L ID
Sbjct  495   PS-SGPTGDHAVRVTTEEDPETWHVQVFRSIDSGSVRGFPKLVQDAEAQNLVCGKNLKID  553

Query  1093  RSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRE  914
             RSI  AY++AIR AQHFIYIENQYFLGS+Y WPSYK AGADNLIPMELALKI SKI   E
Sbjct  554   RSIHAAYVKAIRSAQHFIYIENQYFLGSAYHWPSYKNAGADNLIPMELALKISSKISANE  613

Query  913   RFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDA-HPCDYLNF  737
              F VYIV+PMWPEGVP+SA VQ+IL+WQGQT+ MMY+II + +    + D  HP DYLNF
Sbjct  614   HFRVYIVVPMWPEGVPTSASVQEILFWQGQTMSMMYQIIGQAIHKAGLSDTHHPQDYLNF  673

Query  736   YCLGNREEWHEESASSPTPGCSE--FLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANIN  563
             YCLG RE    ES S+ T   SE   L  +QK  RFMIYVHAKGM+VDDEYV++GSANIN
Sbjct  674   YCLGKREASSTES-SAQTSNSSENRALGLAQKFRRFMIYVHAKGMIVDDEYVLIGSANIN  732

Query  562   QRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLE  383
             QRS+ GSRDTEIAMGAYQP +TW+  + HPH QVYGYRMSLWAEHLG +++   + E LE
Sbjct  733   QRSLDGSRDTEIAMGAYQPSYTWSGKKTHPHGQVYGYRMSLWAEHLGTLEDSFCQPESLE  792

Query  382   CVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGS  203
             C++ VN IA+ NW+ Y A++   + GHL++YP+QV  NG VS L G E FPDVGGKVLGS
Sbjct  793   CIRQVNSIAKNNWQIYAADENKEMTGHLMQYPIQVSKNGNVSTLPGHECFPDVGGKVLGS  852

Query  202   RTTLPDALTT  173
              T LPDALTT
Sbjct  853   PTNLPDALTT  862



>ref|XP_007042278.1| Phospholipase D [Theobroma cacao]
 gb|EOX98109.1| Phospholipase D [Theobroma cacao]
Length=848

 Score =  1121 bits (2900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/838 (65%), Positives = 664/838 (79%), Gaps = 9/838 (1%)
 Frame = -2

Query  2671  VVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRRHTRIITSDPY  2492
               +LHG+LDL I+EA+ LPNMD+ SER+R+FFT F       R+  K      +ITSDPY
Sbjct  15    TTFLHGELDLWIIEAKSLPNMDLASERMRRFFTMFGTCDTYFRKKPKASGRQSMITSDPY  74

Query  2491  VKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVAKVS  2312
             V VCLAGATVA+TR+I+N ++P+W EHF +PVAHPV ++EF VKDNDV GA  IGV +++
Sbjct  75    VSVCLAGATVAQTRIIANCENPLWDEHFIVPVAHPVVKIEFHVKDNDVLGAQLIGVVEIA  134

Query  2311  AQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTE--DY-GLKE  2141
              +K++ G  INDWFPIIG  G   KP   I + ++F P  +NP Y+ GV    DY G+  
Sbjct  135   VEKVLPGHEINDWFPIIGHFGNCLKPYPEIHVSLQFRPMGQNPLYQHGVGTGPDYMGVPN  194

Query  2140  SYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYIVGW  1961
             +YFP+R GG+VTLYQDAHVP+  LPEI +D GK +    CWEDICHAILEAHH++YIVGW
Sbjct  195   TYFPLRKGGSVTLYQDAHVPDSLLPEILLDGGKVYQQGKCWEDICHAILEAHHLIYIVGW  254

Query  1960  SIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTSGVM  1781
             S+YH +KLVREPT+PLPNGG L+LGELLKYKSQEGVRV++L+WDDKTSH +  + T GVM
Sbjct  255   SVYHPIKLVREPTKPLPNGGQLSLGELLKYKSQEGVRVVMLIWDDKTSHDRGLLKTVGVM  314

Query  1780  GTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQGNNRK  1601
              THDEET++FFKHSSV CVLAPRYAS+KLSF KQQVVGTL+THHQKCV++DTQA GNNRK
Sbjct  315   QTHDEETKRFFKHSSVRCVLAPRYASNKLSFFKQQVVGTLFTHHQKCVLLDTQASGNNRK  374

Query  1600  ITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCKIEG  1421
             ITAFIGGLDLCDGRYDTP+HRLF D DTVF+ D++NPTFP    + PRQPWHDLHCKIEG
Sbjct  375   ITAFIGGLDLCDGRYDTPEHRLFHDLDTVFKDDFHNPTFPSNA-QSPRQPWHDLHCKIEG  433

Query  1420  PAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPNDDPS  1241
             PAAYD+LTNFEQRWRKA+KW +   + +K++ WHD+AL++++RISWI SP+P   + D  
Sbjct  434   PAAYDVLTNFEQRWRKAAKWRDF--KLRKVTPWHDEALIRVDRISWIISPSPG-SDGDKI  490

Query  1240  LWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAI  1061
             + V +E DP+NWHVQVFRSIDSGS+KGFPKDV  A  QNLVC K+L +DRSI  AYI+AI
Sbjct  491   VRVCDEEDPENWHVQVFRSIDSGSVKGFPKDVKQAAAQNLVCGKNLKVDRSIHTAYIKAI  550

Query  1060  RRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPMW  881
             R AQHFIYIENQYFLGSSY WPSYK AGADNLIPMELALKI SKI   ERF+VYIVIPMW
Sbjct  551   RSAQHFIYIENQYFLGSSYYWPSYKNAGADNLIPMELALKIASKISANERFSVYIVIPMW  610

Query  880   PEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDA-HPCDYLNFYCLGNREEWHE  704
             PEGVP+S  VQ+IL+WQGQT+ +MY IIA+EL+   + D  HP DYLNFYCLG R+    
Sbjct  611   PEGVPNSNAVQEILFWQGQTMAVMYSIIAQELEKSGLSDQYHPQDYLNFYCLGKRDPSSS  670

Query  703   ESASSPTPGC-SEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEI  527
             ES+S       +  L  +Q+  RFMIYVHAKGM+VDDEYVI+GSANINQRS+ GSRDTEI
Sbjct  671   ESSSQVNQQTDNRALALAQEFRRFMIYVHAKGMIVDDEYVIMGSANINQRSLDGSRDTEI  730

Query  526   AMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEEN  347
             AMGAYQP++TWA  ++HPH QVYGYRMSLWAEHLG +++   E + LEC+K+VN+IA+ N
Sbjct  731   AMGAYQPNYTWAAKKSHPHGQVYGYRMSLWAEHLGKLEDTFREPQSLECIKLVNKIAKRN  790

Query  346   WKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALTT  173
             WK +  + +  ++GHL+ YP+++  NG V PL G E FPD+GGKVLG+ T LPD LTT
Sbjct  791   WKSFVDDDYREMRGHLMLYPIKIRRNGTVGPLPGYETFPDIGGKVLGASTNLPDVLTT  848



>ref|XP_010911814.1| PREDICTED: phospholipase D delta-like isoform X2 [Elaeis guineensis]
Length=921

 Score =  1121 bits (2899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 549/850 (65%), Positives = 667/850 (78%), Gaps = 30/850 (4%)
 Frame = -2

Query  2701  VKMSDGMS-------ENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAF-DCRKP--  2552
             V+ SD M        + V++LHGDLD+ ILEAR LPNMD+ S+R+ + FT +  C  P  
Sbjct  6     VRHSDSMGKRSPTDVDGVMFLHGDLDIWILEARSLPNMDVFSDRMIKCFTVYGTCTTPCG  65

Query  2551  ------ETRQGNKVRRHT---RIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIP  2399
                   +  +     RH    +IITSDPYV VC+AGAT+A+TRVI NS+DP W EHF +P
Sbjct  66    KADKHKDKLKDKHKDRHKSMHKIITSDPYVSVCVAGATIAQTRVIPNSEDPKWDEHFCVP  125

Query  2398  VAHPVSEVEFQVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIR  2219
             VAHPVS++EFQVKDNDVFGA  IGVA +   KI+ G T++ WFP++G +G P KP   + 
Sbjct  126   VAHPVSKIEFQVKDNDVFGAQLIGVAAIPVDKILPGVTVSGWFPVVGPYGNPMKPYPELH  185

Query  2218  LMMKFTPCAENPRYRGGVT---EDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDD  2048
             L ++F P  +NP Y+ GV    E  G+  +YFP+R GG +TLYQDAHVP+  LP I +D 
Sbjct  186   LSLQFRPMEDNPLYKDGVGAGPEYLGVPNAYFPLRTGGNITLYQDAHVPDNMLPTIPLDG  245

Query  2047  GKAFHHENCWEDICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYK  1868
             GK + H  CWEDICHAILEAHH++YIVGWSIYH VKLVREPTRPLPNGG L+LGELLKYK
Sbjct  246   GKTYEHNKCWEDICHAILEAHHLIYIVGWSIYHSVKLVREPTRPLPNGGELSLGELLKYK  305

Query  1867  SQEGVRVLLLVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSF  1688
             +QEGVRV++L+WDDKTSH KF++ T GVM THDEETRKFFKHSSV CVLAPRYAS+KLS 
Sbjct  306   TQEGVRVVMLIWDDKTSHDKFYLKTDGVMHTHDEETRKFFKHSSVHCVLAPRYASNKLSI  365

Query  1687  VKQQVVGTLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFR  1508
              KQQVVGTL+THHQKCVIVDTQA GNNRKITAFIGGLDLCDGRYDTP+HRLF + D+VF 
Sbjct  366   FKQQVVGTLFTHHQKCVIVDTQALGNNRKITAFIGGLDLCDGRYDTPEHRLFQNLDSVFV  425

Query  1507  GDYNNPTFPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKIS  1328
              D++NPTFP     GPRQPWHDLHCKIEGPAA+DILTNFEQRWRKA+KW +   RF K++
Sbjct  426   KDFHNPTFPVNSY-GPRQPWHDLHCKIEGPAAHDILTNFEQRWRKATKWRDF--RFSKVT  482

Query  1327  HWHDDALLKIERISWITSPTPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKD  1148
             HWHDDAL+KI+RISWI +P     N +    VS+E +P+NWHVQ+FRSIDSGS++GFPK 
Sbjct  483   HWHDDALIKIDRISWIITPFSDKSNTN----VSDEQNPENWHVQIFRSIDSGSVRGFPKL  538

Query  1147  VHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADN  968
             V  AE++NLVCAK+L ID+SI  AY++AIR AQHFIY+ENQYF+GSSY WPSYK AGADN
Sbjct  539   VQEAESKNLVCAKNLKIDKSIHSAYVKAIRSAQHFIYVENQYFIGSSYCWPSYKNAGADN  598

Query  967   LIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKE  788
             LIPMELALKIVSKI+ RERF+VYIVIPMWPEG+P++A +Q+IL+WQGQT+ MMY+ + + 
Sbjct  599   LIPMELALKIVSKIKARERFSVYIVIPMWPEGIPTAAAMQEILFWQGQTMAMMYKFVGEA  658

Query  787   LKSEKI-EDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKG  611
             L+ E + E  HP DYLNFYCLG RE   E  +S    G +  L  +QKS RFMIYVH+KG
Sbjct  659   LQEENLSEKYHPQDYLNFYCLGKREAPKENPSSPKVSGDNSALRSAQKSRRFMIYVHSKG  718

Query  610   MVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAE  431
             M+VDDEYVI+GSANINQRS+ GSRDTEIAMGAYQPH+ WA   NHPH QVYGYRMSLWAE
Sbjct  719   MIVDDEYVIIGSANINQRSLEGSRDTEIAMGAYQPHYKWAGKCNHPHGQVYGYRMSLWAE  778

Query  430   HLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPL  251
             HLGM+++   E + LEC++ VN +AE+NWK Y A +   ++GHL++YP++V+ +GK+ PL
Sbjct  779   HLGMVEDCFREPQSLECIRHVNRLAEDNWKSYVAPEIQEMKGHLMRYPIKVERDGKIGPL  838

Query  250   GGCEYFPDVG  221
              G E FPDVG
Sbjct  839   PGHECFPDVG  848



>emb|CDX72557.1| BnaC07g45790D [Brassica napus]
Length=865

 Score =  1120 bits (2898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 559/876 (64%), Positives = 666/876 (76%), Gaps = 46/876 (5%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPET---------R  2543
             M++  +++V+ LHGDLDL I++AR+LPNMD  S  +R   T   C  P T         R
Sbjct  1     MAEKPTDDVMLLHGDLDLTIVQARKLPNMDTFSNHLRLCLTV--CTNPTTTDEEEDRRAR  58

Query  2542  QG---------NKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAH  2390
              G         +  R H ++ITSDPYV V +  AT+ARTRV+ NSQDP W EHF I +AH
Sbjct  59    DGLPPPPQPQPSNARSHRKVITSDPYVTVVVPQATLARTRVLKNSQDPKWDEHFTISIAH  118

Query  2389  PVSEVEFQVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMM  2210
             P+S +EFQVKD+DVFGA  IG AK+  + I SG  +  WFPI+GA GKPPK + A+ + M
Sbjct  119   PMSHLEFQVKDDDVFGAQIIGTAKIPVKDIASGSPVKGWFPILGASGKPPKKETALYIEM  178

Query  2209  KFTPCAENPRYRGGVTEDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHH  2030
             KFTP  +   YR G+    G+K +YFP+R G  V LYQDAHV +G LPEI +D GK + H
Sbjct  179   KFTPFDQIHTYRSGIA---GVKGTYFPVRKGSQVRLYQDAHVMDGMLPEIGLDGGKVYQH  235

Query  2029  ENCWEDICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVR  1850
               CWEDIC+A+ EAHHM+Y+VGWS++HKVKLVREPTR LP GG+L LGELLKYKS+EGVR
Sbjct  236   GKCWEDICYAVSEAHHMIYVVGWSVFHKVKLVREPTRKLPRGGDLTLGELLKYKSEEGVR  295

Query  1849  VLLLVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQ--  1676
             VLLLVWDDKTSH KF I T GVMGTHDEETRKFFKHSSV CVL+PRYASSKL   KQQ  
Sbjct  296   VLLLVWDDKTSHDKFGIRTPGVMGTHDEETRKFFKHSSVICVLSPRYASSKLGLFKQQAS  355

Query  1675  -----VVGTLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVF  1511
                  VVGTL+THHQKCV+VDTQA GNNRK+TAF+GG+DLCDGRYDTP+HR+  D DTVF
Sbjct  356   LPHSSVVGTLFTHHQKCVLVDTQAAGNNRKVTAFLGGIDLCDGRYDTPEHRILHDLDTVF  415

Query  1510  RGDYNNPTFPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKI  1331
             + D++NPT+P  G K PRQPWHDLHC++EGPAAYD+L NFEQRWRKA++W E   R K  
Sbjct  416   KDDFHNPTYPV-GTKAPRQPWHDLHCRLEGPAAYDVLMNFEQRWRKATRWKEFSLRLKGK  474

Query  1330  SHWHDDALLKIERISWITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDS  1175
             +HW DDAL++I RISWI SP        T  VP DDP ++VS E DP+NWHVQVFRSIDS
Sbjct  475   THWQDDALIRIGRISWILSPVFKYLKDGTNMVPEDDPIVYVSKEDDPENWHVQVFRSIDS  534

Query  1174  GSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWP  995
             GSLKGFPK    A++QNL  AK LV+D+SIQ AYI+ IR AQHFIYIENQYFLGSSYAWP
Sbjct  535   GSLKGFPKYEDEAKSQNLESAKRLVVDKSIQTAYIQTIRSAQHFIYIENQYFLGSSYAWP  594

Query  994   SYKE-AGADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTI  818
             +YK+ AGADNLIPMELALKIVSKIR +ERF+VY+VIP+WPEG P S PVQ+ILYWQ QT+
Sbjct  595   NYKDAAGADNLIPMELALKIVSKIRAKERFSVYVVIPLWPEGDPKSGPVQEILYWQSQTM  654

Query  817   QMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGR  638
             QMMY++IA+ELK+ +  DAHP DYLNFYCLG RE + ++     T G +E  + S +  R
Sbjct  655   QMMYDVIARELKAVE-SDAHPLDYLNFYCLGKRERFPDDKPD--TNGSAE--SDSYRFQR  709

Query  637   FMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVY  458
             FMIYVHAKGM+VDDEYV++GSANINQRSMAG++DTEIAMGAYQPHHTW     HP  QVY
Sbjct  710   FMIYVHAKGMIVDDEYVLMGSANINQRSMAGTKDTEIAMGAYQPHHTWTNKGKHPRGQVY  769

Query  457   GYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQV  278
             GYRMSLWAEHLG   ++  E   LECV+ VNE AE NWK++   KFS LQGHL+KYPLQV
Sbjct  770   GYRMSLWAEHLGKTGDEFVEPGDLECVRNVNETAEGNWKKFIDPKFSELQGHLIKYPLQV  829

Query  277   DSNGKVSPLGGCEYFPDVGGKVLGSRT-TLPDALTT  173
             D +GKVS L   + FPDVGGK++G+ +  LPD LTT
Sbjct  830   DVDGKVSSLPDYDSFPDVGGKIIGAHSMALPDTLTT  865



>ref|XP_004233571.1| PREDICTED: phospholipase D delta-like [Solanum lycopersicum]
Length=850

 Score =  1120 bits (2897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/860 (63%), Positives = 671/860 (78%), Gaps = 33/860 (4%)
 Frame = -2

Query  2683  MSE-NVVYLHGDLDLKILEARRLPNMDIVSERIRQFFT-AFDCRKPE---------TRQG  2537
             MSE   + LHGDL L I+EAR LPN DI S+R+R+ FT    C KP            + 
Sbjct  1     MSEPKTIILHGDLQLHIIEARHLPNFDITSDRLRRCFTFGGICGKPHHSTVERAGGDHRS  60

Query  2536  NKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKD  2357
             +K   H RIITSDPYV V      +ARTRVISNSQ P W EHF+IP+AHP++ +EF+VKD
Sbjct  61    DKKDHHRRIITSDPYVTVSAPQTALARTRVISNSQYPFWDEHFRIPLAHPLAYLEFRVKD  120

Query  2356  NDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRY  2177
             +D+FGA+ +G  K+ A++I +GE I+DWF IIG+  KP   D A+R+ MKF P  +N  Y
Sbjct  121   DDLFGAEIMGKVKIPAERIATGEDISDWFQIIGSSSKP---DTALRVQMKFYPYEKNSLY  177

Query  2176  RGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEG-SLPEIKIDDGKAFHHENCWEDI  2009
             + G+  D    G++ SYFP+R G +V LYQDAHV      PEIK+++G  F H  CWEDI
Sbjct  178   KQGIASDPQYLGVRNSYFPVRKGSSVKLYQDAHVSNNVKFPEIKLENGTNFEHNKCWEDI  237

Query  2008  CHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWD  1829
             C+AI EAHH++YIVGWS++HK+KL+REPTRPLP GG+L LGELLKYKSQEGVRVLLL+WD
Sbjct  238   CYAIAEAHHLIYIVGWSVFHKIKLIREPTRPLPRGGDLTLGELLKYKSQEGVRVLLLLWD  297

Query  1828  DKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHH  1649
             DKTSH KFFI T G+MGTHDEET+KFFKHSSV CVL+PRYASSKLS +KQQVVGT++THH
Sbjct  298   DKTSHDKFFITTEGLMGTHDEETKKFFKHSSVICVLSPRYASSKLSIMKQQVVGTMFTHH  357

Query  1648  QKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGL  1469
             QKC++VDTQA GNNRKITAF+GGLDLCDGRYDTP+HRLF D DTVF+ D++ P +P  G 
Sbjct  358   QKCILVDTQAPGNNRKITAFLGGLDLCDGRYDTPEHRLFRDLDTVFKDDFHQPNYPP-GT  416

Query  1468  KGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERI  1289
             K PR+PWHDLHC+I+GPAAYD+L NF QRWR+A+KW E     K ++ WHDDA+LKIERI
Sbjct  417   KAPREPWHDLHCRIDGPAAYDMLINFAQRWRRATKWREFSFLKKTMARWHDDAMLKIERI  476

Query  1288  SWITSPTPSV-------PNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAET  1130
             SWI SP  +V       P DDP L+VS E  P+NWHVQ+FRSIDSGS++GFP+     E 
Sbjct  477   SWILSPAFAVFKERTEIPEDDPELYVSKEDHPENWHVQIFRSIDSGSVQGFPRSTDVTEE  536

Query  1129  QNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMEL  950
             QNL+ +KDLV+D+SI+ AYI+AIR AQHFIYIENQYFLGSSYAWPSYK+AGAD+L+PMEL
Sbjct  537   QNLISSKDLVVDKSIEAAYIQAIRSAQHFIYIENQYFLGSSYAWPSYKDAGADHLVPMEL  596

Query  949   ALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKI  770
             ALKI SKIR++ERF VY+V+PMWPEG P S  +Q+ILYWQ QT+QMMY++IA+ELKS ++
Sbjct  597   ALKIASKIRSKERFCVYVVMPMWPEGDPKSTTMQEILYWQSQTMQMMYQVIARELKSMQL  656

Query  769   EDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEY  590
              D+HP DYLNFYCLGNRE      A++ +   ++ ++ S K  RFMIYVHAKGM+VDDEY
Sbjct  657   LDSHPLDYLNFYCLGNRE------ANAQSSSDADKVSDSFKFQRFMIYVHAKGMIVDDEY  710

Query  589   VIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDE  410
             VI+GSANINQRS+AGS+DTEIAMGAYQP H+W K + HP  Q+YGYRMSLWAEHLG + +
Sbjct  711   VIMGSANINQRSLAGSKDTEIAMGAYQPRHSWGKKKEHPRGQIYGYRMSLWAEHLGTLAD  770

Query  409   KLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFP  230
                E E LECV+ VN +AE+NWKRYTA+ F+ L GHLLKYP+QVD +GKV  L   E FP
Sbjct  771   CFQEPEALECVRRVNAVAEDNWKRYTADNFTELNGHLLKYPVQVDGDGKVGSLPEYECFP  830

Query  229   DVGGKVLGSRT-TLPDALTT  173
             D+GGK++G+ + T+PD LTT
Sbjct  831   DLGGKIVGNPSPTIPDVLTT  850



>ref|XP_010244834.1| PREDICTED: phospholipase D delta-like isoform X3 [Nelumbo nucifera]
Length=855

 Score =  1119 bits (2895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 534/842 (63%), Positives = 671/842 (80%), Gaps = 11/842 (1%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAF-DCRKPETRQGNKVRRHTRIIT  2504
             S+N ++LHG+L++ I EAR LPNMD+VSER+R+ FT F  C +P T++ ++ +   +IIT
Sbjct  19    SDNFIFLHGNLEIWIFEARSLPNMDLVSERMRKCFTMFGSCARP-TKKKDRDKSGRKIIT  77

Query  2503  SDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGV  2324
             SDPYV VC+AGATVA+TR+I+N +DP W EHF++PVAHP+++VEFQVKDND+ GA  IGV
Sbjct  78    SDPYVSVCMAGATVAQTRIIANCEDPSWDEHFRVPVAHPITKVEFQVKDNDILGAQLIGV  137

Query  2323  AKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED---Y  2153
              ++  +KI+ G+ IN WFPI+G +G P KP   + L ++F P  E+P Y+ G+       
Sbjct  138   VEIPIEKILPGDKINGWFPIVGPYGNPLKPYPELHLSLQFRPVEEDPLYKNGIGAGPNYI  197

Query  2152  GLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVY  1973
             G+  +YFP+R GG VTLYQDAHVP G+LP+I +D G+ F    CWEDICHAILEAHH++Y
Sbjct  198   GVPNTYFPLRKGGVVTLYQDAHVPHGALPDIILDGGRVFQQGQCWEDICHAILEAHHLIY  257

Query  1972  IVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINT  1793
             I+GWSIYH VKLVREPT+PLP GG+L LGELLKYKSQ+GVRV++LVWDDKTSH  F + T
Sbjct  258   IIGWSIYHPVKLVREPTKPLPEGGDLTLGELLKYKSQQGVRVMMLVWDDKTSHHNFLLKT  317

Query  1792  SGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQG  1613
              GVM THDEETR+FFKHS+V CVL+PRYAS+KLS  KQQVVGTL+THHQKCV+VDTQA G
Sbjct  318   EGVMHTHDEETRRFFKHSTVHCVLSPRYASNKLSIFKQQVVGTLFTHHQKCVLVDTQASG  377

Query  1612  NNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHC  1433
             N RK+TAFIGGLDLCDGRYDTP+HRLF D DTVF  D++NPTFP    +GPRQPWHDLHC
Sbjct  378   NYRKVTAFIGGLDLCDGRYDTPEHRLFIDLDTVFANDFHNPTFPSRA-RGPRQPWHDLHC  436

Query  1432  KIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPN  1253
             K+EGPAAYDI+TNFEQRWRK +KW +   + + +++WH+DAL+K++RISWI +PT    +
Sbjct  437   KVEGPAAYDIMTNFEQRWRKVAKWRDF--KIRNVTNWHEDALIKLDRISWILTPTVGA-D  493

Query  1252  DDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAY  1073
              D S+  + E DP+NWHVQVFRSIDSGS++GFPK V  AE QNL+C K+L ID+SI +AY
Sbjct  494   GDHSIHAATEDDPENWHVQVFRSIDSGSVRGFPKLVQEAEAQNLICGKNLKIDKSIHVAY  553

Query  1072  IEAIRRAQHFIYIENQYFLGSSYAWPSYKE-AGADNLIPMELALKIVSKIRNRERFAVYI  896
             ++AIR AQHFIYIENQYF+GSS+ WPSYK+ AGADNL+P+ELALKI SKI   ERF+VY+
Sbjct  554   VKAIRSAQHFIYIENQYFIGSSFYWPSYKDAAGADNLVPIELALKIASKISANERFSVYV  613

Query  895   VIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIED-AHPCDYLNFYCLGNR  719
             VIPMWPEGVP+SA VQ+IL+WQGQTI MMY I+ + L +  + +  HP D+LNFYCLG R
Sbjct  614   VIPMWPEGVPTSASVQEILFWQGQTIDMMYRIVGQALDNAGLSNKCHPQDFLNFYCLGKR  673

Query  718   EEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSR  539
             E    + +S   P  +     +QK  RFMIYVHAKGM+VDDEYVI+GSANINQRS+ GSR
Sbjct  674   EPGSPDRSSQTNPSENNAQGLAQKFHRFMIYVHAKGMIVDDEYVIMGSANINQRSLDGSR  733

Query  538   DTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEI  359
             DTEIAMGAYQP++TWA  + HP  QVYGYRMSLWAEHLGM+++   E + +EC++ VN +
Sbjct  734   DTEIAMGAYQPNYTWAMKKCHPRGQVYGYRMSLWAEHLGMLEDCFYEPQSIECIRRVNTL  793

Query  358   AEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDAL  179
             AE NW+ Y +E+F  ++GHL+ YP+ V  +GK+ PL G E FPDVGGKVLG+ TTLPDAL
Sbjct  794   AESNWQSYVSEEFMDMKGHLMPYPIHVGWDGKIGPLPGFECFPDVGGKVLGAPTTLPDAL  853

Query  178   TT  173
             TT
Sbjct  854   TT  855



>gb|KDP38812.1| hypothetical protein JCGZ_04969 [Jatropha curcas]
Length=855

 Score =  1119 bits (2895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/837 (65%), Positives = 669/837 (80%), Gaps = 11/837 (1%)
 Frame = -2

Query  2665  YLHGDLDLKILEARRLPNMDIVSERIRQFFTAF-DCRKPETRQGNKVRRHTRIITSDPYV  2489
             +LHG+LDL I+EA+ LPNMD+ +E IR+ FT F  C  P  ++G K      +ITSDPYV
Sbjct  24    FLHGELDLWIIEAKSLPNMDLPAEHIRRCFTVFGSCSDPCGQKGVKHSGKNSMITSDPYV  83

Query  2488  KVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVAKVSA  2309
              VCLAGATVA+TRVI+N ++P+W EHF +PVAHPV +VEF VKDNDV GA+ IGV ++S 
Sbjct  84    SVCLAGATVAQTRVIANCENPLWDEHFCVPVAHPVVKVEFHVKDNDVLGAELIGVVEISV  143

Query  2308  QKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT--EDY-GLKES  2138
              K+ISG+ INDWFP+IG +G   KPD  + + +++ P  +NP Y+ GV    DY G+  +
Sbjct  144   DKVISGDLINDWFPVIGHYGNCMKPDPELHISIQYKPVCKNPLYKDGVGVGPDYAGVPST  203

Query  2137  YFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYIVGWS  1958
             YFP+R GG VTLYQDAHVP G LPEI +D GK F H  CWEDICHAILEA+H++YI+GWS
Sbjct  204   YFPLRKGGNVTLYQDAHVPAGMLPEILLDGGKVFKHNRCWEDICHAILEANHLIYIIGWS  263

Query  1957  IYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTSGVMG  1778
             IYH VKLVREPT+PLP GG LNLGELLKYKSQEGVRV+LL+WDD+TSH+KF++ T GVM 
Sbjct  264   IYHPVKLVREPTKPLPCGGELNLGELLKYKSQEGVRVVLLIWDDRTSHNKFYLKTEGVMQ  323

Query  1777  THDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQGNNRKI  1598
             THDEET+K+FK++SV CVLAPRYAS+KLS  KQQVVGTL+THHQKC+++DT A GN RKI
Sbjct  324   THDEETKKYFKNTSVHCVLAPRYASTKLSIFKQQVVGTLFTHHQKCLVLDTDASGNKRKI  383

Query  1597  TAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCKIEGP  1418
             TAFIGGLDLCDGRYDTP+HRLFSD DTVF  DY+NPTFP+   K PRQPWHDLHCKIEGP
Sbjct  384   TAFIGGLDLCDGRYDTPEHRLFSDLDTVFENDYHNPTFPDNA-KSPRQPWHDLHCKIEGP  442

Query  1417  AAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPNDDPSL  1238
             AAYD+LTNFEQRW K SKW +   R +K++ W +D L+K++RISWI +P+P  P+ D ++
Sbjct  443   AAYDVLTNFEQRWGK-SKWRDF--RLRKVTQWREDILIKLDRISWIPTPSPG-PDGDKNV  498

Query  1237  WVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAIR  1058
              V++E DP+NWHVQ+FRSIDSGS+KGFPK    A  +NL+C K+L +D+SI  AYIEAIR
Sbjct  499   RVTDEEDPENWHVQIFRSIDSGSVKGFPKATEEAVAKNLICGKNLKVDKSIHTAYIEAIR  558

Query  1057  RAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPMWP  878
              AQHFIYIENQYF+GSSY WPSYK AGADNL+PMELALKI SKI   ERF+VY+V+PM+P
Sbjct  559   SAQHFIYIENQYFVGSSYHWPSYKNAGADNLVPMELALKIASKISAHERFSVYVVLPMFP  618

Query  877   EGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDA-HPCDYLNFYCLGNREEWHEE  701
             EGVP+SA VQ+IL+WQGQT+ MMY+IIAK LK   + D  HP DYLNF+CLG RE     
Sbjct  619   EGVPTSASVQEILFWQGQTMTMMYKIIAKALKDAGLSDQYHPQDYLNFFCLGKREASSAY  678

Query  700   SASSPTPGC-SEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIA  524
             ++S       +  L  +QK GRFMIYVH+KGM+VDD YVI+GSANINQRS+ GSRDTEIA
Sbjct  679   NSSQLNQTTDNRSLAAAQKYGRFMIYVHSKGMIVDDAYVIIGSANINQRSLDGSRDTEIA  738

Query  523   MGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENW  344
             MGAYQP +TWA  ++HP  QVYGYR+SLWAEHLG+++E     + +EC+K+VN+IA+ NW
Sbjct  739   MGAYQPTYTWAAKKSHPRGQVYGYRLSLWAEHLGILEEDFRNPQSVECMKLVNKIAKRNW  798

Query  343   KRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALTT  173
               Y AE+   ++GHL++YP+QV+ +GKVS L G + FPDVGGKVLGS TTLPDALTT
Sbjct  799   NTYVAEENKEMRGHLMQYPVQVNRDGKVSSLRGHQTFPDVGGKVLGSPTTLPDALTT  855



>ref|XP_009410696.1| PREDICTED: phospholipase D delta-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009410698.1| PREDICTED: phospholipase D delta-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009410699.1| PREDICTED: phospholipase D delta-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009410700.1| PREDICTED: phospholipase D delta-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009410701.1| PREDICTED: phospholipase D delta-like [Musa acuminata subsp. 
malaccensis]
Length=840

 Score =  1118 bits (2891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 539/840 (64%), Positives = 668/840 (80%), Gaps = 21/840 (3%)
 Frame = -2

Query  2665  YLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-----CRKPETRQGNKVRRHTRIITS  2501
             +LHGDLD+ ILEAR LPNMD+++ER+R+ FT +      C KP+  +G      ++IITS
Sbjct  13    FLHGDLDIWILEARSLPNMDLMTERMRKCFTVYGACGVPCGKPDNHRGV-----SKIITS  67

Query  2500  DPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVA  2321
             DPYV VC++GAT+A+TRVI NS++P W EHF++PVAHP S++EFQVKDNDVFGA  IGVA
Sbjct  68    DPYVSVCVSGATIAQTRVIPNSENPKWEEHFRVPVAHPASKIEFQVKDNDVFGAQLIGVA  127

Query  2320  KVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTE--DY-G  2150
              +   KI+SGET++ WFP++   G   KP   +   ++F    +NP Y+ GV    +Y G
Sbjct  128   VIPVDKILSGETVSGWFPVVDPSGNSTKPYPELHFSLQFRNIEQNPLYKDGVGAGPNYSG  187

Query  2149  LKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYI  1970
             +  +YFP+ + G+VTLYQDAHVP+  LP I +D+GK +    CWEDICHAI+EAHH++YI
Sbjct  188   VPNAYFPLHNQGSVTLYQDAHVPDNMLPNIALDEGKTYEQNKCWEDICHAIVEAHHLIYI  247

Query  1969  VGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTS  1790
             +GWS+YH+VKL+REPT+P+PNGG L+LGELLKYK+QEGVRV++L+WDDKTSH KF + T 
Sbjct  248   IGWSVYHRVKLIREPTKPVPNGGELSLGELLKYKTQEGVRVVMLIWDDKTSHDKFLLKTD  307

Query  1789  GVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQGN  1610
             GVM THDEETRKFFKHSSV CVLAPRYAS+KLS  KQQVVGTL+THHQKCVIVDTQA GN
Sbjct  308   GVMHTHDEETRKFFKHSSVHCVLAPRYASNKLSIFKQQVVGTLFTHHQKCVIVDTQAGGN  367

Query  1609  NRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCK  1430
             NRKI+AFIGGLDLCDGRYDTP+HRLF D DTVF  D++NPTFP G  +GPRQPWHDLHCK
Sbjct  368   NRKISAFIGGLDLCDGRYDTPEHRLFRDLDTVFGKDFHNPTFP-GTNQGPRQPWHDLHCK  426

Query  1429  IEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPND  1250
             IEGPAA+DILTNFEQRWRKA+KW +   + +K++HWHDDAL+KIERISWI SP+    + 
Sbjct  427   IEGPAAHDILTNFEQRWRKATKWRDF--KLRKVTHWHDDALIKIERISWILSPSAYKSDT  484

Query  1249  DPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYI  1070
             +     S+E D +NWHVQ+FRSIDSGS+KGFPK VH AE +NLVCAK+L ID+SI  AY+
Sbjct  485   E----TSDEKDLENWHVQIFRSIDSGSVKGFPKHVHEAEGKNLVCAKNLKIDKSIHSAYV  540

Query  1069  EAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVI  890
             +AIR AQHFIYIENQYF+GSSY WPSYK AGADNLIPMELALKIVSKI+ +ERFAVY+V+
Sbjct  541   KAIRSAQHFIYIENQYFVGSSYHWPSYKNAGADNLIPMELALKIVSKIKAKERFAVYVVV  600

Query  889   PMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKI-EDAHPCDYLNFYCLGNREE  713
             P+WPEG+P+SA VQ+IL+WQGQT+ MMY+++   LK E + E  HP DYLNFYCLG  E 
Sbjct  601   PLWPEGIPTSAAVQEILFWQGQTMSMMYKVVGDALKEEGLSESHHPQDYLNFYCLGKCEP  660

Query  712   WHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDT  533
               +E         +     SQK  RFMIYVH+KGM+VDDEYV++GSANINQRSM GSRDT
Sbjct  661   VLKEKLPPNQSPENSTQRLSQKFRRFMIYVHSKGMIVDDEYVVIGSANINQRSMEGSRDT  720

Query  532   EIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAE  353
             EIAMGAYQPH+ WA+   HP  QVYGYRMSLWAEHLGM+D+   E + +ECV+ VN++AE
Sbjct  721   EIAMGAYQPHYRWAEKHTHPRGQVYGYRMSLWAEHLGMLDDLFREPQTMECVRHVNKVAE  780

Query  352   ENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALTT  173
              NW+ Y + +   + GHL++YP++V+ +G+V PL G E FPDVGGK+LG+ +TLPD LTT
Sbjct  781   FNWQSYASPEIKEMNGHLMRYPVKVERDGRVGPLPGHENFPDVGGKILGAHSTLPDVLTT  840



>gb|KHG15292.1| Phospholipase D delta -like protein [Gossypium arboreum]
Length=821

 Score =  1117 bits (2889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 554/852 (65%), Positives = 656/852 (77%), Gaps = 51/852 (6%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPE----TRQGNKVRRHTR  2513
             S+  +YLHGDLDL I+EARRLPNMD +   +R   T   C+ P       + +K+R H +
Sbjct  5     SKQQIYLHGDLDLTIVEARRLPNMDFMVNHLRSCLTCEPCKSPAQTAAKEEDSKIRGHRK  64

Query  2512  IITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADF  2333
             IITSDPYV VCL  ATVARTRV+ NSQ+P W EHF IP+AHPV+E++  VKDND+FGAD 
Sbjct  65    IITSDPYVTVCLPQATVARTRVLKNSQNPKWNEHFIIPLAHPVTELDINVKDNDLFGADA  124

Query  2332  IGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED-  2156
             IG AK+ A  I +GE I  WFP+IG  GKPPK D AI L MKFTPC  NP Y+ GV  D 
Sbjct  125   IGTAKIPASSIATGEHITGWFPLIGPSGKPPKSDSAIYLDMKFTPCENNPLYKQGVASDP  184

Query  2155  --YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHH  1982
                G++ +YFP+R G  VTLYQDAHV +  LP+I++DDGK +    CWEDIC+AI EAHH
Sbjct  185   EQAGVRHTYFPLRKGSQVTLYQDAHVTDDLLPKIELDDGKVYSPAKCWEDICYAISEAHH  244

Query  1981  MVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFF  1802
             +VYIVGWS++HK+KLVREPTRPLP GG+L LGELLKYKS+EGVRVLLLVWDDKTSH KF 
Sbjct  245   LVYIVGWSVFHKIKLVREPTRPLPRGGDLTLGELLKYKSEEGVRVLLLVWDDKTSHDKFG  304

Query  1801  INTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQ  1622
             I T+GVM THDEET KFFKHSSVTCVLAPRYAS+                          
Sbjct  305   IRTAGVMQTHDEETLKFFKHSSVTCVLAPRYAST--------------------------  338

Query  1621  AQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHD  1442
               GNNRKITAF+GG+DLCDGRYDTP+HR+  D DTVF+ D++NPTFP G +  PRQPWHD
Sbjct  339   --GNNRKITAFVGGIDLCDGRYDTPEHRILRDLDTVFKDDFHNPTFPVGTM-APRQPWHD  395

Query  1441  LHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSP---  1271
             LH KIEGPAAYD+L NFEQRWRK++KW E    FK  SHW DDA+++IERISWI SP   
Sbjct  396   LHSKIEGPAAYDVLINFEQRWRKSTKWKEFSLLFKGKSHWSDDAMIRIERISWIQSPPLA  455

Query  1270  -----TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKD  1106
                  T  VP+DDP + V ++ D +NW+VQ+FRSIDSGSLKGFPK +  AE QNL CAK+
Sbjct  456   VTDDGTTIVPDDDPKVHVLSKDDRENWNVQIFRSIDSGSLKGFPKYIKKAENQNLFCAKN  515

Query  1105  LVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKI  926
             LVID+SIQ AYI+AIR AQH+IYIENQYFLGSSYAWPSYK AGADNLIPMELALK+ SKI
Sbjct  516   LVIDKSIQAAYIQAIRSAQHYIYIENQYFLGSSYAWPSYKNAGADNLIPMELALKVASKI  575

Query  925   RNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDY  746
             R RERF VYI+IP+WPEG P +A VQ+ILYWQ QT+QMMY+++A+ELKS +I+D+HP DY
Sbjct  576   RARERFVVYIIIPLWPEGDPKTATVQEILYWQSQTMQMMYDVVAQELKSMQIKDSHPRDY  635

Query  745   LNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANI  566
             LNFYCLG REE  +E  S      +  ++ S K GRFMIYVHAKGM+VDDEYVIVGSANI
Sbjct  636   LNFYCLGKREEVSQEMLSG-----NNSVSDSAKFGRFMIYVHAKGMIVDDEYVIVGSANI  690

Query  565   NQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGL  386
             NQRSMAG++DTEIAMGAYQPH+TWAK + +P  QV+GYRMSLWAEHLG +++   E E +
Sbjct  691   NQRSMAGTKDTEIAMGAYQPHYTWAK-KKYPRGQVHGYRMSLWAEHLGELNKLFKEPESV  749

Query  385   ECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLG  206
             ECVKMVN IAEENWK++T  ++SPLQGHLL YPLQVD +GKV+PL   E FPDVGGKV+G
Sbjct  750   ECVKMVNSIAEENWKKFTDAEYSPLQGHLLMYPLQVDMDGKVNPLPEHENFPDVGGKVIG  809

Query  205   SRTT-LPDALTT  173
             + +  LPD LTT
Sbjct  810   AHSIQLPDVLTT  821



>ref|XP_010911813.1| PREDICTED: phospholipase D delta-like isoform X1 [Elaeis guineensis]
Length=922

 Score =  1116 bits (2887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 549/851 (65%), Positives = 667/851 (78%), Gaps = 31/851 (4%)
 Frame = -2

Query  2701  VKMSDGMS-------ENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAF-DCRKP--  2552
             V+ SD M        + V++LHGDLD+ ILEAR LPNMD+ S+R+ + FT +  C  P  
Sbjct  6     VRHSDSMGKRSPTDVDGVMFLHGDLDIWILEARSLPNMDVFSDRMIKCFTVYGTCTTPCG  65

Query  2551  ------ETRQGNKVRRHT---RIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIP  2399
                   +  +     RH    +IITSDPYV VC+AGAT+A+TRVI NS+DP W EHF +P
Sbjct  66    KADKHKDKLKDKHKDRHKSMHKIITSDPYVSVCVAGATIAQTRVIPNSEDPKWDEHFCVP  125

Query  2398  VAHPVSEVEFQVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIR  2219
             VAHPVS++EFQVKDNDVFGA  IGVA +   KI+ G T++ WFP++G +G P KP   + 
Sbjct  126   VAHPVSKIEFQVKDNDVFGAQLIGVAAIPVDKILPGVTVSGWFPVVGPYGNPMKPYPELH  185

Query  2218  LMMKFTPCAENPRYRGGVT---EDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDD  2048
             L ++F P  +NP Y+ GV    E  G+  +YFP+R GG +TLYQDAHVP+  LP I +D 
Sbjct  186   LSLQFRPMEDNPLYKDGVGAGPEYLGVPNAYFPLRTGGNITLYQDAHVPDNMLPTIPLDG  245

Query  2047  GKAFHHENCWEDICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYK  1868
             GK + H  CWEDICHAILEAHH++YIVGWSIYH VKLVREPTRPLPNGG L+LGELLKYK
Sbjct  246   GKTYEHNKCWEDICHAILEAHHLIYIVGWSIYHSVKLVREPTRPLPNGGELSLGELLKYK  305

Query  1867  SQEGVRVLLLVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSF  1688
             +QEGVRV++L+WDDKTSH KF++ T GVM THDEETRKFFKHSSV CVLAPRYAS+KLS 
Sbjct  306   TQEGVRVVMLIWDDKTSHDKFYLKTDGVMHTHDEETRKFFKHSSVHCVLAPRYASNKLSI  365

Query  1687  VKQQVVGTLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFR  1508
              KQQVVGTL+THHQKCVIVDTQA GNNRKITAFIGGLDLCDGRYDTP+HRLF + D+VF 
Sbjct  366   FKQQVVGTLFTHHQKCVIVDTQALGNNRKITAFIGGLDLCDGRYDTPEHRLFQNLDSVFV  425

Query  1507  GDYNNPTFPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKIS  1328
              D++NPTFP     GPRQPWHDLHCKIEGPAA+DILTNFEQRWRKA+KW +   RF K++
Sbjct  426   KDFHNPTFPVNSY-GPRQPWHDLHCKIEGPAAHDILTNFEQRWRKATKWRDF--RFSKVT  482

Query  1327  HWHDDALLKIERISWITSPTPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKD  1148
             HWHDDAL+KI+RISWI +P     N +    VS+E +P+NWHVQ+FRSIDSGS++GFPK 
Sbjct  483   HWHDDALIKIDRISWIITPFSDKSNTN----VSDEQNPENWHVQIFRSIDSGSVRGFPKL  538

Query  1147  VHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKE-AGAD  971
             V  AE++NLVCAK+L ID+SI  AY++AIR AQHFIY+ENQYF+GSSY WPSYK  AGAD
Sbjct  539   VQEAESKNLVCAKNLKIDKSIHSAYVKAIRSAQHFIYVENQYFIGSSYCWPSYKNAAGAD  598

Query  970   NLIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAK  791
             NLIPMELALKIVSKI+ RERF+VYIVIPMWPEG+P++A +Q+IL+WQGQT+ MMY+ + +
Sbjct  599   NLIPMELALKIVSKIKARERFSVYIVIPMWPEGIPTAAAMQEILFWQGQTMAMMYKFVGE  658

Query  790   ELKSEKI-EDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAK  614
              L+ E + E  HP DYLNFYCLG RE   E  +S    G +  L  +QKS RFMIYVH+K
Sbjct  659   ALQEENLSEKYHPQDYLNFYCLGKREAPKENPSSPKVSGDNSALRSAQKSRRFMIYVHSK  718

Query  613   GMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWA  434
             GM+VDDEYVI+GSANINQRS+ GSRDTEIAMGAYQPH+ WA   NHPH QVYGYRMSLWA
Sbjct  719   GMIVDDEYVIIGSANINQRSLEGSRDTEIAMGAYQPHYKWAGKCNHPHGQVYGYRMSLWA  778

Query  433   EHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSP  254
             EHLGM+++   E + LEC++ VN +AE+NWK Y A +   ++GHL++YP++V+ +GK+ P
Sbjct  779   EHLGMVEDCFREPQSLECIRHVNRLAEDNWKSYVAPEIQEMKGHLMRYPIKVERDGKIGP  838

Query  253   LGGCEYFPDVG  221
             L G E FPDVG
Sbjct  839   LPGHECFPDVG  849



>emb|CDY47037.1| BnaAnng08250D [Brassica napus]
Length=885

 Score =  1116 bits (2886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 563/893 (63%), Positives = 664/893 (74%), Gaps = 60/893 (7%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPET---------R  2543
             M++  S++V+ LHGDLDL I++AR+LPNMD  S  +R   T   C  P T         R
Sbjct  1     MAEKPSDDVMLLHGDLDLTIVQARKLPNMDTFSNHLRLCLTV--CTNPSTADEEEDRRAR  58

Query  2542  QG---------NKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAH  2390
              G         +  R H ++ITSDPYV V +  AT+ARTRV+ NSQDP W EHF I +AH
Sbjct  59    DGLPPPPQPQPSNARSHRKVITSDPYVTVVVPQATLARTRVLKNSQDPKWDEHFTISIAH  118

Query  2389  PVSEVEFQVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMM  2210
             P+S +EFQVKD+DVFGA  IG AK+  + I SG  +  WFPI+GA GKPPK + A+ + M
Sbjct  119   PMSHLEFQVKDDDVFGAQIIGTAKIPVKDIASGSPVKGWFPILGASGKPPKKETALYIEM  178

Query  2209  KFTPCAENPRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKA  2039
              FTP  +   YR G+  D    G+K +YFP+R G  V LYQDAHV +G LPEI +D GK 
Sbjct  179   TFTPFDQIHTYRSGIAGDPDRKGVKGTYFPVRKGSQVRLYQDAHVMDGMLPEIGLDGGKV  238

Query  2038  FHHENCWEDICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQE  1859
             + H  CWEDIC+A+ EAHHM+Y+VGWS++HKVKLVREPTR LP GG+L LGELLKYKS+E
Sbjct  239   YQHGKCWEDICYAVSEAHHMIYVVGWSVFHKVKLVREPTRKLPRGGDLTLGELLKYKSEE  298

Query  1858  GVRVLLLVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQ  1679
             GVRVLLLVWDDKTSH KF I T GVMGTHDEETRKFFKHSSV CVL+PRYASSKL   KQ
Sbjct  299   GVRVLLLVWDDKTSHDKFGIRTPGVMGTHDEETRKFFKHSSVICVLSPRYASSKLGLFKQ  358

Query  1678  Q---------------------VVGTLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDG  1562
             Q                     VVGTL+THHQKCV+VDTQA GNNRK+TAF+GG+DLCDG
Sbjct  359   QASLPNSSLFILFLNDQCSREIVVGTLFTHHQKCVLVDTQAAGNNRKVTAFLGGIDLCDG  418

Query  1561  RYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQR  1382
             RYDTP+HR+  D DTVF+ D++NPT+P  G K PRQPWHDLHC++EGPAAYD+L NFEQR
Sbjct  419   RYDTPEHRILHDLDTVFKDDFHNPTYPV-GTKAPRQPWHDLHCRLEGPAAYDVLMNFEQR  477

Query  1381  WRKASKWAELGRRFKKISHWHDDALLKIERISWITSP--------TPSVPNDDPSLWVSN  1226
             WRKA++W E   R K  +HW DDAL++I RISWI SP        T  VP DDP ++VS 
Sbjct  478   WRKATRWKEFSLRLKGKTHWQDDALIRIGRISWILSPVFKYLKDGTNMVPEDDPIVYVSK  537

Query  1225  EGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQH  1046
             E DP+NWHVQVFRSIDSGSLKGFPK    A+ QNL  AK LV+D+SIQ AYI+ IR AQH
Sbjct  538   EDDPENWHVQVFRSIDSGSLKGFPKYEDEAKLQNLESAKRLVVDKSIQTAYIQTIRSAQH  597

Query  1045  FIYIENQYFLGSSYAWPSYKE-AGADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEGV  869
             FIYIENQYFLGSSYAWP+YK+ AGADNLIPMELALKIVSKIR +ERFAVY+VIP+WPEG 
Sbjct  598   FIYIENQYFLGSSYAWPNYKDAAGADNLIPMELALKIVSKIRAKERFAVYVVIPLWPEGD  657

Query  868   PSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREEWHEESASS  689
             P S PVQ+ILYWQ QT+QMMY++IA+ELK+ +  DAHP DYLNFYCLG RE   E+ A  
Sbjct  658   PKSGPVQEILYWQSQTMQMMYDVIARELKAVQ-SDAHPLDYLNFYCLGKREPLPEDMAD-  715

Query  688   PTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQ  509
              T G +E  + S +  RFMIYVHAKGM+VDDEYV++GSANINQRSMAG++DTEIAMGAYQ
Sbjct  716   -TNGSAE--SDSYRFRRFMIYVHAKGMIVDDEYVLIGSANINQRSMAGTKDTEIAMGAYQ  772

Query  508   PHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTA  329
             PHHTW     HP  QVYGYRMSLWAEHLG   ++  E   LECV+ VNEIAE NWK +  
Sbjct  773   PHHTWTNKGKHPRGQVYGYRMSLWAEHLGKTGDEFVEPGDLECVRNVNEIAEGNWKTFID  832

Query  328   EKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRT-TLPDALTT  173
               FS LQGHL+KYPLQVD +GKVS L   + FPDVGGK++G+ +  LPD LTT
Sbjct  833   SNFSELQGHLIKYPLQVDVDGKVSSLPDYDSFPDVGGKIIGAHSMALPDTLTT  885



>gb|ABR17779.1| unknown [Picea sitchensis]
Length=861

 Score =  1113 bits (2878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 549/854 (64%), Positives = 670/854 (78%), Gaps = 13/854 (2%)
 Frame = -2

Query  2710  ISDVKMSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQGN  2534
             + DV ++   S+  V LHG L++ I EA+ LPNMD+ SE++RQ FT F  C     R+  
Sbjct  13    MDDVPLNTSPSQKAVLLHGSLEVWIYEAKALPNMDMTSEKLRQCFTLFQTCSVKIQRRQR  72

Query  2533  KVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDN  2354
                RH +IITSDPYV + + G TVA+TR+I+NSQDP W EHF + +AH  S VEF VKDN
Sbjct  73    DHHRHHKIITSDPYVSIQVGGTTVAQTRIINNSQDPDWNEHFHVDLAHYASNVEFTVKDN  132

Query  2353  DVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENP-RY  2177
             DVFGA+ IG   +  QK+ +G+ I DWFP++ ++GKPPKPD A+RL ++F P    P R 
Sbjct  133   DVFGAELIGTVVIPVQKVSNGDKIEDWFPVLNSYGKPPKPDSALRLSIQFRPAETEPLRK  192

Query  2176  RGGVTEDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAI  1997
              GG     G+ ++YFP+R GG V++YQDAHV +G LPEI++D GK F H  CWE+ICHAI
Sbjct  193   DGG-----GVPDTYFPLRKGGMVSVYQDAHVVDGLLPEIRLDGGKVFEHGKCWEEICHAI  247

Query  1996  LEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTS  1817
             LEAHH+VYI GWSIYHKVKLVREPTRPLP GG+LNLGELLK+KSQEGVRVLLLVWDDKTS
Sbjct  248   LEAHHLVYITGWSIYHKVKLVREPTRPLPLGGDLNLGELLKFKSQEGVRVLLLVWDDKTS  307

Query  1816  HSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCV  1637
             H    + T GVM THDEET+KFFKHSSV CVLAPRYAS+KLS+ KQQVVGTLYTHHQK V
Sbjct  308   HHNMLLKTEGVMQTHDEETKKFFKHSSVQCVLAPRYASTKLSWFKQQVVGTLYTHHQKNV  367

Query  1636  IVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGG-LKGP  1460
             IVD+QAQGN RK+TAFIGGLDLCDGRYDTP+HRLF   +TV+  DY+NPTF       GP
Sbjct  368   IVDSQAQGNYRKLTAFIGGLDLCDGRYDTPEHRLFKGLETVYEEDYHNPTFTTNADAHGP  427

Query  1459  RQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISH-WHDDALLKIERISW  1283
             RQPWHDLH KIEGPAAYDILTNFEQRWRKA+K     +RF+K+++ + DD+L++I RISW
Sbjct  428   RQPWHDLHSKIEGPAAYDILTNFEQRWRKATKLHRFAKRFRKVANRYTDDSLIQIARISW  487

Query  1282  ITSP--TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAK  1109
             I SP  T ++P+ DP LWVS E DP NWHVQVFRSIDSGS+KGFPK V  A+ QNLVC K
Sbjct  488   ILSPSTTQNLPDGDPKLWVSKEDDPDNWHVQVFRSIDSGSVKGFPKSVQDAQNQNLVCRK  547

Query  1108  DLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSK  929
             +L++D+SI  AY++AIR AQHFIYIENQYF+GSSY WPSYK AGA NLIPME+ALK+  K
Sbjct  548   NLLVDKSIHTAYVKAIRSAQHFIYIENQYFVGSSYNWPSYKNAGAHNLIPMEIALKVADK  607

Query  928   IRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDA-HPC  752
             IR  ERFAVY+VIPMWPEG P+ A VQ+IL+WQ QT++MMY IIA+ LK   + D+ HP 
Sbjct  608   IRKGERFAVYVVIPMWPEGNPTGASVQEILFWQSQTMEMMYGIIAEALKDAGLADSQHPQ  667

Query  751   DYLNFYCLGNRE-EWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGS  575
             DYLNFYCLGNRE +   E   + +P  +     +QK  RFMIYVHAKGM+VDDEYVI+GS
Sbjct  668   DYLNFYCLGNREPKDGREPPPTNSPAENSPQGQAQKFRRFMIYVHAKGMIVDDEYVIMGS  727

Query  574   ANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEA  395
             ANIN+RS+ GSRDTEIAMG+YQPHHTW + Q HPH QVYGYRMSLWAEHLG++++  +  
Sbjct  728   ANINERSLDGSRDTEIAMGSYQPHHTWDRKQRHPHGQVYGYRMSLWAEHLGLLEDTFNNP  787

Query  394   EGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGK  215
             + L+CV+ VNE+AE+ W+++TAE+   ++GHLLKYPL+V+++GKV PL G E FPDVGGK
Sbjct  788   QSLDCVRRVNELAEKYWQQFTAEEVIKIKGHLLKYPLKVEADGKVVPLPGNESFPDVGGK  847

Query  214   VLGSRTTLPDALTT  173
             +LG+  +LPD LTT
Sbjct  848   ILGAHGSLPDTLTT  861



>ref|XP_002530670.1| phospholipase d beta, putative [Ricinus communis]
 gb|EEF31701.1| phospholipase d beta, putative [Ricinus communis]
Length=856

 Score =  1110 bits (2870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/842 (64%), Positives = 660/842 (78%), Gaps = 22/842 (3%)
 Frame = -2

Query  2662  LHGDLDLKILEARRLPNMDIVSERIRQFFTAF-DCRKPETRQGNKVRRHTRIITSDPYVK  2486
             LHG+LD+ I+EA+ LPNMD+ +E +R+ FT F  C  P  ++  K     ++ITSDPYV 
Sbjct  25    LHGELDVWIIEAKSLPNMDLPAEHMRRCFTVFGSCTNPCGKRHIKHSGRNKMITSDPYVS  84

Query  2485  VCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVAKVSAQ  2306
             VCLAGATVA+TRVI+N ++P+W EHF +PVAHPV +VEF VKDNDV GA+ IGV  ++ +
Sbjct  85    VCLAGATVAQTRVITNCENPLWDEHFCVPVAHPVVKVEFHVKDNDVLGAELIGVVDIAVE  144

Query  2305  KIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTE--DY-GLKESY  2135
             KIISG  +NDWFPIIG  G   KP   + + ++F    EN  Y+ GV    DY G+  ++
Sbjct  145   KIISGNIVNDWFPIIGHFGNCLKPYPELHISIQFKSVGENSLYKDGVGAGPDYAGVPNTH  204

Query  2134  FPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYIVGWSI  1955
             FP+R GG +T YQDAHVP+  LPEI +D G  F H  CWED+CHAILEAHH++YI+GWSI
Sbjct  205   FPLRKGGNLTFYQDAHVPDAMLPEILLDGGNVFQHSRCWEDMCHAILEAHHLIYIIGWSI  264

Query  1954  YHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTSGVMGT  1775
             +H VKLVREPT+PLP+GG L LGELLKYKSQEGVRV++L+WDDKTSH KF++ T GVM T
Sbjct  265   FHPVKLVREPTKPLPSGGELTLGELLKYKSQEGVRVVMLIWDDKTSHDKFYLKTEGVMQT  324

Query  1774  HDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQGNNRKIT  1595
             HDE+TRKFFKHSSV CVLAPRYAS+KLS  KQQVVGTL+THHQKCV++DTQA GNNRKIT
Sbjct  325   HDEKTRKFFKHSSVHCVLAPRYASNKLSIFKQQVVGTLFTHHQKCVLLDTQASGNNRKIT  384

Query  1594  AFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCKIEGPA  1415
             AFIGGLDLCDGRYDTP+HRLF+D DTVF+ D++NP+F     K PRQPWHDLHCKIEGPA
Sbjct  385   AFIGGLDLCDGRYDTPEHRLFTDLDTVFKNDFHNPSFSSNA-KSPRQPWHDLHCKIEGPA  443

Query  1414  AYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPNDDPSLW  1235
             AYD+LTNFEQRWRKA+KW +   R KK++HW+DD+L++++RISWI +P+P V N D  + 
Sbjct  444   AYDVLTNFEQRWRKATKWRDF--RLKKVTHWNDDSLIRLDRISWILTPSPGV-NGDQVVR  500

Query  1234  VSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRR  1055
             V++E DP+NWHVQ+FRSIDSGS+KGFPK +  A  QNLVC K+L +D+SI  AYI+AIR 
Sbjct  501   VTDEKDPENWHVQIFRSIDSGSVKGFPKVIEEAVAQNLVCGKNLKVDKSIHTAYIKAIRS  560

Query  1054  AQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPMWPE  875
             AQHFIYIENQYFLGSSY WPSYK AGADNLIPME+ALKI SKI   E F+VYIVIPMWPE
Sbjct  561   AQHFIYIENQYFLGSSYYWPSYKNAGADNLIPMEIALKIASKINANEHFSVYIVIPMWPE  620

Query  874   GVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDA-HPCDYLNFYCLGNREEWHEES  698
             GVP+S+ VQ+IL+WQGQT+ MMY+II K L+   + D  HP DYLNFYCLG RE      
Sbjct  621   GVPTSSSVQEILFWQGQTMAMMYKIIGKALEEAGLSDMYHPQDYLNFYCLGKRE------  674

Query  697   ASSPTPGC-------SEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSR  539
             AS P           +  L  +QK+ RFMIYVH+KGM+VDDEYVI+GSANINQRS+ GSR
Sbjct  675   ASCPLNPSHMNQQTENRSLAAAQKNRRFMIYVHSKGMIVDDEYVIIGSANINQRSLDGSR  734

Query  538   DTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEI  359
             DTEIAMG+YQP +TW +  +HP  QVYGYRMSLWAEHLG+++ +  E E L C+K VN+ 
Sbjct  735   DTEIAMGSYQPTYTWKEKNSHPRGQVYGYRMSLWAEHLGVLEGEFREPESLTCMKRVNKT  794

Query  358   AEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDAL  179
             A  NWK Y AE+   ++GHL++YP+ V  +GKVS L G E FPDVGGKVLG+ TTLPDAL
Sbjct  795   ARRNWKAYVAEENKEMRGHLMQYPVHVSRDGKVSALPGHETFPDVGGKVLGAPTTLPDAL  854

Query  178   TT  173
             TT
Sbjct  855   TT  856



>ref|XP_007227049.1| hypothetical protein PRUPE_ppa001322mg [Prunus persica]
 gb|EMJ28248.1| hypothetical protein PRUPE_ppa001322mg [Prunus persica]
Length=854

 Score =  1109 bits (2869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 551/855 (64%), Positives = 671/855 (78%), Gaps = 16/855 (2%)
 Frame = -2

Query  2707  SDVKMSD--GMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAF-DCRKP-ETRQ  2540
             SD + S+  G S+  V LHG+LDL I+EA+ LPNMD+ SER+R+ FT F  C  P   R 
Sbjct  6     SDCQESNEAGSSKEYVILHGELDLWIIEAKSLPNMDLTSERMRRCFTMFGTCSAPFGNRP  65

Query  2539  GNKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVK  2360
                      +ITSDPYV VCLAGATVA+TRVISN ++P W EHF +PVAHPV++VEF VK
Sbjct  66    AKTASGKHSMITSDPYVSVCLAGATVAQTRVISNCENPSWEEHFSVPVAHPVAKVEFHVK  125

Query  2359  DNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPR  2180
             DNDV GA+ IGV ++S  KIISG+ +NDWFP+IG HG   KP   + + ++F P  +NP 
Sbjct  126   DNDVLGAELIGVVEISIDKIISGKPMNDWFPVIGNHGNCLKPFPELHVSIQFKPVGDNPL  185

Query  2179  YRGGVT---EDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDI  2009
             Y+ GV    E  G+  +YFP+R GG+VTLYQDAHVP   LP+I +D GK F    CWE+I
Sbjct  186   YKNGVGAGPEYNGVPNTYFPLRKGGSVTLYQDAHVPNDMLPDIVLDGGKKFQQRKCWEEI  245

Query  2008  CHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWD  1829
             CHAILEA H++YI+GWS+YH+VKLVREPT+PLP+GG L LGELLKYKSQEG+RV++L+WD
Sbjct  246   CHAILEAQHLIYIIGWSVYHRVKLVREPTKPLPSGGELTLGELLKYKSQEGIRVVMLIWD  305

Query  1828  DKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHH  1649
             DKTSH KF + T GVM THDEET+KFF+HSSV CVL+PRYAS+KLS  KQQVVGTL+THH
Sbjct  306   DKTSHDKFLLKTEGVMQTHDEETKKFFRHSSVHCVLSPRYASNKLSIFKQQVVGTLFTHH  365

Query  1648  QKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGL  1469
             QKCV++DT A GNNRK+TAFIGGLDLCDGRYDTP+HRLF D +TVF  D +NPTFP    
Sbjct  366   QKCVLLDT-ASGNNRKLTAFIGGLDLCDGRYDTPEHRLFKDLNTVFENDIHNPTFPPNTY  424

Query  1468  KGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERI  1289
              GPR+PWHDLHCKIEGPAAYDILTNFEQRWRKA K      + KK+++ HDDAL++++R+
Sbjct  425   -GPREPWHDLHCKIEGPAAYDILTNFEQRWRKAKK---RDFKIKKVTNRHDDALIRLDRV  480

Query  1288  SWITSPTPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAK  1109
             SWI SP+ S  + D ++ VS+E D +NWHVQVFRSIDSGS+KGFPK V  AE QNL+C K
Sbjct  481   SWIVSPS-SGRDGDQNVRVSSEEDRENWHVQVFRSIDSGSVKGFPKGVQDAEAQNLICGK  539

Query  1108  DLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSK  929
             +L ID+SI +AYI+AIR AQ FIYIENQYF+GSSY WPSYK AGADNL+PMELALKI SK
Sbjct  540   NLKIDKSIHVAYIKAIRSAQRFIYIENQYFVGSSYYWPSYKNAGADNLVPMELALKIASK  599

Query  928   IRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDA-HPC  752
             I+  ERF+VYIVIPMWPEGVP+++ VQ+ILYWQ QT+ MMY++I+K L+   + D  HP 
Sbjct  600   IKANERFSVYIVIPMWPEGVPTASAVQEILYWQAQTMVMMYQVISKALEDAGLFDQYHPQ  659

Query  751   DYLNFYCLGNREEWHEESASSPT-PGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGS  575
             D+LNFYCLG RE     S+S    P  +  L  +QK  RFMIYVHAKGM+VDDEYVI+GS
Sbjct  660   DFLNFYCLGQREAPSSRSSSQTNQPTDNRGLALAQKFRRFMIYVHAKGMIVDDEYVIMGS  719

Query  574   ANINQRSMAGSRDTEIAMGAYQPHHTWAKNQN-HPHAQVYGYRMSLWAEHLGMMDEKLDE  398
             ANINQRSM GSRDTEIAMGAYQPHHTWA  +N HPH QVYGYRMSLWAEHLG ++E   +
Sbjct  720   ANINQRSMDGSRDTEIAMGAYQPHHTWAAEKNLHPHGQVYGYRMSLWAEHLGGLEETYQD  779

Query  397   AEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGG  218
              E LECVK V+EIA++NWK + +E+   ++GHL++YP+Q+  +G+VS L G E FPDVGG
Sbjct  780   PESLECVKRVSEIAKQNWKAFVSEEHKEMKGHLMQYPVQIGRDGQVSSLPGYESFPDVGG  839

Query  217   KVLGSRTTLPDALTT  173
             K+LG+ T LPDALTT
Sbjct  840   KILGAPTNLPDALTT  854



>ref|XP_010943480.1| PREDICTED: phospholipase D delta-like [Elaeis guineensis]
Length=857

 Score =  1108 bits (2867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 546/859 (64%), Positives = 655/859 (76%), Gaps = 25/859 (3%)
 Frame = -2

Query  2689  DGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNK-------  2531
             D   E ++ LHGDLDL I EAR LPNMD+ +ER+R+   A     P  R+ ++       
Sbjct  2     DATPEQLILLHGDLDLHIHEARDLPNMDMFTERLRRCLGACGLSLPTPRRMDREEEFKRR  61

Query  2530  --------VRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEV  2375
                     ++  T++ITSDPYVKV LAG T+ARTRVI NSQ+P W EHFK+ +AH  + +
Sbjct  62    KRMTSPLPLQPKTKVITSDPYVKVLLAGDTLARTRVIPNSQEPHWEEHFKLFLAHRAARI  121

Query  2374  EFQVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPC  2195
             EF+VKDNDVFGA  IG A +SA  I SG  I DWFP+IG  G+PPKP  A+R+ M+FTP 
Sbjct  122   EFEVKDNDVFGAQLIGTASISAASIASGGEIADWFPVIGPAGRPPKPHSALRISMRFTPV  181

Query  2194  AENPRYRGGVT---EDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPE-IKIDDGKAFHHE  2027
              +NP YR G+    E  G+ ++YFP+R GG +TLYQDAH+ EG LP+ I+++    F H 
Sbjct  182   EDNPAYRNGIPGDPEQKGVPDTYFPLRKGGMLTLYQDAHIREGELPDDIELEGRHVFRHH  241

Query  2026  NCWEDICHAILEAHHMVYIVGWSIYHKVKLVRE-PTRplpnggnlnlgelLKYKSQEGVR  1850
              CWEDIC AIL AHH++YI GWSIYH+V+LVRE P R    G  L      KYKS+EGVR
Sbjct  242   KCWEDICEAILGAHHLIYIAGWSIYHEVRLVRERPLRIPAEGYTLGDLL--KYKSEEGVR  299

Query  1849  VLLLVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVV  1670
             V LLVWDDKTSH K F  T GVM THDEETRKFFKHSSV CVL+PRYAS KLS VKQQ+V
Sbjct  300   VCLLVWDDKTSHDKLFFKTGGVMQTHDEETRKFFKHSSVICVLSPRYASHKLSMVKQQIV  359

Query  1669  GTLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNP  1490
             GTL+THHQKC++VDT+A  N RKITAFIGGLDLCDGRYDTP+HRLF D D VF  D++NP
Sbjct  360   GTLFTHHQKCLLVDTEAPRNTRKITAFIGGLDLCDGRYDTPEHRLFRDLDDVFLNDFHNP  419

Query  1489  TFPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDA  1310
             TFP G  KGPRQPWHDLHCKI+GPAAYD+L NFEQRW+KAS++  LG++FK ++HW DDA
Sbjct  420   TFP-GQTKGPRQPWHDLHCKIDGPAAYDVLKNFEQRWKKASRFWVLGQKFKPVTHWKDDA  478

Query  1309  LLKIERISWITSPTPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAET  1130
             L+KI+RISWI SP+ S P  D +LWVS E   +NWH+Q+FRSIDSGS+KGFPK V  AE 
Sbjct  479   LIKIDRISWIVSPS-SNPYGDSNLWVSEEKSSENWHIQIFRSIDSGSVKGFPKSVSDAEA  537

Query  1129  QNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMEL  950
             +NLVC K+LVID+SI  AY++AIR AQHFIYIENQYF+GSSY WPSY+ A ADNLIPMEL
Sbjct  538   ENLVCGKNLVIDKSIHTAYVKAIRSAQHFIYIENQYFIGSSYGWPSYENAEADNLIPMEL  597

