BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c28389_g1_i1 len=973 path=[1:0-972]

Length=973
                                                                      Score     E

ref|XP_011083422.1|  PREDICTED: uncharacterized protein At1g76070       197   3e-57   
ref|XP_011074719.1|  PREDICTED: uncharacterized protein At1g76070...    182   7e-52   
ref|XP_009624103.1|  PREDICTED: uncharacterized protein At1g76070...    182   1e-51   
ref|XP_007017912.1|  Uncharacterized protein TCM_034301                 182   2e-51   
ref|XP_009776325.1|  PREDICTED: uncharacterized protein At1g76070...    178   4e-50   
gb|KDP36872.1|  hypothetical protein JCGZ_08163                         177   2e-49   
ref|XP_002510598.1|  conserved hypothetical protein                     176   5e-49   Ricinus communis
ref|XP_010266908.1|  PREDICTED: uncharacterized protein At1g76070       172   1e-47   
ref|XP_007160614.1|  hypothetical protein PHAVU_001G002200g             166   1e-45   
ref|XP_010266059.1|  PREDICTED: uncharacterized protein At1g76070...    166   3e-45   
ref|XP_009620052.1|  PREDICTED: uncharacterized protein At1g76070       162   6e-44   
ref|XP_009770080.1|  PREDICTED: uncharacterized protein At1g76070       162   8e-44   
emb|CDP07343.1|  unnamed protein product                                161   2e-43   
ref|XP_004499311.1|  PREDICTED: uncharacterized protein At1g76070...    157   3e-42   
emb|CAN83887.1|  hypothetical protein VITISV_001638                     157   4e-42   Vitis vinifera
ref|XP_010664129.1|  PREDICTED: uncharacterized protein At1g76070       157   5e-42   
ref|XP_004238391.1|  PREDICTED: uncharacterized protein At1g76070...    155   1e-41   
ref|XP_011034958.1|  PREDICTED: uncharacterized protein At1g76070...    157   1e-41   
ref|XP_003603835.1|  Syringolide-induced protein 14-1-1                 155   3e-41   
ref|XP_003545011.1|  PREDICTED: uncharacterized protein At1g76070...    154   5e-41   
ref|XP_010935181.1|  PREDICTED: uncharacterized protein At1g76070...    153   9e-41   
ref|XP_006601369.1|  PREDICTED: uncharacterized protein At1g76070...    152   2e-40   
ref|XP_002301948.2|  hypothetical protein POPTR_0002s01800g             153   2e-40   Populus trichocarpa [western balsam poplar]
ref|XP_003589562.1|  Syringolide-induced protein 14-1-1                 150   1e-39   
gb|AFK40605.1|  unknown                                                 150   2e-39   
ref|XP_004253207.1|  PREDICTED: uncharacterized protein At1g76070...    149   5e-39   
ref|XP_010941356.1|  PREDICTED: uncharacterized protein At1g76070...    148   6e-39   
gb|AGV54595.1|  syringolide-induced protein 14-1-1                      146   5e-38   
ref|XP_006342084.1|  PREDICTED: uncharacterized protein At1g76070...    145   1e-37   
ref|XP_006342559.1|  PREDICTED: uncharacterized protein At1g76070...    145   2e-37   
ref|XP_008806152.1|  PREDICTED: uncharacterized protein At1g76070       144   3e-37   
ref|XP_008813523.1|  PREDICTED: uncharacterized protein At1g76070...    143   3e-37   
gb|EYU17564.1|  hypothetical protein MIMGU_mgv1a022821mg                141   2e-36   
ref|XP_010100120.1|  hypothetical protein L484_014311                   142   5e-36   
ref|XP_006473720.1|  PREDICTED: uncharacterized protein At1g76070...    140   2e-35   
ref|XP_006435260.1|  hypothetical protein CICLE_v10002153mg             139   5e-35   
ref|XP_011003109.1|  PREDICTED: uncharacterized protein At1g76070       138   6e-35   
ref|XP_002306958.2|  hypothetical protein POPTR_0005s26690g             134   2e-33   Populus trichocarpa [western balsam poplar]
ref|XP_010667470.1|  PREDICTED: uncharacterized protein At1g76070       135   2e-33   
ref|XP_007136125.1|  hypothetical protein PHAVU_009G019900g             133   6e-33   
ref|XP_010061108.1|  PREDICTED: uncharacterized protein At1g76070...    132   4e-32   
ref|XP_007226351.1|  hypothetical protein PRUPE_ppa022618mg             130   1e-31   
gb|KHN48527.1|  Hypothetical protein glysoja_043906                     127   6e-31   
ref|XP_008221203.1|  PREDICTED: uncharacterized protein At1g76070...    127   7e-31   
ref|XP_009414427.1|  PREDICTED: uncharacterized protein At1g76070...    125   2e-30   
gb|KHN09055.1|  Hypothetical protein glysoja_034240                     125   6e-30   
ref|XP_004292930.1|  PREDICTED: uncharacterized protein At1g76070...    125   6e-30   
gb|KGN60065.1|  hypothetical protein Csa_3G875410                       124   8e-30   
ref|XP_003527495.1|  PREDICTED: uncharacterized protein At1g76070...    124   2e-29   
ref|XP_010034704.1|  PREDICTED: uncharacterized protein At1g76070...    123   2e-29   
ref|XP_008466454.1|  PREDICTED: uncharacterized protein At1g76070       122   3e-29   
ref|XP_004500912.1|  PREDICTED: uncharacterized protein At1g76070...    122   5e-29   
ref|XP_008377124.1|  PREDICTED: uncharacterized protein At1g76070       121   1e-28   
ref|XP_009334570.1|  PREDICTED: uncharacterized protein At1g76070...    120   5e-28   
ref|XP_008387901.1|  PREDICTED: uncharacterized protein At1g76070...    119   9e-28   
ref|XP_010646649.1|  PREDICTED: uncharacterized protein At1g76070...    119   2e-27   
gb|AFK37300.1|  unknown                                                 115   4e-26   
gb|KFK34451.1|  hypothetical protein AALP_AA5G147100                    112   2e-25   
ref|NP_001237090.1|  syringolide-induced protein 14-1-1                 112   3e-25   
gb|AAR23807.1|  putative syringolide-induced protein 14-1-1             112   3e-25   Helianthus annuus
ref|XP_010536440.1|  PREDICTED: uncharacterized protein At1g76070       111   6e-25   
ref|XP_009128151.1|  PREDICTED: uncharacterized protein At1g76070...    109   3e-24   
ref|NP_565125.1|  uncharacterized protein                               108   6e-24   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65454.1|  unknown                                                 108   6e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006390241.1|  hypothetical protein EUTSA_v10018992mg             108   8e-24   
ref|XP_006828842.1|  hypothetical protein AMTR_s00001p00151610          106   3e-23   
ref|XP_010428658.1|  PREDICTED: uncharacterized protein At1g76070...    106   3e-23   
emb|CDY62977.1|  BnaCnng41180D                                          105   5e-23   
ref|XP_006302690.1|  hypothetical protein CARUB_v10020800mg             105   1e-22   
gb|EYU36812.1|  hypothetical protein MIMGU_mgv1a015184mg                101   3e-22   
ref|XP_010471756.1|  PREDICTED: uncharacterized protein At1g76070...    103   3e-22   
ref|XP_002887625.1|  hypothetical protein ARALYDRAFT_476758             103   3e-22   
ref|XP_006416413.1|  hypothetical protein EUTSA_v10009337mg             100   3e-21   
ref|XP_010416518.1|  PREDICTED: uncharacterized protein At1g76070...    100   4e-21   
ref|XP_006303317.1|  hypothetical protein CARUB_v10010139mg           99.8    5e-21   
ref|XP_002530640.1|  conserved hypothetical protein                   97.8    2e-20   Ricinus communis
ref|XP_009106258.1|  PREDICTED: uncharacterized protein At1g76070     96.7    8e-20   
emb|CDY29360.1|  BnaA06g14360D                                        96.3    1e-19   
ref|XP_010063290.1|  PREDICTED: uncharacterized protein At1g76070...  95.5    4e-19   
ref|XP_004136484.1|  PREDICTED: uncharacterized protein At1g76070...  93.2    6e-19   
ref|XP_007046583.1|  Uncharacterized protein TCM_000126               92.4    2e-18   
ref|XP_009149514.1|  PREDICTED: uncharacterized protein At1g76070     90.9    6e-18   
ref|XP_006383036.1|  hypothetical protein POPTR_0005s10930g           89.7    1e-17   
ref|XP_011022278.1|  PREDICTED: uncharacterized protein At1g76070...  86.7    1e-16   
ref|XP_002890378.1|  hypothetical protein ARALYDRAFT_472259           85.5    4e-16   
ref|NP_564111.1|  uncharacterized protein                             85.1    5e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CDY01382.1|  BnaA07g11550D                                        84.3    9e-16   
gb|AAF88158.1|AC026234_9  Contains similarity to a hypothetical p...  84.3    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009103346.1|  PREDICTED: uncharacterized protein At1g76070...  82.8    4e-15   
gb|KFK44152.1|  hypothetical protein AALP_AA1G221900                  82.0    6e-15   
emb|CDY71911.1|  BnaAnng39270D                                        81.3    8e-15   
ref|XP_010459713.1|  PREDICTED: uncharacterized protein At1g76070...  81.3    1e-14   
emb|CDY31898.1|  BnaC07g15480D                                        79.7    4e-14   
emb|CDY51338.1|  BnaCnng20750D                                        79.3    7e-14   
gb|ABI84248.1|  syringolide-induced protein 14-1-1                    75.5    2e-13   Arachis hypogaea [goober]
gb|ACU15796.1|  unknown                                               75.1    1e-12   Glycine max [soybeans]
emb|CBI18914.3|  unnamed protein product                              75.9    1e-12   
ref|XP_009406454.1|  PREDICTED: uncharacterized protein At1g76070...  73.6    4e-12   
ref|XP_010498465.1|  PREDICTED: uncharacterized protein At1g76070...  74.3    4e-12   
ref|XP_010477264.1|  PREDICTED: uncharacterized protein At1g76070...  74.3    4e-12   
emb|CDX73226.1|  BnaC06g36740D                                        70.5    2e-11   
ref|NP_001144908.1|  uncharacterized protein LOC100278020             72.0    3e-11   Zea mays [maize]
dbj|BAK07532.1|  predicted protein                                    70.5    1e-10   
ref|XP_004289067.1|  PREDICTED: uncharacterized protein At1g76070...  68.9    2e-10   
ref|XP_003578554.1|  PREDICTED: uncharacterized protein At1g76070...  68.9    5e-10   
ref|XP_002460593.1|  hypothetical protein SORBIDRAFT_02g031530        67.4    1e-09   Sorghum bicolor [broomcorn]
gb|EMT18858.1|  hypothetical protein F775_31491                       65.1    9e-09   
ref|XP_006575799.1|  PREDICTED: uncharacterized protein At1g76070...  61.2    5e-08   
ref|XP_004957518.1|  PREDICTED: uncharacterized protein At1g76070...  62.4    7e-08   
ref|NP_001063825.1|  Os09g0542900                                     62.0    1e-07   Oryza sativa Japonica Group [Japonica rice]
gb|EEE70148.1|  hypothetical protein OsJ_30196                        61.6    1e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009337115.1|  PREDICTED: uncharacterized protein At1g76070...  60.1    1e-07   
ref|XP_008361352.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  60.1    2e-07   
ref|XP_009363560.1|  PREDICTED: uncharacterized protein At1g76070...  58.9    3e-07   
gb|KHN35994.1|  hypothetical protein glysoja_003117                   57.0    2e-06   
ref|XP_008653553.1|  PREDICTED: uncharacterized protein At1g76070...  54.3    3e-05   
gb|AAF79816.1|AC007396_16  T4O12.28                                   51.6    5e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010113284.1|  hypothetical protein L484_026613                 51.2    1e-04   



>ref|XP_011083422.1| PREDICTED: uncharacterized protein At1g76070 [Sesamum indicum]
Length=255

 Score =   197 bits (500),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 133/258 (52%), Positives = 166/258 (64%), Gaps = 16/258 (6%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSA--AISFQSLPFSPGRDKRP-AAAADIKTHCNKGFSGPII  260
            MEK    SK+K IL+FLPK+A  A+SFQ+  FSPGRDKRP   +  +KTH +KGFSGPI+
Sbjct  1    MEKAAAKSKSK-ILRFLPKAAQAAVSFQNPQFSPGRDKRPDVNSHKLKTHLSKGFSGPIV  59

Query  261  SIIPAEARRKS-GMDTQEPSSPKVSCIGqikhkkkmakqkrqq--PRVDPLPTKKDYARS  431
            S+IPAEAR KS   +TQEP+SPKVSC+GQIKH+ K++ +K         P    K     
Sbjct  60   SMIPAEARGKSKNFETQEPTSPKVSCMGQIKHRNKISAKKHASLPKEFKPASFAKPEKIR  119

Query  432  LTTSFQEISSSSAAIGKIFHG-RRSDATADSSRLRVCEDAPSLGQMKRFASGRETLSDFN  608
             T    E+    + I KIF G R+SDA+AD  R  + + APSL QM+RFAS R+T ++F+
Sbjct  120  ETRPAPELKKKPSGIKKIFGGGRKSDASADHGRPPLPDRAPSLSQMRRFASSRDTFANFD  179

Query  609  WTTASTATAQVVPH-GRKYCLDNDS--DDEYEEISIPFSAPMFGGHGSTTLPLEPRKEIN  779
            WTTA     Q+ P   R Y  D D    D  +++ IPFSAP+  G       LEPRKEIN
Sbjct  180  WTTA-----QIAPEEDRDYFSDEDRGYSDGEDDVFIPFSAPIPMGGAGRDSGLEPRKEIN  234

Query  780  LWKRRTMAQPKPLQLNAV  833
            LWKRRTMAQP PLQLN V
Sbjct  235  LWKRRTMAQPTPLQLNMV  252



>ref|XP_011074719.1| PREDICTED: uncharacterized protein At1g76070-like [Sesamum indicum]
Length=247

 Score =   182 bits (463),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 127/258 (49%), Positives = 162/258 (63%), Gaps = 47/258 (18%)
 Frame = +3

Query  126  ILKFLPKS--AAISFQSLPFSPGRDKRP-AAAADIKTHCNKGFSGPIISIIPAEARRKSG  296
            +LKF+P++  AA+SFQ+LPFSP RD+RP   A   ++H NKGFSGPI+S+IPAEAR KS 
Sbjct  13   VLKFIPRAVQAAVSFQNLPFSPRRDRRPDVNALRPRSHLNKGFSGPIVSMIPAEARGKSN  72

Query  297  -MDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTTSFQEISSS---  464
              +TQEP+SPKVSC+GQIKHKKK                 +    SL   F+ +S S   
Sbjct  73   NFETQEPTSPKVSCMGQIKHKKK---------------ISRKKHASLPKEFKPVSRSQPE  117

Query  465  --SAAIG--------KIFHG---RRSDATADSSRLRVCEDAPSLGQMKRFASGRETLSDF  605
              +AA G        K+F G   R  D + D +   V   APSL QM+RFAS RET ++F
Sbjct  118  KTNAARGPASKPSGMKLFFGAGGRSDDGSKDHAEPSVA--APSLSQMRRFASSRETFANF  175

Query  606  NWTTASTATAQVVPH-GRKYCLDN---DSDDEYEEISIPFSAPMFGGHGSTTLPLEPRKE  773
            +WTTA     Q+ P   R++  D    DSD E +++ IPFSAP+  G G  +L LEPRKE
Sbjct  176  DWTTA-----QIAPEEDREFFSDEERGDSDAE-DDVIIPFSAPIMVGCGVASLELEPRKE  229

Query  774  INLWKRRTMAQPKPLQLN  827
            INLWKRRTMA+P+PLQLN
Sbjct  230  INLWKRRTMARPQPLQLN  247



>ref|XP_009624103.1| PREDICTED: uncharacterized protein At1g76070-like [Nicotiana 
tomentosiformis]
Length=246

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 120/260 (46%), Positives = 154/260 (59%), Gaps = 26/260 (10%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSAAISFQSL-----PFSPGRDKRPAAAADIKTHCNKGFSGP  254
            MEKP K SK K I K LPK+AA +   L     PFSP R++R A     K H  KG++GP
Sbjct  1    MEKPCK-SKKKTIFKLLPKAAAAAVFILQNAHAPFSPSREQRLATDHHHKNHHYKGYAGP  59

Query  255  IISIIPAEARRKSGMDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSL  434
            IIS+IPA+   +SG +  EPSSPKVSCIGQIK  KK          +     KK    S 
Sbjct  60   IISVIPAD---QSGRNKSEPSSPKVSCIGQIKRNKKKMLNCSSSKNLQKYHVKKKSVSSF  116

Query  435  TTSFQEISSSSAAIGKIFHGRRSDATADSSRLRVCEDAPSLGQMKRFASGRETLSDFNWT  614
               F   SS      K+  GR+SD +AD+   ++ + AP L QMKRFASGRE L++F+W 
Sbjct  117  GNIFAGKSS------KLLPGRKSDVSADNIIAKLPDRAPCLSQMKRFASGREPLTNFDWR  170

Query  615  TASTATAQVVP--HGRKYCLDND----SDDEYEEISIPFSAPMFGGHGSTTLPLEPRKEI  776
            +      Q+ P  H  KY  D++    S+DE +E++  FSAP+  G   T + LEPRKEI
Sbjct  171  ST-----QITPEDHDLKYYTDDEDRGYSEDEEDELNTGFSAPIILGRCRTNITLEPRKEI  225

Query  777  NLWKRRTMAQPKPLQLNAVI  836
            N+WKRRTM QP+PLQLN V+
Sbjct  226  NIWKRRTMNQPRPLQLNTVV  245



>ref|XP_007017912.1| Uncharacterized protein TCM_034301 [Theobroma cacao]
 gb|EOY15137.1| Uncharacterized protein TCM_034301 [Theobroma cacao]
Length=248

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 121/266 (45%), Positives = 163/266 (61%), Gaps = 38/266 (14%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSAA---ISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPII  260
            MEK  KP     ILKFLPK+A+   ++FQ+ PFSPGRDKR       K +  +GFSGPI+
Sbjct  1    MEKQAKPRNK--ILKFLPKAASAVSVTFQNPPFSPGRDKRYDNTGKHKAYAGRGFSGPIV  58

Query  261  SIIPAEARRKSG---MDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARS  431
            SIIP EARRKS     +TQEP+SPKVSC+GQIK KK +        +   +   K+    
Sbjct  59   SIIPDEARRKSKSETFETQEPTSPKVSCMGQIKQKKNIR-------KAKRVSRPKELKPV  111

Query  432  LTTSFQEISSSSAAIGKIFH----GRRSDATADSSRLRVCEDAPSLGQMKRFASGRETLS  599
              +S +E+   ++ + +IF      R+S+ ++  + L   + APSLGQMKRFASGR+  S
Sbjct  112  SGSSEEEVKKHASKLKRIFSMAKPARKSETSSKKTEL--PDRAPSLGQMKRFASGRDAFS  169

Query  600  DFNWTTASTATAQVVP---HGRKYCLDN---DSDDEYEEISIPFSAPM-FGGHGSTTLPL  758
            +F+W       AQ+ P     R Y  D    DSD E +++ IPFSAPM  GG     +PL
Sbjct  170  NFDW------MAQIAPAEADHRDYYSDEERRDSDVEDDDVIIPFSAPMRVGGE----MPL  219

Query  759  EPRKEINLWKRRTMAQPKPLQLNAVI  836
            +PRKEINLWKRRTM  P+PL+LN+++
Sbjct  220  QPRKEINLWKRRTMNPPRPLRLNSMV  245



>ref|XP_009776325.1| PREDICTED: uncharacterized protein At1g76070-like [Nicotiana 
sylvestris]
Length=245

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 118/258 (46%), Positives = 149/258 (58%), Gaps = 23/258 (9%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSAAISFQSL-----PFSPGRDKRPAAAADIKTHCNKGFSGP  254
            MEKP K SK K I K LPK+AA +   L     PFSP R++R A     K H  KGF+GP
Sbjct  1    MEKPCK-SKKKTIFKLLPKAAAAAVFLLQNAHAPFSPSREQRLATDYHHKNHHYKGFAGP  59

Query  255  IISIIPAEARRKSGMDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSL  434
            IIS+IPA+   +SG +  EPSSPKVSCIGQIKH KK          +     KK    S 
Sbjct  60   IISVIPAD---QSGRNKSEPSSPKVSCIGQIKHNKKKMLNCSSSKNLQKHHVKKKSVSSF  116

Query  435  TTSFQEISSSSAAIGKIFHGRRSDATADSSRLRVCEDAPSLGQMKRFASGRETLSDFNWT  614
               F       A   K+  GR+SD +AD+   ++ + AP L QMKRFASGRE L++F+W 
Sbjct  117  GNIF-------AGKAKLLPGRKSDVSADNIIAKLPDRAPCLSQMKRFASGREPLNNFDWR  169

Query  615  TASTATAQVVPHGRKYCLDND----SDDEYEEISIPFSAPMFGGHGSTTLPLEPRKEINL  782
            +          H  KY  D++    S+DE +E++  F AP+  G   T   LEPRKEIN+
Sbjct  170  SIQITAED---HDLKYYTDDEDRGYSEDEEDELNTGFPAPIIIGRCRTNFTLEPRKEINI  226

Query  783  WKRRTMAQPKPLQLNAVI  836
            WKRRTM QP+PLQLN V+
Sbjct  227  WKRRTMNQPRPLQLNTVV  244



>gb|KDP36872.1| hypothetical protein JCGZ_08163 [Jatropha curcas]
Length=253

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 127/268 (47%), Positives = 162/268 (60%), Gaps = 33/268 (12%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSA-AISFQSLPFSPGRDKRP--AAAADIKTHCNKGFSGPII  260
            MEK  +P     ILKFLPK+A A+ F + PFSP RD+R        +K H  KGFSGP +
Sbjct  1    MEK--QPKSKNNILKFLPKAASAVYFHNPPFSPNRDRRSDNNYCHRLKAHVGKGFSGPFV  58

Query  261  SIIPAEARRK---SGMDTQEPSSPKVSCIGqikhkkkmakqkrqq---PRVDPLPTKKDY  422
            S+IP E RRK      +TQEP+SPKVSCIGQIKHKKKM  + ++      +  + + +D 
Sbjct  59   SMIPDEVRRKPKNGSFETQEPTSPKVSCIGQIKHKKKMVNKTKRTSPPKEIKAVSSPRD-  117

Query  423  ARSLTTSFQEISSSSAAIGKIFHGRRSDATADSSRLRVCEDAPSLGQMKRFASGRETLSD  602
             +   + F+ + S SA   K   GRRSDA+    R  + + APSLGQMKRFASGR+T S+
Sbjct  118  VKKHASKFKRLFSISA---KPTAGRRSDASI-YDRPPLSDRAPSLGQMKRFASGRDTFSN  173

Query  603  FNWTTASTATAQVVP---HGRKYCLDNDS-----DDEYEEISIPFSAPMFGGHGSTTLPL  758
            F+WT      AQ+ P     R Y  D D        E +E+ IPFSAPM  G G+    L
Sbjct  174  FDWT------AQITPVESDHRDYSSDEDDRMYCHQGEEDEVIIPFSAPMLIGSGAA---L  224

Query  759  EPRKEINLWKRRTMAQPKPLQLNAVIRS  842
            +PRKE+NLWKRRTM  PKPLQLN  +R+
Sbjct  225  QPRKEVNLWKRRTMNPPKPLQLNLGVRT  252



>ref|XP_002510598.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52785.1| conserved hypothetical protein [Ricinus communis]
Length=275

 Score =   176 bits (446),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 122/269 (45%), Positives = 166/269 (62%), Gaps = 39/269 (14%)
 Frame = +3

Query  126  ILKFLPKSA-AISFQSLPFSPGRDKRPAAAAD-----IKTHCNKGFSGPIISIIPAEARR  287
            ILKFLPK+A A+SFQ+ PFSPGRDKR           +K+H  KG+SGPI+SIIP EARR
Sbjct  15   ILKFLPKAASAVSFQNPPFSPGRDKRIPEYHQHFHNRVKSHVGKGYSGPIVSIIPDEARR  74

Query  288  KSG----MDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTTSFQEI  455
            ++      +  EP+SPK+SC+GQIKHKKK+     +  +     T+ + + S +T  +EI
Sbjct  75   RTSKNGSFENHEPTSPKISCMGQIKHKKKIINSSSKN-KAKNQETEPEKSTSTSTPRREI  133

Query  456  SSSSAAIGKIF--------HGRR-SDATA-DSSRLR-VCEDAPSLGQMKRFASGRETLSD  602
               +  I ++F        HGRR SDA+  D   L      AP+L Q+KRFASGR+T ++
Sbjct  134  KKHALTIKRMFSNAVKVPEHGRRRSDASMYDKPPLTDTSHRAPALSQLKRFASGRDTFAN  193

Query  603  FNWTTASTATAQVVP---HGRKYCLDND-----SDDEYEE-ISIPFSAPMFGGHGSTTLP  755
            F+WT+      QVVP     R Y  D++     SD +Y+E + IPFSAP+  G G   L 
Sbjct  194  FDWTS------QVVPAESDHRNYYSDDEEEERHSDHDYDEDVIIPFSAPIIVGPGVGNL-  246

Query  756  LEPRKEINLWKRRTMAQPKPLQLNAVIRS  842
             +PRKE+NLW+RRTM  PKPLQLN ++R+
Sbjct  247  -QPRKEVNLWRRRTMNPPKPLQLNVMVRT  274



>ref|XP_010266908.1| PREDICTED: uncharacterized protein At1g76070 [Nelumbo nucifera]
Length=244

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 119/258 (46%), Positives = 152/258 (59%), Gaps = 32/258 (12%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSAAISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIISII  269
            MEKP K S +++ L FLPK+ A+ FQ+ PFSPGRDKR   ++  K++  KGFSGPI+SII
Sbjct  1    MEKPAKKSMSRL-LSFLPKATAVIFQNPPFSPGRDKRSENSSKFKSNIGKGFSGPIVSII  59

Query  270  PAEARRKS---GMDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTT  440
            P EAR KS     D+QEP+SPKVSCIGQIK+KKKM + K +  RV P P    +  S+  
Sbjct  60   PVEARTKSKNGNFDSQEPTSPKVSCIGQIKNKKKMCRSKSK--RVAPPPQDSRHV-SVLP  116

Query  441  SFQEISSSSAAIGKIFHGRRSD---ATADSSRLRVCEDAPSLGQMKRFASGRETLSDFNW  611
                    S+ I  IFHG R+      +   +  V + APSLGQMKRFASGR   ++F+W
Sbjct  117  PRDTKKKPSSTIRSIFHGVRTGKRTVVSVDKKPEVADRAPSLGQMKRFASGRNAFANFDW  176

Query  612  TTASTATAQVVPHGRKYCLDNDSDDE-------YEEISIPFSAPMFGGHGSTTLPLEPRK  770
                +             LD D DDE        +E+ +P SAP+  G G      EP K
Sbjct  177  RENES-------------LDLDPDDEEMEESDGEDEVIVPHSAPIMIGGGRVA--SEPNK  221

Query  771  EINLWKRRTMAQPKPLQL  824
            EINLWKRRT++ P PLQL
Sbjct  222  EINLWKRRTISPPAPLQL  239



>ref|XP_007160614.1| hypothetical protein PHAVU_001G002200g [Phaseolus vulgaris]
 gb|ESW32608.1| hypothetical protein PHAVU_001G002200g [Phaseolus vulgaris]
Length=246

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 126/276 (46%), Positives = 159/276 (58%), Gaps = 54/276 (20%)
 Frame = +3

