BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c28373_g1_i1 len=1549 path=[1:0-1548]

Length=1549
                                                                      Score     E

gb|AIY62316.1|  ankyrin repeat domain containing protein 2              522   4e-180   
gb|AAO91861.1|  TGB12K interacting protein 2                            518   1e-178   Nicotiana tabacum [American tobacco]
gb|AAO91862.1|  TGB12K interacting protein 3                            517   3e-178   Nicotiana tabacum [American tobacco]
gb|AAN63819.1|  ankyrin domain protein                                  513   1e-176   Nicotiana tabacum [American tobacco]
emb|CDO97545.1|  unnamed protein product                                513   2e-176   
ref|XP_009800016.1|  PREDICTED: ankyrin repeat domain-containing ...    513   2e-176   
ref|XP_009618229.1|  PREDICTED: ankyrin repeat domain-containing ...    511   6e-176   
ref|XP_009616704.1|  PREDICTED: ankyrin repeat domain-containing ...    510   2e-175   
gb|ADB57050.1|  ankyrin repeat-containing protein                       509   5e-175   Nicotiana tabacum [American tobacco]
gb|KDP47058.1|  hypothetical protein JCGZ_10785                         507   4e-174   
ref|XP_011040859.1|  PREDICTED: ankyrin repeat domain-containing ...    507   8e-174   
ref|XP_011092354.1|  PREDICTED: ankyrin repeat domain-containing ...    506   1e-173   
emb|CDN40974.1|  Ankyrin repeat domain containing protein               505   2e-173   
ref|XP_007201892.1|  hypothetical protein PRUPE_ppa007612mg             505   2e-173   
ref|XP_006384892.1|  hypothetical protein POPTR_0004s21980g             506   2e-173   
ref|XP_008235852.1|  PREDICTED: ankyrin repeat domain-containing ...    504   5e-173   
gb|AIY62315.1|  ankyrin repeat domain containing protein 2              503   1e-172   
ref|XP_004230497.1|  PREDICTED: ankyrin repeat domain-containing ...    502   3e-172   
ref|XP_004290102.1|  PREDICTED: ankyrin repeat domain-containing ...    502   5e-172   
ref|XP_011040864.1|  PREDICTED: ankyrin repeat domain-containing ...    502   6e-172   
ref|XP_007043143.1|  Ankyrin repeat domain-containing protein 2 i...    501   6e-172   
ref|XP_008382530.1|  PREDICTED: ankyrin repeat domain-containing ...    501   1e-171   
ref|XP_008382529.1|  PREDICTED: ankyrin repeat domain-containing ...    501   1e-171   
ref|XP_009358926.1|  PREDICTED: ankyrin repeat domain-containing ...    501   1e-171   
ref|XP_008356269.1|  PREDICTED: ankyrin repeat domain-containing ...    500   2e-171   
gb|AEA50964.1|  putative PDF1-interacting protein 2                     501   2e-171   
ref|XP_010090746.1|  Ankyrin repeat domain-containing protein 2         502   5e-171   
ref|XP_006384889.1|  hypothetical protein POPTR_0004s21970g             499   6e-171   
ref|XP_009358927.1|  PREDICTED: ankyrin repeat domain-containing ...    499   7e-171   
ref|XP_006341819.1|  PREDICTED: ankyrin repeat domain-containing ...    497   2e-170   
gb|AAQ96339.1|  putative ankyrin-repeat protein                         497   3e-170   Vitis aestivalis
ref|XP_011087763.1|  PREDICTED: ankyrin repeat domain-containing ...    496   3e-170   
ref|XP_010645421.1|  PREDICTED: ankyrin repeat domain-containing ...    497   4e-170   
ref|XP_002283498.2|  PREDICTED: ankyrin repeat domain-containing ...    497   5e-170   Vitis vinifera
ref|XP_002514378.1|  ankyrin repeat domain protein, putative            496   6e-170   Ricinus communis
ref|XP_010327342.1|  PREDICTED: ankyrin repeat domain-containing ...    495   2e-169   
gb|ACU21334.1|  unknown                                                 494   3e-169   Glycine max [soybeans]
gb|KHG16227.1|  Ankyrin repeat domain-containing 2 -like protein        495   3e-169   
ref|NP_001241225.1|  uncharacterized protein LOC100797622               494   3e-169   
ref|XP_008448145.1|  PREDICTED: ankyrin repeat domain-containing ...    494   4e-169   
ref|XP_009795715.1|  PREDICTED: ankyrin repeat domain-containing ...    491   7e-169   
gb|AHA84120.1|  ankyrin-repeat protein                                  493   1e-168   
ref|XP_006492896.1|  PREDICTED: ankyrin repeat domain-containing ...    491   5e-168   
ref|XP_006577821.1|  PREDICTED: uncharacterized protein LOC100797...    491   5e-168   
ref|XP_007148690.1|  hypothetical protein PHAVU_005G006400g             490   1e-167   
ref|XP_004139984.1|  PREDICTED: ankyrin repeat domain-containing ...    490   2e-167   
gb|KDO50173.1|  hypothetical protein CISIN_1g018578mg                   489   4e-167   
ref|NP_001241477.1|  uncharacterized protein LOC100784610               487   3e-166   
emb|CDG58550.1|  Ankyrin repeat domain containg protein 2               487   4e-166   
ref|XP_010686618.1|  PREDICTED: ankyrin repeat domain-containing ...    485   1e-165   
gb|EYU26543.1|  hypothetical protein MIMGU_mgv1a009315mg                484   4e-165   
gb|KEH32864.1|  TGB12K interacting protein                              483   5e-165   
gb|KHG19795.1|  Ankyrin repeat domain-containing 2 -like protein        483   1e-164   
gb|ACJ85238.1|  unknown                                                 482   2e-164   Medicago truncatula
gb|KHG20995.1|  Ankyrin repeat domain-containing 2 -like protein        479   6e-164   
ref|XP_004499676.1|  PREDICTED: ankyrin repeat domain-containing ...    479   2e-163   
ref|XP_006349382.1|  PREDICTED: ankyrin repeat domain-containing ...    473   1e-160   
gb|EPS72852.1|  hypothetical protein M569_01905                         471   2e-160   
ref|XP_006840277.1|  hypothetical protein AMTR_s00045p00049310          470   7e-160   
ref|XP_010070187.1|  PREDICTED: ankyrin repeat domain-containing ...    466   3e-158   
gb|KCW58824.1|  hypothetical protein EUGRSUZ_H01461                     466   4e-158   
ref|XP_010250398.1|  PREDICTED: ankyrin repeat domain-containing ...    459   3e-155   