Query  949   ALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKI  770
             ALK+  KIR  ERFAVYIVIPMWPEG P S  VQ+IL+WQ QT++MMYEII  ELKS  I
Sbjct  598   ALKVAKKIRAGERFAVYIVIPMWPEGDPKSPAVQEILFWQDQTMKMMYEIIGGELKSMGI  657

Query  769   EDAHPCDYLNFYCLGNREEWHEESASSPT-PGCSEFLTGSQKSGRFMIYVHAKGMVVDDE  593
             ++ HP DYLNFYCLGNRE   +++  S   P     +  SQK  RFMIYVHAKGM+VDDE
Sbjct  658   QNVHPQDYLNFYCLGNRELLPKDTVQSTNQPLEKTAVALSQKYQRFMIYVHAKGMIVDDE  717

Query  592   YVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMD  413
             YVI+GSANINQRS+ GSRDTEIAMGAYQPH+TW+K + +P  QVYGYRMSLWAEHL  +D
Sbjct  718   YVILGSANINQRSLDGSRDTEIAMGAYQPHYTWSKRKGYPRGQVYGYRMSLWAEHLSKLD  777

Query  412   EKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYF  233
                    GL+CV+ VN+IA+ENW +YTAE+  PLQGHL++YP++VD++GKV+PL G E F
Sbjct  778   PCFMFPSGLDCVRCVNKIADENWTKYTAEEVIPLQGHLIRYPIKVDADGKVTPLSGKETF  837

Query  232   PDVGGKVLGSRTTLPDALT  176
             PDVGGK+LG  TTLPD LT
Sbjct  838   PDVGGKILGEPTTLPDQLT  856



>emb|CDP01838.1| unnamed protein product [Coffea canephora]
Length=870

 Score =  1108 bits (2866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/865 (63%), Positives = 671/865 (78%), Gaps = 30/865 (3%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQGNK---------  2531
             ++  VYL+GDL L ++EAR LPNMD+ SER+R+ F+    C KP +   +          
Sbjct  7     TKGSVYLYGDLYLHVIEARHLPNMDLTSERLRRCFSVCQPCIKPPSSDSSDPGLEHHHHD  66

Query  2530  ---VRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVK  2360
                +  H +IITSDPYV V +  AT+ RT V+ NSQ+P W E F IP+AHP+  +EF+VK
Sbjct  67    KKLIHHHPKIITSDPYVTVSVPQATLVRTHVVPNSQNPKWDERFSIPMAHPLQFLEFRVK  126

Query  2359  DNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPR  2180
             DNDVFGA  +G  K+   +I SGE I+ W+ +    GKPPKPD ++RL MKF P  ++P 
Sbjct  127   DNDVFGAQSMGTVKIPVDRIASGELISGWYSLTDQDGKPPKPDSSLRLEMKFVPADKSPF  186

Query  2179  YRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPE-GSLPEIKIDDGKAFHHENCWED  2012
             ++ G+  D    G++ +YFP+R G ++TLYQDAHV +   LP I++DDG  +    CWED
Sbjct  187   HKHGIAGDPDQNGVRNTYFPLRKGHSLTLYQDAHVTDDAKLPRIELDDGMVYEQNTCWED  246

Query  2011  ICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVW  1832
             IC+AI EAHH++YIVGWS++HK+KL+REPTRP+P GG+L LGELLKYKSQEGVRVLLLVW
Sbjct  247   ICYAIAEAHHLIYIVGWSVFHKIKLIREPTRPVPRGGDLTLGELLKYKSQEGVRVLLLVW  306

Query  1831  DDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTH  1652
             DDKTSH KFFI T G+M THDEET+KFFKHSSV CVL+PRYASSKLS++KQ+VVGT +TH
Sbjct  307   DDKTSHHKFFIKTEGLMQTHDEETKKFFKHSSVICVLSPRYASSKLSYMKQKVVGTFFTH  366

Query  1651  HQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGG  1472
             HQKCV+VDTQA GNNRKITAF+GGLDLCDGRYDTP+HR+F   D+VF+ D++ PTFP  G
Sbjct  367   HQKCVLVDTQAFGNNRKITAFLGGLDLCDGRYDTPEHRIFHGLDSVFKDDFHQPTFPV-G  425

Query  1471  LKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIER  1292
              K PR+PWHDLHC+I+GPAAYD+L NF QRWR+A++W E     K+++ WHDDA++KIER
Sbjct  426   TKAPREPWHDLHCRIDGPAAYDVLLNFAQRWRRATRWREFSILKKRMARWHDDAMIKIER  485

Query  1291  ISWITSPTPS--------VPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTA  1136
             ISWI SP  S        VP DDP L+V      +NW+VQ+FRSIDSGS+KGFPK ++ A
Sbjct  486   ISWILSPALSVSRDGSDKVPEDDPKLYVCGVDHQENWNVQIFRSIDSGSVKGFPKYIYGA  545

Query  1135  ETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPM  956
             E + L  +K LVIDRSIQ AYI+AIR AQHFIYIENQYFLGSSYAWPSYK+AGAD+ IPM
Sbjct  546   EAEKLNYSKKLVIDRSIQTAYIQAIRSAQHFIYIENQYFLGSSYAWPSYKDAGADHQIPM  605

Query  955   ELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSE  776
             EL LKIVSKIR  ERFAVY+V+PMWPEG P +  +Q+IL+WQ QT+QMMY+IIA+ELK+ 
Sbjct  606   ELVLKIVSKIRAGERFAVYVVVPMWPEGDPKTNSMQEILFWQNQTMQMMYQIIAEELKTM  665

Query  775   KIEDAHPCDYLNFYCLGNREEWHE-ESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVD  599
             ++ D+HP DYLNFYCLG REE  E     S + G ++ ++ S K  RFMIYVHAKGMVVD
Sbjct  666   QLVDSHPQDYLNFYCLGKREEIPEIPDMISQSSGDADKVSDSMKYKRFMIYVHAKGMVVD  725

Query  598   DEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGM  419
             DEYVI+GSAN+NQRSMAG++DTEIAMGAYQPHHTWAK   HP  Q+YGYRMSLWAEHLG+
Sbjct  726   DEYVIIGSANLNQRSMAGTKDTEIAMGAYQPHHTWAKKTQHPRGQIYGYRMSLWAEHLGL  785

Query  418   MDEK--LDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGG  245
               E+   ++ + LECVK VNEIAE+NWKRYT E FS LQGHLLKYP+QVD++GKV PL G
Sbjct  786   DKEEKHFEDPQMLECVKRVNEIAEDNWKRYTDENFSLLQGHLLKYPVQVDADGKVGPLPG  845

Query  244   CEYFPDVGGKVLGSR-TTLPDALTT  173
             CE FPDVGG+++G+  T +PD LTT
Sbjct  846   CETFPDVGGRIVGTHFTAIPDVLTT  870



>ref|XP_010244833.1| PREDICTED: phospholipase D delta-like isoform X2 [Nelumbo nucifera]
Length=888

 Score =  1108 bits (2865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 534/875 (61%), Positives = 671/875 (77%), Gaps = 44/875 (5%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAF-DCRKPETRQGNKVRRHTRIIT  2504
             S+N ++LHG+L++ I EAR LPNMD+VSER+R+ FT F  C +P T++ ++ +   +IIT
Sbjct  19    SDNFIFLHGNLEIWIFEARSLPNMDLVSERMRKCFTMFGSCARP-TKKKDRDKSGRKIIT  77

Query  2503  SDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGV  2324
             SDPYV VC+AGATVA+TR+I+N +DP W EHF++PVAHP+++VEFQVKDND+ GA  IGV
Sbjct  78    SDPYVSVCMAGATVAQTRIIANCEDPSWDEHFRVPVAHPITKVEFQVKDNDILGAQLIGV  137

Query  2323  AKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED---Y  2153
              ++  +KI+ G+ IN WFPI+G +G P KP   + L ++F P  E+P Y+ G+       
Sbjct  138   VEIPIEKILPGDKINGWFPIVGPYGNPLKPYPELHLSLQFRPVEEDPLYKNGIGAGPNYI  197

Query  2152  GLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVY  1973
             G+  +YFP+R GG VTLYQDAHVP G+LP+I +D G+ F    CWEDICHAILEAHH++Y
Sbjct  198   GVPNTYFPLRKGGVVTLYQDAHVPHGALPDIILDGGRVFQQGQCWEDICHAILEAHHLIY  257

Query  1972  IVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINT  1793
             I+GWSIYH VKLVREPT+PLP GG+L LGELLKYKSQ+GVRV++LVWDDKTSH  F + T
Sbjct  258   IIGWSIYHPVKLVREPTKPLPEGGDLTLGELLKYKSQQGVRVMMLVWDDKTSHHNFLLKT  317

Query  1792  SGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQG  1613
              GVM THDEETR+FFKHS+V CVL+PRYAS+KLS  KQQVVGTL+THHQKCV+VDTQA G
Sbjct  318   EGVMHTHDEETRRFFKHSTVHCVLSPRYASNKLSIFKQQVVGTLFTHHQKCVLVDTQASG  377

Query  1612  NNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHC  1433
             N RK+TAFIGGLDLCDGRYDTP+HRLF D DTVF  D++NPTFP    +GPRQPWHDLHC
Sbjct  378   NYRKVTAFIGGLDLCDGRYDTPEHRLFIDLDTVFANDFHNPTFPSRA-RGPRQPWHDLHC  436

Query  1432  KIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPN  1253
             K+EGPAAYDI+TNFEQRWRK +KW +   + + +++WH+DAL+K++RISWI +PT    +
Sbjct  437   KVEGPAAYDIMTNFEQRWRKVAKWRDF--KIRNVTNWHEDALIKLDRISWILTPTVGA-D  493

Query  1252  DDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAY  1073
              D S+  + E DP+NWHVQVFRSIDSGS++GFPK V  AE QNL+C K+L ID+SI +AY
Sbjct  494   GDHSIHAATEDDPENWHVQVFRSIDSGSVRGFPKLVQEAEAQNLICGKNLKIDKSIHVAY  553

Query  1072  IEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIV  893
             ++AIR AQHFIYIENQYF+GSS+ WPSYK+AGADNL+P+ELALKI SKI   ERF+VY+V
Sbjct  554   VKAIRSAQHFIYIENQYFIGSSFYWPSYKDAGADNLVPIELALKIASKISANERFSVYVV  613

Query  892   IPMWPEGVPSSAPVQDILYWQ----------------------------------GQTIQ  815
             IPMWPEGVP+SA VQ+IL+WQ                                  GQTI 
Sbjct  614   IPMWPEGVPTSASVQEILFWQDQHTRTMKGKGCRLGRLFALEFEKTLVTSSTSCSGQTID  673

Query  814   MMYEIIAKELKSEKIED-AHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGR  638
             MMY I+ + L +  + +  HP D+LNFYCLG RE    + +S   P  +     +QK  R
Sbjct  674   MMYRIVGQALDNAGLSNKCHPQDFLNFYCLGKREPGSPDRSSQTNPSENNAQGLAQKFHR  733

Query  637   FMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVY  458
             FMIYVHAKGM+VDDEYVI+GSANINQRS+ GSRDTEIAMGAYQP++TWA  + HP  QVY
Sbjct  734   FMIYVHAKGMIVDDEYVIMGSANINQRSLDGSRDTEIAMGAYQPNYTWAMKKCHPRGQVY  793

Query  457   GYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQV  278
             GYRMSLWAEHLGM+++   E + +EC++ VN +AE NW+ Y +E+F  ++GHL+ YP+ V
Sbjct  794   GYRMSLWAEHLGMLEDCFYEPQSIECIRRVNTLAESNWQSYVSEEFMDMKGHLMPYPIHV  853

Query  277   DSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALTT  173
               +GK+ PL G E FPDVGGKVLG+ TTLPDALTT
Sbjct  854   GWDGKIGPLPGFECFPDVGGKVLGAPTTLPDALTT  888



>ref|XP_010065450.1| PREDICTED: phospholipase D delta-like [Eucalyptus grandis]
Length=880

 Score =  1106 bits (2861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/851 (64%), Positives = 658/851 (77%), Gaps = 27/851 (3%)
 Frame = -2

Query  2668  VYLHGDLDLKILEARRLPNMDIVSERIRQFFT--------AFDCRKP-ETRQGNKVRRHT  2516
             ++LHG+LD+ I+EA+ LPNMD+ SERIRQ  +        A   ++P   R   K     
Sbjct  38    IFLHGELDMYIVEAKSLPNMDLASERIRQCCSMIGPPCVPALHGQRPVPARSSGK----N  93

Query  2515  RIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGAD  2336
              +ITSDPYV VCLAGATVA+TRVI N ++P+W E F +PVAHPV +VEF VKDNDVFGA+
Sbjct  94    SMITSDPYVSVCLAGATVAQTRVIQNCENPLWDERFCVPVAHPVVKVEFHVKDNDVFGAE  153

Query  2335  FIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT--  2162
              IGV ++   KI+S + INDWFPIIG  G P KP   + + ++F P ++NP Y+ GV   
Sbjct  154   LIGVVEIPVAKIVSSDMINDWFPIIGNFGSPLKPYPELHISIQFRPVSDNPLYKDGVGVG  213

Query  2161  EDY-GLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAH  1985
              +Y G+  +YFP+R GG VTLYQDAHVP G LP+I +DDGK +    CWEDICHAILEAH
Sbjct  214   PNYVGVPNTYFPLRKGGDVTLYQDAHVPMGKLPQILLDDGKIYEQGRCWEDICHAILEAH  273

Query  1984  HMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKF  1805
             H++YI+GWSIYH V+LVREPTR LPNGG L+LGELLKYKS+EGVRV++LVWDDKTSH KF
Sbjct  274   HLIYIIGWSIYHPVRLVREPTRELPNGGELSLGELLKYKSEEGVRVVVLVWDDKTSHDKF  333

Query  1804  FINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDT  1625
              + T GVM THDEET+KFF+HS V CVLAPRYAS+KLS  KQQVVGTLYTHHQKCV++DT
Sbjct  334   LLKTDGVMQTHDEETKKFFRHSGVRCVLAPRYASTKLSIFKQQVVGTLYTHHQKCVVLDT  393

Query  1624  QAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWH  1445
             QA GNNRKITAFIGGLDLCDGRYDTP+HRL+SD DTVF+ D +NPTF    +  PR+PWH
Sbjct  394   QASGNNRKITAFIGGLDLCDGRYDTPEHRLYSDLDTVFKNDIHNPTF-MSTVNVPREPWH  452

Query  1444  DLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTP  1265
             DLHCK+EG AAYDIL NFEQRW+K +KW E   + K + HWH++ALL+++RISWI  P+ 
Sbjct  453   DLHCKVEGQAAYDILKNFEQRWKKVAKWREF--KLKNVRHWHENALLRLDRISWILCPST  510

Query  1264  SVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSI  1085
             S P+ D  + V +E DP+NWHVQ+FRSIDSGS+KGFPK V  A  QNL+C K+L +D+SI
Sbjct  511   S-PDGDKKVQVRDEDDPENWHVQIFRSIDSGSVKGFPKSVEEAAKQNLICGKNLKVDKSI  569

Query  1084  QMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFA  905
               AY++AIR AQHFIYIENQYFLGSSY WPSYK AGA+NL+PMELALKI SKI   ERF 
Sbjct  570   HTAYVKAIRSAQHFIYIENQYFLGSSYHWPSYKNAGANNLVPMELALKIASKISENERFC  629

Query  904   VYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDA-HPCDYLNFYCL  728
             VYIVIPMWPEGVP+SA VQ+IL+WQGQT+ MMY+IIA+ L+   +    HP DYLNFYCL
Sbjct  630   VYIVIPMWPEGVPTSAAVQEILFWQGQTMTMMYKIIAQALEKAGLSHKYHPSDYLNFYCL  689

Query  727   GNREEWHEESASSPT---PGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQR  557
             G RE      +SS        +  L   QK  RFMIYVHAKGM+VDDEYVI+GSANINQR
Sbjct  690   GKREPLSSTQSSSQAMNQQSENNALASVQKFRRFMIYVHAKGMIVDDEYVIMGSANINQR  749

Query  556   SMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECV  377
             S+ GSRDTEIAMGAYQPHHTWA  ++HPH QVYGYRMSLWAEHLG +++   E +  ECV
Sbjct  750   SLDGSRDTEIAMGAYQPHHTWAGKKSHPHGQVYGYRMSLWAEHLGDLEDSFREPQSTECV  809

Query  376   KMVNEIAEENWKRYTAE-KFSP--LQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLG  206
             K VN+IAE NWK Y  E + +P  ++GHL++YP+ V  +GKV PL G E FPDVGGK+LG
Sbjct  810   KKVNKIAERNWKAYVDEDQHNPKEMRGHLMQYPIHVSRDGKVGPLAGFETFPDVGGKILG  869

Query  205   SRTTLPDALTT  173
             S TTLPDALTT
Sbjct  870   SPTTLPDALTT  880



>ref|XP_008218590.1| PREDICTED: phospholipase D delta-like [Prunus mume]
Length=850

 Score =  1104 bits (2855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 552/855 (65%), Positives = 670/855 (78%), Gaps = 20/855 (2%)
 Frame = -2

Query  2707  SDVKMSD--GMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAF-DCRKPETRQG  2537
             SD + SD  G S+  V LHG+LDL I+EA+ LPNMD+ SER+R+ FT F  C  P   + 
Sbjct  6     SDCQESDEAGSSKEHVILHGELDLWIIEAKSLPNMDLTSERMRRCFTMFGTCSAPFGNRP  65

Query  2536  NKVR--RHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQV  2363
              K    RH   ITSDPYV VCLAGATVA+TRVISN ++P W EHF +PVAHPV++VEF V
Sbjct  66    AKTASGRHP-TITSDPYVSVCLAGATVAQTRVISNCENPSWEEHFCVPVAHPVAKVEFHV  124

Query  2362  KDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENP  2183
             KDNDV GA+ IGV ++S  KIISG+ +NDWFP+IG HG   KP   + + ++F P   NP
Sbjct  125   KDNDVLGAELIGVVEISIDKIISGKPMNDWFPVIGNHGNCLKPFPELHVSLQFKPVGGNP  184

Query  2182  RYRGGVT---EDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWED  2012
              Y+ GV    E  G+  +YFP+R GG+VTLYQDAHVP   LP+I +D GK F    CWE+
Sbjct  185   LYKNGVGAGPEYNGVPNTYFPLRKGGSVTLYQDAHVPNDMLPDIVLDGGKKFQQRKCWEE  244

Query  2011  ICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVW  1832
             ICHAILEA H++YI+GWS+YH+VKLVREPT+PLP+GG L LGELLKYKSQEG+RV++L+W
Sbjct  245   ICHAILEAQHLIYIIGWSVYHRVKLVREPTKPLPSGGELTLGELLKYKSQEGIRVVMLIW  304

Query  1831  DDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTH  1652
             DDKTSH KF + T GVM THDEET+KFF+HSSV CVL+PRYAS+KLS  KQQVVGTL+TH
Sbjct  305   DDKTSHDKFLLKTEGVMQTHDEETKKFFRHSSVHCVLSPRYASNKLSIFKQQVVGTLFTH  364

Query  1651  HQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGG  1472
             HQKCV++DT A GNNRK+TAFIGGLDLCDGRYDTP+HRLF D +TVF  D +NPTFP   
Sbjct  365   HQKCVLLDT-ASGNNRKLTAFIGGLDLCDGRYDTPEHRLFKDLNTVFENDIHNPTFPPNT  423

Query  1471  LKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIER  1292
               GPR+PWHDLHCKIEGPAAYDILTNFEQRWRKA K      + KK+++ HDDAL++++R
Sbjct  424   Y-GPREPWHDLHCKIEGPAAYDILTNFEQRWRKAKK---RDFKIKKVTNRHDDALIRLDR  479

Query  1291  ISWITSPTPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCA  1112
             +SWI SP+ S  + D ++ VS+E D +NWHVQVFRSIDSGS+KGFPK V  AE QNL+C 
Sbjct  480   VSWIVSPS-SGRDGDQNVRVSSEEDRENWHVQVFRSIDSGSVKGFPKGVQDAEAQNLICG  538

Query  1111  KDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVS  932
             K+L ID+SI +AYI+AIR AQ FIYIENQYF+GSSY WPSYK AGADNL+PMELALKI S
Sbjct  539   KNLKIDKSIHVAYIKAIRSAQRFIYIENQYFVGSSYCWPSYKNAGADNLVPMELALKIAS  598

Query  931   KIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDA-HP  755
             KI+  ERF+VYIVIPMWPEGVP+++ VQ+ILYWQ QT+ MMY++I+K L+   + D  HP
Sbjct  599   KIKANERFSVYIVIPMWPEGVPTASAVQEILYWQAQTMGMMYQVISKALEDAGLFDQYHP  658

Query  754   CDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGS  575
              D+LNFYCLG RE     S+ +  P        +QK  RFMIYVHAKGM+VDDEYVI+GS
Sbjct  659   QDFLNFYCLGQREAPSSTSSQTNQPTDKAL---AQKFRRFMIYVHAKGMIVDDEYVIMGS  715

Query  574   ANINQRSMAGSRDTEIAMGAYQPHHTWAKNQN-HPHAQVYGYRMSLWAEHLGMMDEKLDE  398
             ANINQRSM GSRDTEIAMGAYQPHHTWA  +N HPH QVYGYRMSLWAEHLG ++E   +
Sbjct  716   ANINQRSMDGSRDTEIAMGAYQPHHTWAAEKNLHPHGQVYGYRMSLWAEHLGGLEETYQD  775

Query  397   AEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGG  218
              E LECVK V+EIA++NWK + +E+   ++GHL++YP+Q+  +G+VS L G E FPDVGG
Sbjct  776   PESLECVKHVSEIAKQNWKAFVSEEHKEMKGHLMQYPVQIGRDGQVSSLPGYESFPDVGG  835

Query  217   KVLGSRTTLPDALTT  173
             K+LG+ T LPDALTT
Sbjct  836   KILGAPTNLPDALTT  850



>ref|XP_010244830.1| PREDICTED: phospholipase D delta-like isoform X1 [Nelumbo nucifera]
 ref|XP_010244831.1| PREDICTED: phospholipase D delta-like isoform X1 [Nelumbo nucifera]
 ref|XP_010244832.1| PREDICTED: phospholipase D delta-like isoform X1 [Nelumbo nucifera]
Length=889

 Score =  1103 bits (2853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 534/876 (61%), Positives = 671/876 (77%), Gaps = 45/876 (5%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAF-DCRKPETRQGNKVRRHTRIIT  2504
             S+N ++LHG+L++ I EAR LPNMD+VSER+R+ FT F  C +P T++ ++ +   +IIT
Sbjct  19    SDNFIFLHGNLEIWIFEARSLPNMDLVSERMRKCFTMFGSCARP-TKKKDRDKSGRKIIT  77

Query  2503  SDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGV  2324
             SDPYV VC+AGATVA+TR+I+N +DP W EHF++PVAHP+++VEFQVKDND+ GA  IGV
Sbjct  78    SDPYVSVCMAGATVAQTRIIANCEDPSWDEHFRVPVAHPITKVEFQVKDNDILGAQLIGV  137

Query  2323  AKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED---Y  2153
              ++  +KI+ G+ IN WFPI+G +G P KP   + L ++F P  E+P Y+ G+       
Sbjct  138   VEIPIEKILPGDKINGWFPIVGPYGNPLKPYPELHLSLQFRPVEEDPLYKNGIGAGPNYI  197

Query  2152  GLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVY  1973
             G+  +YFP+R GG VTLYQDAHVP G+LP+I +D G+ F    CWEDICHAILEAHH++Y
Sbjct  198   GVPNTYFPLRKGGVVTLYQDAHVPHGALPDIILDGGRVFQQGQCWEDICHAILEAHHLIY  257

Query  1972  IVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINT  1793
             I+GWSIYH VKLVREPT+PLP GG+L LGELLKYKSQ+GVRV++LVWDDKTSH  F + T
Sbjct  258   IIGWSIYHPVKLVREPTKPLPEGGDLTLGELLKYKSQQGVRVMMLVWDDKTSHHNFLLKT  317

Query  1792  SGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQG  1613
              GVM THDEETR+FFKHS+V CVL+PRYAS+KLS  KQQVVGTL+THHQKCV+VDTQA G
Sbjct  318   EGVMHTHDEETRRFFKHSTVHCVLSPRYASNKLSIFKQQVVGTLFTHHQKCVLVDTQASG  377

Query  1612  NNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHC  1433
             N RK+TAFIGGLDLCDGRYDTP+HRLF D DTVF  D++NPTFP    +GPRQPWHDLHC
Sbjct  378   NYRKVTAFIGGLDLCDGRYDTPEHRLFIDLDTVFANDFHNPTFPSRA-RGPRQPWHDLHC  436

Query  1432  KIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPN  1253
             K+EGPAAYDI+TNFEQRWRK +KW +   + + +++WH+DAL+K++RISWI +PT    +
Sbjct  437   KVEGPAAYDIMTNFEQRWRKVAKWRDF--KIRNVTNWHEDALIKLDRISWILTPTVGA-D  493

Query  1252  DDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAY  1073
              D S+  + E DP+NWHVQVFRSIDSGS++GFPK V  AE QNL+C K+L ID+SI +AY
Sbjct  494   GDHSIHAATEDDPENWHVQVFRSIDSGSVRGFPKLVQEAEAQNLICGKNLKIDKSIHVAY  553

Query  1072  IEAIRRAQHFIYIENQYFLGSSYAWPSYKE-AGADNLIPMELALKIVSKIRNRERFAVYI  896
             ++AIR AQHFIYIENQYF+GSS+ WPSYK+ AGADNL+P+ELALKI SKI   ERF+VY+
Sbjct  554   VKAIRSAQHFIYIENQYFIGSSFYWPSYKDAAGADNLVPIELALKIASKISANERFSVYV  613

Query  895   VIPMWPEGVPSSAPVQDILYWQ----------------------------------GQTI  818
             VIPMWPEGVP+SA VQ+IL+WQ                                  GQTI
Sbjct  614   VIPMWPEGVPTSASVQEILFWQDQHTRTMKGKGCRLGRLFALEFEKTLVTSSTSCSGQTI  673

Query  817   QMMYEIIAKELKSEKIED-AHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSG  641
              MMY I+ + L +  + +  HP D+LNFYCLG RE    + +S   P  +     +QK  
Sbjct  674   DMMYRIVGQALDNAGLSNKCHPQDFLNFYCLGKREPGSPDRSSQTNPSENNAQGLAQKFH  733

Query  640   RFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQV  461
             RFMIYVHAKGM+VDDEYVI+GSANINQRS+ GSRDTEIAMGAYQP++TWA  + HP  QV
Sbjct  734   RFMIYVHAKGMIVDDEYVIMGSANINQRSLDGSRDTEIAMGAYQPNYTWAMKKCHPRGQV  793

Query  460   YGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQ  281
             YGYRMSLWAEHLGM+++   E + +EC++ VN +AE NW+ Y +E+F  ++GHL+ YP+ 
Sbjct  794   YGYRMSLWAEHLGMLEDCFYEPQSIECIRRVNTLAESNWQSYVSEEFMDMKGHLMPYPIH  853

Query  280   VDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALTT  173
             V  +GK+ PL G E FPDVGGKVLG+ TTLPDALTT
Sbjct  854   VGWDGKIGPLPGFECFPDVGGKVLGAPTTLPDALTT  889



>emb|CBI29771.3| unnamed protein product [Vitis vinifera]
Length=842

 Score =  1103 bits (2852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 541/845 (64%), Positives = 650/845 (77%), Gaps = 28/845 (3%)
 Frame = -2

Query  2683  MSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAF-DCRKPETRQGNKVRRHTRII  2507
             +S   V+LHG+LDL ILEA+ LPNMD+ +ER+R+ F  F  C  P   +     +H  II
Sbjct  18    VSGEAVFLHGELDLWILEAKSLPNMDLATERVRRCFNMFGSCTSPFKIRHKHSSKHHSII  77

Query  2506  TSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIG  2327
             TSDPYV VCLAGAT+A+TRVI NS++P W EHF +PVAHPV +VEF VKDND+ GA  IG
Sbjct  78    TSDPYVSVCLAGATIAQTRVIPNSENPSWGEHFCVPVAHPVMKVEFHVKDNDILGAQLIG  137

Query  2326  VAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED---  2156
             V  +S +K+ISG  ++ WFPI+G+ G P KP                P    GV      
Sbjct  138   VVGISVEKLISGNAVSGWFPIVGSQGNPLKP---------------YPELHDGVGAGSGY  182

Query  2155  YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMV  1976
              G+  +YFP+  GG++TLYQDAHVP+G LPEI +D GK F    CWE+ICHA+LEAHH++
Sbjct  183   LGVPNTYFPLHKGGSITLYQDAHVPKGMLPEILLDGGKIFQQGQCWEEICHAMLEAHHLI  242

Query  1975  YIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFIN  1796
             YI+GWSI+H VKL+REPT+P+P GG L+LGELLKYKS+EGVRVL+L+WDDKTSH +    
Sbjct  243   YIIGWSIFHPVKLLREPTKPVPAGGELSLGELLKYKSEEGVRVLMLIWDDKTSHDRLLFK  302

Query  1795  TSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQ  1616
             T GVM THDEETRKFFKHS V CVL+PRYAS+KLS  KQQVVGTL+THHQKCV++DTQA 
Sbjct  303   TEGVMQTHDEETRKFFKHSGVHCVLSPRYASNKLSIFKQQVVGTLFTHHQKCVLLDTQAP  362

Query  1615  GNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLH  1436
             GNNRKITAFIGGLDLCDGRYDTP+HRLFSD DTVF  D++NPTFP    +GPRQPWHDLH
Sbjct  363   GNNRKITAFIGGLDLCDGRYDTPEHRLFSDLDTVFSNDFHNPTFPSRA-RGPRQPWHDLH  421

Query  1435  CKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVP  1256
             CK+EGPAAYDI+TNFEQRWRKA+KW +   R KK++HWH+DAL++++RISWI +P+ S P
Sbjct  422   CKVEGPAAYDIMTNFEQRWRKAAKWRDF--RLKKVTHWHEDALIRLDRISWIITPS-SGP  478

Query  1255  NDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMA  1076
               D ++ V+ E DP+ WHVQVFRSIDSGS++GFPK V  AE QNLVC K+L IDRSI  A
Sbjct  479   TGDHAVRVTTEEDPETWHVQVFRSIDSGSVRGFPKLVQDAEAQNLVCGKNLKIDRSIHAA  538

Query  1075  YIEAIRRAQHFIYIENQYFLGSSYAWPSYKE-AGADNLIPMELALKIVSKIRNRERFAVY  899
             Y++AIR AQHFIYIENQYFLGS+Y WPSYK  AGADNLIPMELALKI SKI   E F VY
Sbjct  539   YVKAIRSAQHFIYIENQYFLGSAYHWPSYKNAAGADNLIPMELALKISSKISANEHFRVY  598

Query  898   IVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDA-HPCDYLNFYCLGN  722
             IV+PMWPEGVP+SA VQ+IL+WQGQT+ MMY+II + +    + D  HP DYLNFYCLG 
Sbjct  599   IVVPMWPEGVPTSASVQEILFWQGQTMSMMYQIIGQAIHKAGLSDTHHPQDYLNFYCLGK  658

Query  721   REEWHEESASSPTPGCSE--FLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMA  548
             RE    ES S+ T   SE   L  +QK  RFMIYVHAKGM+VDDEYV++GSANINQRS+ 
Sbjct  659   REASSTES-SAQTSNSSENRALGLAQKFRRFMIYVHAKGMIVDDEYVLIGSANINQRSLD  717

Query  547   GSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMV  368
             GSRDTEIAMGAYQP +TW+  + HPH QVYGYRMSLWAEHLG +++   + E LEC++ V
Sbjct  718   GSRDTEIAMGAYQPSYTWSGKKTHPHGQVYGYRMSLWAEHLGTLEDSFCQPESLECIRQV  777

Query  367   NEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLP  188
             N IA+ NW+ Y A++   + GHL++YP+QV  NG VS L G E FPDVGGKVLGS T LP
Sbjct  778   NSIAKNNWQIYAADENKEMTGHLMQYPIQVSKNGNVSTLPGHECFPDVGGKVLGSPTNLP  837

Query  187   DALTT  173
             DALTT
Sbjct  838   DALTT  842



>ref|XP_008785061.1| PREDICTED: phospholipase D delta-like [Phoenix dactylifera]
Length=860

 Score =  1096 bits (2834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/844 (64%), Positives = 640/844 (76%), Gaps = 26/844 (3%)
 Frame = -2

Query  2638  ILEARRLPNMDIVSERIRQFFTAFDCRKP---------ETRQGNKVRRH------TRIIT  2504
             I EAR LPNMD+ +ERIR+   A     P         E R G K   H       + IT
Sbjct  19    IREARDLPNMDMFTERIRRCLGACGLSLPTRRRTDPEEEFRTGKKTSPHFPLQPKPKAIT  78

Query  2503  SDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGV  2324
             SDPYVKV LA  T+ARTRVI NS +P W EHFK+ +AH    +EF+VKD+DVFGA  IG 
Sbjct  79    SDPYVKVILARDTLARTRVIPNSLEPHWNEHFKLFLAHRAGHIEFEVKDSDVFGAQLIGT  138

Query  2323  AKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT---EDY  2153
             A V A +I SG+ I++WFP+I   G+PP+P  A+R+ M FTP  ENP YR G+    E  
Sbjct  139   ATVPADRIASGQLIDEWFPVIAPSGRPPRPASALRVSMSFTPVEENPAYRNGIPGDPEKR  198

Query  2152  GLKESYFPMRHGGAVTLYQDAHVPEGSLPE-IKIDDGKAFHHENCWEDICHAILEAHHMV  1976
             G++++YFP+R GG +TLYQDAHV  G LP+ I+++ G  F H  CWEDIC AILEAHH++
Sbjct  199   GVRDTYFPLRKGGMLTLYQDAHVRRGELPDDIELEGGTVFRHNKCWEDICEAILEAHHLI  258

Query  1975  YIVGWSIYHKVKLVREPT-RplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFI  1799
             YI GWSIYHKVKLVRE + R       L LGELLKYKS+EGVRV LLVWDD+TSH K F 
Sbjct  259   YIAGWSIYHKVKLVRERSLRIPAMSEALTLGELLKYKSEEGVRVCLLVWDDRTSHDKLFF  318

Query  1798  NTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQA  1619
              T GVM THDEETRKFFKHSSV CVL+PRYAS KLS VKQQVVGTL+THHQKC++VDT+A
Sbjct  319   KTGGVMQTHDEETRKFFKHSSVICVLSPRYASHKLSMVKQQVVGTLFTHHQKCLLVDTEA  378

Query  1618  QGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDL  1439
                 RKITAF+GGLDLCDGRYDTP+HRLF D DTVF  D++NPT P G  KGPRQPWHDL
Sbjct  379   SRTTRKITAFVGGLDLCDGRYDTPEHRLFRDLDTVFLNDFHNPTIP-GQTKGPRQPWHDL  437

Query  1438  HCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSV  1259
             HCKI+GPAAYD+L NFEQRW+KAS++  LG++FK ++HWHDDAL+KI+RISWI SP+ S 
Sbjct  438   HCKIDGPAAYDVLENFEQRWKKASRFWVLGQKFKGVTHWHDDALIKIDRISWILSPSCSD  497

Query  1258  PNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQM  1079
             P  DP+LWVS E D +NWH+Q+FRSIDSGS+KGFP+ VH AE QNLVC K+LVID+SI  
Sbjct  498   PYGDPNLWVSEEKDSENWHIQIFRSIDSGSVKGFPRSVHEAEAQNLVCGKNLVIDKSIHT  557

Query  1078  AYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVY  899
             AY++AIR AQHFIYIENQYF+GSSY WPSY+ A ADNLIPMELALKIV+KI   ERFAVY
Sbjct  558   AYVKAIRSAQHFIYIENQYFIGSSYGWPSYQNAEADNLIPMELALKIVNKISVGERFAVY  617

Query  898   IVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNR  719
             IVIP+WPEG P S  VQ+IL+WQ QTI+MMY II  +LKS  I++ HP DYLNFYCLGNR
Sbjct  618   IVIPLWPEGDPKSQAVQEILFWQSQTIKMMYGIIGGKLKSMGIQNVHPQDYLNFYCLGNR  677

Query  718   EEWHE---ESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMA  548
             E   E   +S + P    +  L  SQK  RFMIYVHAKGM+VDDEYVI+GSANINQRS+ 
Sbjct  678   ELLPEGAIQSTNQPLEKTAAVL--SQKYQRFMIYVHAKGMIVDDEYVILGSANINQRSLD  735

Query  547   GSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMV  368
             GSRDTEIAMGAYQPH+ W++   +PH Q+YGYRMSLWAEHLGM+D        L+CVK V
Sbjct  736   GSRDTEIAMGAYQPHYAWSETTGYPHGQIYGYRMSLWAEHLGMVDPCFKLPHSLDCVKFV  795

Query  367   NEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLP  188
             N IA +NW +YTAE   PLQGHL++YP+ VD++G V+ L   + FPDVGGK+LG  T LP
Sbjct  796   NGIAVQNWAKYTAEDLIPLQGHLIRYPIMVDADGTVTTLPEKDSFPDVGGKILGEPTPLP  855

Query  187   DALT  176
             D LT
Sbjct  856   DQLT  859



>ref|XP_010029629.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase D delta-like [Eucalyptus 
grandis]
Length=869

 Score =  1095 bits (2833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 549/876 (63%), Positives = 660/876 (75%), Gaps = 54/876 (6%)
 Frame = -2

Query  2677  ENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKV----------  2528
             + +VYLHGDLDL I+ A  LPNMD+VSER+R   +A  C +P    G             
Sbjct  7     DELVYLHGDLDLHIISASNLPNMDVVSERLRLCLSA--CSRPGGPGGGGGGGGGGPSPAA  64

Query  2527  ---RRH-TRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVK  2360
                RRH  +I+TSDPYV V +  AT+ARTRV+ N+++P W + F++ +AHPV  +EF+VK
Sbjct  65    SPGRRHGKKIVTSDPYVTVSVPQATIARTRVLKNAKNPKWDQRFRVALAHPVIHLEFRVK  124

Query  2359  DNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPR  2180
             D+DVFGA+ IG+ K+ A+ I +G  I+ WF + G  G   KPD A+ L +KFTP  +NP 
Sbjct  125   DDDVFGAEVIGIVKIPARDIAAGGVISGWFAVSGPAGX--KPDTALELDLKFTPVEKNPV  182

Query  2179  YRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDD--GKAFHHENCWE  2015
             YR G+  D    G++++YFP+R GG VTLYQDAHV +G LPEI++D   G  +    CWE
Sbjct  183   YRFGIAGDPHHQGVRQTYFPLRKGGGVTLYQDAHVVDGLLPEIELDRDAGGVYRQAKCWE  242

Query  2014  DICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLV  1835
             DICH I EAHH++YIVGWS++HK+KLVREPTRPLP GG+L LGELLKYKS+EGVRVLLL+
Sbjct  243   DICHTITEAHHLIYIVGWSVFHKIKLVREPTRPLPRGGDLTLGELLKYKSEEGVRVLLLI  302

Query  1834  WDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYT  1655
             WDDKTSH K+FI T GVM THDEETRKFFKHSSV CVLAPRYASSKL  +KQQVVGT++T
Sbjct  303   WDDKTSHDKYFIKTGGVMQTHDEETRKFFKHSSVNCVLAPRYASSKLGIIKQQVVGTMFT  362

Query  1654  HHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEG  1475
             HHQKCV+VDTQA GN RKITAFIGG+DLCDGRYDTP+HRLF D DTVF+ D++NPTFP  
Sbjct  363   HHQKCVLVDTQAPGNYRKITAFIGGIDLCDGRYDTPEHRLFRDLDTVFKEDFHNPTFP-A  421

Query  1474  GLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIE  1295
             G+K PRQPWHDLHC+IEGPAAYD+L NFEQRWRKA++W E     K   HWHDD+L+KI 
Sbjct  422   GMKAPRQPWHDLHCRIEGPAAYDVLINFEQRWRKATRWKEFSLFVKGKKHWHDDSLIKIG  481

Query  1294  RISWITSP--------------------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDS  1175
             RISWI SP                       VP D+P+L+VS E D  NWHVQ+FRSIDS
Sbjct  482   RISWILSPTSTDTYDSTTSLSKDDSSEQITKVPEDNPNLYVSKEDDSNNWHVQIFRSIDS  541

Query  1174  GSLKGFP-KDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAW  998
             GS+KGFP K    AE QNL+  KDLV+DRSIQ AYI+AIR AQHF+YIENQYFLGSSYAW
Sbjct  542   GSVKGFPTKRKDIAEKQNLLVTKDLVVDRSIQTAYIQAIRSAQHFVYIENQYFLGSSYAW  601

Query  997   PSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTI  818
             PSY +AGADNLIPMELALKI SKIR  ERFAVYIVIPMWPEG P SA VQ+IL+WQ QT+
Sbjct  602   PSYVDAGADNLIPMELALKITSKIRANERFAVYIVIPMWPEGDPKSATVQEILFWQNQTM  661

Query  817   QMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGR  638
             QMMY+++A ELK  ++ D+HP DYLNFYCLG RE+       S  P  +  ++ + KS R
Sbjct  662   QMMYQVVALELKQMQLTDSHPRDYLNFYCLGKRED------ISGQPSSANGVSEAYKSQR  715

Query  637   FMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVY  458
             FMIYVHAKGMVVDDEYV++GSANINQRS+AG++DTEIAMGAYQ HHTWA  +  P  QVY
Sbjct  716   FMIYVHAKGMVVDDEYVLLGSANINQRSLAGTKDTEIAMGAYQQHHTWALKKRPPRGQVY  775

Query  457   GYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQV  278
             GYRMSLWAEHLG ++E  ++   LECVK VNEIA+ NW  Y  +    +QGHLL+YP+QV
Sbjct  776   GYRMSLWAEHLGELEECFNQPGSLECVKKVNEIADNNWNNYMGK--GSVQGHLLRYPIQV  833

Query  277   DSNGKVSPLGGCEYFPDVGGKVLGSRT-TLPDALTT  173
             D +G + PL G E FPDVGGKV+GS + T+PD LTT
Sbjct  834   DQDGNIGPLQGSEEFPDVGGKVVGSHSNTMPDVLTT  869



>gb|AAN05433.1| phospholipase D delta isoform 1a [Gossypium hirsutum]
Length=854

 Score =  1095 bits (2832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 539/855 (63%), Positives = 660/855 (77%), Gaps = 25/855 (3%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKP-------ETRQGNKVRR  2522
             S+ V+YL+GDLDL I+EAR+LPNMDIVS  +R+  T   C+ P       E  +  KV  
Sbjct  6     SKQVIYLYGDLDLTIIEARKLPNMDIVSNHLRKCLTCETCKAPSQAAAAQEPGEVGKVHH  65

Query  2521  HTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFG  2342
             H +I+TSDPYV + +  +T+ART V+ ++ +P W E F IP+AHP++E+E  VKD+D+ G
Sbjct  66    HHKIMTSDPYVTITVPQSTLARTPVLKSADNPEWNERFIIPMAHPLTELEINVKDDDLLG  125

Query  2341  ADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT  2162
             A+ IG  K  AQKI +GE I  WFP+IG+ GKPPKP  AI + MKFTPC ENP Y+  + 
Sbjct  126   AEVIGTTKFLAQKIATGERITGWFPLIGSSGKPPKPTTAIHIDMKFTPCEENPLYKQSLA  185

Query  2161  ED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILE  1991
              D    G++ +YFPMR G  VTLYQDAHVP+G LP+I++DDGK F+   CWED+C+AI E
Sbjct  186   SDPEQGGVRHTYFPMRKGNKVTLYQDAHVPDGMLPKIELDDGKVFNQGKCWEDLCYAISE  245

Query  1990  AHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHS  1811
             AHHM+YI GWS++HKVKLVREPTRPLP GG+LNLGELLKYKS+EGVRVLLLVWDDKTS  
Sbjct  246   AHHMIYIAGWSVFHKVKLVREPTRPLPRGGDLNLGELLKYKSEEGVRVLLLVWDDKTS-D  304

Query  1810  KFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIV  1631
             KF I   G+M THDEET KFFKHSSV CVLA RYA+SKL + KQ+VVG+++THHQK  +V
Sbjct  305   KFGIRKMGLMQTHDEETLKFFKHSSVMCVLAGRYAASKLGYFKQKVVGSMFTHHQKFALV  364

Query  1630  DTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQP  1451
             DTQA GNNRKITAF+GG+DLCDGRYDTP+HR+  D DT+F+ D++NPTF   G+K PRQP
Sbjct  365   DTQAAGNNRKITAFVGGIDLCDGRYDTPEHRILHDLDTIFKDDFHNPTF-SAGIKAPRQP  423

Query  1450  WHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSP  1271
             WHDLH +IEGPAAYD+L NFEQRWR+++KW +           +DDAL++IERISWI SP
Sbjct  424   WHDLHTRIEGPAAYDVLINFEQRWRESTKWKDFCLLCAGKMPSNDDALIRIERISWILSP  483

Query  1270  --------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVC  1115
                     T  +P DDP L V +  D  NW VQ+FRSIDSGS+KGFP+ +   E QNL+ 
Sbjct  484   SLAVTDHGTTIIPEDDPKLHVLSIDDRDNWDVQIFRSIDSGSVKGFPRPMRKPENQNLLV  543

Query  1114  AKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIV  935
             +K++VI++SIQ AYI+AIR AQH+IYIENQYFLGSSYAWPSYK+AGAD+LIPMELALK+ 
Sbjct  544   SKNVVIEKSIQTAYIQAIRSAQHYIYIENQYFLGSSYAWPSYKDAGADHLIPMELALKVA  603

Query  934   SKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHP  755
             SKIR RERFAVYIVIP+WPEG   S  VQ+ILYWQ QT+QMMY+I+A+ELKS +I D+HP
Sbjct  604   SKIRARERFAVYIVIPLWPEGDTKSLSVQEILYWQSQTMQMMYDIVARELKSMQITDSHP  663

Query  754   CDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGS  575
              DYLNFYCLG REE   E       G    ++ S K GRFMIYVHAKGMV+DDEYVIVGS
Sbjct  664   QDYLNFYCLGKREEVTPEMLG----GKGTSVSDSAKFGRFMIYVHAKGMVIDDEYVIVGS  719

Query  574   ANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEA  395
             ANINQRSMAG++D+EIAM AYQPH+TWA+ + HP  QVYGYRMSLWAEHLG + +   E 
Sbjct  720   ANINQRSMAGTKDSEIAMAAYQPHYTWAEKKKHPRGQVYGYRMSLWAEHLGELSKCFKEP  779

Query  394   EGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGK  215
             E LECVK VN +AE+NWK++T   +S LQGHL++YPL+VD +GKV PL G E FPDVGGK
Sbjct  780   ETLECVKTVNTVAEDNWKKFTDTDYSALQGHLMRYPLEVDIDGKVKPLPGYENFPDVGGK  839

Query  214   VLGSRTT-LPDALTT  173
             V+G+ +  LPD LTT
Sbjct  840   VIGTHSVKLPDILTT  854



>ref|XP_009355262.1| PREDICTED: phospholipase D delta-like [Pyrus x bretschneideri]
Length=845

 Score =  1095 bits (2831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 546/847 (64%), Positives = 665/847 (79%), Gaps = 17/847 (2%)
 Frame = -2

Query  2689  DGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAF-DCRKPETRQGNKVRRHTR  2513
             DG  +  + LHG+LDL I+EA+ LPNMD+ SER+R+ FT F  C  P   +  K     +
Sbjct  8     DGSPKEHIILHGELDLWIIEAKALPNMDLPSERMRRCFTMFGTCSTPFGNRPTKTASGKQ  67

Query  2512  -IITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGAD  2336
              +ITSDPYV VCLAGATVA+TR+ISN ++P W EHF +PVAHPV +VEF VKDNDV GA+
Sbjct  68    AMITSDPYVSVCLAGATVAQTRIISNCENPSWEEHFCVPVAHPVVKVEFHVKDNDVLGAE  127

Query  2335  FIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTE-  2159
              IGV ++S  KIISG+ INDWFPIIG HG   KP   + + ++F P   NP Y+ GV   
Sbjct  128   LIGVVEISVDKIISGKPINDWFPIIGNHGNCLKPFPELHVSIQFKPVEGNPLYKNGVGAG  187

Query  2158  -DY-GLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAH  1985
              DY G+  +YFP+R GG+VTLYQDAHVP   LPEI +D GK F    CWEDICHAILEA 
Sbjct  188   PDYKGVPNTYFPLRKGGSVTLYQDAHVPNNMLPEIVLDGGKIFQQGKCWEDICHAILEAQ  247

Query  1984  HMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKF  1805
             H++YI+GWS+YH+VKLVREPT+PLP+GG L LGELLKYKSQEG+RV++L+WDDKTSH K 
Sbjct  248   HLIYIIGWSVYHRVKLVREPTKPLPSGGELALGELLKYKSQEGIRVVMLIWDDKTSHDKL  307

Query  1804  FINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDT  1625
             F+ T GVM THDEET++FFKHSSV CVL+PRYAS+KLS  KQQVVGTL+THHQKCV++DT
Sbjct  308   FLKTEGVMQTHDEETKRFFKHSSVHCVLSPRYASNKLSIFKQQVVGTLFTHHQKCVLLDT  367

Query  1624  QAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWH  1445
              A GNNRKITAFIGGLD+CDGRYDTP+HRLF D  +VF+ D +NPTFP     GPR+PWH
Sbjct  368   -ASGNNRKITAFIGGLDMCDGRYDTPEHRLFKDVGSVFQNDIHNPTFPPND-HGPREPWH  425

Query  1444  DLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTP  1265
             DLHCKIEGPAAYDILTNFEQRWRKA K      + KK+++ HDDAL++++R+SWI SPT 
Sbjct  426   DLHCKIEGPAAYDILTNFEQRWRKAKK---RDFKIKKVTNRHDDALIRLDRVSWIVSPT-  481

Query  1264  SVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSI  1085
             S  + + ++ VS+E D +NWHVQVFRSIDSGS+KGFPK V  AE QNL+C K+L ID+SI
Sbjct  482   SNRDGEQNVRVSSEEDRENWHVQVFRSIDSGSVKGFPKGVQDAEAQNLICGKNLKIDKSI  541

Query  1084  QMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFA  905
              +AYI+AIR AQ FIYIENQYF+GSS+ WPSYK AGADNLIPMELALK+ SKI+  ERF+
Sbjct  542   HVAYIKAIRSAQRFIYIENQYFVGSSFYWPSYKNAGADNLIPMELALKVASKIKANERFS  601

Query  904   VYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDA-HPCDYLNFYCL  728
             VYIV+PMWPEGVP+++  Q+ILYWQ QT+ MMY+++   L+   + D  HP DYLNFYCL
Sbjct  602   VYIVVPMWPEGVPTASATQEILYWQAQTMGMMYQVVTSALQDAGLFDQYHPQDYLNFYCL  661

Query  727   GNREEWHEESASSP-TPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSM  551
             GNRE     S+S P  P  +  L  +QK  RFMIYVHAKGM+VDDEYVI+GSANINQRSM
Sbjct  662   GNRE---APSSSQPHQPTDNRGLLLAQKFRRFMIYVHAKGMIVDDEYVIMGSANINQRSM  718

Query  550   AGSRDTEIAMGAYQPHHTWAKNQN-HPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVK  374
              GSRDTEIAMGAYQPHHTWA  +N HPH QVYGYRMSLWAEHLG +++   + E LECVK
Sbjct  719   DGSRDTEIAMGAYQPHHTWAAEKNLHPHGQVYGYRMSLWAEHLGGVEDTYQDPESLECVK  778

Query  373   MVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTT  194
              VN+IA+ NWK + +E+   ++GHL+ YP+Q+  +G+VS L G E FPDVGGK++G+ T+
Sbjct  779   RVNDIAKLNWKAFVSEEHREMKGHLMTYPVQIGRDGRVSSLPGYESFPDVGGKIMGAPTS  838

Query  193   LPDALTT  173
             LPDALTT
Sbjct  839   LPDALTT  845



>gb|KHG21987.1| Phospholipase D delta -like protein [Gossypium arboreum]
Length=856

 Score =  1094 bits (2829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/862 (63%), Positives = 665/862 (77%), Gaps = 27/862 (3%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKP-------ETRQG  2537
             M +  S+ V+YL+GDLDL I+EAR+LPNMD+VS  +R+  T   C+ P       E  + 
Sbjct  1     MEEEGSKQVIYLYGDLDLTIIEARKLPNMDLVSNHLRKCLTCETCKTPSQAAAAPEPGEV  60

Query  2536  NKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKD  2357
              KV  H +I+TSDPYV V +  +T+ARTRV+ ++++P W E F IP+AHP++E+E  VKD
Sbjct  61    GKVHHHHKIMTSDPYVTVTVPQSTLARTRVLKSAENPKWNERFIIPMAHPLTELEINVKD  120

Query  2356  NDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRY  2177
             +D+ GA+ IG  K  A+KI +GE I  WFP+IG+ GKPPKP  AI + MKFTPC ENP Y
Sbjct  121   DDLLGAEVIGTTKFLAKKIATGERITGWFPLIGSSGKPPKPTTAIYIDMKFTPCEENPLY  180

Query  2176  RGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDIC  2006
             +  +  D    G++ +YFPMR G  VTLYQDAHVP+G LP+I++DDGK F+   CWED+C
Sbjct  181   KQSLASDPEQGGVRHTYFPMRKGNKVTLYQDAHVPDGMLPKIELDDGKVFNQGKCWEDLC  240

Query  2005  HAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDD  1826
             +AI EAHHM+YI GWS++HKVKLVREPTRPLP GG+LNLGELLKYKS+EGVRVLLLVWDD
Sbjct  241   YAISEAHHMIYIAGWSVFHKVKLVREPTRPLPRGGDLNLGELLKYKSEEGVRVLLLVWDD  300

Query  1825  KTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQ--VVGTLYTH  1652
             KTS  KF I   GVM THDEET KFFKHSSV CVLA RYA+SKL + KQ+  VVG+++TH
Sbjct  301   KTS-DKFGIRKVGVMKTHDEETLKFFKHSSVMCVLAGRYAASKLGYFKQKARVVGSMFTH  359

Query  1651  HQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGG  1472
             HQK  +VDTQA GNNRKITAF+GG+DLCDGRYDTP+HR+  D DT+F+ D++NPTF   G
Sbjct  360   HQKFALVDTQAAGNNRKITAFVGGIDLCDGRYDTPEHRILHDLDTIFKDDFHNPTF-SAG  418

Query  1471  LKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIER  1292
             +K PRQPWHDLH +IEGPAAYD+L NFEQRWR+++KW +           +DDAL++IER
Sbjct  419   IKAPRQPWHDLHTRIEGPAAYDVLINFEQRWRESTKWKDFCLLCAGKMPSNDDALIRIER  478

Query  1291  ISWITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTA  1136
             ISWI SP        T  +P DDP L V +  D  NW VQ+FRSIDSGS+KGFP+ +   
Sbjct  479   ISWILSPPLAVTDHGTTIIPEDDPKLHVLSIDDRDNWDVQIFRSIDSGSVKGFPRPMRKP  538

Query  1135  ETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPM  956
             E QNL+ +K++VI++SIQ AYI+AIR AQH+IYIENQYFLGSSYAWPSYK+AGAD+LIPM
Sbjct  539   ENQNLLVSKNVVIEKSIQTAYIQAIRSAQHYIYIENQYFLGSSYAWPSYKDAGADHLIPM  598

Query  955   ELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSE  776
             ELALK+ SKIR RERFAVY+VIP+WPEG   S  VQ+ILYWQ QT+QMMY+I+A+ELKS 
Sbjct  599   ELALKVASKIRARERFAVYVVIPLWPEGDTKSLSVQEILYWQSQTMQMMYDIVARELKSM  658

Query  775   KIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDD  596
             +I D+HP DYLNFYCLG REE   E       G    ++ S K GRFMIYVHAKGMV+DD
Sbjct  659   QITDSHPQDYLNFYCLGKREEVTPEMLG----GNGTSVSDSAKFGRFMIYVHAKGMVIDD  714

Query  595   EYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMM  416
             EYVIVGSANINQRSMAG++D+E+AM AYQPH+TWA+ + HP  QVYGYRMSLWAEHLG +
Sbjct  715   EYVIVGSANINQRSMAGTKDSELAMAAYQPHYTWAEKKKHPRGQVYGYRMSLWAEHLGEL  774

Query  415   DEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEY  236
             ++   E E LECVK VN IAE+NWK++T   +S LQGHL++YPL+VD +GKV PL G E 
Sbjct  775   NKCFKEPETLECVKTVNTIAEDNWKKFTDTDYSALQGHLMRYPLEVDIDGKVKPLPGYEN  834

Query  235   FPDVGGKVLGSRTT-LPDALTT  173
             FPDVGGKV+G+ +  LPD LTT
Sbjct  835   FPDVGGKVIGTHSVKLPDILTT  856



>ref|XP_008357632.1| PREDICTED: phospholipase D delta-like [Malus domestica]
Length=845

 Score =  1094 bits (2829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 546/847 (64%), Positives = 665/847 (79%), Gaps = 17/847 (2%)
 Frame = -2

Query  2689  DGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAF-DCRKPETRQGNKVRRHTR  2513
             DG  +  + LHG+LDL I+EA+ LPNMD+ SER+R+ FT F  C  P   +  K     +
Sbjct  8     DGSPKEHIILHGELDLWIIEAKALPNMDLPSERMRRCFTMFGTCSTPFGNRPTKTASGKQ  67

Query  2512  -IITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGAD  2336
              +ITSDPYV VCLAGATVA+TR+ISN ++P W EHF +PVAHPV +VEF VKDNDV GA+
Sbjct  68    AMITSDPYVSVCLAGATVAQTRIISNCENPSWEEHFCVPVAHPVVKVEFHVKDNDVLGAE  127

Query  2335  FIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTE-  2159
              IGV ++S  KIISG+ INDWFPIIG HG   KP   + + ++F P   NP Y+ GV   
Sbjct  128   LIGVVEISVDKIISGKPINDWFPIIGNHGNCLKPFPELHVSIQFKPVEGNPLYKNGVGAG  187

Query  2158  -DY-GLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAH  1985
              DY G+  +YFP+R GG+VTLYQDAHVP   LPEI ++ GK F    CWEDICHAILEA 
Sbjct  188   PDYKGVPNTYFPLRKGGSVTLYQDAHVPNNMLPEIVLEGGKIFQQGKCWEDICHAILEAQ  247

Query  1984  HMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKF  1805
             H++YI+GWS+YH+VKLVREPT PLP+GG L LGELLKYKSQEG+RV++L+WDDKTSH K 
Sbjct  248   HLIYIIGWSVYHRVKLVREPTXPLPSGGELALGELLKYKSQEGIRVVMLIWDDKTSHDKL  307

Query  1804  FINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDT  1625
             F+ T GVM THDEET++FFKHSSV CVL+PRYAS+KLS  KQQVVGTL+THHQKCV++DT
Sbjct  308   FLKTEGVMQTHDEETKRFFKHSSVHCVLSPRYASNKLSIFKQQVVGTLFTHHQKCVLLDT  367

Query  1624  QAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWH  1445
              A GNNRKITAFIGGLD+CDGRYDTP+HRLF D ++VF+ D +NPTFP     GPR+PWH
Sbjct  368   -ASGNNRKITAFIGGLDMCDGRYDTPEHRLFKDVNSVFQNDIHNPTFPPND-HGPREPWH  425

Query  1444  DLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTP  1265
             DLHCKIEGPAAYDILTNFEQRWRKA K      + KK+++ HDDAL++++R+SWI SPT 
Sbjct  426   DLHCKIEGPAAYDILTNFEQRWRKAKK---RDFKIKKVTNRHDDALIRLDRVSWIVSPT-  481

Query  1264  SVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSI  1085
             S  + + ++ VS+E D +NWHVQVFRSIDSGS+KGFPK V  AE QNL+C K+L ID+SI
Sbjct  482   SNRDGEQNVRVSSEEDRENWHVQVFRSIDSGSVKGFPKGVQDAEAQNLICGKNLKIDKSI  541

Query  1084  QMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFA  905
              +AYI+AIR AQ FIYIENQYF+GSS+ WPSYK AGADNLIPMELALK+ SKI+  ERF+
Sbjct  542   HVAYIKAIRSAQRFIYIENQYFVGSSFYWPSYKNAGADNLIPMELALKVASKIKANERFS  601

Query  904   VYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDA-HPCDYLNFYCL  728
             VYIV+PMWPEGVP+++  Q+ILYWQ QT+ MMY+++   L+   + D  HP DYLNFYCL
Sbjct  602   VYIVVPMWPEGVPTASATQEILYWQAQTMGMMYQVVTSALQDAGLFDQYHPQDYLNFYCL  661

Query  727   GNREEWHEESASSP-TPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSM  551
             GNRE     S+S P  P  +  L  +QK  RFMIYVHAKGM+VDDEYVI+GSANINQRSM
Sbjct  662   GNRE---APSSSQPHQPTDNRGLLLAQKFRRFMIYVHAKGMIVDDEYVILGSANINQRSM  718

Query  550   AGSRDTEIAMGAYQPHHTWAKNQN-HPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVK  374
              GSRDTEIAMGAYQPHHTWA  +N HPH QVYGYRMSLWAEHLG +++   + E LECVK
Sbjct  719   DGSRDTEIAMGAYQPHHTWAAEKNLHPHGQVYGYRMSLWAEHLGGVEDTYQDPESLECVK  778

Query  373   MVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTT  194
              VN+IA+ NWK + +E+   ++GHL+ YP+Q+  +G+VS L G E FPDVGGK+LG+ T+
Sbjct  779   RVNDIAKLNWKAFVSEEHREMKGHLMTYPVQIGRDGRVSSLPGYESFPDVGGKILGAPTS  838

Query  193   LPDALTT  173
             LPDALTT
Sbjct  839   LPDALTT  845



>ref|XP_004504195.1| PREDICTED: phospholipase D delta-like [Cicer arietinum]
Length=857

 Score =  1091 bits (2821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 541/846 (64%), Positives = 656/846 (78%), Gaps = 17/846 (2%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRR-HTRIIT  2504
             ++  V+LHGDLDL I+EA+ LPN+D+ +E IR+  T  +   P   +G K      +IIT
Sbjct  19    NKETVFLHGDLDLLIIEAKSLPNLDLSTETIRRCLTMGNSCTPPFVKGLKTHSGKDKIIT  78

Query  2503  SDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGV  2324
             SDPYV +CLAGAT+A+TRVI N ++P+W EHF +PVAHPV +VEF VKDND+ GA+ IGV
Sbjct  79    SDPYVSICLAGATIAQTRVIPNCENPLWDEHFIVPVAHPVQKVEFLVKDNDILGAELIGV  138

Query  2323  AKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYR------GGVT  2162
              ++  QKI+ G TINDWFPIIG +G   KP   + + +++ P   N   +      G V 
Sbjct  139   VEIPVQKILPGNTINDWFPIIGQYGNCLKPYPELHISIQYKPIGANSSSQYFRDDNGNV-  197

Query  2161  EDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHH  1982
              + G+  +YFP+R GG +TLYQDAHVP+  LPEI +D GK F H  CWEDICHAILEAHH
Sbjct  198   -NLGVPGTYFPLRKGGNITLYQDAHVPDDMLPEIPLDGGKVFQHSKCWEDICHAILEAHH  256

Query  1981  MVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFF  1802
             ++YIVGWSIYH VKLVREPT+PLP+GG L+LGELLKYKSQEG+RV++L+WDD+TSH KF 
Sbjct  257   LIYIVGWSIYHPVKLVREPTKPLPSGGELSLGELLKYKSQEGLRVVVLIWDDRTSHDKFL  316

Query  1801  INTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQ  1622
             + T GVM THDEET+KFFKHS+V CVL+PRYAS+KLS  KQQVVGTL++HHQKCV++DTQ
Sbjct  317   LKTDGVMQTHDEETKKFFKHSTVHCVLSPRYASNKLSIFKQQVVGTLFSHHQKCVLLDTQ  376

Query  1621  AQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHD  1442
               GNNRKITAF+GGLDLCDGRYDTP+HRLF D DTVF  DY+NPTF       PRQPWHD
Sbjct  377   GSGNNRKITAFMGGLDLCDGRYDTPEHRLFRDLDTVFEKDYHNPTFQLNAC-APRQPWHD  435

Query  1441  LHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPS  1262
             LHCK+EGPAAYDILTNFEQR RKA KW +   R +K+++WHDDALL+++RISWI  P+ S
Sbjct  436   LHCKVEGPAAYDILTNFEQRSRKAKKWRDF--RLRKVTNWHDDALLRLDRISWIVKPS-S  492

Query  1261  VPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQ  1082
              P+ D S+ V+ E DP+NWHVQVFRSIDSGS+KGFPKD   A++QNL+C K+L +D+SI 
Sbjct  493   GPDGDKSVRVTEETDPENWHVQVFRSIDSGSVKGFPKDFDKAKSQNLLCGKNLKVDQSIH  552

Query  1081  MAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAV  902
              AY++AIR AQ FIYIENQYFLGSSY WPSYK AGA++LIPMELALKI SKI   ERF+V
Sbjct  553   AAYVKAIRSAQRFIYIENQYFLGSSYHWPSYKNAGANHLIPMELALKIASKISANERFSV  612

Query  901   YIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDA-HPCDYLNFYCLG  725
             YIVIPMWPEGVP+SA VQ+IL+WQGQT+ MMY+IIA  L    + +  HP DYLNFYCLG
Sbjct  613   YIVIPMWPEGVPTSASVQEILFWQGQTMSMMYKIIADALARAGLSECYHPQDYLNFYCLG  672

Query  724   NREEWHEESASSPTPGCSE--FLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSM  551
              RE    ESA SP    SE   L   +K  RFMIYVHAKGM+VDD YVI+GSANINQRSM
Sbjct  673   KREPQLHESA-SPLHQSSENRALASVKKYRRFMIYVHAKGMIVDDGYVIIGSANINQRSM  731

Query  550   AGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKM  371
              GSRDTEIAMGAYQP +  A+N++ PH QVYGYRMSLWAEHLG +D+   E   LECV+ 
Sbjct  732   DGSRDTEIAMGAYQPKYILAENKSLPHGQVYGYRMSLWAEHLGGIDDTFGEPHSLECVRH  791

Query  370   VNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTL  191
             VN IA++NW  Y +E+   ++GHL++YP+ V  NGKVS L G E FPDVGGK+LGS  +L
Sbjct  792   VNRIAKKNWSLYVSEEGYQMRGHLMQYPVHVSRNGKVSSLDGHESFPDVGGKILGSHNSL  851

Query  190   PDALTT  173
             PDALTT
Sbjct  852   PDALTT  857



>ref|XP_003629955.1| Phospholipase D2 [Medicago truncatula]
 gb|AET04431.1| phospholipase D alpha 1 [Medicago truncatula]
Length=842

 Score =  1089 bits (2817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/846 (63%), Positives = 656/846 (78%), Gaps = 10/846 (1%)
 Frame = -2

Query  2698  KMSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRR-  2522
             ++  G +E  V+LHGDLDL I+EA+ LPN+D+ +E IR+  T  +   P   +G K    
Sbjct  3     QVQGGGNEYPVFLHGDLDLFIIEAKSLPNLDLSTEAIRKCLTMGNSCTPPFVKGLKTHSG  62

Query  2521  HTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFG  2342
               +IITSDPYV +CLAGAT+A+TRVI N ++P+W EHF +PVAHP  ++EF VKDND+ G
Sbjct  63    KDKIITSDPYVSICLAGATIAQTRVIPNCENPLWDEHFLVPVAHPAHKIEFLVKDNDILG  122

Query  2341  ADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT  2162
             A+ IGV ++  QKI+SG  +NDWFPIIG +G   KP   + + +++     N    G V 
Sbjct  123   AELIGVVEIPVQKILSGNILNDWFPIIGQYGNCLKPYPELHISIQYMSIDVNED-NGSV-  180

Query  2161  EDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHH  1982
              +YG+  +YFP+R GG VTLYQDAHVP+G LPEI+++ GK F H  CWEDICHAILEAHH
Sbjct  181   -NYGVPGTYFPLRRGGNVTLYQDAHVPDGMLPEIELEGGKMFQHSKCWEDICHAILEAHH  239

Query  1981  MVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFF  1802
             M+YI+GWSI+H VKLVREPT+PLP+GG L+LGELLKYKSQEG+RV++L+WDD+TSH KF 
Sbjct  240   MIYIIGWSIFHPVKLVREPTKPLPSGGELSLGELLKYKSQEGLRVVMLIWDDRTSHDKFL  299

Query  1801  INTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQ  1622
             + T GVM THDEET+KFFKHS+V C+L+PRYAS+KLS  KQQVVGTL+THHQKCV+VDTQ
Sbjct  300   LKTEGVMQTHDEETKKFFKHSTVHCILSPRYASNKLSIFKQQVVGTLFTHHQKCVLVDTQ  359

Query  1621  AQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFP-EGGLKGPRQPWH  1445
               GNNRKITAFIGGLDLCDGRYDTP+HRLFSD DTVF+ D++NPTF        PRQPWH
Sbjct  360   GSGNNRKITAFIGGLDLCDGRYDTPEHRLFSDLDTVFQNDFHNPTFQLNSNSSAPRQPWH  419

Query  1444  DLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTP  1265
             DLHCKIEGPAAYDILTNFEQR RKA KW +   R +K+++WHDDALL+++RISWI  P+ 
Sbjct  420   DLHCKIEGPAAYDILTNFEQRSRKAKKWRDF--RLRKVTNWHDDALLRLDRISWIVKPS-  476

Query  1264  SVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSI  1085
             S P+ D S+ V+ E DP+NWHVQVFRSIDSGS+KGFPKDV  A+ QNL+C K+L +D+SI
Sbjct  477   SGPDGDKSVRVTEETDPENWHVQVFRSIDSGSVKGFPKDVDKAKAQNLLCGKNLKVDQSI  536

Query  1084  QMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFA  905
               AY++AIR AQ F+YIENQYFLGSSY WP+Y+ AGA++LIPMELALKI SKI   ERF+
Sbjct  537   HAAYVKAIRSAQRFVYIENQYFLGSSYHWPTYRNAGANHLIPMELALKIASKIIAHERFS  596

Query  904   VYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDA-HPCDYLNFYCL  728
             VYIVIPMWPEGVP+SA VQ+IL+WQGQT+ MMY+I+A  L    + +  HP DYLNFYCL
Sbjct  597   VYIVIPMWPEGVPTSAAVQEILFWQGQTMSMMYKIVADALAKAGLSECYHPQDYLNFYCL  656

Query  727   GNREEWHEESASSPTPGC-SEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSM  551
             G RE    ES S+ +    +  L   +K  RFMIYVHAKGM+VDD YVI+GSANINQRSM
Sbjct  657   GKREPHSRESLSTQSQSSENRALVSVKKFRRFMIYVHAKGMIVDDGYVIIGSANINQRSM  716

Query  550   AGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKM  371
              GSRDTEIAMGAYQP HT A+  + P  QVYGYRMSLWAEHLG +D    E   LECV+ 
Sbjct  717   DGSRDTEIAMGAYQPKHTLAEKNSLPRGQVYGYRMSLWAEHLGGIDGSFTEPHTLECVRR  776

Query  370   VNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTL  191
             VN IA +NW  Y +E+   ++G+L+ YP+ V  NGKVS   G EYFPDVGGK+LGS+ +L
Sbjct  777   VNRIARKNWSIYVSEESLQMKGNLMHYPVHVSRNGKVSTQEGQEYFPDVGGKILGSQNSL  836