Query  90   MEKPVKPSKAK-MILKFLPKSAA-ISFQSLPFSPGRDKRPAAAADIKTHCNKGF-SGPII  260
            MEK  K SK K  ILK LPK+AA ++FQ+ PFSPGRD +       KTH  KGF SGP+I
Sbjct  1    MEKENKQSKLKNKILKILPKAAAAVTFQNPPFSPGRDHK------FKTHGGKGFFSGPMI  54

Query  261  SIIPAEARRK---SGMDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARS  431
               P EARRK    G++TQEP+SPK+SC+GQIKHKKK                +K+ A+S
Sbjct  55   ---PDEARRKPRHGGVETQEPTSPKISCMGQIKHKKKH--------------IQKEGAKS  97

Query  432  LTTSFQEISSSSAAIGK---------------IFHGRRSDATADSSRLRVCEDAPSLGQM  566
             +TS +   S+S+A                  +FH  +  A A        + AP LG M
Sbjct  98   TSTSTRARESASSATPGDTTEEKKQGSKFQRLLFHAGKPKAAARKKSDAGEDRAPPLGHM  157

Query  567  KRFASGRETLSDFNWTTASTATAQVVPHGRKYCLDND---SDDEYEEISIPFSAPMFGGH  737
            +RFASGRET S+F W       AQ+ P  R    DND     D  +E+ IPFSAP+  G 
Sbjct  158  RRFASGRETFSNFEWK------AQIAPEERDCFSDNDDRVESDAEDEVIIPFSAPLTAG-  210

Query  738  GSTTLPLEPRKEINLWKRRTMAQPKPLQLNAVIRSK  845
            G+  L ++PRKEINLWKRRTMA P+PLQLN V+ +K
Sbjct  211  GAPLLSVQPRKEINLWKRRTMAAPRPLQLNPVLTAK  246



>ref|XP_010266059.1| PREDICTED: uncharacterized protein At1g76070-like [Nelumbo nucifera]
Length=245

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 116/259 (45%), Positives = 149/259 (58%), Gaps = 29/259 (11%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSAAISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIISII  269
            MEKP K      +L FLPK+ A++FQ+ P SPGRDKR   ++  K +  K FSGPIISII
Sbjct  1    MEKPAK--SMSRLLSFLPKATAVTFQNPPLSPGRDKRSDNSSKFKLNNGKAFSGPIISII  58

Query  270  PAEARRKSG---MDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTT  440
            P EAR KS     D QEP+SPKVSCIGQIK KKK  K  R + +    P  +  + + ++
Sbjct  59   PVEARTKSNSGRFDAQEPTSPKVSCIGQIKLKKKKKKIPRSKSKRVAPPPPQGSSSTSSS  118

Query  441  SFQEISSSSAAIGKIFHGRRSDATADSSRLR--VCEDAPSLGQMKRFASGRETLSDFNWT  614
              +     S+AI  IF G R+   A  S ++  V +  PSL QMKRF+SGR   ++F+W 
Sbjct  119  PPEVKKKPSSAIRNIFRGVRTGKKAIVSVMKPPVADKTPSLSQMKRFSSGRNAFANFDW-  177

Query  615  TASTATAQVVPHGRKYCLDN------DSDDEYEEISIPFSAPMFGGHGSTTLPLEPRKEI  776
                         R + L N      D  DE +EI I  SAP+  G G     LEP+KEI
Sbjct  178  -------------RDHVLSNHPDKQKDESDEEDEIIISHSAPILVGGGDVA--LEPKKEI  222

Query  777  NLWKRRTMAQPKPLQLNAV  833
            NLWKRRT+A P PLQLN++
Sbjct  223  NLWKRRTVAPPTPLQLNSM  241



>ref|XP_009620052.1| PREDICTED: uncharacterized protein At1g76070 [Nicotiana tomentosiformis]
Length=246

 Score =   162 bits (409),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 125/266 (47%), Positives = 158/266 (59%), Gaps = 44/266 (17%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSAA--ISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIIS  263
            MEKP K SK  MILK LPK+AA  + FQ+ PFSPGR+KR +       H +KGFSGPI+ 
Sbjct  1    MEKPAK-SKKNMILKLLPKAAAAAVIFQNHPFSPGREKRLSHL-----HNHKGFSGPIL-  53

Query  264  IIPAEAR-RKSGMD-TQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLT  437
             IP EAR RKS  + TQEP+SPKVSCIGQIK +KK   +  +       P +K+   SL 
Sbjct  54   -IPVEARSRKSNNEITQEPTSPKVSCIGQIKQRKKKMVKTTK-------PVEKNSVSSLA  105

Query  438  TSFQEISSSSAAIGKIFH--GRRSDATADSSRLRVCEDAPS-----LGQMKRFASGRET-  593
             S ++ S SS     IF   GR+SDA  +S+   +  D P+     L QMK+FASGRE+ 
Sbjct  106  ESNKKKSRSS--FRNIFQRGGRKSDA-CNSADNNISSDIPNRVPCNLSQMKKFASGRESS  162

Query  594  LSDFNWTTASTATAQVVPHGRKYCLDNDSDDEY--------EEISIPFSAP-MFGGHGST  746
            LS+F+W        Q+ P   + C  +D   +Y        EE+ IPFSAP + G     
Sbjct  163  LSNFDW-----KNVQITPEDHRKCYSDDDRSDYCDEDEDEEEEVIIPFSAPILIGSRDRP  217

Query  747  TLPLEPRKEINLWKRRTMAQPKPLQL  824
              PLEP+KEINLWKRRTM +P PLQL
Sbjct  218  NFPLEPKKEINLWKRRTMTKPNPLQL  243



>ref|XP_009770080.1| PREDICTED: uncharacterized protein At1g76070 [Nicotiana sylvestris]
Length=250

 Score =   162 bits (409),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 120/267 (45%), Positives = 154/267 (58%), Gaps = 42/267 (16%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSAA--ISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIIS  263
            MEKP K SK  MILK LPK+AA  + FQ+ PFSPGR+KR +       H +KGFSGPI+ 
Sbjct  1    MEKPTK-SKKNMILKLLPKAAAAAVIFQNPPFSPGREKRLSHLH----HNHKGFSGPILI  55

Query  264  IIPAEARRKSGMDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTTS  443
             + A +R+ +   TQEP+SPKVSCIGQIK +KK   +        P P +K+   SL  S
Sbjct  56   PVEARSRKSNNETTQEPTSPKVSCIGQIKQRKKKMIKT-------PKPVEKNSVSSLVES  108

Query  444  FQEISSSSAAIGKIFH--GRRSDATADSSRLRVCEDAP-----SLGQMKRFASGRE-TLS  599
             ++ S SS     IF   GR+SDA  +S+   +  D       +L QMK+FASGRE +LS
Sbjct  109  NKKKSRSS--FRNIFQRGGRKSDA-CNSAENNISSDIQNRVPCNLSQMKKFASGRESSLS  165

Query  600  DFNWTTASTATAQVVPHGRKYCLDNDSDDEY----------EEISIPFSAPMFGG--HGS  743
            +F+W        Q+ P   + C  +D   EY          EE+ IPFSAP+  G     
Sbjct  166  NFDW-----KNVQITPEDHRKCYSDDDRSEYCDEDEDEDEEEEVIIPFSAPILVGSSRDK  220

Query  744  TTLPLEPRKEINLWKRRTMAQPKPLQL  824
               PLEP+KEINLWKRRTM +P PLQL
Sbjct  221  PNFPLEPKKEINLWKRRTMTKPNPLQL  247



>emb|CDP07343.1| unnamed protein product [Coffea canephora]
Length=263

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 118/267 (44%), Positives = 164/267 (61%), Gaps = 34/267 (13%)
 Frame = +3

Query  105  KPSKAKMILKFL-----PKSAAISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIISII  269
            KP+ AK  +KFL       +AA    S PFSPG+      A  +K+H NKGFSGPI S++
Sbjct  3    KPAIAKSKIKFLMLLPKAAAAAAKLPSHPFSPGK----VNANKLKSHQNKGFSGPITSVV  58

Query  270  PAEARRKSG---MDTQEPSSPKVSCIGqikhkkkma-----kqkrqqPR---VDPLPTKK  416
              EAR KS     D +EP+SPK+SC+GQIKHKKK++           P+    +P  +  
Sbjct  59   LEEARNKSKNSTFDAKEPTSPKISCMGQIKHKKKISSKKKKAASMSLPKEVVYNPYSSFH  118

Query  417  DYARSLTTSFQEISSSSAAIGKIFH----GRRSDATADSSRLRVCEDAPSLGQMKRFASG  584
             Y+R+  ++ ++    SA+ G IF+    GR+SDA+ + S+ ++ + APSL  MKRFASG
Sbjct  119  AYSRNKPSAMEQKKKKSAS-GNIFNRGKPGRKSDASYEQSK-KLPDRAPSLSHMKRFASG  176

Query  585  RETLSDFNWTTASTATAQVVPHGRKYCLDND-----SDDEYEEISIPFSAPMFGGH-GST  746
            R++ S F+WT+   A  +  P  R+   D +      +++ +E+ IPFSAP+  G  G+ 
Sbjct  177  RDSFSSFDWTSVQVAPEE--PDNRRCYSDEEKRDSSEEEQEDEVIIPFSAPILLGEVGAA  234

Query  747  TLPLEPRKEINLWKRRTMAQPKPLQLN  827
             LPLEPRKEINLWKRRTMAQPKPLQLN
Sbjct  235  VLPLEPRKEINLWKRRTMAQPKPLQLN  261



>ref|XP_004499311.1| PREDICTED: uncharacterized protein At1g76070-like [Cicer arietinum]
Length=245

 Score =   157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 114/262 (44%), Positives = 153/262 (58%), Gaps = 27/262 (10%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSAA---ISFQSLPFSPGRDKRPAAAADI----KTHCNKGFS  248
            MEK  +      ILK +PK+AA   ++FQ+ PFSPGRD +  +  +     KTH  KGFS
Sbjct  1    MEKDKQSKLRNKILKIIPKAAAAITVTFQNGPFSPGRDHKFRSDNNTNRWQKTHFGKGFS  60

Query  249  GPIISIIPAEARRKSGMDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYAR  428
            GP+I   P EAR K   +TQEP+SPK+SC+GQIKHKKK     +       LPT  D + 
Sbjct  61   GPMI---PPEARTKPKGETQEPTSPKISCMGQIKHKKKHHNIAKT------LPTHGDNSA  111

Query  429  SLTTSFQEISSSSAAIGKIFHGRRSDATADSSRLRVCEDAPSLGQMKRFASGRETLSDFN  608
            + T    E+  S     ++F  R     A          AP +G+M+RFASGRE+ ++F+
Sbjct  112  ASTPKDTEVKKSK--FQRMFSHRSKSKFAAKKPDEFVNGAPPMGEMRRFASGRESFANFD  169

Query  609  WTTASTATAQVVPHGRKYCLDNDSDDEYEEISIPFSAPMFGG-HGSTT--LPLEPRKEIN  779
            W       A+ + + R+   D + DDE   I IPFSAP+ GG +G+ T  L L+PR EIN
Sbjct  170  W--KGMIEAEEI-NQRECYTDAEEDDE---ILIPFSAPILGGGNGNVTSNLNLKPRNEIN  223

Query  780  LWKRRTMAQPKPLQLNAVIRSK  845
            LWKRRTMA P+PLQLN V+ +K
Sbjct  224  LWKRRTMAPPRPLQLNPVLTAK  245



>emb|CAN83887.1| hypothetical protein VITISV_001638 [Vitis vinifera]
Length=245

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 118/274 (43%), Positives = 159/274 (58%), Gaps = 53/274 (19%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSAA-ISFQ-SLPFSPGRD-KRPAAAAD-IKTH-CNKGFSGP  254
            MEKP K     MILKFLPK+A+ I+FQ S PFSPGRD KR + + +  K H   +GFSGP
Sbjct  1    MEKPAK--SKNMILKFLPKAASVINFQNSTPFSPGRDHKRSSDSTNKFKAHGAGRGFSGP  58

Query  255  IISIIPAEA--RRKSG-MDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYA  425
            +IS+IP EA  R +SG  D QEP+SPKVSC+GQ+K K K             +P  K  +
Sbjct  59   MISMIPVEAHWRSRSGNFDRQEPTSPKVSCMGQVKDKHKKR-----------IPKTKRAS  107

Query  426  RSLTTSFQEISSSSAAIGKIFH----GRRSDATADSSRLRVCEDAPSLGQMKRFASGRET  593
                +  +E+    + + +IF     GR+SDA++D  +  + + APSLGQMKRF+SGR  
Sbjct  108  PPKESKPREMKKQHSTLRRIFRSSNSGRKSDASSDD-KPSLPDRAPSLGQMKRFSSGRNA  166

Query  594  LSDFNWTTASTATAQVVPHGRKYCLDNDSDDEYEEIS------------IPFSAPMFGGH  737
             S+F+WT      A V P      +D+D    Y +              IPFSAP+  G 
Sbjct  167  FSNFDWT------APVAP------VDSDHRSYYSDEERGDFEEEDEEFIIPFSAPILVG-  213

Query  738  GSTTLPLEPRKEINLWKRRTMAQPKPLQLNAVIR  839
                + LEPRKEINLWKRRT+  P+PL+LN +++
Sbjct  214  --GAVALEPRKEINLWKRRTLVPPRPLRLNTIVK  245



>ref|XP_010664129.1| PREDICTED: uncharacterized protein At1g76070 [Vitis vinifera]
Length=245

 Score =   157 bits (396),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 119/274 (43%), Positives = 159/274 (58%), Gaps = 53/274 (19%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSAA-ISFQ-SLPFSPGRD-KRPAAAAD-IKTH-CNKGFSGP  254
            MEKP K     MILKFLPK+A+ I+FQ S PFSPGRD KR + + +  K H   +GFSGP
Sbjct  1    MEKPAK--SKNMILKFLPKAASVINFQNSTPFSPGRDHKRSSDSTNKFKAHGAGRGFSGP  58

Query  255  IISIIPAEA--RRKSG-MDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYA  425
            +IS+IP EA  R +SG  D QEP+SPKVSC+GQ+K K K             +P  K  +
Sbjct  59   MISMIPVEAHWRSRSGNFDRQEPTSPKVSCMGQVKDKHKKR-----------IPKTKRAS  107

Query  426  RSLTTSFQEISSSSAAIGKIFH----GRRSDATADSSRLRVCEDAPSLGQMKRFASGRET  593
                +  +E+    + + +IF     GR+SDA++D  +  + + APSLGQMKRF+SGR  
Sbjct  108  PPKESKPREMKKQHSTLRRIFRSSNLGRKSDASSDD-KPSLPDRAPSLGQMKRFSSGRNA  166

Query  594  LSDFNWTTASTATAQVVPHGRKYCLDNDSDDEYEEIS------------IPFSAPMFGGH  737
             S+F+WT      A V P      +D+D    Y E              IPFSAP+  G 
Sbjct  167  FSNFDWT------APVAP------VDSDHRSYYSEEERGDFEEEDEEFIIPFSAPILVG-  213

Query  738  GSTTLPLEPRKEINLWKRRTMAQPKPLQLNAVIR  839
                + LEPRKEINLWKRRT+  P+PL+LN +++
Sbjct  214  --GAVALEPRKEINLWKRRTLVPPRPLRLNTIVK  245



>ref|XP_004238391.1| PREDICTED: uncharacterized protein At1g76070-like [Solanum lycopersicum]
Length=235

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 115/253 (45%), Positives = 148/253 (58%), Gaps = 51/253 (20%)
 Frame = +3

Query  123  MILKFLPKSAA--ISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIISIIPAEAR-RKS  293
            MILKFLPK+AA  + FQ+ PFSPGRDKR         H +KGFSGPIISIIPAEAR RKS
Sbjct  13   MILKFLPKAAAATVIFQNHPFSPGRDKRLH-------HNHKGFSGPIISIIPAEARIRKS  65

Query  294  GMDT--QEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTTSFQEISSSS  467
              +T  +EP+SPKVSCIGQIK +KK+ K           P K +  +SL          S
Sbjct  66   NSETKEEEPTSPKVSCIGQIKQRKKLNK-----------PRKTERPKSL-------EKKS  107

Query  468  AAIGKIFHGRR-SDATADSSRLRVCEDA----PSLGQMKRFASGRE-TLSDFNWTTASTA  629
            +    IF  RR +D   + + +R CE      P L QM+++ASGRE  LS+F+W      
Sbjct  108  SNFKNIFQRRRKTDVDKNETNMR-CEVQNRAPPCLSQMRKYASGREGNLSNFDW-----K  161

Query  630  TAQVVPHGRK-------YCLDNDSDDEYEEISIPFSAPMFGGHGST-TLPLEPRKEINLW  785
              Q+ P   +           ++++DE +E+ IPFSAP+  G  +     LEP+KEINLW
Sbjct  162  NVQITPDDHRKYYSDDDRDDYHEAEDE-DEVIIPFSAPILIGRDNRPNFTLEPKKEINLW  220

Query  786  KRRTMAQPKPLQL  824
            KRRTM +P PLQL
Sbjct  221  KRRTMTKPNPLQL  233



>ref|XP_011034958.1| PREDICTED: uncharacterized protein At1g76070-like [Populus euphratica]
Length=273

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 116/262 (44%), Positives = 157/262 (60%), Gaps = 27/262 (10%)
 Frame = +3

Query  87   AMEKPVKPSKAKMILKFLPKSA-AISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIIS  263
             MEK   P     ILKFLPK+A A++F +L FSPGRD+R       K +  KG + P  S
Sbjct  19   GMEKQAAPPPPNRILKFLPKAASAVNFHNLAFSPGRDRRSENIHKHKANVGKGVN-PCRS  77

Query  264  IIPAEARRK---SGMDTQE-PSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARS  431
            +IP E RR+      +TQE P+SPK+SC+GQIKHKKKM K   ++  V P  TK      
Sbjct  78   MIPVEVRRQPMNESFETQEEPTSPKISCMGQIKHKKKMNKATYKRVSV-PQETK-----P  131

Query  432  LTTSFQEISSSSAAIGKIF----HGRRSDATADSSRLRVCEDAPSLGQMKRFASGRETLS  599
            ++ + +++   ++ + ++F     GR+S+A  D  + ++ + APSL QMKRFASGR+TL+
Sbjct  132  VSQTQRQVMKHASKLKRLFTGSKAGRKSNAF-DVGKPKLPDRAPSLSQMKRFASGRDTLA  190

Query  600  DFNWTTASTATAQVVPHGRKYCLDND-----SDDEYEEISIPFSAPMFGGHGSTTLPLEP  764
             F+WT    A   V P GR Y  D +      D E EE+ IPFSAPM  G G   L   P
Sbjct  191  SFDWTAHQIAP--VEPAGRDYYSDEERGDSFEDQEDEEVIIPFSAPMVLGGGVDLL---P  245

Query  765  RKEINLWKRRTMAQPKPLQLNA  830
            RKE+NLWKRRTM  P+PL+L +
Sbjct  246  RKEVNLWKRRTMDPPEPLRLKS  267



>ref|XP_003603835.1| Syringolide-induced protein 14-1-1 [Medicago truncatula]
 gb|AES74086.1| syringolide-induced protein 14-1-1 [Medicago truncatula]
Length=245

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 126/276 (46%), Positives = 157/276 (57%), Gaps = 60/276 (22%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSAAISFQSLPFSPGRD---KRPAAAADIKTHCNKGFSGPII  260
            MEK +K      ILK LPK+  I+FQ+ PFSPGRD   ++  A    + H  KGFSGPI 
Sbjct  1    MEKNLKLRNK--ILKILPKTITINFQNHPFSPGRDHKSRQDNATKWARPHGVKGFSGPIQ  58

Query  261  SIIPAEARRKS----GMDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYAR  428
            SIIP EARRKS    G+D +EP+SPK+SC+GQIKHKKK  K+ +       +  KK    
Sbjct  59   SIIPREARRKSKDINGIDYEEPTSPKISCMGQIKHKKKQIKKSKD------MEVKKH---  109

Query  429  SLTTSFQEISSSSAAIGKIFH-------GRR-SDATA-DSSRLRVCEDAPSLGQMKRFAS  581
                +FQ++         +FH       GRR SDA A    +  + E A  + QMKRFAS
Sbjct  110  --VNTFQKM---------LFHVGKPKSEGRRKSDACAVQDKKYAIEERATHVSQMKRFAS  158

Query  582  GRETLSDFNWTTASTATAQVVPHGRKYCLDNDSDDE----------YEEISIPFSAPMFG  731
            GR+T ++F+W       AQV P      +DN   DE           EE  IPFSAP+ G
Sbjct  159  GRDTFANFDWK------AQVAPEE----IDNYYSDEERMQSDDDDDEEEFKIPFSAPLGG  208

Query  732  GHG--STTLPLEPRKEINLWKRRTMAQPKPLQLNAV  833
            G G  S  L L+PRKEINLWKRRTMA P+PLQL+ V
Sbjct  209  GVGACSLGLDLKPRKEINLWKRRTMAPPRPLQLDPV  244



>ref|XP_003545011.1| PREDICTED: uncharacterized protein At1g76070-like [Glycine max]
 gb|KHN12592.1| Hypothetical protein glysoja_040260 [Glycine soja]
Length=246

 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 116/253 (46%), Positives = 151/253 (60%), Gaps = 34/253 (13%)
 Frame = +3

Query  126  ILKFLPKSAA----ISFQSLPFSPGRDKRPAAAADIKTHCNKGF-SGPIISIIPAEARRK  290
            I K LPK+AA    ++FQ+ PFSPGRD +       K H  KGF SGP+I   P EARRK
Sbjct  15   IFKILPKAAAAAVSMTFQNPPFSPGRDHK------FKHHGGKGFFSGPMI---PVEARRK  65

Query  291  SG---MDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTTSFQEISS  461
            S    ++TQEP+SPK+SC+GQIKHKKK  + K+    +  +PT++   +   + FQ + S
Sbjct  66   SKDGCVETQEPTSPKISCMGQIKHKKKKNQIKKAAKTMS-MPTEE---KKQASKFQRMMS  121

Query  462  SSAAIGKIFHGRRSDATADSSRLRVCEDAPSLGQMKRFASGRETLSDFNWTTASTATAQV  641
              +   K    R+  + AD    R    AP LG M+RFASGRET S+F+W       AQ+
Sbjct  122  FHSGKPKRPAARKQQSDADLESER--SPAPPLGHMRRFASGRETFSNFDWK------AQI  173

Query  642  VPHGR---KYCLDNDSDDEYEEISIPFSAPMFGGHGSTTLPL--EPRKEINLWKRRTMAQ  806
             P  R    Y  D    D  +EI IPFSAP+  G  ++ L L  +PRKEINLWKRRTMA 
Sbjct  174  APEERDCYSYYDDRLESDAEDEIIIPFSAPLTVGGAASALNLNAQPRKEINLWKRRTMAP  233

Query  807  PKPLQLNAVIRSK  845
            P+PLQLN V+ +K
Sbjct  234  PRPLQLNPVLTAK  246



>ref|XP_010935181.1| PREDICTED: uncharacterized protein At1g76070-like [Elaeis guineensis]
Length=231

 Score =   153 bits (387),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 112/257 (44%), Positives = 139/257 (54%), Gaps = 37/257 (14%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSAAISFQSLP-FSPGRDKRPAAAADIKTHCNKGFSGPIISI  266
            MEKP + +KA  I  FLPK  + S    P +SPGR+  PA +  +    +K FSGPIISI
Sbjct  1    MEKPTR-AKATKIFSFLPKPTSFSIPHPPAYSPGREN-PAKSKAL----HKTFSGPIISI  54

Query  267  IPAEARRK----SGMDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSL  434
            IP EARRK     G D QEP+SPKVSCIGQ+KHKK    ++   PR              
Sbjct  55   IPVEARRKEKNGGGFDAQEPTSPKVSCIGQVKHKKPCRPKRSSPPR--------------  100

Query  435  TTSFQEISSSSAAIGKIFH-----GRRSDATADS-SRLRVCEDAPSLGQMKRFASGRETL  596
                QE   ++  I K+F      GRR DA   S  R  V   APSLGQM+RF SGRETL
Sbjct  101  ----QERKPANFIIRKMFQRKARPGRRMDAAESSEGRPAVVGRAPSLGQMQRFTSGRETL  156

Query  597  SDFNWTTASTATAQVVPHGRKYCLDNDSDDEYEEISIPFSAPMFGGHGSTTLPLEPRKEI  776
             DF+W               K    ++  DE  +++I  SAP+  G G   + +EPRKE+
Sbjct  157  RDFDWRKVEMKQEAATGDPEKCPSSDEESDEEHDVAIYHSAPLMVGGG--VVGMEPRKEV  214

Query  777  NLWKRRTMAQPKPLQLN  827
            NLWKRRT+A P PLQ  
Sbjct  215  NLWKRRTLAPPAPLQFK  231



>ref|XP_006601369.1| PREDICTED: uncharacterized protein At1g76070-like [Glycine max]
Length=229

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 113/252 (45%), Positives = 150/252 (60%), Gaps = 51/252 (20%)
 Frame = +3

Query  126  ILKFLPKSAAIS--FQSLPFSPGRDKRPAAAADIKTHCNKGF-SGPIISIIPAEARRKS-  293
            I K LPK+AA+S  FQ+ PFSPGRD +       K +  KGF SG    +IP EARRK+ 
Sbjct  17   IFKILPKAAAMSVTFQNPPFSPGRDHK------CKHYGGKGFFSG---RMIPDEARRKAK  67

Query  294  ---GMDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKD-YARSLTTSFQEISS  461
               G++TQEP+SPK+SC+GQIKHKK  AK          +PT +D   +   + FQ +  
Sbjct  68   NGHGVETQEPTSPKISCMGQIKHKKGGAKNMSMS-----MPTPRDPEVKKHASKFQRML-  121

Query  462  SSAAIGKIFHG---RRSDATADSSRLRVCEDAPSLGQMKRFASGRETLSDFNWTTASTAT  632
                   +FH    ++SDA  +S R      AP +G M+RFASGRET S+F+W       
Sbjct  122  -------LFHAGKPKQSDADVESER----APAPPMGHMRRFASGRETFSNFDWK------  164

Query  633  AQVVPHGRKYCLDNDSDDEYEEISIPFSAPM-FGGHGSTTLPLEPRKEINLWKRRTMAQP  809
            AQ+ PH       +D D   +EI IPFSAP+  GG  +  L ++PRKEINLWKRRTMA P
Sbjct  165  AQIAPH-------DDVDRLDDEIIIPFSAPLTLGGATALNLNVQPRKEINLWKRRTMAPP  217

Query  810  KPLQLNAVIRSK  845
            +PL+LN ++ +K
Sbjct  218  RPLKLNPLLTAK  229



>ref|XP_002301948.2| hypothetical protein POPTR_0002s01800g [Populus trichocarpa]
 gb|EEE81221.2| hypothetical protein POPTR_0002s01800g [Populus trichocarpa]
Length=270

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 114/251 (45%), Positives = 154/251 (61%), Gaps = 27/251 (11%)
 Frame = +3

Query  126  ILKFLPKSA-AISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIISIIPAEARRK---S  293
            ILKFLPK+A A++F +L FSPGRD+R       K +  KGF+ P  S+IP E RR+    
Sbjct  29   ILKFLPKAASAVNFHNLAFSPGRDRRSEIIHKHKANVGKGFN-PCRSMIPVEVRRQPKNE  87

Query  294  GMDTQE-PSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTTSFQEISSSSA  470
              +TQE P+SPK+SC+GQIKHKKKM K   +  RV  LP +   A   + + +++   ++
Sbjct  88   SFETQEEPTSPKISCMGQIKHKKKMNKATYK--RVS-LPQETKPA---SQTQRQVMKHAS  141