ref|XP_010028894.1|  PREDICTED: ankyrin repeat domain-containing ...    456   3e-154   
gb|KCW55723.1|  hypothetical protein EUGRSUZ_I01557                     455   3e-154   
ref|XP_008776174.1|  PREDICTED: LOW QUALITY PROTEIN: ankyrin repe...    451   2e-152   
ref|XP_010909790.1|  PREDICTED: ankyrin repeat domain-containing ...    451   4e-152   
gb|KDO50178.1|  hypothetical protein CISIN_1g018578mg                   447   4e-151   
ref|XP_010526861.1|  PREDICTED: ankyrin repeat domain-containing ...    443   2e-149   
ref|XP_008462015.1|  PREDICTED: ankyrin repeat domain-containing ...    444   2e-149   
ref|XP_004957326.1|  PREDICTED: ankyrin repeat domain-containing ...    442   4e-149   
ref|XP_010909897.1|  PREDICTED: ankyrin repeat domain-containing ...    442   5e-149   
ref|NP_001183774.1|  ankyrin repeat domain-containing protein 2         441   1e-148   
ref|XP_004144559.1|  PREDICTED: ankyrin repeat domain-containing ...    442   1e-148   
gb|KHG27338.1|  Ankyrin repeat domain-containing 2 -like protein        441   7e-148   
ref|XP_002460512.1|  hypothetical protein SORBIDRAFT_02g029680          439   9e-148   Sorghum bicolor [broomcorn]
ref|XP_008801178.1|  PREDICTED: ankyrin repeat domain-containing ...    436   2e-146   
ref|XP_010530981.1|  PREDICTED: LOW QUALITY PROTEIN: ankyrin repe...    435   4e-146   
gb|KDO50179.1|  hypothetical protein CISIN_1g018578mg                   431   9e-145   
ref|XP_002445777.1|  hypothetical protein SORBIDRAFT_07g025610          431   1e-144   Sorghum bicolor [broomcorn]
ref|NP_001142281.1|  uncharacterized protein LOC100274450               430   4e-144   Zea mays [maize]
ref|XP_009385507.1|  PREDICTED: ankyrin repeat domain-containing ...    429   5e-144   
gb|ACG45923.1|  ankyrin repeat domain-containing protein 2              429   5e-144   Zea mays [maize]
ref|XP_004974059.1|  PREDICTED: ankyrin repeat domain-containing ...    428   1e-143   
ref|XP_009411775.1|  PREDICTED: ankyrin repeat domain-containing ...    428   3e-143   
ref|XP_006412101.1|  hypothetical protein EUTSA_v10025639mg             427   4e-143   
ref|XP_003574852.1|  PREDICTED: ankyrin repeat domain-containing ...    423   2e-141   
gb|ABK23212.1|  unknown                                                 423   2e-141   Picea sitchensis
ref|XP_006284044.1|  hypothetical protein CARUB_v10005165mg             422   6e-141   
ref|XP_010489365.1|  PREDICTED: ankyrin repeat domain-containing ...    421   1e-140   
gb|EMT03569.1|  hypothetical protein F775_26795                         421   1e-140   
ref|XP_010467510.1|  PREDICTED: ankyrin repeat domain-containing ...    421   2e-140   
ref|XP_008651816.1|  PREDICTED: ankyrin repeat domain-containing ...    418   5e-140   
gb|EMS52688.1|  Ankyrin repeat domain-containing protein 2              420   6e-140   
ref|XP_006660835.1|  PREDICTED: ankyrin repeat domain-containing ...    419   7e-140   
ref|XP_003578420.1|  PREDICTED: ankyrin repeat domain-containing ...    418   1e-139   
ref|XP_006297928.1|  hypothetical protein CARUB_v10013970mg             420   1e-139   
ref|NP_179331.1|  ankyrin repeat-containing 2B                          418   2e-139   Arabidopsis thaliana [mouse-ear cress]
gb|EMS53267.1|  Ankyrin repeat domain-containing protein 2              418   2e-139   
ref|XP_010515096.1|  PREDICTED: ankyrin repeat domain-containing ...    417   6e-139   
emb|CDY41654.1|  BnaC03g62300D                                          416   7e-139   
ref|XP_004981022.1|  PREDICTED: ankyrin repeat domain-containing ...    417   8e-139   
dbj|BAJ99212.1|  predicted protein                                      415   1e-138   
ref|NP_195270.1|  ankyrin repeat domain-containing protein 2            412   3e-137   Arabidopsis thaliana [mouse-ear cress]
ref|NP_849499.1|  ankyrin repeat domain-containing protein 2            411   3e-137   Arabidopsis thaliana [mouse-ear cress]
gb|EAY77663.1|  hypothetical protein OsI_32702                          411   8e-137   Oryza sativa Indica Group [Indian rice]
ref|XP_009121121.1|  PREDICTED: ankyrin repeat domain-containing ...    411   9e-137   
emb|CDX72536.1|  BnaC07g45580D                                          411   1e-136   
gb|AAC33264.1|  AFT protein                                             412   1e-136   Arabidopsis thaliana [mouse-ear cress]
emb|CDY49426.1|  BnaC07g06450D                                          410   2e-136   
ref|NP_001063647.1|  Os09g0513000                                       410   4e-136   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD34416.1|  putative TGB12K interacting protein 3                  409   5e-136   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010437471.1|  PREDICTED: ankyrin repeat domain-containing ...    409   5e-136   
ref|NP_001140813.1|  ankyrin repeat domain-containing protein 2         410   6e-136   Zea mays [maize]
gb|AAD10949.1|  ankyrin repeat-containing protein 2                     409   7e-136   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006409315.1|  hypothetical protein EUTSA_v10022709mg             411   9e-136   
ref|XP_010909898.1|  PREDICTED: ankyrin repeat domain-containing ...    406   1e-135   
emb|CDY40634.1|  BnaA03g53290D                                          409   1e-135   
ref|XP_010432283.1|  PREDICTED: ankyrin repeat domain-containing ...    408   1e-135   
ref|XP_009138358.1|  PREDICTED: ankyrin repeat domain-containing ...    407   3e-135   
emb|CDY24811.1|  BnaA08g14990D                                          407   4e-135   
ref|NP_001190925.1|  ankyrin repeat domain-containing protein 2         406   9e-135   
ref|XP_002466088.1|  hypothetical protein SORBIDRAFT_01g000990          406   1e-134   Sorghum bicolor [broomcorn]
ref|XP_006650906.1|  PREDICTED: ankyrin repeat domain-containing ...    406   2e-134   