Query  190   PDALTT  173
             PDALTT
Sbjct  837   PDALTT  842



>ref|XP_009382050.1| PREDICTED: phospholipase D delta-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=850

 Score =  1089 bits (2816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/848 (63%), Positives = 641/848 (76%), Gaps = 16/848 (2%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKV-------RR  2522
             S+  + LHGDLDL+I+ AR L NMD+ +ER R+ F       P    G  +       R 
Sbjct  5     SDQAILLHGDLDLEIIAARDLLNMDLCAERFRRCFGLCGLPFPRPADGRNLPSSASAGRA  64

Query  2521  HTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFG  2342
               +IITSDPY KV +AGATVART VI N++DPVW + F+IP+AH  +++EFQVKDND+FG
Sbjct  65    RPKIITSDPYTKVVVAGATVARTHVIPNTEDPVWRQRFRIPLAHCAAKIEFQVKDNDLFG  124

Query  2341  ADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT  2162
             +  IG A + A  + S     +W PII   G+PPKPD A+ + + FTP   NP YR G+ 
Sbjct  125   SQLIGTATIPAALVASVGLSQEWLPIIAPTGRPPKPDSALLVSLSFTPVEANPLYRHGIA  184

Query  2161  ED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILE  1991
              D    G+ ++YF +R GG VTLYQDAHV  G LP I+++ GK F    CWEDICHAILE
Sbjct  185   GDRKHLGVSDTYFHLRKGGKVTLYQDAHVRAGELPGIELEGGKVFQQGKCWEDICHAILE  244

Query  1990  AHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHS  1811
             AHH++YIVGWS+Y KVKLVREPTR LP  G   LGELLKYKS+EGVRV +LVWDDKTSH 
Sbjct  245   AHHLIYIVGWSLYDKVKLVREPTRLLPAAGKCTLGELLKYKSEEGVRVCVLVWDDKTSHD  304

Query  1810  KFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIV  1631
             K+F  ++GVM THDEE RKFFKHSSV CVL+PRYAS KLS VKQQVVGTLYTHHQKC++V
Sbjct  305   KYFFKSAGVMQTHDEEIRKFFKHSSVICVLSPRYASGKLSMVKQQVVGTLYTHHQKCLLV  364

Query  1630  DTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQP  1451
             DT+A  + RKITAF+GGLDLCDGRYDTPQHRLF D ++V+  D++NP       KGPR+P
Sbjct  365   DTEASPSTRKITAFLGGLDLCDGRYDTPQHRLFQDLESVYDNDFHNPILSIQS-KGPREP  423

Query  1450  WHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSP  1271
             WHDLHCKIEGPAAYD+L NFEQRW+KA+++    +  K ++ W DDAL+KI+RISWI SP
Sbjct  424   WHDLHCKIEGPAAYDVLKNFEQRWKKATQFHVFRKHLKNVTRWQDDALIKIDRISWILSP  483

Query  1270  TPSVPN--DDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVI  1097
             +PS  N   DP++WV++E D +NWHVQVFRSIDSGS+KGFPK V  A + NLVC+K+LVI
Sbjct  484   SPSHTNAHGDPNIWVTSEEDCENWHVQVFRSIDSGSVKGFPKSVDEAGSMNLVCSKNLVI  543

Query  1096  DRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNR  917
             D+SI  AY++AIR A+HFIYIENQYFLGSSY W SY  AGADNLIPMELALKI SKIR  
Sbjct  544   DKSIHTAYVKAIRSARHFIYIENQYFLGSSYGWLSYDNAGADNLIPMELALKIASKIRAG  603

Query  916   ERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNF  737
             ERFAVYIVIPMWPEGVP+S  VQ+ILYWQGQT++MMY II +ELKS   + AHP +YLNF
Sbjct  604   ERFAVYIVIPMWPEGVPTSNYVQEILYWQGQTMKMMYSIIGEELKSTNNDKAHPQEYLNF  663

Query  736   YCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQR  557
             YCLG RE  +    S  T   S  +  S+K  RFMIYVHAKGMVVDDEYVI+GSANINQR
Sbjct  664   YCLGKRELPNHTIHS--TTQVSNEVVSSEKYRRFMIYVHAKGMVVDDEYVILGSANINQR  721

Query  556   SMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECV  377
             S+ GSRDTEIAMGAYQP++TW   + HP  Q+YGYRMSLWAEHLG +D    E   L+CV
Sbjct  722   SLDGSRDTEIAMGAYQPYYTWESKRIHPQGQIYGYRMSLWAEHLGGVDPLFKEPHSLDCV  781

Query  376   KMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRT  197
             K VN++AEENW RY AE   PL+GHLL YP+ VD++GKV PL G E FPDVGGKVLG  T
Sbjct  782   KYVNKLAEENWSRYNAEDIIPLKGHLLMYPISVDADGKVEPLPGKETFPDVGGKVLGEPT  841

Query  196   T-LPDALT  176
             T LPD LT
Sbjct  842   TPLPDELT  849



>ref|XP_009382051.1| PREDICTED: phospholipase D delta-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=849

 Score =  1087 bits (2811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/848 (63%), Positives = 641/848 (76%), Gaps = 17/848 (2%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKV-------RR  2522
             S+  + LHGDLDL+I+ AR L NMD+ +ER R+ F       P    G  +       R 
Sbjct  5     SDQAILLHGDLDLEIIAARDLLNMDLCAERFRRCFGLCGLPFPRPADGRNLPSSASAGRA  64

Query  2521  HTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFG  2342
               +IITSDPY KV +AGATVART VI N++DPVW + F+IP+AH  +++EFQVKDND+FG
Sbjct  65    RPKIITSDPYTKVVVAGATVARTHVIPNTEDPVWRQRFRIPLAHCAAKIEFQVKDNDLFG  124

Query  2341  ADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT  2162
             +  IG A + A  + S     +W PII   G+PPKPD A+ + + FTP   NP YR G+ 
Sbjct  125   SQLIGTATIPAALVASVGLSQEWLPIIAPTGRPPKPDSALLVSLSFTPVEANPLYRHGIA  184

Query  2161  ED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILE  1991
              D    G+ ++YF +R GG VTLYQDAHV  G LP I+++ GK F    CWEDICHAILE
Sbjct  185   GDRKHLGVSDTYFHLRKGGKVTLYQDAHVRAGELPGIELEGGKVFQQGKCWEDICHAILE  244

Query  1990  AHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHS  1811
             AHH++YIVGWS+Y KVKLVREPTR LP  G   LGELLKYKS+EGVRV +LVWDDKTSH 
Sbjct  245   AHHLIYIVGWSLYDKVKLVREPTRLLPAAGKCTLGELLKYKSEEGVRVCVLVWDDKTSHD  304

Query  1810  KFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIV  1631
             K+F  ++GVM THDEE RKFFKHSSV CVL+PRYAS KLS VKQQVVGTLYTHHQKC++V
Sbjct  305   KYFFKSAGVMQTHDEEIRKFFKHSSVICVLSPRYASGKLSMVKQQVVGTLYTHHQKCLLV  364

Query  1630  DTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQP  1451
             DT+A  + RKITAF+GGLDLCDGRYDTPQHRLF D ++V+  D++NP       KGPR+P
Sbjct  365   DTEASPSTRKITAFLGGLDLCDGRYDTPQHRLFQDLESVYDNDFHNPILSIQS-KGPREP  423

Query  1450  WHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSP  1271
             WHDLHCKIEGPAAYD+L NFEQRW+KA+++    +  K ++ W DDAL+KI+RISWI SP
Sbjct  424   WHDLHCKIEGPAAYDVLKNFEQRWKKATQFHVFRKHLKNVTRWQDDALIKIDRISWILSP  483

Query  1270  TPSVPN--DDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVI  1097
             +PS  N   DP++WV++E D +NWHVQVFRSIDSGS+KGFPK V  A + NLVC+K+LVI
Sbjct  484   SPSHTNAHGDPNIWVTSEEDCENWHVQVFRSIDSGSVKGFPKSVDEAGSMNLVCSKNLVI  543

Query  1096  DRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNR  917
             D+SI  AY++AIR A+HFIYIENQYFLGSSY W SY  AGADNLIPMELALKI SKIR  
Sbjct  544   DKSIHTAYVKAIRSARHFIYIENQYFLGSSYGWLSYDNAGADNLIPMELALKIASKIRAG  603

Query  916   ERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNF  737
             ERFAVYIVIPMWPEGVP+S  VQ+ILYWQGQT++MMY II +ELKS   + AHP +YLNF
Sbjct  604   ERFAVYIVIPMWPEGVPTSNYVQEILYWQGQTMKMMYSIIGEELKSTNNDKAHPQEYLNF  663

Query  736   YCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQR  557
             YCLG R E    +  S T   +E    S+K  RFMIYVHAKGMVVDDEYVI+GSANINQR
Sbjct  664   YCLGKR-ELPNHTIHSTTQVSNE--VSSEKYRRFMIYVHAKGMVVDDEYVILGSANINQR  720

Query  556   SMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECV  377
             S+ GSRDTEIAMGAYQP++TW   + HP  Q+YGYRMSLWAEHLG +D    E   L+CV
Sbjct  721   SLDGSRDTEIAMGAYQPYYTWESKRIHPQGQIYGYRMSLWAEHLGGVDPLFKEPHSLDCV  780

Query  376   KMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRT  197
             K VN++AEENW RY AE   PL+GHLL YP+ VD++GKV PL G E FPDVGGKVLG  T
Sbjct  781   KYVNKLAEENWSRYNAEDIIPLKGHLLMYPISVDADGKVEPLPGKETFPDVGGKVLGEPT  840

Query  196   T-LPDALT  176
             T LPD LT
Sbjct  841   TPLPDELT  848



>ref|XP_009382053.1| PREDICTED: phospholipase D delta-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=845

 Score =  1085 bits (2807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 536/848 (63%), Positives = 639/848 (75%), Gaps = 21/848 (2%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKV-------RR  2522
             S+  + LHGDLDL+I+ AR L NMD+ +ER R+ F       P    G  +       R 
Sbjct  5     SDQAILLHGDLDLEIIAARDLLNMDLCAERFRRCFGLCGLPFPRPADGRNLPSSASAGRA  64

Query  2521  HTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFG  2342
               +IITSDPY KV +AGATVART VI N++DPVW + F+IP+AH  +++EFQVKDND+FG
Sbjct  65    RPKIITSDPYTKVVVAGATVARTHVIPNTEDPVWRQRFRIPLAHCAAKIEFQVKDNDLFG  124

Query  2341  ADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT  2162
             +  IG A + A  + S     +W PII   G+PPKPD A+ + + FTP   NP YR G+ 
Sbjct  125   SQLIGTATIPAALVASVGLSQEWLPIIAPTGRPPKPDSALLVSLSFTPVEANPLYRHGIA  184

Query  2161  ED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILE  1991
              D    G+ ++YF +R GG VTLYQDAHV  G LP I+++ GK F    CWEDICHAILE
Sbjct  185   GDRKHLGVSDTYFHLRKGGKVTLYQDAHVRAGELPGIELEGGKVFQQGKCWEDICHAILE  244

Query  1990  AHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHS  1811
             AHH++YIVGWS+Y KVKLVREPTR LP  G   LGELLKYKS+EGVRV +LVWDDKTSH 
Sbjct  245   AHHLIYIVGWSLYDKVKLVREPTRLLPAAGKCTLGELLKYKSEEGVRVCVLVWDDKTSHD  304

Query  1810  KFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIV  1631
             K+F  ++GVM THDEE RKFFKHSSV CVL+PRYAS KLS VKQQVVGTLYTHHQKC++V
Sbjct  305   KYFFKSAGVMQTHDEEIRKFFKHSSVICVLSPRYASGKLSMVKQQVVGTLYTHHQKCLLV  364

Query  1630  DTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQP  1451
             DT+A  + RKITAF+GGLDLCDGRYDTPQHRLF D ++V+  D++NP       KGPR+P
Sbjct  365   DTEASPSTRKITAFLGGLDLCDGRYDTPQHRLFQDLESVYDNDFHNPILSIQS-KGPREP  423

Query  1450  WHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSP  1271
             WHDLHCKIEGPAAYD+L NFEQRW+KA+++    +  K ++ W DDAL+KI+RISWI SP
Sbjct  424   WHDLHCKIEGPAAYDVLKNFEQRWKKATQFHVFRKHLKNVTRWQDDALIKIDRISWILSP  483

Query  1270  TPSVPN--DDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVI  1097
             +PS  N   DP++WV++E D +NWHVQVFRSIDSGS+KGFPK V  A + NLVC+K+LVI
Sbjct  484   SPSHTNAHGDPNIWVTSEEDCENWHVQVFRSIDSGSVKGFPKSVDEAGSMNLVCSKNLVI  543

Query  1096  DRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNR  917
             D+SI  AY++AIR A+HFIYIENQYFLGSSY W SY  AGADNLIPMELALKI SKIR  
Sbjct  544   DKSIHTAYVKAIRSARHFIYIENQYFLGSSYGWLSYDNAGADNLIPMELALKIASKIRAG  603

Query  916   ERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNF  737
             ERFAVYIVIPMWPEGVP+S  VQ+ILYWQGQT++MMY II +ELKS   + AHP +YLNF
Sbjct  604   ERFAVYIVIPMWPEGVPTSNYVQEILYWQGQTMKMMYSIIGEELKSTNNDKAHPQEYLNF  663

Query  736   YCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQR  557
             YCLG RE  +    S+           S+K  RFMIYVHAKGMVVDDEYVI+GSANINQR
Sbjct  664   YCLGKRELPNHTIHSTTQ-------VSSEKYRRFMIYVHAKGMVVDDEYVILGSANINQR  716

Query  556   SMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECV  377
             S+ GSRDTEIAMGAYQP++TW   + HP  Q+YGYRMSLWAEHLG +D    E   L+CV
Sbjct  717   SLDGSRDTEIAMGAYQPYYTWESKRIHPQGQIYGYRMSLWAEHLGGVDPLFKEPHSLDCV  776

Query  376   KMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRT  197
             K VN++AEENW RY AE   PL+GHLL YP+ VD++GKV PL G E FPDVGGKVLG  T
Sbjct  777   KYVNKLAEENWSRYNAEDIIPLKGHLLMYPISVDADGKVEPLPGKETFPDVGGKVLGEPT  836

Query  196   T-LPDALT  176
             T LPD LT
Sbjct  837   TPLPDELT  844



>gb|KCW62830.1| hypothetical protein EUGRSUZ_G00422 [Eucalyptus grandis]
Length=880

 Score =  1084 bits (2804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/851 (63%), Positives = 651/851 (76%), Gaps = 27/851 (3%)
 Frame = -2

Query  2668  VYLHGDLDLKILEARRLPNMDIVSERIRQFFT--------AFDCRKP-ETRQGNKVRRHT  2516
             ++LHG+LD+ I EA+ LPNMD+ SERIRQ  +        A   ++P   R   K     
Sbjct  38    IFLHGELDMYIAEAKSLPNMDLASERIRQCCSMIGPPCVPALHGQRPVPARSSGK----N  93

Query  2515  RIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGAD  2336
              +ITSDPYV VCLAGATVA+TRVI N ++P+W E F +PVAHPV +VEF VKDNDVFGA+
Sbjct  94    SMITSDPYVSVCLAGATVAQTRVIQNCENPLWDERFCVPVAHPVVKVEFHVKDNDVFGAE  153

Query  2335  FIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT--  2162
              IGV ++   KI+S + INDWFPIIG  G P KP   + + ++F P ++NP Y+ GV   
Sbjct  154   LIGVVEIPVAKIVSSDMINDWFPIIGNFGSPLKPYPELHISIQFRPVSDNPLYKDGVGVG  213

Query  2161  EDY-GLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAH  1985
              +Y G+  +YFP+R GG VTLYQDAHVP+G LP+I +DDGK +    CWEDICHAILEAH
Sbjct  214   PNYVGVTNTYFPLRKGGDVTLYQDAHVPKGKLPQILLDDGKIYEQGRCWEDICHAILEAH  273

Query  1984  HMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKF  1805
             H++YI+GWSIYH V+LVREPTR LPNGG L+LGELLKYKS+EGVRV++LVWDDKTSH KF
Sbjct  274   HLIYIIGWSIYHPVRLVREPTRELPNGGELSLGELLKYKSEEGVRVVVLVWDDKTSHDKF  333

Query  1804  FINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDT  1625
              +   GVM THDEET+KFF+HS V CVLAPRYAS+KLS  KQQVVGTLYTHHQKCV++DT
Sbjct  334   LLKMDGVMQTHDEETKKFFRHSGVRCVLAPRYASTKLSIFKQQVVGTLYTHHQKCVVLDT  393

Query  1624  QAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWH  1445
             QA GNNRKITAFIGGLDLCDGRYDTP+HRL+SD DTVF+ D +NPTF    +  PR+PWH
Sbjct  394   QALGNNRKITAFIGGLDLCDGRYDTPEHRLYSDLDTVFKNDIHNPTF-MSTVNVPREPWH  452

Query  1444  DLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTP  1265
             DLHCK+EG AAYDIL NFEQRW+K +KW E   + K + HWH++ALL+++RISWI  P+ 
Sbjct  453   DLHCKVEGQAAYDILKNFEQRWKKVAKWREF--KLKNVRHWHENALLRLDRISWILCPST  510

Query  1264  SVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSI  1085
             S P+ D  + V +E D +NWHVQ+FRSIDSGS+KGFPK V  A  QNL+C K+L +D+SI
Sbjct  511   S-PDGDKKVQVRDEDDLENWHVQIFRSIDSGSVKGFPKSVEEAAKQNLICGKNLKVDKSI  569

Query  1084  QMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFA  905
               AY++AIR AQHFIYIENQYF GSSY WPSYK AGA+NL+PMELALKI SKI   + F 
Sbjct  570   HTAYVKAIRSAQHFIYIENQYFFGSSYHWPSYKNAGANNLVPMELALKITSKISENKCFR  629

Query  904   VYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDA-HPCDYLNFYCL  728
             VYIVIPMWPEGVP+SA VQ+IL WQGQT+ MMY+IIA+ L+   +    HP DYLNFYCL
Sbjct  630   VYIVIPMWPEGVPTSAAVQEILLWQGQTMTMMYKIIAQALEKAGLSHKYHPSDYLNFYCL  689

Query  727   GNREEWHEESASSPT---PGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQR  557
             G +E      +SS        +  L   QK  RFMIYVHAKGM+VDDEYVI+GSANINQR
Sbjct  690   GKQEPLSSTQSSSQAMNQQSENNALASVQKFRRFMIYVHAKGMIVDDEYVIMGSANINQR  749

Query  556   SMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECV  377
             S+ GSRDTEIAMGAYQPHH WA  + HPH QVYGYRMSLWAEHL  +++   E +  ECV
Sbjct  750   SLDGSRDTEIAMGAYQPHHIWAGKKRHPHGQVYGYRMSLWAEHLEDLEDSFREPQSTECV  809

Query  376   KMVNEIAEENWKRYTAE-KFSP--LQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLG  206
             K VN+IA+ NWK Y  E + +P  ++GHL++YP+ V  +GKVSPL G E FPDVGGK+LG
Sbjct  810   KRVNKIAKRNWKAYVDEDQHNPKEMRGHLMQYPIHVSRDGKVSPLAGFEMFPDVGGKILG  869

Query  205   SRTTLPDALTT  173
             S TTLPDALTT
Sbjct  870   SPTTLPDALTT  880



>gb|EEC76498.1| hypothetical protein OsI_14257 [Oryza sativa Indica Group]
Length=845

 Score =  1082 bits (2799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/846 (63%), Positives = 644/846 (76%), Gaps = 22/846 (3%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAF-----DCRKPETRQGNKVRRHT  2516
             SE+ V LHGDLD+ I EA+ LPNMDI+SER+R+FFT +      C     R+G    R  
Sbjct  12    SESAVLLHGDLDIWITEAKCLPNMDIMSERMRRFFTGYGACGSSCAGDNARRGGVGVRPK  71

Query  2515  RIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGAD  2336
             +IITSDPYV VCLAGATVA+TRVI NS++P W E F++ VAH VS +EF VKDNDVFGA 
Sbjct  72    KIITSDPYVSVCLAGATVAQTRVIPNSENPRWEERFRVEVAHAVSRLEFHVKDNDVFGAQ  131

Query  2335  FIGVAKVSAQKIISGETINDWFPIIG-AHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTE  2159
              IGVA +   +I+SG     WFPI G     P +P   +RL +++ P  +NP YRGG   
Sbjct  132   LIGVASLPVDRILSGAPAEGWFPIDGHCSSNPMRPPPELRLSVQYRPIDDNPLYRGGAG-  190

Query  2158  DYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHM  1979
                +  +YFP+R GG VTLYQDAHV +G LP I+I  G+A+ H  CWEDICH+I+EAHH+
Sbjct  191   --AVPNAYFPLRRGGGVTLYQDAHVADGGLPAIQIAGGRAYEHGRCWEDICHSIVEAHHL  248

Query  1978  VYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFI  1799
             VY+VGWSIYH VKLVREPTR LP      LGELLK +++EGVR+++L+WDDKTSH KF +
Sbjct  249   VYMVGWSIYHPVKLVREPTRALPGETPSTLGELLKKRAREGVRIVILLWDDKTSHDKFLL  308

Query  1798  NTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQA  1619
              T GVM THDEET+KFF+HS V CVL PRYAS+KLS  KQQVVGTL+THHQKCV+VDTQA
Sbjct  309   KTDGVMHTHDEETKKFFRHSGVHCVLVPRYASTKLSIFKQQVVGTLFTHHQKCVLVDTQA  368

Query  1618  QGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDL  1439
              GNNRKITAFIGGLDLCDGRYDTP+HRLF D DT F  D++NPTFP     GPRQPWHDL
Sbjct  369   TGNNRKITAFIGGLDLCDGRYDTPEHRLFKDLDTAFNKDFHNPTFPVNSY-GPRQPWHDL  427

Query  1438  HCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSV  1259
             HCKIEGPAA+DILTNFEQRWRKA+KW       KK++ WH D L+KI R+SWI +P    
Sbjct  428   HCKIEGPAAFDILTNFEQRWRKATKWKV---NLKKVASWHHDTLIKINRMSWIVTPAA--  482

Query  1258  PNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQM  1079
               D+ +  V  E DP+NWHVQVFRSIDSGS+KGFPK V  AE+QNLVCAK+L ID+SI  
Sbjct  483   --DEANAHVCEEKDPENWHVQVFRSIDSGSVKGFPKIVQEAESQNLVCAKNLKIDKSIHS  540

Query  1078  AYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVY  899
             AY++AIR AQHFIYIENQYF+GSS+ W S+K AGADNLIP+ELALKI SKI+  E+FAVY
Sbjct  541   AYVKAIRSAQHFIYIENQYFIGSSFLWSSHKSAGADNLIPVELALKIASKIKANEQFAVY  600

Query  898   IVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNR  719
             IV+PMWPEG+P++AP+Q IL+WQGQT+ MMY+IIA  L+ + + +AHP DYLNFYCLG R
Sbjct  601   IVLPMWPEGIPTAAPMQQILFWQGQTMSMMYKIIADALRMQGLVEAHPQDYLNFYCLGKR  660

Query  718   EEWHEESASSPTPGCSE--FLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAG  545
             E    +S S  T  C++   L  +QK  RFMIYVH+KGMVVDDEYVI+GSANINQRSM G
Sbjct  661   EVAAGDSMSQ-TSLCNDNSTLRSAQKLRRFMIYVHSKGMVVDDEYVIIGSANINQRSMEG  719

Query  544   SRDTEIAMGAYQPHHTWAK--NQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKM  371
              RDTEIAMGAYQPH+ W+   +Q  P  QVYGYRMSLWAEHLG ++E     E  ECV+ 
Sbjct  720   CRDTEIAMGAYQPHYKWSADHDQGPPRGQVYGYRMSLWAEHLGAVEECFGRPETGECVRR  779

Query  370   VNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTL  191
             V E+AEENW+ Y + +    +GHL+ YPL+VD +G+V  L G + FPDVGGKVLG++T+L
Sbjct  780   VREMAEENWRAYVSPEMEETKGHLMCYPLKVDKDGRVRALPGHDCFPDVGGKVLGTQTSL  839

Query  190   PDALTT  173
             P+ALTT
Sbjct  840   PNALTT  845



>gb|AAF78756.1|AF271358_1 phospholipase D [Oryza sativa Indica Group]
Length=849

 Score =  1081 bits (2795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 534/849 (63%), Positives = 644/849 (76%), Gaps = 24/849 (3%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAF-----DCRKPETRQGNKVRRHT  2516
             SE+ V LHGDLD+ I EA+ LPNMDI+SER+R+FFT +      C     R+G    R  
Sbjct  12    SESAVLLHGDLDIWITEAKCLPNMDIMSERMRRFFTGYGACGSSCAGDNARRGGVGVRPK  71

Query  2515  RIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGAD  2336
             +IITSDPYV VCLAGATVA+TRVI NS++P W E F++ VAH VS +EF VKDNDVFGA 
Sbjct  72    KIITSDPYVSVCLAGATVAQTRVIPNSENPRWEERFRVEVAHAVSRLEFHVKDNDVFGAQ  131

Query  2335  FIGVAKVSAQKIISGETINDWFPIIG-AHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTE  2159
              IGVA +   +I+SG     WFPI G     P +P   +RL +++ P  +NP YRGG   
Sbjct  132   LIGVASLPVDRILSGAPAEGWFPIDGHCSSNPMRPPPELRLSVQYRPIDDNPLYRGGAG-  190

Query  2158  DYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHM  1979
                +  +YFP+R GG VTLYQDAHV +G LP I+I  G+A+ H  CWEDICH+I+EAHH+
Sbjct  191   --AVPNAYFPLRRGGGVTLYQDAHVADGGLPAIQIAGGRAYEHGRCWEDICHSIVEAHHL  248

Query  1978  VYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFI  1799
             VY+VGWSIYH VKLVREPTR LP      LGELLK K++EGVR+++L+WDDKTSH KF +
Sbjct  249   VYMVGWSIYHPVKLVREPTRALPGETPSTLGELLKKKAREGVRIVILLWDDKTSHDKFLL  308

Query  1798  NTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQA  1619
              T GVM THDEET+KFF+HS V CVL PRYAS+KLS  KQQVVGTL+THHQKCV+VDTQA
Sbjct  309   KTDGVMHTHDEETKKFFRHSGVHCVLVPRYASTKLSIFKQQVVGTLFTHHQKCVLVDTQA  368

Query  1618  QGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEG---GLKGPRQPW  1448
              GNNRKITAFIGGLDLCDGRYDTP+HRLF D DT F  D++NPTFP        GPRQPW
Sbjct  369   TGNNRKITAFIGGLDLCDGRYDTPEHRLFKDLDTAFNKDFHNPTFPVSSPVNSYGPRQPW  428

Query  1447  HDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPT  1268
             HDLHCKIEGPAA+DILTNFEQRWRKA+KW       KK++ WH D L+KI R+SWI +P 
Sbjct  429   HDLHCKIEGPAAFDILTNFEQRWRKATKWKV---NLKKVASWHHDTLIKINRMSWIVTPA  485

Query  1267  PSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRS  1088
                  D+ +  V  E DP+NWHVQVFRSIDSGS+KGFPK V  AE+QNLVCAK+L ID+S
Sbjct  486   A----DEANAHVCEEKDPENWHVQVFRSIDSGSVKGFPKIVQEAESQNLVCAKNLKIDKS  541

Query  1087  IQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERF  908
             I  AY++AIR AQHFIYIENQYF+GSS+ W S+K AGADNLIP+ELALKI SKI+  E+F
Sbjct  542   IHSAYVKAIRSAQHFIYIENQYFIGSSFLWSSHKSAGADNLIPVELALKIASKIKANEQF  601

Query  907   AVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCL  728
             AVYIV+PMWPEG+P++AP+Q IL+WQGQT+ MMY+IIA  L+ + + +AHP DYLNFYCL
Sbjct  602   AVYIVLPMWPEGIPTAAPMQQILFWQGQTMSMMYKIIADALRMQGLVEAHPQDYLNFYCL  661

Query  727   GNREEWHEESASSPTPGCSE--FLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRS  554
             G RE    +S S  T  C++   L  +QK  RFMIYVH+KGMVVDDEYVI+GSANINQRS
Sbjct  662   GKREVAAGDSMSQ-TSLCNDNSTLRSAQKLRRFMIYVHSKGMVVDDEYVIIGSANINQRS  720

Query  553   MAGSRDTEIAMGAYQPHHTWAK--NQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLEC  380
             M G RDTEIAMGAYQPH+ W+   +Q  P  QVYGYRMSLWAEHLG ++E     E  EC
Sbjct  721   MEGCRDTEIAMGAYQPHYKWSADHDQGPPRGQVYGYRMSLWAEHLGAVEECFGRPETGEC  780

Query  379   VKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSR  200
             V+ V E+AEENW+ Y + +    +GHL+ YPL+VD +G+V  L G + FPDVGGKVLG++
Sbjct  781   VRRVREMAEENWRAYVSPEMEETKGHLMCYPLKVDKDGRVRALPGHDCFPDVGGKVLGTQ  840

Query  199   TTLPDALTT  173
             T+LP+ALTT
Sbjct  841   TSLPNALTT  849



>ref|XP_009109270.1| PREDICTED: phospholipase D delta-like isoform X1 [Brassica rapa]
Length=846

 Score =  1080 bits (2794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 539/860 (63%), Positives = 655/860 (76%), Gaps = 33/860 (4%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQ--GNKVR  2525
             M++ +SE+V+ LHGDLDLKI++ARRLPN D  SER+R+ F   + C KP T    G    
Sbjct  1     MAENVSEDVILLHGDLDLKIVQARRLPNRDTFSERMRRCFKPCNSCIKPTTDDYDGEASS  60

Query  2524  RHTRI-----ITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVK  2360
                 I      TSDPYV V +  AT+ART V+ N+ DPVW  HFK+ VAHP+S ++F+VK
Sbjct  61    DDENIPGLPRNTSDPYVTVSVPHATLARTHVLKNASDPVWNRHFKVSVAHPLSYLKFKVK  120

Query  2359  DNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPC--AEN  2186
             D DV GA  IG  ++  Q+I SGE I  WFP++G  GKPPK + A+R+ +KFT     + 
Sbjct  121   DYDVSGAQTIGTVRIPVQQIASGERIWGWFPVLGGSGKPPKKETALRIDLKFTSFDKIQT  180

Query  2185  PRYRGGVTEDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDIC  2006
              +  GGV        +YFP+R G  V LYQDAHV +G LPEI++D+G  + H  CWEDIC
Sbjct  181   NKTLGGVMG------TYFPLRKGSQVRLYQDAHVMDGMLPEIRLDNGDVYQHGKCWEDIC  234

Query  2005  HAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDD  1826
             HAI EAHHM+YIVGWS++HKVKLVREPTR LP GG+L LGELLKYKS+EGVRVLLLVWDD
Sbjct  235   HAICEAHHMIYIVGWSVFHKVKLVREPTRELPRGGDLTLGELLKYKSEEGVRVLLLVWDD  294

Query  1825  KTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQ  1646
             K+S  KF I+T GVMGTHDEETRKFFKHSSV C+L+PRYAS+KL   KQQVVGTL+THHQ
Sbjct  295   KSSRDKFGISTPGVMGTHDEETRKFFKHSSVKCILSPRYASNKLGLFKQQVVGTLFTHHQ  354

Query  1645  KCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLK  1466
             KCV+VDTQA G+NRK+TAFIGG+DLCDGRYDTP+HR+F D DTVF+ D++NPTFP G + 
Sbjct  355   KCVLVDTQAVGSNRKVTAFIGGIDLCDGRYDTPEHRIFHDLDTVFKDDFHNPTFPSGAI-  413

Query  1465  GPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERIS  1286
              PRQPWHD+HC+++GPAAYD+L NFEQRWRKA++W E   + K +  W DD+LL+I RIS
Sbjct  414   APRQPWHDMHCRLDGPAAYDVLINFEQRWRKATRWKEFNLKGKTL--WLDDSLLRIGRIS  471

Query  1285  WITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAET  1130
             WI +P           VP DDP ++VSNE DP+NWHVQVFRSIDSGS+KGFPK  + AE 
Sbjct  472   WILNPKFKYRIDGVLDVPEDDPVVYVSNEDDPENWHVQVFRSIDSGSVKGFPKCENEAEA  531

Query  1129  QNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMEL  950
              +L   K LV+D+SIQ AYI+ IR AQHFI+IENQYFLGSSYAWP Y +AGADNLIPMEL
Sbjct  532   LHLQYDKRLVVDKSIQTAYIQIIRSAQHFIFIENQYFLGSSYAWPDYNDAGADNLIPMEL  591

Query  949   ALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKI  770
             ALKI SKIR +ERFAVY+VIPMWPEG P S P+Q+ILYWQ QT+QMMY++IA+ELKS + 
Sbjct  592   ALKITSKIRAKERFAVYVVIPMWPEGDPKSGPMQEILYWQSQTMQMMYDVIARELKSHQ-  650

Query  769   EDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEY  590
              +AHP DYLNFYCLG RE+  ++  ++   G    +T S K  RFMIYVHAKGM+VDDEY
Sbjct  651   SNAHPLDYLNFYCLGKREQLPDDMPATNVSG----VTDSYKFQRFMIYVHAKGMIVDDEY  706

Query  589   VIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDE  410
             V++GSANINQRSMAG++DTEIAMGAYQPHHTWA    HP  QVYGYRMSLWAEHLG   +
Sbjct  707   VLMGSANINQRSMAGTKDTEIAMGAYQPHHTWANKGKHPRGQVYGYRMSLWAEHLGKTGD  766

Query  409   KLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFP  230
                E   L+CVK VNEIAE NW+++   +FS LQGHL+KYPL VD +G V+ L G + FP
Sbjct  767   DFVEPGDLKCVKNVNEIAERNWRKFIDSEFSELQGHLIKYPLHVDIDGNVTSLPGYDSFP  826

Query  229   DVGGKVLGSRT-TLPDALTT  173
             DVGGK++G  +  +PD LTT
Sbjct  827   DVGGKIIGDHSKAIPDTLTT  846



>ref|XP_009382054.1| PREDICTED: phospholipase D delta-like isoform X4 [Musa acuminata 
subsp. malaccensis]
Length=840

 Score =  1080 bits (2793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 534/848 (63%), Positives = 638/848 (75%), Gaps = 26/848 (3%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKV-------RR  2522
             S+  + LHGDLDL+I+ AR L NMD+ +ER R+ F       P    G  +       R 
Sbjct  5     SDQAILLHGDLDLEIIAARDLLNMDLCAERFRRCFGLCGLPFPRPADGRNLPSSASAGRA  64

Query  2521  HTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFG  2342
               +IITSDPY KV +AGATVART VI N++DPVW + F+IP+AH  +++EFQVKDND+FG
Sbjct  65    RPKIITSDPYTKVVVAGATVARTHVIPNTEDPVWRQRFRIPLAHCAAKIEFQVKDNDLFG  124

Query  2341  ADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT  2162
             +  IG A + A  + S     +W PII   G+PPKPD A+ + + FTP   NP YR G+ 
Sbjct  125   SQLIGTATIPAALVASVGLSQEWLPIIAPTGRPPKPDSALLVSLSFTPVEANPLYRHGIA  184

Query  2161  ED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILE  1991
              D    G+ ++YF +R GG VTLYQDAHV  G LP I+++ GK F    CWEDICHAILE
Sbjct  185   GDRKHLGVSDTYFHLRKGGKVTLYQDAHVRAGELPGIELEGGKVFQQGKCWEDICHAILE  244

Query  1990  AHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHS  1811
             AHH++YIVGWS+Y KVKLVREPTR LP  G   LGELLKYKS+EGVRV +LVWDDKTSH 
Sbjct  245   AHHLIYIVGWSLYDKVKLVREPTRLLPAAGKCTLGELLKYKSEEGVRVCVLVWDDKTSHD  304

Query  1810  KFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIV  1631
             K+F  ++GVM THDEE RKFFKHSSV CVL+PRYAS KLS VKQQVVGTLYTHHQKC++V
Sbjct  305   KYFFKSAGVMQTHDEEIRKFFKHSSVICVLSPRYASGKLSMVKQQVVGTLYTHHQKCLLV  364

Query  1630  DTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQP  1451
             DT+A  + RKITAF+GGLDLCDGRYDTPQHRLF D ++V+  D++NP       KGPR+P
Sbjct  365   DTEASPSTRKITAFLGGLDLCDGRYDTPQHRLFQDLESVYDNDFHNPILSIQS-KGPREP  423

Query  1450  WHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSP  1271
             WHDLHCKIEGPAAYD+L NFEQRW+KA+++    +  K ++ W DDAL+KI+RISWI SP
Sbjct  424   WHDLHCKIEGPAAYDVLKNFEQRWKKATQFHVFRKHLKNVTRWQDDALIKIDRISWILSP  483

Query  1270  TPSVPN--DDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVI  1097
             +PS  N   DP++WV++E D +NWHVQVFRSIDSGS+KGFPK V  A + NLVC+K+LVI
Sbjct  484   SPSHTNAHGDPNIWVTSEEDCENWHVQVFRSIDSGSVKGFPKSVDEAGSMNLVCSKNLVI  543

Query  1096  DRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNR  917
             D+SI  AY++AIR A+HFIYIENQYFLGSSY W SY  AGADNLIPMELALKI SKIR  
Sbjct  544   DKSIHTAYVKAIRSARHFIYIENQYFLGSSYGWLSYDNAGADNLIPMELALKIASKIRAG  603

Query  916   ERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNF  737
             ERFAVYIVIPMWPEGVP+S  VQ+ILYWQGQT++MMY II +ELKS   + AHP +YLNF
Sbjct  604   ERFAVYIVIPMWPEGVPTSNYVQEILYWQGQTMKMMYSIIGEELKSTNNDKAHPQEYLNF  663

Query  736   YCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQR  557
             YCLG RE           P  +  +  + +  RFMIYVHAKGMVVDDEYVI+GSANINQR
Sbjct  664   YCLGKRE----------LP--NHTIHSTTQYRRFMIYVHAKGMVVDDEYVILGSANINQR  711

Query  556   SMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECV  377
             S+ GSRDTEIAMGAYQP++TW   + HP  Q+YGYRMSLWAEHLG +D    E   L+CV
Sbjct  712   SLDGSRDTEIAMGAYQPYYTWESKRIHPQGQIYGYRMSLWAEHLGGVDPLFKEPHSLDCV  771

Query  376   KMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRT  197
             K VN++AEENW RY AE   PL+GHLL YP+ VD++GKV PL G E FPDVGGKVLG  T
Sbjct  772   KYVNKLAEENWSRYNAEDIIPLKGHLLMYPISVDADGKVEPLPGKETFPDVGGKVLGEPT  831

Query  196   T-LPDALT  176
             T LPD LT
Sbjct  832   TPLPDELT  839



>gb|KCW62953.1| hypothetical protein EUGRSUZ_G00554 [Eucalyptus grandis]
Length=824

 Score =  1078 bits (2789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 537/832 (65%), Positives = 641/832 (77%), Gaps = 27/832 (3%)
 Frame = -2

Query  2611  MDIVSERIRQFFT--------AFDCRKP-ETRQGNKVRRHTRIITSDPYVKVCLAGATVA  2459
             MD+ SERIRQ  +        A   ++P   R   K      +ITSDPYV VCLAGATVA
Sbjct  1     MDLASERIRQCCSMIGPPCVPALHGQRPVPARSSGK----NSMITSDPYVSVCLAGATVA  56

Query  2458  RTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVAKVSAQKIISGETIN  2279
             +TRVI N ++P+W E F +PVAHPV +VEF VKDNDVFGA+ IGV ++   KI+S + IN
Sbjct  57    QTRVIQNCENPLWDERFCVPVAHPVVKVEFHVKDNDVFGAELIGVVEIPVAKIVSSDMIN  116

Query  2278  DWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT--EDY-GLKESYFPMRHGGAV  2108
             DWFPIIG  G P KP   + + ++F P ++NP Y+ GV    +Y G+  +YFP+R GG V
Sbjct  117   DWFPIIGNFGSPLKPYPELHISIQFRPVSDNPLYKDGVGVGPNYVGVPNTYFPLRKGGDV  176

Query  2107  TLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYIVGWSIYHKVKLVRE  1928
             TLYQDAHVP G LP+I +DDGK +    CWEDICHAILEAHH++YI+GWSIYH V+LVRE
Sbjct  177   TLYQDAHVPMGKLPQILLDDGKIYEQGRCWEDICHAILEAHHLIYIIGWSIYHPVRLVRE  236

Query  1927  PTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTSGVMGTHDEETRKFF  1748
             PTR LPNGG L+LGELLKYKS+EGVRV++LVWDDKTSH KF + T GVM THDEET+KFF
Sbjct  237   PTRELPNGGELSLGELLKYKSEEGVRVVVLVWDDKTSHDKFLLKTDGVMQTHDEETKKFF  296

Query  1747  KHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLC  1568
             +HS V CVLAPRYAS+KLS  KQQVVGTLYTHHQKCV++DTQA GNNRKITAFIGGLDLC
Sbjct  297   RHSGVRCVLAPRYASTKLSIFKQQVVGTLYTHHQKCVVLDTQASGNNRKITAFIGGLDLC  356

Query  1567  DGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFE  1388
             DGRYDTP+HRL+SD DTVF+ D +NPTF    +  PR+PWHDLHCK+EG AAYDIL NFE
Sbjct  357   DGRYDTPEHRLYSDLDTVFKNDIHNPTF-MSTVNVPREPWHDLHCKVEGQAAYDILKNFE  415

Query  1387  QRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPNDDPSLWVSNEGDPQN  1208
             QRW+K +KW E   + K + HWH++ALL+++RISWI  P+ S P+ D  + V +E DP+N
Sbjct  416   QRWKKVAKWREF--KLKNVRHWHENALLRLDRISWILCPSTS-PDGDKKVQVRDEDDPEN  472

Query  1207  WHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIEN  1028
             WHVQ+FRSIDSGS+KGFPK V  A  QNL+C K+L +D+SI  AY++AIR AQHFIYIEN
Sbjct  473   WHVQIFRSIDSGSVKGFPKSVEEAAKQNLICGKNLKVDKSIHTAYVKAIRSAQHFIYIEN  532

Query  1027  QYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQ  848
             QYFLGSSY WPSYK AGA+NL+PMELALKI SKI   ERF VYIVIPMWPEGVP+SA VQ
Sbjct  533   QYFLGSSYHWPSYKNAGANNLVPMELALKIASKISENERFCVYIVIPMWPEGVPTSAAVQ  592

Query  847   DILYWQGQTIQMMYEIIAKELKSEKIEDA-HPCDYLNFYCLGNREEWHEESASSPT---P  680
             +IL+WQGQT+ MMY+IIA+ L+   +    HP DYLNFYCLG RE      +SS      
Sbjct  593   EILFWQGQTMTMMYKIIAQALEKAGLSHKYHPSDYLNFYCLGKREPLSSTQSSSQAMNQQ  652

Query  679   GCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHH  500
               +  L   QK  RFMIYVHAKGM+VDDEYVI+GSANINQRS+ GSRDTEIAMGAYQPHH
Sbjct  653   SENNALASVQKFRRFMIYVHAKGMIVDDEYVIMGSANINQRSLDGSRDTEIAMGAYQPHH  712

Query  499   TWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAE-K  323
             TWA  ++HPH QVYGYRMSLWAEHLG +++   E +  ECVK VN+IAE NWK Y  E +
Sbjct  713   TWAGKKSHPHGQVYGYRMSLWAEHLGDLEDSFREPQSTECVKKVNKIAERNWKAYVDEDQ  772

Query  322   FSP--LQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALTT  173
              +P  ++GHL++YP+ V  +GKV PL G E FPDVGGK+LGS TTLPDALTT
Sbjct  773   HNPKEMRGHLMQYPIHVSRDGKVGPLAGFETFPDVGGKILGSPTTLPDALTT  824



>ref|XP_006431754.1| hypothetical protein CICLE_v10003162mg [Citrus clementina]
 gb|ESR44994.1| hypothetical protein CICLE_v10003162mg [Citrus clementina]
Length=852

 Score =  1078 bits (2788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/842 (62%), Positives = 650/842 (77%), Gaps = 14/842 (2%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQGNKVRRHTRIIT  2504
             S+  V+LHGDLDL ILEA+ LPNMD+++E +R+       CR P  +      RH+ +IT
Sbjct  19    SDEPVFLHGDLDLSILEAKSLPNMDLITESMRKCCNMCGHCRFPFKKTRGLSGRHS-MIT  77

Query  2503  SDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGV  2324
             S+PYV VCL+GATVA+TRVISN ++P W EHF +PVAH V  +EF VKDND+ GA+ IGV
Sbjct  78    SNPYVSVCLSGATVAQTRVISNCENPFWDEHFCVPVAHSVVNLEFHVKDNDILGAELIGV  137

Query  2323  AKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTE--DY-  2153
              ++  +KI+ G  ++DWFPI G++GK  KP   + + M++ P  + P Y+ GV    DY 
Sbjct  138   VQIPVEKILCGNEVDDWFPIAGSYGKNLKPFPQLHVSMRYKPIGQIPLYKDGVGAGPDYQ  197

Query  2152  GLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVY  1973
             G+ ++YFP+R  G +TLYQDAHVP G LPEI +D GK F H  CWE+ICHA+LEA H++Y
Sbjct  198   GVLKTYFPLRKEGNLTLYQDAHVPPGMLPEIALDGGKTFRHGQCWEEICHAVLEARHLIY  257

Query  1972  IVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINT  1793
             I+GWS++H VKLVREPT+PLP+GG L+ GELLK+KSQEGVRVLLL+WDDKTSH   FI T
Sbjct  258   IIGWSVFHPVKLVREPTKPLPSGGELSFGELLKHKSQEGVRVLLLIWDDKTSHDNLFIKT  317

Query  1792  SGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQG  1613
              GVM THDEETRKFFKHSSV CVLAPRYAS+KLS  KQQVVGTL+THHQKCVIVDT A G
Sbjct  318   EGVMQTHDEETRKFFKHSSVNCVLAPRYASNKLSIFKQQVVGTLFTHHQKCVIVDTPASG  377

Query  1612  NNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHC  1433
             NNRKI+AFIGGLDLCDGRYDTP+HRLF D +TVF  D++NP+ P    KGPR+PWHD+HC
Sbjct  378   NNRKISAFIGGLDLCDGRYDTPEHRLFGDLNTVFANDFHNPSLPSHA-KGPREPWHDMHC  436

Query  1432  KIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSV-P  1256
             K+EGPAAYDIL NFEQRWR+++KW E   R KK++HW+DD+L+ ++RI      TPS  P
Sbjct  437   KVEGPAAYDILINFEQRWRRSTKWREF--RLKKVTHWYDDSLINLDRIGI----TPSTGP  490

Query  1255  NDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMA  1076
             +        +E + +NWH+QVFRSIDSGS+KGFPKDV  A  QNLVCAKDL +D+SI  A
Sbjct  491   HSYKPTRAGSEKETENWHIQVFRSIDSGSVKGFPKDVEEAVAQNLVCAKDLKVDKSIHSA  550

Query  1075  YIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYI  896
             Y++AIR AQHFIYIENQYF+GSSY WPSYK AGADNLIPMELALKIVSKI   ERF+VY+
Sbjct  551   YVKAIRSAQHFIYIENQYFIGSSYHWPSYKNAGADNLIPMELALKIVSKINANERFSVYV  610

Query  895   VIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDA-HPCDYLNFYCLGNR  719
             VIPMWPEG P+SA VQ+ILYWQGQTI MMY+I+A+ L+   + +  HP DYL+FYCLG R
Sbjct  611   VIPMWPEGNPNSAAVQEILYWQGQTISMMYKIVAQALQENGLSNKYHPQDYLSFYCLGKR  670

Query  718   EEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSR  539
             E    + +       +  L  +QK  RFMIYVHAKGM+VDDEYVI+GSANINQRS+ GSR
Sbjct  671   EAPPLDRSQMNQQTENRALAAAQKFRRFMIYVHAKGMIVDDEYVIMGSANINQRSLEGSR  730

Query  538   DTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEI  359
             DTEIAMGAYQPH+TWA  ++HP  QVYGYR SLWAEHLG +++   E + LEC++ VN I
Sbjct  731   DTEIAMGAYQPHYTWAAKKSHPRGQVYGYRTSLWAEHLGTLEDTFREPQSLECMQRVNRI  790

Query  358   AEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDAL  179
             A ENWK +  +    ++GHL++YP+Q+   GK+S L G + FPDVGGK+LG+ T+LPDAL
Sbjct  791   AGENWKAFVCDAHKEMRGHLMQYPVQISREGKMSTLPGYDTFPDVGGKILGAPTSLPDAL  850

Query  178   TT  173
             TT
Sbjct  851   TT  852



>ref|XP_009109271.1| PREDICTED: phospholipase D delta-like isoform X2 [Brassica rapa]
Length=843

 Score =  1078 bits (2787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/860 (63%), Positives = 654/860 (76%), Gaps = 36/860 (4%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQ--GNKVR  2525
             M++ +SE+V+ LHGDLDLKI++ARRLPN D  SER+R+ F   + C KP T    G    
Sbjct  1     MAENVSEDVILLHGDLDLKIVQARRLPNRDTFSERMRRCFKPCNSCIKPTTDDYDGEASS  60

Query  2524  RHTRI-----ITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVK  2360
                 I      TSDPYV V +  AT+ART V+ N+ DPVW  HFK+ VAHP+S ++F+VK
Sbjct  61    DDENIPGLPRNTSDPYVTVSVPHATLARTHVLKNASDPVWNRHFKVSVAHPLSYLKFKVK  120

Query  2359  DNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPC--AEN  2186
             D DV GA  IG  ++  Q+I SGE I  WFP++G  GKPPK + A+R+ +KFT     + 
Sbjct  121   DYDVSGAQTIGTVRIPVQQIASGERIWGWFPVLGGSGKPPKKETALRIDLKFTSFDKIQT  180

Query  2185  PRYRGGVTEDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDIC  2006
              +  GGV        +YFP+R G  V LYQDAHV +G LPEI++D+G  + H  CWEDIC
Sbjct  181   NKTLGGVMG------TYFPLRKGSQVRLYQDAHVMDGMLPEIRLDNGDVYQHGKCWEDIC  234

Query  2005  HAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDD  1826
             HAI EAHHM+YIVGWS++HKVKLVREPTR LP GG+L LGELLKYKS+EGVRVLLLVWDD
Sbjct  235   HAICEAHHMIYIVGWSVFHKVKLVREPTRELPRGGDLTLGELLKYKSEEGVRVLLLVWDD  294

Query  1825  KTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQ  1646
             K+S  KF I+T GVMGTHDEETRKFFKHSSV C+L+PRYAS+KL   KQQVVGTL+THHQ
Sbjct  295   KSSRDKFGISTPGVMGTHDEETRKFFKHSSVKCILSPRYASNKLGLFKQQVVGTLFTHHQ  354

Query  1645  KCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLK  1466
             KCV+VDTQA G+NRK+TAFIGG+DLCDGRYDTP+HR+F D DTVF+ D++NPTFP G + 
Sbjct  355   KCVLVDTQAVGSNRKVTAFIGGIDLCDGRYDTPEHRIFHDLDTVFKDDFHNPTFPSGAI-  413

Query  1465  GPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERIS  1286
              PRQPWHD+HC+++GPAAYD+L NFEQRWRKA++W E   + K +  W DD+LL+I RIS
Sbjct  414   APRQPWHDMHCRLDGPAAYDVLINFEQRWRKATRWKEFNLKGKTL--WLDDSLLRIGRIS  471

Query  1285  WITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAET  1130
             WI +P           VP DDP ++VSNE DP+NWHVQVFRSIDSGS+KGFPK  + AE 
Sbjct  472   WILNPKFKYRIDGVLDVPEDDPVVYVSNEDDPENWHVQVFRSIDSGSVKGFPKCENEAEA  531

Query  1129  QNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMEL  950
              +L   K LV+D+SIQ AYI+ IR AQHFI+IENQYFLGSSYAWP Y +AGADNLIPMEL
Sbjct  532   LHLQYDKRLVVDKSIQTAYIQIIRSAQHFIFIENQYFLGSSYAWPDYNDAGADNLIPMEL  591

Query  949   ALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKI  770
             ALKI SKIR +ERFAVY+VIPMWPEG P S P+Q+ILYWQ QT+QMMY++IA+ELKS + 
Sbjct  592   ALKITSKIRAKERFAVYVVIPMWPEGDPKSGPMQEILYWQSQTMQMMYDVIARELKSHQ-  650

Query  769   EDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEY  590
              +AHP DYLNFYCLG RE+  ++  ++        +T S K  RFMIYVHAKGM+VDDEY
Sbjct  651   SNAHPLDYLNFYCLGKREQLPDDMPATN-------VTDSYKFQRFMIYVHAKGMIVDDEY  703

Query  589   VIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDE  410
             V++GSANINQRSMAG++DTEIAMGAYQPHHTWA    HP  QVYGYRMSLWAEHLG   +
Sbjct  704   VLMGSANINQRSMAGTKDTEIAMGAYQPHHTWANKGKHPRGQVYGYRMSLWAEHLGKTGD  763

Query  409   KLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFP  230
                E   L+CVK VNEIAE NW+++   +FS LQGHL+KYPL VD +G V+ L G + FP
Sbjct  764   DFVEPGDLKCVKNVNEIAERNWRKFIDSEFSELQGHLIKYPLHVDIDGNVTSLPGYDSFP  823

Query  229   DVGGKVLGSRT-TLPDALTT  173
             DVGGK++G  +  +PD LTT
Sbjct  824   DVGGKIIGDHSKAIPDTLTT  843



>ref|XP_003524234.1| PREDICTED: phospholipase D delta-like isoform X1 [Glycine max]
 ref|XP_006580220.1| PREDICTED: phospholipase D delta-like isoform X2 [Glycine max]
Length=857

 Score =  1077 bits (2785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/838 (62%), Positives = 647/838 (77%), Gaps = 9/838 (1%)
 Frame = -2

Query  2668  VYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRR-HTRIITSDPY  2492
             V+LHGDLDL I+EA+ LPN+D+ SE IR+  T  +   P   +G K      ++ITSDPY
Sbjct  23    VFLHGDLDLLIIEAKSLPNLDLSSETIRKCITMGNMCHPPFIKGLKTHSGKDKMITSDPY  82

Query  2491  VKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVAKVS  2312
             V VC+AGAT+A+TRVI+N ++P+W E F +PVAHP  ++EF VKDND+ GA+ IGV ++ 
Sbjct  83    VSVCIAGATIAQTRVIANCENPLWDEQFIVPVAHPAQKLEFLVKDNDILGAELIGVVEIP  142

Query  2311  AQKIISGETINDWFPIIGAHGK--PPKPDCAIRLMMKFTPCAENPRYRGGVTEDYGLKES  2138
              QKII+G T+NDWFPIIG +G    P P+  I +  +      +     G  +  G+ ++
Sbjct  143   VQKIIAGNTVNDWFPIIGQYGNCLKPYPELHISVQYRQIGVNRSESISSGDGKALGVPKT  202

Query  2137  YFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYIVGWS  1958
             YFP+R GG+VTLYQDAH+P+G LPEI ++ GK F H  CWEDICHAILEAHH++YI+GWS
Sbjct  203   YFPLRKGGSVTLYQDAHLPDGMLPEITLEGGKVFQHNKCWEDICHAILEAHHLIYIIGWS  262

Query  1957  IYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTSGVMG  1778
             +YH V+LVRE T+PLP+GG L+LGELLKYKSQEG+RV++L+WDD+TSH KF + T GVM 
Sbjct  263   VYHPVRLVREATKPLPSGGELSLGELLKYKSQEGLRVVMLIWDDRTSHDKFLLKTDGVMQ  322

Query  1777  THDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQGNNRKI  1598
             THDEET+KFFKHS+V CVL+PRYAS+KLS  KQQVVGTL+THHQKCV+VD+   GNNRKI
Sbjct  323   THDEETKKFFKHSTVHCVLSPRYASNKLSIFKQQVVGTLFTHHQKCVLVDSLGSGNNRKI  382

Query  1597  TAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFP-EGGLKGPRQPWHDLHCKIEG  1421
             TAFIGGLDLCDGRYDTP+HRLF D DTVF  D++NPTF        PRQPWHDLHCKIEG
Sbjct  383   TAFIGGLDLCDGRYDTPEHRLFRDLDTVFHNDFHNPTFQLHSNSCAPRQPWHDLHCKIEG  442

Query  1420  PAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPNDDPS  1241
             PAAYDILTNFEQRWRKA KW +   R KK+++WHDDALL+++RISWI  P+PS  N D S
Sbjct  443   PAAYDILTNFEQRWRKAKKWRDF--RLKKVTNWHDDALLRLDRISWIVKPSPS-SNGDKS  499

Query  1240  LWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAI  1061
             + V++E DP++W+VQ+FRSIDSGS+KGFPKDV  A+ QNL C K+L +D+SI  AY+ AI
Sbjct  500   VHVTDENDPESWNVQIFRSIDSGSVKGFPKDVDKAKAQNLFCGKNLKVDQSIHTAYVRAI  559

Query  1060  RRAQHFIYIENQYFLGSSYAWPSYK-EAGADNLIPMELALKIVSKIRNRERFAVYIVIPM  884
             R A+HF+YIENQYFLGSSY WPSYK  AGA++L+PMELALKI  KI   ERF VYIVIPM
Sbjct  560   RSAEHFVYIENQYFLGSSYHWPSYKNNAGANHLVPMELALKIAGKIGANERFCVYIVIPM  619

Query  883   WPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIE-DAHPCDYLNFYCLGNREEWH  707
             WPEGVP+SA VQ+IL+WQGQT+ MMY+I+A  L+   +    HP DYLNFYCLG RE   
Sbjct  620   WPEGVPTSAAVQEILFWQGQTMSMMYKIVADALEKAGLSYQYHPQDYLNFYCLGKREPQS  679

Query  706   EESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEI  527
                + +P P  +  L   +K  RFMIYVHAKGMVVDDEYVI+GSANINQRS+ GSRDTEI
Sbjct  680   TNISPTPNPSENRALVSVKKFRRFMIYVHAKGMVVDDEYVIIGSANINQRSLDGSRDTEI  739

Query  526   AMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEEN  347
             AMGAYQP +TW +   HP  QVYGYRMSLWAEHLG +D    E   LECV+ VN+IA+ N
Sbjct  740   AMGAYQPKYTWTEKNAHPRGQVYGYRMSLWAEHLGSLDHCFAEPHNLECVRHVNKIAKRN  799

Query  346   WKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALTT  173
             W  Y +E+ + ++GHL++YP+++  +GKVS L   E FPDVGGK+LGS  +LPDALTT
Sbjct  800   WDIYVSEEENRMRGHLMQYPVKISRDGKVSALDDYESFPDVGGKILGSPNSLPDALTT  857



>ref|XP_006471246.1| PREDICTED: phospholipase D delta-like [Citrus sinensis]
Length=852

 Score =  1075 bits (2781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/842 (62%), Positives = 650/842 (77%), Gaps = 14/842 (2%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQGNKVRRHTRIIT  2504
             S+  V+LHGDLDL ILEA+ LPNMD+++E +R+       CR P  +      RH+ +IT
Sbjct  19    SDEPVFLHGDLDLSILEAKSLPNMDLITESMRKCCNMCGHCRFPFKKTRGLSGRHS-MIT  77

Query  2503  SDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGV  2324
             S+PYV VCL+GATVA+TRVISN ++P W EHF +PVAH V  +EF VKDND+ GA+ IGV
Sbjct  78    SNPYVSVCLSGATVAQTRVISNCENPFWDEHFCVPVAHSVVNLEFHVKDNDILGAELIGV  137

Query  2323  AKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTE--DY-  2153
              ++  +KI+ G  ++DWFPI G++GK  KP   + + M++ P  + P Y+ GV    DY 
Sbjct  138   VQIPVEKILCGNEVDDWFPIAGSYGKNLKPFPQLHVSMQYKPIGQIPLYKDGVGAGPDYQ  197

Query  2152  GLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVY  1973
             G+ ++YFP+R  G +TLYQDAHVP G LPEI +D GK F H  CWE+ICHA+LEA H++Y
Sbjct  198   GVPKTYFPLRKEGNLTLYQDAHVPPGMLPEIALDGGKTFRHGQCWEEICHAVLEARHLIY  257

Query  1972  IVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINT  1793
             I+GWS++H VKLVREPT+PLP+GG L+ GELLK+KSQEGVRVLLL+WDDKTSH   FI T
Sbjct  258   IIGWSVFHPVKLVREPTKPLPSGGELSFGELLKHKSQEGVRVLLLIWDDKTSHDNLFIKT  317

Query  1792  SGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQG  1613
              GVM THDEETRKFFKHSSV CVLAPRYAS+KLS  KQQVVGTL+THHQKCVIVDT A G
Sbjct  318   EGVMQTHDEETRKFFKHSSVNCVLAPRYASNKLSIFKQQVVGTLFTHHQKCVIVDTPASG  377

Query  1612  NNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHC  1433
             NN+KI+AFIGGLDLCDGRYDTP+HRLF D +TVF  D++NP+ P    KGPR+PWHD+HC
Sbjct  378   NNQKISAFIGGLDLCDGRYDTPEHRLFGDLNTVFANDFHNPSLPSHA-KGPREPWHDMHC  436

Query  1432  KIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSV-P  1256
             K+EGPAAYDIL NFEQRWR+++KW E   R KK++HW+DD+L+ ++RI      TPS  P
Sbjct  437   KVEGPAAYDILINFEQRWRRSTKWREF--RLKKVTHWYDDSLINLDRIGI----TPSTGP  490

Query  1255  NDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMA  1076
             +        +E + +NWH+QVFRSIDSGS+KGFPKDV  A  QNLVCAKDL +D+SI  A
Sbjct  491   HSYKPTRAGSEKETENWHIQVFRSIDSGSVKGFPKDVEEAVAQNLVCAKDLKVDKSIHSA  550

Query  1075  YIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYI  896
             Y++AIR AQHFIYIENQYF+GSSY WPSYK AGADNLIPMELALKIVSKI   ERF+VY+
Sbjct  551   YVKAIRSAQHFIYIENQYFIGSSYHWPSYKNAGADNLIPMELALKIVSKINANERFSVYV  610

Query  895   VIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDA-HPCDYLNFYCLGNR  719
             VIPMWPEG P+S+ VQ+ILYWQGQT+ MMY+I+A+ L+   + +  HP DYL+FYCLG R
Sbjct  611   VIPMWPEGNPNSSAVQEILYWQGQTMSMMYKIVAQALQDNGLSNKYHPQDYLSFYCLGKR  670

Query  718   EEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSR  539
             E    + +       +  L  +QK  RFMIYVHAKGM+VDDEYVI+GSANINQRS+ GSR
Sbjct  671   EAPPLDRSQMNQQTENRALAAAQKFRRFMIYVHAKGMIVDDEYVIMGSANINQRSLEGSR  730

Query  538   DTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEI  359
             DTEIAMGAYQPH+TWA  ++HP  QVYGYR SLWAEHL  +++   E + LEC++ VN I
Sbjct  731   DTEIAMGAYQPHYTWAAKKSHPRGQVYGYRTSLWAEHLATLEDTFREPQSLECMQRVNRI  790

Query  358   AEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDAL  179
             AEENWK +  +    ++GHL++YP+Q+   GKVS L G + FPDVGGK+LG+ T+LPDAL
Sbjct  791   AEENWKAFVCDGHKEMRGHLMQYPVQISREGKVSTLPGYDTFPDVGGKILGAPTSLPDAL  850

Query  178   TT  173
             TT
Sbjct  851   TT  852



>gb|AAT77001.1| phospholipase D [Oryza sativa Japonica Group]
 gb|ABF99807.1| Phospholipase D gamma 3, putative, expressed [Oryza sativa Japonica 
Group]
Length=847

 Score =  1075 bits (2780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 532/848 (63%), Positives = 643/848 (76%), Gaps = 24/848 (3%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQGNKVRRH-----  2519
             SE+ V LHGDLD+ I EA+ LPNMDI+SER+R+FFT +  C       G+  RR      
Sbjct  12    SESAVLLHGDLDIWITEAKCLPNMDIMSERMRRFFTGYGACGSSCGGTGDNARRAGGGVR  71

Query  2518  -TRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFG  2342
               +IITSDPYV VCLAGATVA+TRVI NS++P W E F++ VAH VS +EF VKDNDVFG
Sbjct  72    PKKIITSDPYVSVCLAGATVAQTRVIPNSENPRWEERFRVEVAHAVSRLEFHVKDNDVFG  131

Query  2341  ADFIGVAKVSAQKIISGETINDWFPIIG-AHGKPPKPDCAIRLMMKFTPCAENPRYRGGV  2165
             A  IGVA +   +I+SG     WFPI G     P +P   +RL +++ P  +NP YRGG 
Sbjct  132   AQLIGVASLPVDRILSGAPAEGWFPIDGHCSSNPMRPPPELRLSVQYRPIDDNPLYRGGA  191

Query  2164  TEDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAH  1985
                  +  +YFP+R GG VTLYQDAHV +G LP I+I  G+A+ H  CWEDICH+I+EAH
Sbjct  192   G---AVPNAYFPLRRGGGVTLYQDAHVADGGLPAIQIAGGRAYEHGRCWEDICHSIVEAH  248

Query  1984  HMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKF  1805
             H+VY+VGWSIYH VKLVREPTR LP      LGELLK +++EGVR+++L+WDDKTSH KF
Sbjct  249   HLVYMVGWSIYHPVKLVREPTRALPGETPSTLGELLKKRAREGVRIVILLWDDKTSHDKF  308

Query  1804  FINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDT  1625
              + T GVM THDEET+KFF+HS V CVL PRYAS+KLS  KQQVVGTL+THHQKCV+VDT
Sbjct  309   LLKTDGVMHTHDEETKKFFRHSGVHCVLVPRYASTKLSIFKQQVVGTLFTHHQKCVLVDT  368

Query  1624  QAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWH  1445
             QA GNNRKITAFIGGLDLCDGRYDTP+HRLF D DT F  D++NPTFP     GPRQPWH
Sbjct  369   QATGNNRKITAFIGGLDLCDGRYDTPEHRLFKDLDTAFNKDFHNPTFPVNSY-GPRQPWH  427

Query  1444  DLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTP  1265
             DLHCKIEGPAA+DILTNFEQRWRKA+KW       KK++ WH D L+KI R+SWI +P  
Sbjct  428   DLHCKIEGPAAFDILTNFEQRWRKATKWKV---NLKKVASWHHDTLIKINRMSWIVTPAA  484

Query  1264  SVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSI  1085
                 D+ +  V  E DP+NWHVQVFRSIDSGS+KGFPK V  AE+QNLVCAK+L ID+SI
Sbjct  485   ----DEANAHVCEEKDPENWHVQVFRSIDSGSVKGFPKIVQEAESQNLVCAKNLKIDKSI  540

Query  1084  QMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFA  905
               AY++AIR AQHFIYIENQYF+GSS+ W S+K AGADNLIP+ELALKI SKI+  E+FA
Sbjct  541   HSAYVKAIRSAQHFIYIENQYFIGSSFLWSSHKSAGADNLIPVELALKIASKIKANEQFA  600

Query  904   VYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLG  725
             VYIV+PMWPEG+P++AP+Q IL+WQ QT+ MMY+IIA  L+ + + +AHP DYLNFYCLG
Sbjct  601   VYIVLPMWPEGIPTAAPMQQILFWQSQTMSMMYKIIADALQMQGLVEAHPQDYLNFYCLG  660

Query  724   NREEWHEESASSPTPGCSE--FLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSM  551
              RE    +S S  T  C++   L  +QK  RFMIYVH+KGMVVDDEYVI+GSANINQRSM
Sbjct  661   KREVAAGDSMSQ-TSLCNDNSTLRSAQKLRRFMIYVHSKGMVVDDEYVIIGSANINQRSM  719

Query  550   AGSRDTEIAMGAYQPHHTWAKN--QNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECV  377
              G RDTEIAMGAYQPH+ W+ +  Q  P  QVYGYRMSLWAEHLG ++E     E  ECV
Sbjct  720   EGCRDTEIAMGAYQPHYKWSADHGQGPPRGQVYGYRMSLWAEHLGAVEECFGRPETGECV  779

Query  376   KMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRT  197
             + V E+AEENW+ Y + +    +GHL+ YPL+VD +G+V  L G + FPDVGGKVLG++T
Sbjct  780   RRVREMAEENWRAYVSPEMEETKGHLMCYPLKVDKDGRVRSLPGHDCFPDVGGKVLGTQT  839

Query  196   TLPDALTT  173
             +LP+ALTT
Sbjct  840   SLPNALTT  847



>gb|KHG15087.1| Phospholipase D delta -like protein [Gossypium arboreum]
 gb|KHG15888.1| Phospholipase D delta -like protein [Gossypium arboreum]
 gb|KHG30030.1| Phospholipase D delta -like protein [Gossypium arboreum]
Length=848

 Score =  1075 bits (2779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/842 (62%), Positives = 646/842 (77%), Gaps = 13/842 (2%)
 Frame = -2

Query  2677  ENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFT---AFDCRKPETRQGNKVRRHTRII  2507
             E   +LHG+LD  I+EA+ LPNMD+ S+R+R+ F+   + + +K  ++   K      + 
Sbjct  13    EGATFLHGELDFWIIEAKSLPNMDLNSDRMRRLFSMCSSGNKKKASSKPFGKTSSKHTLN  72

Query  2506  TSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIG  2327
             TSDPYV VCL+GATVA++R+ISN ++PVW EHF +PVAHPV ++EF VKDNDV GA+ IG
Sbjct  73    TSDPYVSVCLSGATVAQSRIISNCENPVWDEHFVVPVAHPVGKIEFHVKDNDVLGAELIG  132

Query  2326  VAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTE--DY  2153
             V +++ +K+++G+ I+ WF I+G       P+  + L  ++ P + NP Y+ GV +  DY
Sbjct  133   VVEIAVEKVVTGDEISGWFAIVGNSKSDRNPELHVSL--QYKPVSVNPIYQQGVGKGPDY  190

Query  2152  -GLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMV  1976
              G+  +YFP+R  G +TLYQDAHVPE  LPEI +D+GK+F   +CWEDICHAIL+A H++
Sbjct  191   TGVPYTYFPLRKVGNITLYQDAHVPEFMLPEIPLDNGKSFKQGSCWEDICHAILDARHLI  250

Query  1975  YIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFIN  1796
             Y+VGWS++H +KLVRE T+PLP  G L+LGELLK+KSQEGVRV+LL+WDDKTSH K  + 
Sbjct  251   YVVGWSVFHPIKLVRESTKPLPEEGQLSLGELLKHKSQEGVRVILLIWDDKTSHDKLLLK  310

Query  1795  TSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQ  1616
             T GVM THDEETRKFFK S+V CVL+PRYASSKLSF KQQVVGTL+THHQKCVI+D+Q  
Sbjct  311   TEGVMQTHDEETRKFFKRSNVHCVLSPRYASSKLSFFKQQVVGTLFTHHQKCVILDSQGS  370

Query  1615  GNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLH  1436
             G  RKITAFIGGLDLCDGRYDTP+HRLF D DT+F GD++NPTFP     GPRQPWHD H
Sbjct  371   GETRKITAFIGGLDLCDGRYDTPEHRLFQDLDTIFEGDFHNPTFPTNAY-GPRQPWHDQH  429