Query  471  AIGKIF----HGRRSDATADSSRLRVCEDAPSLGQMKRFASGRETLSDFNWTTASTATAQ  638
             + ++F     GR+S+A  D  +  + + APSL QMKRFASGR+TL+ F+WT    A   
Sbjct  142  KLKRLFTGSKAGRKSNAF-DGGKPTLPDRAPSLSQMKRFASGRDTLASFDWTAHQIAP--  198

Query  639  VVPHGRKYCLDND-----SDDEYEEISIPFSAPMFGGHGSTTLPLEPRKEINLWKRRTMA  803
            V P GR Y  D +      D E EE+ IPFSAPM  G G   L   PRKE+NLWKRRTM 
Sbjct  199  VEPVGRDYYSDEERGDSFEDQEDEEVIIPFSAPMVLGGGVDLL---PRKEVNLWKRRTMD  255

Query  804  QPKPLQLNAVI  836
             P+PL+L + +
Sbjct  256  PPEPLRLKSSM  266



>ref|XP_003589562.1| Syringolide-induced protein 14-1-1 [Medicago truncatula]
 gb|AES59813.1| syringolide-induced protein 14-1-1 [Medicago truncatula]
Length=247

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 114/267 (43%), Positives = 150/267 (56%), Gaps = 42/267 (16%)
 Frame = +3

Query  105  KPSKAKMILKFLPKSAAISFQSLPFSPGRDKR-----PAAAADIKTH-CNKGFSGPIISI  266
            K  ++K+  KF+ K+  I+FQ+ PFSPGRD +            KTH   KGFSGP++++
Sbjct  3    KDKQSKLRNKFM-KAITITFQNAPFSPGRDHKFRSENSNTKWGAKTHAVGKGFSGPMVTM  61

Query  267  IPAEARRK----SGMDTQEPSSPKVSCIGqikhkkkmakqkrq----qPRVDPLPTKKDY  422
            IP EARRK     G +TQEP+SPK+SC+GQIKH KK    K       P+VD      + 
Sbjct  62   IPYEARRKPKDGGGNETQEPTSPKISCMGQIKHHKKKNIPKPNKDLFTPKVD-----TEV  116

Query  423  ARSLTTSFQEISSSSAAIGKIFHGRRSDATA--DSSRLRVCEDAPSLGQMKRFASGRETL  596
             RS    FQ I S  +     F  R+SD +   D    +    AP +G M+RFASGRE  
Sbjct  117  KRS---KFQRIFSQRSKAK--FAERKSDGSGFVDEGNNK----APPMGDMRRFASGREAF  167

Query  597  SDFNWTTASTATAQVVPHGRKYCLDNDSDDEYEEISIPFSAPMFGGHGSTT----LPLEP  764
            S F+W     A  +     ++ C  +  DDE   I IPFSAP+ G  G+TT       +P
Sbjct  168  SKFDWK----AVIEPEEIDQRECFTDGEDDE---ILIPFSAPILGVGGNTTGTSDFKFKP  220

Query  765  RKEINLWKRRTMAQPKPLQLNAVIRSK  845
            R EINLWKRRTMA P+PLQLN V+++K
Sbjct  221  RNEINLWKRRTMAPPRPLQLNPVLKAK  247



>gb|AFK40605.1| unknown [Medicago truncatula]
Length=247

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 113/265 (43%), Positives = 147/265 (55%), Gaps = 38/265 (14%)
 Frame = +3

Query  105  KPSKAKMILKFLPKSAAISFQSLPFSPGRDKR-----PAAAADIKTH-CNKGFSGPIISI  266
            K  ++K+  KF+ K+  I+FQ+ PFSPGRD +            KTH   KGFSGP++++
Sbjct  3    KDKQSKLRNKFM-KAITITFQNAPFSPGRDHKFRSENSNTKWGAKTHAVGKGFSGPMVTM  61

Query  267  IPAEARRK----SGMDTQEPSSPKVSCIGqikhkkkmakqkrq----qPRVDPLPTKKDY  422
            IP EARRK     G +TQEP+SPK+SC+GQIKH KK    K       P+VD      + 
Sbjct  62   IPYEARRKPKDGGGNETQEPTSPKISCMGQIKHHKKKNIPKPNKDLFTPKVD-----TEV  116

Query  423  ARSLTTSFQEISSSSAAIGKIFHGRRSDATADSSRLRVCEDAPSLGQMKRFASGRETLSD  602
             RS    FQ I S  +     F  R+SD +           AP +G M+RFASGRE  S 
Sbjct  117  KRS---KFQRIFSQRSKAK--FAERKSDGSGFVDEGN--NKAPPMGDMRRFASGREAFSK  169

Query  603  FNWTTASTATAQVVPHGRKYCLDNDSDDEYEEISIPFSAPMFGGHGSTT----LPLEPRK  770
            F+W     A  +     ++ C  +  DDE   I IPFSAP+ G  G+TT       +PR 
Sbjct  170  FDWK----AVIEPEEIDQRECFTDGEDDE---ILIPFSAPILGVGGNTTGTSDFKFKPRN  222

Query  771  EINLWKRRTMAQPKPLQLNAVIRSK  845
            EINLWKRRTMA P+PLQLN V++ K
Sbjct  223  EINLWKRRTMAPPRPLQLNPVLKVK  247



>ref|XP_004253207.1| PREDICTED: uncharacterized protein At1g76070-like [Solanum lycopersicum]
Length=242

 Score =   149 bits (375),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 116/254 (46%), Positives = 146/254 (57%), Gaps = 23/254 (9%)
 Frame = +3

Query  90   MEKPVKPSKAKM-ILKFLPKSAAISFQSL-----PFSPGRDKRPAAAADIKTHCNKGFSG  251
            MEKP K SK K+ ILK LPK+AA +   L     PFSP R+KR         H  KGF+G
Sbjct  1    MEKPCKSSKKKITILKLLPKAAAAAAFILQNAHAPFSPSREKRLEHHHKNHHH--KGFTG  58

Query  252  PIISIIPAE--ARRKSGMDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYA  425
            PII +IPA   + RKS     EP SPK+SC+GQIK  K+      +    +  P K    
Sbjct  59   PIIPVIPAHQVSGRKS-----EPGSPKISCMGQIKQNKEKTLNLMRSSE-NTSPGKNQRK  112

Query  426  RSLTTSFQEISSSSAAIGKIFHGRRSDATADSSRLRVCEDAPSLGQMKRFASGRETLSDF  605
                 S     S      K+  GR+SD T ++   ++ + AP L QM+RFASGRE L++F
Sbjct  113  NITRKSMSNFGSMFGGKSKLISGRKSDVTTENIVCKLPDRAPCLSQMQRFASGREPLTNF  172

Query  606  NWTTASTATAQVVPHG-RKYCLDNDSDDEYEEISIPFSAPMFGGHGSTTLPLEPRKEINL  782
            +W      + Q+ P   RKY  D+D DD+ +EIS PFS P+  G   TT+ LEPRKEINL
Sbjct  173  DW-----RSIQITPQDERKYYTDDDDDDDDDEIS-PFSGPILLGRSRTTICLEPRKEINL  226

Query  783  WKRRTMAQPKPLQL  824
            WKRRTM QPKPLQL
Sbjct  227  WKRRTMVQPKPLQL  240



>ref|XP_010941356.1| PREDICTED: uncharacterized protein At1g76070-like [Elaeis guineensis]
Length=237

 Score =   148 bits (374),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 110/265 (42%), Positives = 137/265 (52%), Gaps = 47/265 (18%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSAAISFQSLPFSPGRDK--RPAAAADIKT--HCNKGFSGPI  257
            MEKP + +KA  I  FLPK  + S    P SPGR+K  +P A  +     H NK FSGPI
Sbjct  1    MEKPSR-AKATKIFSFLPKPTSFSISHRPLSPGREKSSKPKAFHNKAKAFHNNKAFSGPI  59

Query  258  ISIIPAEARRKS----GMDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYA  425
            ISI+P EARRK       D QEP+SPKVSCIG+                   +  +K   
Sbjct  60   ISIVPVEARRKEKNGGNFDAQEPTSPKVSCIGR-------------------VKQRKLVC  100

Query  426  RSLTTSF--QEISSSSAAIGKIFHGRRSDA----TADSSRLR----VCEDAPSLGQMKRF  575
            RS   S   QE    +  I K+F  +   +     A+SS  R        APSLGQMKRF
Sbjct  101  RSKRHSLPQQEWKPPTLIIRKMFRRKLRPSRRRDAAESSEGRPAVAAAGRAPSLGQMKRF  160

Query  576  ASGRETLSDFNWTTASTATAQVVPHGRKYCLDNDSDDE-YEEISIPFSAPMFGGHGSTTL  752
             SGRETL +F+W  A            +   D +SD+E Y      +SAP+  G G   +
Sbjct  161  TSGRETLLNFDWRKAERRQEAATGDREESYSDEESDEEDY------YSAPILMGGG--VV  212

Query  753  PLEPRKEINLWKRRTMAQPKPLQLN  827
             +EPRKE+NLWKRRT+A P PLQLN
Sbjct  213  AVEPRKEVNLWKRRTLAPPVPLQLN  237



>gb|AGV54595.1| syringolide-induced protein 14-1-1 [Phaseolus vulgaris]
Length=247

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 119/277 (43%), Positives = 152/277 (55%), Gaps = 55/277 (20%)
 Frame = +3

Query  90   MEKPVKPSKAK-MILKFLPKSAA-ISFQSLPFSPGRDKRPAAAADIKTHCNKGF-SGPII  260
            MEK  K SK K  ILK LPK+AA ++FQ+ PFSPGRD +       KTH  KGF SGP+I
Sbjct  1    MEKENKQSKLKNKILKILPKAAAAVTFQNPPFSPGRDHK------FKTHGGKGFFSGPMI  54

Query  261  SIIPAEARRK---SGMDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARS  431
               P EARRK    G++TQEP+SPK+SC+GQIKHKKK                +K  A+S
Sbjct  55   ---PDEARRKPRHGGVETQEPTSPKISCMGQIKHKKKH--------------IQKGGAKS  97

Query  432  LTTSFQEISSSSAAIGK---------------IFHGRRSDATADSSRLRVCEDAPSLGQM  566
             +TS +   S+S+A                  +FH  +  A A        + AP LG M
Sbjct  98   TSTSTRARESASSATPGDTTEEKKQGSKFQRLLFHAGKPKAAARKKSDAGEDRAPPLGHM  157

Query  567  KRFASGRETLSDFNWTTASTATAQVVPHGRKYCLDNDSDDEY----EEISIPFSAPMFGG  734
            +RFASGRET S+F W       AQ+ P G+K  L     +      +E+   F  P+  G
Sbjct  158  RRFASGRETFSNFEWK------AQIAPGGKKLLLGQWMIEWKAMPKDEVDNSFLCPLKAG  211

Query  735  HGSTTLPLEPRKEINLWKRRTMAQPKPLQLNAVIRSK  845
               T   ++PRKEINLWKRRTMA P+PLQLN V+ +K
Sbjct  212  R-CTVAYVQPRKEINLWKRRTMAAPRPLQLNPVLTAK  247



>ref|XP_006342084.1| PREDICTED: uncharacterized protein At1g76070-like [Solanum tuberosum]
Length=249

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 122/259 (47%), Positives = 155/259 (60%), Gaps = 49/259 (19%)
 Frame = +3

Query  123  MILKFLPKSAA--ISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIISIIPAEARRK--  290
            MILKFLPK+ A  I FQ+ PFSPGR+KR         H +KGFSGPIISIIPAEAR K  
Sbjct  13   MILKFLPKAVAATIIFQNHPFSPGREKRFH-------HNHKGFSGPIISIIPAEARNKKS  65

Query  291  -SGMDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSL---TTSFQEIS  458
             S  + +EP+SPKVSCIGQIK +K + K K           KK+  +SL    ++ ++ S
Sbjct  66   NSETNQEEPTSPKVSCIGQIKQRKNLNKSK-----------KKECPKSLEKNPSNKKKKS  114

Query  459  SSSAAIGKIFHGRRS-DATADSSRLRVCE---DAPSLGQMKRFASGRE-TLSDFNWTTAS  623
            SSS+    IF  RR  D + +SS + +CE    AP L QM+++ASGRE  LS+F+W    
Sbjct  115  SSSSNFRNIFQRRRKIDVSKNSSDI-ICEVENRAPCLSQMRKYASGREGNLSNFDW----  169

Query  624  TATAQVVPHG-RKYC----------LDNDSDDEYEEISIPFSAPMFGGHGST-TLPLEPR  767
                Q+ P   RKY            D D D++ EE+ IPFSAP+  G  +     LEP+
Sbjct  170  -KNVQITPDDHRKYYSDDDRDDYRDGDEDEDEDEEEVIIPFSAPILVGRDNRPNFTLEPK  228

Query  768  KEINLWKRRTMAQPKPLQL  824
            KEINLWKRRTM +P PLQL
Sbjct  229  KEINLWKRRTMTKPNPLQL  247



>ref|XP_006342559.1| PREDICTED: uncharacterized protein At1g76070-like [Solanum tuberosum]
Length=249

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 114/259 (44%), Positives = 151/259 (58%), Gaps = 22/259 (8%)
 Frame = +3

Query  90   MEKPVKPSKAKM-ILKFLPKSAAISFQSL-----PFSPGRDKRPAAAADIKTHCNKGFSG  251
            MEKP K SK K+ ILK LPK+AA +   L     PFSP R+KR AA    K H +KGF+G
Sbjct  1    MEKPCKSSKKKITILKLLPKAAAAAAFILQNAHAPFSPSREKRLAAEHHHKNHHHKGFTG  60

Query  252  PIISIIPAEARRKSGMDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARS  431
            PII +IPA   + SG  + EP SPK+SC+GQIKH KK    + +    +   T K+  ++
Sbjct  61   PIIPVIPAH--QVSGRKS-EPGSPKISCMGQIKHNKKKTLNRMRSS--EKTSTGKNQRKN  115

Query  432  -LTTSFQEISSSSAAIGKIFHGRRSDATADSSRLRVCEDAPSLGQMKRFASGRETLSDFN  608
             +  S     S      K+  GR+SD   ++   ++ + AP L QM+RFASGRE L++F+
Sbjct  116  VMKKSMSNFGSMFGGKSKLISGRKSDVAVENIICKLPDRAPCLSQMQRFASGREPLTNFD  175

Query  609  WTTASTATAQVVPHG-RKYCLDNDSDDEYEEISI----PFSAPMFGGHGSTTLPLEPRKE  773
            W      + Q+ P   RKY  D+D +   ++       PFS P+  G   TT+ LEPRKE
Sbjct  176  W-----RSIQITPQDQRKYYTDDDREFSDDDDEDDEISPFSGPILLGRSRTTICLEPRKE  230

Query  774  INLWKRRTMAQPKPLQLNA  830
            INLWKRRTM QPKPLQL  
Sbjct  231  INLWKRRTMVQPKPLQLQC  249



>ref|XP_008806152.1| PREDICTED: uncharacterized protein At1g76070 [Phoenix dactylifera]
Length=231

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 112/253 (44%), Positives = 140/253 (55%), Gaps = 29/253 (11%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSAAISFQSLP-FSPGRDKRPAAAADIKTHCNKGFSGPIISI  266
            MEKP + +KA  I  FL K+ + S   LP FSPGR+     +   K   NK FSGPIISI
Sbjct  1    MEKPPR-AKATKIFSFLSKANSFSIPRLPSFSPGREN----SMKSKALHNKAFSGPIISI  55

Query  267  IPAEARRKS----GMDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSL  434
            +P EARRK     G+D  EP+SP+VSC+GQ+KHKK    ++   PRV          R  
Sbjct  56   VPVEARRKEKNGGGLDV-EPTSPRVSCMGQVKHKKACRPKRSSPPRVQ--------ERKP  106

Query  435  TTSFQEISSSSAAIGKIFHGRRSDATADSS-RLRVCEDAPSLGQMKRFASGRETLSDFNW  611
                +EI        K+  GRR DA   S  R  V   APSLGQMKRF S RETL DF+W
Sbjct  107  AFIIREIFRR-----KVRPGRRMDAAESSEGRPAVVGRAPSLGQMKRFTSRRETLRDFDW  161

Query  612  TTASTATAQVVPHGRK-YCLDNDSDDEYEEISIPFSAPMFGGHGSTTLPLEPRKEINLWK  788
                           K  C D +SD+E+ +++I  SAP+  G G     ++PRKE+NLWK
Sbjct  162  RKVERKQEAATGDPEKCSCSDEESDEEH-DMAIYHSAPITVGGGMAA--VDPRKEVNLWK  218

Query  789  RRTMAQPKPLQLN  827
            RRT+A P PLQL 
Sbjct  219  RRTLAPPVPLQLK  231



>ref|XP_008813523.1| PREDICTED: uncharacterized protein At1g76070-like [Phoenix dactylifera]
Length=222

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 111/258 (43%), Positives = 132/258 (51%), Gaps = 48/258 (19%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSAAISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIISII  269
            MEKP + +KA  I  FLPK  + S    P SPGR+     A+  K   NK FSGPIISI+
Sbjct  1    MEKPRR-AKATKIFSFLPKPTSFSVSHPPLSPGREN----ASKPKAFHNKAFSGPIISIV  55

Query  270  PAEARRKS----GMDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLT  437
            P EARRK       D QEP+SPKVSCIGQIK                    +K   RS  
Sbjct  56   PVEARRKEKNGGSFDAQEPTSPKVSCIGQIK--------------------RKKVCRSKR  95

Query  438  TS--FQEISSSSAAIGKIFH-----GRRSDATADSS-RLRVCEDAPSLGQMKRFASGRET  593
            +S   QE    +  I ++F       RR+DA   S  R  V   AP LGQMKRF SGR T
Sbjct  96   SSPPQQERKPRTFIIRRMFRRMVRPSRRTDAAESSEGRPAVLGTAPPLGQMKRFTSGRGT  155

Query  594  LSDFNWTTASTATAQVVPHGRKYCLDNDSDDEYEEISIPFSAPMFGGHGSTTLPLEPRKE  773
            L DF+W              R+     D D+   +  I  SAP+  G G   + LEPRKE
Sbjct  156  LHDFDWRKVER---------RQEAATGDRDESDSDEDIYHSAPIVVGDG--VVALEPRKE  204

Query  774  INLWKRRTMAQPKPLQLN  827
            +NLWKRRT+A P PLQLN
Sbjct  205  VNLWKRRTLAPPVPLQLN  222



>gb|EYU17564.1| hypothetical protein MIMGU_mgv1a022821mg [Erythranthe guttata]
Length=226

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 114/258 (44%), Positives = 151/258 (59%), Gaps = 48/258 (19%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSA--AISFQSLP-FSPGRDKRPAAAADIKTHCNKGFSGPII  260
            MEK    SK K I + LPK+A  ++SFQ+ P  SPGRDK       +KTH +KGFSGP  
Sbjct  1    MEKKTTKSKNK-IWRLLPKAAQASLSFQNPPPLSPGRDK-------LKTHFSKGFSGPST  52

Query  261  SIIPAEARRKSGMDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTT  440
            S + ++       + +EP+SPKVSC+GQIKH+                  K    R+  T
Sbjct  53   SDMVSDD------ENREPTSPKVSCMGQIKHR-----------------NKIRRTRNTGT  89

Query  441  SFQEISSSSAAIGKIFH----GRRSDATAD-SSRLRVCEDAPSLGQMKRFASGRETLSDF  605
            + +E+    + + KIF     GR+SD++ +    LR+ + A SL QM+RFASGR T ++F
Sbjct  90   AAREVKKKPSGLKKIFGYGGGGRKSDSSVNHGGGLRLPDRAASLSQMRRFASGRGTCANF  149

Query  606  NWTTASTATAQVVPHGRKYCLDND---SDDEYEEISIPFSAPMF--GGHGSTTLPLEPRK  770
            + TTA  A  +    GR +  D +   SD E + I IPFSAP+F  G  G+  L LEPRK
Sbjct  150  DRTTARNAAKE----GRGFYSDEERGYSDGEDDVIIIPFSAPIFVAGAGGNGGLALEPRK  205

Query  771  EINLWKRRTMAQPKPLQL  824
            EINLWKRRTMAQPKPLQL
Sbjct  206  EINLWKRRTMAQPKPLQL  223



>ref|XP_010100120.1| hypothetical protein L484_014311 [Morus notabilis]
 gb|EXB81503.1| hypothetical protein L484_014311 [Morus notabilis]
Length=271

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 109/276 (39%), Positives = 155/276 (56%), Gaps = 58/276 (21%)
 Frame = +3

Query  126  ILKFLPKSAAIS--FQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIISIIPAEARRKSGM  299
            ILKFLP++ ++    QSLPFSP ++KR              FSGPI+S+IP EARRK   
Sbjct  11   ILKFLPRAVSVVTFHQSLPFSPSKEKR--------------FSGPIVSMIPYEARRKPKK  56

Query  300  DTQ-------EPSSPKVSCIGqikhkkkmakqkrqqPRVDPLP--------TKKDYARSL  434
            + Q       EP+SPKVSCIGQIKHK K    ++++   +           T KD ++ +
Sbjct  57   NGQEEVEVEEEPTSPKVSCIGQIKHKHKKIISEKKKIISEKKKLKKRSGSATIKD-SKPV  115

Query  435  TTSFQEISSSSAAIGKIFH------GRRSDATA-----------DSSRLRVCEDAPSLGQ  563
            T S +E+   + +I ++F       GR+SDA+            ++ +  + + APSL Q
Sbjct  116  TWSPREVKKHALSIKRMFSSNTIKPGRKSDASCADHDHHHHHHHNNRKPPLPDRAPSLSQ  175

Query  564  MKRFASGRETLSDFNWTTASTATAQVVPHG-----RKYCLDNDSDDEYEEISIPFSAPMF  728
            MKRFASGR++  +F+W  A      + P        +Y  D +  DE +E+ IPFSAPM 
Sbjct  176  MKRFASGRDSFLNFDW-GADHDDQVLTPDADYRNITRYSDDREESDEEQEVMIPFSAPMT  234

Query  729  GGHGSTTLPLEPRKEINLWKRRTMAQPKPLQLNAVI  836
             G     +PL+PRKEINLWKRRTMA P+PL+LN ++
Sbjct  235  VGR---EVPLQPRKEINLWKRRTMAPPRPLELNTMM  267



>ref|XP_006473720.1| PREDICTED: uncharacterized protein At1g76070-like [Citrus sinensis]
 gb|KDO84969.1| hypothetical protein CISIN_1g024266mg [Citrus sinensis]
Length=270

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 103/269 (38%), Positives = 149/269 (55%), Gaps = 43/269 (16%)
 Frame = +3

Query  126  ILKFLPKSAAISFQSLPFSPGRDKR------PAAAADIKTHCNKGFSGPIIS--IIPAEA  281
            ILK LPKS+ ++FQ+  +SPGR+KR             KTH  KGFSGP++S  ++PA+A
Sbjct  12   ILKLLPKSSVVNFQNPLYSPGREKRSDPHHHHHHMNKTKTHIGKGFSGPMMSMSLVPADA  71

Query  282  RRKS-------GMDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTT  440
            R ++        +  QEP+SPK+SC+GQIKHK K  ++     +       K+  R+ + 
Sbjct  72   RTRNLKNNNHQSLANQEPTSPKISCMGQIKHKHKQRQKFD---KAKSFSVAKEEKRNTSK  128

Query  441  SF--QEISSSSAAIGKIF------HGRRSDATADS--SRLRVCEDAPSLGQMKRFASGRE  590
             F  ++     + + ++F        R+S   AD+   R  + + AP L QMKRFASGR+
Sbjct  129  VFSPKQAKKHPSMLKRMFTMSKSTAARKSFDQADNHDERRSLPDRAPGLSQMKRFASGRD  188

Query  591  TLSDFNWTTASTATAQVVPH---GRKYCLDN--DSDDEYEE--ISIPFSAPMFGGHGSTT  749
              S F+WT       Q+ P    G  Y  +   DSD+E +E  + IPFSAP+    G   
Sbjct  189  AFSSFDWTAQ-----QIAPETDRGAYYSYEERGDSDEEQDEDRVIIPFSAPIAVVKG---  240

Query  750  LPLEPRKEINLWKRRTMAQPKPLQLNAVI  836
            + L+PRKE+NLWKRR M  P PLQLN+ +
Sbjct  241  VALQPRKEVNLWKRRPMNPPAPLQLNSTL  269



>ref|XP_006435260.1| hypothetical protein CICLE_v10002153mg [Citrus clementina]
 gb|ESR48500.1| hypothetical protein CICLE_v10002153mg [Citrus clementina]
Length=270

 Score =   139 bits (349),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 101/264 (38%), Positives = 145/264 (55%), Gaps = 33/264 (13%)
 Frame = +3

Query  126  ILKFLPKSAAISFQSLPFSPGRDKR------PAAAADIKTHCNKGFSGPIIS--IIPAEA  281
            ILK LPKS+ ++FQ+  +SPGR+KR             KTH  KGFSGP++S  ++PA+A
Sbjct  12   ILKLLPKSSVVNFQNPLYSPGREKRSDPHHHHHHMNKPKTHIGKGFSGPMMSMSLVPADA  71

Query  282  RRKS-------GMDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTT  440
            R ++        +  QEP+SPK+SC+GQIKHK K  ++     +       K+  R+ + 
Sbjct  72   RTRNLKNNNHQSLANQEPTSPKISCMGQIKHKHKQRQKFD---KAKSFSVAKEEKRNTSK  128

Query  441  SF--QEISSSSAAIGKIF------HGRRSDATADS--SRLRVCEDAPSLGQMKRFASGRE  590
             F  ++     + + ++F        R+S   AD+   R  + + AP L QMKRFASGR+
Sbjct  129  VFSPKQAKKHPSMLKRMFTMSKSTAARKSFDQADNHDERRSLPDRAPGLSQMKRFASGRD  188

Query  591  TLSDFNWTTASTATAQVVPHGRKYCLDNDSDDEYEE--ISIPFSAPMFGGHGSTTLPLEP  764
              S F+WT    A          Y    DSD+E +E  + IPFSAP+    G   + L+P
Sbjct  189  AFSSFDWTAQQIAPETDRGAYYSYEERGDSDEEQDEDRVIIPFSAPIAVVKG---VALQP  245

Query  765  RKEINLWKRRTMAQPKPLQLNAVI  836
            RKE+NLWKRR M  P PLQLN+ +
Sbjct  246  RKEVNLWKRRPMNPPAPLQLNSTL  269



>ref|XP_011003109.1| PREDICTED: uncharacterized protein At1g76070 [Populus euphratica]
Length=254

 Score =   138 bits (348),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 105/248 (42%), Positives = 145/248 (58%), Gaps = 24/248 (10%)
 Frame = +3

Query  120  KMILKFLPKS-AAISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIISIIPAEARRK--  290
            +MILKFLPK  +A++F +L   PGRDKR   A   K +  KG + P+ S+IPA+ RR+  
Sbjct  10   RMILKFLPKVVSAVNFHNLTVGPGRDKRSENAHKHKANAGKGVN-PVRSLIPAKVRRQPK  68

Query  291  -SGMDTQE-PSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTTSFQEISSS  464
                +TQE PSSPKVSCIGQ+KHKKKM K   +  RV  LP +    + ++ +  +I   
Sbjct  69   NESFETQEEPSSPKVSCIGQVKHKKKMNKATSK--RVPWLPQE---TKPVSQNPHKIKKH  123

Query  465  SAAIGKIFHGR---RSDATADSSRLRVCEDAPSLGQMKRFASGRETLSDFNWTTASTATA  635
            ++ + ++F G    R    +   +  + +  PSL QMK+FASGR+TL+ F+WT    A  
Sbjct  124  ASKLMRLFTGSKAGRKSIVSGGDKPTLPDKTPSLSQMKKFASGRDTLAGFDWTAHQIAPL  183