ref|XP_009109291.1|  PREDICTED: ankyrin repeat domain-containing ...    404   7e-134   
emb|CDX69141.1|  BnaC01g03120D                                          404   1e-133   
ref|NP_001051917.1|  Os03g0851700                                       403   2e-133   Oryza sativa Japonica Group [Japonica rice]
gb|ABF99934.1|  Ankyrin repeat domain protein 2, putative, expressed    403   2e-133   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001753287.1|  predicted protein                                  402   5e-133   
ref|XP_009101799.1|  PREDICTED: ankyrin repeat domain-containing ...    402   5e-133   
ref|XP_002983736.1|  hypothetical protein SELMODRAFT_180340             400   8e-133   
emb|CDX75504.1|  BnaA01g01980D                                          401   1e-132   
dbj|BAK07558.1|  predicted protein                                      402   1e-132   
ref|XP_002990522.1|  hypothetical protein SELMODRAFT_185403             399   2e-132   
gb|ABR16551.1|  unknown                                                 394   5e-131   Picea sitchensis
gb|EMT24146.1|  hypothetical protein F775_31155                         395   6e-131   
tpg|DAA52534.1|  TPA: hypothetical protein ZEAMMB73_896450              377   6e-124   
dbj|BAD33145.1|  putative ankyrin domain protein                        367   7e-120   Oryza sativa Japonica Group [Japonica rice]
gb|ABK96395.1|  unknown                                                 362   1e-117   Populus trichocarpa x Populus deltoides
dbj|BAG93777.1|  unnamed protein product                                359   5e-117   Oryza sativa Japonica Group [Japonica rice]
gb|EEC83962.1|  hypothetical protein OsI_30076                          357   1e-115   Oryza sativa Indica Group [Indian rice]
ref|XP_007043144.1|  Ankyrin repeat domain-containing protein 2 i...    353   1e-114   
gb|EEE69079.1|  hypothetical protein OsJ_28115                          354   5e-114   Oryza sativa Japonica Group [Japonica rice]
gb|ACN40670.1|  unknown                                                 345   7e-111   Picea sitchensis
gb|ABK23231.1|  unknown                                                 344   3e-110   Picea sitchensis
gb|KDO50180.1|  hypothetical protein CISIN_1g018578mg                   340   7e-110   
gb|EYU35447.1|  hypothetical protein MIMGU_mgv1a0083451mg               332   7e-108   
ref|XP_003559134.1|  PREDICTED: ankyrin repeat domain-containing ...    329   2e-104   
gb|EAZ29329.1|  hypothetical protein OsJ_13395                          309   8e-97    Oryza sativa Japonica Group [Japonica rice]
gb|AAA80576.1|  possible apospory-associated protein                    291   6e-92    Cenchrus ciliaris [African foxtail grass]
gb|AAL83986.1|  apospory-associated protein                             287   3e-90    Oryza sativa [red rice]
dbj|BAG88211.1|  unnamed protein product                                287   4e-90    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002508384.1|  predicted protein                                  285   1e-87    Micromonas commoda
gb|AFK38221.1|  unknown                                                 279   8e-87    
ref|XP_006429824.1|  hypothetical protein CICLE_v10012463mg             275   6e-85    
ref|XP_001784591.1|  predicted protein                                  269   3e-83    
ref|XP_003062959.1|  predicted protein                                  273   4e-83    
emb|CEF96911.1|  Ankyrin repeat                                         272   1e-82    
gb|AFK36388.1|  unknown                                                 265   2e-82    
ref|XP_001415679.1|  predicted protein                                  266   2e-80    Ostreococcus lucimarinus CCE9901
ref|XP_007508763.1|  predicted protein                                  254   2e-75    
gb|KDO50177.1|  hypothetical protein CISIN_1g018578mg                   247   3e-74    
gb|ABR16530.1|  unknown                                                 242   9e-72    Picea sitchensis
ref|XP_001703461.1|  hypothetical protein CHLREDRAFT_127770             234   5e-68    Chlamydomonas reinhardtii
ref|XP_001703462.1|  hypothetical protein CHLREDRAFT_127770             234   7e-68    Chlamydomonas reinhardtii
gb|EEC83963.1|  hypothetical protein OsI_30078                          221   8e-64    Oryza sativa Indica Group [Indian rice]
pdb|4TUM|A  Chain A, Crystal Structure Of Ankyrin Repeat Domain O...    204   1e-59    
gb|KFM25201.1|  Ankyrin repeat domain-containing protein 2              209   4e-59    
gb|AAP80627.1|AF475105_1  apomixis-associated protein                   201   4e-58    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010040103.1|  PREDICTED: ankyrin repeat domain-containing ...    195   2e-56    
ref|NP_001062378.1|  Os08g0539600                                       196   2e-56    Oryza sativa Japonica Group [Japonica rice]
gb|EMT04865.1|  hypothetical protein F775_19878                         198   2e-55    
dbj|BAJ91053.1|  predicted protein                                      186   8e-53    
tpg|DAA52533.1|  TPA: hypothetical protein ZEAMMB73_896450              188   1e-52    
ref|XP_003074674.1|  ankyrin repeat family protein / AFT protein ...    192   1e-52    
ref|XP_006301730.1|  hypothetical protein CARUB_v10022191mg             165   3e-44    
emb|CAE54081.1|  ankyrin-repeat protein                                 164   6e-44    Fagus sylvatica
ref|XP_003603722.1|  Ankyrin repeat domain-containing protein           169   1e-43    
ref|XP_010507312.1|  PREDICTED: ankyrin repeat domain-containing ...    159   6e-43    
gb|EYU35446.1|  hypothetical protein MIMGU_mgv1a0083452mg               157   2e-41    
ref|XP_001691759.1|  predicted protein                                  147   2e-36    Chlamydomonas reinhardtii