Query  1435  CKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVP  1256
             CK+EGPAAYDILTNFEQRWRK SKW +   + +K+S W DDAL+K++R+  I  P+    
Sbjct  430   CKVEGPAAYDILTNFEQRWRKVSKWRDF--KVRKVSPWQDDALIKLDRVPSIACPSLG-S  486

Query  1255  NDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMA  1076
             + D  + V  E DP+NWHVQVFRSIDSGS+KGFPKDV  A  QNL+C K+L +D SI  A
Sbjct  487   DGDSVVHVREEKDPENWHVQVFRSIDSGSVKGFPKDVKQAAAQNLICRKNLKVDMSIHTA  546

Query  1075  YIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYI  896
             YI+AIR AQHFIYIENQYF+GSSY WPSYK AGADNL+PMELALKI  KIR  ERFAVYI
Sbjct  547   YIKAIRSAQHFIYIENQYFIGSSYYWPSYKNAGADNLVPMELALKIAGKIRANERFAVYI  606

Query  895   VIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDA-HPCDYLNFYCLGNR  719
             VIPMWPEG P+S  VQ+ILY+QGQT+ MMY IIAKEL    + D  HP DYLNFYCLG R
Sbjct  607   VIPMWPEGAPTSNAVQEILYFQGQTVTMMYSIIAKELLKAGLSDQYHPQDYLNFYCLGKR  666

Query  718   EEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSR  539
             E    ES++      +  L   QK  RFM+YVHAKGM+VDDEY+I+GSANINQRS+ GSR
Sbjct  667   EPPTSESSTKLNHKDNRELALVQKFRRFMVYVHAKGMIVDDEYIIMGSANINQRSLEGSR  726

Query  538   DTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEI  359
             DTEIAMGAYQPH+TWA  ++HPH QVYGYRMSLWAE +G +D+   E + LECVK+VNEI
Sbjct  727   DTEIAMGAYQPHYTWAGKKSHPHGQVYGYRMSLWAEQMGKLDDNFQEPKSLECVKLVNEI  786

Query  358   AEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDAL  179
             A+ NWK Y  +++  L GHL++YP ++  +G V+P+ G E FPDVGGKVLG+ T LPD L
Sbjct  787   AKSNWKAYVDDEYCELTGHLMQYPYEIGRDGTVNPIPGHETFPDVGGKVLGASTNLPDVL  846

Query  178   TT  173
             TT
Sbjct  847   TT  848



>emb|CDY67335.1| BnaCnng54530D [Brassica napus]
Length=866

 Score =  1075 bits (2779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/880 (61%), Positives = 658/880 (75%), Gaps = 53/880 (6%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQ-------  2540
             M + +SE+V+ LHGDLDLKI++ARRLPN D  SER+R+ F   + C KP T         
Sbjct  1     MPENVSEDVILLHGDLDLKIVQARRLPNRDTFSERMRRCFKPCNSCIKPTTDDYDGEASS  60

Query  2539  ---GNKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEF  2369
                   +R   R  TSDPYV V +  AT+ART V+ N+ DPVW  HFK+ VAHP+S ++F
Sbjct  61    DDDDENIRGLPRN-TSDPYVTVSVPHATLARTHVLKNASDPVWNRHFKVSVAHPLSYLKF  119

Query  2368  QVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPC--  2195
             +VKD DV GA  IG  ++  Q+I SGE I+ WFP++G  GKPPK + A+R+ +KFTP   
Sbjct  120   KVKDYDVSGAQTIGTVRIPVQQIASGERISGWFPVLGGSGKPPKKETALRIDLKFTPFDK  179

Query  2194  AENPRYRGGVTEDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWE  2015
              +  +  GG     G+  +YFP+R G  V LYQDAHV +G LPEI++D+G  + H  CWE
Sbjct  180   IQTNKTLGG-----GVMGTYFPLRKGSQVRLYQDAHVMDGMLPEIRLDNGDVYQHGKCWE  234

Query  2014  DICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLV  1835
             DICHAI EAHHM+YIVGWS++HKVKLVREPTR LP GG+L LGELLKYKS+EGVRVLLLV
Sbjct  235   DICHAICEAHHMIYIVGWSVFHKVKLVREPTRELPRGGDLTLGELLKYKSEEGVRVLLLV  294

Query  1834  WDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQ-------  1676
             WDDK+S  KF I+T GVMGTHDEETRKFFKHSSV C+L+PRYAS+KL   KQQ       
Sbjct  295   WDDKSSRDKFGISTPGVMGTHDEETRKFFKHSSVKCILSPRYASNKLGLFKQQAINVVLT  354

Query  1675  ----------VVGTLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSD  1526
                       VVGTL+THHQKCV+VDTQA G+NRK+TAFIGG+DLCDGRYDTP+HR+F D
Sbjct  355   CHWHGWYLNQVVGTLFTHHQKCVLVDTQAVGSNRKVTAFIGGIDLCDGRYDTPEHRIFHD  414

Query  1525  RDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGR  1346
              DTVF+ D++NPTFP G +  PRQPWHD+HC+++GPAAYD+L NFEQRWRKA++W E   
Sbjct  415   LDTVFKDDFHNPTFPSGAI-APRQPWHDMHCRLDGPAAYDVLINFEQRWRKATRWKEFNL  473

Query  1345  RFKKISHWHDDALLKIERISWITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVF  1190
             + K +  W DD+LL+I RISWI +P           VP DDP ++VSNE DP+NWHVQVF
Sbjct  474   KGKTL--WLDDSLLRIGRISWILNPKFKYRIDGVLDVPEDDPVVYVSNEDDPENWHVQVF  531

Query  1189  RSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGS  1010
             RSIDSGS+KGFPK  + AE  +L   K LV+D+SIQ AYI+ IR AQHFI+IENQYFLGS
Sbjct  532   RSIDSGSVKGFPKCENEAEALHLQYDKRLVVDKSIQTAYIQIIRSAQHFIFIENQYFLGS  591

Query  1009  SYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQ  830
             SYAWP Y +AGADNLIPMELALKI SKIR +ERFAVY+VIPMWPEG P S P+Q+ILYWQ
Sbjct  592   SYAWPDYNDAGADNLIPMELALKITSKIRAKERFAVYVVIPMWPEGDPKSGPMQEILYWQ  651

Query  829   GQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQ  650
              QT+QMMY++IA+ELKS +  +AHP DYLNFYCLG RE+  ++  ++   G    +T S 
Sbjct  652   SQTMQMMYDVIARELKSHQ-SNAHPLDYLNFYCLGKREQLPDDMPATNVSG----VTDSY  706

Query  649   KSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPH  470
             K  RFMIYVHAKGM+VDDEYV++GSANINQRSMAG++DTEIAMGAYQPHHTWA    HP 
Sbjct  707   KFQRFMIYVHAKGMIVDDEYVLMGSANINQRSMAGTKDTEIAMGAYQPHHTWANKGKHPR  766

Query  469   AQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKY  290
              QVYGYRMSLWAEHLG   +   E   L+CVK VNEIAE NW+++   +FS LQGHL+KY
Sbjct  767   GQVYGYRMSLWAEHLGKTGDDFVEPGDLKCVKNVNEIAERNWRKFIDSEFSELQGHLIKY  826

Query  289   PLQVDSNGKVSPLGGCEYFPDVGGKVLGSRT-TLPDALTT  173
             PL VD +G V+ L G + FPDVGGK++G  +  +PD LTT
Sbjct  827   PLHVDIDGNVTSLPGYDSFPDVGGKIIGDHSKAIPDTLTT  866



>gb|AER41566.1| phospholipase+D [Oryza australiensis]
Length=838

 Score =  1069 bits (2765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/840 (62%), Positives = 645/840 (77%), Gaps = 13/840 (2%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRRHTRIITS  2501
             S   + LHGDLD++I+EA+ LPNMD+++ER+R+ FT +     E  + +      +IITS
Sbjct  8     SGTSMLLHGDLDIQIVEAKCLPNMDLMTERMRKCFTGYGACSTECGKSDPHPDMRKIITS  67

Query  2500  DPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVA  2321
             DPYV VCL+GATVA+TRVI+NS++P W EHF + VAH VS VEF VKDNDVFGA+ IGVA
Sbjct  68    DPYVSVCLSGATVAQTRVIANSENPKWDEHFYVQVAHSVSRVEFHVKDNDVFGAELIGVA  127

Query  2320  KVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED----Y  2153
              V  + I  G+ ++ WFPI G +  P K    + L +++ P  +NP Y+ GV  D     
Sbjct  128   SVPVEDITPGDIVSGWFPISGQYSNPMKASPELHLSIQYKPIEQNPLYKDGVGSDSCQSI  187

Query  2152  GLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVY  1973
             G+  +YFP+R GG VTLYQDAHVP+   P+I+ID G+ +    CWEDICHAI EAHH++Y
Sbjct  188   GVPNAYFPLRKGGRVTLYQDAHVPDDFCPKIEIDGGRVYEQNKCWEDICHAIAEAHHLIY  247

Query  1972  IVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINT  1793
             I+GWS+YH VKLVRE T+P+PNG    +G LLK K QEGVRV++L+WDDKTSH KF + T
Sbjct  248   IIGWSLYHPVKLVRESTKPVPNGSPPTIGGLLKTKVQEGVRVIVLLWDDKTSHDKFLLKT  307

Query  1792  SGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQG  1613
              G+M THDEE RKFF+HS V CVLAPRYAS+KLS  KQQVVGTL+THHQKCVIVDTQA G
Sbjct  308   DGLMHTHDEEARKFFRHSGVHCVLAPRYASNKLSIFKQQVVGTLFTHHQKCVIVDTQATG  367

Query  1612  NNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHC  1433
             NNRKITAFIGGLDLCDGRYDTP+HRLF D DTVF+ D++NPTF +    GPRQPWHDLHC
Sbjct  368   NNRKITAFIGGLDLCDGRYDTPEHRLFKDLDTVFKDDFHNPTF-QVNKSGPRQPWHDLHC  426

Query  1432  KIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPN  1253
             KIEGPAAYDILTNFEQRWRK++KW    RR      WH D L+KI R+SWI SP+     
Sbjct  427   KIEGPAAYDILTNFEQRWRKSAKWKVSVRR---AVSWHHDTLVKINRMSWIVSPSA----  479

Query  1252  DDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAY  1073
             D+ +  V ++ DP+NWHVQ+FRSIDSGS+KGFPK V  AE+QNLVCAK+L ID+SI  AY
Sbjct  480   DELNAHVCDQDDPENWHVQIFRSIDSGSVKGFPKLVQEAESQNLVCAKNLQIDKSIHNAY  539

Query  1072  IEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIV  893
             ++AIR AQH++YIENQYF+GSSY W S + AGA+NLIP+ELA+KI  KI+ RERFA YIV
Sbjct  540   VKAIRSAQHYVYIENQYFIGSSYFWSSNRSAGAENLIPIELAIKIARKIKARERFAAYIV  599

Query  892   IPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREE  713
             IPMWPEG P++A +Q+IL+WQGQT+ MMY+I+A  L+ E ++D HP DYLNFYCLG RE 
Sbjct  600   IPMWPEGNPTAAAMQEILFWQGQTMSMMYKIVADALRKEGLDDTHPQDYLNFYCLGKREV  659

Query  712   WHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDT  533
              ++ S +S +   S  L  +QK  RFMIYVH+KGM+VDDEYV++GSANINQRSM GSRDT
Sbjct  660   SNDVSTTSHSNENSP-LRLAQKFKRFMIYVHSKGMIVDDEYVLMGSANINQRSMDGSRDT  718

Query  532   EIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAE  353
             EIAMGAYQPH++WA  +  P  QVYGYRMSLWAEHLG ++E       +ECV+ VNE+AE
Sbjct  719   EIAMGAYQPHYSWAGGKKAPRGQVYGYRMSLWAEHLGTLEECFRWPHSVECVRQVNEMAE  778

Query  352   ENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALTT  173
             ENW RY + +   ++GHL++YP+ VD +G+V P+ G E FPDVGGKVLG+ ++LP+ALTT
Sbjct  779   ENWARYVSLEMVNMRGHLMRYPIDVDRDGRVGPVHGYECFPDVGGKVLGTHSSLPNALTT  838



>ref|XP_006657599.1| PREDICTED: phospholipase D delta-like [Oryza brachyantha]
Length=838

 Score =  1068 bits (2763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 516/840 (61%), Positives = 647/840 (77%), Gaps = 13/840 (2%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRRHTRIITS  2501
             S   + LHGDLD++I+EA+ LPNMD+++ER+R+ FT +     E  + +      +IITS
Sbjct  8     SGTSLLLHGDLDIQIVEAKCLPNMDLMTERMRRCFTGYGACSTECGKSDPHPDMRKIITS  67

Query  2500  DPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVA  2321
             DPYV VCL+GATVA+TRVI+NS++P W EHF + VAH VS +EF VKDNDVFGA+ IGVA
Sbjct  68    DPYVSVCLSGATVAQTRVIANSENPKWDEHFNVQVAHSVSRIEFHVKDNDVFGAELIGVA  127

Query  2320  KVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGV----TEDY  2153
              V  + I  G+ ++ WFPI G +  P K    + L +++ P  +NP Y+ GV    ++  
Sbjct  128   SVPVEDITPGDMVSGWFPISGQYSNPMKASPELHLSIQYKPIDQNPLYKDGVGSEGSQST  187

Query  2152  GLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVY  1973
             G+  +YFP+R GG VTLYQDAHVP+   P+I+ID G+ +    CWEDICHAI+EAHH++Y
Sbjct  188   GVPNAYFPLRKGGRVTLYQDAHVPDDFCPKIEIDGGRLYEQNKCWEDICHAIVEAHHLIY  247

Query  1972  IVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINT  1793
             I+GWS+YH VKLVRE T+P+PNG    +GELLK K QEGVRV++L+WDDKTSH KF + T
Sbjct  248   IIGWSLYHPVKLVRESTKPVPNGSPPTIGELLKSKVQEGVRVIVLLWDDKTSHDKFLLKT  307

Query  1792  SGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQG  1613
              G+M THDEE RKFF+HS V CVLAPRYAS+KLS  KQQVVGTL+THHQKCVIVDTQA G
Sbjct  308   DGLMHTHDEEARKFFRHSGVHCVLAPRYASNKLSIFKQQVVGTLFTHHQKCVIVDTQASG  367

Query  1612  NNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHC  1433
             NNRKITAFIGGLDLCDGRYDTP+HRLF D DTVF+ D++NPTF +    GPRQPWHDLHC
Sbjct  368   NNRKITAFIGGLDLCDGRYDTPEHRLFKDLDTVFKDDFHNPTF-QVNKSGPRQPWHDLHC  426

Query  1432  KIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPN  1253
             KIEGPAAYDILTNFEQRWRK++KW    RR      WH D L+KI R+SWI SP+     
Sbjct  427   KIEGPAAYDILTNFEQRWRKSAKWKVSVRR---AVSWHHDTLVKINRMSWIVSPSA----  479

Query  1252  DDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAY  1073
             D+ +  V ++ DP+NWHVQ+FRSIDSGS+KGFPK V  AE+QNLVCAK+L ID+SI  AY
Sbjct  480   DELNAHVCDQNDPENWHVQIFRSIDSGSVKGFPKLVQEAESQNLVCAKNLQIDKSIHNAY  539

Query  1072  IEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIV  893
             ++AIR AQ +IYIENQYF+GSSY W S + AGA+NLIP+ELA+KI  KI+ RERFA YIV
Sbjct  540   VKAIRSAQQYIYIENQYFIGSSYYWSSNRSAGAENLIPIELAIKIARKIKARERFAAYIV  599

Query  892   IPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREE  713
             IPMWPEG P++A +Q+IL+WQGQT+ MMY+I+A  L+ E + D HP DYLNFYCLG RE 
Sbjct  600   IPMWPEGNPTTAAMQEILFWQGQTMSMMYKIVADALRKEGLHDTHPQDYLNFYCLGKREA  659

Query  712   WHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDT  533
               + S +S +   S  L  +QK  RFMIYVH+KGM+VDDEYV++GSANINQRSM GSRDT
Sbjct  660   LSDISTTSHSNENSS-LRLAQKFRRFMIYVHSKGMIVDDEYVLIGSANINQRSMDGSRDT  718

Query  532   EIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAE  353
             EIAMGAYQPH++WA  +  P+ QVYGYRMSLWAEHLG ++E       +ECV+ VN++AE
Sbjct  719   EIAMGAYQPHYSWAGGKKAPNGQVYGYRMSLWAEHLGTLEECFRWPHSMECVRQVNQMAE  778

Query  352   ENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALTT  173
             ENW  Y + + + ++GHL++YP+ VDS+G+V P+ G E FPDVGGKVLG+ ++LP+ALTT
Sbjct  779   ENWACYVSPEMANMRGHLMRYPISVDSDGRVGPVRGQECFPDVGGKVLGTHSSLPNALTT  838



>ref|XP_004986130.1| PREDICTED: phospholipase D delta-like [Setaria italica]
Length=878

 Score =  1068 bits (2763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 536/856 (63%), Positives = 651/856 (76%), Gaps = 31/856 (4%)
 Frame = -2

Query  2677  ENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCR-------KPET-----RQGN  2534
             E  V LHGDLD++I+EA+ LPNMDI+SER+R+ F++           +P       R+G+
Sbjct  9     EAAVLLHGDLDIRIVEAKCLPNMDIMSERMRRCFSSCGGGAGACSGDRPNAPPDGLRRGS  68

Query  2533  KVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDN  2354
             +  +  +IITSDPYV VCLAGATVA+TRVI NS++P W EHF++ VAH  + VEF VKDN
Sbjct  69    RSAK-KKIITSDPYVSVCLAGATVAQTRVIPNSENPRWEEHFRVEVAHAAARVEFHVKDN  127

Query  2353  DVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYR  2174
             DVFGA  IGVA V   KI +G  I+ WFPI G     P+P   ++  +++ P  +NP Y+
Sbjct  128   DVFGAQLIGVASVPVHKIAAGALISGWFPIEGHCSNSPRPAPELQFSIRYEPIEDNPLYK  187

Query  2173  GGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICH  2003
              GV       G+  +YFP+R GG VTLYQDAHV +G+LP+I+ID G+ + H  CWEDICH
Sbjct  188   DGVGAGPRYSGVPNAYFPLRRGGRVTLYQDAHVADGNLPKIEIDGGRIYEHGKCWEDICH  247

Query  2002  AILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDK  1823
             AI++AHH+VY+VGWSIYH VKLVREPT+PLP G    LG+LLK K +EGVRV++L+WDDK
Sbjct  248   AIIQAHHLVYMVGWSIYHPVKLVREPTKPLPGGTPATLGDLLKGKVREGVRVVVLLWDDK  307

Query  1822  TSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQK  1643
             TSH KF   T GVM THDEETRKFF HS V C+L PRYAS+KLS  KQQVVGTL+THHQK
Sbjct  308   TSHDKFLFKTDGVMHTHDEETRKFFSHSGVHCILVPRYASTKLSIFKQQVVGTLFTHHQK  367

Query  1642  CVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKG  1463
             CVIVD+QA GNNRKITAFIGGLDLCDGRYDTP+HRLF D DT+F+ D++NPTFP     G
Sbjct  368   CVIVDSQAAGNNRKITAFIGGLDLCDGRYDTPEHRLFKDLDTIFKKDFHNPTFPVNSY-G  426

Query  1462  PRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISW  1283
             PRQPWHDLHCK+EGPAAYDILTNFEQRWRKA+KW       KK++ WH D L+K+ R+SW
Sbjct  427   PRQPWHDLHCKVEGPAAYDILTNFEQRWRKATKWKV---NLKKVASWHYDTLIKLNRMSW  483

Query  1282  ITSPTPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDL  1103
             I SP     N      V +E DP+NWHVQVFRSIDSGS+KGFPK V  AE+QNLVCAK+L
Sbjct  484   IVSPATGEANAH----VCDEQDPENWHVQVFRSIDSGSIKGFPKLVQEAESQNLVCAKNL  539

Query  1102  VIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIR  923
              IDRSI  AY++AIR AQ FIYIENQYF+GSS+ WPS K AGADNLIP+ELALKI SKI+
Sbjct  540   KIDRSIHSAYVKAIRSAQRFIYIENQYFIGSSFCWPSCKNAGADNLIPIELALKIASKIK  599

Query  922   NRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYL  743
              +ERFAVYIVIPMWPEG+P++A +Q IL+WQGQT+ MMY+I+A  L+S+ + DAHP DYL
Sbjct  600   AKERFAVYIVIPMWPEGIPTTAAMQQILFWQGQTMSMMYKIVADTLQSQDLFDAHPQDYL  659

Query  742   NFYCLGNREEWHEESASSPTPGCSEF--LTGSQKSGRFMIYVHAKGMVVDDEYVIVGSAN  569
             NFYCLG R E  +    SP   C++   L  +QK  RFMIYVH+KGMVVDDEYVI+GSAN
Sbjct  660   NFYCLGKR-ELADGDILSPKTLCNDTSPLHMAQKFRRFMIYVHSKGMVVDDEYVIIGSAN  718

Query  568   INQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEG  389
             INQRSM GSRDTEIAMGAYQPH+ WA N   P  QVYGYRMSLWAEHLG ++E     E 
Sbjct  719   INQRSMEGSRDTEIAMGAYQPHYKWAGNTCPPRGQVYGYRMSLWAEHLGTVEECFRRPET  778

Query  388   LECVKMVNEIAEENWKRYTA---EKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGG  218
              ECV+ V E+AEENW +Y +   E+ +   GHLL+YP+QV  +G+V P+ G E+FPDVGG
Sbjct  779   EECVRRVKEMAEENWHKYVSPDVEEETRGGGHLLRYPVQVGKDGQVGPVPGNEFFPDVGG  838

Query  217   KVLGSR-TTLPDALTT  173
             KVLG++ ++LP+ALTT
Sbjct  839   KVLGAQSSSLPNALTT  854



>gb|AER41647.1| phospholipase+D [Oryza punctata]
Length=838

 Score =  1068 bits (2763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/840 (62%), Positives = 643/840 (77%), Gaps = 13/840 (2%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRRHTRIITS  2501
             S   + LHGDLD++I+EA+ LPNMD+++ER+R+ FT +     E  + +      +IITS
Sbjct  8     SGTSMLLHGDLDIQIVEAKCLPNMDLMTERMRKCFTGYGACSTECGKSDPHPDVRKIITS  67

Query  2500  DPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVA  2321
             DPYV VCL+GATVA+TRVI+NS++P W EHF + VAH VS VEF VKDNDVFGA+ IGVA
Sbjct  68    DPYVSVCLSGATVAQTRVIANSENPKWDEHFYVQVAHSVSRVEFHVKDNDVFGAELIGVA  127

Query  2320  KVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED----Y  2153
              V  + I  G+T++ WFPI G +  P K    + L +++ P  +NP Y  GV  D     
Sbjct  128   SVPVEDITQGDTVSGWFPISGQYSNPMKASPELHLSIQYKPIEQNPLYEDGVGSDCCQSI  187

Query  2152  GLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVY  1973
             G+  +YFP+R GG VTLYQDAHVP+   P+I+ID G+ +    CWEDICHAI EAHH++Y
Sbjct  188   GVPNAYFPLRKGGMVTLYQDAHVPDDFCPKIEIDGGRVYEQNKCWEDICHAIAEAHHLIY  247

Query  1972  IVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINT  1793
             I+GWS+YH VKLVRE T+P+PNG    LG LLK K QEGVRV++L+WDDKTSH KF + T
Sbjct  248   IIGWSLYHPVKLVRESTKPMPNGCPPTLGGLLKTKVQEGVRVIVLLWDDKTSHDKFLLKT  307

Query  1792  SGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQG  1613
              G+M THDEE RKFF+HS V CVLAPRYAS+KLS  KQQVVGTL+THHQKCVIVDTQA G
Sbjct  308   DGLMHTHDEEARKFFRHSGVHCVLAPRYASNKLSIFKQQVVGTLFTHHQKCVIVDTQATG  367

Query  1612  NNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHC  1433
             NNRKITAFIGGLDLCDGRYDTP+HRLF D DTVF+ D++NPTF +    GPRQPWHDLHC
Sbjct  368   NNRKITAFIGGLDLCDGRYDTPEHRLFKDLDTVFKDDFHNPTF-QVNKSGPRQPWHDLHC  426

Query  1432  KIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPN  1253
             KIEGPAAYDILTNFEQRWRK++KW    RR      WH D L+KI R+SWI SP+     
Sbjct  427   KIEGPAAYDILTNFEQRWRKSAKWKVSVRR---AVSWHHDTLVKINRMSWIVSPSA----  479

Query  1252  DDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAY  1073
             D+ +  V  + DP+NWHVQ+FRSIDSGS+KGFPK V  AE+QNLVCAK+L ID+SI  AY
Sbjct  480   DELNARVCEQDDPENWHVQIFRSIDSGSVKGFPKLVQEAESQNLVCAKNLQIDKSIHNAY  539

Query  1072  IEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIV  893
             ++AIR AQH+IYIENQYF+GSSY W S + AGA+NLIP+ELA+KI  KI+ RERFA YIV
Sbjct  540   VKAIRSAQHYIYIENQYFIGSSYYWSSNRSAGAENLIPIELAIKIARKIKARERFAAYIV  599

Query  892   IPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREE  713
             IPMWPEG P++A +Q+IL+WQGQT+ MMY+I+A  L+ E ++D HP DYLNFYCLG RE 
Sbjct  600   IPMWPEGNPTTAAMQEILFWQGQTMSMMYKIVADALRKEGLDDTHPQDYLNFYCLGKREV  659

Query  712   WHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDT  533
              ++ S +S +   S  +   QK  RFMIYVH+KGM+VDDEYV++GSANINQRSM GSRDT
Sbjct  660   SNDVSTTSHSNENSP-MRLVQKFRRFMIYVHSKGMIVDDEYVLIGSANINQRSMDGSRDT  718

Query  532   EIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAE  353
             EIAMGAYQPH++WA  +  P  QVYGYRMSLWAEHLG ++E        ECV+ VNE+AE
Sbjct  719   EIAMGAYQPHYSWAGGKKAPRGQVYGYRMSLWAEHLGAVEECFRWPHAEECVRRVNEMAE  778

Query  352   ENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALTT  173
             ENW RY + +   ++GHL++YP+ VDS+G+V P+ G E FPDVGGKVLG+ ++LP+ALTT
Sbjct  779   ENWARYVSPEMVNMRGHLMRYPINVDSDGRVGPVRGYECFPDVGGKVLGTHSSLPNALTT  838



>ref|XP_003532794.1| PREDICTED: phospholipase D delta-like isoform X1 [Glycine max]
 ref|XP_006585218.1| PREDICTED: phospholipase D delta-like isoform X2 [Glycine max]
Length=857

 Score =  1068 bits (2761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/855 (61%), Positives = 655/855 (77%), Gaps = 10/855 (1%)
 Frame = -2

Query  2719  FCIISDVKMSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQ  2540
              C  S  +  +G++E+V +LHGDLDL I+EA+ LPN+D+ +E +R+  T  +   P   +
Sbjct  7     ICQSSPNREHEGLNEHV-FLHGDLDLLIVEAKSLPNLDLSTEAVRKCITMGNMCHPPFIK  65

Query  2539  GNKVRR-HTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQV  2363
             G K      ++ITSDPYV VC+AGAT+A+TRVI+N ++P+W E F +PVAHP  ++EF V
Sbjct  66    GLKTHSGKDKMITSDPYVSVCIAGATIAQTRVIANCENPLWDEQFIVPVAHPAQKLEFLV  125

Query  2362  KDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGK--PPKPDCAIRLMMKFTPCAE  2189
             KDND+ GA+ IGV ++  QKII+G TINDWFPIIG +G    P P+  I +  +      
Sbjct  126   KDNDLLGAELIGVVEIPVQKIIAGNTINDWFPIIGQYGNCLKPYPELHISVQYRQIGVNR  185

Query  2188  NPRYRGGVTEDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDI  2009
             +     G  +  G+ ++YFP+R GG+VTLYQDAH+P+G LPEI ++ GK F    CWEDI
Sbjct  186   SESISSGDGKALGVPKTYFPLRKGGSVTLYQDAHLPDGMLPEIPLEGGKVFQQNKCWEDI  245

Query  2008  CHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWD  1829
             CHAILEAHH++YI+GWS+YH V+LVRE T+PLP+GG L+LGELLKYKSQEG+RV++L+WD
Sbjct  246   CHAILEAHHLIYIIGWSVYHPVRLVREATKPLPSGGELSLGELLKYKSQEGLRVVMLIWD  305

Query  1828  DKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHH  1649
             D+TSH KF + T GVM THDEET+KFFKHS+V CVL+PRYAS+KLS  KQQVVGTL+THH
Sbjct  306   DRTSHDKFLLKTDGVMQTHDEETKKFFKHSTVHCVLSPRYASNKLSIFKQQVVGTLFTHH  365

Query  1648  QKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFP-EGG  1472
             QKCV+VD+   GNNRKITAF+GGLDLCDGRYDTP+HRLF D DTVF  D++NPTF     
Sbjct  366   QKCVLVDSLGSGNNRKITAFMGGLDLCDGRYDTPEHRLFRDLDTVFHNDFHNPTFQLNSN  425

Query  1471  LKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIER  1292
                PRQPWHDLHCKIEGPAAYDILTNFEQRWRKA KW +   R KK+++WHDDALL+++R
Sbjct  426   SCAPRQPWHDLHCKIEGPAAYDILTNFEQRWRKAKKWRDF--RLKKVTNWHDDALLRLDR  483

Query  1291  ISWITSPTPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCA  1112
             ISWI  P+P     D S+ V++E DP++W+VQ+FRSIDSGS+KGFPKDV  A++QNL+C 
Sbjct  484   ISWIVKPSP-CSKGDKSVHVTDEKDPESWNVQIFRSIDSGSVKGFPKDVDKAKSQNLLCG  542

Query  1111  KDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYK-EAGADNLIPMELALKIV  935
             K+L +D+SI  AY+ AIR A+ F+YIENQYFLGSSY WPSYK  AGA++L+PMELALKI 
Sbjct  543   KNLKVDQSIHTAYVRAIRSAERFVYIENQYFLGSSYHWPSYKNNAGANHLVPMELALKIA  602

Query  934   SKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDA-H  758
              KI   ERF VYIVIPMWPEGVP+SA VQ+IL+WQGQT+ MMY+IIA  L+   + D  H
Sbjct  603   GKIGANERFCVYIVIPMWPEGVPTSAAVQEILFWQGQTMSMMYKIIADALEKAGLSDKYH  662

Query  757   PCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVG  578
             P DYLNFYCLG RE      + +P P  +  L   +K  RFMIYVHAKGMV+DDEYVI+G
Sbjct  663   PQDYLNFYCLGKREPQSTNISPTPNPSENRALVSVKKFRRFMIYVHAKGMVIDDEYVIIG  722

Query  577   SANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDE  398
             SANINQRS+ GSRDTEIAMGAYQP++TW +   HP  QVYGYRMSLWAEHL  +D    E
Sbjct  723   SANINQRSLDGSRDTEIAMGAYQPNYTWTEKNAHPRGQVYGYRMSLWAEHLADLDHCFTE  782

Query  397   AEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGG  218
                LECV+ VN+IA++NW  Y +E+ + ++GHL++YP+++  +GKVS L   E FPDVGG
Sbjct  783   PHNLECVRHVNKIAKQNWDIYVSEEGNRMRGHLMQYPVKISKDGKVSALDDYESFPDVGG  842

Query  217   KVLGSRTTLPDALTT  173
             KVLGS  +LPDALT 
Sbjct  843   KVLGSPNSLPDALTA  857



>gb|EEC81825.1| hypothetical protein OsI_25571 [Oryza sativa Indica Group]
Length=838

 Score =  1066 bits (2757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 517/840 (62%), Positives = 643/840 (77%), Gaps = 13/840 (2%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRRHTRIITS  2501
             S   + LHGDLD++I+EA+ LPNMD+++ER+R+ FT +     E  + +      +IITS
Sbjct  8     SGTSMLLHGDLDIQIVEAKCLPNMDLMTERMRKCFTGYGACSTECGKSDPHTDVRKIITS  67

Query  2500  DPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVA  2321
             DPYV VCL+GATVA+TRVI+NS++P W EHF + VAH VS VEF VKDNDVFGA+ IGVA
Sbjct  68    DPYVSVCLSGATVAQTRVIANSENPKWDEHFYVQVAHSVSRVEFHVKDNDVFGAELIGVA  127

Query  2320  KVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED----Y  2153
              V  + I  G+T++ WFPI G +  P K    + L +++ P  +NP Y+ GV  D     
Sbjct  128   SVPVENITPGDTVSGWFPISGQYSNPMKASPELHLSIQYKPIEQNPLYKDGVGSDGCQSI  187

Query  2152  GLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVY  1973
             G+  +YFP+R GG VTLYQDAH+P+   P+I+ID G+ +    CWEDICHAI EAHH++Y
Sbjct  188   GVPNAYFPLRKGGMVTLYQDAHIPDDFCPKIEIDGGRVYEQNKCWEDICHAIAEAHHLIY  247

Query  1972  IVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINT  1793
             I+GWS+YH VKLVRE T+P+PNG    LG LLK K QEGVRV++L+WDDKTSH KF + T
Sbjct  248   IIGWSVYHPVKLVRESTKPVPNGSPPTLGGLLKTKVQEGVRVIVLLWDDKTSHDKFLLKT  307

Query  1792  SGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQG  1613
              G+M THDEE RKFF+HS V CVLAPRYAS+KLS  KQQVVGTL+THHQKCVIVDTQ  G
Sbjct  308   DGLMHTHDEEARKFFRHSGVHCVLAPRYASNKLSIFKQQVVGTLFTHHQKCVIVDTQVIG  367

Query  1612  NNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHC  1433
             NNRKITAFIGGLDLCDGRYDTP+HRLF D DTVF+ D++NPTF +    GPRQPWHDLHC
Sbjct  368   NNRKITAFIGGLDLCDGRYDTPEHRLFKDLDTVFKDDFHNPTF-QVNKSGPRQPWHDLHC  426

Query  1432  KIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPN  1253
             KIEGPAAYDILTNFEQRWRK++KW    RR      WH D L+KI R+SWI SP+     
Sbjct  427   KIEGPAAYDILTNFEQRWRKSAKWKVSVRR---AVSWHHDTLVKINRMSWIVSPSA----  479

Query  1252  DDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAY  1073
             D+ +  V  + DP+NWHVQ+FRSIDSGS+KGFPK V  AE+QNLVCAK+L ID+SI  AY
Sbjct  480   DELNARVCEQDDPENWHVQIFRSIDSGSVKGFPKLVQEAESQNLVCAKNLQIDKSIHNAY  539

Query  1072  IEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIV  893
             ++AIR AQH+IYIENQYF+GSSY W S + AGA+NLIP+ELA+KI  KI+ RERFA YIV
Sbjct  540   VKAIRSAQHYIYIENQYFIGSSYYWSSNRSAGAENLIPIELAIKIARKIKARERFAAYIV  599

Query  892   IPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREE  713
             IPMWPEG P++A +Q+IL+WQGQT+ MMY+I+A+ L+ E ++D HP DYLNFYCLG RE 
Sbjct  600   IPMWPEGNPTTAAMQEILFWQGQTMSMMYKIVAEALQKEGLDDTHPQDYLNFYCLGKREV  659

Query  712   WHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDT  533
              ++ S +S +   S      QK  RFMIYVH+KGM+VDDEYV++GSANINQRSM GSRDT
Sbjct  660   SNDVSTTSQSNENSPQRL-VQKFKRFMIYVHSKGMIVDDEYVLIGSANINQRSMDGSRDT  718

Query  532   EIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAE  353
             EIAMGAYQPH++WA  +  P  QVYGYRMSLWAEHLG ++E       +ECV+ VNE+AE
Sbjct  719   EIAMGAYQPHYSWAGRKKAPRGQVYGYRMSLWAEHLGTVEECFRWPHSVECVRQVNEMAE  778

Query  352   ENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALTT  173
             ENW RY + +   ++GHL++YP+ V+ +G+V P+ G E FPDVGGKVLG+ ++LP+ALTT
Sbjct  779   ENWARYVSPEMVNMRGHLMRYPINVERDGRVGPVHGYECFPDVGGKVLGTHSSLPNALTT  838



>ref|NP_001059324.1| Os07g0260400 [Oryza sativa Japonica Group]
 dbj|BAC84242.1| putative phospholipase D [Oryza sativa Japonica Group]
 dbj|BAF21238.1| Os07g0260400 [Oryza sativa Japonica Group]
 gb|EEE66915.1| hypothetical protein OsJ_23763 [Oryza sativa Japonica Group]
 gb|AER41621.1| phospholipase+D [Oryza glumipatula]
Length=838

 Score =  1066 bits (2757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 517/840 (62%), Positives = 643/840 (77%), Gaps = 13/840 (2%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRRHTRIITS  2501
             S   + LHGDLD++I+EA+ LPNMD+++ER+R+ FT +     E  + +      +IITS
Sbjct  8     SGTSMLLHGDLDIQIVEAKCLPNMDLMTERMRKCFTGYGACSTECGKSDPHTDVRKIITS  67

Query  2500  DPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVA  2321
             DPYV VCL+GATVA+TRVI+NS++P W EHF + VAH VS VEF VKDNDVFGA+ IGVA
Sbjct  68    DPYVSVCLSGATVAQTRVIANSENPKWDEHFYVQVAHSVSRVEFHVKDNDVFGAELIGVA  127

Query  2320  KVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED----Y  2153
              V  + I  G+T++ WFPI G +  P K    + L +++ P  +NP Y+ GV  D     
Sbjct  128   SVPVENITPGDTVSGWFPISGQYSNPMKASPELHLSIQYKPIEQNPLYKDGVGSDGCQSI  187

Query  2152  GLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVY  1973
             G+  +YFP+R GG VTLYQDAH+P+   P+I+ID G+ +    CWEDICHAI EAHH++Y
Sbjct  188   GVPNAYFPLRKGGMVTLYQDAHIPDDFCPKIEIDGGRVYEQNKCWEDICHAIAEAHHLIY  247

Query  1972  IVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINT  1793
             I+GWS+YH VKLVRE T+P+PNG    LG LLK K QEGVRV++L+WDDKTSH KF + T
Sbjct  248   IIGWSLYHPVKLVRESTKPVPNGSPPTLGGLLKTKVQEGVRVIVLLWDDKTSHDKFLLKT  307

Query  1792  SGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQG  1613
              G+M THDEE RKFF+HS V CVLAPRYAS+KLS  KQQVVGTL+THHQKCVIVDTQ  G
Sbjct  308   DGLMHTHDEEARKFFRHSGVHCVLAPRYASNKLSIFKQQVVGTLFTHHQKCVIVDTQVIG  367

Query  1612  NNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHC  1433
             NNRKITAFIGGLDLCDGRYDTP+HRLF D DTVF+ D++NPTF +    GPRQPWHDLHC
Sbjct  368   NNRKITAFIGGLDLCDGRYDTPEHRLFKDLDTVFKDDFHNPTF-QVNKSGPRQPWHDLHC  426

Query  1432  KIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPN  1253
             KIEGPAAYDILTNFEQRWRK++KW    RR      WH D L+KI R+SWI SP+     
Sbjct  427   KIEGPAAYDILTNFEQRWRKSAKWKVSVRR---AVSWHHDTLVKINRMSWIVSPSA----  479

Query  1252  DDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAY  1073
             D+ +  V  + DP+NWHVQ+FRSIDSGS+KGFPK V  AE+QNLVCAK+L ID+SI  AY
Sbjct  480   DELNARVCEQDDPENWHVQIFRSIDSGSVKGFPKLVQEAESQNLVCAKNLQIDKSIHNAY  539

Query  1072  IEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIV  893
             ++AIR AQH+IYIENQYF+GSSY W S + AGA+NLIP+ELA+KI  KI+ RERFA YIV
Sbjct  540   VKAIRSAQHYIYIENQYFIGSSYYWSSNRSAGAENLIPIELAIKIARKIKARERFAAYIV  599

Query  892   IPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREE  713
             IPMWPEG P++A +Q+IL+WQGQT+ MMY+I+A+ L+ E ++D HP DYLNFYCLG RE 
Sbjct  600   IPMWPEGNPTTAAMQEILFWQGQTMSMMYKIVAEALQKEGLDDTHPQDYLNFYCLGKREV  659

Query  712   WHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDT  533
              ++ S +S +   S      QK  RFMIYVH+KGM+VDDEYV++GSANINQRSM GSRDT
Sbjct  660   SNDVSTTSQSNENSPQRL-VQKFKRFMIYVHSKGMIVDDEYVLIGSANINQRSMDGSRDT  718

Query  532   EIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAE  353
             EIAMGAYQPH++WA  +  P  QVYGYRMSLWAEHLG ++E       +ECV+ VNE+AE
Sbjct  719   EIAMGAYQPHYSWAGRKKAPRGQVYGYRMSLWAEHLGTVEECFRWPHSVECVRQVNEMAE  778

Query  352   ENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALTT  173
             ENW RY + +   ++GHL++YP+ V+ +G+V P+ G E FPDVGGKVLG+ ++LP+ALTT
Sbjct  779   ENWARYVSPEMVNMRGHLMRYPINVERDGRVGPVHGYECFPDVGGKVLGTHSSLPNALTT  838



>ref|XP_008670089.1| PREDICTED: phospholipase D delta-like isoform X1 [Zea mays]
 ref|XP_008670090.1| PREDICTED: phospholipase D delta-like isoform X1 [Zea mays]
 ref|XP_008670091.1| PREDICTED: phospholipase D delta-like isoform X1 [Zea mays]
 tpg|DAA39788.1| TPA: phospholipase D family protein [Zea mays]
Length=839

 Score =  1065 bits (2755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/844 (61%), Positives = 647/844 (77%), Gaps = 28/844 (3%)
 Frame = -2

Query  2668  VYLHGDLDLKILEARRLPNMDIVSERIRQFFTAF-----DCRKPETRQGNKVRRHTRIIT  2504
             + LHGDLD++I+EA+ LPNMD+++ER+R+ FT +     DC K E    +      +IIT
Sbjct  12    MLLHGDLDIQIIEAKCLPNMDLMTERMRKCFTGYGACSNDCGKSEPPHPDM----RKIIT  67

Query  2503  SDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGV  2324
             SDPYV VCL+GATVA+TRVI+NS++P W EHF + VAH VS VEF VKDNDVFGA+ IGV
Sbjct  68    SDPYVSVCLSGATVAQTRVIANSENPKWDEHFYVQVAHSVSRVEFHVKDNDVFGAELIGV  127

Query  2323  AKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED----  2156
             A +  + I+ G+ +  WFPI G +  P KP   + L +++ P   NP Y+ GV  D    
Sbjct  128   ASIPVEHIMPGDLVGGWFPISGQYSNPMKPSPELHLSIQYKPIDTNPLYKDGVGADGHQS  187

Query  2155  YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMV  1976
              G+  +YFP+R GG VTLYQDAHVP+   P I++DDG+ +    CWEDICHAI+EAHH++
Sbjct  188   VGVPNAYFPLRKGGKVTLYQDAHVPDNFQPHIEMDDGRTYEQNKCWEDICHAIIEAHHLI  247

Query  1975  YIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFIN  1796
             YIVGWS+YH VKLVRE T+P+PNG  + +GE+LK K QEGVRV++L+WDDKTSH KF + 
Sbjct  248   YIVGWSLYHPVKLVRESTKPVPNGNPVTIGEILKRKVQEGVRVIVLLWDDKTSHDKFLLK  307

Query  1795  TSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQ  1616
             T G+M THDEE RK+F+HS V CVL+PRYAS+KLS  KQQVVGTL+THHQKCVIVDTQA 
Sbjct  308   TDGLMHTHDEEARKYFRHSGVHCVLSPRYASNKLSIFKQQVVGTLFTHHQKCVIVDTQAT  367

Query  1615  GNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLH  1436
             GNNRKITAFIGGLDLCDGRYDTP+HRLF D DT+F+ D++NPTFP     GPRQPWHDLH
Sbjct  368   GNNRKITAFIGGLDLCDGRYDTPEHRLFKDLDTIFKDDFHNPTFPVNK-NGPRQPWHDLH  426

Query  1435  CKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVP  1256
             CKIEGPAAYDILTNFEQRWRK++KW    RR      WH D L+KI+R+SWI SP+    
Sbjct  427   CKIEGPAAYDILTNFEQRWRKSAKWKVSVRR---AVSWHHDTLVKIDRMSWIVSPS----  479

Query  1255  NDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMA  1076
             +D+ +  V  E DP+NWHVQVFRSIDSGS+KGFPK V  AE+QNLVCAK+L ID+SI  A
Sbjct  480   SDELNAHVCEEKDPENWHVQVFRSIDSGSVKGFPKLVQEAESQNLVCAKNLQIDKSIHNA  539

Query  1075  YIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYI  896
             Y++AIR AQHF+YIENQYF+GSSY W +++ AGA+NLIP+ELA+KI  KI+ +ERFA YI
Sbjct  540   YVKAIRSAQHFVYIENQYFIGSSYYWSAHRSAGAENLIPIELAIKIARKIKAKERFAAYI  599

Query  895   VIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNRE  716
             VIPMWPEG P++A +Q+ILYWQG T+ MMY+I+A  L+ E + + HP +YLNFYCLG R 
Sbjct  600   VIPMWPEGNPTTAAMQEILYWQGHTMSMMYKIVADALRKEGLHERHPQEYLNFYCLGKR-  658

Query  715   EWHEESASSPTPGCSEFLTG---SQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAG  545
                E S   PT G S   +    SQK  RFMIYVH+KGM+VDDEYV++GSANINQRSM G
Sbjct  659   ---EVSNEVPTTGNSNENSAVRLSQKFKRFMIYVHSKGMIVDDEYVLIGSANINQRSMDG  715

Query  544   SRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVN  365
             SRDTEIAMGAYQPH++WA +   P  QVYGYRMSLWAEHLG + E     E  ECV+ VN
Sbjct  716   SRDTEIAMGAYQPHYSWAGSGRPPRGQVYGYRMSLWAEHLGTVQECFRRPESEECVQQVN  775

Query  364   EIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPD  185
             ++A++NW  Y + + + ++GHL+KYP++V+ +G+V PL G E FPDVGGKVLG+ ++LP+
Sbjct  776   QMADDNWASYVSPQMADMKGHLMKYPVRVEQDGRVGPLHGQESFPDVGGKVLGTHSSLPN  835

Query  184   ALTT  173
             ALTT
Sbjct  836   ALTT  839



>gb|EMS67406.1| Phospholipase D delta [Triticum urartu]
Length=824

 Score =  1064 bits (2752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/821 (64%), Positives = 622/821 (76%), Gaps = 62/821 (8%)
 Frame = -2

Query  2527  RRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDV  2348
             RR +RIITSDPYV + +AGA VART VI NSQ+P W E F +P+AH  + +EFQV     
Sbjct  28    RRCSRIITSDPYVTLSVAGAVVARTAVIPNSQEPRWDEQFFVPLAHRATVLEFQV-----  82

Query  2347  FGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGG  2168
                              + + + +W PI+G  GK  KP  A+ +  +F P A NP YR G
Sbjct  83    ----------------TAADELEEWVPIVGTSGKTYKPRTALFIRYRFRPFAANPVYRRG  126

Query  2167  VTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAI  1997
             +  D    G+K+SYFP+RHGG VTLYQDAHV EG LP+++++ GK F H  CWEDICHAI
Sbjct  127   IPGDPDQQGVKDSYFPLRHGGKVTLYQDAHVNEGDLPDVELERGKKFEHNQCWEDICHAI  186

Query  1996  LEAHHMVYIVGWSIYHKVKLVREPT--RplpnggnlnlgelLKYKSQEGVRVLLLVWDDK  1823
             LEAHHM+YIVGWSIY KVKLVREP+  RPLP+GG L LGELLK+KSQEGVRV LLVWDDK
Sbjct  187   LEAHHMIYIVGWSIYDKVKLVREPSSSRPLPDGGELTLGELLKFKSQEGVRVCLLVWDDK  246

Query  1822  TSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQ-----------  1676
             TSH K FI T GVMGTHDEETRKFFKHSSV CVL+PRYASSKLS  KQQ           
Sbjct  247   TSHDKLFIKTGGVMGTHDEETRKFFKHSSVICVLSPRYASSKLSIFKQQASSGSLLVLYL  306

Query  1675  --------------------VVGTLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRY  1556
                                 VVGTL+THHQKCV+VDTQA GN RK+TAF+GGLDLCDGRY
Sbjct  307   YFISFVDRLQVIAVIINLKQVVGTLFTHHQKCVLVDTQASGNKRKVTAFVGGLDLCDGRY  366

Query  1555  DTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWR  1376
             DTPQHRLF D DTVF  D++NPTF   G KGPRQPWHDLHCKI+GPAAYD+L NFEQRWR
Sbjct  367   DTPQHRLFKDLDTVFENDFHNPTF-SAGAKGPRQPWHDLHCKIDGPAAYDVLKNFEQRWR  425

Query  1375  KASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPNDDPSLWVSNEGDPQNWHVQ  1196
             KASK+ +   RF+K+S W DDAL+K+ERISWI SP+P+VPND  SL VS E DP+NWHVQ
Sbjct  426   KASKFRD---RFRKVSRWKDDALIKLERISWILSPSPNVPNDHVSLRVSKEEDPENWHVQ  482

Query  1195  VFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFL  1016
             VFRSIDSGSLKGFP D   A  QNLVC K+L+ID+SI  AY+ AIR AQHFIYIENQYFL
Sbjct  483   VFRSIDSGSLKGFPSDCKEASKQNLVCRKNLIIDKSIHTAYVRAIRSAQHFIYIENQYFL  542

Query  1015  GSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILY  836
             GSSY WPSY  +GADNLIPMELALKI +KIR  ERFAVY+VIPMWPEGVP+SA VQ+IL+
Sbjct  543   GSSYEWPSYVNSGADNLIPMELALKIATKIRAGERFAVYVVIPMWPEGVPTSASVQEILF  602

Query  835   WQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTG  656
             +Q QT++MMY +IA+ELK+  IEDA+  DYLNFYCLGNREE   + +        +   G
Sbjct  603   FQAQTMEMMYGVIARELKAMNIEDANLQDYLNFYCLGNREEPSTDGSPESDKSTDKSAAG  662

Query  655   -SQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQN  479
              ++K  RFMIYVHAKGM+VDDEYVI+GSANINQRS+AGSRDTEIAMGAYQPHH W+  + 
Sbjct  663   LARKHRRFMIYVHAKGMIVDDEYVILGSANINQRSLAGSRDTEIAMGAYQPHHAWSSKKG  722

Query  478   HPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHL  299
             HPH QVYGYR SLWAEHLGM+D+   E   LECV++VN+IAEENW+R+ +E+   LQGHL
Sbjct  723   HPHGQVYGYRNSLWAEHLGMVDDHFKEPSSLECVRLVNQIAEENWERFASEEMKTLQGHL  782

Query  298   LKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALT  176
             L+YP++V+S+GK+ PL   E FPDVGGK+ G+ T+LPD+LT
Sbjct  783   LRYPVKVESDGKIVPLPDQECFPDVGGKICGAPTSLPDSLT  823



>ref|XP_006650874.1| PREDICTED: phospholipase D delta-like [Oryza brachyantha]
Length=847

 Score =  1063 bits (2750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 531/849 (63%), Positives = 642/849 (76%), Gaps = 24/849 (3%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFT---AFDC------RKPETRQGNKV  2528
             S + V LHGDLD+ I EA+ LPNMDI+SER+R+ FT   AF C         + R+G   
Sbjct  10    SGSAVLLHGDLDIGITEAKCLPNMDIMSERMRRCFTGYGAFGCGAACGGHSADARRGGGG  69

Query  2527  RRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDV  2348
              R  +IITSDPYV VCLAGATVA+TRVI NS++P W E F++  AH V  +EF VKDNDV
Sbjct  70    GRAKKIITSDPYVSVCLAGATVAQTRVIPNSENPRWEERFRVEGAHAVVRLEFHVKDNDV  129

Query  2347  FGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGG  2168
             FGA  IGVA +   KI SG  +  WFPI G    P +P   +RL +++ P  +NP YR G
Sbjct  130   FGAQLIGVASLPVDKIASGAPVEGWFPIDGHCSNPTRPPPELRLSVQYMPIQDNPLYRDG  189

Query  2167  VTEDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEA  1988
                   +  +YFP+R GG+VTLYQDAHV +G LP I+I  G+ + H  CWEDICH+I+EA
Sbjct  190   AD---AVPNAYFPIRRGGSVTLYQDAHVADGGLPPIEIAGGRVYEHGRCWEDICHSIVEA  246

Query  1987  HHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSK  1808
             HH+VY+VGWSIYH VKLVREPTRPLP G    LGELLK K+ EGVRV++L+WDDKTSH K
Sbjct  247   HHLVYMVGWSIYHPVKLVREPTRPLPGGTPSMLGELLKGKAHEGVRVVILLWDDKTSHDK  306

Query  1807  FFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVD  1628
             F + T GVM THDEET++FF+HS V CVL PRYAS+KLS  KQQVVGTL+THHQKCVI+D
Sbjct  307   FLLKTDGVMHTHDEETKRFFRHSGVHCVLVPRYASTKLSIFKQQVVGTLFTHHQKCVILD  366

Query  1627  TQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPW  1448
             TQA GNNRKITAFIGGLDLCDGRYDTP+HRLF D DTVF  D++NPTFP     GPRQPW
Sbjct  367   TQATGNNRKITAFIGGLDLCDGRYDTPEHRLFKDLDTVFNKDFHNPTFPVNSY-GPRQPW  425

Query  1447  HDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPT  1268
             HDLHCK+EGPAA+DILTNFEQRWRKA+KW       KK++ WH D L+KI R+SWI +P 
Sbjct  426   HDLHCKVEGPAAFDILTNFEQRWRKATKWKV---NLKKVASWHHDTLIKINRMSWIVTPA  482

Query  1267  PSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRS  1088
                  D+ +  V +E DP+NWHVQVFRSIDSGS+KGFPK V  AE QNLVCAK+L ID+S
Sbjct  483   A----DEANAHVCDEKDPENWHVQVFRSIDSGSVKGFPKIVQEAELQNLVCAKNLKIDKS  538

Query  1087  IQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERF  908
             I  AY++AIR AQHFIYIENQYF+GSS+ W S+K AGADNLIP+ELALKI SKI+  E+F
Sbjct  539   IHSAYVKAIRSAQHFIYIENQYFIGSSFLWSSHKSAGADNLIPVELALKIASKIKANEQF  598

Query  907   AVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCL  728
             AVYIV+PMWPEG+P++AP+Q IL+WQGQT+  MY+IIA  L+ + + +AHP DYLNFYCL
Sbjct  599   AVYIVLPMWPEGIPTTAPMQQILFWQGQTMSSMYKIIADALQMQGLLEAHPQDYLNFYCL  658

Query  727   GNREEWHEESASSPTPGCSE--FLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRS  554
             G RE        SPT  C++   L  +QK  RFMIYVH+KGMVVDDEYVI+GSANINQRS
Sbjct  659   GKRELAAGGDTMSPTSICNDNSALRTAQKLRRFMIYVHSKGMVVDDEYVIIGSANINQRS  718

Query  553   MAGSRDTEIAMGAYQPHHTWAKNQNH--PHAQVYGYRMSLWAEHLGMMDEKLDEAEGLEC  380
             M G RDTEIAMG YQPH+ W+   +   P  QVYGYRMSLWAEHLG ++E     E  EC
Sbjct  719   MEGCRDTEIAMGGYQPHYKWSATGHDGPPRGQVYGYRMSLWAEHLGGVEEWFRRPETGEC  778

Query  379   VKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSR  200
             V+ VNE+AEENW+ Y + +    +GHL++YP++VD +G+V PL G E FPDVGGKVLG++
Sbjct  779   VRRVNEMAEENWRAYVSPEMEETRGHLMRYPVKVDRDGRVRPLQGHECFPDVGGKVLGTQ  838

Query  199   TTLPDALTT  173
             ++LP+ALTT
Sbjct  839   SSLPNALTT  847



>ref|XP_002461794.1| hypothetical protein SORBIDRAFT_02g008130 [Sorghum bicolor]
 gb|EER98315.1| hypothetical protein SORBIDRAFT_02g008130 [Sorghum bicolor]
Length=839

 Score =  1061 bits (2745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 516/841 (61%), Positives = 647/841 (77%), Gaps = 22/841 (3%)
 Frame = -2

Query  2668  VYLHGDLDLKILEARRLPNMDIVSERIRQFFTAF-----DCRKPETRQGNKVRRHTRIIT  2504
             + LHGDLDL+I+EA+ LPNMD+++ER+R+ FT +     DC K E    +      +IIT
Sbjct  12    MLLHGDLDLQIIEAKCLPNMDLMTERMRKCFTGYGACSTDCGKSENAHPDM----RKIIT  67

Query  2503  SDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGV  2324
             SDPYV VCL+GATVA+TRVI NS++P W EHF + VAH VS +EF VKDNDVFGA+ IGV
Sbjct  68    SDPYVSVCLSGATVAQTRVIPNSENPKWDEHFYVQVAHSVSRIEFLVKDNDVFGAELIGV  127

Query  2323  AKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED----  2156
             A +  + I  G+ +  WFPI G +  P KP   + L +++ P   NP Y+ GV  D    
Sbjct  128   ATIPVEHITPGDMVGGWFPISGQYSNPMKPSPELHLNIQYKPIDMNPLYKDGVGADGPQS  187

Query  2155  YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMV  1976
              G+  +YFP+R GG VTLYQDAHVP+   P+I+ID G+ +    CWEDICHAI+EAHH++
Sbjct  188   VGVPNAYFPLRKGGRVTLYQDAHVPDNFQPQIEIDGGRTYEQNKCWEDICHAIIEAHHLI  247

Query  1975  YIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFIN  1796
             YIVGWS+YH VKLVRE T+P+PNG  + +GE+LK K QEGVRV++L+WDDKTSH KF + 
Sbjct  248   YIVGWSLYHPVKLVRESTKPVPNGNPVTIGEILKRKVQEGVRVIVLLWDDKTSHDKFLLK  307

Query  1795  TSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQ  1616
             T G+M THDEE RK+F+HS V CVL+PRYAS+KLS  KQQVVGTL+THHQKCVIVDTQA 
Sbjct  308   TDGLMHTHDEEARKYFRHSGVHCVLSPRYASNKLSIFKQQVVGTLFTHHQKCVIVDTQAT  367

Query  1615  GNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLH  1436
             GNNRKITAFIGGLDLCDGRYDTP+HRLF D DT+F+ D++NPTFP     GPRQPWHDLH
Sbjct  368   GNNRKITAFIGGLDLCDGRYDTPEHRLFKDLDTIFKDDFHNPTFPVNK-HGPRQPWHDLH  426

Query  1435  CKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVP  1256
             CKIEGPAAYDILTNFEQRWRK++KW    RR      WH D L+KI+R+SWI SPT    
Sbjct  427   CKIEGPAAYDILTNFEQRWRKSAKWKVSVRR---AVSWHHDTLVKIDRMSWIVSPTA---  480

Query  1255  NDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMA  1076
              D+ +  V  E DP+NWHVQVFRSIDSGS+KGFPK V  AE+QNLVCAK+L ID+SI  A
Sbjct  481   -DELNAHVVEEKDPENWHVQVFRSIDSGSVKGFPKLVQEAESQNLVCAKNLQIDKSIHNA  539

Query  1075  YIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYI  896
             Y++AIR AQHF+YIENQYF+GSSY W +++ AGA+NLIP+ELA+KI  KI+ +ERFA YI
Sbjct  540   YVKAIRSAQHFVYIENQYFIGSSYYWSAHRSAGAENLIPIELAIKIARKIKAKERFAAYI  599

Query  895   VIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNRE  716
             VIPMWPEG P++A +Q+ILYWQG T+ MMY+I+A  L+ E + ++HP +YLNFYCLG RE
Sbjct  600   VIPMWPEGNPTTAAMQEILYWQGHTMSMMYKIVADALRKEGLHESHPQEYLNFYCLGKRE  659

Query  715   EWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRD  536
                 E +S+     +  L  +QK  RFMIYVH+KGM+VDDEYV++GSANINQRSM GSRD
Sbjct  660   G-SNEVSSTSNSNENSALRLAQKFRRFMIYVHSKGMIVDDEYVLIGSANINQRSMDGSRD  718

Query  535   TEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIA  356
             TEIAMGAYQPH++WA + + P  QVYGYRMSLWAEHLG ++E     E  ECV++VN++A
Sbjct  719   TEIAMGAYQPHYSWAGSGSPPKGQVYGYRMSLWAEHLGTVEECFRRPESEECVQLVNQMA  778

Query  355   EENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALT  176
             ++NW  Y + +   ++GHL+KYP++V+ +G+V PL G E FPDVGGKVLG+ ++LP+ALT
Sbjct  779   DDNWASYVSPQMVDMKGHLMKYPVKVEQDGRVGPLPGQESFPDVGGKVLGTHSSLPNALT  838

Query  175   T  173
             T
Sbjct  839   T  839



>gb|KFK29154.1| hypothetical protein AALP_AA7G096000 [Arabis alpina]
Length=701

 Score =  1061 bits (2744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/704 (71%), Positives = 593/704 (84%), Gaps = 4/704 (1%)
 Frame = -2

Query  2284  INDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTEDYGLKESYFPMRHGGAVT  2105
             I+ WFPI+ + G+PPKPD A+RL MKF PC  N  Y  G+T   G+   YFP+R GG VT
Sbjct  2     ISGWFPILSSSGRPPKPDAAVRLEMKFVPCGRNDVYTRGITS-LGVTNCYFPVRPGGHVT  60

Query  2104  LYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYIVGWSIYHKVKLVREP  1925
             LYQDAHV    +PEI++DDG  + HE CWEDIC+ I++AHHMVYIVGWSI+HKVKLVR+P
Sbjct  61    LYQDAHVSPEDMPEIELDDGVLYQHERCWEDICNTIVQAHHMVYIVGWSIFHKVKLVRDP  120

Query  1924  TRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTSGVMGTHDEETRKFFK  1745
             +RPLPNGGNL+LG+LLKYKSQEGVRVLLLVWDDKTSH+KFFINT+GVM THDEETRKFFK
Sbjct  121   SRPLPNGGNLSLGDLLKYKSQEGVRVLLLVWDDKTSHNKFFINTTGVMQTHDEETRKFFK  180

Query  1744  HSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCD  1565
              SSV+CVL+PRY SSKLS  KQQVVGTL+THHQKCVIVDTQA GNNRKITAFIGGLDLCD
Sbjct  181   RSSVSCVLSPRYGSSKLSIFKQQVVGTLFTHHQKCVIVDTQASGNNRKITAFIGGLDLCD  240

Query  1564  GRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQ  1385
             GRYDTP+H LF   DT+++GDY+NPTF  GG K PRQPWHDLHCK+EGPAAYDILTNFEQ
Sbjct  241   GRYDTPEHTLFKGLDTIYQGDYHNPTF-SGGTKAPRQPWHDLHCKVEGPAAYDILTNFEQ  299

Query  1384  RWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPNDDPSLWVSNEGDPQNW  1205
             RW+KA+K +E+G++ KK++ WHDDAL+K+ERISWI SP+  +  +D SLWVS + D QNW
Sbjct  300   RWKKATKRSEIGQKLKKVTRWHDDALIKLERISWILSPSAIISTNDTSLWVSKDEDKQNW  359

Query  1204  HVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQ  1025
             HVQ+FRSIDSGSLKGFPKDVHTA  QNL CAK+LVI++SIQ AYI+AIR AQHFIYIENQ
Sbjct  360   HVQIFRSIDSGSLKGFPKDVHTAHAQNLDCAKNLVIEKSIQTAYIQAIRSAQHFIYIENQ  419

Query  1024  YFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQD  845
             YF+GSS+AWP+YKEAGADNL+PMELALKI SKIR  ERF+VYIVIPMWPEGVPSSAPVQ+
Sbjct  420   YFIGSSFAWPNYKEAGADNLVPMELALKISSKIRANERFSVYIVIPMWPEGVPSSAPVQE  479

Query  844   ILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEF  665
             ILYWQGQT+QMMYEIIA+E+++  +E+ HP DYLNFYCLGNREE    S        SE 
Sbjct  480   ILYWQGQTMQMMYEIIAREIRAMNLENVHPRDYLNFYCLGNREEL--PSDKKDVSNNSEM  537

Query  664   LTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKN  485
             ++ SQK  RFMIYVHAKGMVVDDEYV++GSANINQRS+ GSRDTEIAMGAYQ   TW+  
Sbjct  538   VSSSQKWQRFMIYVHAKGMVVDDEYVLLGSANINQRSLGGSRDTEIAMGAYQSQQTWSHR  597

Query  484   QNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQG  305
             + HP  Q+YGYRMSLWAEH+G +D++  E + +ECV+ VN+I ++NWK+YT++ F PLQG
Sbjct  598   KKHPRGQIYGYRMSLWAEHMGKVDDRFKEPQSIECVRKVNKIGDDNWKKYTSDNFLPLQG  657

Query  304   HLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALTT  173
             HLL YPL VD  GK++ L G + FPDVGG++LG+RT LPD LTT
Sbjct  658   HLLNYPLAVDITGKLTSLPGFDTFPDVGGRILGTRTNLPDVLTT  701



>dbj|BAK05685.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=839

 Score =  1060 bits (2740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/840 (60%), Positives = 647/840 (77%), Gaps = 20/840 (2%)
 Frame = -2

Query  2668  VYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRRHTRIITSDPYV  2489
             + LHGDLD++I+EA+ LPNMD+++ERIR+ FT +   +      N      +IITSDPYV
Sbjct  12    LLLHGDLDIQIVEAKCLPNMDLMTERIRKCFTGYGACRTNCGNSNTKPDVRKIITSDPYV  71

Query  2488  KVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVAKVSA  2309
              VCL+GATVA+TRVI+NS++P W EHF + VAH VS +EF VKD+DVFGA+ IGVA V  
Sbjct  72    SVCLSGATVAQTRVINNSENPKWDEHFYVQVAHSVSRLEFHVKDDDVFGAELIGVASVPV  131

Query  2308  QKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGV----TEDYGLKE  2141
             ++I  G+ ++ WFPI G H   PK    + L +++ P  +NP Y+ GV    TE+ G+  
Sbjct  132   EQITEGDIVSGWFPISG-HYSNPKISPELNLSIQYKPFDQNPLYKDGVGAGGTENIGVPN  190

Query  2140  SYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYIVGW  1961
             +YFP+R GG V+LYQDAHVP+   P I+I+ G+ +    CWEDICHAI+EAHH++Y++GW
Sbjct  191   AYFPLRKGGRVSLYQDAHVPDDFRPNIEIEGGRTYEQNKCWEDICHAIVEAHHLIYLIGW  250

Query  1960  SIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTSGVM  1781
             S+YH + L+RE  +PLP+G    +GE+LK K QEGVRV++L+WDDKTSH KF + T G+M
Sbjct  251   SLYHPINLLRESAKPLPDGVPRTIGEILKSKVQEGVRVIVLLWDDKTSHDKFLLKTDGLM  310

Query  1780  GTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQGNNRK  1601
              THDEE RKFF+HS V CVLAPRYAS+K+S  KQQVVGTL+THHQKCVIVDTQA GNNRK
Sbjct  311   HTHDEEARKFFRHSGVHCVLAPRYASNKMSIFKQQVVGTLFTHHQKCVIVDTQATGNNRK  370

Query  1600  ITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCKIEG  1421
             ITAF+GGLDLCDGRYDTP+HRLF D  TVF+ D++NPTFP     GPRQPWHDLHCKIEG
Sbjct  371   ITAFLGGLDLCDGRYDTPEHRLFKDLTTVFKDDFHNPTFPVNKSDGPRQPWHDLHCKIEG  430

Query  1420  PAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPNDDPS  1241
             PAAYDILTNFEQRWRK++KW    RR      WH D L+KI R+SWI SP+     D+ +
Sbjct  431   PAAYDILTNFEQRWRKSAKWKVSVRR---AVSWHHDTLVKINRMSWIVSPSA----DELN  483

Query  1240  LWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAI  1061
               V  E DP+NWHVQ+FRSIDSGS+KGFPKDV  AE+QNLVC K+L ID+SI+ AY++AI
Sbjct  484   AHVCEENDPENWHVQIFRSIDSGSVKGFPKDVQEAESQNLVCGKNLQIDKSIRNAYVKAI  543

Query  1060  RRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPMW  881
             R AQHFIYIENQYF+GSSY W ++K AGA+NLIP+ELA+KI  KI+ RE FA YI+IPMW
Sbjct  544   RSAQHFIYIENQYFIGSSYYWSAHKGAGAENLIPIELAIKIARKIKAREPFAAYIIIPMW  603

Query  880   PEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREEWHEE  701
             PEG P++AP+Q+IL+WQGQT+ MMY+IIA  L+ E ++DAHP DYLNFYCLG R    E 
Sbjct  604   PEGNPTTAPMQEILFWQGQTMSMMYKIIADALRKEGLDDAHPQDYLNFYCLGKR----EV  659

Query  700   SASSPTPGC----SEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDT  533
             +A  PTP      +  +  +QK  RFMIYVH+KGM++DDE+V++GSANINQRS+ G RDT
Sbjct  660   TAEVPTPTSHSNENSPMRLAQKFRRFMIYVHSKGMIIDDEFVLIGSANINQRSLDGLRDT  719

Query  532   EIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAE  353
             EIAMGAYQPH++WA +Q  P  QVYGYRMSLWAEHLG ++E   + +  ECV++VN++AE
Sbjct  720   EIAMGAYQPHYSWAGSQGPPRGQVYGYRMSLWAEHLGTVEECFRQPQSTECVQLVNQMAE  779

Query  352   ENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALTT  173
             +NW  Y + +   ++GHL++YP++V+ +G+V PL G E FPDVGGKVLGS ++LP+ALTT
Sbjct  780   DNWACYVSPQMVDMKGHLMRYPIKVEKDGRVVPLPGHESFPDVGGKVLGSHSSLPNALTT  839



>ref|XP_004956880.1| PREDICTED: phospholipase D delta-like isoform X1 [Setaria italica]
 ref|XP_004956881.1| PREDICTED: phospholipase D delta-like isoform X2 [Setaria italica]
Length=838

 Score =  1059 bits (2739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/836 (61%), Positives = 646/836 (77%), Gaps = 13/836 (2%)
 Frame = -2

Query  2668  VYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRRHTRIITSDPYV  2489
             + LHGDLD++I+EA+ LPNMD+++ER+R+ FT +     +  + +      +IITSDPYV
Sbjct  12    MLLHGDLDIQIIEAKCLPNMDLMTERMRKCFTGYGACSTDCGKADPHPDMRKIITSDPYV  71

Query  2488  KVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVAKVSA  2309
              VCL+GATVA+TRVI+NS++P W EHF + VAH VS VEF VKDNDVFGA+ IGVA +  
Sbjct  72    SVCLSGATVAQTRVIANSENPKWEEHFYVQVAHSVSRVEFHVKDNDVFGAELIGVASIPV  131

Query  2308  QKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED----YGLKE  2141
             + I  G+ ++ WFPI G +  P KP   + L +++ P   NP Y+ GV  D     G+  
Sbjct  132   EHITPGDMVSGWFPISGQYSNPMKPSPELHLSIQYKPIDMNPLYKDGVGADGHQSVGVPN  191

Query  2140  SYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYIVGW  1961
             +YFP+R GG VTLYQDAHVP+   P+I+ID G+ +    CWEDICHAI+EAHH++YIVGW
Sbjct  192   AYFPIRKGGMVTLYQDAHVPDNFRPQIEIDGGRTYEQNRCWEDICHAIIEAHHLIYIVGW  251