Query  636  QVVPHGRKYCLDNDSDDEY-----EEISIPFSAPMFGGHGSTTLPLEPRKEINLWKRRTM  800
            +     R Y  D +  D       EE+ IPFSAP+  G G   + L PRKEINLWK+RT+
Sbjct  184  ES--DSRDYYTDEERVDRLEEEEHEEVIIPFSAPILVGGG---IDLLPRKEINLWKKRTI  238

Query  801  AQPKPLQL  824
              P PLQL
Sbjct  239  NPPHPLQL  246



>ref|XP_002306958.2| hypothetical protein POPTR_0005s26690g [Populus trichocarpa]
 gb|EEE93954.2| hypothetical protein POPTR_0005s26690g [Populus trichocarpa]
Length=254

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 104/250 (42%), Positives = 143/250 (57%), Gaps = 24/250 (10%)
 Frame = +3

Query  120  KMILKFLPKS-AAISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIISIIPAEARRK--  290
            +MILKFLPK  +A++F +L   PGRDKR   A   K    KG + P+ S+IP E RR+  
Sbjct  10   RMILKFLPKVVSAVNFHNLTVGPGRDKRSENAHKHKAIAGKGVN-PVRSLIPVEVRRQPK  68

Query  291  -SGMDTQE-PSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTTSFQEISSS  464
                +TQE P+SPKVSCIGQ+KHKKKM K   +  RV  LP +    + ++ +  +I   
Sbjct  69   NESFETQEDPTSPKVSCIGQVKHKKKMYKATSK--RVPWLPQE---TKPVSQNPHKIKKH  123

Query  465  SAAIGKIFHGR---RSDATADSSRLRVCEDAPSLGQMKRFASGRETLSDFNWTTASTATA  635
            ++ + ++F G    R    +   +  + +  PSL QM RFASGR+TL+ F+WT    A  
Sbjct  124  ASKLMRLFTGSKAGRKSIVSGGDKPTLPDKTPSLSQMTRFASGRDTLAGFDWTAHQIAPV  183

Query  636  QVVPHGRKYCLDNDSDDEYEE-----ISIPFSAPMFGGHGSTTLPLEPRKEINLWKRRTM  800
            +     R Y  D +  D  EE     + IPFSAP+  G G   + L PRKEINLWK+RT+
Sbjct  184  ES--DRRDYYSDEERVDRLEEEEHEEVIIPFSAPIMVGGG---IDLLPRKEINLWKKRTI  238

Query  801  AQPKPLQLNA  830
              P PLQL +
Sbjct  239  NPPNPLQLRS  248



>ref|XP_010667470.1| PREDICTED: uncharacterized protein At1g76070 [Beta vulgaris subsp. 
vulgaris]
Length=296

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 121/309 (39%), Positives = 153/309 (50%), Gaps = 81/309 (26%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSA-AISFQS---LPFSPGRDKRPA-----------AAADIK  224
            ME   KP    + LKFLPK A A SFQS     FSPGRD               ++  +K
Sbjct  1    MENSNKPRS--LFLKFLPKPASAASFQSNNNAHFSPGRDHHHYNHHNNHHNNHHSSTKLK  58

Query  225  THCNKGFSGPI-ISIIPAEARRKSGMD----TQEPSSPKVSCIGqikhkkkmakqkrqqP  389
             H +KGFSGPI  S +P EAR K   D      EP+SPKVSC+GQIK+K K  K  ++  
Sbjct  59   AHAHKGFSGPINFSTLPDEARTKPNKDGSFEAHEPTSPKVSCMGQIKYKHKKKKLMKKA-  117

Query  390  RVDPLPTKKDYARSLTTSFQEISSSSAAIGKIF----------------------HGRRS  503
              + + TK D+        Q++  SS+AI K F                      HGRR 
Sbjct  118  SKNSINTKSDH--------QQVKKSSSAISKFFNRSSSSKFDKKSTAVPSLGHGKHGRRD  169

Query  504  DATADSSRLRVCEDA--PSLGQMKRFASGRETLSDFNWTTASTATAQVVP----------  647
                +SS  ++   A  PSLGQM +FASGRE+L++F+WT      AQ+ P          
Sbjct  170  TLDHNSSNNKITSTAMVPSLGQMNKFASGRESLTNFDWT------AQIAPLDHDRDYYSD  223

Query  648  -HGRKYCLDNDSDDEYEEISIPFSAPMFGG---------HGSTTLPLEPRKEINLWKRRT  797
                +    +D DD+  E+ IP+SAPM  G         H    L LEPRKE+NLWKRRT
Sbjct  224  DDDHRRDHSSDDDDDQREVIIPYSAPMLLGGRSSIDHDDHVMGGLCLEPRKEVNLWKRRT  283

Query  798  MAQPKPLQL  824
            MA P PL L
Sbjct  284  MAPPVPLAL  292



>ref|XP_007136125.1| hypothetical protein PHAVU_009G019900g [Phaseolus vulgaris]
 gb|ESW08119.1| hypothetical protein PHAVU_009G019900g [Phaseolus vulgaris]
Length=263

 Score =   133 bits (335),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 109/278 (39%), Positives = 159/278 (57%), Gaps = 48/278 (17%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSAA---ISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPII  260
            MEK +K      ILK LPK+ A   ++FQ+ PFSPGRD +               S P++
Sbjct  1    MEKQLKLRNK--ILKALPKAVAAVTMTFQNPPFSPGRDHK---------------SKPMV  43

Query  261  SIIPAEARRKS-------GMDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKD  419
            S+IP EARRK+       G+ +QEP+SPK+SC+GQIKHKKK  K+ + +  +       +
Sbjct  44   SMIPHEARRKTHDRNGINGIYSQEPTSPKISCMGQIKHKKKQIKKAKTKSVMTRPKEATN  103

Query  420  YARSLTTSFQ---EISSSSAAIGK--IFH-------GRRSDATA------DSSRLRVCED  545
             AR+ ++S     E+   ++   K  +FH       GR+S+A+A       +  L     
Sbjct  104  VARNKSSSASRDAEVKKHASTFQKMLLFHAAKPKSEGRKSNASAPGDISDGNHALGDAAR  163

Query  546  APSLGQMKRFASGRETLSDFNWTTASTA--TAQVVPHGRKYCLDN-DSDDEYEEISIPFS  716
            AP + Q++RF+SGR+ L+ F+W  A  A   A++  +   Y +++ D ++E EE+ IPFS
Sbjct  164  APHVSQVRRFSSGRDALASFDWKVAQVAPDEAEIDYYSDDYRVESSDGEEEEEEVMIPFS  223

Query  717  APMFGGHGSTTLPLEPRKEINLWKRRTMAQPKPLQLNA  830
            AP+  G G   L L+PRKEINLWKRRTMA P PLQL+ 
Sbjct  224  APILVGGGVGVLNLKPRKEINLWKRRTMAPPMPLQLHG  261



>ref|XP_010061108.1| PREDICTED: uncharacterized protein At1g76070-like [Eucalyptus 
grandis]
Length=317

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 107/293 (37%), Positives = 149/293 (51%), Gaps = 52/293 (18%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKS-AAISF-QSLPFSPGRDKR-------------PAAAADIK  224
            MEK     K+K +LKFLP++ ++ISF Q+ PFSP RDKR              +    ++
Sbjct  20   MEKSQAKPKSKKVLKFLPRTVSSISFFQNPPFSPDRDKRLPSSSSSYSSELINSTKRRLR  79

Query  225  THCNKGFSGPIISIIPAEARRKS----GMDTQEPSSPKVSCIGq-----------ikhkk  359
            +H   GFSGP+IS+IP EAR K+      D  EP+SPKVSC+GQ              K 
Sbjct  80   SHVGTGFSGPLISLIPDEARAKNRNDRDFDVNEPTSPKVSCMGQIKHKNKKSWPSSAAKA  139

Query  360  kmakqkrqqPRVDPLPTKKDYARSLTTSFQEISSSSAAIGKIFHGRR-------SDATAD  518
                             K+D  +   +S      SS  + +IF   R       SD + +
Sbjct  140  DKRSSFSSSASSSFSKLKRDVNKPPRSSNTHEKQSST-LKRIFSRARGGNKKKPSDTSGN  198

Query  519  SSRL--RVCEDAPSLGQMKRFASGRETLSDFNWTTASTATAQVVPHGRK----YCLD---  671
            + R    + + APSL QMKRFASGR+TL+ F+W   S     V+   R+    Y  D   
Sbjct  199  NCRKPPLLPDRAPSLSQMKRFASGRDTLASFDW---SAEVGPVLDADRQDYYHYYSDEER  255

Query  672  --NDSDDEYEEISIPFSAPMFGGHGSTTLPLEPRKEINLWKRRTMAQPKPLQL  824
              +D ++E +++ IPFSAP+  G G   +  + RKEINLWKRRTM  P+PL+L
Sbjct  256  RESDQEEEDDKVIIPFSAPIPVGGGGVRVNPQSRKEINLWKRRTMDPPRPLEL  308



>ref|XP_007226351.1| hypothetical protein PRUPE_ppa022618mg [Prunus persica]
 gb|EMJ27550.1| hypothetical protein PRUPE_ppa022618mg [Prunus persica]
Length=255

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 106/258 (41%), Positives = 145/258 (56%), Gaps = 34/258 (13%)
 Frame = +3

Query  126  ILKFLPKSAA-ISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIISIIPAEARRK----  290
            ILKFLPK+A+ + F + P+SP RD+R   AA +K H  +GFSGP++  I  EARRK    
Sbjct  12   ILKFLPKAASGVYFHNPPYSPTRDRRLENAAKLKAHGRRGFSGPLM--ISDEARRKPRTG  69

Query  291  ---SGMDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTTSFQEISS  461
                    +EP+SPKVSC+GQIKHKK++ K KR    +  L  K         S +EI  
Sbjct  70   SFDYHTQEEEPTSPKVSCMGQIKHKKQIKKIKRAN--IHNLIPKDASKPPAPWSPREIKK  127

Query  462  SSAAIGKIFH----GRRSDAT-----ADSSRLRVCEDAPSLGQMKRFASGR-ETLSDFNW  611
               A  ++F      R+SD+       D +  R+ + APSL QMKRFASGR    ++F+ 
Sbjct  128  HGFAFRRMFSSVNPARKSDSINVNHDHDRTAPRLPDRAPSLSQMKRFASGRGNAFANFDI  187

Query  612  TTASTATAQVVPHGRKYCLDNDSDDEYEEISIPFSAPMF-GGHGSTTLPLEPRKEINLWK  788
                 +  +            DSD E E++ I FSAP+  GG     +PL+PRKEIN+WK
Sbjct  188  NHHDCSDEER----------GDSDGE-EDVRIAFSAPLVAGGDQFHQVPLQPRKEINIWK  236

Query  789  RRTMAQPKPLQLNAVIRS  842
            RRTMA P PL+L  ++R+
Sbjct  237  RRTMAAPSPLELKPMVRA  254



>gb|KHN48527.1| Hypothetical protein glysoja_043906 [Glycine soja]
Length=240

 Score =   127 bits (319),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 100/245 (41%), Positives = 139/245 (57%), Gaps = 26/245 (11%)
 Frame = +3

Query  126  ILKFLPKSAAIS--FQSLPFSPGRDKRPAAAADIKTHCNKGF-SGPIISIIPAEARRKSG  296
            I K LPK+AA+S  FQ+ PFSPGRD +       K +  KGF SGP+I   P EARRK+ 
Sbjct  17   IFKILPKAAAMSVTFQNPPFSPGRDHK------CKHYGGKGFFSGPMI---PDEARRKAK  67

Query  297  MD-TQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTTSFQEISSSSAA  473
             D  QE    +   +     +KK   Q ++  +   +PT++   +   + FQ + S  + 
Sbjct  68   NDQAQEGRGKEHVHVHAYSQRKKKKNQIKKAAKTMSMPTEE---KKQASKFQRMMSFHSG  124

Query  474  IGKIFHGRRSDATADSSRLRVCEDAPSLGQMKRFASGRETLSDFNWTTASTATAQVVPHG  653
              K    R+  + AD    R    AP LG M+RFASGRET S+F+W       AQ+ PH 
Sbjct  125  KPKRPAARKQQSDADLESER--SPAPPLGHMRRFASGRETFSNFDWK------AQIAPHD  176

Query  654  RKYCLDNDSDDEYEEISIPFSAPM-FGGHGSTTLPLEPRKEINLWKRRTMAQPKPLQLNA  830
            ++    +D D   +EI IPFSAP+  GG  +  L ++PRKEINLWKRRTMA P+PL+LN 
Sbjct  177  QERD-YDDVDRLDDEIIIPFSAPLTLGGATALNLNVQPRKEINLWKRRTMAPPRPLKLNP  235

Query  831  VIRSK  845
            ++ +K
Sbjct  236  LLTAK  240



>ref|XP_008221203.1| PREDICTED: uncharacterized protein At1g76070-like [Prunus mume]
Length=255

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 107/258 (41%), Positives = 146/258 (57%), Gaps = 34/258 (13%)
 Frame = +3

Query  126  ILKFLPKSAA-ISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIISIIPAEARRKS---  293
            ILKFLPK+A+ + F + P+SP RD+R   AA +K H  +GFSGP++  I  +ARRK    
Sbjct  12   ILKFLPKAASGVYFHNPPYSPTRDRRLENAAKLKAHGRRGFSGPLM--ISDDARRKPRTG  69

Query  294  --GMDTQE--PSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTTSFQEISS  461
                 TQE  P+SPKVSC+GQIKHKK++ K KR    +  L  K         S +EI  
Sbjct  70   SFDYHTQEDEPTSPKVSCMGQIKHKKQIKKIKRAN--IHNLIPKDASKPPAPWSPREIKK  127

Query  462  SSAAIGKIFH----GRRSDAT-----ADSSRLRVCEDAPSLGQMKRFASGR-ETLSDFNW  611
               A  ++F      R+SD+       D +  R+ + APSL QMKRFASGR    ++F+ 
Sbjct  128  RGFAFRRMFSSVNPARKSDSINVNHDHDGTAPRLPDRAPSLSQMKRFASGRGNAFANFDI  187

Query  612  TTASTATAQVVPHGRKYCLDNDSDDEYEEISIPFSAPMF-GGHGSTTLPLEPRKEINLWK  788
                 +  +            DSD E E++ I FSAP+  GG     +PL+PRKEIN+WK
Sbjct  188  NHHDCSDEER----------GDSDGE-EDVRIAFSAPLVAGGDQFHQVPLQPRKEINIWK  236

Query  789  RRTMAQPKPLQLNAVIRS  842
            RRTMA P PL+L  ++R+
Sbjct  237  RRTMAAPSPLELKPMVRA  254



>ref|XP_009414427.1| PREDICTED: uncharacterized protein At1g76070-like [Musa acuminata 
subsp. malaccensis]
Length=236

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 100/254 (39%), Positives = 137/254 (54%), Gaps = 26/254 (10%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSAAIS-FQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIISI  266
            MEKP + S    I+ FLP  A+ S     P+SPGR+      A ++   NKGFSGP++SI
Sbjct  1    MEKPRRSS----IISFLPNRASFSHIPHHPYSPGREN----PAKMRALQNKGFSGPMVSI  52

Query  267  IPAEARRK----SGMDT-QEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARS  431
            +P EARRK     G +T +EP+SPKV+C+GQIK +K  ++ K       P P +++   S
Sbjct  53   VPMEARRKQKNRGGFETPEEPTSPKVTCMGQIKLRKMASRCK------KPSPDRRERKPS  106

Query  432  LTTSFQEISSSSAAIGKIFHGRRSDATADSSRLRVCEDAPS--LGQMKRFASGRETLSDF  605
                        AA  +      S AT  ++R      A +  LGQ +RFAS RE+L DF
Sbjct  107  FIIRKIFRRKGKAAASRGPDAGESGATRPTTRAAAAVPARAPLLGQTRRFASSRESLGDF  166

Query  606  NWTTASTATAQVVPHGRKYCLDNDSDDEYEEISIPFSAPMFGGHGSTTLPLEPRKEINLW  785
            +W        +    G  Y  D  SD E +E+ IP SAP+    G     +EP+KE+NLW
Sbjct  167  DWR--KVLEREDGGEGTYYAGDEGSDAEEDEVIIPHSAPII--LGGMVAAVEPKKEVNLW  222

Query  786  KRRTMAQPKPLQLN  827
            KRRT++ P PLQLN
Sbjct  223  KRRTLSPPLPLQLN  236



>gb|KHN09055.1| Hypothetical protein glysoja_034240 [Glycine soja]
Length=259

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 102/268 (38%), Positives = 149/268 (56%), Gaps = 50/268 (19%)
 Frame = +3

Query  126  ILKFLPKSAA---ISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIISIIPAEARRKSG  296
            ILK LPK+ +   ++FQ+ PFSPGRD +               S PI+S+IP EARRK+ 
Sbjct  5    ILKALPKAVSAVTVTFQNHPFSPGRDHK---------------SKPIVSMIPHEARRKTH  49

Query  297  ----------MDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTTSF  446
                      + +QEP+SPK+SC+GQIKHKKK  ++ + + +      +   ++  +++ 
Sbjct  50   DRGNNNDIDEIYSQEPTSPKISCMGQIKHKKKQIEKSKSKSKSMTKEARNVASKQTSSAS  109

Query  447  QEISS----SSAAIGKIFHG-------RRSDATA-----DSSRLRVCEDAPSLGQMKRFA  578
            +EI      S+     +FHG       R+S+A+A         L     AP + QM+RF+
Sbjct  110  REIEVKNHVSTFQKMLLFHGTKPKSDGRKSNASAPGDINKDRALADAARAPRVSQMRRFS  169

Query  579  SGRETLSDFNWTTASTA--TAQVVPHGRKYCLDNDSDDEYEEISIPFSAPMFGGHGSTTL  752
            SGR+ L DF+W  A  A    ++  +   Y +D+D D+E E+I IPFSAP+  G G    
Sbjct  170  SGRDALGDFDWKVAQVAPDEEEIDYYSDHYRVDSDGDEE-EQIIIPFSAPLLVGVGVGHG  228

Query  753  P---LEPRKEINLWKRRTMAQPKPLQLN  827
                L+PR EINLWKRRTMA P+PLQL+
Sbjct  229  GVLNLKPRIEINLWKRRTMAPPRPLQLD  256



>ref|XP_004292930.1| PREDICTED: uncharacterized protein At1g76070-like [Fragaria vesca 
subsp. vesca]
Length=266

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 101/264 (38%), Positives = 137/264 (52%), Gaps = 40/264 (15%)
 Frame = +3

Query  126  ILKFLPKSA-AISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIISIIPAEARRK----  290
            ILKFLPK+A A+ F    +SP    +P     +      GFSGP+I   P EARRK    
Sbjct  13   ILKFLPKAASAVYFHGASYSP--KHKPHGGRGV------GFSGPLI---PDEARRKPRNN  61

Query  291  ------SGMDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTTSFQE  452
                    +D  EP+SPKVSC+GQIK KK+  +Q ++  R    P  +      T   +E
Sbjct  62   VGGSSFGSVDEVEPTSPKVSCMGQIKKKKEQHQQIKKTKREGLPPRNQSKDSKETKPSRE  121

Query  453  ISSSSAAIGKIFHG----RRSDATADSSRLR----VCEDAPSLGQMKRFASGR-ETLSDF  605
            +   ++   ++F G    R+SDA  D  +      + + APSL QM+RFASGR + +++F
Sbjct  122  VKKHASTFRRMFSGVNSRRKSDADVDDLKTNKAAGLPDRAPSLSQMRRFASGRGKAIANF  181

Query  606  NWTT--ASTATAQVVPHGRKYCLDND------SDDEYEEISIPFSAPM-FGGHGSTTLPL  758
            +W    A  A      + + Y  D D       D E E   I FSAP+  GG     + L
Sbjct  182  DWQAPLAKVAPRHDDDNNQNYHSDEDGEYSDHEDHEREHTKIAFSAPLTIGGSPGGDVAL  241

Query  759  EPRKEINLWKRRTMAQPKPLQLNA  830
            +PRKEINLWKRRTMA P PLQ+ A
Sbjct  242  QPRKEINLWKRRTMAPPSPLQVKA  265



>gb|KGN60065.1| hypothetical protein Csa_3G875410 [Cucumis sativus]
Length=225

 Score =   124 bits (310),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 103/262 (39%), Positives = 138/262 (53%), Gaps = 57/262 (22%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSA-AISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPI-IS  263
            MEK   P K+K  +KFLP++A A++F + P SPGR+ RP A         +GFSGP+  S
Sbjct  4    MEKHSNP-KSK-FMKFLPRAASAVNFHNPPVSPGRETRPLAG--------RGFSGPMNFS  53

Query  264  IIPAEAR----RKSGMDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARS  431
            IIP EAR      SG +T EP+SPKVSCIGQIKHKKK+        +     T +   R 
Sbjct  54   IIPREARITKSNNSGFETPEPTSPKVSCIGQIKHKKKLKGMA----KTAAAATVESKNRL  109

Query  432  LTTSFQEISSSSAAIGKIFHGRRSDATADSSRLRVCEDAPSLGQMKRFASGRETLSDFNW  611
              +  + I +    +G+      + A A S +  + E AP L QMKRF+SGR  L++F+W
Sbjct  110  PPSRIKRIFTGGKVLGRA-KSNVAGAAAQSGKPPLPERAPGLNQMKRFSSGRGALANFDW  168

Query  612  TTASTATAQVVPHGRKYCLDNDSDDEYEEISIPFSAPMFGGHGSTTL-------PLEPRK  770
            T      AQ+ P           +DE E            G G  T+       P +PRK
Sbjct  169  T------AQIAP-----------EDEVE------------GEGRRTVWIGEEVGPFQPRK  199

Query  771  EINLWKRRTMAQPKPLQLNAVI  836
            E+N+WKRRT+  P PLQLN+ I
Sbjct  200  EVNIWKRRTVVPPTPLQLNSTI  221



>ref|XP_003527495.1| PREDICTED: uncharacterized protein At1g76070-like [Glycine max]
Length=259

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 101/268 (38%), Positives = 150/268 (56%), Gaps = 50/268 (19%)
 Frame = +3

Query  126  ILKFLPKSAA---ISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIISIIPAEARRKSG  296
            ILK LPK+ +   ++FQ+ PFSPGRD +               S PI+S+IP EARRK+ 
Sbjct  5    ILKALPKAVSAVTVTFQNHPFSPGRDHK---------------SKPIVSMIPHEARRKTH  49

Query  297  ----------MDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTTSF  446
                      + +QEP+SPK+SC+GQIKHKKK  ++ + + +      +   ++  +++ 
Sbjct  50   DRGNNNDIDEIYSQEPTSPKISCMGQIKHKKKQIEKSKSKSKSMTKEARNVASKQTSSAS  109

Query  447  Q--EISSSSAAIGK--IFHG-------RRSDATA-----DSSRLRVCEDAPSLGQMKRFA  578
            +  E+ +  +   K  +FHG       R+S+A+A         L     AP + QM+RF+
Sbjct  110  RDIEVKNHVSTFQKMLLFHGTKPKSDGRKSNASAPGDINKDRALADAARAPRVSQMRRFS  169

Query  579  SGRETLSDFNWTTASTA--TAQVVPHGRKYCLDNDSDDEYEEISIPFSAPMFGGHGSTTL  752
            SGR+ L DF+W  A  A    ++  +   Y +D+D D+E E+I IPFSAP+  G G    
Sbjct  170  SGRDALGDFDWKVAQVAPDEEEIDYYSDHYRVDSDGDEE-EQIIIPFSAPLLVGVGVGHG  228

Query  753  P---LEPRKEINLWKRRTMAQPKPLQLN  827
                L+PR EINLWKRRTMA P+PLQL+
Sbjct  229  GVLNLKPRIEINLWKRRTMAPPRPLQLD  256



>ref|XP_010034704.1| PREDICTED: uncharacterized protein At1g76070-like [Eucalyptus 
grandis]
 gb|KCW53226.1| hypothetical protein EUGRSUZ_J02492 [Eucalyptus grandis]
Length=233

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 109/252 (43%), Positives = 138/252 (55%), Gaps = 29/252 (12%)
 Frame = +3

Query  90   MEKPVKPSKAK-MILKFLPKS-AAISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIIS  263
            MEK  KPSK K M+LKFLPKS  A++FQS P SP R   P  A  I          P  S
Sbjct  1    MEK-GKPSKLKGMLLKFLPKSPTAVTFQSPPISP-RKATPGKALLI----------PAAS  48

Query  264  IIPAEARRK---SGMDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPL-PTKKDYARS  431
            IIP +ARR+      D +EP SP VSCIGQ+K+KKK  K +  +  + P+  T+ +  R 
Sbjct  49   IIPKDARRRMKNGSFDAREPGSPMVSCIGQVKNKKKKTKLRLNRQDLPPMGETRLEEKRP  108

Query  432  LTTSFQEISSSSAAIGKIF-HGRRSDATADSSRLRVCEDAPSLGQMKRFASGRETLSDFN  608
                    SSS   + K    G++SD  AD S+    E  PSL  +K+FASGR  L++F+
Sbjct  109  KEVKKNSHSSSKFQLFKTAKRGQKSD-IADKSKPLGLEKVPSLADVKKFASGRGVLTNFD  167

Query  609  WTTASTATAQVVPHGRKYCLDNDSDDEYEEISIPFSAPMFGGHGSTTLPLEPRKEINLWK  788
            W     A   VVP     C D++  D  ++  IP SAP+  G     L  EP+KEINLWK
Sbjct  168  WRDHGAA---VVPD----CSDDEEIDGVKKKIIPHSAPIVLGRNEIVL--EPKKEINLWK  218

Query  789  RRTMAQPKPLQL  824
            RRT A P PLQL
Sbjct  219  RRTTAPPPPLQL  230



>ref|XP_008466454.1| PREDICTED: uncharacterized protein At1g76070 [Cucumis melo]
Length=222

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 100/263 (38%), Positives = 139/263 (53%), Gaps = 61/263 (23%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSA-AISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPI-IS  263
            MEK     K+K  +KFLP++A A++F + P SPGR+ RP A         +GFSGP+  S
Sbjct  3    MEKHSSNPKSKF-MKFLPRAASAVNFHNPPVSPGRETRPLAG--------RGFSGPMKFS  53

Query  264  IIPAEAR----RKSGMDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARS  431
            IIP +AR      SG +T EP+SPKVSCIGQIKHKKK+                KD A++
Sbjct  54   IIPRDARITKSNNSGFETPEPTSPKVSCIGQIKHKKKL----------------KDLAKT  97

Query  432  LTTSFQEISS-SSAAIGKIFHG-------RRSDATADSSRLRVCEDAPSLGQMKRFASGR  587
               + +  +    + I +IF G       + S A A + +  + E AP + QMKRF+SGR
Sbjct  98   AAATVESKNRLPPSRIKRIFTGGKVLGRAKSSVAGAQTGKAPLPERAPGVNQMKRFSSGR  157

Query  588  ETLSDFNWTTASTATAQVVPHGRKYCLDNDSDDEYEEISIPFSAPMFGGHGSTTLPLEPR  767
              L++F+WT      AQ+ P       D    +E   + I          G    P +PR
Sbjct  158  GALANFDWT------AQIAPE------DEVEGEERRTVWI----------GEEVGPFQPR  195

Query  768  KEINLWKRRTMAQPKPLQLNAVI  836
            KE+N+WKRRT+  P PLQL++ I
Sbjct  196  KEVNIWKRRTVVPPTPLQLSSTI  218



>ref|XP_004500912.1| PREDICTED: uncharacterized protein At1g76070-like [Cicer arietinum]
Length=239

 Score =   122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 108/248 (44%), Positives = 140/248 (56%), Gaps = 32/248 (13%)
 Frame = +3