ref|XP_010452180.1|  PREDICTED: ankyrin repeat domain-containing ...    131   1e-31    
ref|XP_002949641.1|  hypothetical protein VOLCADRAFT_120788             123   2e-28    
ref|XP_003603781.1|  Ankyrin repeat domain-containing protein           125   2e-28    
gb|KEH36257.1|  hypothetical protein MTR_3g114110                       124   3e-28    
gb|KEH41753.1|  hypothetical protein MTR_1g054540                       125   3e-28    
ref|XP_003603780.1|  Ankyrin repeat domain-containing protein           124   5e-28    
gb|KEH41766.1|  hypothetical protein MTR_1g054620                       124   6e-28    
gb|KEH41767.1|  hypothetical protein MTR_1g054620                       124   6e-28    
ref|XP_002502361.1|  predicted protein                                  120   5e-27    Micromonas commoda
gb|KEH25793.1|  hypothetical protein MTR_6g034405                       120   1e-26    
gb|KEH25792.1|  hypothetical protein MTR_6g034405                       120   2e-26    
emb|CEG00021.1|  Ankyrin repeat                                         117   2e-26    
ref|XP_003082507.1|  putative ankyrin-repeat protein (ISS)              117   4e-26    
ref|XP_001753203.1|  predicted protein                                  110   2e-25    
ref|XP_005649242.1|  ankyrin                                            110   1e-23    
ref|XP_001695823.1|  flagellar associated protein                       105   9e-22    Chlamydomonas reinhardtii
gb|KEH41763.1|  hypothetical protein MTR_1g054600                       102   3e-21    
gb|KEH41755.1|  hypothetical protein MTR_1g054550                       102   4e-21    
ref|XP_007514863.1|  predicted protein                                  103   8e-21    
ref|XP_010471941.1|  PREDICTED: ankyrin repeat domain-containing ...  97.4    5e-20    
pdb|4HQD|A  Chain A, Crystal Structure Of Engineered Protein. Nor...  94.4    7e-19    
ref|XP_006394994.1|  hypothetical protein EUTSA_v10005721mg           90.5    2e-18    
pdb|4GPM|A  Chain A, Crystal Structure Of Engineered Protein. Nor...  93.2    2e-18    
gb|AGW45418.1|  hypothetical protein                                  89.0    4e-18    
pdb|4HB5|A  Chain A, Crystal Structure Of Engineered Protein. Nor...  92.0    6e-18    
gb|KFM24339.1|  Ankyrin repeat domain-containing protein 2            92.8    1e-17    
ref|XP_001328182.1|  hypothetical protein                             96.3    1e-17    Trichomonas vaginalis G3
pdb|1N0R|A  Chain A, 4ank: A Designed Ankyrin Repeat Protein With...  88.2    4e-17    
ref|XP_006487159.1|  PREDICTED: ankyrin repeat domain-containing ...  87.0    5e-17    
ref|XP_001421038.1|  predicted protein                                84.3    7e-16    Ostreococcus lucimarinus CCE9901
ref|XP_004347155.1|  bromodomain domain containing protein            89.0    3e-15    
pdb|4GMR|A  Chain A, Crystal Structure Of Engineered Protein. Nor...  83.6    4e-15    
ref|XP_005484011.1|  PREDICTED: ankyrin repeat domain-containing ...  87.4    8e-15    
gb|KEH36341.1|  TGB12K interacting protein                            80.9    1e-14    
ref|XP_001469053.1|  putative ankyrin repeat protein                  82.0    2e-14    Leishmania infantum JPCM5
pdb|4HRM|B  Chain B, Structural Basis For Eliciting A Cytotoxic E...  81.6    2e-14    
emb|CCX10138.1|  Similar to Ankyrin repeat domain-containing prot...  81.3    2e-14    
pdb|4HLL|A  Chain A, Crystal Structure Of Artificial Ankyrin Repe...  81.3    3e-14    
gb|KFA63315.1|  hypothetical protein S40285_01859                     85.9    3e-14    
ref|XP_001315403.1|  ankyrin repeat protein                           85.5    3e-14    Trichomonas vaginalis G3
emb|CDJ91582.1|  Pleckstrin homology and Arf GTPase activating pr...  85.5    4e-14    
ref|XP_002738132.1|  PREDICTED: ankyrin repeat and EF-hand domain...  84.7    5e-14    Saccoglossus kowalevskii
ref|XP_008620665.1|  hypothetical protein SDRG_16243                  82.8    5e-14    
ref|XP_002486819.1|  ankyrin repeat-containing protein, putative      85.1    7e-14    Talaromyces stipitatus ATCC 10500
ref|XP_003722660.1|  putative ankyrin repeat protein                  80.1    7e-14    
ref|WP_029520633.1|  hypothetical protein                             80.1    9e-14    
gb|EKC39541.1|  Ankyrin repeat domain-containing protein 39           79.7    1e-13    
ref|XP_006155359.1|  PREDICTED: ankyrin repeat domain-containing ...  82.8    1e-13    
ref|XP_008772242.1|  PREDICTED: ankyrin repeat domain-containing ...  83.2    1e-13    
ref|XP_010702677.1|  ankyrin repeat protein, putative                 79.3    1e-13    
ref|XP_003723231.1|  putative ankyrin repeat protein                  79.3    1e-13    
ref|XP_009527661.1|  hypothetical protein PHYSODRAFT_504685           78.2    1e-13    
ref|XP_003731399.1|  PREDICTED: uncharacterized protein LOC100891178  84.0    2e-13    
emb|CAQ52948.1|  CD4-specific ankyrin repeat protein D2.1             79.0    2e-13    
ref|XP_005872151.1|  PREDICTED: ankyrin repeat domain-containing ...  83.2    2e-13    
gb|KDR21653.1|  Ankyrin-2                                             80.1    2e-13    
gb|KFA73903.1|  hypothetical protein S40288_00891                     83.2    2e-13    
ref|XP_006778324.1|  PREDICTED: ankyrin repeat domain-containing ...  83.2    2e-13    
ref|XP_006222512.2|  PREDICTED: ankyrin repeat domain-containing ...  82.4    2e-13    
emb|CAQ52951.1|  CD4-specific ankyrin repeat protein D5.1             78.6    2e-13    
ref|XP_008772241.1|  PREDICTED: ankyrin repeat domain-containing ...  82.8    2e-13    
ref|XP_001323837.1|  ankyrin repeat protein                           82.8    3e-13    Trichomonas vaginalis G3
gb|KDO22630.1|  TKL protein kinase                                    82.8    3e-13    
ref|XP_008770070.1|  PREDICTED: putative ankyrin repeat domain-co...  82.4    3e-13    