Query  1960  SIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTSGVM  1781
             S+YH V+LVRE T+P+PNG  L +GELLK K QEGVRV++L+WDDKTSH KF + T G+M
Sbjct  252   SLYHPVRLVRESTKPVPNGNPLTIGELLKRKVQEGVRVIVLLWDDKTSHDKFLLKTDGLM  311

Query  1780  GTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQGNNRK  1601
              THDEE RK+F+HS V CVL+PRYAS+KLS  KQQVVGTL+THHQKCVIVDTQA GNNRK
Sbjct  312   NTHDEEARKYFRHSGVHCVLSPRYASNKLSIFKQQVVGTLFTHHQKCVIVDTQATGNNRK  371

Query  1600  ITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCKIEG  1421
             ITAFIGGLDLCDGRYDTP+HRLF D DTVF+ D++NPTFP   L GPRQPWHDLHCKIEG
Sbjct  372   ITAFIGGLDLCDGRYDTPEHRLFKDLDTVFKDDFHNPTFPVNKL-GPRQPWHDLHCKIEG  430

Query  1420  PAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPNDDPS  1241
             PAAYD+LTNFEQRWRK++KW    RR      WH D L+KI+R+SWI SP+     D+ +
Sbjct  431   PAAYDVLTNFEQRWRKSAKWKVSVRR---AVSWHHDTLVKIDRMSWIVSPSA----DELN  483

Query  1240  LWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAI  1061
               V  E DP+NWHVQVFRSIDSGS+KGFPK V  AE+QNLVCAK++ ID+SI  AY++AI
Sbjct  484   AHVCEENDPENWHVQVFRSIDSGSVKGFPKLVQEAESQNLVCAKNVQIDKSIHNAYVKAI  543

Query  1060  RRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPMW  881
             R AQHF+YIENQYF+GSSY W +++ AGA+NLIP+ELA+KI  KI+ +ERFA YIVIPMW
Sbjct  544   RSAQHFVYIENQYFIGSSYYWSAHRSAGAENLIPIELAIKIARKIKAKERFAAYIVIPMW  603

Query  880   PEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREEWHEE  701
             PEG P++A +Q+ILYWQG T+ +MY+I+A  L+ E + + HP +YLNFYCLG RE   + 
Sbjct  604   PEGNPTTAAMQEILYWQGHTMSLMYKIVADALRKEGLHERHPQEYLNFYCLGKREVLSDV  663

Query  700   SASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAM  521
              A++ +   S  L  +QK  RFMIYVH+KGM+VDDEYV++GSANINQRSM GSRDTEIAM
Sbjct  664   LATNNSNENSA-LRLAQKFRRFMIYVHSKGMIVDDEYVLIGSANINQRSMDGSRDTEIAM  722

Query  520   GAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWK  341
             GAYQPH++WA   + P  QVYGYRMSLWAEHLG ++E     E  ECV+ VN++A++NW 
Sbjct  723   GAYQPHYSWAGRGSPPKGQVYGYRMSLWAEHLGTVEECFRRPESEECVRRVNQMADDNWA  782

Query  340   RYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALTT  173
              Y + +   ++GHL++YP++V+ +G+V PL G E FPDVGGKVLG+ ++LP+ALTT
Sbjct  783   GYVSPQMVDMKGHLMRYPVRVEQDGRVGPLPGQEIFPDVGGKVLGTHSSLPNALTT  838



>emb|CDY41630.1| BnaC03g62540D [Brassica napus]
Length=867

 Score =  1056 bits (2731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 536/881 (61%), Positives = 652/881 (74%), Gaps = 54/881 (6%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQ-------  2540
             M++ +SE+V+ LHGDLDLKI++ARRLPN D  SER+R+ F   + C KP T         
Sbjct  1     MAENVSEDVILLHGDLDLKIVQARRLPNRDTFSERMRRCFKPCNSCIKPTTDDYDGEASS  60

Query  2539  ---GNKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEF  2369
                   +R   R  TSDPYV V +  AT+ART V+ N+ DPVW  HFK+ VAHP+S ++ 
Sbjct  61    DDDDENIRGLPRN-TSDPYVTVSVPQATLARTHVLKNASDPVWNRHFKVSVAHPLSYLKL  119

Query  2368  QVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAE  2189
             +VKD DV GA  IG  ++  Q+I SGE I+ WFP++G  GKPPK + A+ + +KFTP  +
Sbjct  120   KVKDYDVSGAQTIGTVRIPVQQIASGERISGWFPVLGRSGKPPKKETALHIDLKFTPFDK  179

Query  2188  -NPRYRGGVTEDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWED  2012
               P+   GV        +YFP+R G  V LYQDAHV +G LPEI++++G+ + H  CWED
Sbjct  180   IQPKTTLGVMG------TYFPLRKGSQVKLYQDAHVMDGMLPEIRLENGEVYQHGKCWED  233

Query  2011  ICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVW  1832
             ICHAI EAHHM+YIVGWS++HKV+LVREPTR LP GG+L LGELLKYKS+EGVRVLLLVW
Sbjct  234   ICHAICEAHHMIYIVGWSVFHKVQLVREPTRVLPRGGDLTLGELLKYKSEEGVRVLLLVW  293

Query  1831  DDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQ--------  1676
             DDK+S  KF I+T GVMGTHDEETRKFF HSSV C+L+PRYAS+KL   KQQ        
Sbjct  294   DDKSSRDKFGISTPGVMGTHDEETRKFFNHSSVKCILSPRYASNKLGLFKQQAINGLFTR  353

Query  1675  -----------VVGTLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFS  1529
                        VVGTL+THHQKCV+VDTQA G+NRK+TAFIGG+DLCDGRYDTP+HR+F 
Sbjct  354   VSVWHGWYLNQVVGTLFTHHQKCVLVDTQAVGSNRKVTAFIGGIDLCDGRYDTPEHRIFH  413

Query  1528  DRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELG  1349
             D DTVF+ D++NPTFP G +  PRQPWHD+HC+++GPAAYD+L NFEQRWRKA++W E  
Sbjct  414   DLDTVFKDDFHNPTFPSGAI-APRQPWHDMHCRLDGPAAYDVLINFEQRWRKATRWKEFN  472

Query  1348  RRFKKISHWHDDALLKIERISWITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQV  1193
                K +  W DD+LL+I RISWI +P           VP DDP ++VSNE +P+NWHVQV
Sbjct  473   LNGKTL--WQDDSLLRIGRISWILNPKFKYRIDGVSHVPEDDPIVYVSNEDNPENWHVQV  530

Query  1192  FRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLG  1013
             FRSIDSGS+KGF K  + AE  +L   K LV+D+SIQ AYI+ IR AQHFIYIENQYFLG
Sbjct  531   FRSIDSGSVKGFLKFENDAEALHLEYDKRLVVDKSIQTAYIQIIRSAQHFIYIENQYFLG  590

Query  1012  SSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYW  833
             SSYAW  Y +AGADNLIPMELALKI SKIR +ERFAVY+VIPMWPEG P S P+Q+ILYW
Sbjct  591   SSYAWLDYNDAGADNLIPMELALKITSKIRAKERFAVYVVIPMWPEGDPKSGPMQEILYW  650

Query  832   QGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGS  653
             Q QT+QMMY++IA+ELKS +  +AHP DYLNFYCLG RE++ +     P    S  +T S
Sbjct  651   QSQTMQMMYDVIARELKSVQ-SNAHPLDYLNFYCLGKREQFPDHDM--PATNVSA-VTDS  706

Query  652   QKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHP  473
              K  RFMIYVHAKGMVVDDEYV++GSANINQRSMAG++DTEIAMGAYQPHHTWA    HP
Sbjct  707   YKFKRFMIYVHAKGMVVDDEYVLMGSANINQRSMAGTKDTEIAMGAYQPHHTWANKGKHP  766

Query  472   HAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLK  293
               QVYGYRMSLWAEHLG   ++  E   LECVK VNEIAE NW+++   +FS LQGHL+K
Sbjct  767   RGQVYGYRMSLWAEHLGKTGDEFVEPGDLECVKNVNEIAERNWRKFIDSEFSELQGHLIK  826

Query  292   YPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRT-TLPDALTT  173
             YPL VD +G V  L G + FPDVGGK++G  +  +PD LTT
Sbjct  827   YPLHVDIDGNVISLPGYDSFPDVGGKIIGDHSKAIPDTLTT  867



>gb|KHN33827.1| Phospholipase D delta [Glycine soja]
Length=702

 Score =  1053 bits (2722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/705 (74%), Positives = 598/705 (85%), Gaps = 28/705 (4%)
 Frame = -2

Query  2212  MKFTPCAENPRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGK  2042
             MKFT C ++  YR     D   + +++SYFP+RHGG+VTLYQDAHVP+  LPE++++DG 
Sbjct  1     MKFTRCEDSFMYRSRTETDPDRFVVRDSYFPVRHGGSVTLYQDAHVPDSMLPEVELEDGV  60

Query  2041  AFHHENCWEDICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQ  1862
              F H  CWEDICHAILEAHH+VYIVGWSIYHKVKLVREPT+PLP+GGNL+LGELLKYKSQ
Sbjct  61    VFEHGKCWEDICHAILEAHHLVYIVGWSIYHKVKLVREPTKPLPSGGNLSLGELLKYKSQ  120

Query  1861  EGVRVLLLVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVK  1682
             EG+RVLLLVWDDKTSHSKFFINTSGVM THDEETRKFFKHSSV C+L+PRYAS ++ F K
Sbjct  121   EGLRVLLLVWDDKTSHSKFFINTSGVMQTHDEETRKFFKHSSVRCLLSPRYAS-RIVFRK  179

Query  1681  Q--------------------QVVGTLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDG  1562
             Q                    QVVGTL+THHQKCVIVDTQA GNNRKITAFIGGLDLCDG
Sbjct  180   QDYFVFQKLKNIFTILLGTKLQVVGTLFTHHQKCVIVDTQAHGNNRKITAFIGGLDLCDG  239

Query  1561  RYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQR  1382
             RYDTP+HR+  D DTV++ DY+NPTF   G KGPRQPWHDLHCKIEGPAAYDILTNFEQR
Sbjct  240   RYDTPEHRILRDIDTVYQDDYHNPTFC-AGTKGPRQPWHDLHCKIEGPAAYDILTNFEQR  298

Query  1381  WRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPNDDPSLWVSNEGDPQNWH  1202
             WRKA++W+ELGR+ K++SHW+DD+L+K+ERISWI SP+ S P DDP LWVS E DP+NWH
Sbjct  299   WRKATRWSELGRKLKRVSHWNDDSLIKLERISWILSPSESTPIDDPELWVSKEDDPENWH  358

Query  1201  VQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQY  1022
             VQVFRSIDSGSLKGFPKDV  AETQNLVCAK+LVID+SIQ AYI AIR AQHFIYIENQY
Sbjct  359   VQVFRSIDSGSLKGFPKDVVVAETQNLVCAKNLVIDKSIQTAYIHAIRSAQHFIYIENQY  418

Query  1021  FLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDI  842
             F+GSS+AWP+YKEAGADNLIP+ELALKIVSKIR++ERFAVYIVIPMWPEG PSS  VQ+I
Sbjct  419   FIGSSFAWPAYKEAGADNLIPVELALKIVSKIRSKERFAVYIVIPMWPEGSPSSTSVQEI  478

Query  841   LYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREEWHEE--SASSPTPGCSE  668
             L+WQGQT++MMYEIIA+ELKS ++ D+HP DYLNFYCLGNRE+   E  S+SS      E
Sbjct  479   LFWQGQTMKMMYEIIARELKSMQL-DSHPQDYLNFYCLGNREQLTTEVSSSSSSPSDNGE  537

Query  667   FLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAK  488
              ++ SQK  RFMIYVHAKGM+VDDEYVI+GSANINQRS+AGSRDTEIAMGAYQPHHTW++
Sbjct  538   TVSASQKFRRFMIYVHAKGMIVDDEYVILGSANINQRSLAGSRDTEIAMGAYQPHHTWSQ  597

Query  487   NQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQ  308
              + HPH QVYGYRMSLWAEH G ++    E E LECVK VN+IAE+NWK+YTA+ +SPLQ
Sbjct  598   KKGHPHGQVYGYRMSLWAEHTGTIEACFKEPECLECVKSVNKIAEDNWKKYTADDYSPLQ  657

Query  307   GHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALTT  173
             GHL+KYP+ V++NGKV  L G E FPDVGGKVLGSR+TLPDALTT
Sbjct  658   GHLMKYPVSVNANGKVKSLPGFESFPDVGGKVLGSRSTLPDALTT  702



>ref|XP_009600603.1| PREDICTED: phospholipase D delta-like [Nicotiana tomentosiformis]
 ref|XP_009600604.1| PREDICTED: phospholipase D delta-like [Nicotiana tomentosiformis]
Length=834

 Score =  1051 bits (2718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/837 (61%), Positives = 640/837 (76%), Gaps = 21/837 (3%)
 Frame = -2

Query  2668  VYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQ-GNKVRRHTRIITSDPY  2492
             V LHG+LDL+++EA+ LPNMD+        F+ F  RK +++  GNK      I TSDPY
Sbjct  14    VLLHGELDLRVIEAKSLPNMDMAC---CSKFSPFGTRKVKSKDTGNKSATRKIIDTSDPY  70

Query  2491  VKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVAKVS  2312
             V VC+ GA VART VI N ++P W EH +IPVAH V +VEF VKDND  GA+ IG  ++ 
Sbjct  71    VSVCIGGAKVARTTVIRNDENPTWNEHVRIPVAHKVDKVEFFVKDNDGVGAELIGKVEIP  130

Query  2311  AQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED---YGLKE  2141
             A KI  G+ I+ WFPI+G+ G P K    + L +++ P AENP YR GV  +    G+  
Sbjct  131   ADKIHVGKEISGWFPILGSSGDPLKTGAQLHLSIQYKPVAENPIYRNGVGGEANRVGVPH  190

Query  2140  SYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYIVGW  1961
             +YFP+R GG VTLYQDAHVP+ +LPEI +DDGK F+H  CWEDICHA+LEA +++Y+VGW
Sbjct  191   TYFPLRKGGNVTLYQDAHVPDATLPEILLDDGKVFNHNKCWEDICHAMLEAKYLIYVVGW  250

Query  1960  SIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTSGVM  1781
             S+YH ++LVREPTR LP+ G   LG+LLKYKSQEGVRV+LL+WDDKTS+   F+ T GVM
Sbjct  251   SVYHPIRLVREPTRTLPSAGERTLGDLLKYKSQEGVRVILLIWDDKTSNDDLFLKTEGVM  310

Query  1780  GTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQGNNRK  1601
              THDEETRKFFKHSSV CVL PR ASSKLS +K+Q+VG+L+THHQKCV+VDT+A GN RK
Sbjct  311   QTHDEETRKFFKHSSVHCVLCPRSASSKLSVLKRQIVGSLFTHHQKCVLVDTEAPGNERK  370

Query  1600  ITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCKIEG  1421
             ITAFIGGLDLCDGRYDTPQHRLFSD DTVF  D +NPTF      GPR+PWHDLHCKIEG
Sbjct  371   ITAFIGGLDLCDGRYDTPQHRLFSDLDTVFGNDVHNPTFTTTS-GGPREPWHDLHCKIEG  429

Query  1420  PAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPNDDPS  1241
             PAAYD+LTNFEQR+ KA KW +L R+ K+ S    D LLK++RI+ I  P+   P+ D  
Sbjct  430   PAAYDVLTNFEQRFNKAIKWLKL-RKVKQGS----DTLLKLDRIAAIRMPSAG-PDGDRV  483

Query  1240  LWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAI  1061
             + V++E DP++WHVQVFRSIDSGS+KGFPKDV  AE QNL   K+L I+RSI +AY++AI
Sbjct  484   VRVTSEQDPESWHVQVFRSIDSGSVKGFPKDVKEAEAQNLASGKNLKIERSIHLAYVKAI  543

Query  1060  RRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPMW  881
             R AQHF+Y+ENQYFLGS+Y+WPS++ +GA+NL+PME+ALKI  KI   E FA YIV+PMW
Sbjct  544   RSAQHFVYVENQYFLGSAYSWPSHRNSGANNLVPMEIALKIARKIAANEPFAAYIVVPMW  603

Query  880   PEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDA-HPCDYLNFYCLGNREEWHE  704
             PEGVPSS PVQ+IL+WQ QT+ MMY+I+A+ L   ++    HP DYLNFYCLG RE    
Sbjct  604   PEGVPSSKPVQEILFWQSQTMAMMYKIVAEALDKARVSQYFHPQDYLNFYCLGKREVAKG  663

Query  703   ESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIA  524
             +S  S + G       +QK GRFMIYVH+KGM+VDDEYV++GSANINQRS++GSRDTEIA
Sbjct  664   KSEKSVSQGL------AQKFGRFMIYVHSKGMIVDDEYVLMGSANINQRSLSGSRDTEIA  717

Query  523   MGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENW  344
             MGAYQP++TWAK   HPH QVYGYRMSLWAEHLG+++  L E + +ECV+ VNEIA  NW
Sbjct  718   MGAYQPNYTWAKKDRHPHGQVYGYRMSLWAEHLGVIENTLTEPQTVECVRRVNEIARYNW  777

Query  343   KRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALTT  173
               ++ +++  ++GHL++YP+QV  NG V+ + G E FPDVGGK+LG+ T LPDALTT
Sbjct  778   NAFSGDEYKKMKGHLMQYPIQVSKNGDVTTMPGFECFPDVGGKILGAPTNLPDALTT  834



>gb|KHN41861.1| Phospholipase D delta [Glycine soja]
Length=735

 Score =  1051 bits (2717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/740 (68%), Positives = 608/740 (82%), Gaps = 25/740 (3%)
 Frame = -2

Query  2332  IGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED-  2156
             +G  KV A++I +G  I++WFP++   GKPPKPD A+ + M+FTP +EN  Y+ G+  D 
Sbjct  1     MGTVKVPARRIATGAKISEWFPVLLPSGKPPKPDTALHVEMQFTPVSENLLYQRGIAADP  60

Query  2155  --YGLKESYFPMRHGGAVTLYQDAHVPE---GSLPEIKIDDGKAFHHENCWEDICHAILE  1991
                G++ +YFP+R G +V LYQDAH  E   G +PEIK+++G  + H  CWEDIC+AI E
Sbjct  61    EHNGVRHTYFPVRKGSSVRLYQDAHCTESGEGKIPEIKLENGNVYRHGKCWEDICYAISE  120

Query  1990  AHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHS  1811
             AHHMVY+VGWSIYHKV+LVREPTRPLP GG+L LGELLKYKS+EGVRVLLLVWDDKTSH 
Sbjct  121   AHHMVYLVGWSIYHKVRLVREPTRPLPRGGDLTLGELLKYKSEEGVRVLLLVWDDKTSHD  180

Query  1810  KFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQ--VVGTLYTHHQKCV  1637
             K F+ T+GVMGTHDEETRKFFKHSSV CVL+PRYASSK+SF+KQQ  VVGT++THHQKCV
Sbjct  181   KVFLKTAGVMGTHDEETRKFFKHSSVMCVLSPRYASSKMSFLKQQASVVGTVFTHHQKCV  240

Query  1636  IVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPR  1457
             IVDTQA GNNRKITAFIGGLDLCDGRYDTP+HRLF + D VF GD++NPTFP  G + PR
Sbjct  241   IVDTQAAGNNRKITAFIGGLDLCDGRYDTPEHRLFRNLDDVFDGDFHNPTFP-AGTRVPR  299

Query  1456  QPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWIT  1277
             QPWHDLHC+I+GPAAYD+L NFEQRWRKA+KW E    FKK S WHDDAL++IERISWI 
Sbjct  300   QPWHDLHCRIDGPAAYDVLINFEQRWRKATKWKEFAILFKKTSQWHDDALIRIERISWIL  359

Query  1276  SPTP-----------SVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAET  1130
             SP+            +VP DDP +WVS+E DP+NWHVQ+FRSIDSGSLKGFPK V  A +
Sbjct  360   SPSGAATLKDKSDYYTVPEDDPLVWVSSEDDPENWHVQIFRSIDSGSLKGFPKRVDIALS  419

Query  1129  QNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMEL  950
             QNL+CAK+LVID+SIQ AYI+AIR AQHFIYIENQYF+GSSYAWP+YK+AGADNLIPMEL
Sbjct  420   QNLICAKNLVIDKSIQTAYIQAIRSAQHFIYIENQYFIGSSYAWPAYKDAGADNLIPMEL  479

Query  949   ALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKI  770
             ALKI SKIR +ERFAVYI++PMWPEG P +  +Q+IL+WQGQT+QMMY+++A+ELKS ++
Sbjct  480   ALKIASKIRAKERFAVYIILPMWPEGDPKTGAMQEILFWQGQTMQMMYDVVARELKSMQL  539

Query  769   EDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEY  590
              D HP +YLNFYCLGNRE ++E+S+S  T G    ++ + K  RFMIYVHAKGM+VDDEY
Sbjct  540   TDVHPQEYLNFYCLGNREHFNEDSSS--TNGAQ--VSTAYKYRRFMIYVHAKGMIVDDEY  595

Query  589   VIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDE  410
             VI+GSANINQRSMAG++DTEIAMGAYQPH+TW+  + HPH Q+YGYRMSLW EHLGM+DE
Sbjct  596   VIIGSANINQRSMAGTKDTEIAMGAYQPHYTWSAKKRHPHGQIYGYRMSLWGEHLGMLDE  655

Query  409   KLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFP  230
               +E   LECV+ VNEIAE NWK + +E FS LQGHLLKYP+QVDS+GK+  L  CE FP
Sbjct  656   TFEEPGRLECVEKVNEIAENNWKLFASEDFSLLQGHLLKYPVQVDSDGKIRSLPDCENFP  715

Query  229   DVGGKVLGSR-TTLPDALTT  173
             D GGK+LG+  TT+PD LTT
Sbjct  716   DAGGKILGAHSTTIPDILTT  735



>ref|XP_003557320.1| PREDICTED: phospholipase D delta-like isoform X1 [Brachypodium 
distachyon]
Length=841

 Score =  1047 bits (2707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/846 (60%), Positives = 646/846 (76%), Gaps = 22/846 (3%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRRHTRIITS  2501
             S   + LHGDLD++I+EA+ LPNMD+++ER+R+ FT +   + +    +      +IITS
Sbjct  8     SGTSMLLHGDLDIQIVEAKCLPNMDLMTERMRKCFTGYGACRTDCGNSDPHPDVRKIITS  67

Query  2500  DPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVA  2321
             DPYV VCL+GATVA+TRVISNS++P W EHF   VAH VS +EF VKDNDVFGA+ IGVA
Sbjct  68    DPYVSVCLSGATVAQTRVISNSENPKWDEHFCFQVAHSVSRLEFHVKDNDVFGAELIGVA  127

Query  2320  KVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT----EDY  2153
              +  ++I  G+ +  WFPI G H   PK    + L +++ P  +NP Y+ GV     E+ 
Sbjct  128   SIPVEQIAPGDVVTGWFPISG-HYNNPKTSPELHLSIQYKPFEQNPLYKDGVFADSFENA  186

Query  2152  GLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVY  1973
             G+  +YFP+R GG VTLYQDAHV +   P I+ID  + +    CWEDICHAI+EAHH++Y
Sbjct  187   GVPNAYFPLRKGGKVTLYQDAHVSDDFRPNIEIDGERIYEQNKCWEDICHAIVEAHHLIY  246

Query  1972  IVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINT  1793
             ++GWS+YH +KL+RE  +PLPNG    +GE+LK K QEGVRV++L+WDDKTSH KF + T
Sbjct  247   MIGWSLYHPIKLLRESAKPLPNGVPETIGEILKSKVQEGVRVIVLLWDDKTSHDKFLLKT  306

Query  1792  SGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQG  1613
              G+M THDEE RKFF+HS V CVL+PRYAS+K+S  KQQVVGTL+THHQKCVIVDTQA G
Sbjct  307   DGLMHTHDEEARKFFRHSGVHCVLSPRYASNKMSIFKQQVVGTLFTHHQKCVIVDTQATG  366

Query  1612  NNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHC  1433
             NNRKITAFIGGLDLCDGRYDTP+HRLF D +TVF+ D++NPTF      GPRQPWHDLHC
Sbjct  367   NNRKITAFIGGLDLCDGRYDTPEHRLFKDLNTVFKDDFHNPTFQVNKSDGPRQPWHDLHC  426

Query  1432  KIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPN  1253
             KIEGPAAYDILTNFEQRWRK++KW    RR      WH D L+KI R+SWI SP+     
Sbjct  427   KIEGPAAYDILTNFEQRWRKSAKWKVSVRR---AVSWHHDTLVKINRMSWIVSPSA----  479

Query  1252  DDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAY  1073
             D+ +  V +E DP+NWHVQ+F+SIDSGS+KGFPK V  AE+QNLVCAK+L ID+SI  AY
Sbjct  480   DELNAHVCDEKDPENWHVQIFQSIDSGSVKGFPKLVQEAESQNLVCAKNLQIDKSIHNAY  539

Query  1072  IEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIV  893
             ++AIR AQHFIYIENQYF+GSSY W S++ AGA+NLIP+ELA+KI  KI+ RE FA YIV
Sbjct  540   VKAIRCAQHFIYIENQYFVGSSYYWSSHRNAGAENLIPIELAIKIARKIKAREPFAAYIV  599

Query  892   IPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREE  713
             IPMWPEG P++A +Q+IL+WQGQT+ MMY+IIA  L+ E ++DAHP DYLNFYCLG R  
Sbjct  600   IPMWPEGNPTTAAMQEILFWQGQTMSMMYKIIADALRKEGLDDAHPQDYLNFYCLGKR--  657

Query  712   WHEESASSPTPGCSEF------LTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSM  551
               E S+  P P  S        +  +QK  RFMIYVH+KGM++DDE+V++GSANINQRSM
Sbjct  658   --EISSEVPAPSHSSHSNENSPMRLAQKFKRFMIYVHSKGMIIDDEFVLIGSANINQRSM  715

Query  550   AGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKM  371
              G RDTEIAMGA+QPH++WA + + P  QVYGYRMSLWAEHLGM++E     + +ECV++
Sbjct  716   DGLRDTEIAMGAFQPHYSWAGSSSPPRGQVYGYRMSLWAEHLGMLEECFKRPQSVECVQL  775

Query  370   VNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTL  191
             VN +AE+NW+ Y + + S ++GHL+KYP++V+S+G+V PL G E FPDVGGKVLGS ++L
Sbjct  776   VNCMAEDNWQCYVSPQMSEMKGHLMKYPIKVESDGRVGPLPGYENFPDVGGKVLGSHSSL  835

Query  190   PDALTT  173
             P+ALTT
Sbjct  836   PNALTT  841



>gb|AER41581.1| phospholipase+D [Oryza brachyantha]
Length=829

 Score =  1046 bits (2705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/840 (61%), Positives = 639/840 (76%), Gaps = 22/840 (3%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRRHTRIITS  2501
             S   + LHGDLD++I+EA+ LPNMD+++ER+R+ FT +     E  + +      +IITS
Sbjct  8     SGTSLLLHGDLDIQIVEAKCLPNMDLMTERMRRCFTGYGACSTECGKSDPHPDMRKIITS  67

Query  2500  DPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVA  2321
             DPYV VCL+GATVA+TRVI+NS++P W EHF + VAH VS +EF VKDNDVFGA+ IGVA
Sbjct  68    DPYVSVCLSGATVAQTRVIANSENPKWDEHFNVQVAHSVSRIEFHVKDNDVFGAELIGVA  127

Query  2320  KVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGV----TEDY  2153
              V  + I  G+ ++ WFPI G +  P K    + L +++ P  +NP Y+ GV    ++  
Sbjct  128   SVPVEDITPGDMVSGWFPISGQYSNPMKASPELHLSIQYKPIDQNPLYKDGVGSEGSQST  187

Query  2152  GLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVY  1973
             G+  +YFP+R GG VTLYQDAHVP+   P+I+ID G+ +    CWEDICHAI+EAHH++Y
Sbjct  188   GVPNAYFPLRKGGRVTLYQDAHVPDDFCPKIEIDGGRLYEQNKCWEDICHAIVEAHHLIY  247

Query  1972  IVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINT  1793
             I+GWS+YH VKLVRE T+P+PNG    +GELLK K QEGVRV++L+WDDKTSH KF + T
Sbjct  248   IIGWSLYHPVKLVRESTKPVPNGSPPTIGELLKSKVQEGVRVIVLLWDDKTSHDKFLLKT  307

Query  1792  SGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQG  1613
              G+M THDEE RKFF+HS V CVLAPRYAS+KLS  KQQVVGTL+THHQKCVIVDTQA G
Sbjct  308   DGLMHTHDEEARKFFRHSGVHCVLAPRYASNKLSIFKQQVVGTLFTHHQKCVIVDTQASG  367

Query  1612  NNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHC  1433
             NNRKITAFIGGLDLCDGRYDTP+HRLF D DTVF+ D++NPTF +    GPRQPWHDLHC
Sbjct  368   NNRKITAFIGGLDLCDGRYDTPEHRLFKDLDTVFKDDFHNPTF-QVNKSGPRQPWHDLHC  426

Query  1432  KIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPN  1253
             KIEGPAAYDILTNFEQRWRK++KW    RR      WH D L+KI R+SWI SP+     
Sbjct  427   KIEGPAAYDILTNFEQRWRKSAKWKVSVRR---AVSWHHDTLVKINRMSWIVSPSA----  479

Query  1252  DDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAY  1073
             D+ +  V ++ DP+NWHVQ+FRSIDSGS+KGFPK V  AE+Q         ID+SI  AY
Sbjct  480   DELNAHVCDQNDPENWHVQIFRSIDSGSVKGFPKLVQEAESQ---------IDKSIHNAY  530

Query  1072  IEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIV  893
             ++AIR AQ +IYIENQYF+GSSY W S + AGA+NLIP+ELA+KI  KI+ RERFA YIV
Sbjct  531   VKAIRSAQQYIYIENQYFIGSSYYWSSNRSAGAENLIPIELAIKIARKIKARERFAAYIV  590

Query  892   IPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREE  713
             IPMWPEG P++A +Q+IL+WQGQT+ MMY+I+A  L+ E + D HP DYLNFYCLG RE 
Sbjct  591   IPMWPEGNPTTAAMQEILFWQGQTMSMMYKIVADALRKEGLHDTHPQDYLNFYCLGKREA  650

Query  712   WHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDT  533
               + S +S +   S  L  +QK  RFMIYVH+KGM+VDDEYV++GSANINQRSM GSRDT
Sbjct  651   LSDISTTSHSNENSS-LRLAQKFRRFMIYVHSKGMIVDDEYVLIGSANINQRSMDGSRDT  709

Query  532   EIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAE  353
             EIAMGAYQPH++WA  +  P+ QVYGYRMSLWAEHLG ++E       +ECV+ VN++AE
Sbjct  710   EIAMGAYQPHYSWAGGKKAPNGQVYGYRMSLWAEHLGTLEECFRWPHSMECVRQVNQMAE  769

Query  352   ENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALTT  173
             ENW  Y + + + ++GHL++YP+ VDS+G+V P+ G E FPDVGGKVLG+ ++LP+ALTT
Sbjct  770   ENWACYVSPEMANMRGHLMRYPISVDSDGRVGPVRGQECFPDVGGKVLGTHSSLPNALTT  829



>ref|XP_010029628.1| PREDICTED: phospholipase D delta-like isoform X2 [Eucalyptus 
grandis]
Length=870

 Score =  1046 bits (2704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 536/883 (61%), Positives = 646/883 (73%), Gaps = 55/883 (6%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTA------------FDCRKP  2552
             M+    +  VYLHGDLDL I+ A  LPNMD+V+ R+R  F+A                 P
Sbjct  1     MAGSPPDGPVYLHGDLDLHIISASDLPNMDMVTGRLRWCFSACARPPRSPDPDPDPASLP  60

Query  2551  ETRQGNKVR-RHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEV  2375
               R  +     H +IITSDPYV VC+  ATVARTRV+ N+QDP W + F IP+AHPV  +
Sbjct  61    IHRSDDDDGPHHAKIITSDPYVTVCVPHATVARTRVLHNTQDPEWDQWFCIPLAHPVDYL  120

Query  2374  EFQVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPC  2195
             EF+VKDND+FGA  IG  K+SA++I+    I+  FP+ G   K    + A++L + FTP 
Sbjct  121   EFRVKDNDLFGAQVIGTVKISAREIMEKRVISRSFPLSGPSAKQ---NSALKLQLTFTPV  177

Query  2194  AENPRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDD--GKAFHH  2030
              EN  YR G+  D    G++++YFP+R G  +TLYQDAHV +GSLPEIK+D   G  +  
Sbjct  178   EENEVYRIGIAGDPKHQGVRQTYFPLRKGSGLTLYQDAHVIDGSLPEIKLDSDAGGVYRR  237

Query  2029  ENCWEDICHAILEAHHMVYIVGWSIYHKVKLVRE--PTRplpnggnlnlgelLKYKSQEG  1856
             E CWEDICHAI EAHH++YIVGWS+ HK+KL+RE   TRPLP  G+L LGELLKYKSQEG
Sbjct  238   EKCWEDICHAISEAHHLIYIVGWSVSHKIKLIREHTQTRPLPQDGDLTLGELLKYKSQEG  297

Query  1855  VRVLLLVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQ  1676
             VRVLLL+WDDKTSH K+FIN  GVM THDEET+ FFKHSSV CVLAPR  SSKL ++KQQ
Sbjct  298   VRVLLLIWDDKTSHKKYFINMEGVMQTHDEETKDFFKHSSVNCVLAPRNPSSKLGYIKQQ  357

Query  1675  VVGTLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYN  1496
             VVG+++THHQKC++VDTQA GN RKITAFIGG+DLCDGRYDTP+HRLF + DTVF+ D++
Sbjct  358   VVGSMFTHHQKCILVDTQASGNYRKITAFIGGIDLCDGRYDTPEHRLFRNLDTVFKDDFH  417

Query  1495  NPTFPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHD  1316
             NPTFP  G++ PRQPWHDLHC+IEGPAAYD+L NFEQRWRKA++W +     K   HWHD
Sbjct  418   NPTFP-AGVEAPRQPWHDLHCRIEGPAAYDVLINFEQRWRKATRWKDFSLFVKGKKHWHD  476

Query  1315  DALLKIERISWITSP--------------------TPSVPNDDPSLWVSNEGDPQNWHVQ  1196
             D+LLKI RISWI SP                    T  VP D+P ++VS E D  NWHVQ
Sbjct  477   DSLLKISRISWILSPPSTDLHDSTRSLSKENRHERTTVVPEDNPDIYVSKEDDHNNWHVQ  536

Query  1195  VFRSIDSGSLKGFP-KDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYF  1019
             +FRSIDSGS+KGFP K    A  QNL+ AKD+V+DRSIQ AYI+AIR A++F+YIENQYF
Sbjct  537   IFRSIDSGSVKGFPKKKKEVAGKQNLIDAKDVVVDRSIQTAYIQAIRSAKNFVYIENQYF  596

Query  1018  LGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDIL  839
             LGSSYAWPS+ +AGADNLIPMELALKI SKI+  ERFAVYIVIPMWPEG P SA VQ+IL
Sbjct  597   LGSSYAWPSHNDAGADNLIPMELALKIASKIKANERFAVYIVIPMWPEGDPKSAAVQEIL  656

Query  838   YWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLT  659
             +WQ QT+QMMY +IA +LK   ++D +P DYLNFYCLG RE+       SP    SE   
Sbjct  657   FWQNQTMQMMYRVIASQLKQTSLKD-YPQDYLNFYCLGKRED--NSGQHSPNNAVSE---  710

Query  658   GSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQN  479
              S  S RFMIYVHAKGMVVDDEYV++GSAN+NQRS+AG++DTEIAMGAYQPHHT AK + 
Sbjct  711   -SYNSKRFMIYVHAKGMVVDDEYVLLGSANLNQRSLAGTKDTEIAMGAYQPHHTCAKKEG  769

Query  478   HPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHL  299
             HP  QVYGYRMSLWAEHLG+++E  +E     CVK V EIA +NW  Y  +    LQGHL
Sbjct  770   HPRGQVYGYRMSLWAEHLGVVEECFNEPGSPACVKRVKEIAGKNWNSYKNQ--GELQGHL  827

Query  298   LKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRT-TLPDALTT  173
             L+YP+ VD +G V PL G E FPDVGGKV+G+ T  +PD LTT
Sbjct  828   LQYPIDVDQHGNVGPLPGSEEFPDVGGKVVGAHTAAIPDVLTT  870



>ref|XP_010029627.1| PREDICTED: phospholipase D delta-like isoform X1 [Eucalyptus 
grandis]
Length=871

 Score =  1043 bits (2698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/883 (60%), Positives = 650/883 (74%), Gaps = 54/883 (6%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTA------------FDCRKP  2552
             M+    +  VYLHGDLDL I+ A  LPNMD+V+ R+R  F+A                 P
Sbjct  1     MAGSPPDGPVYLHGDLDLHIISASDLPNMDMVTGRLRWCFSACARPPRSPDPDPDPASLP  60

Query  2551  ETRQGNKVR-RHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEV  2375
               R  +     H +IITSDPYV VC+  ATVARTRV+ N+QDP W + F IP+AHPV  +
Sbjct  61    IHRSDDDDGPHHAKIITSDPYVTVCVPHATVARTRVLHNTQDPEWDQWFCIPLAHPVDYL  120

Query  2374  EFQVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPC  2195
             EF+VKDND+FGA  IG  K+SA++I+    I+  FP+ G   K    + A++L + FTP 
Sbjct  121   EFRVKDNDLFGAQVIGTVKISAREIMEKRVISRSFPLSGPSAKQ---NSALKLQLTFTPV  177

Query  2194  AENPRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDD--GKAFHH  2030
              EN  YR G+  D    G++++YFP+R G  +TLYQDAHV +GSLPEIK+D   G  +  
Sbjct  178   EENEVYRIGIAGDPKHQGVRQTYFPLRKGSGLTLYQDAHVIDGSLPEIKLDSDAGGVYRR  237

Query  2029  ENCWEDICHAILEAHHMVYIVGWSIYHKVKLVRE--PTRplpnggnlnlgelLKYKSQEG  1856
             E CWEDICHAI EAHH++YIVGWS+ HK+KL+RE   TRPLP  G+L LGELLKYKSQEG
Sbjct  238   EKCWEDICHAISEAHHLIYIVGWSVSHKIKLIREHTQTRPLPQDGDLTLGELLKYKSQEG  297

Query  1855  VRVLLLVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQ  1676
             VRVLLL+WDDKTSH K+FIN  GVM THDEET+ FFKHSSV CVLAPR  SSKL ++KQQ
Sbjct  298   VRVLLLIWDDKTSHKKYFINMEGVMQTHDEETKDFFKHSSVNCVLAPRNPSSKLGYIKQQ  357

Query  1675  VVGTLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYN  1496
             VVG+++THHQKC++VDTQA GN RKITAFIGG+DLCDGRYDTP+HRLF + DTVF+ D++
Sbjct  358   VVGSMFTHHQKCILVDTQASGNYRKITAFIGGIDLCDGRYDTPEHRLFRNLDTVFKDDFH  417

Query  1495  NPTFPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHD  1316
             NPTFP  G++ PRQPWHDLHC+IEGPAAYD+L NFEQRWRKA++W +     K   HWHD
Sbjct  418   NPTFP-AGVEAPRQPWHDLHCRIEGPAAYDVLINFEQRWRKATRWKDFSLFVKGKKHWHD  476

Query  1315  DALLKIERISWITSP--------------------TPSVPNDDPSLWVSNEGDPQNWHVQ  1196
             D+LLKI RISWI SP                    T  VP D+P ++VS E D  NWHVQ
Sbjct  477   DSLLKISRISWILSPPSTDLHDSTRSLSKENRHERTTVVPEDNPDIYVSKEDDHNNWHVQ  536

Query  1195  VFRSIDSGSLKGFP-KDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYF  1019
             +FRSIDSGS+KGFP K    A  QNL+ AKD+V+DRSIQ AYI+AIR A++F+YIENQYF
Sbjct  537   IFRSIDSGSVKGFPKKKKEVAGKQNLIDAKDVVVDRSIQTAYIQAIRSAKNFVYIENQYF  596

Query  1018  LGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDIL  839
             LGSSYAWPS+ +AGADNLIPMELALKI SKI+  ERFAVYIVIPMWPEG P SA VQ+IL
Sbjct  597   LGSSYAWPSHNDAGADNLIPMELALKIASKIKANERFAVYIVIPMWPEGDPKSAAVQEIL  656

Query  838   YWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLT  659
             +WQ QT+QMMY +IA +LK   ++D +P DYLNFYCLG R    E+++   +P  ++ ++
Sbjct  657   FWQNQTMQMMYRVIASQLKQTSLKD-YPQDYLNFYCLGKR----EDNSGQHSPNNAQ-VS  710

Query  658   GSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQN  479
              S  S RFMIYVHAKGMVVDDEYV++GSAN+NQRS+AG++DTEIAMGAYQPHHT AK + 
Sbjct  711   ESYNSKRFMIYVHAKGMVVDDEYVLLGSANLNQRSLAGTKDTEIAMGAYQPHHTCAKKEG  770

Query  478   HPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHL  299
             HP  QVYGYRMSLWAEHLG+++E  +E     CVK V EIA +NW  Y  +    LQGHL
Sbjct  771   HPRGQVYGYRMSLWAEHLGVVEECFNEPGSPACVKRVKEIAGKNWNSYKNQ--GELQGHL  828

Query  298   LKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRT-TLPDALTT  173
             L+YP+ VD +G V PL G E FPDVGGKV+G+ T  +PD LTT
Sbjct  829   LQYPIDVDQHGNVGPLPGSEEFPDVGGKVVGAHTAAIPDVLTT  871



>ref|XP_006425352.1| hypothetical protein CICLE_v10024876mg [Citrus clementina]
 gb|ESR38592.1| hypothetical protein CICLE_v10024876mg [Citrus clementina]
Length=767

 Score =  1040 bits (2688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/766 (66%), Positives = 607/766 (79%), Gaps = 29/766 (4%)
 Frame = -2

Query  2689  DGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPE-----------T  2546
             D   E V+YLHGDLDLKI+ ARRLPNMD++SE +R+ FTA D C+ P             
Sbjct  6     DSDKEKVIYLHGDLDLKIIRARRLPNMDMMSEHLRRCFTACDACKTPAPTHETFQDDDGV  65

Query  2545  RQGNKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQ  2366
             R  +K+ R ++IITSDPYV V +  ATVARTRV+ NSQ+PVW EHF IP+AHP+  +E Q
Sbjct  66    RHTSKIIRKSKIITSDPYVTVVVPQATVARTRVLKNSQEPVWNEHFIIPLAHPLVNLEIQ  125

Query  2365  VKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAEN  2186
             VKD+DVFGA  IG A + A  I +GE I+ W+ II   G PPKP  +I+L +KFTPC +N
Sbjct  126   VKDDDVFGAQIIGTAAIPADTIATGEFISRWYDIIAPSGSPPKPGASIQLELKFTPCDKN  185

Query  2185  PRYRGGVT---EDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWE  2015
             P YR G+    E  G++ +YFP+R G  V LYQDAHV EG LPEI +DDGK +    CWE
Sbjct  186   PLYRHGIAGDPEQKGVRNTYFPLRKGSHVRLYQDAHVTEGILPEIPLDDGKLYKPGTCWE  245

Query  2014  DICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLV  1835
             DICHAI EAHH++YIVGWS++HK+KL+REPTRPLP GG+L LGELLKYKS+EGVRVLLL+
Sbjct  246   DICHAISEAHHLIYIVGWSVFHKIKLIREPTRPLPRGGDLTLGELLKYKSEEGVRVLLLI  305

Query  1834  WDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYT  1655
             WDDKTSH K  + T+GVM THDEET+KFFKHSSV CVLAPRYASSKLS+ KQQ+VGT++T
Sbjct  306   WDDKTSHDKLGVKTAGVMATHDEETKKFFKHSSVNCVLAPRYASSKLSYFKQQIVGTIFT  365

Query  1654  HHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEG  1475
             HHQKCV+VDTQA GNNRKITAFIGG+DLCDGRYDTP+HRLF D DTVF+ D++NPT+P  
Sbjct  366   HHQKCVLVDTQASGNNRKITAFIGGIDLCDGRYDTPEHRLFRDLDTVFKDDFHNPTYPI-  424

Query  1474  GLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIE  1295
             G K PR+PWHDLHC+++GPAAYD+L NFEQRWRKA+K  EL  +FK++SHW DD L+KI 
Sbjct  425   GTKAPREPWHDLHCRLDGPAAYDVLINFEQRWRKATKLTELTFKFKRVSHWRDDYLIKIG  484

Query  1294  RISWITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHT  1139
             RISWI SP        T  VP DD  + VS E DP+NWHVQ+FRSIDSGS+KGFPK +  
Sbjct  485   RISWILSPELSLKTNGTTIVPRDDNVVRVSKEDDPENWHVQIFRSIDSGSVKGFPKSIED  544

Query  1138  AETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIP  959
              + Q+L+CAKD+VID+SIQ AYI+AIR AQHFIYIENQYFLGSSYAWPSYK AGADNLIP
Sbjct  545   IDDQSLICAKDVVIDKSIQTAYIQAIRSAQHFIYIENQYFLGSSYAWPSYKNAGADNLIP  604

Query  958   MELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKS  779
             MELALKI SKIR  ERFAVY++IPMWPEG P +  VQ+IL+WQ QT+QMMY ++A+EL+ 
Sbjct  605   MELALKIASKIRANERFAVYVIIPMWPEGDPKTNTVQEILFWQSQTMQMMYSVVAQELRE  664

Query  778   EKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVD  599
              ++ DAHP DYL+FYCLG REE  ++  ++     S+    SQK+ RFMIYVHAKGM+VD
Sbjct  665   MQV-DAHPQDYLSFYCLGKREEAPKDVLANNGDKVSD----SQKNQRFMIYVHAKGMIVD  719

Query  598   DEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQV  461
             DEYVI+GSANINQRSMAGS+DTEIAMG+YQPHHTWA+ Q HPH QV
Sbjct  720   DEYVIMGSANINQRSMAGSKDTEIAMGSYQPHHTWARKQKHPHGQV  765



>ref|XP_009796632.1| PREDICTED: phospholipase D delta-like [Nicotiana sylvestris]
 ref|XP_009796633.1| PREDICTED: phospholipase D delta-like [Nicotiana sylvestris]
Length=835

 Score =  1039 bits (2686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/837 (61%), Positives = 638/837 (76%), Gaps = 20/837 (2%)
 Frame = -2

Query  2668  VYLHGDLDLKILEARRLPNMDIVS-ERIRQFFTAFDCRKPETRQGNKVRRHTRIITSDPY  2492
             V LHG+LDL+++EA  LPNMD+    +   F T    +  +T  GNK      I TSDPY
Sbjct  14    VLLHGELDLRVIEANSLPNMDMTCCSKFSPFGTTRKVKSKDT--GNKSATRKIIDTSDPY  71

Query  2491  VKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVAKVS  2312
             V VC+ GA VART VI N ++P W EH +IPVAH V +VEF VKD+D  G + IG  ++ 
Sbjct  72    VSVCIGGAKVARTTVIRNDENPTWNEHVRIPVAHKVDKVEFFVKDDDGVGGELIGKVEIP  131

Query  2311  AQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED---YGLKE  2141
             A KI  G+ I+ WFPI+G+ G P K    + L +++ P AENP YR GV  +    G+  
Sbjct  132   ADKIHVGKEISGWFPILGSSGDPLKTGAQLHLSIQYKPMAENPIYRNGVGGEANRVGVPH  191

Query  2140  SYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYIVGW  1961
             +YFP+R GG VTLYQDAHVP+ +LPEI +DDGK F+H  CWEDICHA+LEA +++Y+VGW
Sbjct  192   TYFPLRKGGNVTLYQDAHVPDATLPEILLDDGKVFNHNKCWEDICHAMLEAKYLIYVVGW  251

Query  1960  SIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTSGVM  1781
             S+YH ++LVREPTRPLP+ G   LG+LLKYKSQEGVRV+LL+WDDKTS+   F+ T GVM
Sbjct  252   SVYHPIRLVREPTRPLPSAGERTLGDLLKYKSQEGVRVILLIWDDKTSNDDLFLKTEGVM  311

Query  1780  GTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQGNNRK  1601
              THDEETRKFFK+SSV CVL PR ASSKLS +K+Q+VG L+THHQKCV+VDT+A GN RK
Sbjct  312   QTHDEETRKFFKYSSVHCVLCPRSASSKLSVLKRQIVGNLFTHHQKCVLVDTEAPGNERK  371

Query  1600  ITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCKIEG  1421
             ITAFIGGLDLCDGRYDTP+HRLFSD DTVF  D +NPTF      GPR+PWHDLHCKI+G
Sbjct  372   ITAFIGGLDLCDGRYDTPEHRLFSDLDTVFGNDVHNPTFTTTS-GGPREPWHDLHCKIDG  430

Query  1420  PAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPNDDPS  1241
             PAAYD+LTNFEQR+ KA+KW +L R+ K+ S    D LLK++RI+ I  P+   P+ D  
Sbjct  431   PAAYDVLTNFEQRFNKATKWLKL-RKVKQGS----DTLLKLDRIAAIRMPSAG-PDGDRV  484

Query  1240  LWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAI  1061
             + V++E DP++WHVQVFRSIDSGS+KGFPKD+  AE QNLV  K+L I+RSI +AY++AI
Sbjct  485   VRVTSEQDPESWHVQVFRSIDSGSVKGFPKDIKEAEAQNLVSGKNLKIERSIHLAYVKAI  544

Query  1060  RRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPMW  881
             R AQHF+Y+ENQYFLGS+Y+WPS++ +GA+NL+PME+ALKI  KI   E FA YIV+PMW
Sbjct  545   RSAQHFVYVENQYFLGSAYSWPSHRNSGANNLVPMEIALKIARKIAANEPFAAYIVVPMW  604

Query  880   PEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDA-HPCDYLNFYCLGNREEWHE  704
             PEGVPSS PVQ+IL+WQ QT+ MMY+I+A+ L    +    HP DYLNFYCLG RE    
Sbjct  605   PEGVPSSKPVQEILFWQSQTMAMMYKIVAEALDKAGVSQYFHPQDYLNFYCLGKREVAKG  664

Query  703   ESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIA  524
             +S  S + G       +QK GRFMIYVH+KGM+VDDEYV++GSANINQRS++GSRDTEIA
Sbjct  665   KSEKSVSQGL------AQKFGRFMIYVHSKGMIVDDEYVLMGSANINQRSLSGSRDTEIA  718

Query  523   MGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENW  344
             MGAYQP++TWAK  +HPH QVYGYRMSLWAEHLG+++    E + +ECV+ VNEIA  NW
Sbjct  719   MGAYQPNYTWAKKDSHPHGQVYGYRMSLWAEHLGVVENTFTEPQTVECVRRVNEIARYNW  778

Query  343   KRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALTT  173
               ++ ++++ ++GHL++YP+QV  NG V+ L G E FPDVGGK+LG+ T LPDALTT
Sbjct  779   NAFSGDEYNKMKGHLMQYPIQVSKNGDVTTLPGFECFPDVGGKILGAPTNLPDALTT  835



>ref|XP_010315479.1| PREDICTED: phospholipase D delta-like [Solanum lycopersicum]
Length=857

 Score =  1036 bits (2679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/842 (60%), Positives = 629/842 (75%), Gaps = 23/842 (3%)
 Frame = -2

Query  2683  MSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRRHTRIIT  2504
             ++ N V LHG+LDL I+EA  LPN+D       +    F  +  ++   + +     + T
Sbjct  34    LTGNAVLLHGELDLCIIEACSLPNLD------AKCLPMFSWKSKDSTNASGL-----VDT  82

Query  2503  SDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGV  2324
             SDPYV VCLAGA++ART VI N+++P W E   IPVAH V +VEF VKDND  GA+ IG+
Sbjct  83    SDPYVSVCLAGASIARTAVIPNNENPTWNERLCIPVAHAVDKVEFIVKDNDKVGAELIGI  142

Query  2323  AKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGV---TEDY  2153
               + + KI  G+ IN WFPI G+ G P + D  + L + +TP  ENP Y+ GV    E  
Sbjct  143   VAIPSTKIAEGKQINGWFPICGSSGAPLETDAQLHLSIHYTPATENPLYKNGVGTEAEQK  202

Query  2152  GLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVY  1973
             G+  +YFP+R GG VTLYQDAH P+ +LPEI +D+GK F H  CWEDICHA+LEA H++Y
Sbjct  203   GVPHTYFPLRKGGDVTLYQDAHAPDETLPEILLDNGKVFKHNKCWEDICHAMLEAQHLIY  262

Query  1972  IVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINT  1793
             IVGWS+YH V+++REPTRP+P+ G L LGE+LKYKSQEGVRV+LL+WDDKTS+   F+ T
Sbjct  263   IVGWSVYHLVRIIREPTRPVPSSGWLELGEMLKYKSQEGVRVILLIWDDKTSNDDLFLKT  322

Query  1792  SGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQG  1613
              GVM THDEET+KFFKHSSV C+L PR ASSKLS  KQQVVG ++THHQKCVIVDTQA G
Sbjct  323   EGVMQTHDEETKKFFKHSSVNCILCPRSASSKLSIFKQQVVGNIFTHHQKCVIVDTQAAG  382

Query  1612  NNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHC  1433
             N RKITAF+GGLDLCDGRYDTP+HRLFSD DTVF  D +NPTF      GPR+PWHDLH 
Sbjct  383   NTRKITAFVGGLDLCDGRYDTPEHRLFSDLDTVFENDIHNPTFTVSSSGGPREPWHDLHS  442

Query  1432  KIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPN  1253
             KIEGPAAYD+LTNFEQR+RKA KW  + +    +     D+LLK++RI  I  P    P+
Sbjct  443   KIEGPAAYDVLTNFEQRYRKAIKWIRIKKCKPGL-----DSLLKLDRIPSIHMPAAG-PD  496

Query  1252  DDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAY  1073
              D  + V+ E DP+NWHVQ+FRSIDSGS+KGFPKD   A  QNLV  K+L IDRSI +AY
Sbjct  497   GDQVVHVTKEEDPENWHVQIFRSIDSGSVKGFPKDAKEATAQNLVSGKNLRIDRSIHLAY  556

Query  1072  IEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIV  893
             ++AIR AQHFIY+ENQYFLGSSY WPSY+ AGA+NL+PME+ALKI SKI   E FA YIV
Sbjct  557   VKAIRSAQHFIYVENQYFLGSSYCWPSYRNAGANNLVPMEIALKIASKIAASEPFAAYIV  616

Query  892   IPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIED-AHPCDYLNFYCLGNRE  716
             IPMWPEG+P+S  VQ+IL+WQGQT+ MMY+IIA+ L++  I    HP DYLNFYCLGNRE
Sbjct  617   IPMWPEGIPTSNAVQEILFWQGQTMSMMYKIIAQALENAGISQFFHPQDYLNFYCLGNRE  676

Query  715   EWHEES-ASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSR  539
                      +PTP        +QK  RFMIYVH+KGM+VDDEYV++GSANINQRS++GSR
Sbjct  677   AKKRGGDGDNPTPQ-EHTHELAQKFRRFMIYVHSKGMIVDDEYVLLGSANINQRSLSGSR  735

Query  538   DTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEI  359
             DTEIAMGAYQPH+TWAK + HPH QVYGYRMSLWAEHLG ++E   + + +ECV+ VN+I
Sbjct  736   DTEIAMGAYQPHYTWAKKEAHPHGQVYGYRMSLWAEHLGRVEEGFMDPQTIECVRRVNKI  795

Query  358   AEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDAL  179
             A  NW+ + A+++ P++GHL++YP+ V  NG+V+ L G E FPDVGGK+LG+ T LPDAL
Sbjct  796   ARRNWQAFVADEYKPMKGHLMQYPVHVSKNGEVTALPGFECFPDVGGKILGAPTNLPDAL  855

Query  178   TT  173
             TT
Sbjct  856   TT  857



>ref|XP_002306960.2| hypothetical protein POPTR_0005s26730g [Populus trichocarpa]
 gb|EEE93956.2| hypothetical protein POPTR_0005s26730g [Populus trichocarpa]
Length=692

 Score =  1036 bits (2678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 502/692 (73%), Positives = 586/692 (85%), Gaps = 20/692 (3%)
 Frame = -2

Query  2662  LHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKP--ETRQGNKVRRHTRIITSDPY  2492
             LHGDLDL+I+EARRLPNMD+VS+R+R+ FT FD CR P  + R+  + RRH +IITSDPY
Sbjct  15    LHGDLDLRIIEARRLPNMDLVSDRLRRCFTVFDSCRDPCSKERKEQQHRRH-KIITSDPY  73

Query  2491  VKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVAKVS  2312
             V V ++GA VARTRVISN+Q+P+W EHFKIP+AHP  ++EF VKD+D+FGA+FIG+A V 
Sbjct  74    VMVGVSGARVARTRVISNNQNPIWNEHFKIPLAHPAEKIEFYVKDDDMFGAEFIGIASVE  133

Query  2311  AQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTEDYGLKESYF  2132
              +KI+SGETI DWFPIIG +GKPPK  CA+ + MKFT C +       +    G++  YF
Sbjct  134   VEKILSGETIKDWFPIIGLYGKPPKTGCALHVEMKFTKCEQ-------IDNKLGVENCYF  186

Query  2131  PMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYIVGWSIY  1952
             P+RHGG VTLYQDAHVP+ SLPEI++++G  F HE CWEDICHAI+EAHH+VYIVGWSIY
Sbjct  187   PVRHGGNVTLYQDAHVPDSSLPEIELENGNLFRHEKCWEDICHAIVEAHHLVYIVGWSIY  246

Query  1951  HKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTSGVMGTH  1772
             HKV+LVREP++PLP GG+LNLGELLKYKSQEGVRVLLLVWDDKTSH+KFFI T+GVM TH
Sbjct  247   HKVRLVREPSKPLPRGGDLNLGELLKYKSQEGVRVLLLVWDDKTSHNKFFIRTTGVMQTH  306

Query  1771  DEETRKFFKHSSVTCVLAPRYASSKLSFVKQQ---VVGTLYTHHQKCVIVDTQAQGNNRK  1601
             DEETRKFFKHSSV CVL+PRY  SKLSF KQQ   VVGTLYTHHQKCVIVD QA GNNRK
Sbjct  307   DEETRKFFKHSSVNCVLSPRYPGSKLSFFKQQACLVVGTLYTHHQKCVIVDAQASGNNRK  366

Query  1600  ITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCKIEG  1421
             ITAFIGGLDLCDGRYDTP+HRLF D DTVF+ DY+NPTFP G + GPRQPWHDLHCKIEG
Sbjct  367   ITAFIGGLDLCDGRYDTPEHRLFQDLDTVFQDDYHNPTFPAGTM-GPRQPWHDLHCKIEG  425

Query  1420  PAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPNDDPS  1241
             PAAYD+LTNFEQRWRKASKW+E GR FK+ + W DD+L+K+ERISWI  P+PSVP+DDP 
Sbjct  426   PAAYDVLTNFEQRWRKASKWSEFGRSFKRSTPWRDDSLIKLERISWIHGPSPSVPSDDPK  485

Query  1240  LWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAI  1061
             LWVSNE DP+NWHVQVFRSIDSGSLKGFPKDV+ AE QNLVCAK++VID+SIQ AY++AI
Sbjct  486   LWVSNEDDPENWHVQVFRSIDSGSLKGFPKDVYRAEKQNLVCAKNMVIDKSIQTAYVQAI  545

Query  1060  RRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPMW  881
             R AQHFIYIENQYFLGSS+AW  YK AGA+NLIPMELALKI SKIR +ERFAVY+VIPMW
Sbjct  546   RLAQHFIYIENQYFLGSSFAWSEYKNAGAENLIPMELALKIASKIRAKERFAVYVVIPMW  605

Query  880   PEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREEWHEE  701
             PEG P+SA VQ+IL+WQGQT+QMMYE+IAKELKS  +E++HP DYLNFYCLGNRE+    
Sbjct  606   PEGAPTSASVQEILFWQGQTMQMMYEVIAKELKSMNLENSHPQDYLNFYCLGNREQ----  661

Query  700   SASSPTPGCSEFLTGSQKSGRFMIYVHAKGMV  605
                     C + ++ SQK  RFM+YVHAKGM+
Sbjct  662   -VPGSDKSCDQTVSMSQKFQRFMVYVHAKGMI  692



>gb|KDO38443.1| hypothetical protein CISIN_1g002960mg [Citrus sinensis]
Length=767

 Score =  1033 bits (2672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 505/766 (66%), Positives = 604/766 (79%), Gaps = 29/766 (4%)
 Frame = -2

Query  2689  DGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPE-----------T  2546
             D   E V+YLHGDLDLKI+ ARRLPNMD++SE +R+ FTA D C+ P             
Sbjct  6     DSDKEKVIYLHGDLDLKIIRARRLPNMDMMSEHLRRCFTACDVCKTPAPTHETFQDDDGV  65

Query  2545  RQGNKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQ  2366
             R  +K+ R ++IITSDPYV V +  ATVARTRV+ NSQ+PVW EHF IP+AHP+S +E Q
Sbjct  66    RHTSKIIRKSKIITSDPYVTVVVPQATVARTRVLKNSQEPVWNEHFNIPLAHPLSNLEIQ  125

Query  2365  VKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAEN  2186
             VKD+DVFGA  IG A + A  I +GE I+ W+ II   G PPKP  +I+L +KFTPC +N
Sbjct  126   VKDDDVFGAQIIGTAAIPAHTIATGELISRWYDIIAPSGSPPKPGASIQLELKFTPCDKN  185

Query  2185  PRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWE  2015
             P YR G+  D    G++ +YFP+R G  V LYQDAHV EG LPEI +D GK +    CWE
Sbjct  186   PLYRQGIAGDPEHKGVRNAYFPLRKGSHVRLYQDAHVTEGILPEIPLDGGKLYKPGTCWE  245

Query  2014  DICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLV  1835
             DICHAI EAHH++YIVGWS++HK+KL+RE TRPLP GG+L LGELLKYKS+EGVRVLLLV
Sbjct  246   DICHAISEAHHLIYIVGWSVFHKIKLIREQTRPLPRGGDLTLGELLKYKSEEGVRVLLLV  305

Query  1834  WDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYT  1655
             WDDKTSH K  + T GVM THDEET+KFFKHSSV CVLAPRYASSKLS+ KQQ+VGT++T
Sbjct  306   WDDKTSHDKLGVKTPGVMATHDEETKKFFKHSSVNCVLAPRYASSKLSYFKQQIVGTIFT  365

Query  1654  HHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEG  1475
             HHQKCV+VDTQA GNNRKITAFIGG+DLCDGRYDTP+HRLF D DTVF+ D++NPT+P  
Sbjct  366   HHQKCVLVDTQASGNNRKITAFIGGIDLCDGRYDTPEHRLFRDLDTVFKDDFHNPTYPI-  424

Query  1474  GLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIE  1295
             G K PR+PWHDLHC+++GPAAYD+L NFEQRWRKA+K  EL  +FK++SHW DD L+KI 
Sbjct  425   GTKAPREPWHDLHCRLDGPAAYDVLINFEQRWRKATKLTELTFKFKRVSHWRDDYLIKIG  484

Query  1294  RISWITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHT  1139
             RISWI SP        T  VP DD  + VS E DP+NWHVQ+FRSIDSGS+KGFPK +  
Sbjct  485   RISWILSPELSLKTNGTTIVPRDDNVVRVSKEDDPENWHVQIFRSIDSGSVKGFPKSIED  544

Query  1138  AETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIP  959
              + Q+L+CAKD+VID+SIQ AYI+AIR AQHFIYIENQYFLGSSYAWPSYK AGADNLIP
Sbjct  545   IDDQSLICAKDVVIDKSIQTAYIQAIRSAQHFIYIENQYFLGSSYAWPSYKNAGADNLIP  604

Query  958   MELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKS  779
             MELALKI SKIR  ERFAVY++IPMWPEG P +  VQ+IL+WQ QT+QMMY ++A+EL+ 
Sbjct  605   MELALKIASKIRANERFAVYVIIPMWPEGDPKTNTVQEILFWQSQTMQMMYSVVAQELRE  664

Query  778   EKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVD  599
              ++ DAHP DYL+FYCLG REE  ++  ++     S+    SQK+ RFMIYVHAKGM+VD
Sbjct  665   MQV-DAHPQDYLSFYCLGKREEAPKDVLANNGDKVSD----SQKNQRFMIYVHAKGMIVD  719

Query  598   DEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQV  461
             DEYVI+GSANINQRSMAGS+DTEIAMG+YQPHHTWA+   HPH QV
Sbjct  720   DEYVIMGSANINQRSMAGSKDTEIAMGSYQPHHTWARKLKHPHGQV  765



>gb|KDP43703.1| hypothetical protein JCGZ_22330 [Jatropha curcas]
Length=821

 Score =  1032 bits (2668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/866 (59%), Positives = 628/866 (73%), Gaps = 79/866 (9%)
 Frame = -2

Query  2686  GMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETR------------  2543
             G ++  +YLHGDLDL I++AR LPNMDI       F + +    PE+             
Sbjct  7     GSNQQPIYLHGDLDLYIIQARTLPNMDI-------FRSCYAACTPESTTSAAATAPTTDK  59

Query  2542  -----QGNKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSE  2378
                  Q  K+    RI+ SDPYV V +  ATVARTRV+ N+++P W E F I +AHPV +
Sbjct  60    TTGNDQDEKIHHRRRIVNSDPYVTVVVPQATVARTRVVKNARNPKWKERFYIALAHPVID  119

Query  2377  VEFQVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTP  2198
             +EF VKDN +  ++ +GV K+ A++I +GE I+DWFPIIG  GKPPKPD A+ L MKFTP
Sbjct  120   LEFHVKDNALLRSENVGVVKIPARRIATGEVISDWFPIIGYSGKPPKPDTALHLEMKFTP  179

Query  2197  CAENPRYRGGVT---EDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHE  2027
             C +NP Y+ G+    E  G++ +YFP+R G  +T+YQDAHV +  LPEIKIDDGK F  +
Sbjct  180   CEKNPLYKHGIAGDPEQRGVRNTYFPLRKGSKLTMYQDAHVLDDELPEIKIDDGKVFKQQ  239

Query  2026  NCWEDICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRV  1847
              CWEDIC+AI EAHH++Y+VGWS+++K+KLVREPTRPLP GG+L LGELLKYKS EGVRV
Sbjct  240   KCWEDICYAISEAHHLIYVVGWSVFYKIKLVREPTRPLPRGGDLTLGELLKYKSAEGVRV  299

Query  1846  LLLVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVG  1667
             LLLVWDD TS S F I T                                       +VG
Sbjct  300   LLLVWDDVTSRSIFGITT---------------------------------------IVG  320

Query  1666  TLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPT  1487
             T++THHQKCV+VDTQA GNNRKITAF+GGLDLCDGRYDTP+HRLF D DTVF GD++N T
Sbjct  321   TVFTHHQKCVLVDTQAAGNNRKITAFLGGLDLCDGRYDTPEHRLFRDLDTVFHGDFHNIT  380

Query  1486  FPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDAL  1307
             F +  +K PRQPWHDLHC+I+GPAAYD+L NFEQRW+K +KW + G  F+K+  W DD+L
Sbjct  381   FTDPLIKTPRQPWHDLHCRIDGPAAYDVLINFEQRWKKETKWTKFGLLFRKV-FWDDDSL  439

Query  1306  LKIERISWITSP-------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKD  1148
             LKIER+SWI SP          VP DDP++ VS+E DP+NWHVQVFRSID+GS+KGFPK 
Sbjct  440   LKIERMSWILSPPFTIKDDMTVVPPDDPTVHVSSEEDPENWHVQVFRSIDNGSVKGFPKT  499

Query  1147  VHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADN  968
             VH    QNL+ AK+ VI+RSIQ AYI+AIR AQHFIYIENQYFLGSSY WPSY+ AG DN
Sbjct  500   VHQCRAQNLMTAKNQVIERSIQAAYIQAIRSAQHFIYIENQYFLGSSYGWPSYENAGVDN  559

Query  967   LIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKE  788
             LIPMELALK+ SKIR  ERFAVYIV+PMWPEGVP+S P+Q+ILYWQ QT+QMMY I+A+E
Sbjct  560   LIPMELALKVASKIRANERFAVYIVVPMWPEGVPTSGPMQEILYWQSQTMQMMYNIVAQE  619

Query  787   LKSEKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGM  608
             +KS ++ D+HP DYLNFYCLG REE  +++  +      E ++ SQK  RF IYVHAKG+
Sbjct  620   IKSMQLVDSHPKDYLNFYCLGKREENTQQTVITD----DEMVSDSQKFQRFTIYVHAKGI  675

Query  607   VVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEH  428
             +VDDEY I+GSANINQRSMAG++DTEIAMGAYQPH TWA  + HP  Q+YG+RMSLWAEH
Sbjct  676   IVDDEYAIIGSANINQRSMAGTKDTEIAMGAYQPHQTWAAKKKHPRGQIYGFRMSLWAEH  735

Query  427   LGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLG  248
              G +     E + L+CVK VN+IAEENWKRYT   F  LQG LL YP+QVD++GKV  L 
Sbjct  736   FGEVQGLFMEPQSLDCVKTVNKIAEENWKRYTDPDFKVLQGQLLNYPVQVDADGKVGALS  795

Query  247   GCEYFPDVGGKVLGSRTT-LPDALTT  173
             G E FPDVGGKVLG+ T  +PD LTT
Sbjct  796   GFENFPDVGGKVLGTHTIKVPDILTT  821



>gb|KDO38441.1| hypothetical protein CISIN_1g002960mg [Citrus sinensis]
Length=776

 Score =  1031 bits (2667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/765 (66%), Positives = 603/765 (79%), Gaps = 29/765 (4%)
 Frame = -2

Query  2689  DGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPE-----------T  2546
             D   E V+YLHGDLDLKI+ ARRLPNMD++SE +R+ FTA D C+ P             
Sbjct  6     DSDKEKVIYLHGDLDLKIIRARRLPNMDMMSEHLRRCFTACDVCKTPAPTHETFQDDDGV  65

Query  2545  RQGNKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQ  2366
             R  +K+ R ++IITSDPYV V +  ATVARTRV+ NSQ+PVW EHF IP+AHP+S +E Q
Sbjct  66    RHTSKIIRKSKIITSDPYVTVVVPQATVARTRVLKNSQEPVWNEHFNIPLAHPLSNLEIQ  125

Query  2365  VKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAEN  2186
             VKD+DVFGA  IG A + A  I +GE I+ W+ II   G PPKP  +I+L +KFTPC +N
Sbjct  126   VKDDDVFGAQIIGTAAIPAHTIATGELISRWYDIIAPSGSPPKPGASIQLELKFTPCDKN  185

Query  2185  PRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWE  2015
             P YR G+  D    G++ +YFP+R G  V LYQDAHV EG LPEI +D GK +    CWE
Sbjct  186   PLYRQGIAGDPEHKGVRNAYFPLRKGSHVRLYQDAHVTEGILPEIPLDGGKLYKPGTCWE  245

Query  2014  DICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLV  1835
             DICHAI EAHH++YIVGWS++HK+KL+RE TRPLP GG+L LGELLKYKS+EGVRVLLLV
Sbjct  246   DICHAISEAHHLIYIVGWSVFHKIKLIREQTRPLPRGGDLTLGELLKYKSEEGVRVLLLV  305