Query  126  ILKFLPKSAAISFQSLPFSPGRD-KRPAAAADIKTHCNKGFSGPIISIIPAEARRKSGMD  302
            ILK LP S  ++FQ+ PFSPG++ K     A      +KGFSGPI+SI P      +G++
Sbjct  11   ILKILP-SINLTFQNNPFSPGKNHKSKQDNAKNWARPHKGFSGPIVSIKPKGI---NGIE  66

Query  303  TQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTTSFQEISSSSAAIGK  482
             +EP+SPK+SC+GQIKHKKK  K+       D +  KK       T+FQ++         
Sbjct  67   NEEPTSPKISCMGQIKHKKKQIKKV-----KDIVEVKKH-----VTTFQKMLLHVGKPKS  116

Query  483  IFHGRRSDATA-DSSRLRVCEDAPSLGQMKRFASGRETLSDFNWTTASTATAQVVPHG-R  656
                R+SDATA   ++  + E A  L QMKRFASGR T ++F+W       AQVV     
Sbjct  117  EGRRRKSDATAAQDNKYALEERATHLSQMKRFASGRGTFANFDWK------AQVVAEEIE  170

Query  657  KYCLDNDSDD-------EYEEISIPFSAPMFGGHGSTTLP--LEPRKEINLWKRRTMAQP  809
             Y  D D  +       E EE  IPFSAP+  G G   +   L+PRKEINLWKRRTMA P
Sbjct  171  DYYSDEDRMNGDDDDDDEEEEFMIPFSAPILLGGGGVGVLDNLKPRKEINLWKRRTMAPP  230

Query  810  KPLQLNAV  833
            +PLQL+ V
Sbjct  231  RPLQLDKV  238



>ref|XP_008377124.1| PREDICTED: uncharacterized protein At1g76070 [Malus domestica]
Length=258

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 105/260 (40%), Positives = 148/260 (57%), Gaps = 37/260 (14%)
 Frame = +3

Query  126  ILKFLPKSAA-ISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIISIIPAEARRKS---  293
            ILKFLPK+A+ +SF S P+SP R+    AAA +K    +GFSGP++  IP + RRK    
Sbjct  13   ILKFLPKAASGVSFXSRPYSPXRE----AAAKLKAQGRRGFSGPLM--IPDQVRRKQRNG  66

Query  294  GMDTQ----EPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARS-LTTSFQEIS  458
              D Q    EP+SPKVSC+GQIKHKK + K      RV+ +P  +  ++     S +EI 
Sbjct  67   SFDGQTXEEEPTSPKVSCMGQIKHKKHINKIN----RVNLIPKDRQKSKPPAPWSPREIK  122

Query  459  SSSAAIGKIFH----GRRSDATA-DSSRLRVC----EDAPSLGQMKRFASGR-ETLSDFN  608
                   ++F     GR+S++ A D  R R      + APSL QMKRF+SGR     +F+
Sbjct  123  KHGFQFRRMFSNINPGRKSESDASDLDRSRTAPSLPDMAPSLNQMKRFSSGRGHAFENFD  182

Query  609  WTTASTATAQVVPHGRKYCLDNDSDDEYEE--ISIPFSAPM-FGGHGS-TTLPLEPRKEI  776
            W ++      ++ + R Y  +   D +  E  + I FSAP+  GG      +PL+P+KEI
Sbjct  183  WESSHN----IMNNHRDYSDEEREDSDEREEDVRIAFSAPLGIGGRNQFHQVPLQPKKEI  238

Query  777  NLWKRRTMAQPKPLQLNAVI  836
            NLWKRRTMA P PL+L  ++
Sbjct  239  NLWKRRTMAPPIPLELKPMV  258



>ref|XP_009334570.1| PREDICTED: uncharacterized protein At1g76070-like [Pyrus x bretschneideri]
Length=258

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 107/268 (40%), Positives = 146/268 (54%), Gaps = 52/268 (19%)
 Frame = +3

Query  126  ILKFLPKSAA-ISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIISIIPAEARRKS---  293
            ILKFLPK+A+ + F + P+SP  D    AAA +K H  +GFSGP++  IP + RRK    
Sbjct  13   ILKFLPKAASGVYFHNPPYSPTGD----AAAKLKAHGRRGFSGPLM--IPDQVRRKQKNG  66

Query  294  GMDTQ----EPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTTSF--QEI  455
              D Q    EP+SPKVSC+GQIKHKK   K       VD +P  +  ++     +  +EI
Sbjct  67   SFDGQTREEEPTSPKVSCMGQIKHKKHTNKINS----VDLIPKDRQKSKPPPGPWSPREI  122

Query  456  SSSSAAIGKIFH----GRRSDATA-DSSRLRVCED----APSLGQMKRFASGR-ETLSDF  605
                    ++F     GR+S++ A D  R R   +    APSL QMKRFASGR ++    
Sbjct  123  KKHGFPFRRMFSNINPGRKSESDASDLDRDRTAPNLPDRAPSLSQMKRFASGRGQSFEKL  182

Query  606  NWTTASTATAQVVPHGRKYCLDNDSDD-------EYEEISIPFSAPM-FGG-HGSTTLPL  758
            +W              R + + ND  D       E E++ I FSAP+  GG +    +PL
Sbjct  183  DWE-------------RPHDIMNDHRDYSDEEREEREDVRIAFSAPLGIGGINQLHQVPL  229

Query  759  EPRKEINLWKRRTMAQPKPLQLNAVIRS  842
            +PRKEINLWKRRTMA P PL+L  ++R+
Sbjct  230  QPRKEINLWKRRTMAPPSPLELKPMVRA  257



>ref|XP_008387901.1| PREDICTED: uncharacterized protein At1g76070-like [Malus domestica]
Length=258

 Score =   119 bits (298),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 106/261 (41%), Positives = 147/261 (56%), Gaps = 38/261 (15%)
 Frame = +3

Query  126  ILKFLPKSAA-ISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIISIIPAEARRKS---  293
            ILKFLPK+A+ I F + P+SP  D    AAA +K H  +GFSGP++  IP + RRK    
Sbjct  13   ILKFLPKAASGIYFHNPPYSPTGD----AAAKLKAHGRRGFSGPLM--IPDQVRRKQKSG  66

Query  294  GMDTQ----EPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYAR--SLTTSFQEI  455
              D Q    EP+SPKVSC+GQIKHKK   K       V+ +P  +  ++  S   S +EI
Sbjct  67   SFDGQTREEEPTSPKVSCMGQIKHKKHTNKINS----VNLIPKDRQKSKPPSGPWSPREI  122

Query  456  SSSSAAIGKIFH----GRRSDATA-DSSRLRVCED----APSLGQMKRFASGR-ETLSDF  605
                    ++F     GR+S++ A D  R R   +    APSL QMKRF+SGR +   + 
Sbjct  123  KKHGFPFRRMFSNINPGRKSESDASDLDRDRTAPNLPDRAPSLSQMKRFSSGRGQYFENL  182

Query  606  NWTTASTATAQVVPHGRKYCLDNDSDDEYEEISIPFSAPM-FGG-HGSTTLPLEPRKEIN  779
            +W +       ++   R Y  +     E E++ I FSAP+  GG +    +PL+PRKEIN
Sbjct  183  DWESPHD----IMNDHRDYSDEERE--EREDVRIAFSAPLGIGGINQLHQVPLQPRKEIN  236

Query  780  LWKRRTMAQPKPLQLNAVIRS  842
            LWKRRTMA P PL+L  ++R+
Sbjct  237  LWKRRTMAPPSPLELKPMVRA  257



>ref|XP_010646649.1| PREDICTED: uncharacterized protein At1g76070-like [Vitis vinifera]
Length=277

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 105/271 (39%), Positives = 141/271 (52%), Gaps = 29/271 (11%)
 Frame = +3

Query  42   LYIYSNLYRHT--YRS*AMEKPVKPSKAKMILKFLPKSAA-ISFQSLPFSPGRDKRPAAA  212
            L +Y +L R T   +S  MEK     K +  LK LPK+A+ + F S P SP  D+R    
Sbjct  26   LSLYISLTRITKEQQSDLMEKRSTRMK-RTFLKLLPKAASPVIFLSPPLSPVGDRRIENT  84

Query  213  ADIKTHCNKGFSGPIISIIPAEARRKS---GMDTQEPSSPKVSCIGqikhkkkmakqkrq  383
              +K    KG+SGP +S++P EARRKS     DT+EP+SPKVSC+GQI  KKK  K K  
Sbjct  85   TKLKA-ITKGYSGPNVSMVPPEARRKSKNGSFDTREPTSPKVSCMGQINIKKKKNKSKTV  143

Query  384  qPRVDPLPTKKDYARSLTTSFQEISSSSAAIGKIFHGRRSDATADSSRLRVCEDAP----  551
             P  +         +S    F+        I +IF G  S+    S  + V + AP    
Sbjct  144  LPPTEKPKPVSSPGKSKKNPFE--------IHRIFQG--SNHCRKSGHIDVKQPAPDRTP  193

Query  552  SLGQMKRFASGRETLSDFNWTTASTATAQVVPHGRKYCLDNDSDDEYEEISIPFSAPMFG  731
            SL QMK FASGR+   +F+W     A   V P  + +C D   + E + I I FSAP+  
Sbjct  194  SLSQMKGFASGRDAFMNFDWRVHGAA---VAPDNQNHCADGKEEGEEKAI-ISFSAPIAV  249

Query  732  GHGSTTLPLEPRKEINLWKRRTMAQPKPLQL  824
            G     + + P+K I+LWKRRT+  P  LQL
Sbjct  250  GGA---VAVGPKKAIDLWKRRTVPPPPALQL  277



>gb|AFK37300.1| unknown [Lotus japonicus]
Length=280

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 103/295 (35%), Positives = 150/295 (51%), Gaps = 65/295 (22%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSAAISFQSLPFSPGR-------DKRPAAAADIKTHC---NK  239
            MEK  K + +K++   +  + +++F + PFSPGR       D+  A    +K H    NK
Sbjct  1    MEKQHKRNGSKILKAVI--AVSMTFHNTPFSPGRDHHKSRTDQNNATTKWVKPHHHGGNK  58

Query  240  GFSGPIISIIPAEARRKSGMD--TQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTK  413
            GFSGP   +IP    +  G +   +E +SPK+SC+GQIKHKK   K+ + +  V      
Sbjct  59   GFSGP---MIPRTNLKDGGFENYNRESTSPKISCMGQIKHKKNQIKKSKSKKSVSLQNET  115

Query  414  KDYA----------------------RSLTTSFQEISSSSAAIGKIFHGRRSDATADSSR  527
            + +A                      +++ + FQ +   +A   K   GR+SDA++    
Sbjct  116  RKFASTTNKTTTTSTSNSTDVIEVKKKNVASKFQRMLFHAAKQPKSA-GRKSDASS----  170

Query  528  LRVCEDAPSLGQMKRFASGRETLSDFNWTTASTATAQVVPHGRKY------CLDNDSDDE  689
                 +AP + QMKRF+SGR+  S F+W  A  A  ++  H   Y       +++D D+E
Sbjct  171  --AEREAPHMSQMKRFSSGRDAFSSFDW-KAEMAAEEI--HIDDYYSDEDRVVESDGDEE  225

Query  690  YEEISIPFSAPMF---------GGHGSTTLPLEPRKEINLWKRRTMAQPKPLQLN  827
             E I IPFSAPM            HG   L L+PRKEINLWKRRTMA P+PLQL+
Sbjct  226  EERIIIPFSAPMLIGGGAGGGCVAHGD-VLNLKPRKEINLWKRRTMAPPRPLQLD  279



>gb|KFK34451.1| hypothetical protein AALP_AA5G147100 [Arabis alpina]
Length=263

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 94/261 (36%), Positives = 131/261 (50%), Gaps = 35/261 (13%)
 Frame = +3

Query  105  KPSKAKMILKFLPKSAAISFQSLPFSPGRDKRPAAAADIKTHCNKGF-SGPIISIIPAEA  281
            KP     ILK LPK+ +   +  PFSPGRD       +  T  NK F SGP++ ++P  A
Sbjct  14   KPKNKNKILKMLPKAMSFGHRVPPFSPGRDLHHNHHHN--TASNKAFFSGPMVPLVPNAA  71

Query  282  R-RKSGMDT--QEPSSPKVSCIGqikhkkkmakqkrqq-----PRVDPLPTKKDYARSLT  437
            R R++  D    EP+SPKVSCIGQIK  K   +   +      P+   L  + + +R   
Sbjct  72   RVRRNKNDAVWDEPTSPKVSCIGQIKRVKSKNRANTKSLIPKVPKTSSLTKENEKSRGFF  131

Query  438  TSFQEISSSSAAIGKIFHGRRSDATADSSRLRVCEDAPSLGQMKRFASGRETLSDFNWTT  617
               + + S S A G     R+S ++A +         PSLGQMK+FAS R+ L  F+W+ 
Sbjct  132  -KIKRLFSFSPATGGGKTSRKSHSSAVAEHPVTV--VPSLGQMKKFASSRDALGGFDWSV  188

Query  618  ASTATAQV-VPHGRKYCLDNDSDDEY-----------EEISIPFSAPMFGGHGSTTLPLE  761
                       H R Y  D+++  +Y           ++I IPFSAP         L L+
Sbjct  189  EMKQEEDSPADHHRGYYSDDETKGKYFRDDDDEDEDEDDIIIPFSAP---------LSLK  239

Query  762  PRKEINLWKRRTMAQPKPLQL  824
            P++E+NLWKRRTM  PKPL L
Sbjct  240  PKQEVNLWKRRTMDPPKPLHL  260



>ref|NP_001237090.1| syringolide-induced protein 14-1-1 [Glycine max]
 dbj|BAB86891.1| syringolide-induced protein 14-1-1 [Glycine max]
 gb|ACU19824.1| unknown [Glycine max]
 gb|KHN45960.1| Hypothetical protein glysoja_023183 [Glycine soja]
Length=257

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 105/267 (39%), Positives = 153/267 (57%), Gaps = 50/267 (19%)
 Frame = +3

Query  126  ILKFLPKSAA---ISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIISIIPAEARRKS-  293
            ILK LPK+ A   ++FQ+ PFSPGRD +               S PI+S+IP EARRK+ 
Sbjct  5    ILKALPKAVAAVTVTFQNHPFSPGRDHK---------------SKPIVSMIPHEARRKTH  49

Query  294  -----GMD---TQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTTSFQ  449
                 G+D   +QEP+SPK+SC+GQIKHKKK  K+ + + +      +   ++  +++ +
Sbjct  50   DRGNNGIDEIYSQEPTSPKISCMGQIKHKKKQIKKSKSKSKSMTKEARNVASKKTSSASR  109

Query  450  --EISSSSAAIGK--IFHG-------RRSDATA-----DSSRLRVCEDAPSLGQMKRFAS  581
              E+    +   K  +FHG       R+S+A+A         L     AP + QM+RF+S
Sbjct  110  DIEVKKHVSTFHKMLLFHGAKPKSEGRKSNASAPGDINKDLALADAARAPRVSQMRRFSS  169

Query  582  GRETLSDFNWTTASTATAQVVPHGRKYCLDNDSDDEYEEISIPFSAPMFGGHGSTT----  749
            GR+ L++F+W   S    ++  +  +Y +D+D + E EEI IPFSAP+  G G       
Sbjct  170  GRDALAEFDWKV-SPDEEEIDYYSDEYRVDSDGE-EEEEIIIPFSAPLLVGGGVGHTRGG  227

Query  750  -LPLEPRKEINLWKRRTMAQPKPLQLN  827
             L L+PRKEINLWKRRTMA P+PLQL+
Sbjct  228  VLNLKPRKEINLWKRRTMAPPRPLQLD  254



>gb|AAR23807.1| putative syringolide-induced protein 14-1-1 [Helianthus annuus]
Length=289

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 96/275 (35%), Positives = 142/275 (52%), Gaps = 43/275 (16%)
 Frame = +3

Query  93   EKPVKPSKAKMILKFLPK-SAAISFQSLP-FSPGRDKRPAAAADIKTHCNKGFSGPIISI  266
            +K V       ILK+LP+ ++++SFQ+ P +SP +DK+P+     K++   GFSGPI+S 
Sbjct  4    QKAVSTKSMTKILKYLPRATSSLSFQNPPLYSPVKDKKPSEKPH-KSNLGIGFSGPILST  62

Query  267  IPAEARRKSGMDTQ-----EPSSPKVSCIGqikhkkkmakqkrqqPR---------VDPL  404
            +P++  RK   D++     EP+SP+VSC+G +K K       +   +         V   
Sbjct  63   LPSDTHRKINNDSKLTLLHEPTSPRVSCVGTVKCKHYRKLTNKPTNKFSRTTSYTPVRTY  122

Query  405  PTKKDYARSL-TTSFQEISSSSAAIGKIFHGRRSDA--TADSSRLRVC-EDAPSLGQMKR  572
             T++D  + +        S     I  +F G R  A  +  S R R+  +  P L  MKR
Sbjct  123  KTEEDQEKVMKVDPVVVKSKKKCXIRSLFSGGRISAMQSMRSQRWRLTGQKGPCLSTMKR  182

Query  573  FASGRETLSDFNWTTASTATAQVVPHGRKYCLDNDSDDEYEEISIPFSAPMF---GGHGS  743
            F+SGR+    F+W T      QV P      LD+   D  EE  +P SAP+     G G 
Sbjct  183  FSSGRDAFMSFDWAT------QVAP------LDSGESDG-EEAVMPGSAPVVVRNKGVGD  229

Query  744  -----TTLPLEPRKEINLWKRRTMAQPKPLQLNAV  833
                   + LEP KEINLWKRR+MAQP+PLQ++A+
Sbjct  230  DFVRVAGVKLEP-KEINLWKRRSMAQPQPLQVHAI  263



>ref|XP_010536440.1| PREDICTED: uncharacterized protein At1g76070 [Tarenaya hassleriana]
Length=256

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 96/251 (38%), Positives = 130/251 (52%), Gaps = 32/251 (13%)
 Frame = +3

Query  126  ILKFLPKSAAISFQSLPFSPGRD----KRPAAAADIKTHCNKGF-SGPIISIIPAEAR-R  287
            ILK LPK+ +   +  PFSP RD    +  + +       N+ F SGPI  ++P EAR R
Sbjct  17   ILKMLPKAMSFGQRLAPFSPRRDLHHHQSTSTSTAAAAAGNRAFLSGPITRLVPVEARLR  76

Query  288  KSGMD--TQEPSSPKVSCIGqikhkkkmakqkrqqP-RVDPLPTK------KDYARSLTT  440
            KS  D    EP+SPKVSCIGQIK  K      +++P RV P   K      KD  R+  +
Sbjct  77   KSKNDGVMDEPTSPKVSCIGQIKLAKTKCSDTKKKPHRVPPAKPKTASSRSKDEDRARPS  136

Query  441  SFQEISSSSAAIGKIFHGRRSDATADSSRLRVCEDAPSLGQMKRFASGRETLSDFNWTTA  620
              + + SS+ A         + +  D     +  D PSLGQMK+FAS RE  + F+W   
Sbjct  137  MIKRMFSSAGAKPPEKPPPAAASAGD-----LAGDRPSLGQMKKFASSREAFAGFDWAAE  191

Query  621  STATAQ---VVPHGRKYCLDNDSDDEYEEISIPFSAPMFGGHGSTTLPLEPRKEINLWKR  791
              +  +    V   R+Y  D+      EE  I FSAP+     + T  L+P+KEINLWKR
Sbjct  192  MKSREESPATVYRRREYFSDD------EERVIAFSAPL---PLNETEGLKPKKEINLWKR  242

Query  792  RTMAQPKPLQL  824
            RTM  P+PLQ+
Sbjct  243  RTMNPPRPLQI  253



>ref|XP_009128151.1| PREDICTED: uncharacterized protein At1g76070-like [Brassica rapa]
 ref|XP_009128152.1| PREDICTED: uncharacterized protein At1g76070-like [Brassica rapa]
 ref|XP_009128153.1| PREDICTED: uncharacterized protein At1g76070-like [Brassica rapa]
 emb|CDY65985.1| BnaAnng21350D [Brassica napus]
Length=261

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 87/251 (35%), Positives = 123/251 (49%), Gaps = 34/251 (14%)
 Frame = +3

Query  135  FLPKSAAISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIISIIPAEAR---RKSGMDT  305
             LPK+ +   +  PFSPG+D          +     FSGP++ ++P  AR    KS    
Sbjct  23   MLPKAMSFGHRVPPFSPGKDLHHNHNTTSSSSNKAYFSGPMV-LVPNAARVRRNKSDAVW  81

Query  306  QEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLP-----TKKDYARSLTTSFQEISSSSA  470
             EP+SPKVSCIGQIK  K         P+ +P P     TK D  +   + F+ + S S+
Sbjct  82   DEPTSPKVSCIGQIKLVKSKRSS----PKKNPKPSSSSLTKGDDNKGRFSKFKRLFSFSS  137

Query  471  AIGKIFHGRRSDATADSSRLRVCEDA--PSLGQMKRFASGRETLSDFNWTTASTATAQVV  644
            + G     +   A      + V   A  PSLGQMK+FAS R+ L  F+W        +  
Sbjct  138  SAGGNKSRKPHPAAVTEQPVTVVTSAAVPSLGQMKKFASSRDGLGRFDWEVEMKREEEES  197

Query  645  P--HGRKYCLDND--------SDDEYEEISIPFSAPMFGGHGSTTLPLEPRKEINLWKRR  794
            P  H R Y  D++         ++E +++ IPFSAP         L ++P+ E+NLWKRR
Sbjct  198  PADHRRGYFSDDERRGGCLRGKEEEEDDVIIPFSAP---------LSMKPKNEVNLWKRR  248

Query  795  TMAQPKPLQLN  827
            TM  PKPL L+
Sbjct  249  TMDPPKPLHLH  259



>ref|NP_565125.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9SGS5.1|Y1607_ARATH RecName: Full=Uncharacterized protein At1g76070 [Arabidopsis 
thaliana]
 gb|AAF17625.1|AC009978_1 T23E18.1 [Arabidopsis thaliana]
 gb|AAO24552.1| At1g76070 [Arabidopsis thaliana]
 dbj|BAF00088.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE35793.1| uncharacterized protein AT1G76070 [Arabidopsis thaliana]
Length=272

 Score =   108 bits (271),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 95/262 (36%), Positives = 125/262 (48%), Gaps = 39/262 (15%)
 Frame = +3

Query  135  FLPKSAAISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIISIIPAEAR---RKSGMDT  305
             LPK+ +   +  PFSPGRD       +        FSGP++ ++P  AR    KS    
Sbjct  21   MLPKAMSFGHRVPPFSPGRDLHHNNHHNYTAANKMFFSGPMVPLVPNAARVRRNKSDAVW  80

Query  306  QEPSSPKVSCIGqik-------hkkkmakqkrqqPRVDPLPTK---KDYARSLTTSFQEI  455
             EP+SPKVSCIGQIK         KK        P++    T    K+  +   +  + I
Sbjct  81   DEPTSPKVSCIGQIKLGKSKCPTGKKNKAPSSLIPKISKTSTSSLTKEDEKGRLSKIKSI  140

Query  456  SSSSAAIGKIFHGRRSDATA----DSSRLRVCEDA--PSLGQMKRFASGRETLSDFNWTT  617
             S S A G+    R+S  TA    D   + V   A  PSLGQMK+FAS R+ L DF+W  
Sbjct  141  FSFSPASGRNT-SRKSHPTAVSAADEHPVTVVSTAAVPSLGQMKKFASSRDALGDFDWAV  199

Query  618  ASTATAQV-VPHGRKYCLDNDSDDEY---------EEISIPFSAPMFGGHGSTTLPLEPR  767
                  +    H R Y  D+D+   Y         ++I IPFSAP         L L+P+
Sbjct  200  EMKHEEESPADHHRGYYSDDDTRGAYLRYDDDEDEDDIIIPFSAP---------LGLKPK  250

Query  768  KEINLWKRRTMAQPKPLQLNAV  833
            KE+NLWKRRTM  PKPL L  +
Sbjct  251  KEVNLWKRRTMDPPKPLHLQTI  272



>gb|AAM65454.1| unknown [Arabidopsis thaliana]
Length=252

 Score =   108 bits (269),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 95/262 (36%), Positives = 125/262 (48%), Gaps = 39/262 (15%)
 Frame = +3

Query  135  FLPKSAAISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIISIIPAEAR---RKSGMDT  305
             LPK+ +   +  PFSPGRD       +        FSGP++ ++P  AR    KS    
Sbjct  1    MLPKAMSFGHRVPPFSPGRDLHHNNHHNYTAANKMFFSGPMVPLVPNAARVRRNKSDAVW  60

Query  306  QEPSSPKVSCIGqik-------hkkkmakqkrqqPRVDPLPTK---KDYARSLTTSFQEI  455
             EP+SPKVSCIGQIK         KK        P++    T    K+  +   +  + I
Sbjct  61   DEPTSPKVSCIGQIKLGKSKCPTGKKNKAPSSLIPKISKTSTSSLTKEDEKGRLSKIKSI  120

Query  456  SSSSAAIGKIFHGRRSDATA----DSSRLRVCEDA--PSLGQMKRFASGRETLSDFNWTT  617
             S S A G+    R+S  TA    D   + V   A  PSLGQMK+FAS R+ L DF+W  
Sbjct  121  FSFSPASGRNT-SRKSHPTAVSAADEHPVTVVSTAAVPSLGQMKKFASSRDALGDFDWAV  179

Query  618  ASTATAQV-VPHGRKYCLDNDSDDEY---------EEISIPFSAPMFGGHGSTTLPLEPR  767
                  +    H R Y  D+D+   Y         ++I IPFSAP         L L+P+
Sbjct  180  EMKHEEESPADHHRGYYSDDDTRGAYLRYDDDEDEDDIIIPFSAP---------LGLKPK  230

Query  768  KEINLWKRRTMAQPKPLQLNAV  833
            KE+NLWKRRTM  PKPL L  +
Sbjct  231  KEVNLWKRRTMDPPKPLHLQTI  252



>ref|XP_006390241.1| hypothetical protein EUTSA_v10018992mg [Eutrema salsugineum]
 gb|ESQ27527.1| hypothetical protein EUTSA_v10018992mg [Eutrema salsugineum]
Length=274

 Score =   108 bits (270),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 97/281 (35%), Positives = 129/281 (46%), Gaps = 59/281 (21%)
 Frame = +3

Query  105  KPSKAKMILKFLPKSAAISFQSLPFSPGRDKRPAAAADIKTHCNKGF-SGPIISIIPAEA  281
            KP     +LK LPK+ +   +  PFSPGRD       +  +  NK F SGP++ ++P  A
Sbjct  11   KPKSKNKLLKMLPKAMSFGHRVPPFSPGRDLHHHHHNNTTSFSNKAFFSGPMVPLVPKAA  70

Query  282  R-RKSGMDT--QEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTTSFQE  452
            R R++  DT   EP+SPKVSCIGQIK  K               P K     SL     +
Sbjct  71   RVRRTKTDTVWDEPTSPKVSCIGQIKRVKSKRCS----------PKKNRAVASLIPKIPK  120

Query  453  ISSSSAA----------IGKIF--------------HGRRSDATADSSRLRVCED--APS  554
             SSSS A          I ++F              H   + A A    + V      PS
Sbjct  121  TSSSSLAKEDEKGRLSKIKRLFSFSATGRGHTSRKSHPSAAGAAATEHPVTVVSTTAVPS  180

Query  555  LGQMKRFASGRETLSDFNWTTASTATAQV-VPHGRKYCLDNDSDDEY---------EEIS  704
            LGQMK+FAS R+ L  F+W        +    H R Y  D++   +Y         ++I 
Sbjct  181  LGQMKKFASSRDALGGFDWMVEMKEDEESPADHRRGYYSDDERRGDYMRDDDEEEEDDII  240