ref|XP_006091864.1|  PREDICTED: ankyrin repeat domain-containing ...  82.4    3e-13    
ref|XP_001583641.1|  ankyrin repeat protein                           82.4    3e-13    Trichomonas vaginalis G3
ref|XP_001325696.1|  ankyrin repeat protein                           78.6    4e-13    Trichomonas vaginalis G3
gb|EAL59787.1|  ankyrin repeat domain protein                         81.3    4e-13    Wolbachia endosymbiont of Drosophila simulans
ref|XP_001782585.1|  predicted protein                                76.6    4e-13    
gb|KFA46967.1|  hypothetical protein S40293_10036                     82.4    4e-13    
gb|KIH61288.1|  ankyrin repeat protein                                77.8    5e-13    
ref|XP_004353890.1|  ankyrin repeat-containing protein                82.4    5e-13    
gb|KEY66210.1|  hypothetical protein S7711_09223                      82.0    5e-13    
ref|WP_007548420.1|  ankyrin                                          81.3    6e-13    
ref|XP_010922600.1|  PREDICTED: receptor-interacting serine/threo...  80.9    6e-13    
ref|XP_009386849.1|  PREDICTED: ankyrin repeat domain-containing ...  77.0    6e-13    
pdb|4JB8|P  Chain P, Caspase-7 In Complex With Darpin C7_16           77.4    7e-13    
gb|AFK33309.1|  unknown                                               78.2    7e-13    
ref|WP_012673053.1|  ankyrin                                          81.3    8e-13    
pdb|2XEE|A  Chain A, Structural Determinants For Improved Thermal...  76.6    8e-13    
gb|EQB52360.1|  hypothetical protein CGLO_08024                       81.6    8e-13    
ref|XP_010146672.1|  PREDICTED: ankyrin repeat and SOCS box prote...  78.2    8e-13    
ref|XP_001325957.1|  ankyrin repeat protein                           80.1    8e-13    Trichomonas vaginalis G3
ref|XP_005986329.1|  PREDICTED: ankyrin repeat and SOCS box prote...  78.6    9e-13    
gb|AFI09262.1|  LmrCD-specific DARPin                                 77.0    9e-13    
ref|XP_001323756.1|  ankyrin repeat protein                           80.9    9e-13    Trichomonas vaginalis G3
ref|XP_010028798.1|  PREDICTED: signal recognition particle 43 kD...  79.7    1e-12    
ref|XP_010806804.1|  PREDICTED: ankyrin repeat domain-containing ...  80.9    1e-12    
ref|XP_008536231.1|  PREDICTED: ankyrin repeat domain-containing ...  80.9    1e-12    
ref|WP_007548441.1|  MULTISPECIES: ankyrin                            78.2    1e-12    
emb|CDJ06036.1|  ankyrin :unc                                         81.3    1e-12    
gb|KFW02176.1|  Ankyrin repeat and SOCS box protein 8                 77.8    1e-12    
emb|CAG07467.1|  unnamed protein product                              78.2    1e-12    Tetraodon nigroviridis
ref|XP_006055407.1|  PREDICTED: ankyrin repeat domain-containing ...  80.5    1e-12    
ref|XP_008300299.1|  PREDICTED: ankyrin repeat and death domain-c...  80.1    1e-12    
ref|WP_022846134.1|  ankyrin                                          79.7    1e-12    
dbj|GAM09214.1|  ankyrin repeat domain-containing protein 29          76.3    1e-12    
ref|XP_001325343.1|  ankyrin repeat protein                           79.7    1e-12    Trichomonas vaginalis G3
ref|XP_010947239.1|  PREDICTED: ankyrin repeat domain-containing ...  80.5    1e-12    
gb|KFO73146.1|  Ankyrin repeat and SOCS box protein 8                 77.8    1e-12    
ref|XP_003963148.1|  PREDICTED: ankyrin repeat and SOCS box prote...  77.8    1e-12    
ref|XP_007834909.1|  hypothetical protein PFICI_08137                 80.5    1e-12    
pdb|1SVX|A  Chain A, Crystal Structure Of A Designed Selected Ank...  76.3    1e-12    
ref|XP_010087522.1|  Serine/threonine-protein phosphatase 6 regul...  79.7    1e-12    
pdb|1N0Q|A  Chain A, 3ank: A Designed Ankyrin Repeat Protein With...  74.3    1e-12    
gb|KCW55615.1|  hypothetical protein EUGRSUZ_I01479                   79.3    1e-12    
emb|CAQ52949.1|  CD4-specific ankyrin repeat protein D3.1             76.3    1e-12    
ref|XP_010006611.1|  PREDICTED: ankyrin repeat and SOCS box prote...  77.4    1e-12    
ref|XP_001309767.1|  ankyrin repeat protein                           80.5    1e-12    
ref|XP_005248740.1|  PREDICTED: ankyrin repeat domain-containing ...  80.1    2e-12    
ref|XP_001301368.1|  ankyrin repeat protein                           77.8    2e-12    
emb|CCQ71000.1|  hypothetical protein CWATWH0402_3736                 75.1    2e-12    
ref|XP_005627689.1|  PREDICTED: ankyrin repeat domain-containing ...  80.1    2e-12    
ref|XP_005596887.1|  PREDICTED: ankyrin repeat domain-containing ...  80.1    2e-12    
ref|XP_009640069.1|  PREDICTED: ankyrin repeat and SOCS box prote...  77.0    2e-12    
ref|XP_007831188.1|  hypothetical protein PFICI_04416                 80.9    2e-12    
ref|XP_009705913.1|  PREDICTED: ankyrin repeat and SOCS box prote...  77.0    2e-12    
ref|XP_009416821.1|  PREDICTED: 26S proteasome non-ATPase regulat...  77.0    2e-12    
ref|XP_010563391.1|  PREDICTED: ankyrin repeat and SOCS box prote...  77.4    2e-12    
pdb|2XEH|A  Chain A, Structural Determinants For Improved Thermal...  75.9    2e-12    
gb|KFU83694.1|  Ankyrin repeat and SOCS box protein 8                 77.0    2e-12    
ref|XP_009449921.1|  PREDICTED: ankyrin repeat domain-containing ...  80.1    2e-12    
ref|XP_009889407.1|  PREDICTED: ankyrin repeat and SOCS box prote...  77.0    2e-12    
gb|EJY57493.1|  AAEL017480-PA                                         78.2    2e-12    
ref|XP_006139131.1|  PREDICTED: ankyrin repeat and SOCS box prote...  77.4    2e-12    
ref|XP_001328994.1|  ankyrin repeat protein                           76.6    2e-12    
gb|EYB84535.1|  hypothetical protein Y032_0314g2218                   77.0    2e-12    
ref|XP_010303154.1|  PREDICTED: ankyrin repeat and SOCS box prote...  77.0    2e-12    