Query  1834  WDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYT  1655
             WDDKTSH K  + T GVM THDEET+KFFKHSSV CVLAPRYASSKLS+ KQQ+VGT++T
Sbjct  306   WDDKTSHDKLGVKTPGVMATHDEETKKFFKHSSVNCVLAPRYASSKLSYFKQQIVGTIFT  365

Query  1654  HHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEG  1475
             HHQKCV+VDTQA GNNRKITAFIGG+DLCDGRYDTP+HRLF D DTVF+ D++NPT+P  
Sbjct  366   HHQKCVLVDTQASGNNRKITAFIGGIDLCDGRYDTPEHRLFRDLDTVFKDDFHNPTYPI-  424

Query  1474  GLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIE  1295
             G K PR+PWHDLHC+++GPAAYD+L NFEQRWRKA+K  EL  +FK++SHW DD L+KI 
Sbjct  425   GTKAPREPWHDLHCRLDGPAAYDVLINFEQRWRKATKLTELTFKFKRVSHWRDDYLIKIG  484

Query  1294  RISWITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHT  1139
             RISWI SP        T  VP DD  + VS E DP+NWHVQ+FRSIDSGS+KGFPK +  
Sbjct  485   RISWILSPELSLKTNGTTIVPRDDNVVRVSKEDDPENWHVQIFRSIDSGSVKGFPKSIED  544

Query  1138  AETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIP  959
              + Q+L+CAKD+VID+SIQ AYI+AIR AQHFIYIENQYFLGSSYAWPSYK AGADNLIP
Sbjct  545   IDDQSLICAKDVVIDKSIQTAYIQAIRSAQHFIYIENQYFLGSSYAWPSYKNAGADNLIP  604

Query  958   MELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKS  779
             MELALKI SKIR  ERFAVY++IPMWPEG P +  VQ+IL+WQ QT+QMMY ++A+EL+ 
Sbjct  605   MELALKIASKIRANERFAVYVIIPMWPEGDPKTNTVQEILFWQSQTMQMMYSVVAQELRE  664

Query  778   EKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVD  599
              ++ DAHP DYL+FYCLG REE  ++  ++     S+    SQK+ RFMIYVHAKGM+VD
Sbjct  665   MQV-DAHPQDYLSFYCLGKREEAPKDVLANNGDKVSD----SQKNQRFMIYVHAKGMIVD  719

Query  598   DEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQ  464
             DEYVI+GSANINQRSMAGS+DTEIAMG+YQPHHTWA+   HPH Q
Sbjct  720   DEYVIMGSANINQRSMAGSKDTEIAMGSYQPHHTWARKLKHPHGQ  764



>ref|XP_009602808.1| PREDICTED: phospholipase D delta-like [Nicotiana tomentosiformis]
 ref|XP_009602809.1| PREDICTED: phospholipase D delta-like [Nicotiana tomentosiformis]
 ref|XP_009602810.1| PREDICTED: phospholipase D delta-like [Nicotiana tomentosiformis]
 ref|XP_009602811.1| PREDICTED: phospholipase D delta-like [Nicotiana tomentosiformis]
Length=857

 Score =  1029 bits (2660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/842 (60%), Positives = 631/842 (75%), Gaps = 23/842 (3%)
 Frame = -2

Query  2683  MSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRRHTRIIT  2504
             +S + V LHG+LDL I+EA+ LPN+D       +    F  +  ++   + +     I T
Sbjct  34    ISGSTVLLHGELDLWIIEAKSLPNLDA------KCLPMFSWKSKDSNNASGL-----IDT  82

Query  2503  SDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGV  2324
             SDPYV VCLAGA++ART VI N ++P W E   +PVAH V +VEF VKDND  GA+ IG+
Sbjct  83    SDPYVSVCLAGASIARTAVIPNDENPTWNERLCVPVAHAVDKVEFIVKDNDRVGAELIGI  142

Query  2323  AKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGV---TEDY  2153
              ++SA KI+ G+ IN WFPI G+ G P      + L +++ P AENP Y+ GV    +  
Sbjct  143   VEISANKIVEGDEINGWFPIRGSSGDPLDTGAQLHLSIQYRPTAENPMYKNGVGNEADQK  202

Query  2152  GLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVY  1973
             G+  +YFP+R GG+VTLYQDAHVP+ + P I +D+ K F+   CWEDICHAILEA H++Y
Sbjct  203   GVPHTYFPLRQGGSVTLYQDAHVPDETFPNILLDNEKVFNRNKCWEDICHAILEAQHLIY  262

Query  1972  IVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINT  1793
             IVGWS+YH V+L+REPTRP+P+ G L LGELLKYKSQEGVRV+LL+WDDKTS+   F+ T
Sbjct  263   IVGWSVYHPVRLIREPTRPVPSAGWLELGELLKYKSQEGVRVILLIWDDKTSNDDLFLKT  322

Query  1792  SGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQG  1613
              GVM THDEETRK+FKHSSV CVL PR ASSKLS  KQQVVG ++THHQKCVIVDTQA  
Sbjct  323   EGVMQTHDEETRKYFKHSSVHCVLCPRSASSKLSIFKQQVVGNIFTHHQKCVIVDTQAAD  382

Query  1612  NNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHC  1433
             N+RKITAFIGGLDLCDGRYDTP+HRLF+D DTVF  D +NPTF      GPR+PWHDLHC
Sbjct  383   NDRKITAFIGGLDLCDGRYDTPEHRLFNDLDTVFENDVHNPTFTSCS-GGPREPWHDLHC  441

Query  1432  KIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPN  1253
             KIEGPAAYD+LTNFEQR+RKA KW  + +    +     D+LLK++RI  I  P   + +
Sbjct  442   KIEGPAAYDVLTNFEQRYRKAIKWIRIKKCKPGL-----DSLLKLDRIPSIHIPAAGL-D  495

Query  1252  DDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAY  1073
              D  + V+ E DP+NWHVQVFRSIDSGS+KGFPKDV  A  QNLV  K+L IDRSI +AY
Sbjct  496   GDHVVRVTREEDPENWHVQVFRSIDSGSVKGFPKDVKEAGAQNLVSGKNLRIDRSIHLAY  555

Query  1072  IEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIV  893
             ++AIR AQHFIYIENQYFLGSSY WPSY+ AGA+NL+PME+ALKI SKI   E FA YIV
Sbjct  556   VKAIRSAQHFIYIENQYFLGSSYCWPSYRNAGANNLVPMEIALKIASKIAANEPFAAYIV  615

Query  892   IPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIED-AHPCDYLNFYCLGNRE  716
             +PMWPEG+P+S  VQ+IL+WQGQT+ MMY+I+A+ L++  I    HP DYLNFYCLGNRE
Sbjct  616   VPMWPEGIPTSNAVQEILFWQGQTMAMMYKIVAQALENAGISQFFHPQDYLNFYCLGNRE  675

Query  715   EWHEESASSPTPGCSEFL-TGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSR  539
                        P   E+    +QK  RFMIYVH+KGM+ DDEYV++GSANINQRS++GSR
Sbjct  676   AKKRGGCDEDNPPPQEYSHELAQKFRRFMIYVHSKGMIADDEYVLMGSANINQRSLSGSR  735

Query  538   DTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEI  359
             DTEIAMGAYQPH+TWAK ++HPH QVYGYRMSLWAEHLG +++   + + +ECV+ VNEI
Sbjct  736   DTEIAMGAYQPHYTWAKKESHPHGQVYGYRMSLWAEHLGAVEDVFKDPQTIECVRRVNEI  795

Query  358   AEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDAL  179
             A  NW+ + A+++ P++GHL++YP+ V  NG+V+ L G E FPDVGGK+LG+ T LPDAL
Sbjct  796   ARRNWQAFVADEYRPMKGHLMQYPVHVSKNGQVTALPGFESFPDVGGKILGAPTNLPDAL  855

Query  178   TT  173
             TT
Sbjct  856   TT  857



>gb|KDO38442.1| hypothetical protein CISIN_1g002960mg [Citrus sinensis]
Length=766

 Score =  1029 bits (2660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/763 (66%), Positives = 602/763 (79%), Gaps = 29/763 (4%)
 Frame = -2

Query  2689  DGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPE-----------T  2546
             D   E V+YLHGDLDLKI+ ARRLPNMD++SE +R+ FTA D C+ P             
Sbjct  6     DSDKEKVIYLHGDLDLKIIRARRLPNMDMMSEHLRRCFTACDVCKTPAPTHETFQDDDGV  65

Query  2545  RQGNKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQ  2366
             R  +K+ R ++IITSDPYV V +  ATVARTRV+ NSQ+PVW EHF IP+AHP+S +E Q
Sbjct  66    RHTSKIIRKSKIITSDPYVTVVVPQATVARTRVLKNSQEPVWNEHFNIPLAHPLSNLEIQ  125

Query  2365  VKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAEN  2186
             VKD+DVFGA  IG A + A  I +GE I+ W+ II   G PPKP  +I+L +KFTPC +N
Sbjct  126   VKDDDVFGAQIIGTAAIPAHTIATGELISRWYDIIAPSGSPPKPGASIQLELKFTPCDKN  185

Query  2185  PRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWE  2015
             P YR G+  D    G++ +YFP+R G  V LYQDAHV EG LPEI +D GK +    CWE
Sbjct  186   PLYRQGIAGDPEHKGVRNAYFPLRKGSHVRLYQDAHVTEGILPEIPLDGGKLYKPGTCWE  245

Query  2014  DICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLV  1835
             DICHAI EAHH++YIVGWS++HK+KL+RE TRPLP GG+L LGELLKYKS+EGVRVLLLV
Sbjct  246   DICHAISEAHHLIYIVGWSVFHKIKLIREQTRPLPRGGDLTLGELLKYKSEEGVRVLLLV  305

Query  1834  WDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYT  1655
             WDDKTSH K  + T GVM THDEET+KFFKHSSV CVLAPRYASSKLS+ KQQ+VGT++T
Sbjct  306   WDDKTSHDKLGVKTPGVMATHDEETKKFFKHSSVNCVLAPRYASSKLSYFKQQIVGTIFT  365

Query  1654  HHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEG  1475
             HHQKCV+VDTQA GNNRKITAFIGG+DLCDGRYDTP+HRLF D DTVF+ D++NPT+P  
Sbjct  366   HHQKCVLVDTQASGNNRKITAFIGGIDLCDGRYDTPEHRLFRDLDTVFKDDFHNPTYPI-  424

Query  1474  GLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIE  1295
             G K PR+PWHDLHC+++GPAAYD+L NFEQRWRKA+K  EL  +FK++SHW DD L+KI 
Sbjct  425   GTKAPREPWHDLHCRLDGPAAYDVLINFEQRWRKATKLTELTFKFKRVSHWRDDYLIKIG  484

Query  1294  RISWITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHT  1139
             RISWI SP        T  VP DD  + VS E DP+NWHVQ+FRSIDSGS+KGFPK +  
Sbjct  485   RISWILSPELSLKTNGTTIVPRDDNVVRVSKEDDPENWHVQIFRSIDSGSVKGFPKSIED  544

Query  1138  AETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIP  959
              + Q+L+CAKD+VID+SIQ AYI+AIR AQHFIYIENQYFLGSSYAWPSYK AGADNLIP
Sbjct  545   IDDQSLICAKDVVIDKSIQTAYIQAIRSAQHFIYIENQYFLGSSYAWPSYKNAGADNLIP  604

Query  958   MELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKS  779
             MELALKI SKIR  ERFAVY++IPMWPEG P +  VQ+IL+WQ QT+QMMY ++A+EL+ 
Sbjct  605   MELALKIASKIRANERFAVYVIIPMWPEGDPKTNTVQEILFWQSQTMQMMYSVVAQELRE  664

Query  778   EKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVD  599
              ++ DAHP DYL+FYCLG REE  ++  ++     S+    SQK+ RFMIYVHAKGM+VD
Sbjct  665   MQV-DAHPQDYLSFYCLGKREEAPKDVLANNGDKVSD----SQKNQRFMIYVHAKGMIVD  719

Query  598   DEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPH  470
             DEYVI+GSANINQRSMAGS+DTEIAMG+YQPHHTWA+   HPH
Sbjct  720   DEYVIMGSANINQRSMAGSKDTEIAMGSYQPHHTWARKLKHPH  762



>dbj|BAC79202.1| putative phospholipase D beta 1 [Oryza sativa Japonica Group]
Length=843

 Score =  1029 bits (2660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/856 (62%), Positives = 631/856 (74%), Gaps = 57/856 (7%)
 Frame = -2

Query  2668  VYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPET----RQGNKVRRHTR--II  2507
             V LHGDLDL ++EAR LPNMD+ SE +R+ F A  C+ P +    RQ    R H R  II
Sbjct  19    VLLHGDLDLWVVEARLLPNMDMFSEHVRRCFAA--CKPPTSCATARQPRHARGHHRRKII  76

Query  2506  TSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIG  2327
             TSDPYV + +AGA VARTRVI N QDPVW E F +P+AH  + +EF VKDND FGA  IG
Sbjct  77    TSDPYVTLSVAGAVVARTRVIPNDQDPVWDERFAVPLAHYAAALEFHVKDNDTFGAQLIG  136

Query  2326  VAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED---  2156
                + A ++ S + + DWFPIIG +G+P KPD A+RL ++F P A+NP YR G+  D   
Sbjct  137   TVTIPADRVASCQEVEDWFPIIGNNGRPYKPDTALRLRLRFNPAADNPLYRRGIPGDPDH  196

Query  2155  YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDG-KAFHHENCWEDICHAILEAHHM  1979
              G+K+SYFP+RHGG VTLYQDAH  EG LPEI++D+G K F H  CWEDICHAILEAHHM
Sbjct  197   QGIKDSYFPLRHGGRVTLYQDAHYREGDLPEIELDEGGKVFDHNACWEDICHAILEAHHM  256

Query  1978  VYIVGWSIYHKVKLVREPT--RplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKF  1805
             +YIVGWS+Y KV+LVREP+  RPLP GG+LNLGELLK+KSQEGVRV LLVWDDKTSH K 
Sbjct  257   IYIVGWSVYDKVRLVREPSPSRPLPEGGDLNLGELLKFKSQEGVRVCLLVWDDKTSHDKL  316

Query  1804  FINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDT  1625
             FI T GVM THDEETRKFFKHSSV CVL+PR           QVVGTL+THHQKCV+VDT
Sbjct  317   FIKTGGVMATHDEETRKFFKHSSVICVLSPRL----------QVVGTLFTHHQKCVLVDT  366

Query  1624  QAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWH  1445
             QA GN RKITAFIGGLDLCDGRYDTP+HRLF D DTVF  DY+NPTFP G   GPRQPWH
Sbjct  367   QAWGNKRKITAFIGGLDLCDGRYDTPEHRLFKDLDTVFDNDYHNPTFPSGAKGGPRQPWH  426

Query  1444  DLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTP  1265
             DLHC+I+GPAAYD+L NFEQRWRKA+KW E   RF+K+SHW DDAL+K+ERISWI SP+P
Sbjct  427   DLHCRIDGPAAYDVLKNFEQRWRKATKWRE---RFRKVSHWKDDALIKLERISWILSPSP  483

Query  1264  SVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSI  1085
             ++PNDD SL VS E DP+NWHVQVFRSIDSGSLKGFP D   A  QNL+C KDL+ID+SI
Sbjct  484   TIPNDDISLRVSKEEDPENWHVQVFRSIDSGSLKGFPSDCKEASKQNLICRKDLIIDKSI  543

Query  1084  QMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFA  905
               AY+ AIR AQHFIYIENQYFLGSSYAWPSY  +GADNL+P+ELALKI SKIR  ERFA
Sbjct  544   HTAYVRAIRSAQHFIYIENQYFLGSSYAWPSYVNSGADNLVPIELALKIASKIRAGERFA  603

Query  904   VYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLG  725
             VY+VIPMWPEGVP++A VQ+IL++Q QT++MMY IIA+ELK+  I++AHP DYLNFYCLG
Sbjct  604   VYVVIPMWPEGVPTAASVQEILFFQAQTMEMMYRIIAQELKAMNIKNAHPQDYLNFYCLG  663

Query  724   NR---------EEWHEESASSPTPG----CSEFLTGSQKSGRFMIYVHAKGMVVDDEYVI  584
             NR          E +++SA+  +        E L           +   +G+++   Y+ 
Sbjct  664   NREESSSSNGSPESNDKSAAQTSTKDLWLVPEILKLPWAHTSLTTHGLQRGVILAVSYI-  722

Query  583   VGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKL  404
                          S+ +  A+    P      N+     QVYGYR SLWAEHLGM+D+  
Sbjct  723   ------------NSKGSLKAIVVDLPPKELHTNR----LQVYGYRTSLWAEHLGMVDDLF  766

Query  403   DEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDV  224
              +   LECV  VNEIAEENW+R+TAE+   LQGHLLKYP++V+++GKV PL   E FPDV
Sbjct  767   KDPSSLECVNYVNEIAEENWRRFTAEQLITLQGHLLKYPVKVEADGKVGPLPEHECFPDV  826

Query  223   GGKVLGSRTTLPDALT  176
             GGK+LG+ T+LPD LT
Sbjct  827   GGKILGAPTSLPDTLT  842



>ref|XP_006349430.1| PREDICTED: phospholipase D delta-like [Solanum tuberosum]
Length=858

 Score =  1028 bits (2657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 505/843 (60%), Positives = 629/843 (75%), Gaps = 24/843 (3%)
 Frame = -2

Query  2683  MSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRRHTRIIT  2504
             ++ N V LHG+LDL I+EA  LPN+D       +    F  +  ++   + +     + T
Sbjct  34    LTGNAVLLHGELDLCIIEACSLPNLDA------KCLPMFSWKSKDSTNASGL-----VDT  82

Query  2503  SDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGV  2324
             SDPYV VCLAGA++ART VI N ++P W E   IPVAH V +VEF VKDND  GA+ IG+
Sbjct  83    SDPYVSVCLAGASIARTAVIPNDENPTWNERLCIPVAHAVDKVEFIVKDNDKVGAELIGI  142

Query  2323  AKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGV---TEDY  2153
               + + +I  G  IN WFPI G+ G P + D  + L + +TP  ENP Y+ GV    +  
Sbjct  143   VAIPSSRIAEGNRINGWFPICGSSGAPLETDAQLHLSIHYTPATENPLYKNGVGNEADQK  202

Query  2152  GLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVY  1973
             G+  +YFP+R GG VTLYQDAH P+ +LPEI +D+GK F H  CWEDICHA+LEA H++Y
Sbjct  203   GVPHTYFPLRKGGDVTLYQDAHAPDETLPEILLDNGKVFKHNKCWEDICHAMLEAQHLIY  262

Query  1972  IVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINT  1793
             IVGWS+YH V+++REPTRP+P+ G L LGE+LKYKSQEGVRV+LL+WDDKTS+   F+ T
Sbjct  263   IVGWSVYHLVRIIREPTRPVPSSGWLELGEMLKYKSQEGVRVILLIWDDKTSNDDLFLKT  322

Query  1792  SGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQG  1613
              GVM THDEET+KFFKHSSV C+L PR ASSKLS  KQQVVG ++THHQKCVIVDTQA G
Sbjct  323   EGVMQTHDEETKKFFKHSSVHCILCPRSASSKLSIFKQQVVGNIFTHHQKCVIVDTQAAG  382

Query  1612  NNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHC  1433
             N+RKITAF+GGLDLCDGRYDTP+HRLFSD DTVF  D +NPTF      GPR+PWHDLH 
Sbjct  383   NDRKITAFVGGLDLCDGRYDTPEHRLFSDLDTVFENDVHNPTFTSSS-GGPREPWHDLHS  441

Query  1432  KIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPN  1253
             KIEGPAAYD+L NFEQR+RKA KW  + +    +     D+LLK+ERI  I  P    P+
Sbjct  442   KIEGPAAYDVLINFEQRYRKAIKWIRIKKCKPGL-----DSLLKLERIPSIHMPAAG-PD  495

Query  1252  DDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAY  1073
              D  + V+ E DP+NWHVQVFRSIDSGS+KGFPKD   A  QNLV  K+L IDRSI +AY
Sbjct  496   GDQVVHVTKEEDPENWHVQVFRSIDSGSVKGFPKDAKEARAQNLVSGKNLRIDRSIHLAY  555

Query  1072  IEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIV  893
             +++IR AQHFIY+ENQYFLGSSY WPSY+ AGA+NL+PME+ALKI SKI   E FA YIV
Sbjct  556   VKSIRSAQHFIYVENQYFLGSSYCWPSYRNAGANNLVPMEIALKIASKIAASEPFAAYIV  615

Query  892   IPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIED-AHPCDYLNFYCLGNRE  716
             IPMWPEG+P+S  VQ+IL+WQGQT+ MMY+IIA+ L++  I    HP DYLNFYCLGNRE
Sbjct  616   IPMWPEGIPTSNAVQEILFWQGQTMSMMYKIIAQALENAGISQFFHPQDYLNFYCLGNRE  675

Query  715   -EWHEESASSPTPG-CSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGS  542
              +       +PTP   +     +QK  RFMIYVH+KGM+VDDEYV++GSANINQRS++GS
Sbjct  676   AKKRGGDGDNPTPQEHTPMQELAQKFRRFMIYVHSKGMIVDDEYVLLGSANINQRSLSGS  735

Query  541   RDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNE  362
             RDTEIAMGAYQPH+TWAK + HPH QVYGYRMSLWAEHLG +++   + + +ECV+ VN+
Sbjct  736   RDTEIAMGAYQPHYTWAKKEAHPHGQVYGYRMSLWAEHLGRVEDGFMDPQTIECVRRVNK  795

Query  361   IAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDA  182
             IA  NW+ + A+++ P++GHL++YP+ V  NG+V+ L G E FPDVGGK+LG+ T LPDA
Sbjct  796   IARRNWQAFVADEYKPMKGHLMQYPVHVSKNGEVTALPGFECFPDVGGKILGAPTNLPDA  855

Query  181   LTT  173
             LTT
Sbjct  856   LTT  858



>ref|XP_009776072.1| PREDICTED: phospholipase D delta-like [Nicotiana sylvestris]
Length=857

 Score =  1027 bits (2656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/842 (61%), Positives = 627/842 (74%), Gaps = 23/842 (3%)
 Frame = -2

Query  2683  MSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRRHTRIIT  2504
             +S + V LHG+LDL I+EAR LPN+D       +    F  +  +      +     I T
Sbjct  34    ISGSPVLLHGELDLWIIEARSLPNLDA------KCLPMFSWKSKDNNNAAGL-----IDT  82

Query  2503  SDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGV  2324
             SDPYV VCLAGA++ART VI N ++P W EH  +PVAH V +VEF VKDND  GA+ IG+
Sbjct  83    SDPYVSVCLAGASIARTAVIPNDENPTWNEHLCVPVAHAVDKVEFIVKDNDRVGAELIGI  142

Query  2323  AKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGV---TEDY  2153
              ++SA KI  G+ IN WFPI G+ G P      + L +++ P AENP YR GV    +  
Sbjct  143   VEISANKIAEGDEINGWFPIRGSSGNPLDTGAQLHLSIQYRPTAENPMYRNGVGNEADQK  202

Query  2152  GLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVY  1973
             G+  +YFP+R GG+VTLYQDAHVP+ + P+I +D+ K F    CWEDICHAILEA H++Y
Sbjct  203   GVPHTYFPLRKGGSVTLYQDAHVPDETFPDILLDNEKVFKRNKCWEDICHAILEAQHLIY  262

Query  1972  IVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINT  1793
             IVGWS+YH V+L+REPTRP+P+ G L LGELLKYKSQEGVRV+LL+WDDKTS+    + T
Sbjct  263   IVGWSVYHPVRLIREPTRPVPSAGWLELGELLKYKSQEGVRVILLIWDDKTSNDDLLLKT  322

Query  1792  SGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQG  1613
              GVM THDEETRK+FKHSSV CVL PR ASSKLS  KQQVVG ++THHQKCVIVDTQA  
Sbjct  323   EGVMQTHDEETRKYFKHSSVHCVLCPRSASSKLSIFKQQVVGNIFTHHQKCVIVDTQAAD  382

Query  1612  NNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHC  1433
             N+RKITAFIGGLDLCDGRYDTP+HRLFSD DTVF  D +NPTF      GPR+PWHDLHC
Sbjct  383   NDRKITAFIGGLDLCDGRYDTPEHRLFSDLDTVFENDVHNPTFTSCS-GGPREPWHDLHC  441

Query  1432  KIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPN  1253
             KIEGPAAYD+LTNFEQR+RKA KW  + +    +     D+LLK++RI  I  P    P+
Sbjct  442   KIEGPAAYDVLTNFEQRYRKAIKWIRIKKCKPGL-----DSLLKLDRIPSIHIPADG-PD  495

Query  1252  DDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAY  1073
              D  + V+ E DP+NWHVQVFRSIDSGS+KGFPKDV  A  QNLV  K+L IDRSI +AY
Sbjct  496   GDHVVRVTREEDPENWHVQVFRSIDSGSVKGFPKDVKEAGAQNLVSGKNLRIDRSIHLAY  555

Query  1072  IEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIV  893
             ++AIR AQHFIYIENQYFLGSSY WPSY+ AGA+NL+PME+ALKI SKI   E FA YIV
Sbjct  556   VKAIRSAQHFIYIENQYFLGSSYCWPSYRNAGANNLVPMEIALKIASKIAANEPFAAYIV  615

Query  892   IPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIED-AHPCDYLNFYCLGNRE  716
             +PMWPEG+P+S  VQ+IL+WQGQT+ MMY+I+A+ L++  I    HP DYLNFYCLGNRE
Sbjct  616   VPMWPEGIPTSNAVQEILFWQGQTMAMMYKIVAQALENAGISQFFHPQDYLNFYCLGNRE  675

Query  715   EWHEESASSPTPGCSEFL-TGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSR  539
                        P   E     +QK  RFMIYVH+KGM+ DDEYV++GSANINQRS++GSR
Sbjct  676   AKKRGGCDEDNPTPQEHSHELAQKFHRFMIYVHSKGMIADDEYVLMGSANINQRSLSGSR  735

Query  538   DTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEI  359
             DTEIAMGAYQPH+TWAK ++HPH QVYGYRMSLWAEHLG +++   + + +ECV+ VN I
Sbjct  736   DTEIAMGAYQPHYTWAKKESHPHGQVYGYRMSLWAEHLGAVEDVFMDPQTIECVRRVNVI  795

Query  358   AEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDAL  179
             A  NW+ + A+++ P++GHL++YP+ V  NG+V+ L G E FPDVGGK+LG+ TTLPDAL
Sbjct  796   ARRNWQAFVADEYQPMKGHLMQYPVHVSKNGEVTALPGFECFPDVGGKILGAPTTLPDAL  855

Query  178   TT  173
             TT
Sbjct  856   TT  857



>ref|XP_006341816.1| PREDICTED: phospholipase D delta-like isoform X1 [Solanum tuberosum]
Length=836

 Score =  1026 bits (2654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/839 (60%), Positives = 632/839 (75%), Gaps = 14/839 (2%)
 Frame = -2

Query  2677  ENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRRHTRIITSD  2498
             +  V LHG+LD++I+EA+ LPNMD+      +F      RK + +   K      I TSD
Sbjct  8     DGAVLLHGELDVQIIEAKSLPNMDMAC--CSKFSPFGSTRKVKNKDPGKSGTRKIIDTSD  65

Query  2497  PYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVAK  2318
             PYV V + GA VART VI N ++P W EH +IPVAH V +VEF VKDND  GA+ IG  +
Sbjct  66    PYVSVVIGGAKVARTTVIRNDENPSWNEHVRIPVAHTVDKVEFFVKDNDGVGAELIGKVE  125

Query  2317  VSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED---YGL  2147
             + A KI++G+ I+ WFPI+G  G P K    + L +++ P AENP YR GV  D    G+
Sbjct  126   IPADKILAGKEISSWFPILGHSGDPLKTGAQLHLSIQYKPVAENPLYRNGVGRDANSVGV  185

Query  2146  KESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYIV  1967
               +YFP+R GG VTLYQDAHVP+ +LP+I +DDGK F H  CWEDICHA+LEA +++Y+V
Sbjct  186   PHTYFPLRRGGNVTLYQDAHVPDATLPKILLDDGKVFSHNKCWEDICHAMLEAKYLIYVV  245

Query  1966  GWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTSG  1787
             GWS+YH ++LVREPTRPLP+ G   LG+LLKYKSQEGVRV+LL+WDDKTS+   F+ T G
Sbjct  246   GWSVYHPIRLVREPTRPLPSAGERTLGDLLKYKSQEGVRVILLIWDDKTSNDDLFLKTEG  305

Query  1786  VMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQGNN  1607
             VM THDEETRKFFKHSSV CVL PR ASSKLS +K+Q+VG L+THHQKCV+VDT A  N 
Sbjct  306   VMQTHDEETRKFFKHSSVHCVLCPRSASSKLSILKRQIVGNLFTHHQKCVLVDTAAPQNE  365

Query  1606  RKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCKI  1427
             RKITAF+GGLDLCDGRYDTP+HRLFSD DTVF  D +NPTF      GPR+PWHDLHCKI
Sbjct  366   RKITAFVGGLDLCDGRYDTPEHRLFSDLDTVFGNDVHNPTFTTTS-GGPREPWHDLHCKI  424

Query  1426  EGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPNDD  1247
             +GPAAYD+LTNFEQR+ KA KW +L R+ K+ S    D LLK++RI+ I  P+   P+ D
Sbjct  425   DGPAAYDVLTNFEQRFNKAMKWLKL-RKVKQGS----DTLLKLDRIAAIRMPSAG-PDGD  478

Query  1246  PSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIE  1067
              ++ V+NE DP++W+VQVFRSIDSGS+KGFPKD+  AE QNLV  K+L I+RSI +AY++
Sbjct  479   LAVRVTNEQDPESWNVQVFRSIDSGSVKGFPKDIKEAEAQNLVSGKNLKIERSIHLAYVK  538

Query  1066  AIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIP  887
             AIR AQHF+Y+ENQYFLGSSY+WPSY+ AGA+NL+PME+ALKI  KI   E FA YIV+P
Sbjct  539   AIRSAQHFVYVENQYFLGSSYSWPSYRNAGANNLVPMEIALKIARKIAANEPFAAYIVVP  598

Query  886   MWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDA-HPCDYLNFYCLGNREEW  710
             MWPEGVP+S  VQ+IL+WQ QT+ MMY+++A+ L+   +    HP DYLNFYCLG RE  
Sbjct  599   MWPEGVPTSKAVQEILFWQSQTMSMMYKVVAEALEKAGLSQYFHPQDYLNFYCLGKREVK  658

Query  709   HEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTE  530
                  +S        L  +QK GRFMIYVH+KGM+VDDEYV++GSANINQRS++GSRDTE
Sbjct  659   PVNQKTS-AHNQDRLLGLAQKFGRFMIYVHSKGMIVDDEYVLMGSANINQRSLSGSRDTE  717

Query  529   IAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEE  350
             IAMGAYQP++TWA+   HP+ QVYGYRMSLW+EHLG ++    E + +ECV+ VNE+A  
Sbjct  718   IAMGAYQPNYTWARKDRHPNGQVYGYRMSLWSEHLGSVENTFMEPQTVECVRRVNEMARY  777

Query  349   NWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALTT  173
             NW  ++ +++  ++GHL++YP+QV  NG+V+ L G E FPDVGGK+LG+ T LPDALTT
Sbjct  778   NWNAFSGDEYKKMKGHLMQYPIQVSKNGEVTNLPGFECFPDVGGKILGAPTNLPDALTT  836



>gb|KHN35993.1| Phospholipase D delta [Glycine soja]
Length=740

 Score =  1024 bits (2648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 501/746 (67%), Positives = 599/746 (80%), Gaps = 32/746 (4%)
 Frame = -2

Query  2332  IGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED-  2156
             +G  KV A++I +G  I++WFPI+   GKPPKPD A+ + MKFTP  EN  Y+ G+  D 
Sbjct  1     MGTVKVPARRIATGAKISEWFPILLPSGKPPKPDTALHVEMKFTPVWENLLYQRGIAADP  60

Query  2155  --YGLKESYFPMRHGGAVTLYQDAHVPE---GSLPEIKIDDGKAFHHENCWEDICHAILE  1991
                G++ +YFP+R G +V LYQDAH  E   G LPEIK+++G  + HE CWEDIC+AI E
Sbjct  61    EHNGVRHTYFPVRKGSSVRLYQDAHCTESGEGKLPEIKLENGNVYRHEKCWEDICYAISE  120

Query  1990  AHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHS  1811
             AHHMVY+VGWSIYHKV+LVREPTRPLP GG+L LGELLKYKS+EGVRVLLLVWDDKTSH 
Sbjct  121   AHHMVYLVGWSIYHKVRLVREPTRPLPRGGDLTLGELLKYKSEEGVRVLLLVWDDKTSHD  180

Query  1810  KFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVK--------QQVVGTLYT  1655
             K F+ T+GVMGTHDEETRKFFKHSSV CVL+PR   ++  F++          VVGT++T
Sbjct  181   KVFLKTAGVMGTHDEETRKFFKHSSVMCVLSPR-NRARPKFLRLATRGCSLNVVVGTVFT  239

Query  1654  HHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEG  1475
             HHQKCVIVDTQA GNNRKITAFIGGLDLCDGRYDTP+HRLF + D VF GD++NPTF   
Sbjct  240   HHQKCVIVDTQAAGNNRKITAFIGGLDLCDGRYDTPEHRLFRNLDDVFDGDFHNPTF-SA  298

Query  1474  GLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIE  1295
             G + PRQPWHDLHC+I+GPAAYD+L NFEQRWRKA+KW E    FKK S WHDDAL++IE
Sbjct  299   GTRVPRQPWHDLHCRIDGPAAYDVLINFEQRWRKATKWKEFAILFKKSSQWHDDALIRIE  358

Query  1294  RISWITSPTP-----------SVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKD  1148
             RISWI SP+            +VP DDP +WVS+E DP+NWHVQ+FRSIDSGSLKGFPK 
Sbjct  359   RISWILSPSGAATLKDKSDDYTVPEDDPLVWVSSEDDPENWHVQIFRSIDSGSLKGFPKR  418

Query  1147  VHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADN  968
             V  A +QNL+CAK+LVID+SIQ AYI+AIR AQHFIYIENQYF+GSSYAWP+YK+AGADN
Sbjct  419   VDVALSQNLICAKNLVIDKSIQTAYIQAIRSAQHFIYIENQYFIGSSYAWPAYKDAGADN  478

Query  967   LIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKE  788
             LIPMELALKI SKIR +ERFAVYIV+PMWPEG P +  +Q+IL+WQGQT+QMMY+ +A+E
Sbjct  479   LIPMELALKIASKIRAKERFAVYIVLPMWPEGDPKTGAMQEILFWQGQTMQMMYDAVARE  538

Query  787   LKSEKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGM  608
             LKS ++ D HP DYLNFYCLGNRE ++E+S+S  T G    ++ + K  RFMIYVHAKGM
Sbjct  539   LKSMQLTDVHPQDYLNFYCLGNREHFNEDSSS--TNGAQ--VSTAYKYRRFMIYVHAKGM  594

Query  607   VVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEH  428
             +VDDEYVI+GSANINQRSMAG++DTEIAMGAYQPH+TW+  + HPH Q+YGYRMSLW EH
Sbjct  595   IVDDEYVIIGSANINQRSMAGTKDTEIAMGAYQPHYTWSAKKRHPHGQIYGYRMSLWGEH  654

Query  427   LGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLG  248
             LGM+DE  +E E LECV  VN+IA+ NWK + +E FS LQGHLLKYP+QVDS+GK+  L 
Sbjct  655   LGMLDETFEEPERLECVHKVNKIADNNWKLFASEDFSLLQGHLLKYPVQVDSDGKIRSLP  714

Query  247   GCEYFPDVGGKVLGSR-TTLPDALTT  173
              CE FPD GGK+LG+  TT+PD LTT
Sbjct  715   DCENFPDAGGKILGAHSTTIPDILTT  740



>gb|EEE60272.1| hypothetical protein OsJ_13309 [Oryza sativa Japonica Group]
Length=829

 Score =  1021 bits (2641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 519/853 (61%), Positives = 623/853 (73%), Gaps = 52/853 (6%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQGNKVRRH-----  2519
             SE+ V LHGDLD+ I EA+ LPNMDI+SER+R+FFT +  C       G+  RR      
Sbjct  12    SESAVLLHGDLDIWITEAKCLPNMDIMSERMRRFFTGYGACGSSCGGTGDNARRAGGGVR  71

Query  2518  -TRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFG  2342
               +IITSDPYV VCLAGATVA+TRVI NS++P W E F++ VAH VS +EF VKDNDVFG
Sbjct  72    PKKIITSDPYVSVCLAGATVAQTRVIPNSENPRWEERFRVEVAHAVSRLEFHVKDNDVFG  131

Query  2341  ADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT  2162
             A  IGVA +   +I+SG       P  G                   P    P  RGG  
Sbjct  132   AQLIGVASLPVDRILSGA------PAEG-----------------LAPSTTTPSTRGGAG  168

Query  2161  EDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHH  1982
                 +  +YFP+R GG VTLYQDAHV +G LP I+I  G+A+ H  CWEDICH+I+EAHH
Sbjct  169   ---AVPNAYFPLRRGGGVTLYQDAHVADGGLPAIQIAGGRAYEHGRCWEDICHSIVEAHH  225

Query  1981  MVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFF  1802
             +VY+VGWSIYH VKLVREPTR LP      LGELLK +++EGVR+++L+WDDKTSH KF 
Sbjct  226   LVYMVGWSIYHPVKLVREPTRALPGETPSTLGELLKKRAREGVRIVILLWDDKTSHDKFL  285

Query  1801  INTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQ  1622
             + T GVM THDEET+KFF+HS V CVL PRYAS+KLS  KQQVVGTL+THHQKCV+VDTQ
Sbjct  286   LKTDGVMHTHDEETKKFFRHSGVHCVLVPRYASTKLSIFKQQVVGTLFTHHQKCVLVDTQ  345

Query  1621  AQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHD  1442
             A GNNRKITAFIGGLDLCDGRYDTP+HRLF D DT F  D++NPTFP     GPRQPWHD
Sbjct  346   ATGNNRKITAFIGGLDLCDGRYDTPEHRLFKDLDTAFNKDFHNPTFPVNSY-GPRQPWHD  404

Query  1441  LHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPS  1262
             LHCKIEGPAA+DILTNFEQRWRKA+KW       KK++ WH D L+KI R+SWI +P   
Sbjct  405   LHCKIEGPAAFDILTNFEQRWRKATKWKV---NLKKVASWHHDTLIKINRMSWIVTPAA-  460

Query  1261  VPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQ  1082
                D+ +  V  E DP+NWHVQVFRSIDSGS+KGFPK V  AE+QNLVCAK+L ID+SI 
Sbjct  461   ---DEANAHVCEEKDPENWHVQVFRSIDSGSVKGFPKIVQEAESQNLVCAKNLKIDKSIH  517

Query  1081  MAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAV  902
              AY++AIR AQHFIYIENQYF+GSS+ W S+K AGADNLIP+ELALKI SKI+  E+FAV
Sbjct  518   SAYVKAIRSAQHFIYIENQYFIGSSFLWSSHKSAGADNLIPVELALKIASKIKANEQFAV  577

Query  901   YIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGN  722
             YIV+PMWPEG+P++AP+Q IL+WQ QT+ MMY+IIA  L+ + + +AHP DYLNFYCLG 
Sbjct  578   YIVLPMWPEGIPTAAPMQQILFWQSQTMSMMYKIIADALQMQGLVEAHPQDYLNFYCLGK  637

Query  721   REEWHEESASSPTPGCSE--FLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMA  548
             RE    +S S  T  C++   L  +QK  RFMIYVH+KGMVVDDEYVI+GSANINQRSM 
Sbjct  638   REVAAGDSMSQ-TSLCNDNSTLRSAQKLRRFMIYVHSKGMVVDDEYVIIGSANINQRSME  696

Query  547   GSRDTEIAMGAYQPHHTWAKN--QNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVK  374
             G RDTEIAMGAYQPH+ W+ +  Q  P  QVYGYRMSLWAEHLG ++E     E  ECV+
Sbjct  697   GCRDTEIAMGAYQPHYKWSADHGQGPPRGQVYGYRMSLWAEHLGAVEECFGRPETGECVR  756

Query  373   MVNEIAEENWKRYTAEKFSPL------QGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKV  212
              V E+A       T  +   +      +GHL+ YPL+VD +G+V  L G + FPDVGGKV
Sbjct  757   RVREMAGGRTGGRTCLQGVRVAGDGGDEGHLMCYPLKVDKDGRVRSLPGHDCFPDVGGKV  816

Query  211   LGSRTTLPDALTT  173
             LG++T+LP+ALTT
Sbjct  817   LGTQTSLPNALTT  829



>gb|KCW56568.1| hypothetical protein EUGRSUZ_I02299 [Eucalyptus grandis]
Length=842

 Score =  1019 bits (2634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/812 (63%), Positives = 614/812 (76%), Gaps = 42/812 (5%)
 Frame = -2

Query  2521  HTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFG  2342
             H +IITSDPYV VC+  ATVARTRV+ N+QDP W + F IP+AHPV  +EF+VKDND+FG
Sbjct  44    HAKIITSDPYVTVCVPHATVARTRVLHNTQDPEWDQWFCIPLAHPVDYLEFRVKDNDLFG  103

Query  2341  ADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT  2162
             A  IG  K+SA++I+    I+  FP+ G   K    + A++L + FTP  EN  YR G+ 
Sbjct  104   AQVIGTVKISAREIMEKRVISRSFPLSGPSAKQ---NSALKLQLTFTPVEENEVYRIGIA  160

Query  2161  ED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDD--GKAFHHENCWEDICHAI  1997
              D    G++++YFP+R G  +TLYQDAHV +GSLPEIK+D   G  +  E CWEDICHAI
Sbjct  161   GDPKHQGVRQTYFPLRKGSGLTLYQDAHVIDGSLPEIKLDSDAGGVYRREKCWEDICHAI  220

Query  1996  LEAHHMVYIVGWSIYHKVKLVRE--PTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDK  1823
              EAHH++YIVGWS+ HK+KL+RE   TRPLP  G+L LGELLKYKSQEGVRVLLL+WDDK
Sbjct  221   SEAHHLIYIVGWSVSHKIKLIREHTQTRPLPQDGDLTLGELLKYKSQEGVRVLLLIWDDK  280

Query  1822  TSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQK  1643
             TSH K+FIN  GVM THDEET+ FFKHSSV CVLAPR  SSKL ++KQQVVG+++THHQK
Sbjct  281   TSHKKYFINMEGVMQTHDEETKDFFKHSSVNCVLAPRNPSSKLGYIKQQVVGSMFTHHQK  340

Query  1642  CVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKG  1463
             C++VDTQA GN RKITAFIGG+DLCDGRYDTP+HRLF + DTVF+ D++NPTFP  G++ 
Sbjct  341   CILVDTQASGNYRKITAFIGGIDLCDGRYDTPEHRLFRNLDTVFKDDFHNPTFP-AGVEA  399

Query  1462  PRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISW  1283
             PRQPWHDLHC+IEGPAAYD+L NFEQRWRKA++W +     K   HWHDD+LLKI RISW
Sbjct  400   PRQPWHDLHCRIEGPAAYDVLINFEQRWRKATRWKDFSLFVKGKKHWHDDSLLKISRISW  459

Query  1282  ITSP--------------------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLK  1163
             I SP                    T  VP D+P ++VS E D  NWHVQ+FRSIDSGS+K
Sbjct  460   ILSPPSTDLHDSTRSLSKENRHERTTVVPEDNPDIYVSKEDDHNNWHVQIFRSIDSGSVK  519

Query  1162  GFP-KDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYK  986
             GFP K    A  QNL+ AKD+V+DRSIQ AYI+AIR A++F+YIENQYFLGSSYAWPS+ 
Sbjct  520   GFPKKKKEVAGKQNLIDAKDVVVDRSIQTAYIQAIRSAKNFVYIENQYFLGSSYAWPSHN  579

Query  985   EAGADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMY  806
             +AGADNLIPMELALKI SKI+  ERFAVYIVIPMWPEG P SA VQ+IL+WQ QT+QMMY
Sbjct  580   DAGADNLIPMELALKIASKIKANERFAVYIVIPMWPEGDPKSAAVQEILFWQNQTMQMMY  639

Query  805   EIIAKELKSEKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIY  626
              +IA +LK   ++D +P DYLNFYCLG RE+       SP    SE    S  S RFMIY
Sbjct  640   RVIASQLKQTSLKD-YPQDYLNFYCLGKRED--NSGQHSPNNAVSE----SYNSKRFMIY  692

Query  625   VHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRM  446
             VHAKGMVVDDEYV++GSAN+NQRS+AG++DTEIAMGAYQPHHT AK + HP  QVYGYRM
Sbjct  693   VHAKGMVVDDEYVLLGSANLNQRSLAGTKDTEIAMGAYQPHHTCAKKEGHPRGQVYGYRM  752

Query  445   SLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNG  266
             SLWAEHLG+++E  +E     CVK V EIA +NW  Y  +    LQGHLL+YP+ VD +G
Sbjct  753   SLWAEHLGVVEECFNEPGSPACVKRVKEIAGKNWNSYKNQ--GELQGHLLQYPIDVDQHG  810

Query  265   KVSPLGGCEYFPDVGGKVLGSRT-TLPDALTT  173
              V PL G E FPDVGGKV+G+ T  +PD LTT
Sbjct  811   NVGPLPGSEEFPDVGGKVVGAHTAAIPDVLTT  842



>ref|XP_010029625.1| PREDICTED: phospholipase D delta-like [Eucalyptus grandis]
Length=859

 Score =  1018 bits (2632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/879 (59%), Positives = 642/879 (73%), Gaps = 58/879 (7%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKP------------  2552
             M+D    + VYLHGDLDL I+ A  LPNMD+VS R+R+  +A  C +P            
Sbjct  1     MADLPPGHGVYLHGDLDLHIISACNLPNMDMVSGRLRRCLSA--CARPSRSSDPAPASPL  58

Query  2551  ETRQGNKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVE  2372
               R  +  R H ++ITSDPYV V +  AT+ARTR++ N Q+P W + F+IP+AH   ++E
Sbjct  59    RDRCDHDARCHGKVITSDPYVTVRVPHATIARTRILHNMQNPWWDQRFRIPLAHRAVDLE  118

Query  2371  FQVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCA  2192
             F+VKD+++F A  IG   +SA++I SGE I+  FP+    G   KP+  ++L +KFTP  
Sbjct  119   FRVKDSNLFCAQLIGTVNISAREIKSGEDISGSFPL---RGPSAKPNSRLQLKLKFTPVE  175

Query  2191  ENPRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENC  2021
             +NP Y+ G+  D    G++ +YFP+R G  V LYQDAHV + SLPEI+++  +    E C
Sbjct  176   DNPVYKNGIAGDPNHLGVRHTYFPLRKGCGVRLYQDAHVIDKSLPEIEMN-CECDRREKC  234

Query  2020  WEDICHAILEAHHMVYIVGWSIYHKVKLVRE--PTRplpnggnlnlgelLKYKSQEGVRV  1847
             WEDI HAI EAHH++YIVGWS+ + +KL+RE   TR +P GG+L LGELLKYKSQEGV V
Sbjct  235   WEDIGHAISEAHHLIYIVGWSVSYNIKLIRERTQTRRMPQGGDLTLGELLKYKSQEGVHV  294

Query  1846  LLLVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVG  1667
             LLL+WDDKTS  K F+N  GVM T DEETR FFK+SSV CVL PR AS KL ++KQQVVG
Sbjct  295   LLLIWDDKTSRDKHFVNKEGVMQTRDEETRDFFKNSSVNCVLVPRNASGKLGYIKQQVVG  354

Query  1666  TLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPT  1487
             +++THHQKCV+VDTQA GN+RKITAFIGG+DLCDGRYDTP+HRLF D DTVF+ D +NPT
Sbjct  355   SMFTHHQKCVLVDTQALGNHRKITAFIGGIDLCDGRYDTPEHRLFHDLDTVFKDDIHNPT  414

Query  1486  FPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDAL  1307
             FP  G+K PRQPWHDLHC+IEGPAAYD+L NFEQRWRKA++W   G++ +     HDD+L
Sbjct  415   FP-AGMKAPRQPWHDLHCRIEGPAAYDVLMNFEQRWRKATRWFSKGKKNQ-----HDDSL  468

Query  1306  LKIERISWITSPTPS-------------------VPNDDPSLWVSNEGDPQNWHVQVFRS  1184
              KI RISWI SPT +                   VP D+P L+VSNE D  NWHVQ+FRS
Sbjct  469   FKIGRISWILSPTSTESHDSTSLSKDDHHDRITVVPEDNPDLYVSNENDHNNWHVQIFRS  528

Query  1183  IDSGSLKGFP-KDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSS  1007
             IDSGS+KGFP K    AE QNL+  KD V+DRSIQ AY++AIR AQHF+YIENQ+FLGSS
Sbjct  529   IDSGSVKGFPTKKKDVAEKQNLIVTKDAVVDRSIQTAYVQAIRSAQHFVYIENQHFLGSS  588

Query  1006  YAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQG  827
             YAWPS  +AGADNLIPMELALKI SKI+  ERFAVYIVIPMWPEG P SA VQ+IL+WQ 
Sbjct  589   YAWPSNNDAGADNLIPMELALKIASKIKANERFAVYIVIPMWPEGDPKSATVQEILFWQN  648

Query  826   QTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQK  647
             QT+QMMYE++A++LK   + D+HP DYLNFYCLG RE+      +S  P   + ++ S K
Sbjct  649   QTMQMMYEVVARQLKQMALGDSHPQDYLNFYCLGKRED------NSGQPSLDDAVSESYK  702

Query  646   SGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHA  467
             S RFMIYVHAKGMVVDDEYV++GSANINQRS+ G+RDTEIAMGAYQPHHT AK + H   
Sbjct  703   SQRFMIYVHAKGMVVDDEYVLLGSANINQRSLTGTRDTEIAMGAYQPHHTCAKKEGHQRG  762

Query  466   QVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYP  287
             QVYGYRMSLWAEHL ++++  +E   L CVK VNEIA  NW  Y  +    LQGHLL+YP
Sbjct  763   QVYGYRMSLWAEHLRVVEKCFNEPGSLACVKRVNEIAGNNWNSYKNQ--GELQGHLLRYP  820

Query  286   LQVDSNGKVSPLGGCEYFPDVGGKVLGSRTT-LPDALTT  173
             +QVD +G V PL G E FPDV GKV+G+ TT +PD LTT
Sbjct  821   IQVDKDGNVGPLPGSEEFPDVCGKVVGAHTTAIPDVLTT  859



>ref|XP_004248600.1| PREDICTED: phospholipase D delta-like [Solanum lycopersicum]
Length=839

 Score =  1018 bits (2631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 498/837 (59%), Positives = 633/837 (76%), Gaps = 16/837 (2%)
 Frame = -2

Query  2668  VYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRRHTRIITSDPYV  2489
             + LHG+LD++I+EA+ LPNMD+      +F      RK + +   K      I TSDPYV
Sbjct  14    ILLHGELDVQIIEAKSLPNMDMAC--CSKFSPFGSTRKAKNKDPGKSGTRKIIDTSDPYV  71

Query  2488  KVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVAKVSA  2309
              V + GA VART VI N ++P W EH +IPVAH V +VEF VKDND  GA+ IG  ++ A
Sbjct  72    SVVIGGAKVARTTVIRNDENPSWNEHVRIPVAHTVDKVEFFVKDNDGVGAELIGKVEIPA  131

Query  2308  QKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED---YGLKES  2138
              KI++G+ IN WF I+G  G P K    + L +++ P AENP YR GV  D    G+  +
Sbjct  132   DKIVAGKEINSWFSILGHSGDPLKTGAQLHLSIQYKPVAENPLYRNGVGRDTNSVGVPHT  191

Query  2137  YFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYIVGWS  1958
             YFP+R GG +TLYQDAHVP+ +LP+I +DDGK F H  CWEDICH++LEA +++Y+VGWS
Sbjct  192   YFPLRRGGNLTLYQDAHVPDAALPKIWLDDGKVFSHNKCWEDICHSMLEAKYLIYVVGWS  251

Query  1957  IYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTSGVMG  1778
             +YH ++LVREPTRPLP+ G   LG+LLKYKSQEGVRV+LL+WDDKTS+   F+ T GVM 
Sbjct  252   VYHPIRLVREPTRPLPSAGERTLGDLLKYKSQEGVRVILLIWDDKTSNDDVFLKTEGVMQ  311

Query  1777  THDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQGNNRKI  1598
             THDEETRKFFKHSSV CVL PR ASSKLS +K+Q+VG L+THHQKCV+VDT+A  N RKI
Sbjct  312   THDEETRKFFKHSSVHCVLCPRSASSKLSILKRQIVGNLFTHHQKCVLVDTEAPQNERKI  371

Query  1597  TAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCKIEGP  1418
             TAF+GGLDLCDGRYDTP+HRLFSD DTVF  D +NPTF      GPR+PWHDLHCKI+GP
Sbjct  372   TAFVGGLDLCDGRYDTPEHRLFSDLDTVFGNDVHNPTFTTTS-GGPREPWHDLHCKIDGP  430

Query  1417  AAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPNDDPSL  1238
             AAYD+LTNFEQR+ KA KW +L R+ K+ S    D LLK++RI+ I  P+   P+ D ++
Sbjct  431   AAYDVLTNFEQRFNKAMKWLKL-RKVKQGS----DTLLKLDRIAAIRMPSAG-PDGDLAV  484

Query  1237  WVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAIR  1058
              V+NE DP++W+VQVFRSIDSGS+KGFPKD+  AE QNLV  K+L I+RSI +AY++AIR
Sbjct  485   RVTNEQDPESWNVQVFRSIDSGSVKGFPKDIKEAEAQNLVSGKNLKIERSIHLAYVKAIR  544

Query  1057  RAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPMWP  878
              AQHF+YIENQYFLGSSY WPS++ AGA+NL+PME+ALKI  KI   E FA YIV+PMWP
Sbjct  545   SAQHFVYIENQYFLGSSYNWPSHRNAGANNLVPMEIALKIARKIAANEPFAAYIVVPMWP  604

Query  877   EGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDA-HPCDYLNFYCLGNRE-EWHE  704
             EGVP+S  VQ+IL+WQ QT+ MMY+I+A+ L+   +    HP DYLNFYCLG RE +   
Sbjct  605   EGVPTSKAVQEILFWQSQTMSMMYKIVAEALEKACLSQYFHPQDYLNFYCLGKREVKPAN  664

Query  703   ESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIA  524
             + AS+        L  +QK GRFMIYVH+KGM+VDDEYV++GSANINQRS++GSRDTEIA
Sbjct  665   QKASAHIQ--DRLLGSAQKFGRFMIYVHSKGMIVDDEYVLMGSANINQRSLSGSRDTEIA  722

Query  523   MGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENW  344
             MGAYQP++TWAK   HP+ QVYGYRMSLW+EHLG+++    E + +ECV+ VNE+A  NW
Sbjct  723   MGAYQPNYTWAKKDRHPNGQVYGYRMSLWSEHLGIVENTFMEPQTVECVRRVNEMARYNW  782

Query  343   KRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALTT  173
               ++ +++  ++GHL++YP+QV  NG+V+ L G E F DVGG++LG+ T LPDALTT
Sbjct  783   NAFSGDEYKKMKGHLMQYPIQVSKNGEVTNLPGFESFLDVGGRILGAPTNLPDALTT  839



>ref|XP_006341817.1| PREDICTED: phospholipase D delta-like isoform X2 [Solanum tuberosum]
Length=839

 Score =  1016 bits (2627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 501/848 (59%), Positives = 633/848 (75%), Gaps = 29/848 (3%)
 Frame = -2

Query  2677  ENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRRHTRIITSD  2498
             +  V LHG+LD++I+EA+ LPNMD+      +F      RK + +   K      I TSD
Sbjct  8     DGAVLLHGELDVQIIEAKSLPNMDMAC--CSKFSPFGSTRKVKNKDPGKSGTRKIIDTSD  65

Query  2497  PYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVAK  2318
             PYV V + GA VART VI N ++P W EH +IPVAH V +VEF VKDND  GA+ IG  +
Sbjct  66    PYVSVVIGGAKVARTTVIRNDENPSWNEHVRIPVAHTVDKVEFFVKDNDGVGAELIGKVE  125

Query  2317  VSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED---YGL  2147
             + A KI++G+ I+ WFPI+G  G P K    + L +++ P AENP YR GV  D    G+
Sbjct  126   IPADKILAGKEISSWFPILGHSGDPLKTGAQLHLSIQYKPVAENPLYRNGVGRDANSVGV  185

Query  2146  KESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYIV  1967
               +YFP+R GG VTLYQDAHVP+ +LP+I +DDGK F H  CWEDICHA+LEA +++Y+V
Sbjct  186   PHTYFPLRRGGNVTLYQDAHVPDATLPKILLDDGKVFSHNKCWEDICHAMLEAKYLIYVV  245

Query  1966  GWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTSG  1787
             GWS+YH ++LVREPTRPLP+ G   LG+LLKYKSQEGVRV+LL+WDDKTS+   F+ T G
Sbjct  246   GWSVYHPIRLVREPTRPLPSAGERTLGDLLKYKSQEGVRVILLIWDDKTSNDDLFLKTEG  305

Query  1786  VMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQ------VVGTLYTHHQKCVIVDT  1625
             VM THDEETRKFFKHSSV CVL PR ASSKLS +K+Q      +VG L+THHQKCV+VDT
Sbjct  306   VMQTHDEETRKFFKHSSVHCVLCPRSASSKLSILKRQDHLILQIVGNLFTHHQKCVLVDT  365

Query  1624  QAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWH  1445
              A  N RKITAF+GGLDLCDGRYDTP+HRLFSD DTVF  D +NPTF      GPR+PWH
Sbjct  366   AAPQNERKITAFVGGLDLCDGRYDTPEHRLFSDLDTVFGNDVHNPTFTTTS-GGPREPWH  424

Query  1444  DLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTP  1265
             DLHCKI+GPAAYD+LTNFEQR+ KA KW +L R+ K+ S    D LLK++RI+ I  P+ 
Sbjct  425   DLHCKIDGPAAYDVLTNFEQRFNKAMKWLKL-RKVKQGS----DTLLKLDRIAAIRMPSA  479

Query  1264  SVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSI  1085
               P+ D ++ V+NE DP++W+VQVFRSIDSGS+KGFPKD+  AE QNLV  K+L I+RSI
Sbjct  480   G-PDGDLAVRVTNEQDPESWNVQVFRSIDSGSVKGFPKDIKEAEAQNLVSGKNLKIERSI  538

Query  1084  QMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFA  905
              +AY++AIR AQHF+Y+ENQYFLGSSY+WPSY+ AGA+NL+PME+ALKI  KI   E FA
Sbjct  539   HLAYVKAIRSAQHFVYVENQYFLGSSYSWPSYRNAGANNLVPMEIALKIARKIAANEPFA  598

Query  904   VYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDA-HPCDYLNFYCL  728
              YIV+PMWPEGVP+S  VQ+IL+WQ QT+ MMY+++A+ L+   +    HP DYLNFYCL
Sbjct  599   AYIVVPMWPEGVPTSKAVQEILFWQSQTMSMMYKVVAEALEKAGLSQYFHPQDYLNFYCL  658

Query  727   GNREEWHEESASSPTPGCSEFLTG---SQKSGRFMIYVHAKGMVVDDEYVIVGSANINQR  557
             G RE         P    +  LT    +QK GRFMIYVH+KGM+VDDEYV++GSANINQR
Sbjct  659   GKRE-------VKPVNQKTIHLTLQGLAQKFGRFMIYVHSKGMIVDDEYVLMGSANINQR  711

Query  556   SMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECV  377
             S++GSRDTEIAMGAYQP++TWA+   HP+ QVYGYRMSLW+EHLG ++    E + +ECV
Sbjct  712   SLSGSRDTEIAMGAYQPNYTWARKDRHPNGQVYGYRMSLWSEHLGSVENTFMEPQTVECV  771

Query  376   KMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRT  197
             + VNE+A  NW  ++ +++  ++GHL++YP+QV  NG+V+ L G E FPDVGGK+LG+ T
Sbjct  772   RRVNEMARYNWNAFSGDEYKKMKGHLMQYPIQVSKNGEVTNLPGFECFPDVGGKILGAPT  831

Query  196   TLPDALTT  173
              LPDALTT
Sbjct  832   NLPDALTT  839



>ref|XP_010029630.1| PREDICTED: phospholipase D delta-like [Eucalyptus grandis]
Length=862

 Score =  1014 bits (2623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 515/872 (59%), Positives = 637/872 (73%), Gaps = 59/872 (7%)
 Frame = -2

Query  2668  VYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQG------------NKVR  2525
              YLHGDLDL I+ A  LP MD+VS R+R+  +A  C +P                 +  R
Sbjct  10    AYLHGDLDLHIISASNLPTMDMVSGRLRRCLSA--CARPSRSSDLAPASPLRDPCVHDAR  67

Query  2524  RHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVF  2345
              H ++ITSDPYV V +  AT+ARTR++ N Q+P W + F+IP+AH   ++EF+VKD+++F
Sbjct  68    CHKKVITSDPYVTVRVPHATIARTRILHNMQNPWWDQRFRIPLAHFAVDLEFRVKDSNLF  127

Query  2344  GADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGV  2165
              A  IG   +SA++I SGE I+  FP+    G   KP+  ++L +KFT    N  Y+  +
Sbjct  128   CAQLIGTVNISAREIKSGEDISGSFPL---RGPSAKPNSRLQLKLKFTSVENNAVYQHSI  184

Query  2164  TED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLP--EIKIDDGKAFHHENCWEDICHA  2000
               D    G++ +YFP+R G +V LYQDAHV +G  P  E++ D G  + HE CWEDICHA
Sbjct  185   AGDPDHLGVRHTYFPLRKGCSVRLYQDAHVVDGMSPGIELESDAGGVYRHEKCWEDICHA  244

Query  1999  ILEAHHMVYIVGWSIYHKVKLVRE--PTRplpnggnlnlgelLKYKSQEGVRVLLLVWDD  1826
             I EAHH++YIVGWS+ + +KL+RE   TR +P GG+L LGELLKYKS+EGVRVLLL+WDD
Sbjct  245   ISEAHHLIYIVGWSVSYNIKLIRERTQTRRMPLGGDLTLGELLKYKSREGVRVLLLIWDD  304

Query  1825  KTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQ  1646
             KTS  K FIN  GVM T DEETR FFK+SSV CVL PR A  KL ++KQQVVG+++THHQ
Sbjct  305   KTSRDKHFINKEGVMQTRDEETRDFFKNSSVNCVLVPRNARGKLGYIKQQVVGSMFTHHQ  364

Query  1645  KCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLK  1466
             KC++VDTQA GN+RKITAFIGG+DLCDGRYDTP+HRLF D DTVF+ D++NPTFP  G+K
Sbjct  365   KCILVDTQALGNHRKITAFIGGIDLCDGRYDTPEHRLFRDLDTVFKDDFHNPTFP-AGMK  423

Query  1465  GPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERIS  1286
              PRQPWHDLHC+IEGPAAYD+L NFEQRWRKA++W   G++ +     HDD+LLKI RIS
Sbjct  424   APRQPWHDLHCRIEGPAAYDVLMNFEQRWRKATRWFSKGKKNR-----HDDSLLKIGRIS  478

Query  1285  WITSPTPS-------------------VPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLK  1163
             WI SPT +                   VP D+P L+VS E D  NWHVQ+FRSIDSGS+K
Sbjct  479   WILSPTSTESHDSTSLTKDDHHDRITVVPEDNPDLYVSKEDDHNNWHVQIFRSIDSGSVK  538

Query  1162  GFP-KDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYK  986
             GFP K    AE QNL+  KD V+DRSIQ AY++AIR AQHF+YIENQ+FLGSSYAWPS  
Sbjct  539   GFPTKKKDVAEKQNLIVTKDAVVDRSIQTAYVQAIRSAQHFVYIENQHFLGSSYAWPSNN  598

Query  985   EAGADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMY  806
             +AGADNLIPMELALKI SKIR ++RFAVYIVIPMWPEG P SA +Q IL+WQ QT+QMMY
Sbjct  599   DAGADNLIPMELALKIASKIRAKQRFAVYIVIPMWPEGDPKSATIQQILFWQNQTMQMMY  658

Query  805   EIIAKELKSEKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIY  626
             +++A +LK   + D+HP DYLNFYCLG R    E+++  P+P   + ++ S KSGRFMI 
Sbjct  659   KVVASQLKQMALGDSHPQDYLNFYCLGKR----EDNSGQPSP--DDAVSESYKSGRFMIN  712

Query  625   VHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRM  446
             VHAKGMVVDDEYV++GSANINQRS+AG++DTEIAMGAYQPHHTWA+ + HP  QV GYRM
Sbjct  713   VHAKGMVVDDEYVLLGSANINQRSLAGTKDTEIAMGAYQPHHTWAQKKRHPFGQVLGYRM  772

Query  445   SLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNG  266
             SLW EH G ++E   EA  LECVK VN+IAE NWK Y  +    LQGHLL YP+QVD +G
Sbjct  773   SLWIEHFGGVEECFIEAGSLECVKRVNKIAENNWKSYKEQ--GSLQGHLLWYPIQVDRDG  830

Query  265   KVSPLGGCEYFPDVGGKVLGSR-TTLPDALTT  173
             +V PL G E FPDV GKV G+  TT+PD LTT
Sbjct  831   RVGPLPGSEEFPDVCGKVAGAHSTTIPDVLTT  862



>ref|XP_002304050.2| hypothetical protein POPTR_0003s01070g, partial [Populus trichocarpa]
 gb|EEE79029.2| hypothetical protein POPTR_0003s01070g, partial [Populus trichocarpa]
Length=748

 Score =  1010 bits (2612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 501/747 (67%), Positives = 591/747 (79%), Gaps = 15/747 (2%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRRHT---RI  2510
             S+  V+LHG+LD+ ILEA+ LPNMD+ SE +R+ FT      P    G+K   H+    I
Sbjct  10    SKESVFLHGELDIWILEAKSLPNMDLASENMRKCFTMCGSYSPLC--GHKPMTHSGKHSI  67

Query  2509  ITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFI  2330
             ITSDPYV VCLAGATVA+TRVI+N ++P+W EHF +PVAHPV +VEF VKDND  GA  I
Sbjct  68    ITSDPYVSVCLAGATVAQTRVIANCENPLWDEHFCVPVAHPVVKVEFHVKDNDFLGAQLI  127

Query  2329  GVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT---E  2159
             GV ++ A+KIISG TINDWFPII   G   KP   +   ++F P  +NP Y+ GV    E
Sbjct  128   GVVEIPAEKIISGNTINDWFPIICTSGTCLKPYPELHFSIQFKPVEDNPLYKDGVGDGPE  187

Query  2158  DYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHM  1979
               G+  +YFP+R GG+VTLYQDAHVP+  LP+I +DDGK F H +CWEDICHAILEAH++
Sbjct  188   YKGVPNTYFPLRKGGSVTLYQDAHVPDAVLPKITLDDGKVFQHSSCWEDICHAILEAHNL  247

Query  1978  VYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFI  1799
             +YIVGWS+YH+VKLVREPT+PLP GG L LGELLKYKS+EGVRV++L+WDDKTSH  F +
Sbjct  248   IYIVGWSVYHRVKLVREPTKPLPAGGELTLGELLKYKSEEGVRVVMLLWDDKTSHDTFCL  307

Query  1798  NTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQA  1619
              T GVM THDEET+KFFKHSSV CVLAPRY S+KLS  KQQVVGTL++HHQKCVI+DTQ+
Sbjct  308   KTDGVMQTHDEETKKFFKHSSVHCVLAPRYGSNKLSVFKQQVVGTLFSHHQKCVILDTQS  367

Query  1618  QGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDL  1439
              GNNRKIT+FIGGLDLCDGRYDTP+HRLF D  TVF  D++NP+FP    K PRQPWHDL
Sbjct  368   SGNNRKITSFIGGLDLCDGRYDTPEHRLFRDLHTVFENDFHNPSFP-SNTKSPRQPWHDL  426

Query  1438  HCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSV  1259
             HCKIEGPAAYDILTNFEQRW+KA+KW    RR KK++ WHDDAL+K+ERISWI +P+ S 
Sbjct  427   HCKIEGPAAYDILTNFEQRWKKATKW----RRIKKVTRWHDDALIKLERISWILTPSSS-  481

Query  1258  PNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQM  1079
             PN D  + V++EGDP+NWHVQVFRSIDSGS+KGFPK    A  QNLVC K+L +D+SI  
Sbjct  482   PNGDKIVHVTDEGDPENWHVQVFRSIDSGSVKGFPKSTQEAVDQNLVCGKNLKVDKSIHT  541

Query  1078  AYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVY  899
             AY++AIR AQHFIYIENQYFLGSSY WPSYK AGADNL+PMELALKI SKIR  ERF+VY
Sbjct  542   AYVKAIRSAQHFIYIENQYFLGSSYYWPSYKNAGADNLVPMELALKIASKIRANERFSVY  601

Query  898   IVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIE-DAHPCDYLNFYCLGN  722
             IVIPMWPEGVP+SA VQ+ILYWQGQT+ MMY+IIAKEL+   +    HP  YLNFYCLG 
Sbjct  602   IVIPMWPEGVPTSASVQEILYWQGQTMAMMYKIIAKELEKAGLSYQYHPQYYLNFYCLGK  661

Query  721   REEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGS  542
             RE    +S+       +  L  +QK  RFMIYVHAKGMVVDDEYVI+GSANINQRS+ GS
Sbjct  662   RENSPHDSSEINQQTENRSLAAAQKFRRFMIYVHAKGMVVDDEYVIMGSANINQRSLDGS  721

Query  541   RDTEIAMGAYQPHHTWAKNQNHPHAQV  461
             RDTEIAMGAYQP +TWA+  +HPH QV
Sbjct  722   RDTEIAMGAYQPTYTWARKNSHPHGQV  748



>gb|AER41636.1| phospholipase+D [Oryza officinalis]
Length=790

 Score =  1006 bits (2600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/840 (58%), Positives = 609/840 (73%), Gaps = 61/840 (7%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRRHTRIITS  2501
             S   + LHGDLD++I+EA+ LPNMD+++ER+R+ FT +     E  + +      +IITS
Sbjct  8     SGTSMLLHGDLDIQIMEAKCLPNMDLMTERMRKCFTGYGACSTECGKSDPHPDVRKIITS  67

Query  2500  DPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVA  2321
             DPYV VCL+GATVA+TRVI+NS++P W EHF + VAH VS VEF VKDNDVFGA+ IGVA
Sbjct  68    DPYVSVCLSGATVAQTRVIANSENPKWDEHFYVQVAHSVSRVEFHVKDNDVFGAELIGVA  127

Query  2320  KVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED----Y  2153
              V  + II G+T++ WFPI G +  P K    + L +++ P  +NP Y+ GV  D     
Sbjct  128   SVPVEDIIPGDTVSGWFPISGQYSNPMKASPELHLSIQYKPIEQNPLYKDGVGSDSCQSI  187

Query  2152  GLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVY  1973
             G+  +YFP+R GG VTLYQDAHVP+   P+I+ID G+ +    CWEDICHA+ EAHH++Y
Sbjct  188   GVPNAYFPLRKGGMVTLYQDAHVPDDFCPKIEIDGGRVYEQNKCWEDICHAMAEAHHLIY  247