Query  705  IPFSAPMFGGHGSTTLPLEPRKEINLWKRRTMAQPKPLQLN  827
            IPFSAP         L L+P++E+NLWKRRTM  P+PL L 
Sbjct  241  IPFSAP---------LSLKPKQEVNLWKRRTMDPPEPLHLQ  272



>ref|XP_006828842.1| hypothetical protein AMTR_s00001p00151610 [Amborella trichopoda]
 gb|ERM96258.1| hypothetical protein AMTR_s00001p00151610 [Amborella trichopoda]
Length=244

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 98/266 (37%), Positives = 139/266 (52%), Gaps = 47/266 (18%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSAAISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIISII  269
            MEK  K  +  +   FLPK        +P SPG +KR  +++ ++++  KGFSGPI+S+I
Sbjct  1    MEKAFKGRRGGL-FAFLPKQ-------VPCSPGHEKRLDSSSKLRSNTGKGFSGPIVSMI  52

Query  270  PAEARRKSGMDTQ-----EPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSL  434
            PAEARRK  +DT      EP+SPKVSC+GQIKHKKK +++KR         ++K  +   
Sbjct  53   PAEARRK--IDTNNSHRFEPTSPKVSCMGQIKHKKKRSEKKR---------SEKKQSEKN  101

Query  435  TTSFQEISSSSAAIGKIFH----GRRSDATADSSRLRVCEDAPSLGQMKRFASGRET--L  596
                +E       + KIF     GR+ +A   +S        P LGQM RF+S RE   L
Sbjct  102  QPEMKEPKKKGIELSKIFQRKKGGRKIEAAPPASE----PFPPHLGQMMRFSSRREAPGL  157

Query  597  SDFNWTTA----STATAQVVPHGRKYCLDNDSDD------EYEEISIPFSAPMFGGHGST  746
            ++F+W  A         +     R+Y  D + +       E EE  + FS P+    G+ 
Sbjct  158  ANFDWRAAMVDEGGGDKECGGGEREYYSDEERESGWEVEREREEPLVAFSCPIVVAGGAA  217

Query  747  TLPLEPRKEINLWKRRTMAQPKPLQL  824
             +   PRKE+NLWKRRT+  P PL L
Sbjct  218  VV---PRKEVNLWKRRTVEPPLPLTL  240



>ref|XP_010428658.1| PREDICTED: uncharacterized protein At1g76070-like [Camelina sativa]
Length=274

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 107/277 (39%), Positives = 139/277 (50%), Gaps = 53/277 (19%)
 Frame = +3

Query  105  KPSKAKMILKFLPKSAAISFQSLPFSPGRDKRPAAAADIKTHCNKGF-SGPIISIIPAEA  281
            KP     +L+ LPK+ +   +  PFSPGRD      ++  T  NK F SGP++ ++P  A
Sbjct  11   KPKTKNKLLQMLPKAMSFGHRVPPFSPGRDLHHNHHSN--TASNKMFFSGPMVPLVPNAA  68

Query  282  R-RKSGMDT--QEPSSPKVSCIGqikh----------kkkmakqkrqqPRVDP----LPT  410
            R R++  D    EP+SPKVSCIGQIK           KK  A      P+V      L  
Sbjct  69   RVRRNKNDGVWDEPTSPKVSCIGQIKLGKSSNKCPTGKKNKATAASLIPKVSKTSSSLTK  128

Query  411  KKDYAR-SLTTSFQEISSSSAAIGKIFHGRRSDATA----DSSRLRVCEDA---PSLGQM  566
            + D  R S    F   SS++ A       R+S  TA    D   + V   A   PSLGQM
Sbjct  129  EDDKGRVSKIKRFFSFSSANTA------SRKSHPTAVSAADEHPVTVVSTAAAVPSLGQM  182

Query  567  KRFASGRETLSDFNWTTASTATAQVVP--HGRKYCLDNDS---------DDEYEEISIPF  713
            K+FAS RE L  F+W  A     +  P  H R Y  D+D+         DD+ ++I IPF
Sbjct  183  KKFASSREGLGGFDWA-AEMKLGEESPADHHRGYYSDDDTRGGNLRDDDDDDEDDIIIPF  241

Query  714  SAPMFGGHGSTTLPLEPRKEINLWKRRTMAQPKPLQL  824
            SAP+        L L+P+KE+NLWKRRTM  PKPL L
Sbjct  242  SAPL-------GLNLKPKKEVNLWKRRTMDPPKPLHL  271



>emb|CDY62977.1| BnaCnng41180D [Brassica napus]
Length=263

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 84/247 (34%), Positives = 120/247 (49%), Gaps = 26/247 (11%)
 Frame = +3

Query  135  FLPKSAAISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIISIIPAEAR---RKSGMDT  305
             LPK+ +   +  PFSPG+D          +     FSGP++ ++P  AR    KS    
Sbjct  25   MLPKAMSFGHRVPPFSPGKDLHHNHNTTSSSSNKAYFSGPMV-LVPNAARVRRNKSDAVW  83

Query  306  QEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLP-TKKDYARSLTTSFQEISS--SSAAI  476
             EP+SPKVSCIGQIK  K      ++ P+      TK D  +   + F+ + S  S A  
Sbjct  84   DEPTSPKVSCIGQIKLVKSKRSSLKKNPKTSSSSLTKGDDGKGRFSKFKRLFSFPSRAGG  143

Query  477  GKIFHGRRSDATADSSRLRVCEDAPSLGQMKRFASGRETLSDFNWTTASTATAQVVP--H  650
             K      +  T   + +      PSLGQMK+FAS R+ L  F+W        +  P  H
Sbjct  144  DKSRKPHPAAVTEQPATVVTSAAVPSLGQMKKFASSRDGLGRFDWEVEMKREEEESPADH  203

Query  651  GRKYCLDND--------SDDEYEEISIPFSAPMFGGHGSTTLPLEPRKEINLWKRRTMAQ  806
             R Y  D++         ++E +++ IPFSAP         L ++P+ E+NLWKRRTM  
Sbjct  204  RRGYFSDDERRGGCLRGKEEEEDDVIIPFSAP---------LSMKPKNEVNLWKRRTMDP  254

Query  807  PKPLQLN  827
            PKPL L+
Sbjct  255  PKPLHLH  261



>ref|XP_006302690.1| hypothetical protein CARUB_v10020800mg [Capsella rubella]
 gb|EOA35588.1| hypothetical protein CARUB_v10020800mg [Capsella rubella]
Length=267

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 98/266 (37%), Positives = 128/266 (48%), Gaps = 38/266 (14%)
 Frame = +3

Query  105  KPSKAKMILKFLPKSAAISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIISIIPAEAR  284
            KP     +L+ LPK+ +   +  PFSPGRD                FSGP++ ++P  AR
Sbjct  11   KPKSKNKLLQMLPKAMSFGHRVPPFSPGRDLHHNNHHSNTASNKMFFSGPMVPLVPNAAR  70

Query  285  -RKSGMDT--QEPSSPKVSCIGqik--------hkkkmakqkrqqPRVDPLPTKKDYARS  431
             R++  D    EP+SPKVSCIGQIK          KK        P+     TK+D    
Sbjct  71   VRRNKNDAVWDEPTSPKVSCIGQIKLGKSNKCPTGKKNKPTASLIPKTSSSLTKEDDKGR  130

Query  432  LTTSFQEISSSSAAIGKIFHGRRSDATA----DSSRLRVCEDA--PSLGQMKRFASGRET  593
            ++   +  S S A        R+S  TA    D   + V   A  PSLGQMK+FAS RE 
Sbjct  131  ISKIKRFFSFSPANTT----SRKSHPTAVSAADEHPVTVVSSAAVPSLGQMKKFASSREA  186

Query  594  LSDFNWTTASTATAQVVPHG--RKYCLDNDSDDEY-------EEISIPFSAPMFGGHGST  746
            L  F+W  A     +  P    R Y  D+D+   Y       ++I IPFSAP+       
Sbjct  187  LGGFDWA-AEMKHEEDSPADLHRGYYSDDDTRGAYLRDDDDEDDIIIPFSAPL-------  238

Query  747  TLPLEPRKEINLWKRRTMAQPKPLQL  824
             L L+P+KE+NLWKRRTM  PKPL L
Sbjct  239  GLNLKPKKEVNLWKRRTMDPPKPLHL  264



>gb|EYU36812.1| hypothetical protein MIMGU_mgv1a015184mg [Erythranthe guttata]
Length=165

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 79/123 (64%), Gaps = 11/123 (9%)
 Frame = +3

Query  468  AAIGKIF-HGRRSDATADSSRLRVCEDAPSLGQMKRFASGRETLSDFNWTTASTATAQVV  644
            + I K+F  GR+SDA+ D  R  + E APSL QM++FAS R+T ++F+WTTA  A  +  
Sbjct  50   SGIKKLFGAGRKSDASIDYKRPPISETAPSLNQMRKFASSRDTFANFDWTTAQIAPEE--  107

Query  645  PHGRKYCLDNDSDDEYEEISIPFSAPMF---GGHGSTTLPLEPRKEINLWKRRTMAQPKP  815
               R +  D+      +++ IPFSAP+     G G   L LEPRKEINLWKRRTMAQPKP
Sbjct  108  -EDRGFYSDDSD----DDVIIPFSAPILMAGAGGGVFGLDLEPRKEINLWKRRTMAQPKP  162

Query  816  LQL  824
            + +
Sbjct  163  IIM  165



>ref|XP_010471756.1| PREDICTED: uncharacterized protein At1g76070-like [Camelina sativa]
Length=274

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 104/281 (37%), Positives = 136/281 (48%), Gaps = 61/281 (22%)
 Frame = +3

Query  105  KPSKAKMILKFLPKSAAISFQSLPFSPGRD---KRPAAAADIKTHCNKGFSGPIISIIPA  275
            KP     +L+ LPK+ +   +  PFSPGRD      ++AA  K      FSGP++ ++  
Sbjct  11   KPKSKNKLLQMLPKAMSFGHRVPPFSPGRDLHHNHHSSAASNKMF----FSGPMVPLVSN  66

Query  276  EAR-RKSGMDT--QEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTTSF  446
             AR R++  D+   EP+SPKVSCIGQIK  K   K         P   KK  A SL    
Sbjct  67   AARVRRNKNDSVWDEPTSPKVSCIGQIKLGKSSNKC--------PTGKKKKAAASLIPKV  118

Query  447  QEISSS---------SAAIGKIFH-------GRRSDATADS-------SRLRVCEDAPSL  557
             + SSS          + I + F         R+S  TA S       + +      PSL
Sbjct  119  SKTSSSLTKEDDKGHVSKIKRFFSFSSANTASRKSHPTAISAADEHPVTMVSAAAAVPSL  178

Query  558  GQMKRFASGRETLSDFNWTTASTATAQVVP--HGRKYCLDNDS----------DDEYEEI  701
            GQMK+FAS RE L  F+W  A     +  P  H R Y  D+D+          DD+ ++I
Sbjct  179  GQMKKFASSREGLGGFDWA-AEMKLGEDSPADHHRGYYSDDDTRGANLRGDDDDDDEDDI  237

Query  702  SIPFSAPMFGGHGSTTLPLEPRKEINLWKRRTMAQPKPLQL  824
             IPFSAP+        L L P+KE+NLWKRRTM  PKPL L
Sbjct  238  IIPFSAPL-------GLNLRPKKEVNLWKRRTMDPPKPLHL  271



>ref|XP_002887625.1| hypothetical protein ARALYDRAFT_476758 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63884.1| hypothetical protein ARALYDRAFT_476758 [Arabidopsis lyrata subsp. 
lyrata]
Length=275

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 96/264 (36%), Positives = 125/264 (47%), Gaps = 44/264 (17%)
 Frame = +3

Query  135  FLPKSAAISFQSLPFSPGRDKRPAAAADIKTHCNKGF-SGPIISIIPAEAR---RKSGMD  302
             LPK+ +   +  PFSPGRD          T  NK F SGP++ ++P  AR    KS   
Sbjct  21   MLPKAMSFGHRVPPFSPGRDLHHNHNHHNNTAANKMFFSGPMVPLVPNAARVRRNKSDAV  80

Query  303  TQEPSSPKVSCIGq---------ikhkkkmakqkrqqPRVDPLPT----KKDYARSLTTS  443
              EP+SPKVSCIGQ            K K        P++    T    K+D    L+  
Sbjct  81   WDEPTSPKVSCIGQIKLGKSKCPTGKKNKNKTTPLLIPKISKTSTSSLTKEDEKGRLSKI  140

Query  444  FQEISSSSAAIGKIFHGRRSDATADSSR----LRVCEDA--PSLGQMKRFASGRETLSDF  605
             +  S S A+ G I   R+S  TA S+     + V   A  PSLGQMK+FAS R+ L  F
Sbjct  141  KRIFSFSPASGGNI--SRKSHPTAVSAAGEHPVTVVSTAAVPSLGQMKKFASSRDALGGF  198

Query  606  NWTTASTATAQV-VPHGRKYCLDNDSDDEY---------EEISIPFSAPMFGGHGSTTLP  755
            +WT       +    H R Y  D++    Y         ++I IPFSAP         L 
Sbjct  199  DWTVEMEHDEESPADHRRGYYSDDEKRGAYFRDDDDDDEDDIIIPFSAP---------LG  249

Query  756  LEPRKEINLWKRRTMAQPKPLQLN  827
            L+P+KE+NLWKRRT+  PKPL L 
Sbjct  250  LKPKKEVNLWKRRTIDPPKPLHLQ  273



>ref|XP_006416413.1| hypothetical protein EUTSA_v10009337mg [Eutrema salsugineum]
 gb|ESQ34766.1| hypothetical protein EUTSA_v10009337mg [Eutrema salsugineum]
Length=266

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 94/272 (35%), Positives = 132/272 (49%), Gaps = 47/272 (17%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSAAISFQSLPFSPGRDKRPAAAADIKTHCNKG--FSGPIIS  263
            MEK  K +  K+    L K+ +I   + PFSP RD R        +  N+G  FS PI  
Sbjct  1    MEKASKNNSTKLS-NMLQKALSIGHSAAPFSPSRDLRHYRTT---STANRGLFFSSPIRP  56

Query  264  IIPAEARRKSGMDTQ----EPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYA--  425
            ++P  AR K  +  +    EP+SPKVSCIG         + K  +P+    P KK+ A  
Sbjct  57   LLPTAARVKRRIKNEVVYAEPTSPKVSCIG---------QIKLSKPKC---PDKKNRAAL  104

Query  426  RSLTTSF-----QEISSSSAAIGKIFH-GRRSDATADSSRLRVCED----------APSL  557
            ++L T+      +E   S + + + F  GR     ++S    V  +          APSL
Sbjct  105  KNLETASSSLIKEEGKGSFSKLKRFFSTGRNPSRKSNSIDFAVESEHPVAAVEAVAAPSL  164

Query  558  GQMKRFASGRETLSDFNWTTASTATAQVVPHGRKYCLDNDSDDEYEEISIP--FSAPMFG  731
            G+MK+FA+ RE+L  F+WT           H R Y     SD+E E I IP   S P+  
Sbjct  165  GKMKKFATSRESLGGFDWTVEMKRDESQSDHRRGYF----SDEEEENIMIPSSVSIPLTH  220

Query  732  GHGSTTLPLEPRKEINLWKRRTMAQPKPLQLN  827
              G    P +P+ E+NLWKRRTM +PKPL+ N
Sbjct  221  QEGLRLSP-KPKSEVNLWKRRTMDRPKPLKKN  251



>ref|XP_010416518.1| PREDICTED: uncharacterized protein At1g76070-like [Camelina sativa]
Length=273

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 105/278 (38%), Positives = 137/278 (49%), Gaps = 56/278 (20%)
 Frame = +3

Query  105  KPSKAKMILKFLPKSAAISFQSLPFSPGRDKRPAAAADIKTHCNKGF-SGPIISIIPAEA  281
            KP     +L+ LPK+ +   +  PFSPGRD      ++  T  NK F SGP++ ++P  A
Sbjct  11   KPKSKNKLLQMLPKAMSFGHRVPPFSPGRDLHHNHHSN--TASNKMFFSGPMVPLVPNAA  68

Query  282  R-RKSGMDT--QEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTTSFQE  452
            R R++  D    EP+SPKVSCIGQIK  K   K         P   KK  A SL     +
Sbjct  69   RVRRNKNDGVWDEPTSPKVSCIGQIKLGKSSNKC--------PTGKKKKAAASLIPKVFK  120

Query  453  ISSS---------SAAIGKIFH-------GRRSDATADSS-------RLRVCEDAPSLGQ  563
             SSS          + I + F         R+S  TA S+        +      PSLGQ
Sbjct  121  TSSSLTKEDDKGRVSKIKRFFSFSSANTASRKSHPTAVSASDEHPVTVVSAAAAVPSLGQ  180

Query  564  MKRFASGRETLSDFNWTTASTATAQVVP--HGRKYCLDNDS---------DDEYEEISIP  710
            MK+FAS RE L  F+W  A     +  P  H R Y  D+D+         DD+ ++I IP
Sbjct  181  MKKFASSREGLGGFDWA-AEMKLGEESPADHHRGYYSDDDTRGANLRDDDDDDEDDIIIP  239

Query  711  FSAPMFGGHGSTTLPLEPRKEINLWKRRTMAQPKPLQL  824
            FSAP+        L L+P+KE+NLWKRRTM  PKPL L
Sbjct  240  FSAPL-------GLNLKPKKEVNLWKRRTMDPPKPLHL  270



>ref|XP_006303317.1| hypothetical protein CARUB_v10010139mg [Capsella rubella]
 gb|EOA36215.1| hypothetical protein CARUB_v10010139mg [Capsella rubella]
Length=243

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 85/259 (33%), Positives = 132/259 (51%), Gaps = 34/259 (13%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSAAISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIISII  269
            MEK    +K+    K L ++ +I   + PFSPGRD   +  A    H    FS P++   
Sbjct  1    MEKASNSNKSTKFSKMLQRALSIGHSAAPFSPGRDFHHSRTAST-VHRGIFFSSPLV---  56

Query  270  PAEARRKSGMDTQ----EPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLT  437
            P  AR +     +    EP+SPKVSCIGQ+K  K     +R+    + L T    + S  
Sbjct  57   PTAARVRRSTKNEGVLAEPTSPKVSCIGQVKLNKPKCSSERKNKATNKLKTASSLS-SCA  115

Query  438  TSFQEISSSSAAIGKIFH-----GRRSDATADSSRLR---VCEDAPSLGQMKRFASGRET  593
               +E   S + + ++F       ++S++TA ++      V   APSLG+MK+FAS R  
Sbjct  116  IKEEENRRSFSKLKRLFSTLSFSSKKSNSTAFATAAVEEPVVAVAPSLGKMKKFASSRGA  175

Query  594  LSDFNWTTASTATAQVVPHGRKYCLDNDSDDEYEEISIPFS--APMFGGHGSTTLPLEPR  767
            L  F+WT         V   R+     +S  ++++++IP+S   P+    G +  P +P+
Sbjct  176  LGGFDWT---------VEMKRQ-----ESQSDHQDVTIPYSQSMPLTQLEGLSLCP-KPK  220

Query  768  KEINLWKRRTMAQPKPLQL  824
             E+NLWKRRTM +PKPLQ+
Sbjct  221  SEVNLWKRRTMDRPKPLQV  239



>ref|XP_002530640.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31748.1| conserved hypothetical protein [Ricinus communis]
Length=219

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 90/252 (36%), Positives = 130/252 (52%), Gaps = 47/252 (19%)
 Frame = +3

Query  102  VKPSKAKMILKFLPKSAA-ISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIISIIPAE  278
            ++ SK+K I   LPK+A  ++F S P SP R            +  KG S P +S+IP E
Sbjct  4    LQKSKSK-ISDLLPKAAGPVTFLSPPPSPAR-----------ANSWKGLSSPRVSLIPKE  51

Query  279  ARRKS---GMDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTTSFQ  449
             RRK+     D +EP+SPKVSC+G+IK++K+   + ++       PTK D    L +S  
Sbjct  52   IRRKARILSFDAREPTSPKVSCMGKIKNRKRNKNETKKWNN----PTKLDM---LVSS--  102

Query  450  EISSSSAAIGKIFHGRRS----DATADSSRLRVCEDA---PSLGQMKRFASGRETLSDFN  608
             +SSS A I KIF G++     DA+ D S   + E A    S  Q+K+FASGR  L DF+
Sbjct  103  -LSSSGAMILKIFKGKQEIEERDAS-DKSPTTIAERAVRASSSSQVKKFASGRGVLKDFD  160

Query  609  WTTASTATAQVVPHGRKYCLDNDSDDEYEEISIPFSAPMFGGHGSTTLPLEPRKEINLWK  788
            W       A         C  +D + + E               +  + +EPRKE+NLWK
Sbjct  161  WKAHVAGAA----DAESNCPQDDKNQDKERDV---------ETRTECISVEPRKEVNLWK  207

Query  789  RRTMAQPKPLQL  824
            +R ++ P+PLQL
Sbjct  208  KRAISPPRPLQL  219



>ref|XP_009106258.1| PREDICTED: uncharacterized protein At1g76070 [Brassica rapa]
 emb|CDX87644.1| BnaA07g32290D [Brassica napus]
Length=265

 Score = 96.7 bits (239),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 89/254 (35%), Positives = 123/254 (48%), Gaps = 33/254 (13%)
 Frame = +3

Query  135  FLPKSAAISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIISIIPAEAR---RKSGMDT  305
             LPK+ +   +  PFSPGRD          +     FSGP++ ++P  AR    KS    
Sbjct  21   MLPKAMSFGHRVPPFSPGRDLHHHHNTTSSSSNKAYFSGPMVPLVPKAARVRRNKSDAVW  80

Query  306  QEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLP-------TKKDYARSLTTSFQEISSS  464
             EP+SPKVSCIGQIK  K       ++  +  +P       TK D  +   +  + + S 
Sbjct  81   SEPTSPKVSCIGQIKRVKSKRSSSPKKNMIPKIPKTSSSSLTKGD-EKGRVSMIKRLFSF  139

Query  465  SAAIGKIFHGRRSDATADSSR-LRVCEDA--PSLGQMKRFASGRETLSDFNWTTASTATA  635
            S+A G     R+S  TA +   + V   A  PSLGQMK+FAS RE L  F+W        
Sbjct  140  SSAAGSGNSSRKSRPTAATEHPVTVVSSAAVPSLGQMKKFASTREGLGGFDWA-VEMKRE  198

Query  636  QVVPHGRKYCLDNDSDDEY----------EEISIPFSAPMFGGHGSTTLPLEPRKEINLW  785
            +  P  R Y  D++    +          ++I IPFSAP+        + L+P+ E+NLW
Sbjct  199  EESPADRGYYSDDERRGGFLRDDDEEEEEDDIIIPFSAPL--------MSLKPKTEVNLW  250

Query  786  KRRTMAQPKPLQLN  827
            KRRTM  PKPL L 
Sbjct  251  KRRTMDPPKPLHLQ  264



>emb|CDY29360.1| BnaA06g14360D [Brassica napus]
Length=255

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 93/264 (35%), Positives = 140/264 (53%), Gaps = 41/264 (16%)
 Frame = +3

Query  111  SKAKMILKFLPKSAAISFQSLPFSPGRDKRPAAAADIKTHCNKG--FSGPIISIIP--AE  278
            + +K + K L K+ +I   + PFSP RD R           ++G  FS PI  ++P  A 
Sbjct  9    NNSKKLSKMLQKALSIGHSAAPFSPVRDFRHHRTIST---ASRGYFFSSPITPLLPTSAR  65

Query  279  ARRKS---GMDTQEPSSPKVSCIGqikhkkkma-kqkrqqPRVDPLPTKKDYARSLTTSF  446
            ARR++   G+   EP+SPKVSCIGQIK  K    + K ++P+   L T      S +   
Sbjct  66   ARRRTKSNGVVVAEPTSPKVSCIGQIKLAKSKCPEMKNREPKTKTLETS-----SSSLVK  120

Query  447  QEISSSSAAIGKIFH-GR----RSDATADSSRLR------VCEDAPSLGQMKRFASGRET  593
            +E   + + + ++F  GR    +S ATA ++ +           APSLG+MKRFA+ RE+
Sbjct  121  EEGKGNWSILKRLFSTGRNPLKKSSATASAAVIEHPVVAVEAVTAPSLGKMKRFATSRES  180

Query  594  LSDFNWTTASTATAQVVPHGRKYCLDNDSDDEYEEISIPFSA--PMFGGHGSTTLPLEPR  767
            L  F+W        ++   G +   D+ + D+ EE +IPFS   P+    G   L L PR
Sbjct  181  LGGFDW------RVEMKRQGEESRPDHYTPDD-EETTIPFSVSMPLTQQEG---LSLYPR  230

Query  768  K--EINLWKRRTMAQPKPLQLNAV  833
            +  E+NLW+RRT+ +PKPLQ+ A 
Sbjct  231  QKSEVNLWERRTVDRPKPLQVKAT  254



>ref|XP_010063290.1| PREDICTED: uncharacterized protein At1g76070-like [Eucalyptus 
grandis]
Length=351

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 97/281 (35%), Positives = 138/281 (49%), Gaps = 78/281 (28%)
 Frame = +3

Query  156  ISFQSLPFSPGRDKRPAAAAD--------IKTHCNKG-FSGPIISIIPAEARRK------  290
            ++FQ+ PFSP RD    +++          K+H  +  FSGPI+ +IP E R +      
Sbjct  89   VTFQNPPFSPTRDSNARSSSSEVFGKISTAKSHAKRASFSGPIVPLIPKEVRHRRRFKND  148

Query  291  -----SGMDT-QEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYAR-----SLT  437
                 + +D  QEP+SPKVSC+GQIK K K+ K+K++          ++ AR     S +
Sbjct  149  DDDDATSLDAPQEPTSPKVSCMGQIKLKNKIKKKKKK--------KSEEIARVKEPSSGS  200

Query  438  TSFQEISSSSAAIGKIFH----GRRSDATADSSRLR-------VCED-APSLGQMKRFAS  581
               +E    S    +IF     GR+S A    +  R       V E+ APSLGQM+RFAS
Sbjct  201  FCSEEKKPKSRIFRRIFSRAGAGRKSGAPGVPTEDRGERDTSGVSEERAPSLGQMRRFAS  260

Query  582  GRETLSDFNWTTASTATAQVVP---HGRKYCLD----------------NDSDDEYEEIS  704
            GR  L+ F+W       AQV P     ++ C                  ND D    E  
Sbjct  261  GRNALASFDW------AAQVAPVDAAEQRNCYSDDEDRDRDRDRVEGDDNDDD----EAI  310

Query  705  IPFSAPMFGGHGSTTLPLEPRKEINLWKRRTMAQPKPLQLN  827
            +PFSAP+  G G   +  + ++E+NLWKRRTMA P+PL+L 
Sbjct  311  VPFSAPISLGGG---VEWKAKQEVNLWKRRTMAPPQPLRLQ  348



>ref|XP_004136484.1| PREDICTED: uncharacterized protein At1g76070-like [Cucumis sativus]
 ref|XP_004168609.1| PREDICTED: uncharacterized protein At1g76070-like [Cucumis sativus]
Length=212

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 79/196 (40%), Positives = 108/196 (55%), Gaps = 21/196 (11%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSA-AISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPI-IS  263
            MEK   P K+K  +KFLP++A A++F + P SPGR+ RP A         +GFSGP+  S
Sbjct  1    MEKHSNP-KSK-FMKFLPRAASAVNFHNPPVSPGRETRPLAG--------RGFSGPMNFS  50

Query  264  IIPAEAR----RKSGMDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARS  431
            IIP EAR      SG +T EP+SPKVSCIGQIKHKKK+        +     T +   R 
Sbjct  51   IIPREARITKSNNSGFETPEPTSPKVSCIGQIKHKKKLKGMA----KTAAAATVESKNRL  106