ref|XP_009480000.1|  PREDICTED: ankyrin repeat and SOCS box prote...  77.0    2e-12    
ref|XP_008234958.1|  PREDICTED: ankyrin-3-like                        79.3    2e-12    
ref|XP_010523483.1|  PREDICTED: 26S proteasome non-ATPase regulat...  76.6    2e-12    
ref|XP_001303587.1|  ankyrin repeat protein                           78.2    2e-12    
ref|XP_005233160.1|  PREDICTED: ankyrin repeat and SOCS box prote...  76.6    2e-12    
ref|XP_001314547.1|  ankyrin repeat protein                           78.6    2e-12    
ref|WP_009072270.1|  ankyrin repeat-containing protein                78.6    2e-12    
ref|XP_010332092.1|  PREDICTED: ankyrin repeat domain-containing ...  79.7    2e-12    
gb|KFP68679.1|  Ankyrin repeat and SOCS box protein 8                 76.6    2e-12    
ref|XP_003386203.1|  PREDICTED: tankyrase-2-like                      75.9    2e-12    
ref|XP_009578651.1|  PREDICTED: ankyrin repeat and SOCS box prote...  76.6    2e-12    
gb|KFP18458.1|  Ankyrin repeat and SOCS box protein 8                 76.6    2e-12    
ref|XP_005291955.1|  PREDICTED: ankyrin repeat and SOCS box prote...  77.0    2e-12    
ref|XP_001302479.1|  ankyrin repeat protein                           79.7    2e-12    
gb|EHK44149.1|  putative ankyrin repeat protein                       80.1    2e-12    
ref|WP_012717676.1|  ankyrin                                          78.2    3e-12    
ref|XP_006030658.1|  PREDICTED: ankyrin repeat and SOCS box prote...  75.9    3e-12    
ref|XP_004239075.1|  PREDICTED: 26S proteasome non-ATPase regulat...  76.6    3e-12    
ref|XP_008465712.1|  PREDICTED: 26S proteasome non-ATPase regulat...  76.6    3e-12    
gb|KFV97323.1|  Ankyrin repeat and SOCS box protein 8                 76.6    3e-12    
gb|KFQ47712.1|  Ankyrin repeat and SOCS box protein 8                 76.6    3e-12    
gb|KCW64899.1|  hypothetical protein EUGRSUZ_G02461                   77.4    3e-12    
ref|WP_034933748.1|  hypothetical protein                             75.1    3e-12    
gb|AGD97566.1|  receptor-interacting serine-threonine kinase 4        76.3    3e-12    
gb|KGL98139.1|  Ankyrin repeat and SOCS box protein 8                 76.6    3e-12    
ref|XP_001327512.1|  ankyrin repeat protein                           79.3    3e-12    
ref|XP_010066858.1|  PREDICTED: 26S proteasome non-ATPase regulat...  76.6    3e-12    
gb|KFR03063.1|  Ankyrin repeat and SOCS box protein 8                 76.6    3e-12    
gb|EYB84534.1|  hypothetical protein Y032_0314g2218                   76.6    3e-12    
gb|KFO12023.1|  Ankyrin repeat and SOCS box protein 8                 76.6    3e-12    
ref|XP_008974738.1|  PREDICTED: ankyrin repeat domain-containing ...  79.3    3e-12    
ref|XP_009685814.1|  PREDICTED: ankyrin repeat and SOCS box prote...  76.3    3e-12    
gb|KFM05146.1|  Ankyrin repeat and SOCS box protein 8                 76.6    3e-12    
emb|CAQ52955.1|  CD4-specific ankyrin repeat protein D27.2            75.5    3e-12    
gb|AFI09263.1|  LmrCD-specific DARPin                                 75.5    3e-12    
ref|XP_006822047.1|  PREDICTED: ankyrin repeat domain-containing ...  79.3    3e-12    
ref|XP_004348666.1|  muscle ankyrin repeat protein 3                  79.7    3e-12    
gb|KFQ75671.1|  Ankyrin repeat and SOCS box protein 8                 76.3    3e-12    
ref|XP_002116175.1|  hypothetical protein TRIADDRAFT_7160             75.1    3e-12    
ref|XP_007058580.1|  PREDICTED: ankyrin repeat and SOCS box prote...  76.6    3e-12    
emb|CAQ52952.1|  CD4-specific ankyrin repeat protein D6.1             75.1    3e-12    
ref|XP_005111146.1|  PREDICTED: inversin-like                         79.7    3e-12    
pdb|2Y1L|E  Chain E, Caspase-8 In Complex With Darpin-8.4             75.1    3e-12    
ref|WP_038601855.1|  hypothetical protein                             78.6    4e-12    
gb|KFV74247.1|  Ankyrin repeat and SOCS box protein 8                 76.3    4e-12    
pdb|2V4H|C  Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex          74.3    4e-12    
ref|XP_003214048.1|  PREDICTED: ankyrin repeat and SOCS box prote...  76.3    4e-12    
ref|XP_010207586.1|  PREDICTED: ankyrin repeat and SOCS box prote...  76.3    4e-12    
gb|KFP23794.1|  Ankyrin repeat and SOCS box protein 8                 76.3    4e-12    
gb|EYB84533.1|  hypothetical protein Y032_0314g2218                   77.0    4e-12    
ref|WP_034918186.1|  hypothetical protein                             74.7    4e-12    
ref|XP_005291956.1|  PREDICTED: ankyrin repeat and SOCS box prote...  76.3    4e-12    
ref|XP_010705932.1|  PREDICTED: ankyrin repeat domain-containing ...  79.0    4e-12    
ref|XP_004813624.1|  PREDICTED: ankyrin repeat domain-containing ...  79.0    4e-12    
gb|ETN74158.1|  PH domain protein                                     79.0    4e-12    
gb|AFI09260.1|  LmrCD-specific DARPin                                 75.1    4e-12    
ref|XP_001584189.1|  hypothetical protein                             78.2    4e-12    
ref|XP_006030656.1|  PREDICTED: ankyrin repeat and SOCS box prote...  76.3    4e-12    
gb|ETP04452.1|  hypothetical protein, variant 2                       79.3    4e-12    
gb|ETP32586.1|  hypothetical protein, variant 2                       79.3    5e-12    
gb|AGK33658.1|  receptor-interacting serine-threonine kinase 4        75.5    5e-12    
gb|EXI69256.1|  ankyrin repeat protein                                75.5    5e-12    
gb|ETL87363.1|  hypothetical protein L917_13428                       77.0    5e-12    
gb|ELK00080.1|  Ankyrin repeat domain-containing protein 6            78.6    5e-12    
ref|XP_005111939.1|  PREDICTED: GA-binding protein subunit beta-1...  77.4    5e-12    
ref|WP_020151310.1|  hypothetical protein                             78.2    5e-12    
gb|AGK33596.1|  receptor-interacting serine-threonine kinase 4        75.5    5e-12    