Query  1972  IVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINT  1793
             I+GWS+YH VKL                                                
Sbjct  248   IIGWSLYHPVKL------------------------------------------------  259

Query  1792  SGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQG  1613
              G+M THDEE RKFF+HS V CVLAPRYAS+KLS  KQQVVGTL+THHQKCVIVDTQA G
Sbjct  260   DGLMHTHDEEARKFFRHSGVHCVLAPRYASNKLSIFKQQVVGTLFTHHQKCVIVDTQATG  319

Query  1612  NNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHC  1433
             NNRKITAFIGGLDLCDGRYDTP+HRLF D DT+F+ D++NPTF +    GPRQPWHDLHC
Sbjct  320   NNRKITAFIGGLDLCDGRYDTPEHRLFKDLDTIFKDDFHNPTF-QVNKSGPRQPWHDLHC  378

Query  1432  KIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPN  1253
             KIEGPAAYDILTNFEQRWRK++KW    RR      WH D L+K+ R+SWI SP+     
Sbjct  379   KIEGPAAYDILTNFEQRWRKSAKWKVSVRR---AVSWHHDTLVKLNRMSWIVSPSA----  431

Query  1252  DDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAY  1073
             D+ +  V ++ DP+NWHVQ+FRSIDSGS+KGFPK V  AE+QNLVCAK+L ID+SI  AY
Sbjct  432   DELNAHVCDQDDPENWHVQIFRSIDSGSVKGFPKLVQEAESQNLVCAKNLQIDKSIHNAY  491

Query  1072  IEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIV  893
             ++AIR AQH+IYIENQYF+GSSY W S + AGA+NLIP+ELA+KI  KI+ RERFA YIV
Sbjct  492   VKAIRSAQHYIYIENQYFIGSSYYWSSNRSAGAENLIPIELAIKIARKIKARERFAAYIV  551

Query  892   IPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREE  713
             IPMWPEG P++A +Q+IL+WQGQT+ MMY+I+A  L+ E ++D HP DYLNFYCLG RE 
Sbjct  552   IPMWPEGNPTTAAMQEILFWQGQTMSMMYKIVADALRKEGLDDTHPQDYLNFYCLGKREV  611

Query  712   WHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDT  533
              ++ S +S +   S  L   QK  RFMIYVH+KGM+VDDEYV++GSANINQRSM GSRDT
Sbjct  612   SNDVSTTSHSNENSP-LRLVQKFKRFMIYVHSKGMIVDDEYVLIGSANINQRSMDGSRDT  670

Query  532   EIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAE  353
             EIAMGAYQPH++WA  +  P  QVYGYRMSLWAEHLG ++E       +ECV+ VNE+AE
Sbjct  671   EIAMGAYQPHYSWAGGKKAPRGQVYGYRMSLWAEHLGTVEECFRWPHSMECVRQVNEMAE  730

Query  352   ENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALTT  173
             ENW RY + +   ++GHL++YP+ VD +G+V P+ G E FPDVGGKVLG+ ++LP+ALTT
Sbjct  731   ENWARYLSPEMVNMRGHLMRYPINVDRDGRVGPVRGYECFPDVGGKVLGTHSSLPNALTT  790



>gb|AER41632.1| phospholipase+D [Oryza nivara]
 gb|AER41658.1| phospholipase+D [Oryza rufipogon]
Length=790

 Score =  1000 bits (2586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/841 (58%), Positives = 608/841 (72%), Gaps = 63/841 (7%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRRHTRIITS  2501
             S   + LHGDLD++I+EA+ LPNMD+++ER+R+ FT +     E  + +      +IITS
Sbjct  8     SGTSMLLHGDLDIQIVEAKCLPNMDLMTERMRKCFTGYGACSTECGKSDPHTDVRKIITS  67

Query  2500  DPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVA  2321
             DPYV VCL+GATVA+TRVI+NS++P W EHF + VAH VS VEF VKDNDVFGA+ IGVA
Sbjct  68    DPYVSVCLSGATVAQTRVIANSENPKWDEHFYVQVAHSVSRVEFHVKDNDVFGAELIGVA  127

Query  2320  KVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED----Y  2153
              V  + I  G+T++ WFPI G +  P K    + L +++ P  +NP Y+ GV  D     
Sbjct  128   SVPVENITPGDTVSGWFPISGQYSNPMKASPELHLSIQYKPIEQNPLYKDGVGSDGCQSI  187

Query  2152  GLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVY  1973
             G+  +YFP+R GG VTLYQDAH+P+   P+I+ID G+ +    CWEDICHAI EAHH++Y
Sbjct  188   GVPNAYFPLRKGGMVTLYQDAHIPDDFCPKIEIDGGRVYEQNKCWEDICHAIAEAHHLIY  247

Query  1972  IVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINT  1793
             I+GWS+YH VKL                                                
Sbjct  248   IIGWSLYHPVKL------------------------------------------------  259

Query  1792  SGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQG  1613
              G+M THDEE RKFF+HS V CVLAPRYAS+KLS  KQQVVGTL+THHQKCVIVDTQ  G
Sbjct  260   DGLMHTHDEEARKFFRHSGVHCVLAPRYASNKLSIFKQQVVGTLFTHHQKCVIVDTQVIG  319

Query  1612  NNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHC  1433
             NNRKITAFIGGLDLCDGRYDTP+HRLF D DTVF+ D++NPTF +    GPRQPWHDLHC
Sbjct  320   NNRKITAFIGGLDLCDGRYDTPEHRLFKDLDTVFKDDFHNPTF-QVNKSGPRQPWHDLHC  378

Query  1432  KIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPN  1253
             KIEGPAAYDILTNFEQRWRK++KW    RR      WH D L+KI R+SWI SP+     
Sbjct  379   KIEGPAAYDILTNFEQRWRKSAKWKVSVRR---AVSWHHDTLVKINRMSWIVSPSA----  431

Query  1252  DDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAY  1073
             D+ +  V  + DP+NWHVQ+FRSIDSGS+KGFPK V  AE+QNLVCAK+L ID+SI  AY
Sbjct  432   DELNARVCEQDDPENWHVQIFRSIDSGSVKGFPKLVQEAESQNLVCAKNLQIDKSIHNAY  491

Query  1072  IEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIV  893
             ++AIR AQH+IYIENQYF+GSSY W S + AGA+NLIP+ELA+KI  KI+ RERFA YIV
Sbjct  492   VKAIRCAQHYIYIENQYFIGSSYYWSSNRSAGAENLIPIELAIKIARKIKARERFAAYIV  551

Query  892   IPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREE  713
             IPMWPEG P++A +Q+IL+WQGQT+ MMY+I+A+ L+ E ++D HP DYLNFYCLG RE 
Sbjct  552   IPMWPEGNPTTAAMQEILFWQGQTMSMMYKIVAEALQKEGLDDTHPQDYLNFYCLGKREV  611

Query  712   WHEESASSPTPGCS-EFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRD  536
              ++ S +S +   S + L   QK  RFMIYVH+KGM+VDDEYV++GSANINQRSM GSRD
Sbjct  612   SNDVSTTSQSNENSPQRLV--QKFKRFMIYVHSKGMIVDDEYVLIGSANINQRSMDGSRD  669

Query  535   TEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIA  356
             TEIAMGAYQPH++WA  +  P  QVYGYRMSLWAEHLG ++E       +ECV+ VNE+A
Sbjct  670   TEIAMGAYQPHYSWAGRKKAPRGQVYGYRMSLWAEHLGTVEECFRWPHSVECVRQVNEMA  729

Query  355   EENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALT  176
             EENW RY + +   ++GHL++YP+ V+ +G+V P+ G E FPDVGGKVLG+ ++LP+ALT
Sbjct  730   EENWARYVSPEMVNMRGHLMRYPINVERDGRVGPVHGYECFPDVGGKVLGAHSSLPNALT  789

Query  175   T  173
             T
Sbjct  790   T  790



>gb|AER41602.1| phospholipase+D [Oryza glaberrima]
Length=790

 Score =  1000 bits (2586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/841 (58%), Positives = 607/841 (72%), Gaps = 63/841 (7%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRRHTRIITS  2501
             S   + LHGDLD++I+EA+ LPNMD+++ER+R+ FT +     E  + +      +IITS
Sbjct  8     SGTSMLLHGDLDIQIVEAKCLPNMDLMTERMRKCFTGYGACSTECGKSDPHTDVRKIITS  67

Query  2500  DPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVA  2321
             DPYV VCL+GATVA+TRVI+NS++P W EHF + VAH VS VEF VKDNDVFGA+ IGVA
Sbjct  68    DPYVSVCLSGATVAQTRVIANSENPKWDEHFYVQVAHSVSRVEFHVKDNDVFGAELIGVA  127

Query  2320  KVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED----Y  2153
              V  + I  G+T++ WFPI G +  P K    + L +++ P  +NP Y+ GV  D     
Sbjct  128   SVPVENITPGDTVSGWFPISGQYSNPMKASPELHLSIQYKPIEQNPLYKDGVGSDGCQSI  187

Query  2152  GLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVY  1973
             G+  +YFP+R GG VTLYQDAH+P+   P+I+ID G+ +    CWEDICHAI EAHH++Y
Sbjct  188   GVPNAYFPLRKGGMVTLYQDAHIPDDFCPKIEIDGGRVYEQNKCWEDICHAIAEAHHLIY  247

Query  1972  IVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINT  1793
             I+GWS+YH VKL                                                
Sbjct  248   IIGWSLYHPVKL------------------------------------------------  259

Query  1792  SGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQG  1613
              G+M THDEE RKFF+HS V CVLAPRYAS+KLS  KQQVVGTL+THHQKCVIVDTQ  G
Sbjct  260   DGLMHTHDEEARKFFRHSGVHCVLAPRYASNKLSIFKQQVVGTLFTHHQKCVIVDTQVIG  319

Query  1612  NNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHC  1433
             NNRKITAFIGGLDLCDGRYDTP+HRLF D DTVF+ D++NPTF +    GPRQPWHDLHC
Sbjct  320   NNRKITAFIGGLDLCDGRYDTPEHRLFKDLDTVFKDDFHNPTF-QVNKSGPRQPWHDLHC  378

Query  1432  KIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPN  1253
             KIEGPAAYDILTNFEQRWRK++KW    RR      WH D L+KI R+SWI SP+     
Sbjct  379   KIEGPAAYDILTNFEQRWRKSAKWKVSVRR---AVSWHHDTLVKINRMSWIVSPSA----  431

Query  1252  DDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAY  1073
             D+ +  V  + DP+NWHVQ+FRSIDSGS+KGFPK V  AE+QNLVCAK+L ID+SI  AY
Sbjct  432   DELNARVCEQDDPENWHVQIFRSIDSGSVKGFPKLVQEAESQNLVCAKNLQIDKSIHNAY  491

Query  1072  IEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIV  893
             ++AIR AQH+IYIENQYF+GSSY W S + AGA+NLIP+ELA+KI  KI+ RERFA YIV
Sbjct  492   VKAIRSAQHYIYIENQYFIGSSYYWSSNRSAGAENLIPIELAIKIARKIKARERFAAYIV  551

Query  892   IPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREE  713
             IPMWPEG P++A +Q+IL+WQGQT+ MMY+I+A+ L+ E + D HP DYLNFYCLG RE 
Sbjct  552   IPMWPEGNPTTAAMQEILFWQGQTMSMMYKIVAEALQKEGLHDTHPQDYLNFYCLGKREV  611

Query  712   WHEESASSPTPGCS-EFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRD  536
              ++ S +S +   S + L   QK  RFMIYVH+KGM+VDDEYV++GSANINQRSM GSRD
Sbjct  612   SNDVSTTSQSNENSPQRLV--QKFKRFMIYVHSKGMIVDDEYVLIGSANINQRSMDGSRD  669

Query  535   TEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIA  356
             TEIAMGAYQPH++WA  +  P  QVYGYRMSLWAEHLG ++E       +ECV+ VNE+A
Sbjct  670   TEIAMGAYQPHYSWAGRKKAPRGQVYGYRMSLWAEHLGTVEECFRWPHSVECVRQVNEMA  729

Query  355   EENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALT  176
             EENW RY + +   ++GHL++YP+ V+ +G+V P+ G E FPDVGGKVLG+ ++LP+ALT
Sbjct  730   EENWARYVSPEMVNMRGHLMRYPINVERDGRVGPVHGYECFPDVGGKVLGTHSSLPNALT  789

Query  175   T  173
             T
Sbjct  790   T  790



>gb|EYU24262.1| hypothetical protein MIMGU_mgv1a021891mg [Erythranthe guttata]
Length=771

 Score =   996 bits (2576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/838 (59%), Positives = 611/838 (73%), Gaps = 71/838 (8%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRRHTRIITS  2501
             +   VYLHGDLDL I+E RR+ +M+ VSE +R+F                          
Sbjct  3     NNETVYLHGDLDLVIIEVRRIASMEFVSEHVRRFL------------------------K  38

Query  2500  DPYVKVCLAGATVARTRVIS--NSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIG  2327
              PY+KV L  A VART  +   +SQ+PVW EHF+IP+AHPV               D I 
Sbjct  39    HPYIKVYLGEARVARTARVRAHDSQNPVWNEHFEIPLAHPV---------------DQIL  83

Query  2326  VAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTEDYGL  2147
              A VSA+KI+ GE I++WFP++G  G       AIRL + FTPC  NP Y  G+ E+Y +
Sbjct  84    NAFVSAKKIVMGELIDEWFPVVGTDGT----HTAIRLQITFTPCNINPIYANGIAENYAV  139

Query  2146  KESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYIV  1967
               SYFP+RHGG +TLYQDAHV +G LP+IK+ DGK F H  CWEDICHAILEA ++VYI 
Sbjct  140   MCSYFPLRHGGKLTLYQDAHVIDGRLPDIKLGDGKNFEHHKCWEDICHAILEAQNLVYIA  199

Query  1966  GWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTSG  1787
             GWSIYHK+ LVREP++PLPNGG+LNLGELLKYKSQ+GVRV+LL+WDDKTS  K      G
Sbjct  200   GWSIYHKIMLVREPSKPLPNGGDLNLGELLKYKSQQGVRVVLLIWDDKTSQDKCLFKIGG  259

Query  1786  VMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQGNN  1607
             +M THD+ETRKFFKHS VTCV                    +Y+ HQKCVIVD +   NN
Sbjct  260   MMQTHDKETRKFFKHSGVTCVCR-----------------IIYSQHQKCVIVDAKGHENN  302

Query  1606  RKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCKI  1427
             RKI AF+GGLDLCDGRYDTP HRL++D DT+F+ DY+NPTF +G  KGPRQPWHDLHC+I
Sbjct  303   RKIIAFLGGLDLCDGRYDTPDHRLYNDIDTIFKNDYHNPTFCQGK-KGPRQPWHDLHCRI  361

Query  1426  EGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPNDD  1247
             EGPAAYD+L NFEQRW+KA++ +E  R  K I  WHD  L+ IE IS I SP+ ++PND 
Sbjct  362   EGPAAYDVLKNFEQRWKKATECSEFTRICKLILGWHDYILVDIEHISQIASPSGTIPNDH  421

Query  1246  PSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIE  1067
             PSLW   E DP+NWH+Q+FRS+DS S++GFP +V  A+ QNLV  K   IDRSIQMAYI+
Sbjct  422   PSLWAFKENDPENWHIQIFRSVDSESVEGFPTNVFAAKEQNLVFEKKWAIDRSIQMAYIQ  481

Query  1066  AIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIP  887
             AIR AQ FI++ENQYF+GSS+AWP  K+ GA+NLIPMELALKI SKIR  ERF VY++IP
Sbjct  482   AIRSAQRFIFVENQYFIGSSFAWPCNKKTGANNLIPMELALKIASKIRANERFGVYVIIP  541

Query  886   MWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREEWH  707
             MWPEG PSS+ VQ ILYWQ QT+QMMY+IIA+ELKS  +E+AH  DYLNFYCLG R++ H
Sbjct  542   MWPEGEPSSSSVQQILYWQRQTMQMMYKIIAEELKSSNVENAHATDYLNFYCLGKRDDGH  601

Query  706   EESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEI  527
              + +S+         + S+   RFMIYVH+KGM+VDDEY+I+GSANINQRSMAG RD EI
Sbjct  602   TQESSND--------SASEAFRRFMIYVHSKGMIVDDEYIIIGSANINQRSMAGHRDVEI  653

Query  526   AMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEEN  347
             AMGAYQPH+TW K + HP  QVYGYRMSLWAEHLG ++    + + LECVK +N +AE+N
Sbjct  654   AMGAYQPHYTWIKKKEHPLGQVYGYRMSLWAEHLGCIENCFKDPQNLECVKYINNVAEDN  713

Query  346   WKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALTT  173
             WK+YTAE++SPLQGH+LKYP++++++GK++PL G   FPDVGG+VLGS T LPD +TT
Sbjct  714   WKKYTAEEYSPLQGHILKYPVKIEADGKINPLPGHNLFPDVGGRVLGSMTILPDVITT  771



>gb|EYU41069.1| hypothetical protein MIMGU_mgv1a026439mg [Erythranthe guttata]
Length=787

 Score =   994 bits (2569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 498/838 (59%), Positives = 625/838 (75%), Gaps = 56/838 (7%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRRHTRIITS  2501
             +E ++YLHGD+D+KI+EAR +P M+ +SE                        H      
Sbjct  4     NEEMIYLHGDIDIKIIEARCMPCMEFISE------------------------HVCHCLQ  39

Query  2500  DPYVKVCLAGATVART-RVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGV  2324
             +PYVKV +  A VA T RV + SQ+PVW EHF++P+AHPV +V F ++D ++        
Sbjct  40    NPYVKVYMGEARVACTARVRARSQNPVWNEHFQLPLAHPVDQVRFALRDTEICETKL--N  97

Query  2323  AKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTEDYGLK  2144
             A V A+KI++GE I++WF ++G  G    P  AI+L +KFTPC  NP Y  G++E++ ++
Sbjct  98    AFVPAKKIVTGELIDEWFLVVGTDG----PHTAIKLQIKFTPCEINPIYSSGISENFAVE  153

Query  2143  ESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYIVG  1964
              SYFPMRHGG +TLYQDAHV +G LPEIK++DG+ F HE CWEDICH+I EA H+VYIVG
Sbjct  154   RSYFPMRHGGKLTLYQDAHVIDGMLPEIKLEDGRNFEHEKCWEDICHSISEALHLVYIVG  213

Query  1963  WSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTSGV  1784
             WS+YHKVKLVREP++ LPNGG+LNLGELLKYK+Q+GVRV LLVW+D+TS    FI T G 
Sbjct  214   WSVYHKVKLVREPSKQLPNGGDLNLGELLKYKAQQGVRVALLVWNDRTSCDNCFIKTKGK  273

Query  1783  MGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQGNNR  1604
             M THD+ETR FFKHSSVTCV                     Y+ HQKCVIVDT+   NNR
Sbjct  274   MKTHDKETRNFFKHSSVTCVGR-----------------MFYSQHQKCVIVDTKGHENNR  316

Query  1603  KITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCKIE  1424
             KIT FIGGLDLCDGRYDTP HRL+ D + VF+ DY+NPT  EG  KGPRQPWHDLHCKIE
Sbjct  317   KITTFIGGLDLCDGRYDTPDHRLY-DNNNVFKDDYHNPTLHEGE-KGPRQPWHDLHCKIE  374

Query  1423  GPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPNDDP  1244
             GPAAYD+L NFEQRW+KA+K +E  +  K++  W+D  L+ I   S I SP+ +VPNDD 
Sbjct  375   GPAAYDVLKNFEQRWKKATKNSEFSQFCKRLLGWNDFTLVDINHNSRIASPSTTVPNDDH  434

Query  1243  SLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEA  1064
             SL VSNE D +NWHVQ+FRS+DS S++GFPK    A+ QNLV  + LVID SIQMAYI+A
Sbjct  435   SLRVSNEDDHENWHVQIFRSVDSASVEGFPKTDIEAKEQNLVYEQKLVIDMSIQMAYIQA  494

Query  1063  IRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPM  884
             IR A+HFI+IENQYFLGSS+AWP+YK+AGA NLIPMELALKI SKIR+ ERF VY+VIPM
Sbjct  495   IRSARHFIFIENQYFLGSSFAWPTYKKAGAHNLIPMELALKIASKIRSNERFTVYVVIPM  554

Query  883   WPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREEWHE  704
             WPEG P S PVQ+IL WQG+T++MMY IIA+ELKS ++++AHP DYLNFYCLGNR+E H+
Sbjct  555   WPEGDPKSGPVQEILCWQGETMKMMYRIIAQELKSVQLDNAHPTDYLNFYCLGNRQERHK  614

Query  703   ESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIA  524
             + +S       +  + S++ GRFMIYVH+KGM+VDDEYVI+GSANIN+RSMAG RDTEIA
Sbjct  615   DESSR-----QDMDSASEEHGRFMIYVHSKGMIVDDEYVIIGSANINERSMAGYRDTEIA  669

Query  523   MGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENW  344
              GAYQP++TW     HP  QVYGYRMS+WAEH+G ++  + E + LECVK +N +AE+NW
Sbjct  670   TGAYQPYYTWTNKNEHPCGQVYGYRMSIWAEHIGRIESCIKEPKNLECVKYINRVAEDNW  729

Query  343   KRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRT-TLPDALTT  173
             K+YTAE++SPLQGH+LKYP+++D+ G V PL G E+FPDVGGKVLG+    LP  L+T
Sbjct  730   KKYTAEQYSPLQGHILKYPVEIDAYGNVKPLPGHEFFPDVGGKVLGNPCMMLPKNLST  787



>gb|KCW56569.1| hypothetical protein EUGRSUZ_I02300 [Eucalyptus grandis]
Length=831

 Score =   992 bits (2564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 505/851 (59%), Positives = 623/851 (73%), Gaps = 58/851 (7%)
 Frame = -2

Query  2611  MDIVSERIRQFFTAFDCRKP------------ETRQGNKVRRHTRIITSDPYVKVCLAGA  2468
             MD+VS R+R+  +A  C +P              R  +  R H ++ITSDPYV V +  A
Sbjct  1     MDMVSGRLRRCLSA--CARPSRSSDPAPASPLRDRCDHDARCHGKVITSDPYVTVRVPHA  58

Query  2467  TVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVAKVSAQKIISGE  2288
             T+ARTR++ N Q+P W + F+IP+AH   ++EF+VKD+++F A  IG   +SA++I SGE
Sbjct  59    TIARTRILHNMQNPWWDQRFRIPLAHRAVDLEFRVKDSNLFCAQLIGTVNISAREIKSGE  118

Query  2287  TINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTED---YGLKESYFPMRHG  2117
              I+  FP+    G   KP+  ++L +KFTP  +NP Y+ G+  D    G++ +YFP+R G
Sbjct  119   DISGSFPL---RGPSAKPNSRLQLKLKFTPVEDNPVYKNGIAGDPNHLGVRHTYFPLRKG  175

Query  2116  GAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYIVGWSIYHKVKL  1937
               V LYQDAHV + SLPEI+++  +    E CWEDI HAI EAHH++YIVGWS+ + +KL
Sbjct  176   CGVRLYQDAHVIDKSLPEIEMN-CECDRREKCWEDIGHAISEAHHLIYIVGWSVSYNIKL  234

Query  1936  VRE--PTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTSGVMGTHDEE  1763
             +RE   TR +P GG+L LGELLKYKSQEGV VLLL+WDDKTS  K F+N  GVM T DEE
Sbjct  235   IRERTQTRRMPQGGDLTLGELLKYKSQEGVHVLLLIWDDKTSRDKHFVNKEGVMQTRDEE  294

Query  1762  TRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQGNNRKITAFIG  1583
             TR FFK+SSV CVL PR AS KL ++KQQVVG+++THHQKCV+VDTQA GN+RKITAFIG
Sbjct  295   TRDFFKNSSVNCVLVPRNASGKLGYIKQQVVGSMFTHHQKCVLVDTQALGNHRKITAFIG  354

Query  1582  GLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCKIEGPAAYDI  1403
             G+DLCDGRYDTP+HRLF D DTVF+ D +NPTFP  G+K PRQPWHDLHC+IEGPAAYD+
Sbjct  355   GIDLCDGRYDTPEHRLFHDLDTVFKDDIHNPTFP-AGMKAPRQPWHDLHCRIEGPAAYDV  413

Query  1402  LTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPS-------------  1262
             L NFEQRWRKA++W   G++ +     HDD+L KI RISWI SPT +             
Sbjct  414   LMNFEQRWRKATRWFSKGKKNQ-----HDDSLFKIGRISWILSPTSTESHDSTSLSKDDH  468

Query  1261  ------VPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFP-KDVHTAETQNLVCAKDL  1103
                   VP D+P L+VSNE D  NWHVQ+FRSIDSGS+KGFP K    AE QNL+  KD 
Sbjct  469   HDRITVVPEDNPDLYVSNENDHNNWHVQIFRSIDSGSVKGFPTKKKDVAEKQNLIVTKDA  528

Query  1102  VIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIR  923
             V+DRSIQ AY++AIR AQHF+YIENQ+FLGSSYAWPS  +AGADNLIPMELALKI SKI+
Sbjct  529   VVDRSIQTAYVQAIRSAQHFVYIENQHFLGSSYAWPSNNDAGADNLIPMELALKIASKIK  588

Query  922   NRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYL  743
               ERFAVYIVIPMWPEG P SA VQ+IL+WQ QT+QMMYE++A++LK   + D+HP DYL
Sbjct  589   ANERFAVYIVIPMWPEGDPKSATVQEILFWQNQTMQMMYEVVARQLKQMALGDSHPQDYL  648

Query  742   NFYCLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANIN  563
             NFYCLG RE+      +S  P   + ++ S KS RFMIYVHAKGMVVDDEYV++GSANIN
Sbjct  649   NFYCLGKRED------NSGQPSLDDAVSESYKSQRFMIYVHAKGMVVDDEYVLLGSANIN  702

Query  562   QRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLE  383
             QRS+ G+RDTEIAMGAYQPHHT AK + H   QVYGYRMSLWAEHL ++++  +E   L 
Sbjct  703   QRSLTGTRDTEIAMGAYQPHHTCAKKEGHQRGQVYGYRMSLWAEHLRVVEKCFNEPGSLA  762

Query  382   CVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGS  203
             CVK VNEIA  NW  Y  +    LQGHLL+YP+QVD +G V PL G E FPDV GKV+G+
Sbjct  763   CVKRVNEIAGNNWNSYKNQ--GELQGHLLRYPIQVDKDGNVGPLPGSEEFPDVCGKVVGA  820

Query  202   RTT-LPDALTT  173
              TT +PD LTT
Sbjct  821   HTTAIPDVLTT  831



>gb|KCW56570.1| hypothetical protein EUGRSUZ_I02302, partial [Eucalyptus grandis]
Length=906

 Score =   972 bits (2513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/912 (56%), Positives = 628/912 (69%), Gaps = 111/912 (12%)
 Frame = -2

Query  2665  YLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQG------------NKVRR  2522
             YLHGDLDL I+ A  LP MD+VS R+R+  +A  C +P                 +  R 
Sbjct  11    YLHGDLDLHIISASNLPTMDMVSGRLRRCLSA--CARPSRSSDLAPASPLRDPCVHDARC  68

Query  2521  HTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFG  2342
             H ++ITSDPYV V +  AT+ARTR++ N Q+P W + F+IP+AH   ++EF+VKD+++F 
Sbjct  69    HKKVITSDPYVTVRVPHATIARTRILHNMQNPWWDQRFRIPLAHFAVDLEFRVKDSNLFC  128

Query  2341  ADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT  2162
             A  IG   +SA++I SGE I+  FP+    G   KP+  ++L +KFT    N  Y+  + 
Sbjct  129   AQLIGTVNISAREIKSGEDISGSFPL---RGPSAKPNSRLQLKLKFTSVENNAVYQHSIA  185

Query  2161  ED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLP--EIKIDDGKAFHHENCWEDICHAI  1997
              D    G++ +YFP+R G +V LYQDAHV +G  P  E++ D G  + HE CWEDICHAI
Sbjct  186   GDPDHLGVRHTYFPLRKGCSVRLYQDAHVVDGMSPGIELESDAGGVYRHEKCWEDICHAI  245

Query  1996  LEAHHMVYIVGWSIYHKVKLVRE--PTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDK  1823
              EAHH++YIVGWS+ + +KL+RE   TR +P GG+L LGELLKYKS+EGVRVLLL+WDDK
Sbjct  246   SEAHHLIYIVGWSVSYNIKLIRERTQTRRMPLGGDLTLGELLKYKSREGVRVLLLIWDDK  305

Query  1822  TSHSKFFINT-----------------------------------SGVMGTHDEETRKFF  1748
             TS  K FIN                                     GVM T DEETR FF
Sbjct  306   TSRDKHFINKYIEVACGIGDYYVVVGPVVQSMIMVSVFATRSTCLEGVMQTRDEETRDFF  365

Query  1747  KHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLC  1568
             K+SSV CVL PR A  KL ++KQQVVG+++THHQKC++VDTQA GN+RKITAFIGG+DLC
Sbjct  366   KNSSVNCVLVPRNARGKLGYIKQQVVGSMFTHHQKCILVDTQALGNHRKITAFIGGIDLC  425

Query  1567  DGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFE  1388
             DGRYDTP+HRLF D DTVF+ D++NPTFP  G+K PRQPWHDLHC+IEGPAAYD+L NFE
Sbjct  426   DGRYDTPEHRLFRDLDTVFKDDFHNPTFP-AGMKAPRQPWHDLHCRIEGPAAYDVLMNFE  484

Query  1387  QRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPS------------------  1262
             QRWRKA++W   G++ +     HDD+LLKI RISWI SPT +                  
Sbjct  485   QRWRKATRWFSKGKKNR-----HDDSLLKIGRISWILSPTSTESHDSTSLTKDDHHDRIT  539

Query  1261  -VPNDDPSLWVSNEGDPQNWHVQV-------------FRSIDSGSLKGFP---KDVHTAE  1133
              VP D+P L+VS E D  NWHVQV             FRSIDSGS+KGFP   KDV   +
Sbjct  540   VVPEDNPDLYVSKEDDHNNWHVQVGNASSLSLSRVQIFRSIDSGSVKGFPTKKKDVAEKQ  599

Query  1132  --TQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIP  959
                QNL+  KD V+DRSIQ AY++AIR AQHF+YIENQ+FLGSSYAWPS  +AGADNLIP
Sbjct  600   FLVQNLIVTKDAVVDRSIQTAYVQAIRSAQHFVYIENQHFLGSSYAWPSNNDAGADNLIP  659

Query  958   MELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKS  779
             MELALKI SKIR ++RFAVYIVIPMWPEG P SA +Q IL+WQ QT+QMMY+++A +LK 
Sbjct  660   MELALKIASKIRAKQRFAVYIVIPMWPEGDPKSATIQQILFWQNQTMQMMYKVVASQLKQ  719

Query  778   EKIEDAHPCDYLNFYCLGNREEWHEESASSPTPGCSEFL---TGSQKSGRFMIYVHAKGM  608
               + D+HP DYLNFYCLG R    E+++  P+P  +  L   + S KSGRFMI VHAKGM
Sbjct  720   MALGDSHPQDYLNFYCLGKR----EDNSGQPSPDDAVMLLTVSESYKSGRFMINVHAKGM  775

Query  607   VVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEH  428
             VVDDEYV++GSANINQRS+AG++DTEIAMGAYQPHHTWA+ + HP  QV GYRMSLW EH
Sbjct  776   VVDDEYVLLGSANINQRSLAGTKDTEIAMGAYQPHHTWAQKKRHPFGQVLGYRMSLWIEH  835

Query  427   LGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLG  248
              G ++E   EA  LECVK VN+IAE NWK Y  +    LQGHLL YP+QVD +G+V PL 
Sbjct  836   FGGVEECFIEAGSLECVKRVNKIAENNWKSYKEQ--GSLQGHLLWYPIQVDRDGRVGPLP  893

Query  247   GCEYFPDVGGKV  212
             G E FPDV GKV
Sbjct  894   GSEEFPDVCGKV  905



>ref|XP_001759244.1| predicted protein [Physcomitrella patens]
 gb|EDQ75928.1| predicted protein [Physcomitrella patens]
Length=844

 Score =   970 bits (2508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/849 (58%), Positives = 611/849 (72%), Gaps = 34/849 (4%)
 Frame = -2

Query  2662  LHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQGNKVRR-----HTRIITS  2501
             LHG L+++I  A  LPNMD+ SE+ RQ F+    C+ P  +  +K+         + ITS
Sbjct  11    LHGTLEVEIRSAENLPNMDMFSEKFRQCFSYLTICKAPFVKTKSKINEKGHGHRPKGITS  70

Query  2500  DPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVA  2321
             DPY  V LAGA VARTRVISNS +P W EHF IPVAH VSEVE  VKDNDV GA  IG  
Sbjct  71    DPYAAVNLAGARVARTRVISNSTNPQWNEHFSIPVAHYVSEVEITVKDNDVLGAQLIGDV  130

Query  2320  KVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYR---GGVTEDYG  2150
             K+    I+ G+ +  W  +I   GK    +  I   MKFTP   NP Y    GG  + + 
Sbjct  131   KIPVGDIMDGKVVEGWHDVIAPSGKIAHGNARIYFTMKFTPVEMNPIYMAAVGGPEKLHA  190

Query  2149  LKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYI  1970
             +  +YFP R G  +T+YQDAH+ +GSLP+I + DG  + H   WE++C AIL+AHH++YI
Sbjct  191   VPNTYFPCRKGCEITMYQDAHIMDGSLPQITLADGVPYQHRQAWEEMCTAILDAHHLIYI  250

Query  1969  VGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTS  1790
              GWSIY K+KL+R+ TR LP+GG+  LG+LLK KS EGVRVL+LVWDDKTSH   FI T 
Sbjct  251   AGWSIYTKIKLLRDTTRDLPDGGDYCLGDLLKRKSAEGVRVLMLVWDDKTSHQNPFIKTV  310

Query  1789  GVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQGN  1610
             GVMG HDEET+ FF++S+V CVL+PRYA SKLS+ +QQVVGTLYTHHQK VIVD+Q  GN
Sbjct  311   GVMGVHDEETKSFFRNSAVRCVLSPRYADSKLSWFRQQVVGTLYTHHQKTVIVDSQGPGN  370

Query  1609  NRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTF---PEGGLKGPRQPWHDL  1439
              RK+T+F+GGLDLCDGR+DTP H LF+   T  + D++NPTF    EGG  GPRQPWHD 
Sbjct  371   KRKLTSFLGGLDLCDGRWDTPTHSLFNTLSTFHKDDFHNPTFAVGAEGG--GPRQPWHDW  428

Query  1438  HCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSV  1259
             HCKI+GPAAYD+LTNFEQRWRKA++             WH+D L++IERISWI  P P  
Sbjct  429   HCKIDGPAAYDVLTNFEQRWRKAAR-------------WHEDELIQIERISWILGPKPPF  475

Query  1258  PND-DPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQ  1082
             P + DP L+V+ + DP  W  QVFRSIDSGS+KGFP++V  AE Q+L   K + ID SIQ
Sbjct  476   PAEGDPKLYVTKDDDPSTWRCQVFRSIDSGSVKGFPRNVEQAEKQHLSWGKSIAIDISIQ  535

Query  1081  MAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAV  902
             MAYI+AIR AQHFI+IENQYF+GSSY WP YK+AGA++LIPMELALK+ SKIR  +RFAV
Sbjct  536   MAYIKAIRSAQHFIHIENQYFIGSSYNWPDYKDAGANHLIPMELALKVASKIREHKRFAV  595

Query  901   YIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKS-EKIEDAHPCDYLNFYCLG  725
             Y+VIPMWPEGVP S  +Q+IL++Q QTI+MMY +IA  L+   K+ + HP DYLNFYCLG
Sbjct  596   YVVIPMWPEGVPDSGAMQEILFFQAQTIKMMYGVIADALRDVGKLGELHPRDYLNFYCLG  655

Query  724   NRE---EWHEESASSPTPGCSEFLTG-SQKSGRFMIYVHAKGMVVDDEYVIVGSANINQR  557
             NRE   E   ++         E   G +QK  RFMIYVHAKGMVVDDEY+I GSANINQR
Sbjct  656   NRETKSEVEAKADPPAKAPAPETKHGQAQKHRRFMIYVHAKGMVVDDEYIICGSANINQR  715

Query  556   SMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECV  377
             SM GSRDTEIAMGA+QP +TWA N  HP  QVYGYRMSLW+EHLG ++    EA  LECV
Sbjct  716   SMDGSRDTEIAMGAFQPRYTWAHNGGHPMGQVYGYRMSLWSEHLGHVESLFTEAGSLECV  775

Query  376   KMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLG-SR  200
             + VN+IA+ENWK+Y AE+ + ++GHLL YP+QV+ +G +  + G + FPDVGG +LG ++
Sbjct  776   RTVNKIADENWKQYAAEEVTDMKGHLLPYPIQVNQDGTIGSIPGFDTFPDVGGNILGNNQ  835

Query  199   TTLPDALTT  173
               LPD+LTT
Sbjct  836   INLPDSLTT  844



>ref|XP_010941360.1| PREDICTED: phospholipase D delta-like isoform X2 [Elaeis guineensis]
Length=809

 Score =   964 bits (2491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/689 (69%), Positives = 543/689 (79%), Gaps = 22/689 (3%)
 Frame = -2

Query  2722  PFCIISDVKMSDGMS-----ENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCR  2558
             P   I   +M+ G       E  V LHGDLDL IL+ARRLPNMD+ SE +R+ F A  CR
Sbjct  9     PTSAIPTAEMTAGADGCFSEEQTVLLHGDLDLWILKARRLPNMDMFSEHLRRCFVA--CR  66

Query  2557  KPETRQGNKVRR----------HTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHF  2408
              P      +  R          H +IITSDPYV + LAGATVARTRVISNS+DP W EHF
Sbjct  67    PPSPSSCTRFHRPHHHDHHHHHHRKIITSDPYVTISLAGATVARTRVISNSEDPNWNEHF  126

Query  2407  KIPVAHPVSEVEFQVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDC  2228
             KIP+AH    ++F VKDNDVFGA  IG   + A  + SGE + DWFPI+   GKPPKP+ 
Sbjct  127   KIPLAHRSRFIDFHVKDNDVFGAQLIGTVSIPATLVASGELVRDWFPILDPSGKPPKPET  186

Query  2227  AIRLMMKFTPCAENPRYRGGVT---EDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIK  2057
             A+ + +++ P   NP Y  G+    E  G++++YFPMR GG VTLYQDAHV EG LPEI+
Sbjct  187   ALLVSLQYKPVGSNPIYDHGIPGDPEKLGVRDTYFPMRKGGLVTLYQDAHVREGELPEIE  246

Query  2056  IDDGKAFHHENCWEDICHAILEAHHMVYIVGWSIYHKVKLVREPTRplp-nggnlnlgel  1880
             ++ G  F H  CWEDICHAILEAHH++YIVGWS+YHKVKLVREPTRPLP    N  LGEL
Sbjct  247   LEKGTKFEHNRCWEDICHAILEAHHLIYIVGWSVYHKVKLVREPTRPLPPEVENFTLGEL  306

Query  1879  LKYKSQEGVRVLLLVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASS  1700
             LKYKSQEGVRV LLVWDDKTSH K    T GVM THDE+TRKFFKHSSV CVL+PRYASS
Sbjct  307   LKYKSQEGVRVCLLVWDDKTSHDKLCFKTEGVMQTHDEDTRKFFKHSSVICVLSPRYASS  366

Query  1699  KLSFVKQQVVGTLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRD  1520
             KLS  KQQVVGTL+THHQKCV+VDTQA  NNRKI+AFIGGLDLCDGRYDTPQHR+FSD D
Sbjct  367   KLSIFKQQVVGTLFTHHQKCVLVDTQASLNNRKISAFIGGLDLCDGRYDTPQHRIFSDLD  426

Query  1519  TVFRGDYNNPTFPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRF  1340
             +VF  D++NPTFP    KGPRQPWHDLHCKIEGPAAYD+LTNFEQRWRKA+KW E G RF
Sbjct  427   SVFLNDFHNPTFP-AVTKGPRQPWHDLHCKIEGPAAYDVLTNFEQRWRKATKWREFGERF  485

Query  1339  KKISHWHDDALLKIERISWITSPTPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKG  1160
             K++SHW DDAL+K+ERISWI SP+ +VPN+DPSLWVS E D + WHVQ+FRSIDSGS+KG
Sbjct  486   KRVSHWSDDALIKLERISWILSPSSTVPNNDPSLWVSKEEDSETWHVQIFRSIDSGSVKG  545

Query  1159  FPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEA  980
             FPKDVH A  +NLVC K+LVID+SI  AY++AIR AQHFIYIENQYFLGSSY WPSYK A
Sbjct  546   FPKDVHEALEKNLVCQKNLVIDKSIHTAYVKAIRSAQHFIYIENQYFLGSSYGWPSYKNA  605

Query  979   GADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEI  800
             GADNLIPMELALK+ SKIR  ERFAVYIVIPMWPEGVP++A VQ+IL+WQGQTIQMMYEI
Sbjct  606   GADNLIPMELALKVASKIRAGERFAVYIVIPMWPEGVPTAASVQEILFWQGQTIQMMYEI  665

Query  799   IAKELKSEKIEDAHPCDYLNFYCLGNREE  713
             I +ELKS  +E+AHP DYLNFYCLGNREE
Sbjct  666   IGQELKSMNVENAHPQDYLNFYCLGNREE  694


 Score =   144 bits (364),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = -2

Query  469  AQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKY  290
            A VYGYRMSLWAEHLGM+D++  E   +ECVK VNEIA+ENW +Y AE+  PL+GHLLKY
Sbjct  711  AAVYGYRMSLWAEHLGMVDDRFKEPNSIECVKFVNEIADENWAKYLAEEVRPLRGHLLKY  770

Query  289  PLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALT  176
            P++V+ +GKV PL   E FPDVGG++LGS TTLPD LT
Sbjct  771  PIKVEVDGKVGPLPNQECFPDVGGRILGSPTTLPDTLT  808



>gb|KHN20136.1| Phospholipase D delta [Glycine soja]
Length=644

 Score =   962 bits (2486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/685 (70%), Positives = 557/685 (81%), Gaps = 46/685 (7%)
 Frame = -2

Query  2212  MKFTPCAENPRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGK  2042
             MKFT C ++  YR     D   + +++SYFP+RHGG+VTLYQDAHVP+  LPE++++DG 
Sbjct  1     MKFTRCEDSFMYRSRTETDPDRFVVRDSYFPVRHGGSVTLYQDAHVPDSMLPEVELEDGV  60

Query  2041  AFHHENCWEDICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQ  1862
              F H  CWEDICHAIL AHH+VYIVGWSIYHKVKLVREPT+PLP+GGNLNLGELLKYKSQ
Sbjct  61    VFVHGKCWEDICHAILGAHHLVYIVGWSIYHKVKLVREPTKPLPSGGNLNLGELLKYKSQ  120

Query  1861  EGVRVLLLVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVK  1682
             EG+RVLLLVWDDKTSHSKF INTSGVM THDEETRKFFKHSSV C+L+PRYASS      
Sbjct  121   EGLRVLLLVWDDKTSHSKFGINTSGVMQTHDEETRKFFKHSSVRCLLSPRYASS------  174

Query  1681  QQVVGTLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGD  1502
                                              GLDLCDGRYDTP+HR+  D DTV++ D
Sbjct  175   ---------------------------------GLDLCDGRYDTPEHRILRDIDTVYQDD  201

Query  1501  YNNPTFPEGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHW  1322
             Y+NPTF   G KGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKA+KW+ELGR+ K++SHW
Sbjct  202   YHNPTFC-AGTKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKATKWSELGRKLKRVSHW  260

Query  1321  HDDALLKIERISWITSPTPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVH  1142
             +DD+L+K+ERI WI SP+ S P DDP LWVS E DP+NWHVQVFRSIDSGSLKGFPKDV 
Sbjct  261   NDDSLIKLERIFWILSPSESTPVDDPELWVSKEDDPENWHVQVFRSIDSGSLKGFPKDVV  320

Query  1141  TAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLI  962
              AETQNLVCAK+LVID+SIQ AYI AIR AQHFIYIENQYF+GSS+AWP+YKEAGADNLI
Sbjct  321   VAETQNLVCAKNLVIDKSIQTAYIHAIRSAQHFIYIENQYFIGSSFAWPAYKEAGADNLI  380

Query  961   PMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELK  782
             P+ELALKIVSKIR++ERF VYIVIPMWPEG PSS  VQ+IL+WQGQT++MMYEIIA ELK
Sbjct  381   PVELALKIVSKIRSKERFTVYIVIPMWPEGSPSSTSVQEILFWQGQTMKMMYEIIALELK  440

Query  781   SEKIEDAHPCDYLNFYCLGNREEWHEE--SASSPTPGCSEFLTGSQKSGRFMIYVHAKGM  608
             S ++ D+HP DYLNFYCLGNRE+   E  S+S+      E ++ SQK  RFMIYVHAKGM
Sbjct  441   SMQL-DSHPQDYLNFYCLGNREQLTTEVSSSSNSPSDNGETVSASQKFRRFMIYVHAKGM  499

Query  607   VVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEH  428
             +VDDEYVI+GSANINQRS+AGSRDTEIAMGA+QPHHTW++ + HPH QVYGYRMSLWAEH
Sbjct  500   IVDDEYVILGSANINQRSLAGSRDTEIAMGAHQPHHTWSQKKRHPHGQVYGYRMSLWAEH  559

Query  427   LGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLG  248
             +  ++    E E LECVK VN+IAE+NWK+YTA+ ++PLQGH++KYP+ V++ GKV  L 
Sbjct  560   METIEACFKEPESLECVKSVNKIAEDNWKKYTADDYTPLQGHIMKYPVCVNAYGKVKSLT  619

Query  247   GCEYFPDVGGKVLGSRTTLPDALTT  173
             G E FPDVGGKVLGSR+TLPDALTT
Sbjct  620   GFESFPDVGGKVLGSRSTLPDALTT  644



>ref|XP_002979744.1| hypothetical protein SELMODRAFT_153581 [Selaginella moellendorffii]
 gb|EFJ19146.1| hypothetical protein SELMODRAFT_153581 [Selaginella moellendorffii]
Length=834

 Score =   957 bits (2475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/849 (57%), Positives = 611/849 (72%), Gaps = 39/849 (5%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-----CRKPETRQGNKVRRHT  2516
             S  V  L+G ++L+I+EA+ LPNMD  SER  Q F+        C KP+    +K+  H 
Sbjct  10    SPKVCLLYGTVELEIIEAKSLPNMDWFSERASQCFSILGGLQTMCAKPK----DKLAHHR  65

Query  2515  RIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGAD  2336
               ITSDPYV   L  A +A+T+VISNSQ P W E F++ VAH V EV   VKDNDVFGA 
Sbjct  66    HKITSDPYVVFSLGDAILAKTKVISNSQIPHWGERFQLHVAHSVPEVLLTVKDNDVFGAQ  125

Query  2335  FIGVAKVSAQKIISGETIND-WFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTE  2159
              IG  K+ A +I SG  I + WF ++G+ GKP K    +++ +K+TP  ++  Y+ GV  
Sbjct  126   VIGGVKIPAHRIASGPAIVETWFDVVGSGGKPVKQGAQLKISIKYTPVEQDKNYQHGVGA  185

Query  2158  DYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHM  1979
             +  +  +YFP+R G +V LYQDAH P+G LPEI ++ G A+ H  CWEDIC AILEAHH+
Sbjct  186   EGAVPRTYFPLRKGCSVKLYQDAHCPDGGLPEITLEGGGAYEHGKCWEDICQAILEAHHL  245

Query  1978  VYIVGWSIYHKVKLVREP---TRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSK  1808
             VYI GWS++HKVK+VREP    +   +  NL LGELLK K+ EGVRVLLLVWDDKTSH  
Sbjct  246   VYIAGWSVFHKVKIVREPENHKKFSNDIANLTLGELLKRKAAEGVRVLLLVWDDKTSHHT  305

Query  1807  FFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVD  1628
                 T GVMGT+DEET+KFF+HS+V CVL+PRY  SK+S++KQ+VVGT YTHHQK VIVD
Sbjct  306   PLFTTEGVMGTYDEETKKFFRHSAVRCVLSPRYGDSKMSWLKQRVVGTFYTHHQKLVIVD  365

Query  1627  TQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLK--GPRQ  1454
             +Q +GNNRK+T+FIGGLDL  GRYDTP+H LF    ++ R DY+NPTF  G +   GPRQ
Sbjct  366   SQGRGNNRKLTSFIGGLDLAQGRYDTPEHPLFKTLGSIHRDDYHNPTF-TGTIDHGGPRQ  424

Query  1453  PWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITS  1274
             PWHDLHC+I+GPAAYD+LTNF QRWRKA+ W             H+DA+++I+RISWI S
Sbjct  425   PWHDLHCRIDGPAAYDVLTNFAQRWRKAATW-------------HEDAMIEIDRISWILS  471

Query  1273  PTPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVID  1094
             P     + D +L V+   DP+ W+VQVFRSIDSGS+KGFPK+    + QNLV  K++ ID
Sbjct  472   PN----DGDQALMVTELNDPETWNVQVFRSIDSGSVKGFPKEPADCQKQNLVTLKNVAID  527

Query  1093  RSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRE  914
              SI  AY+E IR AQHFIYIENQYFLGSSYAWP YK+ GA ++IPMELALK+ SKIR+ +
Sbjct  528   TSIHTAYVERIRSAQHFIYIENQYFLGSSYAWPDYKKGGATHMIPMELALKVASKIRSGD  587

Query  913   RFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFY  734
              FAVY+VIPMWPEGVP SA VQ+ILY+Q QT++MMY+IIA+ L +E     HP DYLNFY
Sbjct  588   PFAVYVVIPMWPEGVPDSATVQEILYFQSQTMKMMYKIIAQAL-NEVGSGNHPTDYLNFY  646

Query  733   CLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRS  554
             CL NREE  E    +P    +++   +QK  RFMIY+H+KGM+VDDEYVI+GSANINQRS
Sbjct  647   CLANREERSEPGTMAPAEKSTQWY--AQKYKRFMIYIHSKGMIVDDEYVIIGSANINQRS  704

Query  553   MAGSRDTEIAMGAYQPHHTWA-KNQNHPHAQVYGYRMSLWAEHLGMMDEKL-DEAEGLEC  380
             M GSRDTE+AMGAYQPH+TWA K  +HP  QVYGYR SLWAEHLG  D  L ++   + C
Sbjct  705   MDGSRDTELAMGAYQPHYTWAHKKHSHPFGQVYGYRASLWAEHLGDFDPALFNDPSDIRC  764

Query  379   VKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSR  200
             V  VNEIA+ NWK++ +E+ S ++GHL+ YP+ V  NG++ P+ G E FPDV G+VLG  
Sbjct  765   VHKVNEIAQGNWKQFVSEEPSDMKGHLMSYPMSVQVNGEIKPIAGNESFPDVAGQVLGQH  824

Query  199   T-TLPDALT  176
             +  LPD LT
Sbjct  825   SINLPDNLT  833



>gb|KHN06490.1| Phospholipase D delta [Glycine soja]
Length=763

 Score =   956 bits (2472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/786 (60%), Positives = 581/786 (74%), Gaps = 48/786 (6%)
 Frame = -2

Query  2515  RIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGAD  2336
             ++ITSDPYV VC+AGAT+A+TRVI+N ++P+W E F +PVAHP  ++EF VKDND+ GA+
Sbjct  21    KMITSDPYVSVCIAGATIAQTRVIANCENPLWDEQFIVPVAHPAQKLEFLVKDNDILGAE  80

Query  2335  FIGVAKVSAQKIISGETINDWFPIIGAHGK--PPKPDCAIRLMMKFTPCAENPRYRGGVT  2162
              IGV ++  QKII+G T+NDWFPIIG +G    P P+  I +  +      +     G  
Sbjct  81    LIGVVEIPVQKIIAGNTVNDWFPIIGQYGNCLKPYPELHISVQYRQIGVNRSESISSGDG  140

Query  2161  EDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHH  1982
             +  G+ ++YFP+R GG+VTLYQDAH+P+G LPEI ++ GK F H  CWEDICHAILEAHH
Sbjct  141   KALGVPKTYFPLRKGGSVTLYQDAHLPDGMLPEITLEGGKVFQHNKCWEDICHAILEAHH  200

Query  1981  MVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFF  1802
             ++YI+GWS+YH V+LVRE T+PLP+GG L+LGELLKYKSQEG+RV++L+WDD+TSH KF 
Sbjct  201   LIYIIGWSVYHPVRLVREATKPLPSGGELSLGELLKYKSQEGLRVVMLIWDDRTSHDKFL  260

Query  1801  INTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQ  1622
             + T                                        VGTL+THHQKCV+VD+ 
Sbjct  261   LKT----------------------------------------VGTLFTHHQKCVLVDSL  280

Query  1621  AQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFP-EGGLKGPRQPWH  1445
               GNNRKITAFIGGLDLCDGRYDTP+HRLF D DTVF  D++NPTF        PRQPWH
Sbjct  281   GSGNNRKITAFIGGLDLCDGRYDTPEHRLFRDLDTVFHNDFHNPTFQLHSNSCAPRQPWH  340

Query  1444  DLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTP  1265
             DLHCKIEGPAAYDILTNFEQRWRKA KW +   R KK+++WHDDALL+++RISWI  P+P
Sbjct  341   DLHCKIEGPAAYDILTNFEQRWRKAKKWRDF--RLKKVTNWHDDALLRLDRISWIVKPSP  398

Query  1264  SVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSI  1085
             S  N D S+ V++E DP++W+VQ+FRSIDSGS+KGFPKDV  A+ QNL C K+L +D+SI
Sbjct  399   S-SNGDKSVHVTDENDPESWNVQIFRSIDSGSVKGFPKDVDKAKAQNLFCGKNLKVDQSI  457

Query  1084  QMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKE-AGADNLIPMELALKIVSKIRNRERF  908
               AY+ AIR A+HF+YIENQYFLGSSY WPSYK  AGA++L+PMELALKI  KI   ERF
Sbjct  458   HTAYVRAIRSAEHFVYIENQYFLGSSYHWPSYKNNAGANHLVPMELALKIAGKIGANERF  517

Query  907   AVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIE-DAHPCDYLNFYC  731
              VYIVIPMWPEGVP+SA VQ+IL+WQGQT+ MMY+I+A  L+   +    HP DYLNFYC
Sbjct  518   CVYIVIPMWPEGVPTSAAVQEILFWQGQTMSMMYKIVADALEKAGLSYQYHPQDYLNFYC  577

Query  730   LGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSM  551
             LG RE      + +P P  +  L   +K  RFMIYVHAKGMVVDDEYVI+GSANINQRS+
Sbjct  578   LGKREPQSTNISPTPNPSENRALVSVKKFRRFMIYVHAKGMVVDDEYVIIGSANINQRSL  637

Query  550   AGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKM  371
              GSRDTEIAMGAYQP +TW +   HP  QVYGYRMSLWAEHLG +D    E   LECV+ 
Sbjct  638   DGSRDTEIAMGAYQPKYTWTEKNAHPRGQVYGYRMSLWAEHLGSLDHCFAEPHNLECVRH  697

Query  370   VNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTL  191
             VN+IA+ NW  Y +E+ + ++GHL++YP+++  +GKVS L   E FPDVGGK+LGS  +L
Sbjct  698   VNKIAKRNWDIYVSEEENRMRGHLMQYPVKISRDGKVSALDDYESFPDVGGKILGSPNSL  757

Query  190   PDALTT  173
             PDALTT
Sbjct  758   PDALTT  763



>ref|XP_009386170.1| PREDICTED: phospholipase D delta-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=792

 Score =   956 bits (2472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/706 (67%), Positives = 554/706 (78%), Gaps = 16/706 (2%)
 Frame = -2

Query  2677  ENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTA-------FDCRKPETRQGNKVRRH  2519
             + VV LHGDL L ++EARRLPNMD+ SE +R+ FT+       + C     +Q +    H
Sbjct  16    DGVVLLHGDLVLTVIEARRLPNMDMFSEHLRRCFTSCGPPFSNYSCGAVRHQQHHHHHHH  75

Query  2518  TRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGA  2339
              +IITSDPYV  CLA ATVARTRVISNS+DP+W EHFKIP+AH  + +   VKDNDVFGA
Sbjct  76    RKIITSDPYVTACLAEATVARTRVISNSEDPIWNEHFKIPLAHRAAALVLHVKDNDVFGA  135

Query  2338  DFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT-  2162
               IG   V   +I SG+ I  WFPI+GA+GKP K D A+ L M+FT   + P Y+ G+T 
Sbjct  136   QLIGTVSVPTARIASGKKIQGWFPILGANGKPYKRDTALHLSMEFTAVEKKPEYQHGITG  195

Query  2161  --EDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEA  1988
               E  G++++YFP+R GG+VTLYQDAHV EG LPE+ ++ G  F HENCWEDICHAILEA
Sbjct  196   DPEKLGVRDTYFPLRQGGSVTLYQDAHVREGELPEVNLEKGAMFKHENCWEDICHAILEA  255

Query  1987  HHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSK  1808
             HHM+Y+VGWSIYHKVKLVREPTRPLPNGG L LG+LLKYKSQEGVRV +LVWDDKTSH K
Sbjct  256   HHMIYLVGWSIYHKVKLVREPTRPLPNGGALTLGDLLKYKSQEGVRVCMLVWDDKTSHDK  315

Query  1807  FFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVD  1628
              F+ T GVM THDEETRKFFKHSSV CVL+PRYASSKLS VKQQVVGTL+THHQKCV+VD
Sbjct  316   LFLKTGGVMQTHDEETRKFFKHSSVICVLSPRYASSKLSIVKQQVVGTLFTHHQKCVLVD  375

Query  1627  TQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPW  1448
             TQA GN RKITAFIGGLDLCDGRYDTP HRLF D DTVF  D +NPTF   G KGPRQPW
Sbjct  376   TQASGNKRKITAFIGGLDLCDGRYDTPDHRLFCDMDTVFLNDIHNPTF-AAGTKGPRQPW  434

Query  1447  HDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPT  1268
             HDLHCKIEGPAAYDIL NFEQRWRKA+KW E   RF+K S WHDDAL+ +ERISWI SP+
Sbjct  435   HDLHCKIEGPAAYDILKNFEQRWRKATKWREFSLRFRKASRWHDDALIHLERISWILSPS  494

Query  1267  PSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRS  1088
              SVP+ DPSLWVS E DP+NWHVQ+FRSIDSGS+KGFP +V  +   NLVC K+LVID+S
Sbjct  495   LSVPDGDPSLWVSQEEDPENWHVQIFRSIDSGSVKGFPSNVQESLKMNLVCRKNLVIDKS  554

Query  1087  IQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERF  908
             I  AY++AIR AQHFIYIENQYFLGSS+AWPSYK +GADNLIP+ELALKI SKIR +ERF
Sbjct  555   IHTAYVKAIRSAQHFIYIENQYFLGSSFAWPSYKNSGADNLIPVELALKIASKIRAKERF  614

Query  907   AVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCL  728
             AVY+VIPMWPEG P+S  VQ+IL+WQGQT++MMYEI+A+ELKS  +E+AHP D+LNFYCL
Sbjct  615   AVYVVIPMWPEGDPTSNAVQEILFWQGQTMKMMYEIVAQELKSMNLENAHPQDFLNFYCL  674

Query  727   GNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEY  590
             GNRE   +E+    +   S  + G     R  ++    GM VDD +
Sbjct  675   GNREIAPKENLQQQSLDKSPMVYGY----RMSLWAEHLGM-VDDRF  715


 Score =   145 bits (366),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = -2

Query  463  VYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPL  284
            VYGYRMSLWAEHLGM+D++ ++ +  ECV  VN IAE+NW RYTA++  PL+GHLLKYP+
Sbjct  696  VYGYRMSLWAEHLGMVDDRFEKPDSTECVNFVNRIAEDNWSRYTADEIIPLKGHLLKYPI  755

Query  283  QVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALT  176
            +VDS+GKV PL   EYFPDVGGK+LG+ T LPD LT
Sbjct  756  KVDSDGKVRPLPNHEYFPDVGGKILGAPTALPDTLT  791



>gb|AAL02150.1|AF274239_1 phospholipase D-like protein p98, partial [Arabidopsis thaliana]
Length=656

 Score =   953 bits (2463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/664 (70%), Positives = 536/664 (81%), Gaps = 17/664 (3%)
 Frame = -2

Query  2137  YFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYIVGWS  1958
             YFP+R G  V LYQDAHV +G+LP I +D+GK + H  CWEDIC+AI EAHHM+YIVGWS
Sbjct  1     YFPVRKGSQVRLYQDAHVMDGTLPAIGLDNGKVYEHGKCWEDICYAISEAHHMIYIVGWS  60

Query  1957  IYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTSGVMG  1778
             I+HK+KLVRE    +P   ++ LGELLKYKSQEGVRVLLLVWDDKTSH KF I T GVMG
Sbjct  61    IFHKIKLVRE--TKVPRDKDMTLGELLKYKSQEGVRVLLLVWDDKTSHDKFGIKTPGVMG  118

Query  1777  THDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQGNNRKI  1598
             THDEETRKFFKHSSV CVL+PRYASSKL   KQQVVGTL+THHQKCV+VDTQA GNNRK+
Sbjct  119   THDEETRKFFKHSSVICVLSPRYASSKLGLFKQQVVGTLFTHHQKCVLVDTQAVGNNRKV  178

Query  1597  TAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCKIEGP  1418
             TAFIGGLDLCDGRYDTP+HR+  D DTVF+ D++NPTFP  G K PRQPWHDLHC+I+GP
Sbjct  179   TAFIGGLDLCDGRYDTPEHRILHDLDTVFKDDFHNPTFP-AGTKAPRQPWHDLHCRIDGP  237

Query  1417  AAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSP--------TPS  1262
             AAYD+L NFEQRWRKA++W E   R K  +HW DDAL++I RISWI SP        T  
Sbjct  238   AAYDVLINFEQRWRKATRWKEFSLRLKGKTHWQDDALIRIGRISWILSPVFKFLKDGTSI  297

Query  1261  VPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQ  1082
             +P DDP +WVS E DP+NWHVQ+FRSIDSGS+KGFPK    AE Q+L CAK LV+D+SIQ
Sbjct  298   IPEDDPCVWVSKEDDPENWHVQIFRSIDSGSVKGFPKYEDEAEAQHLECAKRLVVDKSIQ  357

Query  1081  MAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAV  902
              AYI+ IR AQHFIYIENQYFLGSSYAWPSY++AGADNLIPMELALKIVSKIR +ERFAV
Sbjct  358   TAYIQTIRSAQHFIYIENQYFLGSSYAWPSYRDAGADNLIPMELALKIVSKIRAKERFAV  417

Query  901   YIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGN  722
             Y+VIP+WPEG P S PVQ+ILYWQ QT+QMMY++IAKELK+ +  DAHP DYLNFYCLG 
Sbjct  418   YVVIPLWPEGDPKSGPVQEILYWQSQTMQMMYDVIAKELKAVQ-SDAHPLDYLNFYCLGK  476

Query  721   REEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGS  542
             RE+  ++  ++        ++ S    RFMIYVHAKGM+VDDEYV++GSANINQRSMAG+
Sbjct  477   REQLPDDMPAT----NGSVVSDSYNFQRFMIYVHAKGMIVDDEYVLMGSANINQRSMAGT  532

Query  541   RDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNE  362
             +DTEIAMGAYQP+HTWA    HP  QVYGYRMSLWAEHLG   ++  E   LEC+K VN 
Sbjct  533   KDTEIAMGAYQPNHTWAHKGRHPRGQVYGYRMSLWAEHLGKTGDEFVEPSDLECLKKVNT  592

Query  361   IAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRT-TLPD  185
             I+EENWKR+   KFS LQGHL+KYPLQVD +GKVSPL   E FPDVGGK++G+ +  LPD
Sbjct  593   ISEENWKRFIDPKFSELQGHLIKYPLQVDVDGKVSPLPDYETFPDVGGKIIGAHSMALPD  652

Query  184   ALTT  173
              LTT
Sbjct  653   TLTT  656



>gb|KHN48093.1| Phospholipase D delta [Glycine soja]
Length=763

 Score =   951 bits (2458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/786 (59%), Positives = 582/786 (74%), Gaps = 48/786 (6%)
 Frame = -2

Query  2515  RIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGAD  2336
             ++ITSDPYV VC+AGAT+A+TRVI+N ++P+W E F +PVAHP  ++EF VKDND+ GA+
Sbjct  21    KMITSDPYVSVCIAGATIAQTRVIANCENPLWDEQFIVPVAHPAQKLEFLVKDNDLLGAE  80

Query  2335  FIGVAKVSAQKIISGETINDWFPIIGAHGK--PPKPDCAIRLMMKFTPCAENPRYRGGVT  2162
              IGV ++  QKII+G TINDWFPIIG +G    P P+  I +  +      +     G  
Sbjct  81    LIGVVEIPVQKIIAGNTINDWFPIIGQYGNCLKPYPELHISVQYRQIGVNRSESISSGDG  140

Query  2161  EDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHH  1982
             +  G+ ++YFP+R GG+VTLYQDAH+P+G LPEI ++ GK F    CWEDICHAILEAHH
Sbjct  141   KALGVPKTYFPLRKGGSVTLYQDAHLPDGMLPEIPLEGGKVFQQNKCWEDICHAILEAHH  200

Query  1981  MVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFF  1802
             ++YI+GWS+YH V+LVRE T+PLP+GG L+LGELLKYKSQEG+RV++L+WDD+TSH KF 
Sbjct  201   LIYIIGWSVYHPVRLVREATKPLPSGGELSLGELLKYKSQEGLRVVMLIWDDRTSHDKFL  260

Query  1801  INTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQ  1622
             + T                                        VGTL+THHQKCV+VD+ 
Sbjct  261   LKT----------------------------------------VGTLFTHHQKCVLVDSL  280

Query  1621  AQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFP-EGGLKGPRQPWH  1445
               GNNRKITAF+GGLDLCDGRYDTP+HRLF D DTVF  D++NPTF        PRQPWH
Sbjct  281   GSGNNRKITAFMGGLDLCDGRYDTPEHRLFRDLDTVFHNDFHNPTFQLNSNSCSPRQPWH  340

Query  1444  DLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTP  1265
             DLHCKIEGPAAYDILTNFEQRWRKA KW +   R KK+++WHDDALL+++RISWI  P+P
Sbjct  341   DLHCKIEGPAAYDILTNFEQRWRKAKKWRDF--RLKKVTNWHDDALLRLDRISWIVKPSP  398

Query  1264  SVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSI  1085
                N D S+ V++E DP++W+VQ+FRSIDSGS+KGFPKDV  A++QNL+C K+L +D+SI
Sbjct  399   -CSNGDKSVHVTDEKDPESWNVQIFRSIDSGSVKGFPKDVDKAKSQNLLCGKNLKVDQSI  457

Query  1084  QMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKE-AGADNLIPMELALKIVSKIRNRERF  908
               AY+ AIR A+ F+YIENQYFLGSSY WPSYK  AGA++L+PMELALKI  KI   ERF
Sbjct  458   HTAYVRAIRSAERFVYIENQYFLGSSYHWPSYKNNAGANHLVPMELALKIAGKIGANERF  517

Query  907   AVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDA-HPCDYLNFYC  731
              VYIVIPMWPEGVP+SA VQ+IL+WQGQT+ MMY+IIA  L+   + D  HP DYLNFYC
Sbjct  518   CVYIVIPMWPEGVPTSAAVQEILFWQGQTMSMMYKIIADALEKAGLSDKYHPQDYLNFYC  577

Query  730   LGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSM  551
             LG RE      + +P P  +  L   +K  RFMIYVHAKGMV+DDEYVI+GSANINQRS+
Sbjct  578   LGKREPQSTNISPTPNPSENRALVSVKKFRRFMIYVHAKGMVIDDEYVIIGSANINQRSL  637

Query  550   AGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKM  371
              GSRDTEIAMGAYQP++TW +   HP  QVYGYRMSLWAEHL  +D    E   LECV+ 
Sbjct  638   DGSRDTEIAMGAYQPNYTWTEKNAHPRGQVYGYRMSLWAEHLADLDHCFTEPHNLECVRH  697

Query  370   VNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTL  191
             VN+IA++NW  Y +E+ + ++GHL++YP+++  +GKVS L   E FPDVGGKVLGS  +L
Sbjct  698   VNKIAKQNWDIYVSEEGNRMRGHLMQYPVKISKDGKVSALDDYESFPDVGGKVLGSPNSL  757

Query  190   PDALTT  173
             PDALTT
Sbjct  758   PDALTT  763



>ref|XP_006573536.1| PREDICTED: phospholipase D delta-like isoform X2 [Glycine max]
Length=700

 Score =   949 bits (2454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/690 (68%), Positives = 555/690 (80%), Gaps = 25/690 (4%)
 Frame = -2

Query  2686  GMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRK-----PETRQGNKVRR  2522
             G    V YLHGDLDLKI+EAR LPNMDI SER+R+  TA D  K     P    G   R+
Sbjct  7     GDDNGVTYLHGDLDLKIIEARHLPNMDIFSERLRRCVTACDTIKFHSEAPAGGGGAGQRK  66

Query  2521  H--TRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDV  2348
             H   RIITSDPYV V +  ATVARTRV+ NS +PVW E F IP+AHPV ++EF+VKD+DV
Sbjct  67    HHHPRIITSDPYVTVSVPQATVARTRVLKNSPNPVWEEQFNIPLAHPVVDLEFRVKDDDV  126

Query  2347  FGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGG  2168
             FGA  +G  KV A++I +G  I++WFPI+   GKPPKPD A+ + MKFTP  EN  Y+ G
Sbjct  127   FGAQTMGTVKVPARRIATGAKISEWFPILLPSGKPPKPDTALHVEMKFTPVWENLLYQRG  186

Query  2167  VTED---YGLKESYFPMRHGGAVTLYQDAHVPE---GSLPEIKIDDGKAFHHENCWEDIC  2006
             +  D    G++ +YFP+R G +V LYQDAH  E   G LPEIK+++G  + HE CWEDIC
Sbjct  187   IAADPEHNGVRHTYFPVRKGSSVRLYQDAHCTESGEGKLPEIKLENGNVYRHEKCWEDIC  246

Query  2005  HAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDD  1826
             +AI EAHHMVY+VGWSIYHKV+LVREPTRPLP GG+L LGELLKYKS+EGVRVLLLVWDD
Sbjct  247   YAISEAHHMVYLVGWSIYHKVRLVREPTRPLPRGGDLTLGELLKYKSEEGVRVLLLVWDD  306

Query  1825  KTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQ  1646
             KTSH K F+ T+GVMGTHDEETRKFFKHSSV CVL+PRYAS+K+SF+KQQVVGT++THHQ
Sbjct  307   KTSHDKVFLKTAGVMGTHDEETRKFFKHSSVMCVLSPRYASNKMSFLKQQVVGTVFTHHQ  366

Query  1645  KCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLK  1466
             KCVIVDTQA GNNRKITAFIGGLDLCDGRYDTP+HRLF + D VF GD++NPTF   G +
Sbjct  367   KCVIVDTQAAGNNRKITAFIGGLDLCDGRYDTPEHRLFRNLDDVFDGDFHNPTF-SAGTR  425