Query  432  LTTSFQEISSSSAAIGKIFHGRRSDATADSSRLRVCEDAPSLGQMKRFASGRETLSDFNW  611
              +  + I +    +G+      + A A S +  + E AP L QMKRF+SGR  L++F+W
Sbjct  107  PPSRIKRIFTGGKVLGRA-KSNVAGAAAQSGKPPLPERAPGLNQMKRFSSGRGALANFDW  165

Query  612  TTASTATAQVVPHGRK  659
            T       +V   GR+
Sbjct  166  TAQIAPEDEVEGEGRR  181



>ref|XP_007046583.1| Uncharacterized protein TCM_000126 [Theobroma cacao]
 gb|EOX90740.1| Uncharacterized protein TCM_000126 [Theobroma cacao]
Length=249

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 89/257 (35%), Positives = 119/257 (46%), Gaps = 50/257 (19%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSA-AISFQ-SLPFSPGRDKRPAAAADIKTHCNKGFSGPIIS  263
            MEK VK  +   +L FLPK+A A++FQ S P SP                 KG+SGPI+S
Sbjct  1    MEKQVK--QRNKVLPFLPKAASAVTFQVSTPISPA---------------GKGYSGPIVS  43

Query  264  IIPAEARRKSGMDT-QEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTT  440
            +IP EARRKS   +  EP+SPKVSC+GQIK +K                 K +       
Sbjct  44   LIPKEARRKSKNGSFDEPTSPKVSCMGQIKCRK-----------------KNETVTPPQV  86

Query  441  SFQEISSSSAAIGKIFHGRRSDATADSSRL---RVCEDAP-SLGQMKRFASGRETLSDFN  608
            + +E+      + ++  G +S    D S     +V E  P SL QMK+F+S R TLSDF+
Sbjct  87   ATEEMKRKRFLMLRVLKGTKSGHRFDVSNAGADQVAESVPSSLRQMKQFSSARGTLSDFD  146

Query  609  WTTASTATAQVVPHGRKYCLDNDSDDEYEEISIPFSAPMFGGHGSTTLPLEPRKEINLWK  788
            W       A     G   C+ N     YEE  +              +  E R+E NLW 
Sbjct  147  WMAYEAEGA-----GEAGCVSNPL---YEEKGVKSEKEAKVVVNGVGVVEEIRRE-NLWT  197

Query  789  RRTMAQPKPLQLNAVIR  839
            RRT A   P+Q    +R
Sbjct  198  RRTTASLTPIQFTIPVR  214



>ref|XP_009149514.1| PREDICTED: uncharacterized protein At1g76070 [Brassica rapa]
Length=255

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 90/270 (33%), Positives = 131/270 (49%), Gaps = 53/270 (20%)
 Frame = +3

Query  111  SKAKMILKFLPKSAAISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIISIIP--AEAR  284
            + +K + K L K+ +I   + PFSP RD R        +     FS PI  ++P  A AR
Sbjct  9    NNSKKLSKMLQKALSIGHSAAPFSPVRDFRHHRTISTASR-GYFFSSPITPLLPTSARAR  67

Query  285  RKS---GMDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTTSF---  446
            R++   G+   EP+SPKVSCIGQIK  K          +   +  ++   ++L TS    
Sbjct  68   RRTKSNGVVVAEPTSPKVSCIGQIKLAKS---------KCPEMKNREPNTKTLETSSSSL  118

Query  447  --QEISSSSAAIGKIFH-GR----RSDATADSSRLR------VCEDAPSLGQMKRFASGR  587
              +E   + + + ++F  GR    +S ATA ++ +           APSLG MKRFA+ R
Sbjct  119  VKEEGKGNWSILKRLFSTGRNPLKKSSATASAAVIEHPVVAVEAVTAPSLGTMKRFATSR  178

Query  588  ETLSDFNWTTASTATAQVVPHGRKYCLDNDSDDEY----EEISIPFSA--PMFGGHGSTT  749
            E+L  F+W               K   +    D Y    EE +IPFS   P+    G   
Sbjct  179  ESLGGFDWRVEM-----------KRQEEESRPDHYTPDDEETTIPFSVSMPLTQREG---  224

Query  750  LPLEPRK--EINLWKRRTMAQPKPLQLNAV  833
            L L PR+  E+NLW+RRT+ +PKPLQ+ A 
Sbjct  225  LCLYPRQKSEVNLWERRTVDRPKPLQVKAT  254



>ref|XP_006383036.1| hypothetical protein POPTR_0005s10930g [Populus trichocarpa]
 gb|ERP60833.1| hypothetical protein POPTR_0005s10930g [Populus trichocarpa]
Length=214

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 116/246 (47%), Gaps = 51/246 (21%)
 Frame = +3

Query  126  ILKFLPKSAA-ISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIISIIPAEARRK--SG  296
            +   LP++A+ ++FQS P SP             ++ ++G SG I+S++P EAR K  SG
Sbjct  11   VFACLPQAASPVTFQSPPTSPRM-----------SNTDRGLSGRIVSLVPKEARTKARSG  59

Query  297  M--DTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTTSFQEISSSSA  470
               D QEPSSPKVSC G++ +K           +  P  TK D            S    
Sbjct  60   CFDDAQEPSSPKVSCTGKVNNKS----------KKKPQATKSD------------SCPEP  97

Query  471  AIGKIFHGRRSDATADSSRLR--VCEDAPSLGQMKRFASGRETLSDFNWTTASTATAQVV  644
             +  +  G++    +D+SR R  V +  PSLG MK+F+S    L DF+W     +    +
Sbjct  98   TVLTVLKGKKQGLQSDTSRGRPPVADKPPSLGHMKQFSSNCGVLRDFDWKAHDVSG---M  154

Query  645  PHGRKYCLDNDSDDEYEEISIPFSAPMFGGHGSTTLPLEPRKEINLWKRRTM-AQPKPLQ  821
            P    Y   ++ + + E++ I              +P EP+K++ LW+RR+    P PLQ
Sbjct  155  PDNSNYSSYDEKNGDKEKVFIVVEV-------DEDIPREPKKQVELWRRRSCRTPPGPLQ  207

Query  822  LNAVIR  839
            L    R
Sbjct  208  LEKQAR  213



>ref|XP_011022278.1| PREDICTED: uncharacterized protein At1g76070-like [Populus euphratica]
Length=213

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 77/246 (31%), Positives = 114/246 (46%), Gaps = 52/246 (21%)
 Frame = +3

Query  126  ILKFLPKSAA-ISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIISIIPAEARR--KSG  296
            +   LP++A+ ++FQS P SP              + ++G SG I+S++P EARR  +SG
Sbjct  11   VFACLPQAASPVTFQSPPTSP-----------RMANTDRGLSGRIVSLVPKEARRNARSG  59

Query  297  M--DTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTTSFQEISSSSA  470
               D QEP+SPKVSC G++K+K K            P  TK D     T +         
Sbjct  60   TFDDAQEPTSPKVSCTGKVKNKSKKK----------PQATKSDSCPKPTPT---------  100

Query  471  AIGKIFHGRRSDATAD-SSRLR--VCEDAPSLGQMKRFASGRETLSDFNWTTASTATAQV  641
                +F G++    +D +SR R  V +  PSLG M +F+S    L DF+W          
Sbjct  101  ----VFKGKKQGLQSDHTSRGRPPVADKPPSLGHMNQFSSNCGVLRDFDWKA--------  148

Query  642  VPHGRKYCLDNDSDDEYEEISIPFSAPMFGGHGSTTLPLEPRKEINLWKRRTMAQPKPLQ  821
              H      DN ++  Y+E +               +P EP+K++ LW+RR+   P PLQ
Sbjct  149  --HDVSGMPDNSTNSSYDEKNGDKEKVFIVVEVDEDIPREPKKQVELWRRRSRTPPGPLQ  206

Query  822  LNAVIR  839
            L    R
Sbjct  207  LEKQAR  212



>ref|XP_002890378.1| hypothetical protein ARALYDRAFT_472259 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66637.1| hypothetical protein ARALYDRAFT_472259 [Arabidopsis lyrata subsp. 
lyrata]
Length=236

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 83/265 (31%), Positives = 128/265 (48%), Gaps = 51/265 (19%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSAAISFQSLPFSPGRDKRPAAAADIKTHCNKG--FSGPIIS  263
            MEK    +K+    K L ++ +I   + PFSPGRD          +  N+G  FS P++ 
Sbjct  1    MEKASNNNKSAKFSKMLQRALSIGHSAAPFSPGRD---FHQYRTTSTANRGYFFSSPLV-  56

Query  264  IIPAEARRKSGMDTQ----EPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARS  431
              P  AR +     +    EP+SPKVSCIGQ+K  K    + + +      P     A S
Sbjct  57   --PTAARVRRSTKNEAVFAEPTSPKVSCIGQVKLAKPKCPETKIK-----APKNLKAASS  109

Query  432  LTTSF--QEISSSSAAIGKIFHGR-----RSDATADS-----SRLRVCEDAPSLGQMKRF  575
            L++    +E + S + + ++F  R     +S++TA +     + +     APSLG+MK+F
Sbjct  110  LSSCVIREEDNGSFSKLKRLFSTRSYPSGKSNSTAAAREHPVAAVEAVTAAPSLGKMKKF  169

Query  576  ASGRETLSDFNWTTASTATAQVVPHGRKYCLDNDSDDEYEEISIP--FSAPMFGGHGSTT  749
            AS RE L  F+WT                        + EE++IP   S P+    G + 
Sbjct  170  ASSREALGGFDWTV-------------------QMKRDEEEVTIPCSVSMPLTQLEGLSL  210

Query  750  LPLEPRKEINLWKRRTMAQPKPLQL  824
             P +P+ E+NLW+RRTM +PK LQ+
Sbjct  211  CP-KPKSEVNLWRRRTMDRPKRLQV  234



>ref|NP_564111.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM66948.1| unknown [Arabidopsis thaliana]
 gb|AEE29960.1| uncharacterized protein AT1G20310 [Arabidopsis thaliana]
Length=240

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 85/270 (31%), Positives = 127/270 (47%), Gaps = 57/270 (21%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSAAISFQSLPFSPGRD---KRPAAAADIKTHCNKG--FSGP  254
            MEK    +K+    K L ++ +I   + PFSP RD    R  + A      N+G  FS P
Sbjct  1    MEKASNSNKSTKFSKMLQRAMSIGHSAAPFSPRRDFHQHRTTSTA------NRGIFFSSP  54

Query  255  IISIIPAEARRKSGMDT--QEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYAR  428
            ++    A  RR +  +    EP+SPKVSCIGQ+K  +    +     + +  P     A 
Sbjct  55   LVPTA-ARVRRNTKYEAVFAEPTSPKVSCIGQVKLARPKCPE-----KKNKAPKNLKTAS  108

Query  429  SLTTSF--QEISSSSAAIGKIFH-----GRRSDATADS---------SRLRVCEDAPSLG  560
            SL++    +E + S + + +IF       R+S++TA +         + +     APSLG
Sbjct  109  SLSSCVIKEEDNGSFSKLKRIFSMRSYPSRKSNSTAFAAAAAREHPIAEVDAVTAAPSLG  168

Query  561  QMKRFASGRETLSDFNWTTASTATAQVVPHGRKYCLDNDSDDEYEEISIPFSA--PMFGG  734
             MK+FAS RE L  F+WT                        E E++ IP S   P+   
Sbjct  169  AMKKFASSREALGGFDWTV-------------------QMKREKEDVMIPCSVGIPLTQL  209

Query  735  HGSTTLPLEPRKEINLWKRRTMAQPKPLQL  824
               +  P +P+ E+NLWKRRTM +PKPLQ+
Sbjct  210  EDLSLCP-KPKSEVNLWKRRTMDRPKPLQV  238



>emb|CDY01382.1| BnaA07g11550D [Brassica napus]
Length=232

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 88/256 (34%), Positives = 124/256 (48%), Gaps = 62/256 (24%)
 Frame = +3

Query  132  KFLPKSAAISFQSLPFSPGRD---KRPAAAADIKTHCNKGF--SGPIISIIPAEARR---  287
            K L K+ +IS    PFSP RD    R A+ A      N+GF  SGPI  ++P  A R   
Sbjct  14   KMLQKALSISHS--PFSPVRDFHHHRTASTA------NRGFFFSGPITPLLPTAASRARR  65

Query  288  --KSGMDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTTSFQEISS  461
              K+ +   EP+SPKVSCIGQIK   K    +          TK    ++L T+   +  
Sbjct  66   RTKNAVVFAEPTSPKVSCIGQIKLANKSKCPE----------TKTRERKNLKTASSHLVK  115

Query  462  SS-----AAIGKIFH--GRRSDATADSSR----LRVCED--APSLGQMKRFASGRETLSD  602
             +     + + ++F    R+S+  A S+     +   E   APSL +MK+FAS RE L  
Sbjct  116  EAGKGNWSKLKRLFSMGSRKSNYVAVSAASEPPISAVEAVAAPSLCKMKKFASSREALGG  175

Query  603  FNWTTASTATAQVVPHGRKYCLDNDSDDEYEEISIPFSAPMFGGHGSTTLPLEPRKEINL  782
            F+WT      A++    ++Y     SDD+   I    S P+        +    + E+NL
Sbjct  176  FDWT------AEI----KRY----SSDDKETMIPCAVSTPL-------AMCSRQKSEVNL  214

Query  783  WKRRTMAQPKPLQLNA  830
            WKRRTM QPKPLQ+ A
Sbjct  215  WKRRTMDQPKPLQVKA  230



>gb|AAF88158.1|AC026234_9 Contains similarity to a hypothetical protein T23E18.1 gi|6573705 
from Arabidopsis thaliana BAC T23E18 gb|AC009978 [Arabidopsis 
thaliana]
Length=313

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 85/269 (32%), Positives = 126/269 (47%), Gaps = 57/269 (21%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSAAISFQSLPFSPGRD---KRPAAAADIKTHCNKG--FSGP  254
            MEK    +K+    K L ++ +I   + PFSP RD    R  + A      N+G  FS P
Sbjct  1    MEKASNSNKSTKFSKMLQRAMSIGHSAAPFSPRRDFHQHRTTSTA------NRGIFFSSP  54

Query  255  IISIIPAEARRKSGMDT--QEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYAR  428
            ++    A  RR +  +    EP+SPKVSCIGQ+K  +    +     + +  P     A 
Sbjct  55   LVPT-AARVRRNTKYEAVFAEPTSPKVSCIGQVKLARPKCPE-----KKNKAPKNLKTAS  108

Query  429  SLTTSF--QEISSSSAAIGKIFH-----GRRSDATADS---------SRLRVCEDAPSLG  560
            SL++    +E + S + + +IF       R+S++TA +         + +     APSLG
Sbjct  109  SLSSCVIKEEDNGSFSKLKRIFSMRSYPSRKSNSTAFAAAAAREHPIAEVDAVTAAPSLG  168

Query  561  QMKRFASGRETLSDFNWTTASTATAQVVPHGRKYCLDNDSDDEYEEISIPFSA--PMFGG  734
             MK+FAS RE L  F+WT                        E E++ IP S   P+   
Sbjct  169  AMKKFASSREALGGFDWTV-------------------QMKREKEDVMIPCSVGIPLTQL  209

Query  735  HGSTTLPLEPRKEINLWKRRTMAQPKPLQ  821
               +  P +P+ E+NLWKRRTM +PKPLQ
Sbjct  210  EDLSLCP-KPKSEVNLWKRRTMDRPKPLQ  237



>ref|XP_009103346.1| PREDICTED: uncharacterized protein At1g76070-like [Brassica rapa]
Length=243

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 82/246 (33%), Positives = 114/246 (46%), Gaps = 43/246 (17%)
 Frame = +3

Query  153  AISFQSLPFSPGRDKRPAAAADIKTHCNKGF--SGPIISIIPAEARR-----KSGMDTQE  311
            A+S    PFSP RD      A      ++GF  SGPI  ++P  A R     K+ +   E
Sbjct  19   ALSIGHSPFSPVRDFHHHRTAST---VSRGFFFSGPITPLLPTAASRARRRTKNAVVFAE  75

Query  312  PSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTTSFQEISSSS-----AAI  476
            P+SPKVSCIGQIK   K    +          TK    ++L T+   +   +     + +
Sbjct  76   PTSPKVSCIGQIKLANKSKCPE----------TKTRERKNLKTASSRLVKEAGKGNWSKL  125

Query  477  GKIFH--GRRSDATADSSR----LRVCED--APSLGQMKRFASGRETLSDFNWTTASTAT  632
             ++F    R+S+  A S+     +   E   APSL +MK+FAS RE L  F+WT      
Sbjct  126  KRLFSMGSRKSNYVAVSAASEPPISAVEAVAAPSLCKMKKFASSREALGGFDWTAEIKRE  185

Query  633  AQVVPHGRKYCLDNDSDDEYEEISIPFSAPMFGGHGSTTLPLEPRKEINLWKRRTMAQPK  812
                 H R+      SDD+   I    S P+        +    + E+NLWKRRTM QPK
Sbjct  186  ESRSDHHRR---GYSSDDKETMIPCAVSTPL-------AMCSRQKSEVNLWKRRTMDQPK  235

Query  813  PLQLNA  830
            PLQ+ A
Sbjct  236  PLQVKA  241



>gb|KFK44152.1| hypothetical protein AALP_AA1G221900 [Arabis alpina]
Length=233

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 83/264 (31%), Positives = 118/264 (45%), Gaps = 69/264 (26%)
 Frame = +3

Query  135  FLPKSAAISFQSLPFSPGRDKRPAAAADIKTHCNKG--FSGPIISIIPAEARRKSGMDTQ  308
             L K+ ++     PFSP RD R      I T  N+G  FS P+  ++P  AR +  +   
Sbjct  1    MLQKAMSVGHSVTPFSPARDFR-HHHRTIST-ANRGYFFSSPMTPLVPMAARARRRIKNH  58

Query  309  ----EPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYA---RSLTTSFQEISS--  461
                EP+SPKVSCIGQIK  K         P+    P KK+ A   ++L  +   +SS  
Sbjct  59   GVLAEPTSPKVSCIGQIKLAK---------PK---FPEKKNRAGGSKNLKKTSSTLSSFL  106

Query  462  --------SSAAIGKIFH---GRRSDATADSSRLRVCED----------APSLGQMKRFA  578
                    S + + + F    G+     ++S+ L    +          APSLG+MK+FA
Sbjct  107  VKEEDNKGSLSKLKRFFSFSTGKNQLIKSNSTALAAANEHSTAAVEAVAAPSLGKMKKFA  166

Query  579  SGRETLSDFNWTTASTATAQVVPHGRKYCLDNDSDDEYEEISIP--FSAPMFGGHGSTTL  752
            S RE    F+WT                       +  E + IP   S P+    G +  
Sbjct  167  SSREAFGGFDWTVEM--------------------NREEAVMIPCSVSTPLSKSEGLSLC  206

Query  753  PLEPRKEINLWKRRTMAQPKPLQL  824
            P +P+ E+NLWKRRTM  PKPLQ+
Sbjct  207  P-KPKSEVNLWKRRTMDPPKPLQV  229



>emb|CDY71911.1| BnaAnng39270D, partial [Brassica napus]
Length=211

 Score = 81.3 bits (199),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 83/242 (34%), Positives = 117/242 (48%), Gaps = 60/242 (25%)
 Frame = +3

Query  174  PFSPGRD---KRPAAAADIKTHCNKGF--SGPIISIIPAEARR-----KSGMDTQEPSSP  323
            PFSP RD    R A+ A      N+GF  SGPI  ++P  A R     K+ +   EP+SP
Sbjct  5    PFSPVRDFHHHRTASTA------NRGFFFSGPITPLLPTAASRARRRTKNAVVFAEPTSP  58

Query  324  KVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTTSFQEISSSS-----AAIGKIF  488
            KVSCIGQIK   K    +          TK    ++L T+   +   +     + + ++F
Sbjct  59   KVSCIGQIKLANKSKCPE----------TKTRERKNLKTASSRLVKEAGKGNWSKLKRLF  108

Query  489  H--GRRSDATADSSR----LRVCED--APSLGQMKRFASGRETLSDFNWTTASTATAQVV  644
                R+S+  A S+     +   E   APSL +MK+FAS RE L  F+WT      A++ 
Sbjct  109  SMGSRKSNYVAVSAASEPPISAVEAVAAPSLCKMKKFASSREALGGFDWT------AEI-  161

Query  645  PHGRKYCLDNDSDDEYEEISIPFSAPMFGGHGSTTLPLEPRKEINLWKRRTMAQPKPLQL  824
               ++Y     SDD+   I    S P+        +    + E+NLWKRRTM QPKPLQ+
Sbjct  162  ---KRY----SSDDKETMIPCAVSTPL-------AMCSRQKSEVNLWKRRTMDQPKPLQV  207

Query  825  NA  830
             A
Sbjct  208  KA  209



>ref|XP_010459713.1| PREDICTED: uncharacterized protein At1g76070-like [Camelina sativa]
Length=248

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 77/270 (29%), Positives = 124/270 (46%), Gaps = 46/270 (17%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSAAISFQSLPFSPGRDKRPAAAADIKTHCNKG--FSGPIIS  263
            MEK    +K+    K L ++ +I   + PFSPGRD        + +  N+G  FS P++ 
Sbjct  1    MEKGSNSNKSTKFSKMLQRALSIGHSAAPFSPGRD---FHQHRMTSTVNRGIFFSSPLVP  57

Query  264  IIPAEARRKSGMDT--QEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLT  437
               A  RR++  ++   EP+SPKVSCIGQ+K  K     +++    +          S  
Sbjct  58   TA-ARVRRRTKNESVFAEPTSPKVSCIGQVKLNKPKCSSEKRNKEPNNNLKTASSLSSCV  116

Query  438  TSFQEISSSSAAIGKIFHG-----RRSDATADSSRLRVCE-------------DAPSLGQ  563
            T  +E   + + + ++F       R+S++ +  +                   DAPSLG+
Sbjct  117  TIKEEDKGNFSKLKRLFSTKSFLWRKSNSNSTPTAFATTSEYPAAAVEPVPAVDAPSLGK  176

Query  564  MKRFASGRETLSDFNWTTASTATAQVVPHGRKYCLDNDSDDEYEEISIP--FSAPMFGGH  737
            MK+F+S R  L  F+WT                  +    +    ++IP   S P+    
Sbjct  177  MKKFSSSRGALGGFDWTA-----------------EMKRQESQSNLTIPCSVSMPLTPLE  219

Query  738  GSTTLPLEPRKEINLWKRRTMAQPKPLQLN  827
            G +  P +P+ E+NLWKRRTM +PK LQ+N
Sbjct  220  GLSLCP-KPKSEVNLWKRRTMDRPKALQVN  248



>emb|CDY31898.1| BnaC07g15480D [Brassica napus]
Length=236

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 83/249 (33%), Positives = 120/249 (48%), Gaps = 44/249 (18%)
 Frame = +3

Query  132  KFLPKSAAISFQSLPFSPGRDKRPAAAADIKTHCNKGF--SGPIISIIPAEARR-----K  290
            K L K+ +I   + PFSP RD          T  N+GF  SGPI  ++P  A R     K
Sbjct  14   KMLQKALSIGHGAAPFSPVRDFHHHHHRTAST-VNRGFFFSGPITPLLPTAASRARRRTK  72

Query  291  SGMDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTTSFQEISSSS-  467
            + +   EP+SPKVSCIGQIK   K      +         +K+   + +   +E    + 
Sbjct  73   NAVVFAEPTSPKVSCIGQIKLANKSKCPDAKNRE------RKNLKPASSCLVKEAGKGNW  126

Query  468  AAIGKIFH--GRRSDATADSSR----LRVCEDA--PSLGQMKRFASGRETLSDFNWTTAS  623
            + + ++F    R+S+ TA S+     +   E    PSLG+MK+FAS RE L  F+     
Sbjct  127  SKLKRLFSMGSRKSNYTAVSAASEHPISAVEAVAVPSLGKMKKFASSREALGGFD-----  181

Query  624  TATAQVVPHGRKYCLDNDSDDEYEEISIPFSAPMFGGHGSTTLPLEPRKEINLWKRRTMA  803
              TA++    ++Y     SDD+   I    S P+        L    + E+NLWKRRTM 
Sbjct  182  -RTAEI----KRY----SSDDKETMIPCAVSTPL-------ALCSRQKSEVNLWKRRTMD  225

Query  804  QPKPLQLNA  830
            +PKPLQ+ A
Sbjct  226  RPKPLQVKA  234



>emb|CDY51338.1| BnaCnng20750D [Brassica napus]
Length=254

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 86/268 (32%), Positives = 130/268 (49%), Gaps = 50/268 (19%)
 Frame = +3

Query  111  SKAKMILKFLPKSAAISFQSLP-FSPGRDKRPAAAADIKTHCNKG--FSGPIISIIP--A  275
            + +K + K   K+ +I   + P F+P RD R           ++G  FS P+  ++P  A
Sbjct  9    NNSKKLSKMFQKALSIGHSAAPPFNPVRDFRHHRTIST---ASRGYFFSSPMTPLLPTSA  65

Query  276  EARRKS---GMDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTTSF  446
             ARR++   G+   EP+SPKVSCIGQIK  K         P +     K     S +   
Sbjct  66   RARRRTKSNGVVVAEPTSPKVSCIGQIKLAKSKC------PEMKKRAPKNLETSSSSLVK  119

Query  447  QEISSSSAAIGKIFH-GR----RSDATADSSRLR---VCEDA---PSLGQMKRFASGRET  593
            +E   + + + ++F  GR    +S +TA ++ +    V  +A   P+LG MK+FA+ RE+
Sbjct  120  EEGKGNWSILKRLFSTGRNPLKKSSSTASAAVIEHPVVAVEAVAGPTLGNMKKFATSRES  179

Query  594  LSDFNWTTASTATAQVVPHGRKYCLDNDSDDEY----EEISIPFSA--PMFGGHGSTTLP  755
            L  F+W               K   +    D Y    EE +IPFS   P+    G   L 
Sbjct  180  LGGFDWRVEM-----------KRQEEESRPDHYTPDDEETTIPFSVSMPLTQREG---LS  225

Query  756  LEPRK--EINLWKRRTMAQPKPLQLNAV  833
            L PR+  E+NLW+RRT+ +PKPLQ+ A 
Sbjct  226  LYPRQKSEVNLWERRTVDRPKPLQVKAT  253



>gb|ABI84248.1| syringolide-induced protein 14-1-1 [Arachis hypogaea]
Length=118

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 66/124 (53%), Gaps = 33/124 (27%)
 Frame = +3

Query  555  LGQMKRFASGRETLSDFNWTTASTATAQVVPH--GRKYCLDNDS-----------DDEYE  695
            +G M+RFAS R+T S+F+W       AQ+ P     + C   D             DE E
Sbjct  1    IGHMRRFASSRQTFSNFDWK------AQIAPEDINHRDCYSEDDRPAAGSDVEDEHDEEE  54

Query  696  EISIPFSAPM---------FGGHGS-----TTLPLEPRKEINLWKRRTMAQPKPLQLNAV  833
            E+ IPFSAP+         FGG G        L L+PRKEINLWKRRTMA P+PLQL  V
Sbjct  55   EVVIPFSAPIGGRGGCNGDFGGRGVHHEIVDNLNLQPRKEINLWKRRTMAPPRPLQLKPV  114

Query  834  IRSK  845
            + +K
Sbjct  115  LTAK  118



>gb|ACU15796.1| unknown [Glycine max]
Length=216

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 104/194 (54%), Gaps = 44/194 (23%)
 Frame = +3

Query  126  ILKFLPKSAA---ISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIISIIPAEARRKSG  296
            ILK LPK+ +   ++FQ+ PFSPGRD +               S PI+S+IP EARRK+ 
Sbjct  5    ILKALPKAVSAVTVTFQNHPFSPGRDHK---------------SKPIVSMIPHEARRKTH  49