ref|XP_011066300.1|  PREDICTED: ankyrin repeat, PH and SEC7 domai...  78.2    5e-12    
ref|WP_038603808.1|  hypothetical protein                             78.2    5e-12    
ref|XP_001312218.1|  ankyrin repeat protein                           75.9    5e-12    
gb|KFB71011.1|  Phosphocholine transferase AnkX                       75.1    5e-12    
gb|AGK33980.1|  receptor-interacting serine-threonine kinase 4        75.1    6e-12    
ref|XP_001309441.1|  ankyrin repeat protein                           79.0    6e-12    
gb|AGK33637.1|  receptor-interacting serine-threonine kinase 4        75.1    6e-12    
ref|XP_010016208.1|  PREDICTED: ankyrin repeat and SOCS box prote...  75.5    6e-12    
ref|XP_006273398.1|  PREDICTED: ankyrin repeat and SOCS box prote...  75.9    6e-12    
ref|XP_002932471.1|  PREDICTED: ankyrin repeat and SOCS box prote...  75.9    6e-12    
emb|CDS20415.1|  ankyrin :unc                                         79.0    6e-12    
ref|NP_001085435.1|  ankyrin repeat and SOCS box containing 8         75.9    6e-12    
ref|XP_002414454.1|  ankyrin repeat-containing protein                78.6    6e-12    
ref|WP_013386976.1|  ankyrin                                          73.9    6e-12    
gb|KID72228.1|  ankyrin repeat protein                                79.0    6e-12    
pdb|4ATZ|D  Chain D, Ad5 Knob In Complex With A Designed Ankyrin ...  73.9    6e-12    
gb|EYU25253.1|  hypothetical protein MIMGU_mgv1a009364mg              76.6    6e-12    
ref|XP_001300994.1|  ankyrin repeat protein                           78.2    6e-12    
ref|XP_007199816.1|  hypothetical protein PRUPE_ppa005211mg           77.8    7e-12    
ref|XP_009203925.1|  PREDICTED: ankyrin repeat domain-containing ...  78.2    7e-12    
ref|XP_002605142.1|  hypothetical protein BRAFLDRAFT_265772           78.2    7e-12    
emb|CAQ52956.1|  CD4-specific ankyrin repeat protein D29.2            74.3    7e-12    
ref|XP_001311114.1|  ankyrin repeat protein                           78.2    7e-12    
ref|XP_001305451.1|  hypothetical protein                             77.4    7e-12    
ref|WP_012473174.1|  hypothetical protein                             76.6    7e-12    
gb|KCW64900.1|  hypothetical protein EUGRSUZ_G02461                   75.5    7e-12    
gb|KFQ52678.1|  Ankyrin repeat and SOCS box protein 8                 75.1    7e-12    
ref|XP_008119402.1|  PREDICTED: ankyrin repeat and SOCS box prote...  75.9    7e-12    
ref|XP_003384716.1|  PREDICTED: ankyrin-3-like                        78.2    7e-12    
gb|KFK33514.1|  hypothetical protein AALP_AA5G022800                  75.1    7e-12    
gb|EYU25254.1|  hypothetical protein MIMGU_mgv1a009364mg              76.6    8e-12    
gb|AGK33827.1|  receptor-interacting serine-threonine kinase 4        74.7    8e-12    
ref|XP_009619006.1|  PREDICTED: 26S proteasome non-ATPase regulat...  75.1    8e-12    
ref|XP_001581620.1|  ankyrin repeat protein                           77.8    8e-12    
ref|XP_004074046.1|  PREDICTED: serine/threonine-protein phosphat...  78.2    8e-12    
ref|XP_005002681.1|  PREDICTED: ankyrin repeat domain-containing ...  77.8    8e-12    
ref|XP_001326156.1|  ankyrin repeat protein                           77.0    8e-12    
ref|XP_001321690.1|  hypothetical protein                             77.8    8e-12    
gb|EDP74900.1|  ankyrin repeat domain protein                         74.7    8e-12    
gb|ETP38481.1|  hypothetical protein F442_13923                       76.3    8e-12    
gb|ETM40583.1|  hypothetical protein L914_13514                       76.3    8e-12    
gb|KHN75718.1|  Ankyrin-2                                             78.6    8e-12    
pdb|4F6R|D  Chain D, Tubulin:stathmin-Like Domain Complex             73.9    8e-12    
ref|XP_009203931.1|  PREDICTED: ankyrin repeat domain-containing ...  77.8    8e-12    
gb|AGK33964.1|  receptor-interacting serine-threonine kinase 4        74.7    8e-12    
ref|XP_002741541.2|  PREDICTED: transient receptor potential cati...  78.2    8e-12    
gb|AGK33661.1|  receptor-interacting serine-threonine kinase 4        74.3    8e-12    
emb|CEG04030.1|  unnamed protein product                              78.2    8e-12    
gb|AGK33977.1|  receptor-interacting serine-threonine kinase 4        74.7    8e-12    
gb|ETI40529.1|  hypothetical protein F443_14078                       76.3    9e-12    
gb|KFM81130.1|  Tankyrase-1                                           78.2    9e-12    
tpe|CBF88083.1|  TPA: conserved hypothetical protein                  78.2    9e-12    
ref|XP_001303008.1|  ankyrin repeat protein                           75.9    9e-12    
ref|XP_003135685.1|  hypothetical protein LOAG_00097                  77.4    9e-12    
ref|XP_007786961.1|  hypothetical protein EPUS_01633                  78.2    9e-12    
ref|XP_001330303.1|  ankyrin repeat protein                           73.9    9e-12    
ref|XP_007434452.1|  PREDICTED: ankyrin repeat domain-containing ...  78.2    9e-12    
ref|XP_008909571.1|  hypothetical protein PPTG_14779                  76.3    9e-12    
pdb|4J7W|A  Chain A, E3_5 Darpin L86a Mutant                          73.9    9e-12    
ref|WP_015898888.1|  ankyrin domain protein                           74.7    9e-12    
ref|XP_008913181.1|  hypothetical protein PPTG_17222                  76.3    1e-11    
gb|AGK33714.1|  receptor-interacting serine-threonine kinase 4        74.3    1e-11    
ref|XP_001329422.1|  ankyrin repeat protein                           78.2    1e-11    
ref|XP_001309352.1|  hypothetical protein                             77.4    1e-11    
pdb|3NOG|D  Chain D, Designed Ankyrin Repeat Protein (Darpin) Bin...  73.9    1e-11    
ref|XP_009114155.1|  PREDICTED: 26S proteasome non-ATPase regulat...  74.7    1e-11    