Query  1465  GPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERIS  1286
              PRQPWHDLHC+I+GPAAYD+L NFEQRWRKA+KW E    FKK S WHDDAL++IERIS
Sbjct  426   VPRQPWHDLHCRIDGPAAYDVLINFEQRWRKATKWKEFAILFKKSSQWHDDALIRIERIS  485

Query  1285  WITSPTP-----------SVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHT  1139
             WI SP+            +VP DDP +WVS+E DP+NWHVQ+FRSIDSGSLKGFPK V  
Sbjct  486   WILSPSGAATLKDKSDDYTVPEDDPLVWVSSEDDPENWHVQIFRSIDSGSLKGFPKRVDV  545

Query  1138  AETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIP  959
             A +QNL+CAK+LVID+SIQ AYI+AIR AQHFIYIENQYF+GSSYAWP+YK+AGADNLIP
Sbjct  546   ALSQNLICAKNLVIDKSIQTAYIQAIRSAQHFIYIENQYFIGSSYAWPAYKDAGADNLIP  605

Query  958   MELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKS  779
             MELALKI SKIR +ERFAVYIV+PMWPEG P +  +Q+IL+WQGQT+QMMY+ +A+ELKS
Sbjct  606   MELALKIASKIRAKERFAVYIVLPMWPEGDPKTGAMQEILFWQGQTMQMMYDAVARELKS  665

Query  778   EKIEDAHPCDYLNFYCLGNREEWHEESASS  689
              ++ D HP DYLNFYCLGNRE ++E+S+S+
Sbjct  666   MQLTDVHPQDYLNFYCLGNREHFNEDSSST  695



>emb|CBI24451.3| unnamed protein product [Vitis vinifera]
Length=1607

 Score =   946 bits (2445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/668 (69%), Positives = 546/668 (82%), Gaps = 24/668 (4%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQ--GNK-V  2528
             M+D  S+ V+YLHGDLDLKIL+AR LPNMD+V+E +R+ FT  D C+ P   +  G+K +
Sbjct  673   MADTASQRVIYLHGDLDLKILKARDLPNMDLVTEHVRRCFTLCDACKTPSAGKDPGDKRL  732

Query  2527  RRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDV  2348
               H +IITSDPYV VC+  ATVARTRVISN+Q+P W E+F I +AHPV+ +EFQVKDND+
Sbjct  733   DHHRKIITSDPYVTVCVPQATVARTRVISNTQNPYWNENFYISLAHPVANLEFQVKDNDL  792

Query  2347  FGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGG  2168
             FGA+ IGVA++ A++I +GE I+ WFP+IGA+GK PKP  A+++ +KFTP  +NP YR G
Sbjct  793   FGAEVIGVARIPAERIATGEHISGWFPVIGANGKQPKPTTALQIEIKFTPFEQNPFYRTG  852

Query  2167  VTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAI  1997
             +  D    G++ +YFP+R GG  TLYQDAHVPEG LP+I++D G+ + HE CWEDICHAI
Sbjct  853   IAGDPEHLGVRHTYFPLRKGGLATLYQDAHVPEGLLPDIEVDGGQVYRHETCWEDICHAI  912

Query  1996  LEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTS  1817
             +EAHHMVYIVGWSIYHKVKL+REPTRPLP GG+L LG+LLKYKS+EGVRVL+LVWDD+TS
Sbjct  913   VEAHHMVYIVGWSIYHKVKLIREPTRPLPRGGDLTLGDLLKYKSEEGVRVLMLVWDDRTS  972

Query  1816  HSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCV  1637
             H KFFINT GVM THDEETRKFFKHSSV CVL+PRYASSKLSF+KQQVVGT++THHQKCV
Sbjct  973   HDKFFINTKGVMETHDEETRKFFKHSSVICVLSPRYASSKLSFIKQQVVGTIFTHHQKCV  1032

Query  1636  IVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPR  1457
             +VD+QA GNNRKITAF+GG+DLCDGRYDTP+HRLF D DTVF  D++NPTFP G  K PR
Sbjct  1033  LVDSQAHGNNRKITAFLGGIDLCDGRYDTPEHRLFKDLDTVFNEDFHNPTFPAGS-KAPR  1091

Query  1456  QPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWIT  1277
             QPWHDLHCKIEGPAAYD+L NFEQRW+KA+KW E G   KKISHWHDDAL+KI+RISWI 
Sbjct  1092  QPWHDLHCKIEGPAAYDVLINFEQRWKKATKWTEFGLHLKKISHWHDDALIKIDRISWIL  1151

Query  1276  SP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNL  1121
             SP          SVP DDPSLWV+ E DP+NWHVQVFRSIDSGSLKGFPK V TAE QNL
Sbjct  1152  SPPSGSDGDDVTSVPKDDPSLWVTKEDDPENWHVQVFRSIDSGSLKGFPKTVDTAENQNL  1211

Query  1120  VCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALK  941
             +CAK+LVID+SIQ AYI+AIR AQHFIYIENQYFLGSSYAWPSYK+AGADNLIPMELALK
Sbjct  1212  ICAKNLVIDKSIQTAYIQAIRSAQHFIYIENQYFLGSSYAWPSYKDAGADNLIPMELALK  1271

Query  940   IVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDA  761
             I SKI+ +ERFAVYIVIPMWPEG P S  VQ+IL+WQ         ++     + +    
Sbjct  1272  IASKIKAKERFAVYIVIPMWPEGDPKSNTVQEILFWQ--------IVLCDFGGTIRFRPY  1323

Query  760   HPCDYLNF  737
             H C+YL F
Sbjct  1324  HICEYLEF  1331


 Score =   406 bits (1044),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 195/271 (72%), Positives = 228/271 (84%), Gaps = 3/271 (1%)
 Frame = -2

Query  976   ADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEII  797
             ADNLIPMELALKI SKIR +ERFAVYIVIPMWPEG P S  VQ+IL+WQ QT+QMMYE+I
Sbjct  1337  ADNLIPMELALKIASKIRAKERFAVYIVIPMWPEGDPKSNTVQEILFWQAQTMQMMYEVI  1396

Query  796   AKELKSEKIEDAHPCDYLNFYCLGNREEWHEESA--SSPTPGCSEFLTGSQKSGRFMIYV  623
             AKELKS ++ED+HP DYLNFYCLGNRE   +E +  +SPTP  ++ +  S K  RFMIYV
Sbjct  1397  AKELKSMQLEDSHPLDYLNFYCLGNREGVTKEMSEKASPTPANADAVLASAKFRRFMIYV  1456

Query  622   HAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMS  443
             HAKGM+VDDEY+I+GSANINQRSMAG++DTEIAMGAYQ HHTWA+ + HPH QVYGYRMS
Sbjct  1457  HAKGMIVDDEYLIMGSANINQRSMAGTKDTEIAMGAYQRHHTWAEKKKHPHGQVYGYRMS  1516

Query  442   LWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGK  263
             LWAEHLGM+++   E E LECV+ VNE+AEENWKR+TAE+F+PLQGHLLKYP+QVD++GK
Sbjct  1517  LWAEHLGMVNKLFKEPENLECVRTVNEMAEENWKRFTAEEFTPLQGHLLKYPMQVDADGK  1576

Query  262   VSPLGGCEYFPDVGGKVLGSR-TTLPDALTT  173
             VS   G E FPDVGG  LG   TTLPD+LTT
Sbjct  1577  VSSKPGHENFPDVGGYALGCHSTTLPDSLTT  1607


 Score =   314 bits (805),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 151/290 (52%), Positives = 208/290 (72%), Gaps = 16/290 (6%)
 Frame = -2

Query  2740  ASNNNCPFCIISDVKMSDGM-SEN------VVYLHGDLDLKILEARRLPNMDIVSERIRQ  2582
             + N     C + ++   D M SEN      +VYL+GDLDLKILEAR LPNMD+++  + +
Sbjct  363   SGNRKSYTCHLVNINSVDSMISENFRPNTQMVYLNGDLDLKILEARHLPNMDLLALNLSR  422

Query  2581  FFTAFDCRKPET-----RQGNKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWV  2417
              F + + RK  +     R G++  RHT IITSDPYVKVC+  AT+ARTRVISN+Q+P W 
Sbjct  423   CFASCEARKRPSSPDRQRPGDRKDRHTNIITSDPYVKVCVPQATLARTRVISNTQNPYWN  482

Query  2416  EHFKIPVAHPVSEVEFQVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPK  2237
             E F IP+AHP++ ++F+VK+ND+ GA+ +G   + A+K+ SG+ I+ WFP+IG  GKPPK
Sbjct  483   ERFSIPLAHPLANLKFEVKENDLLGAELMGTVLIPAEKLASGDPISGWFPVIGPLGKPPK  542

Query  2236  PDCAIRLMMKFTPCAENPRYRGGVT---EDYGLKESYFPMRHGGAVTLYQDAHVPEGSL-  2069
             P+ A+R+ M+FTPC +NP Y+ G+    E  G+ ++YFP+R GG+V LYQDAH P  +L 
Sbjct  543   PNTALRIEMQFTPCEKNPHYQRGIAGHPEHMGVHQTYFPLRRGGSVALYQDAHSPGEALS  602

Query  2068  PEIKIDDGKAFHHENCWEDICHAILEAHHMVYIVGWSIYHKVKLVREPTR  1919
             PEI++D G  +    CWEDICHAI+EAHHM+Y+VGWSI+HKVKL+RE TR
Sbjct  603   PEIELDGGIVYKRGQCWEDICHAIVEAHHMIYLVGWSIFHKVKLIREHTR  652



>ref|XP_002988389.1| hypothetical protein SELMODRAFT_269402 [Selaginella moellendorffii]
 gb|EFJ10479.1| hypothetical protein SELMODRAFT_269402 [Selaginella moellendorffii]
Length=830

 Score =   939 bits (2427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/849 (57%), Positives = 605/849 (71%), Gaps = 43/849 (5%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-----CRKPETRQGNKVRRHT  2516
             S  V  L+G ++L+I+EA+ LPNMD  SER  Q F+        C KP+    +K+  H 
Sbjct  10    SPKVCLLYGTVELEIIEAKSLPNMDWFSERASQCFSILGGLQTMCAKPK----DKLAHHR  65

Query  2515  RIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGAD  2336
               ITSDPYV   L  A +A+T+VISNSQ P W E F++ VAH V EV   VKDNDVFGA 
Sbjct  66    HKITSDPYVVFSLGDAILAKTKVISNSQIPHWGERFQLHVAHSVPEVLLTVKDNDVFGAQ  125

Query  2335  FIGVAKVSAQKIISGETIND-WFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTE  2159
              IG  K+ A +I SG  I + WF ++G+     K    +++ +K+TP  ++  Y+ GV  
Sbjct  126   VIGGVKIPAHRIASGPAIVETWFDVVGS----GKEGAQLKISIKYTPVEQDKNYQHGVGA  181

Query  2158  DYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHM  1979
             +  +  +YFP+R G +V LYQDAH P+G LPEI ++ G A+ H  CWEDIC AILEAHH+
Sbjct  182   EGAVPRTYFPLRKGCSVKLYQDAHCPDGGLPEITLEGGGAYEHGKCWEDICQAILEAHHL  241

Query  1978  VYIVGWSIYHKVKLVREP---TRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSK  1808
             VYI GWS++HKVK+VREP    +   +  NL LGELLK K+ EGVRVLLLVWDDKTSH  
Sbjct  242   VYIAGWSVFHKVKIVREPENHKKFSNDIANLTLGELLKRKAAEGVRVLLLVWDDKTSHHT  301

Query  1807  FFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVD  1628
                 T GVM T+DEET+KFF+HS+V CVL+PRY  SK+S++KQ VVGT YTHHQK VIVD
Sbjct  302   PLFTTKGVMATYDEETKKFFRHSAVRCVLSPRYGDSKMSWLKQWVVGTFYTHHQKLVIVD  361

Query  1627  TQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLK--GPRQ  1454
             +Q +GNNRK+T+FIGGLDL  GRYDTP+H LF    ++ R DY+NPTF  G +   GPRQ
Sbjct  362   SQGRGNNRKLTSFIGGLDLAQGRYDTPEHPLFKTLGSIHRDDYHNPTF-TGTIDHGGPRQ  420

Query  1453  PWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITS  1274
             PWHDLHC+I+GPAAYD+LTNF QRWRKA+ W             H+DA+++I+RISWI S
Sbjct  421   PWHDLHCRIDGPAAYDVLTNFAQRWRKAATW-------------HEDAMIEIDRISWILS  467

Query  1273  PTPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVID  1094
             P     + D +L V+   DP+ W+VQVFRSIDSGS+KGFPK+    + QNLV  K++ ID
Sbjct  468   PN----DGDQALMVTELDDPETWNVQVFRSIDSGSVKGFPKEPADCQKQNLVTLKNVAID  523

Query  1093  RSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRE  914
              SI  AY+E IR AQHFIYIENQYFLGSSYAWP YK+  A ++IPMELALK+ SKIR+ +
Sbjct  524   TSIHTAYVERIRSAQHFIYIENQYFLGSSYAWPDYKKGDATHMIPMELALKVASKIRSGD  583

Query  913   RFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFY  734
              FAVY+VIPMWPEGVP SA VQ+ILY+Q QT++MMY+IIA+ L +E     HP DYLNFY
Sbjct  584   PFAVYVVIPMWPEGVPDSATVQEILYFQSQTMKMMYKIIAQAL-NEVGSGNHPTDYLNFY  642

Query  733   CLGNREEWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRS  554
             CL NREE  E    +P    +++   +QK  RFMIY+H+KGM+VDDEYVI+GSANINQRS
Sbjct  643   CLANREERSEPGTMAPAEKSTQWY--AQKYKRFMIYIHSKGMIVDDEYVIIGSANINQRS  700

Query  553   MAGSRDTEIAMGAYQPHHTWA-KNQNHPHAQVYGYRMSLWAEHLGMMDEKL-DEAEGLEC  380
             M GSRDTE+AMGAYQPH+TWA K  +HP  QVYGYR SLWAEHLG  D  L ++   + C
Sbjct  701   MDGSRDTELAMGAYQPHYTWAHKKHSHPFGQVYGYRASLWAEHLGDFDPALFNDPSDIRC  760

Query  379   VKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSR  200
             V  VNEIA+ NWK++ +E+ S ++GHL+ YP+ V  NG++ P+ G E FPDV G+VLG  
Sbjct  761   VHKVNEIAQGNWKQFVSEEPSDMKGHLMSYPMSVQVNGEIKPIAGNESFPDVAGQVLGQH  820

Query  199   T-TLPDALT  176
             +  LPD LT
Sbjct  821   SINLPDNLT  829



>ref|XP_010523062.1| PREDICTED: phospholipase D beta 1 [Tarenaya hassleriana]
Length=1115

 Score =   926 bits (2394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/846 (55%), Positives = 591/846 (70%), Gaps = 35/846 (4%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRRHTRIITS  2501
             S  V+ LHG+LD+ I +A+ LPNMD+  + +   F     R P         + +R ITS
Sbjct  293   SLKVLLLHGNLDIWIYDAKNLPNMDMFHKTLGDMFG----RLPGNMSNKIEGQLSRKITS  348

Query  2500  DPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVA  2321
             DPYV + +AGA + RT V+SNS++PVW++HF +PVAH   EV F VKD+DV G+  IG+ 
Sbjct  349   DPYVSISVAGAVIGRTYVLSNSENPVWMQHFYVPVAHHAPEVHFVVKDSDVVGSQLIGIV  408

Query  2320  KVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGV---TEDYG  2150
              +  ++I SG  I   FPI+ ++GKP KP   + L +++TP  +   Y  GV    + YG
Sbjct  409   AIPVEQIFSGARIEGTFPILTSNGKPCKPGAVLSLSIQYTPMEKLSVYHHGVGAGPDYYG  468

Query  2149  LKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYI  1970
             +  +YFP+R GG +TLYQDAHVPE  LP I++D+G ++ H  CW D+  AI +A  ++YI
Sbjct  469   VPGTYFPLRKGGTMTLYQDAHVPERMLPGIRLDNGMSYEHGKCWHDMFDAIRQARRLIYI  528

Query  1969  VGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTS  1790
              GWS++HKV LVR+  RP        L    + KSQEGVRVLLLVWDD TS S     T 
Sbjct  529   TGWSVWHKVSLVRDSERPASECTLGELL---RSKSQEGVRVLLLVWDDPTSRSILGYKTD  585

Query  1789  GVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQGN  1610
             GVM THDEETR+FFKHSSV  +L PR A  + S+VKQ+ VGT+YTHHQK VIVD  A GN
Sbjct  586   GVMATHDEETRRFFKHSSVQVLLCPRIAGKRHSWVKQREVGTIYTHHQKTVIVDADAGGN  645

Query  1609  NRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKG-PRQPWHDLHC  1433
              RKI AF+GGLDLCDGRYDTPQH LF    TV + DY+NPTF  G + G PR+PWHDLH 
Sbjct  646   RRKIIAFVGGLDLCDGRYDTPQHSLFRTLQTVHKDDYHNPTF-TGNVSGCPREPWHDLHS  704

Query  1432  KIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWI--TSPTPSV  1259
             KI+GPAAYD+LTNFE+RW KA+K     R  KK+   +DDALL+IERI  I   S  P+V
Sbjct  705   KIDGPAAYDVLTNFEERWMKAAK----PRGIKKLKMSYDDALLRIERIPDILGVSDVPTV  760

Query  1258  PNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQM  1079
                       +E DP+ WHVQ+FRSIDS S+KGFPKD   A ++NLVC K+++ID SI  
Sbjct  761   ----------SENDPEAWHVQIFRSIDSNSVKGFPKDPKDATSKNLVCGKNMLIDMSIHT  810

Query  1078  AYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVY  899
             AY++AIR AQHFIYIENQYF+GSSY W ++K+ GA+NLIPME+ALKI  KI+  ERFA Y
Sbjct  811   AYVKAIRAAQHFIYIENQYFIGSSYNWNAHKDIGANNLIPMEIALKIAEKIKANERFAAY  870

Query  898   IVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAH-PCDYLNFYCLGN  722
             IVIPMWPEGVP+ A  Q ILYWQ +T+QMMYE I K L    +E A  P DYLNF+CLGN
Sbjct  871   IVIPMWPEGVPTGAATQRILYWQHKTMQMMYETIYKALVEMGLEGAFTPQDYLNFFCLGN  930

Query  721   REEW----HEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRS  554
             RE      H  + S  +    + L  S+KS RFMIYVH+KGMVVDDEYV++GSANINQRS
Sbjct  931   RETVDGIDHSGTGSPSSANTPQVL--SKKSRRFMIYVHSKGMVVDDEYVVIGSANINQRS  988

Query  553   MAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVK  374
             M G+RDTEIAMGAYQP HTWA+ Q+ P  Q+YGYRMSLWAEH+G ++E   + + LECV+
Sbjct  989   MEGTRDTEIAMGAYQPQHTWARKQSGPRGQIYGYRMSLWAEHMGTLEECFTQPDSLECVR  1048

Query  373   MVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTT  194
              V  + E NWK+++A++ + ++GHLLKYP+QVD  GKV PL GCE FPDVGG ++GS   
Sbjct  1049  KVRAMGERNWKQFSADEITDMRGHLLKYPVQVDLKGKVRPLPGCESFPDVGGNIVGSFIA  1108

Query  193   LPDALT  176
             + + LT
Sbjct  1109  IQENLT  1114



>gb|KDO38444.1| hypothetical protein CISIN_1g002960mg [Citrus sinensis]
Length=696

 Score =   924 bits (2388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/682 (66%), Positives = 538/682 (79%), Gaps = 25/682 (4%)
 Frame = -2

Query  2689  DGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPE-----------T  2546
             D   E V+YLHGDLDLKI+ ARRLPNMD++SE +R+ FTA D C+ P             
Sbjct  6     DSDKEKVIYLHGDLDLKIIRARRLPNMDMMSEHLRRCFTACDVCKTPAPTHETFQDDDGV  65

Query  2545  RQGNKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQ  2366
             R  +K+ R ++IITSDPYV V +  ATVARTRV+ NSQ+PVW EHF IP+AHP+S +E Q
Sbjct  66    RHTSKIIRKSKIITSDPYVTVVVPQATVARTRVLKNSQEPVWNEHFNIPLAHPLSNLEIQ  125

Query  2365  VKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAEN  2186
             VKD+DVFGA  IG A + A  I +GE I+ W+ II   G PPKP  +I+L +KFTPC +N
Sbjct  126   VKDDDVFGAQIIGTAAIPAHTIATGELISRWYDIIAPSGSPPKPGASIQLELKFTPCDKN  185

Query  2185  PRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWE  2015
             P YR G+  D    G++ +YFP+R G  V LYQDAHV EG LPEI +D GK +    CWE
Sbjct  186   PLYRQGIAGDPEHKGVRNAYFPLRKGSHVRLYQDAHVTEGILPEIPLDGGKLYKPGTCWE  245

Query  2014  DICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLV  1835
             DICHAI EAHH++YIVGWS++HK+KL+RE TRPLP GG+L LGELLKYKS+EGVRVLLLV
Sbjct  246   DICHAISEAHHLIYIVGWSVFHKIKLIREQTRPLPRGGDLTLGELLKYKSEEGVRVLLLV  305

Query  1834  WDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYT  1655
             WDDKTSH K  + T GVM THDEET+KFFKHSSV CVLAPRYASSKLS+ KQQ+VGT++T
Sbjct  306   WDDKTSHDKLGVKTPGVMATHDEETKKFFKHSSVNCVLAPRYASSKLSYFKQQIVGTIFT  365

Query  1654  HHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEG  1475
             HHQKCV+VDTQA GNNRKITAFIGG+DLCDGRYDTP+HRLF D DTVF+ D++NPT+P  
Sbjct  366   HHQKCVLVDTQASGNNRKITAFIGGIDLCDGRYDTPEHRLFRDLDTVFKDDFHNPTYPI-  424

Query  1474  GLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIE  1295
             G K PR+PWHDLHC+++GPAAYD+L NFEQRWRKA+K  EL  +FK++SHW DD L+KI 
Sbjct  425   GTKAPREPWHDLHCRLDGPAAYDVLINFEQRWRKATKLTELTFKFKRVSHWRDDYLIKIG  484

Query  1294  RISWITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHT  1139
             RISWI SP        T  VP DD  + VS E DP+NWHVQ+FRSIDSGS+KGFPK +  
Sbjct  485   RISWILSPELSLKTNGTTIVPRDDNVVRVSKEDDPENWHVQIFRSIDSGSVKGFPKSIED  544

Query  1138  AETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIP  959
              + Q+L+CAKD+VID+SIQ AYI+AIR AQHFIYIENQYFLGSSYAWPSYK AGADNLIP
Sbjct  545   IDDQSLICAKDVVIDKSIQTAYIQAIRSAQHFIYIENQYFLGSSYAWPSYKNAGADNLIP  604

Query  958   MELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKS  779
             MELALKI SKIR  ERFAVY++IPMWPEG P +  VQ+IL+WQ QT+QMMY ++A+EL+ 
Sbjct  605   MELALKIASKIRANERFAVYVIIPMWPEGDPKTNTVQEILFWQSQTMQMMYSVVAQELRE  664

Query  778   EKIEDAHPCDYLNFYCLGNREE  713
              ++ DAHP DYL+FYCLG REE
Sbjct  665   MQV-DAHPQDYLSFYCLGKREE  685



>ref|NP_849502.1| phospholipase D delta [Arabidopsis thaliana]
 gb|AEE86570.1| phospholipase D delta [Arabidopsis thaliana]
Length=693

 Score =   924 bits (2387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/684 (66%), Positives = 539/684 (79%), Gaps = 27/684 (4%)
 Frame = -2

Query  2695  MSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPETRQ-------  2540
             M++ +SE+V+ LHGDLDLKI++ARRLPNMD+ SE +R+ FTA + C +P           
Sbjct  1     MAEKVSEDVMLLHGDLDLKIVKARRLPNMDMFSEHLRRLFTACNACARPTDTDDVDPRDK  60

Query  2539  ---GNK-VRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVE  2372
                G+K +R H ++ITSDPYV V +  AT+ARTRV+ NSQ+P+W E F I +AHP + +E
Sbjct  61    GEFGDKNIRSHRKVITSDPYVTVVVPQATLARTRVLKNSQEPLWDEKFNISIAHPFAYLE  120

Query  2371  FQVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCA  2192
             FQVKD+DVFGA  IG AK+  + I SGE I+ WFP++GA GKPPK + AI + MKFTP  
Sbjct  121   FQVKDDDVFGAQIIGTAKIPVRDIASGERISGWFPVLGASGKPPKAETAIFIDMKFTPFD  180

Query  2191  ENPRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENC  2021
             +   YR G+  D    G++ +YFP+R G  V LYQDAHV +G+LP I +D+GK + H  C
Sbjct  181   QIHSYRCGIAGDPERRGVRRTYFPVRKGSQVRLYQDAHVMDGTLPAIGLDNGKVYEHGKC  240

Query  2020  WEDICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLL  1841
             WEDIC+AI EAHHM+YIVGWSI+HK+KLVRE    +P   ++ LGELLKYKSQEGVRVLL
Sbjct  241   WEDICYAISEAHHMIYIVGWSIFHKIKLVRETK--VPRDKDMTLGELLKYKSQEGVRVLL  298

Query  1840  LVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTL  1661
             LVWDDKTSH KF I T GVMGTHDEETRKFFKHSSV CVL+PRYASSKL   KQQVVGTL
Sbjct  299   LVWDDKTSHDKFGIKTPGVMGTHDEETRKFFKHSSVICVLSPRYASSKLGLFKQQVVGTL  358

Query  1660  YTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFP  1481
             +THHQKCV+VDTQA GNNRK+TAFIGGLDLCDGRYDTP+HR+  D DTVF+ D++NPTFP
Sbjct  359   FTHHQKCVLVDTQAVGNNRKVTAFIGGLDLCDGRYDTPEHRILHDLDTVFKDDFHNPTFP  418

Query  1480  EGGLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLK  1301
               G K PRQPWHDLHC+I+GPAAYD+L NFEQRWRKA++W E   R K  +HW DDAL++
Sbjct  419   -AGTKAPRQPWHDLHCRIDGPAAYDVLINFEQRWRKATRWKEFSLRLKGKTHWQDDALIR  477

Query  1300  IERISWITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDV  1145
             I RISWI SP        T  +P DDP +WVS E DP+NWHVQ+FRSIDSGS+KGFPK  
Sbjct  478   IGRISWILSPVFKFLKDGTSIIPEDDPCVWVSKEDDPENWHVQIFRSIDSGSVKGFPKYE  537

Query  1144  HTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNL  965
               AE Q+L CAK LV+D+SIQ AYI+ IR AQHFIYIENQYFLGSSYAWPSY++AGADNL
Sbjct  538   DEAEAQHLECAKRLVVDKSIQTAYIQTIRSAQHFIYIENQYFLGSSYAWPSYRDAGADNL  597

Query  964   IPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKEL  785
             IPMELALKIVSKIR +ERFAVY+VIP+WPEG P S PVQ+ILYWQ QT+QMMY++IAKEL
Sbjct  598   IPMELALKIVSKIRAKERFAVYVVIPLWPEGDPKSGPVQEILYWQSQTMQMMYDVIAKEL  657

Query  784   KSEKIEDAHPCDYLNFYCLGNREE  713
             K+ +  DAHP DYLNFYCLG RE+
Sbjct  658   KAVQ-SDAHPLDYLNFYCLGKREQ  680



>ref|XP_006857964.1| hypothetical protein AMTR_s00069p00174350 [Amborella trichopoda]
 gb|ERN19431.1| hypothetical protein AMTR_s00069p00174350 [Amborella trichopoda]
Length=1093

 Score =   924 bits (2387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/876 (55%), Positives = 613/876 (70%), Gaps = 32/876 (4%)
 Frame = -2

Query  2782  FSHLLLPSQQPGTTASNNNCPFCIISDVKMSDGMSENVVYLHGDLDLKILEARRLPNMDI  2603
             FSH  L S  P   +S +N    I+   + S G S  V+ LHG+LD+ ILEA  LPNMD 
Sbjct  242   FSHPSLVS--PSMDSSQHNQTLQIVP-FEPSKG-SLKVLLLHGNLDIWILEANNLPNMDT  297

Query  2602  VSERIRQFFTA-FDCRKPETRQGNKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDP  2426
               + +   F   F        +G+   +H   ITSDPYV V ++ A VART VISNS++P
Sbjct  298   FHKTLGDMFGKRFSSPVASKNEGHMPHQH---ITSDPYVSVHVSKAVVARTYVISNSENP  354

Query  2425  VWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGK  2246
             VW +H  +PVAH  +EV+F VKDNDV G+ FIG   +  ++I SG  +   FPI+G++GK
Sbjct  355   VWNQHCWVPVAHYAAEVQFVVKDNDVVGSQFIGTVSIPTEQICSGSKVEGLFPILGSNGK  414

Query  2245  PPKPDCAIRLMMKFTPCAENPRYRGGVT--EDY-GLKESYFPMRHGGAVTLYQDAHVPEG  2075
             P K    +RL ++F P  +   Y+ GV    DY G+ ++YFP+R GG VTLYQDAHVP+G
Sbjct  415   PCKAGAVLRLSIQFIPMEKLTIYQFGVGVGPDYCGVPDTYFPLRKGGKVTLYQDAHVPDG  474

Query  2074  SLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnl  1895
               P +K+D G  + H  CWED+  AI +A  ++YI GWS+YHKVKLVRE      N  + 
Sbjct  475   FFPGLKLDGGLRYEHGKCWEDVYKAISQARRLIYITGWSVYHKVKLVRE---QGVNDCDC  531

Query  1894  nlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAP  1715
              LG+LL+ KSQEGVRVLLLVWDD TS S   I T GVM THDEETR+FFKHSSV  +L P
Sbjct  532   TLGDLLRSKSQEGVRVLLLVWDDPTSRSLLGIKTDGVMQTHDEETRRFFKHSSVQVLLCP  591

Query  1714  RYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRL  1535
             R A  + SF KQ  VG +YTHHQK VIVD  A    RKI AF+GGLDLCDGRYDTP+H L
Sbjct  592   RSAGKRHSFFKQHEVGAIYTHHQKTVIVDADAGNYKRKIIAFVGGLDLCDGRYDTPKHPL  651

Query  1534  FSDRDTVFRGDYNNPTFPEG-GLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWA  1358
             F    TV + DY+NPTFP G  + GPR+PWHDLH +I+GPAAYD+LTNF++RW KASK  
Sbjct  652   FRTLQTVHKEDYHNPTFPAGPDVSGPREPWHDLHSRIDGPAAYDVLTNFQERWLKASKRH  711

Query  1357  ELGRRFKKISHWHDDALLKIERISWITSPTPSVPNDDPSLWVSNEGDPQNWHVQVFRSID  1178
              L     K+   +DD+LL +ERI  I      V  DD S   SNE DP++WHVQ+FRSID
Sbjct  712   GL----SKLKRSYDDSLLLLERIPDI------VGLDDTSY--SNESDPESWHVQIFRSID  759

Query  1177  SGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAW  998
             S S+KGFPKD   A ++NL C K+++ID SI  AY++AIR AQHFIYIENQYF+GSSY W
Sbjct  760   SNSVKGFPKDPKFATSKNLACGKNVIIDMSIHTAYVKAIRSAQHFIYIENQYFIGSSYNW  819

Query  997   PSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTI  818
              ++ + GA+NLIPME+ALKI SKI+  ERF+ YIVIPMWPEGVP+S P Q IL+WQ +T+
Sbjct  820   SAHSDVGANNLIPMEIALKIASKIKANERFSAYIVIPMWPEGVPTSVPTQRILFWQHKTM  879

Query  817   QMMYEIIAKELKSEKIEDAH-PCDYLNFYCLGNREEWHEE-SASSPTPGCSEFLTGSQKS  644
             QMMYEII K L+   +E  + P DYLNF+CLGNRE    + S SSP     E    +++S
Sbjct  880   QMMYEIIYKALEEMGLEKTYQPQDYLNFFCLGNREIPDGDISVSSPANNPREL---AKRS  936

Query  643   GRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQ  464
             GRFMIYVH+KGMVVDDEYVI+GSANINQRS+ GSRD+EIAMGAYQP HTWA+N ++P  Q
Sbjct  937   GRFMIYVHSKGMVVDDEYVIIGSANINQRSLDGSRDSEIAMGAYQPQHTWARNLSNPCGQ  996

Query  463   VYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPL  284
             VYGYR+SLWAEH G++D+     E LECV+ +  +AE NWK++ +E+ + ++GHLLKYP+
Sbjct  997   VYGYRLSLWAEHTGLVDKCFSNPESLECVRKIRTLAEMNWKQFASEEKTEIRGHLLKYPV  1056

Query  283   QVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALT  176
             +V +NGKV  L GCE FPDVGG +LG+ + + + LT
Sbjct  1057  EVLANGKVKALPGCETFPDVGGNILGTFSIIQENLT  1092



>gb|KDO38445.1| hypothetical protein CISIN_1g002960mg [Citrus sinensis]
Length=731

 Score =   923 bits (2386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/682 (66%), Positives = 538/682 (79%), Gaps = 25/682 (4%)
 Frame = -2

Query  2689  DGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFD-CRKPE-----------T  2546
             D   E V+YLHGDLDLKI+ ARRLPNMD++SE +R+ FTA D C+ P             
Sbjct  6     DSDKEKVIYLHGDLDLKIIRARRLPNMDMMSEHLRRCFTACDVCKTPAPTHETFQDDDGV  65

Query  2545  RQGNKVRRHTRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQ  2366
             R  +K+ R ++IITSDPYV V +  ATVARTRV+ NSQ+PVW EHF IP+AHP+S +E Q
Sbjct  66    RHTSKIIRKSKIITSDPYVTVVVPQATVARTRVLKNSQEPVWNEHFNIPLAHPLSNLEIQ  125

Query  2365  VKDNDVFGADFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAEN  2186
             VKD+DVFGA  IG A + A  I +GE I+ W+ II   G PPKP  +I+L +KFTPC +N
Sbjct  126   VKDDDVFGAQIIGTAAIPAHTIATGELISRWYDIIAPSGSPPKPGASIQLELKFTPCDKN  185

Query  2185  PRYRGGVTED---YGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWE  2015
             P YR G+  D    G++ +YFP+R G  V LYQDAHV EG LPEI +D GK +    CWE
Sbjct  186   PLYRQGIAGDPEHKGVRNAYFPLRKGSHVRLYQDAHVTEGILPEIPLDGGKLYKPGTCWE  245

Query  2014  DICHAILEAHHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLV  1835
             DICHAI EAHH++YIVGWS++HK+KL+RE TRPLP GG+L LGELLKYKS+EGVRVLLLV
Sbjct  246   DICHAISEAHHLIYIVGWSVFHKIKLIREQTRPLPRGGDLTLGELLKYKSEEGVRVLLLV  305

Query  1834  WDDKTSHSKFFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYT  1655
             WDDKTSH K  + T GVM THDEET+KFFKHSSV CVLAPRYASSKLS+ KQQ+VGT++T
Sbjct  306   WDDKTSHDKLGVKTPGVMATHDEETKKFFKHSSVNCVLAPRYASSKLSYFKQQIVGTIFT  365

Query  1654  HHQKCVIVDTQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEG  1475
             HHQKCV+VDTQA GNNRKITAFIGG+DLCDGRYDTP+HRLF D DTVF+ D++NPT+P  
Sbjct  366   HHQKCVLVDTQASGNNRKITAFIGGIDLCDGRYDTPEHRLFRDLDTVFKDDFHNPTYPI-  424

Query  1474  GLKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIE  1295
             G K PR+PWHDLHC+++GPAAYD+L NFEQRWRKA+K  EL  +FK++SHW DD L+KI 
Sbjct  425   GTKAPREPWHDLHCRLDGPAAYDVLINFEQRWRKATKLTELTFKFKRVSHWRDDYLIKIG  484

Query  1294  RISWITSP--------TPSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHT  1139
             RISWI SP        T  VP DD  + VS E DP+NWHVQ+FRSIDSGS+KGFPK +  
Sbjct  485   RISWILSPELSLKTNGTTIVPRDDNVVRVSKEDDPENWHVQIFRSIDSGSVKGFPKSIED  544

Query  1138  AETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIP  959
              + Q+L+CAKD+VID+SIQ AYI+AIR AQHFIYIENQYFLGSSYAWPSYK AGADNLIP
Sbjct  545   IDDQSLICAKDVVIDKSIQTAYIQAIRSAQHFIYIENQYFLGSSYAWPSYKNAGADNLIP  604

Query  958   MELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKS  779
             MELALKI SKIR  ERFAVY++IPMWPEG P +  VQ+IL+WQ QT+QMMY ++A+EL+ 
Sbjct  605   MELALKIASKIRANERFAVYVIIPMWPEGDPKTNTVQEILFWQSQTMQMMYSVVAQELRE  664

Query  778   EKIEDAHPCDYLNFYCLGNREE  713
              ++ DAHP DYL+FYCLG REE
Sbjct  665   MQV-DAHPQDYLSFYCLGKREE  685



>gb|EYU20517.1| hypothetical protein MIMGU_mgv1a018363mg [Erythranthe guttata]
Length=769

 Score =   920 bits (2378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/837 (57%), Positives = 595/837 (71%), Gaps = 81/837 (10%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRRHTRIITS  2501
             +   +YLHGD+DL I+EARR+ + + V E  R+                   RH      
Sbjct  3     NNETIYLHGDMDLVIVEARRITSTEFVYEDFRRL------------------RH------  38

Query  2500  DPYVKVCLAGATVART-RVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGV  2324
              PYVKV L  A VA+T RV ++SQ+P+W EHF++P+AHPV +               IG 
Sbjct  39    -PYVKVYLGEARVAQTTRVRADSQNPMWNEHFELPLAHPVDQE--------------IG-  82

Query  2323  AKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTEDYGLK  2144
             A V A++I  G+ I++WFP++G++G       AIRL + FTPC  NP Y  G++EDY +K
Sbjct  83    AFVPAKRIAIGDLIDEWFPVVGSNGTY----TAIRLQITFTPCDINPSYTSGISEDYSVK  138

Query  2143  ESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYIVG  1964
              SYFPMRHGG +TLYQDAHV +G LPEI +D G+ F    CWEDICH I EAH+++Y++G
Sbjct  139   RSYFPMRHGGKLTLYQDAHVIDGRLPEIGLDYGRKFEQNKCWEDICHTIWEAHNLIYVIG  198

Query  1963  WSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTSGV  1784
             WSIYHKV+L RE ++ LPNGG+LNLGELLKYKSQ+GVRV+LL+WDDKTSH   FI T G+
Sbjct  199   WSIYHKVRLAREDSKQLPNGGDLNLGELLKYKSQQGVRVVLLIWDDKTSHDNCFIKTGGL  258

Query  1783  MGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQGNNR  1604
             M THD+ETR FFKHS +TCVL  RY  +        V    Y+ HQKCVI DT+   NNR
Sbjct  259   MKTHDKETRNFFKHSPITCVLDARYRIN-------NVCRIFYSQHQKCVITDTKGHENNR  311

Query  1603  KITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCKIE  1424
             KITAF+GGLDLCDGRYDTP H+L+ D +T+F+ DY+NP F +    GPRQPWHDLHCKIE
Sbjct  312   KITAFLGGLDLCDGRYDTPDHQLYDDLNTLFKDDYHNPIFRQRE-NGPRQPWHDLHCKIE  370

Query  1423  GPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPNDDP  1244
             GPAAYD+L NFEQRW+KA++ +E  R  KKI    D  L+ IE+IS I+SP+ ++PND P
Sbjct  371   GPAAYDVLKNFEQRWKKATECSEFTRFCKKILGRDDYNLVDIEQISQISSPSGTIPNDHP  430

Query  1243  SLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEA  1064
             SLW S E D +NWH+Q+FRS+DS S+ GFP++V  A+ Q                    A
Sbjct  431   SLWASKEDDLENWHIQIFRSVDSESVVGFPRNVLAAKEQ--------------------A  470

Query  1063  IRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPM  884
             IR AQ FI+IENQYF+GSS+ W S ++AGA+NLIPMELALKIVSKIR +ERF+VY+VIPM
Sbjct  471   IRCAQRFIFIENQYFIGSSFGWTSKRKAGANNLIPMELALKIVSKIRTKERFSVYVVIPM  530

Query  883   WPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREEWHE  704
             WPEG P S  V+ ILYWQGQTIQMMY+II++ELKS   E+AHP DYLNFYCLGNREE H 
Sbjct  531   WPEGEPDSDSVRAILYWQGQTIQMMYQIISQELKSANFENAHPSDYLNFYCLGNREERHR  590

Query  703   ESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIA  524
             E +SS         + S+K  RFMIYVH+KGMVVDDEYVI+GSANINQRSMAG RDT+IA
Sbjct  591   EESSS--------DSTSEKYDRFMIYVHSKGMVVDDEYVIIGSANINQRSMAGHRDTKIA  642

Query  523   MGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENW  344
             MGAYQPH+T  + + HP  Q+YGYRMSLWAEHLG ++      E LECV+ +N +AE+NW
Sbjct  643   MGAYQPHYTCTRKKEHPCGQIYGYRMSLWAEHLGCIENCFKYHENLECVRYINNVAEDNW  702

Query  343   KRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALTT  173
             KRYTA++++ LQGH+LKYP+++  +G V+PL G E FPDVGG VLG+    P  +T 
Sbjct  703   KRYTADEYNQLQGHILKYPIEIGVDGSVNPLPGHELFPDVGGLVLGNPPIFPPVITA  759



>ref|XP_002511773.1| phospholipase d beta, putative [Ricinus communis]
 gb|EEF50442.1| phospholipase d beta, putative [Ricinus communis]
Length=1114

 Score =   918 bits (2373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/841 (54%), Positives = 590/841 (70%), Gaps = 28/841 (3%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRRHTRIITS  2501
             S  V+ LHG+LD+ I EA+ LPNMD+  + +   F           +G   R+    ITS
Sbjct  295   SLRVLLLHGNLDIYIYEAKNLPNMDMFHKTLGDMFNRLPGNIGSKIEGQMSRK----ITS  350

Query  2500  DPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVA  2321
             DPYV + + GA + RT VISNS+DPVW++HF +PVAH  +EV F VKD+DV G+  IGV 
Sbjct  351   DPYVSISVVGAVIGRTFVISNSEDPVWMQHFYVPVAHNAAEVHFLVKDSDVVGSQLIGVV  410

Query  2320  KVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT---EDYG  2150
              +  ++I SG  +   +PI+ ++GKP KP   +++ +++TP  +   Y  GV    + YG
Sbjct  411   AIPVEQIYSGARVEGVYPILNSNGKPCKPGATLKISIQYTPMEKLSIYHQGVGAGPDYYG  470

Query  2149  LKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYI  1970
             +  +YFP+R GG VTLYQDAHVP+G LP +K+D G ++ H  CW DI  AI  A  ++YI
Sbjct  471   VPGTYFPLRKGGTVTLYQDAHVPDGCLPNLKLDHGLSYVHGKCWHDIFDAIRHARRLIYI  530

Query  1969  VGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTS  1790
              GWS++HKV+L+R+         ++ LG+LL+ KSQEGVRVLLL+WDD TS S     T 
Sbjct  531   TGWSVWHKVRLIRD------ADPDVTLGDLLRSKSQEGVRVLLLIWDDPTSRSILGYRTD  584

Query  1789  GVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQGN  1610
             G+M THDEETR+FFKHSSV  +L PR A  + S+VKQ+ VGT+YTHHQK VIVD  A  N
Sbjct  585   GIMATHDEETRRFFKHSSVQVLLCPRIAGKRHSWVKQREVGTIYTHHQKTVIVDADAGNN  644

Query  1609  NRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCK  1430
              RKI AF+GGLDLCDGRYD P H LF    TV + DY+NPTF       PR+PWHDLH K
Sbjct  645   RRKIVAFVGGLDLCDGRYDAPHHPLFRTLQTVHKDDYHNPTFTGNVTGCPREPWHDLHSK  704

Query  1429  IEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPND  1250
             I+GPAAYD+LTNFE+RW KA++     +  KK+   +DDALL+IERI  I         D
Sbjct  705   IDGPAAYDVLTNFEERWFKAAR----PQGIKKLKMSYDDALLRIERIPDILGVF-----D  755

Query  1249  DPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYI  1070
              PS+    E DP+ WHVQ+FRSIDS S+KGFPKD   A ++NLVC K+++ID SI  AY+
Sbjct  756   APSV---GENDPEGWHVQIFRSIDSNSVKGFPKDPKEATSKNLVCGKNVLIDMSIHTAYV  812

Query  1069  EAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVI  890
             +AIR AQHFIYIENQYF+GSSY W SYK+ GA+NLIPME+ALKI  KIR  ERFA YIVI
Sbjct  813   KAIRAAQHFIYIENQYFIGSSYNWSSYKDLGANNLIPMEIALKIADKIRANERFAAYIVI  872

Query  889   PMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDA-HPCDYLNFYCLGNRE-  716
             PMWPEGVP+ A  Q IL+WQ +T+QMMYE I K L    +E+A  P DYLNF+CLGNRE 
Sbjct  873   PMWPEGVPTGAATQRILFWQHKTMQMMYETIYKALVEVGLENAFSPQDYLNFFCLGNREF  932

Query  715   -EWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSR  539
              +  + SA S     +     S+KS RFMIYVH+KGM+VDDEYVI+GSANINQRSM G+R
Sbjct  933   TDTCDTSAVSSPTAANNPQALSRKSRRFMIYVHSKGMIVDDEYVILGSANINQRSMEGTR  992

Query  538   DTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEI  359
             DTEIAMGAYQPHHTWA+ Q++P+ Q++GYRMSLWAEH+G ++    + E LECV+ +  +
Sbjct  993   DTEIAMGAYQPHHTWARKQSNPYGQIHGYRMSLWAEHVGGIEGCFTQPESLECVRRIRTL  1052

Query  358   AEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDAL  179
              E NWK++ A++ + ++GHLLKYP++VD  GKV P+ GCE FPDVGG ++GS   + + L
Sbjct  1053  GEMNWKQFAADEITEMKGHLLKYPVEVDRKGKVRPIPGCETFPDVGGNIVGSFLAIQENL  1112

Query  178   T  176
             T
Sbjct  1113  T  1113



>ref|XP_009418303.1| PREDICTED: phospholipase D delta-like [Musa acuminata subsp. 
malaccensis]
Length=759

 Score =   916 bits (2367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/647 (68%), Positives = 513/647 (79%), Gaps = 17/647 (3%)
 Frame = -2

Query  2611  MDIVSERIRQFFTAFDCRKP-----------ETRQGNKVRRHTRIITSDPYVKVCLAGAT  2465
             MD  SE +R+ +T+  C  P           +  Q ++   H +IITSDPYV   LAGAT
Sbjct  1     MDYFSEHLRRCYTS--CCPPIPGSTASKSGSDATQHHQNHHHRKIITSDPYVTASLAGAT  58

Query  2464  VARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVAKVSAQKIISGET  2285
             VARTRVISNS+DP W EHF IPVAH  S +E QVKDNDVFGA  IG+  +   +I +G+ 
Sbjct  59    VARTRVISNSEDPAWNEHFNIPVAHRASTLELQVKDNDVFGAQLIGIVSIPTARIAAGKK  118

Query  2284  INDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT---EDYGLKESYFPMRHGG  2114
             I DWFPIIG  GKPPKP+ A+ L +++ P  E P Y+ G+    E  G++ +YFP+R GG
Sbjct  119   IQDWFPIIGPKGKPPKPETALHLSIEYIPVEEEPEYQHGIAGDPEQLGVRNTYFPLRKGG  178

Query  2113  AVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYIVGWSIYHKVKLV  1934
             +VTLYQDAHV +  LPE+ ++ G  F HE CWEDICHAILEAHH++Y+VGWSIYHKVKLV
Sbjct  179   SVTLYQDAHVLDDELPEVTLEKGAVFKHEKCWEDICHAILEAHHLIYLVGWSIYHKVKLV  238

Query  1933  REPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTSGVMGTHDEETRK  1754
             REPTRPLP+ G L LG+LLKYKSQEGVRV +LVWDDKTSH K FI T GVM THDEET+K
Sbjct  239   REPTRPLPDAGKLTLGDLLKYKSQEGVRVCMLVWDDKTSHDKLFIKTGGVMQTHDEETKK  298

Query  1753  FFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQGNNRKITAFIGGLD  1574
             FFKHSSV CVL+PRYASSKLS VKQQVVGTL+THHQKCV+VDTQA GN RKITAFIGGLD
Sbjct  299   FFKHSSVICVLSPRYASSKLSIVKQQVVGTLFTHHQKCVLVDTQASGNMRKITAFIGGLD  358

Query  1573  LCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCKIEGPAAYDILTN  1394
             LCDGRYDTP+HRLF D DT F  D++NPTF   G+K PRQPWHDLHCKIEGPA YDIL N
Sbjct  359   LCDGRYDTPEHRLFRDLDTTFLNDFHNPTF-AAGIKAPRQPWHDLHCKIEGPAVYDILKN  417

Query  1393  FEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVPNDDPSLWVSNEGDP  1214
             FEQRWRKA++W E    FK  S WHDDAL+++ERISWI SP+PSVP+DDPSLWVS + D 
Sbjct  418   FEQRWRKATRWQEFSLCFKNPSGWHDDALIRLERISWILSPSPSVPDDDPSLWVSQQEDS  477

Query  1213  QNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRRAQHFIYI  1034
             + WHVQVFRSIDSGS+KGFP +V  A   NLVC K+LVID+SI  AY++AIR AQHFIYI
Sbjct  478   EQWHVQVFRSIDSGSVKGFPDNVQEASKMNLVCRKNLVIDKSIHTAYVKAIRSAQHFIYI  537

Query  1033  ENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPMWPEGVPSSAP  854
             ENQYFLGSSY WPSYK +GADNLIPMELALK+ SKIR  E FAVY+VIPMWPEGVP++  
Sbjct  538   ENQYFLGSSYGWPSYKHSGADNLIPMELALKVASKIRANEPFAVYVVIPMWPEGVPTTNA  597

Query  853   VQDILYWQGQTIQMMYEIIAKELKSEKIEDAHPCDYLNFYCLGNREE  713
             VQ+IL+WQGQTIQMMYEI+A+ LK   +E+AHP DYLNFYCLGNREE
Sbjct  598   VQEILFWQGQTIQMMYEIVARALKFMNLENAHPQDYLNFYCLGNREE  644


 Score =   148 bits (373),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = -2

Query  466  QVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYP  287
            +VYGYRMSLWAEHLGM+D++  E   LECVK VN+IAEENW RYTAE+ +PL GHLLKYP
Sbjct  662  EVYGYRMSLWAEHLGMIDDRFKEPNSLECVKFVNKIAEENWSRYTAEEITPLTGHLLKYP  721

Query  286  LQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALT  176
            ++V+++GKV PL   E FPDVGGK+LG+ T LPD LT
Sbjct  722  VKVEADGKVGPLPNQECFPDVGGKILGAYTALPDTLT  758



>ref|XP_010529524.1| PREDICTED: phospholipase D gamma 1 [Tarenaya hassleriana]
Length=856

 Score =   915 bits (2365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/850 (54%), Positives = 591/850 (70%), Gaps = 42/850 (5%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRRHTRIITS  2501
             S  V+ LHG+LD+ + EAR LPNMD+   ++ + F+ F  +     +G K  +    ITS
Sbjct  33    SMRVLLLHGNLDIWVKEARNLPNMDMFHNKLGEMFSGFSKKSANKAEGQKPSK----ITS  88

Query  2500  DPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVA  2321
             DPYV V + GA +ART VI+NS+ PVW++HF +PVAH  +EV F VKDND+FG+  IG  
Sbjct  89    DPYVTVSVCGAVIARTFVINNSESPVWMQHFDVPVAHNAAEVHFVVKDNDIFGSQIIGAV  148

Query  2320  KVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTE--DY-G  2150
              + A+++ SG  +  +FPI+ + GKP KP   + L ++FTP      Y+ GV    DY G
Sbjct  149   GIPAEQLWSGNKVEGFFPILNSSGKPCKPGAVLNLSIQFTPMERMSLYKMGVGSGPDYAG  208

Query  2149  LKESYFPMRHGGAVTLYQDAHVPEGS-LPEIKIDDGKAFHHENCWEDICHAILEAHHMVY  1973
             +  +YFP+R GG VTLYQDAHV +   LP + +D G  + H  CWED+  AI +A  +VY
Sbjct  209   VPGTYFPLRKGGRVTLYQDAHVDDDCMLPNLNLDGGIQYRHGRCWEDVASAISQARRLVY  268

Query  1972  IVGWSIYHKVKLVR---EPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFF  1802
             I GWS+YH V+LVR   +PT       +  LGELLK KSQEGVRVLLLVWDD TS S   
Sbjct  269   ITGWSVYHPVRLVRRNNDPT-------DGILGELLKSKSQEGVRVLLLVWDDPTSRSILG  321

Query  1801  INTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQ  1622
             I T GVMGT DEETR+FFKHSSV  +L PR      SF+K+  VGT+YTHHQK VIVD  
Sbjct  322   IKTQGVMGTSDEETRRFFKHSSVQVLLCPRSGGKGHSFIKKSEVGTIYTHHQKTVIVDAD  381

Query  1621  AQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHD  1442
             A  N RKI AF+GGLDLC+GRYDTP+H LF    T+ + D++NP F      GPR+PWHD
Sbjct  382   AGQNRRKIIAFVGGLDLCNGRYDTPKHPLFRTLRTLHKDDFHNPNFVTTADDGPREPWHD  441

Query  1441  LHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPS  1262
             LH +I+GPAAYD+L NFE+RW KASK   LG    K+    DD+LL+IERI  I   +  
Sbjct  442   LHSRIDGPAAYDVLANFEERWLKASKPRGLG----KLKTSRDDSLLRIERIPDIMGIS--  495

Query  1261  VPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQ  1082
                    +  +N+ DP++WHVQVFRSIDS S+KGFPKD   A  +NL+C K+++ID SI 
Sbjct  496   ------EISSANDNDPESWHVQVFRSIDSSSVKGFPKDPREATGRNLLCGKNILIDMSIH  549

Query  1081  MAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAV  902
              AY++AIR AQHFIYIENQYFLGSS+ W S K+ GA+NLIPME+ALKI +KIR RERF+V
Sbjct  550   AAYVKAIRSAQHFIYIENQYFLGSSFNWDSNKDLGANNLIPMEIALKIANKIRARERFSV  609

Query  901   YIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAH-PCDYLNFYCLG  725
             YIVIPMWPEG P+S P+Q IL+WQ +T+QMMYE I K L    ++  + P D+LNF+CLG
Sbjct  610   YIVIPMWPEGAPTSNPIQRILFWQHKTMQMMYETIYKALVEVGLDGQYEPQDFLNFFCLG  669

Query  724   NRE-------EWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANI  566
              RE        ++  + +   P   + L    KS RFMIYVH+KGM+VDDEYVI+GSANI
Sbjct  670   TREVPEGTVAVYNPRNQNQANPVQVQAL----KSRRFMIYVHSKGMIVDDEYVIIGSANI  725

Query  565   NQRSMAGSRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGL  386
             NQRS+ G+RDTEIAMG YQPHHTWA   + P  Q+YGYRMSLWAEHLG +++  ++AE L
Sbjct  726   NQRSLEGTRDTEIAMGGYQPHHTWAMKGSRPRGQIYGYRMSLWAEHLGFLEQGFEQAESL  785

Query  385   ECVKMVNEIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLG  206
             ECV+ V +++E NW+++ AE+ + ++GHLLKYP+QVD  GKV PL GCE FPDVGGK+LG
Sbjct  786   ECVRRVRQMSEFNWRQFAAEEVTEMKGHLLKYPVQVDRTGKVRPLPGCETFPDVGGKILG  845

Query  205   SRTTLPDALT  176
             S   + + LT
Sbjct  846   SFLAVQENLT  855



>ref|XP_002275783.1| PREDICTED: phospholipase D beta 1-like [Vitis vinifera]
 ref|XP_010661431.1| PREDICTED: phospholipase D beta 1-like [Vitis vinifera]
 ref|XP_010661435.1| PREDICTED: phospholipase D beta 1-like [Vitis vinifera]
Length=850

 Score =   915 bits (2365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/834 (55%), Positives = 585/834 (70%), Gaps = 25/834 (3%)
 Frame = -2

Query  2662  LHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRRHTRIITSDPYVKV  2483
             LHG+LD+ + EA+ LPNMD+    +   F  F  +   T +G+K  +    ITSDPYV +
Sbjct  36    LHGNLDIWVKEAKTLPNMDMFHRSLSDMFGRFSVKSAPTIEGHKPHK----ITSDPYVTI  91

Query  2482  CLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGVAKVSAQK  2303
              ++GA + RT VISNS++PVW++HF +PVAH  +EV F VKD+DV G+  IG   +  ++
Sbjct  92    SVSGAVIGRTFVISNSENPVWMQHFYVPVAHHAAEVHFVVKDSDVVGSQIIGAVGIPVEQ  151

Query  2302  IISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT---EDYGLKESYF  2132
             I SG  +   F I+   GKP KP   + L +++TP  +   Y+ GV    E  G+  +YF
Sbjct  152   IYSGSKVEGTFQILNGSGKPRKPGAVLTLSIQYTPIEKVTLYQFGVGSGPEYTGVPGTYF  211

Query  2131  PMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVYIVGWSIY  1952
             P+R G  VTLYQDAHV +G LP +K+D+   F H  CW DI  AI +A  ++YI GWS+Y
Sbjct  212   PLRTGSKVTLYQDAHVHDGCLPNLKLDNDVQFEHGKCWHDIFQAISQARRLIYITGWSVY  271

Query  1951  HKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINTSGVMGTH  1772
             H V+L+R+      N     LG LLK KSQEGVRVLLLVWDD TS S     T G+M T+
Sbjct  272   HSVRLIRD----TDNSTEFMLGHLLKTKSQEGVRVLLLVWDDPTSRSILGYKTDGIMQTY  327

Query  1771  DEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQGNNRKITA  1592
             DEETR+FFKHSSV  +L PR A    S++KQQ VGT+YTHHQK VIVD  A    RKI A
Sbjct  328   DEETRRFFKHSSVQVLLCPRSAGKGHSWIKQQEVGTIYTHHQKTVIVDADAGHYKRKIIA  387

Query  1591  FIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPWHDLHCKIEGPAA  1412
             FIGGLDLC GRYDTPQH +F    TV + DY+NP F       PR+PWHD+HC+I+GPAA
Sbjct  388   FIGGLDLCAGRYDTPQHHIFKTLQTVHQDDYHNPNFTGPTTGCPREPWHDMHCRIDGPAA  447

Query  1411  YDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITS-PTPSVPNDDPSLW  1235
             YDILTNFE+RW KASK   L ++ K  S+  DDALLK+ERIS I      S PN      
Sbjct  448   YDILTNFEERWLKASKPRGL-QKLKASSY--DDALLKLERISDIIGMADASCPN------  498

Query  1234  VSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMAYIEAIRR  1055
                E DP+ WHVQVFRSIDS S++GFPK+   A ++NLVC K+++ID SI  AY++AIR 
Sbjct  499   ---ENDPEAWHVQVFRSIDSTSVEGFPKEPKEATSKNLVCGKNILIDMSIHTAYVKAIRA  555

Query  1054  AQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYIVIPMWPE  875
             AQHFIYIENQYFLGSSY W SYK+ GA+NLIPME+ALKI +KIR +ERF+ YIVIPMWPE
Sbjct  556   AQHFIYIENQYFLGSSYNWASYKDLGANNLIPMEIALKIANKIRAKERFSAYIVIPMWPE  615

Query  874   GVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDA-HPCDYLNFYCLGNREEWHEES  698
             GVP+S P Q IL+WQ +T+QMMYE++ K L+   +E+  HP DYLNF+CLGNREE  + S
Sbjct  616   GVPTSTPTQRILFWQHKTMQMMYEMVYKALQEVGLENQYHPQDYLNFFCLGNREEGVDTS  675

Query  697   ASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAGSRDTEIAMG  518
              +      +     ++KS RFMIYVH+KGM+VDDEY+I+GSANINQRSM G+RDTEIAMG
Sbjct  676   NAGNQSAANTPQALARKSRRFMIYVHSKGMIVDDEYLIIGSANINQRSMEGTRDTEIAMG  735

Query  517   AYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVNEIAEENWKR  338
             AYQPHHTWA+ Q+ PH Q+YGYRMSLWAEH G+++E   + E +ECV+ +  + E NW++
Sbjct  736   AYQPHHTWARKQSSPHGQIYGYRMSLWAEHTGVLEECFKQPESVECVRRLRSLGELNWRQ  795

Query  337   YTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPDALT  176
             + A++ + ++GHLLKYP++V+  GKV PL G E FPDVGG ++G+ T + + LT
Sbjct  796   FAADQITEMKGHLLKYPVEVERTGKVRPLPGSETFPDVGGNIVGTFTAIQENLT  849



>gb|KDP28706.1| hypothetical protein JCGZ_14477 [Jatropha curcas]
Length=1129

 Score =   911 bits (2354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/843 (54%), Positives = 591/843 (70%), Gaps = 29/843 (3%)
 Frame = -2

Query  2680  SENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVR-RHTRIIT  2504
             S  V+ LHG+LD+ + +A+ LPNMD+  + I   F      K     GNK+  + +R IT
Sbjct  307   SLRVLLLHGNLDIWVYDAKDLPNMDMFHKTIGDMFN-----KLPGSIGNKIEGQMSRKIT  361

Query  2503  SDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGADFIGV  2324
             SDPYV + +AGA + RT VISN+++PVW +HF +PVAH  +EV F VKD+DV G+  +GV
Sbjct  362   SDPYVSISVAGAVIGRTFVISNNENPVWTQHFYVPVAHHAAEVHFLVKDSDVLGSQLMGV  421

Query  2323  AKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVTE--DY-  2153
               +  ++I SG  +   +PI+   GKP K    +R+ +++TP  +   Y  GV    DY 
Sbjct  422   VAIPVEQIYSGAKVEGTYPILNNSGKPCKHGAVLRISIQYTPMEKLSNYHKGVGAGPDYH  481

Query  2152  GLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEAHHMVY  1973
             G+  +YFP+R GG VTLYQDAHVP+  LP +K+D G ++ H  CW DI  AI  A  +VY
Sbjct  482   GVPGTYFPLRKGGTVTLYQDAHVPDDCLPSLKLDHGLSYEHGKCWHDIFDAIRHARRLVY  541

Query  1972  IVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSKFFINT  1793
             I GWS++HKV+L+R+   P       +L    + KSQEGVRVLLLVWDD TS S     T
Sbjct  542   ITGWSVWHKVRLIRDDANPSSEVTLGDLL---RSKSQEGVRVLLLVWDDPTSRSILGYKT  598

Query  1792  SGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVDTQAQG  1613
              G+M THDEETR+FFKHSSV  +L PR A  K S+VKQ+ VGT+YTHHQK VIVD  A  
Sbjct  599   DGIMATHDEETRRFFKHSSVQVLLCPRIAGKKHSWVKQREVGTIYTHHQKTVIVDADAGN  658

Query  1612  NNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKG-PRQPWHDLH  1436
             N RKI AF+GGLDLCDGRYDTP H +F    TV + DY+NPTF  G + G PR+PWHDLH
Sbjct  659   NRRKILAFVGGLDLCDGRYDTPHHPIFRTLQTVHKDDYHNPTF-TGNVSGCPREPWHDLH  717

Query  1435  CKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPTPSVP  1256
             C+I+GPAAYD+LTNFE+RW KA+K        KK+   +DDALL+IERI  I        
Sbjct  718   CRIDGPAAYDVLTNFEERWFKAAK----PHGIKKLKMSYDDALLRIERIPDIIGVF----  769

Query  1255  NDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRSIQMA  1076
              D PS+    + DP+ WH Q+FRSIDS S++GFPKD   A +++LVC K+++ID SI  A
Sbjct  770   -DAPSV---GDNDPEVWHCQIFRSIDSNSVRGFPKDPREATSKSLVCGKNVLIDMSIHTA  825

Query  1075  YIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERFAVYI  896
             Y++AIR AQHFIYIENQYF+GSSY W SYK+ GA+NLIPME+ALKI  KIR  ERFA YI
Sbjct  826   YVKAIRAAQHFIYIENQYFIGSSYNWSSYKDLGANNLIPMEIALKIADKIRANERFAAYI  885

Query  895   VIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAH-PCDYLNFYCLGNR  719
             VIPMWPEGVP+ A  Q IL+WQ +T+QMMYE I K L+   +E+ + P DYLNF+CLGNR
Sbjct  886   VIPMWPEGVPTGAATQRILFWQNKTMQMMYETIYKALEEVGLENVYTPQDYLNFFCLGNR  945

Query  718   E--EWHEESASSPTPGCSEFLTGSQKSGRFMIYVHAKGMVVDDEYVIVGSANINQRSMAG  545
             E  + +E SA S     +     S+K+ RFMIYVH+KGM+VDDEYVI+GSANINQRSM G
Sbjct  946   EFTDTYETSAVSSPTAANTPQALSRKTRRFMIYVHSKGMIVDDEYVILGSANINQRSMEG  1005

Query  544   SRDTEIAMGAYQPHHTWAKNQNHPHAQVYGYRMSLWAEHLGMMDEKLDEAEGLECVKMVN  365
             +RDTEIAMGAYQPHHTWA+ Q++P+ Q+YGYRM+LWAEH+G +++   + E L+CV+ + 
Sbjct  1006  TRDTEIAMGAYQPHHTWARKQSNPYGQIYGYRMALWAEHVGAIEDCFTQPESLDCVRRIR  1065

Query  364   EIAEENWKRYTAEKFSPLQGHLLKYPLQVDSNGKVSPLGGCEYFPDVGGKVLGSRTTLPD  185
              + E NW+++ A+  + ++GHLLKYP++VD  GKV P+ GCE FPDVGG ++GS   + +
Sbjct  1066  TLGEMNWRQFAADDVTEMRGHLLKYPVEVDRKGKVRPIPGCENFPDVGGNIVGSFLAIQE  1125

Query  184   ALT  176
              LT
Sbjct  1126  NLT  1128



>ref|XP_007040091.1| Phospholipase D beta 1 [Theobroma cacao]
 gb|EOY24592.1| Phospholipase D beta 1 [Theobroma cacao]
Length=852

 Score =   910 bits (2352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/850 (54%), Positives = 586/850 (69%), Gaps = 34/850 (4%)
 Frame = -2

Query  2698  KMSDGMSENVVYLHGDLDLKILEARRLPNMDIVSERIRQFFTAFDCRKPETRQGNKVRRH  2519
             K +DG S  V+ LHG+LD+ + EA+ LPNMDI  +++   F  F+ +     +G+   + 
Sbjct  27    KTTDG-SLKVLLLHGNLDIWVKEAKNLPNMDIFHKKLGDVFGKFNLKVSSKIEGHMPHK-  84

Query  2518  TRIITSDPYVKVCLAGATVARTRVISNSQDPVWVEHFKIPVAHPVSEVEFQVKDNDVFGA  2339
                ITSDPYV V  AGA + RT VISN+++PVW++HF IPVAH   EV F VKD+DV G+
Sbjct  85    ---ITSDPYVTVSAAGAVIGRTFVISNTENPVWMQHFNIPVAHYAPEVHFVVKDSDVVGS  141

Query  2338  DFIGVAKVSAQKIISGETINDWFPIIGAHGKPPKPDCAIRLMMKFTPCAENPRYRGGVT-  2162
               +G   +  +K+ SG  +   FPI+ A GKP KP   + L +++TP  +   Y  G+  
Sbjct  142   QIMGAVGIPVEKLCSGTKVEGTFPILNASGKPCKPGAVLTLSIQYTPTEKVALYHRGLGS  201

Query  2161  --EDYGLKESYFPMRHGGAVTLYQDAHVPEGSLPEIKIDDGKAFHHENCWEDICHAILEA  1988
               + +G+  +YFP+R GG VTLYQD HV +G LP +K+D    + H NCW+DIC+AI +A
Sbjct  202   GPDHHGVPGTYFPLRKGGKVTLYQDVHVHDGFLPNLKVDGNVQYEHGNCWQDICNAISQA  261

Query  1987  HHMVYIVGWSIYHKVKLVREPTRplpnggnlnlgelLKYKSQEGVRVLLLVWDDKTSHSK  1808
               ++YI GWS+YH V+LVRE  +   +     L    K KSQEGVRVLLLVWDD TS S 
Sbjct  262   RRLIYIAGWSVYHNVRLVRETDKATNSTLGDLL----KTKSQEGVRVLLLVWDDPTSRSI  317

Query  1807  FFINTSGVMGTHDEETRKFFKHSSVTCVLAPRYASSKLSFVKQQVVGTLYTHHQKCVIVD  1628
                 T G+M T+DEETR+FFKHSSV  +L PR A  + S+VK+Q  GT+YTHHQK VIVD
Sbjct  318   LGYKTEGIMHTNDEETRRFFKHSSVQVLLCPRSAG-RGSWVKKQETGTIYTHHQKTVIVD  376

Query  1627  TQAQGNNRKITAFIGGLDLCDGRYDTPQHRLFSDRDTVFRGDYNNPTFPEGGLKGPRQPW  1448
               A  N RK+TAF+GGLDLC+GRYDTP H LF    TV + DY NP F E     PRQPW
Sbjct  377   ADAGNNKRKVTAFVGGLDLCNGRYDTPNHPLFRTLQTVHKDDYRNPNFTENDAGCPRQPW  436

Query  1447  HDLHCKIEGPAAYDILTNFEQRWRKASKWAELGRRFKKISHWHDDALLKIERISWITSPT  1268
             HDLHC+I+GPAAYDILTNFE+RW KASK   L    +K+    DDALLKIERI  I   T
Sbjct  437   HDLHCRIDGPAAYDILTNFEERWLKASKPHGL----QKLKTSVDDALLKIERIPEIAGIT  492

Query  1267  PSVPNDDPSLWVSNEGDPQNWHVQVFRSIDSGSLKGFPKDVHTAETQNLVCAKDLVIDRS  1088
                  + P L    E DP+ WHVQVFRSIDS S+KGFP D   A   NLVC K+++ID S
Sbjct  493   -----EIPYL---REDDPETWHVQVFRSIDSNSVKGFPDDPKDATRMNLVCGKNVLIDMS  544

Query  1087  IQMAYIEAIRRAQHFIYIENQYFLGSSYAWPSYKEAGADNLIPMELALKIVSKIRNRERF  908
             I  AY+ AIR AQ FIYIENQYFLGSS+ W S+K+ GA+NLIPME+ALKI +KIR+ ERF
Sbjct  545   IHTAYVNAIRAAQRFIYIENQYFLGSSFNWDSHKDLGANNLIPMEIALKIANKIRSNERF  604

Query  907   AVYIVIPMWPEGVPSSAPVQDILYWQGQTIQMMYEIIAKELKSEKIEDAH-PCDYLNFYC  731
             + YI+IPMWPEGV +S P+Q IL+WQ +T+QMMY+I+ K L    +E+ + P D+LNF+C
Sbjct  605   SAYILIPMWPEGVTTSTPIQRILFWQHKTMQMMYDIVYKALVEVGLENKYEPQDFLNFFC  664

Query  730   LGNREEWHEESASSPTPGCSEFLTGS-----QKSGRFMIYVHAKGMVVDDEYVIVGSANI  566
             LGNRE  +   +  P    S F + S     QK+ RFMIY+H+KGM+VDDEYVI+GSANI
Sbjct  665   LGNREAVNGGDSLDPR---SSFASNSPQALAQKNRRFMIYIHSKGMIVDDEYVIIGSANI  721

Query  565   NQRS