Query  297  ----------MDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTTSF  446
                      + +QEP+SPK+SC+GQIKHKKK  ++ + + +      +   ++  +++ 
Sbjct  50   DRGNNNDIDEIYSQEPTSPKISCMGQIKHKKKQIEKSKSKSKSMTKEARNVASKQTSSAS  109

Query  447  Q--EISSSSAAIGK--IFHG-------RRSDATA-----DSSRLRVCEDAPSLGQMKRFA  578
            +  E+ +  +   K  +FHG       R+S+A+A         L     AP + QM+RF+
Sbjct  110  RDIEVKNHVSTFQKMLLFHGTKPKSDGRKSNASAPGDINKDRALADAARAPRVSQMRRFS  169

Query  579  SGRETLSDFNWTTA  620
            SGR+ L DF+W  A
Sbjct  170  SGRDALGDFDWKVA  183



>emb|CBI18914.3| unnamed protein product [Vitis vinifera]
Length=269

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 65/181 (36%), Positives = 91/181 (50%), Gaps = 52/181 (29%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSAA-ISFQ-SLPFSPGRDKRPAAAADIKTHCNKGFSGPIIS  263
            MEKP K     MILKFLPK+A+ I+FQ S PFSPGRD +                     
Sbjct  1    MEKPAK--SKNMILKFLPKAASVINFQNSTPFSPGRDHK---------------------  37

Query  264  IIPAEARRKSGMDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTTS  443
                         + +P+SPKVSC+GQ+K K K             +P  K  +    + 
Sbjct  38   -----------RSSDKPTSPKVSCMGQVKDKHKKR-----------IPKTKRASPPKESK  75

Query  444  FQEISSSSAAIGKIFH----GRRSDATADSSRLRVCEDAPSLGQMKRFASGRETLSDFNW  611
             +E+    + + +IF     GR+SDA++D  +  + + APSLGQMKRF+SGR   S+F+W
Sbjct  76   PREMKKQHSTLRRIFRSSNLGRKSDASSDD-KPSLPDRAPSLGQMKRFSSGRNAFSNFDW  134

Query  612  T  614
            T
Sbjct  135  T  135



>ref|XP_009406454.1| PREDICTED: uncharacterized protein At1g76070-like [Musa acuminata 
subsp. malaccensis]
Length=196

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 90/256 (35%), Positives = 114/256 (45%), Gaps = 70/256 (27%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSAAISFQSLPFSPGRDK--RPAAAADIKTHCNKGFSGPII-  260
            MEKP      + I+ FLPK A           GR+   +P A        ++ FSGPI  
Sbjct  1    MEKP-----DRSIITFLPKLAT----------GRENPMKPRAHGQ-----SRSFSGPITG  40

Query  261  SIIPAEARRK----SGMDT-QEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYA  425
            SIIP EARRK     G +  QEPSSPKV+C+GQIK +K  A       R  P P +K   
Sbjct  41   SIIPIEARRKQKRRGGFEAPQEPSSPKVTCMGQIKLEKMTAGCC----RKPPPPGRKWKL  96

Query  426  RSLTTSFQEISSSSAAIGKIFHGRRSDATADSSRLRVCEDA-PSLGQMKRFASGRETLSD  602
             S              I +IF   +        + R    A PSLG M R A GR +L D
Sbjct  97   ASF-------------IRQIFRRPKVGPAGGGGKSRPPVSAPPSLGGMSRSAGGRNSLGD  143

Query  603  FNWTTASTATAQVVPHGRKYCLDNDSDDEYEEISIPFSAPMFGGHGSTTLPLEPRK-EIN  779
            F+W  A+                     + EE+ I  SAP+  G G   + +EPRK   +
Sbjct  144  FDWRKAA---------------------DTEEVIIAHSAPIMVGGG--VVAVEPRKVSSS  180

Query  780  LWKRRTMAQPKPLQLN  827
            LWKRR  A+   LQLN
Sbjct  181  LWKRRAAARLTTLQLN  196



>ref|XP_010498465.1| PREDICTED: uncharacterized protein At1g76070-like [Camelina sativa]
Length=248

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 76/270 (28%), Positives = 121/270 (45%), Gaps = 46/270 (17%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSAAISFQSLPFSPGRDKRPAAAADIKTHCNKG--FSGPIIS  263
            MEK    +K+    K L ++ +I   + PFSPGRD             N+G  FS P++ 
Sbjct  1    MEKGSNSNKSTKFSKMLQRALSIGHSAAPFSPGRDFHQHRTIST---VNRGIFFSSPLVP  57

Query  264  IIPAEARRKSGMDT--QEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLT  437
               A  RR++  ++   EP+SPKVSCIGQ+K  K     +++    +          S  
Sbjct  58   -TAARVRRRTKNESVFAEPTSPKVSCIGQVKLNKPKCSSEKKNKEPNKNLKTASSLSSCV  116

Query  438  TSFQEISSSSAAIGKIFHG-----RRSDATADSSRLRVCED-------------APSLGQ  563
            T  +E   S + + ++F       R+S++ +  +      +             APSLG+
Sbjct  117  TIKEEDKGSFSKLKRLFSTKSFLWRKSNSNSTPTAFATVSEYPAAAVEPVAVVEAPSLGK  176

Query  564  MKRFASGRETLSDFNWTTASTATAQVVPHGRKYCLDNDSDDEYEEISIP--FSAPMFGGH  737
            MK+F+S R  L  F+WT                  +    +    ++IP   S P+    
Sbjct  177  MKKFSSSRGALGGFDWTA-----------------EMKRQESQSNLTIPCSVSMPLTRLE  219

Query  738  GSTTLPLEPRKEINLWKRRTMAQPKPLQLN  827
            G +  P +P+ E+NLWKRRTM +PK L +N
Sbjct  220  GLSLCP-KPKSEVNLWKRRTMDRPKALHVN  248



>ref|XP_010477264.1| PREDICTED: uncharacterized protein At1g76070-like [Camelina sativa]
Length=250

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 78/272 (29%), Positives = 122/272 (45%), Gaps = 52/272 (19%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSAAISFQSLPFSPGRDKRPAAAADIKTHCNKG--FSGPIIS  263
            MEK    +K+    K L ++ +I   + PFSPGRD        + +  N+G  FS P++ 
Sbjct  1    MEKGSNSNKSTKFSKMLQRALSIGHSAAPFSPGRD---FHQHRMTSTVNRGIFFSSPLV-  56

Query  264  IIPAEARRKSGMDTQ----EPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARS  431
              PA AR +     +    EP+SPKVSCIGQ+K  K     +++    +          S
Sbjct  57   --PAAARVRRRTKNESVFAEPTSPKVSCIGQVKLNKPKCSSEKKNKEPNKNLKTASSLSS  114

Query  432  LTTSFQEISSSSAAIGKIFHGR-------RSDATADSSRLRVCE-------------DAP  551
              T  +E   S + + ++F  +        S++T  ++   V E             + P
Sbjct  115  CVTIKEEDKGSFSKLKRLFSTKSFLWRKSNSNSTPTTAFATVSEYPAAAVEPVVAVVEPP  174

Query  552  SLGQMKRFASGRETLSDFNWTTASTATAQVVPHGRKYCLDNDSDDEYEEISIP--FSAPM  725
            SLG+MK+F+S R  L  F+WT                  +    +    ++IP   S P+
Sbjct  175  SLGKMKKFSSSRGALGGFDWTA-----------------EMKRQESQSNLTIPCSVSMPL  217

Query  726  FGGHGSTTLPLEPRKEINLWKRRTMAQPKPLQ  821
                G +  P +P+ E+NLWKRRTM +PK LQ
Sbjct  218  TELEGLSLCP-KPKSEVNLWKRRTMDRPKALQ  248



>emb|CDX73226.1| BnaC06g36740D [Brassica napus]
Length=155

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 55/102 (54%), Gaps = 17/102 (17%)
 Frame = +3

Query  546  APSLGQMKRFASGRETLSDFNWTTASTATAQVVPHGRKYCLDNDSDDEY--------EEI  701
             PSLGQMK+FAS RE L  F+W        +  P  R Y  D +   +Y        ++I
Sbjct  62   VPSLGQMKKFASSREGLGGFDWAV-EMKREEESPADRGYYSDEERRGDYLRDDDDEEDDI  120

Query  702  SIPFSAPMFGGHGSTTLPLEPRKEINLWKRRTMAQPKPLQLN  827
             IPFSAP+        + L+P+ E+NLWKRRTM  PKPL L 
Sbjct  121  IIPFSAPL--------MSLKPKTEVNLWKRRTMDPPKPLHLQ  154



>ref|NP_001144908.1| uncharacterized protein LOC100278020 [Zea mays]
 gb|ACG43776.1| hypothetical protein [Zea mays]
 gb|ACR38726.1| unknown [Zea mays]
 tpg|DAA40665.1| TPA: hypothetical protein ZEAMMB73_771474 [Zea mays]
Length=265

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 75/229 (33%), Positives = 100/229 (44%), Gaps = 50/229 (22%)
 Frame = +3

Query  243  FSGPII-SIIPAEARRKSGMD------TQEPSSPKVSCIGqikhkkkmakqkrq------  383
            FSGPI+ SI+P EAR   G        T EPSSPKVSCIGQIK      ++K        
Sbjct  51   FSGPIVVSIVPPEARGGGGRRKRPGYVTPEPSSPKVSCIGQIKRSNSRRQKKVNPSCGKG  110

Query  384  -----qPRVDPLPTKKDYARSLTTSFQEI-----------------SSSSAAIGKIFHGR  497
                  P   P   KK  +R+ ++    +                 +SS   +  +  G+
Sbjct  111  GGACPLPPRPPAEDKKPCSRTSSSRGSLVKRMPFFRRSRSRPRSRAASSKDGLIVVGDGK  170

Query  498  RSDATADSSRLRVCEDAPSLGQMKRFASGRETLSDFNWTTASTATAQVVPHGRKYCLDND  677
             SD  +  +          LGQMKRF SGR    DF+W      T +          D+D
Sbjct  171  ESDGDSAVADPAPPPPPMGLGQMKRFTSGRAAFQDFDWREEERTTGR----------DSD  220

Query  678  SDDEYEEISIPFSAPMFGGHGSTTLPLEPRKEINLWKRRTMAQPKPLQL  824
             DD+     +  SAP+  G G   +  EPRKE+NLW+RR +  P  LQL
Sbjct  221  EDDDG---FVAHSAPLVLGGG--VVASEPRKEVNLWRRRPIVPPTQLQL  264



>dbj|BAK07532.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=277

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 58/115 (50%), Gaps = 16/115 (14%)
 Frame = +3

Query  483  IFHGRRSDATADSSRLRVCEDAPSLGQMKRFASGRETLSDFNWTTASTATAQVVPHGRKY  662
            +F GR   + A ++          LGQMKRF SGR    DF+W  A              
Sbjct  177  LFKGRPGSSAAVAAAPVSGPGMAGLGQMKRFTSGRGAFQDFDWRDAERR-----------  225

Query  663  CLDNDSDDEYEEIS-IPFSAPMFGGHGSTTLPLEPRKEINLWKRRTMAQPKPLQL  824
               +D D +YE+   + FSAP+  G G   +  EPRKE+NLW+RR M+ P PL+L
Sbjct  226  --GSDVDHDYEDDGFVAFSAPLVLGGG--VVASEPRKEVNLWRRRPMSPPTPLEL  276



>ref|XP_004289067.1| PREDICTED: uncharacterized protein At1g76070-like [Fragaria vesca 
subsp. vesca]
Length=212

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 100/188 (53%), Gaps = 38/188 (20%)
 Frame = +3

Query  105  KPSKAKM-ILKFLPKSAA--ISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIISIIPA  275
            K SK +M ILKFL ++AA  ++++S P SP                      PI+SIIP 
Sbjct  3    KQSKLRMQILKFLSQAAAPAVTYKSPPASPRH--------------------PIVSIIPR  42

Query  276  EARRK-----SGMDTQEPSSPKVSCIGqikhkkkmakqkrqqP---RVDPLPTKKDYARS  431
            EARRK     S   ++EP+SPKVSC+GQ+K K K  K+K+ +P   +V P P ++  + +
Sbjct  43   EARRKPRNGSSSFASKEPTSPKVSCMGQVKGKNKKKKKKKSKPKPKQVCPPPPEESTSLA  102

Query  432  LTTSFQEISSSSAAIGKIF--HGRRSD----ATADSSRL-RVCEDAPSLGQMKRFASGRE  590
            L    ++    S  I K+    G+  D    AT+  SR  R  E  PSLG MKRF S R 
Sbjct  103  LCVPKEKTFRVSNVIPKLLMNQGKTKDDGSVATSSLSRTSRAAERVPSLGHMKRFESRRG  162

Query  591  TLSDFNWT  614
             LSDF+ T
Sbjct  163  VLSDFDLT  170



>ref|XP_003578554.1| PREDICTED: uncharacterized protein At1g76070-like [Brachypodium 
distachyon]
Length=269

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 49/93 (53%), Gaps = 17/93 (18%)
 Frame = +3

Query  555  LGQMKRFASGRETLSDFNWTTASTATAQVVPHGRKYCLDNDSDDEYEEISIPF---SAPM  725
            LG MKRF SGR    DF+W  A    +            +D D+EY  +   F   SAP+
Sbjct  190  LGHMKRFTSGRAAFQDFDWKEAERRGS------------DDEDEEYSFVDDGFVAHSAPL  237

Query  726  FGGHGSTTLPLEPRKEINLWKRRTMAQPKPLQL  824
              G G   +  EPRKE+NLW+RR M+ P PLQL
Sbjct  238  VLGGG--VVASEPRKEVNLWRRRPMSPPTPLQL  268



>ref|XP_002460593.1| hypothetical protein SORBIDRAFT_02g031530 [Sorghum bicolor]
 gb|EER97114.1| hypothetical protein SORBIDRAFT_02g031530 [Sorghum bicolor]
Length=258

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 49/91 (54%), Gaps = 16/91 (18%)
 Frame = +3

Query  555  LGQMKRFASGRETLSDFNWTTASTATAQVVPHGRKYCLDNDSDDEYEEIS-IPFSAPMFG  731
            LG M+RF SGR    DF+W      +              DSD+E+E+   +  SAP+  
Sbjct  182  LGHMRRFTSGRAAFQDFDWREEERRS-------------RDSDEEFEDDGFVAHSAPLVL  228

Query  732  GHGSTTLPLEPRKEINLWKRRTMAQPKPLQL  824
            G G   +  EPRKE+NLW+RR MA P PL+L
Sbjct  229  GGG--VVASEPRKEVNLWRRRPMAPPTPLEL  257



>gb|EMT18858.1| hypothetical protein F775_31491 [Aegilops tauschii]
Length=276

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 58/114 (51%), Gaps = 12/114 (11%)
 Frame = +3

Query  483  IFHGRRSDATADSSRLRVCEDAPSLGQMKRFASGRETLSDFNWTTASTATAQVVPHGRKY  662
            +F GR   + A ++          LGQMKRF SGR    DF+W  A           R+ 
Sbjct  174  LFKGRPGSSAAVAAAPVSGPGMAGLGQMKRFTSGRGAFQDFDWREAE----------RRG  223

Query  663  CLDNDSDDEYEEISIPFSAPMFGGHGSTTLPLEPRKEINLWKRRTMAQPKPLQL  824
               +  DD  ++  + FSAP+  G G   +  EPRKE+NLW+RR M+ P PL+L
Sbjct  224  SDVDVDDDYVDDGFVAFSAPLVLGGG--VVASEPRKEVNLWRRRPMSPPTPLEL  275



>ref|XP_006575799.1| PREDICTED: uncharacterized protein At1g76070-like [Glycine max]
Length=157

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 55/169 (33%), Positives = 73/169 (43%), Gaps = 36/169 (21%)
 Frame = +3

Query  126  ILKFLPKSAAISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIISIIPAEARRKSGMDT  305
            + KFLP     SFQ+   SP     P A     TH         +SI+P EARR+   ++
Sbjct  11   LFKFLPNQPLASFQNPNLSPSGSVTPGAG-RTPTHR--------VSIVPKEARRRHKTES  61

Query  306  ---QEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYARSLTTSFQEISSSSAAI  476
                EP+SPKVSC+GQ                   + +KK          Q   S +   
Sbjct  62   FSGWEPNSPKVSCMGQ-------------------VKSKKKRKAHEQKKVQTQESENKRF  102

Query  477  GKIFHGRRSDATADSSRLR----VCEDAPSLGQMKRFASGRE-TLSDFN  608
             +    R  + T +S  L       E APSLG MK+FASGRE +L DF+
Sbjct  103  LRWIFMRNGEGTKESGNLEEKASTTEVAPSLGTMKKFASGREGSLRDFD  151



>ref|XP_004957518.1| PREDICTED: uncharacterized protein At1g76070-like [Setaria italica]
Length=257

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 50/91 (55%), Gaps = 13/91 (14%)
 Frame = +3

Query  555  LGQMKRFASGRETLSDFNWTTASTATAQVVPHGRKYCLDNDSDDEYEEISIPFSAPMFGG  734
            LGQMKRF SGR    DF+W       +            +  ++E +E  + +SAP+  G
Sbjct  180  LGQMKRFTSGRAAFQDFDWREEEERRS-----------RDSDEEEEDEGFVAYSAPLTLG  228

Query  735  HGSTTLPLEPRKEINLWKRRTMAQPKPLQLN  827
             G   +  EPRKE+NLW+RR MA P PLQL+
Sbjct  229  GG--VVASEPRKEVNLWRRRPMAPPTPLQLH  257



>ref|NP_001063825.1| Os09g0542900 [Oryza sativa Japonica Group]
 dbj|BAC79200.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF25739.1| Os09g0542900 [Oryza sativa Japonica Group]
 dbj|BAG93438.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC84977.1| hypothetical protein OsI_32237 [Oryza sativa Indica Group]
Length=254

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 46/88 (52%), Gaps = 18/88 (20%)
 Frame = +3

Query  561  QMKRFASGRETLSDFNWTTASTATAQVVPHGRKYCLDNDSDDEYEEISIPFSAPMFGGHG  740
            QMKRF SGR    DF+W  A               + +D DD+   + +  SAP+  G G
Sbjct  184  QMKRFTSGRAAFEDFDWREAER-------------MASDDDDD---VLVAHSAPLVLGGG  227

Query  741  STTLPLEPRKEINLWKRRTMAQPKPLQL  824
               +  EPRKE+NLW RR MA P PL+L
Sbjct  228  --LVASEPRKEVNLWSRRPMAPPTPLRL  253



>gb|EEE70148.1| hypothetical protein OsJ_30196 [Oryza sativa Japonica Group]
Length=255

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 46/88 (52%), Gaps = 18/88 (20%)
 Frame = +3

Query  561  QMKRFASGRETLSDFNWTTASTATAQVVPHGRKYCLDNDSDDEYEEISIPFSAPMFGGHG  740
            QMKRF SGR    DF+W  A               + +D DD+   + +  SAP+  G G
Sbjct  185  QMKRFTSGRAAFEDFDWREAER-------------MASDDDDD---VLVAHSAPLVLGGG  228

Query  741  STTLPLEPRKEINLWKRRTMAQPKPLQL  824
               +  EPRKE+NLW RR MA P PL+L
Sbjct  229  --LVASEPRKEVNLWSRRPMAPPTPLRL  254



>ref|XP_009337115.1| PREDICTED: uncharacterized protein At1g76070-like [Pyrus x bretschneideri]
Length=152

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 89/182 (49%), Gaps = 41/182 (23%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSA---AISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPII  260
            MEKP+K   +K IL FL K+A    I+F S P SP    R AA             GP+I
Sbjct  1    MEKPLKRMGSK-ILTFLSKAAQPAVITFHSPPPSP----RKAA-------------GPMI  42

Query  261  SIIPAEARRK--SGMD--TQEPSSPKVSCIGqikhkkkmakqkrqqPRVD----PLPTKK  416
             I P E+RRK  SG+   ++EP+SPKVSC+GQ+  KKK   +            P   K 
Sbjct  43   RIFPPESRRKTRSGITFASKEPTSPKVSCMGQVHGKKKSKSKSNSTGSAPVSCIPKEVKN  102

Query  417  DYARSLTTSFQEISSSSAAIGKIFHGRRSDATADSSRLRVCEDAPSLGQMKRFASGRETL  596
              AR  +   +E++               +   + +R    E  PSLGQMKRFASGR TL
Sbjct  103  KPARVSSKVPKEVALP------------EEGNENRNRDGAPERVPSLGQMKRFASGRSTL  150

Query  597  SD  602
            +D
Sbjct  151  AD  152



>ref|XP_008361352.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At1g76070-like 
[Malus domestica]
Length=204

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 68/185 (37%), Positives = 90/185 (49%), Gaps = 41/185 (22%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSA---AISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPII  260
            MEKP+K   +K IL FL K+A    I+F S P SP    R AA             GP+I
Sbjct  1    MEKPLKRMGSK-ILTFLSKAAQPAVITFHSPPPSP----RKAA-------------GPMI  42

Query  261  SIIPAEARRK--SGMD--TQEPSSPKVSCIGqikhkkkmakqkrqqPRVD----PLPTKK  416
             I P E+RRK  SG+   ++EP+SPKVSC+GQ+  KKK   +            P   K 
Sbjct  43   RIFPPESRRKTRSGITFASKEPTSPKVSCMGQVHGKKKNKSKSNSTGSAPVSCIPKEVKN  102

Query  417  DYARSLTTSFQEISSSSAAIGKIFHGRRSDATADSSRLRVCEDAPSLGQMKRFASGRETL  596
              AR  +   +E++               +   + +R    E  PSLGQMKRFASGR TL
Sbjct  103  KPARVSSKVPKEVALP------------EEGNENRNRDGAPERVPSLGQMKRFASGRSTL  150

Query  597  SDFNW  611
            +D + 
Sbjct  151  ADXDL  155



>ref|XP_009363560.1| PREDICTED: uncharacterized protein At1g76070-like [Pyrus x bretschneideri]
Length=152

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 88/182 (48%), Gaps = 41/182 (23%)
 Frame = +3

Query  90   MEKPVKPSKAKMILKFLPKSA---AISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPII  260
            MEKP+K   +K IL FL K+A    I F S P SP    R AA             GP+I
Sbjct  1    MEKPLKRMGSK-ILTFLSKAAQPAVIMFHSPPPSP----RKAA-------------GPMI  42

Query  261  SIIPAEARRK--SGMD--TQEPSSPKVSCIGqikhkkkmakqkrqqPRVD----PLPTKK  416
             I P E+RRK  SG+   ++EP+SPKVSC+GQ+  KKK   +            P   K 
Sbjct  43   RIFPPESRRKTRSGITFASKEPTSPKVSCMGQVHGKKKSKSKSNSTGSAPVSCIPKEVKN  102

Query  417  DYARSLTTSFQEISSSSAAIGKIFHGRRSDATADSSRLRVCEDAPSLGQMKRFASGRETL  596
              AR  +   +E++               +   + +R    E  PSLGQMKRFASGR TL
Sbjct  103  KPARVSSKVPKEVALP------------EEGNENRNRDGAPERVPSLGQMKRFASGRSTL  150

Query  597  SD  602
            +D
Sbjct  151  AD  152



>gb|KHN35994.1| hypothetical protein glysoja_003117 [Glycine soja]
Length=167

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 70/125 (56%), Gaps = 4/125 (3%)
 Frame = +3

Query  255  IISIIPAEARRKSGMDT---QEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYA  425
            ++SIIP EARRK   +T   +EP+SPKVSC+GQ++ KK+ A+++++    D     KD  
Sbjct  42   VVSIIPKEARRKHKGETFSAREPTSPKVSCMGQVQGKKRKARKQKRAQAQDQAQAHKDPT  101

Query  426  RSLTTSFQEISSSSAAIGKIFHGRRSDATADSSRLRVCEDAPSLGQMKRFASGRETLSDF  605
            ++ T S  E       I K     R     +  R     +APSL  MK+FASGR +L DF
Sbjct  102  KN-TNSIGEKKEILLWIQKGSDEGRKRKVLEEKRASGTVEAPSLNTMKKFASGRGSLYDF  160

Query  606  NWTTA  620
            + T A
Sbjct  161  DVTIA  165



>ref|XP_008653553.1| PREDICTED: uncharacterized protein At1g76070-like [Zea mays]
 tpg|DAA64277.1| TPA: hypothetical protein ZEAMMB73_717780 [Zea mays]
Length=230

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 91/205 (44%), Gaps = 37/205 (18%)
 Frame = +3

Query  201  PAAAADIKTHCN--KGFSGPIISIIPAEARRKSGMD-----TQEPSSPKVSCIGqikhkk  359
            P+A+   ++  N   GFSGPI+SI+P EAR   G +     T EPSSPKVSCIGQIK   
Sbjct  37   PSASVGTRSSFNHRNGFSGPIVSIVPPEARGGGGRNRSGYMTPEPSSPKVSCIGQIKRSN  96

Query  360  kmakqkrqqPRVD-----PLPTKKDYARSLTTSFQEIS--------SSSAAIGKIFHGRR  500
               ++K      +     PLP      +   +  + +S          S A G + +G+ 
Sbjct  97   SRRQRKVNPCGKNGGGACPLPPAPAEGKPRGSLVKRLSFFRRGRSRPRSRADGLVGNGKE  156

Query  501  SDATADSSRLRVCEDAPSLGQMKRFASGRETLSDFNWTTASTATAQVVPHGRKYCLDNDS  680
             D  A ++          LGQM+RF SGR    D +W        +V             
Sbjct  157  CDGGATAAAAA--PAPAGLGQMRRFTSGRAAFQDLDWRQEWRRAGRV-------------  201

Query  681  DDEYEEISIPFSAPMFGGHGSTTLP  755
             DE +E  +  SAP+   HGS++ P
Sbjct  202  SDEEDEGFVAHSAPL--PHGSSSHP  224



>gb|AAF79816.1|AC007396_16 T4O12.28 [Arabidopsis thaliana]
Length=96

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 38/72 (53%), Gaps = 3/72 (4%)
 Frame = +3

Query  135  FLPKSAAISFQSLPFSPGRDKRPAAAADIKTHCNKGFSGPIISIIPAEA---RRKSGMDT  305
             LPK+ +   +  PFSPGRD       +        FSGP++ ++P  A   R KS    
Sbjct  21   MLPKAMSFGHRVPPFSPGRDLHHNNHHNYTAANKMFFSGPMVPLVPNAARVRRNKSDAVW  80

Query  306  QEPSSPKVSCIG  341
             EP+SPKVSCIG
Sbjct  81   DEPTSPKVSCIG  92



>ref|XP_010113284.1| hypothetical protein L484_026613 [Morus notabilis]
 gb|EXC35291.1| hypothetical protein L484_026613 [Morus notabilis]
Length=156

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 58/126 (46%), Gaps = 28/126 (22%)
 Frame = +3

Query  261  SIIPAEARRK----SGMDTQEPSSPKVSCIGqikhkkkmakqkrqqPRVDPLPTKKDYAR  428
            SIIP+EARRK    S  DT+EP+SPKVSC+G                ++      K   +
Sbjct  48   SIIPSEARRKPKYGSSFDTREPTSPKVSCLG----------------QITNKKKPKPKPK  91

Query  429  SLTTSFQEISSSSAAIGK-------IFHGRRSDATADSSRLRVCEDAPSLGQMKRFASGR  587
             +  S QE+        K       I  G  S   AD S + +    PSLG+MKRF S R
Sbjct  92   KVGCSVQEVKVVKKRHKKGVKENMIIDDGPNSKDKADGSNVGILV-VPSLGEMKRFTSAR  150

Query  588  ETLSDF  605
              LS+F
Sbjct  151  GVLSEF  156



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2121035180950