gb|AGK33659.1|  receptor-interacting serine-threonine kinase 4        74.3    1e-11    
ref|XP_008804940.1|  PREDICTED: LOW QUALITY PROTEIN: ankyrin repe...  77.0    1e-11    
emb|CDY04153.1|  BnaA09g19310D                                        74.7    1e-11    
ref|XP_001299144.1|  ankyrin repeat protein                           77.0    1e-11    
gb|ETE71703.1|  Ankyrin repeat and SOCS box protein 8                 75.1    1e-11    
gb|KDO19582.1|  TKL protein kinase                                    77.8    1e-11    
ref|XP_003728980.1|  PREDICTED: uncharacterized protein LOC100892969  77.8    1e-11    
ref|XP_004212245.1|  PREDICTED: ankyrin-3-like                        75.1    1e-11    
ref|XP_658734.1|  hypothetical protein AN1130.2                       77.8    1e-11    
ref|XP_009765565.1|  PREDICTED: 26S proteasome non-ATPase regulat...  74.7    1e-11    
gb|ETN62018.1|  hypothetical protein AND_006315                       74.3    1e-11    
ref|XP_008555793.1|  PREDICTED: ankyrin repeat domain-containing ...  73.9    1e-11    
ref|XP_003704452.1|  PREDICTED: ankyrin-3                             77.8    1e-11    
ref|XP_009035996.1|  hypothetical protein AURANDRAFT_7202             72.0    1e-11    
ref|XP_001318225.1|  hypothetical protein                             77.0    1e-11    
ref|XP_001862630.1|  26S proteasome non-ATPase regulatory subunit 10  74.3    1e-11    
ref|XP_001279302.1|  ankyrin repeat protein                           75.5    1e-11    
ref|XP_001313144.1|  ankyrin repeat protein                           73.2    1e-11    
ref|NP_956064.1|  ankyrin repeat and SOCS box protein 8               75.1    1e-11    
gb|AFI09261.1|  LmrCD-specific DARPin                                 73.6    1e-11    
pdb|1MJ0|A  Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein  73.6    1e-11    
ref|XP_007157422.1|  hypothetical protein PHAVU_002G068900g           74.3    1e-11    
gb|KGQ04931.1|  Death-associated protein kinase 1                     77.4    1e-11    
ref|XP_010112700.1|  hypothetical protein L484_020426                 76.6    1e-11    
gb|KDP41272.1|  hypothetical protein JCGZ_15679                       74.3    1e-11    
ref|XP_001330150.1|  ankyrin repeat protein                           75.9    1e-11    
pdb|3NOC|D  Chain D, Designed Ankyrin Repeat Protein (Darpin) Bin...  73.6    1e-11    
ref|XP_008294785.1|  PREDICTED: ankyrin repeat and SOCS box prote...  75.1    1e-11    
gb|AGK33786.1|  receptor-interacting serine-threonine kinase 4        73.9    1e-11    
ref|XP_007556759.1|  PREDICTED: ankyrin repeat and SOCS box prote...  75.1    1e-11    
ref|XP_008308563.1|  PREDICTED: ankyrin repeat and death domain-c...  76.6    1e-11    
ref|XP_008411779.1|  PREDICTED: ankyrin repeat and SOCS box prote...  74.7    1e-11    
ref|XP_001323196.1|  ankyrin repeat protein                           74.7    1e-11    
ref|XP_005067228.1|  PREDICTED: ankyrin repeat and SOCS box prote...  74.7    1e-11    
ref|XP_004558753.1|  PREDICTED: ankyrin repeat and SOCS box prote...  74.7    1e-11    
ref|XP_003448195.1|  PREDICTED: ankyrin repeat and SOCS box prote...  74.7    1e-11    
ref|XP_007045934.1|  Ankyrin repeat family protein                    74.3    2e-11    
gb|AGK33972.1|  receptor-interacting serine-threonine kinase 4        73.9    2e-11    
gb|AGD97648.1|  receptor-interacting serine-threonine kinase 4        73.9    2e-11    
ref|XP_003512950.1|  PREDICTED: ankyrin repeat and SOCS box prote...  74.7    2e-11    
ref|XP_007424844.1|  PREDICTED: ankyrin repeat and SOCS box prote...  74.7    2e-11    
pdb|4DUI|A  Chain A, Darpin D1 Binding To Tubulin Beta Chain (not...  73.2    2e-11    
ref|WP_006475485.1|  ankyrin                                          74.7    2e-11    
ref|NP_001141239.1|  Tankyrase 2                                      72.8    2e-11    
ref|XP_010746686.1|  PREDICTED: ankyrin repeat and SOCS box prote...  74.7    2e-11    
gb|AEK98013.1|  receptor-interacting serine-threonine kinase 4        73.9    2e-11    
ref|XP_001323779.1|  ankyrin repeat protein                           77.0    2e-11    
gb|AFI09265.1|  LmrCD-specific DARPin                                 73.2    2e-11    
gb|AGK33587.1|  receptor-interacting serine-threonine kinase 4        73.6    2e-11    
ref|XP_006348714.1|  PREDICTED: 26S proteasome non-ATPase regulat...  73.9    2e-11    
ref|WP_005963124.1|  ankyrin                                          75.1    2e-11    
gb|EGW14134.1|  Ankyrin repeat and SOCS box protein 8                 74.3    2e-11    
ref|XP_001304616.1|  ankyrin repeat protein                           76.6    2e-11    
emb|CCC50824.1|  putative ankyrin repeat protein                      72.8    2e-11    
ref|XP_009079343.1|  PREDICTED: ankyrin repeat and SOCS box prote...  74.3    2e-11    
gb|AGK33647.1|  receptor-interacting serine-threonine kinase 4        73.6    2e-11    
ref|XP_001319270.1|  ankyrin repeat protein                           72.0    2e-11    
ref|XP_008316419.1|  PREDICTED: ankyrin repeat and SOCS box prote...  74.3    2e-11    
ref|XP_001329732.1|  ankyrin repeat protein                           76.3    2e-11    



>gb|AIY62316.1| ankyrin repeat domain containing protein 2 [Nicotiana benthamiana]
Length=350

 Score =   522 bits (1345),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 279/350 (80%), Positives = 304/350 (87%), Gaps = 3/350 (1%)
 Frame = -1

Query  1411  MSQEEKNLPAQKQDEKSGAADSKKPLESTSLDTQS--gqggaplaagpGMHNPFDFSAMT  1238
             MS+ EK LP    DEKSGA+++K   ES+S +  S   +  +  AAG G+ NPFDFSAM+
Sbjct  1     MSEGEKVLPTASADEKSGASENKISSESSSTEAPSGEARTTSTAAAGAGLQNPFDFSAMS  60

Query  1237  GLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQNP  1058
             GLLNDPSIKELAEQIAKDP+F QMAEQLQ+TFQGAA  + +P FD QQYY TMQQVMQNP
Sbjct  61    GLLNDPSIKELAEQIAKDPAFNQMAEQLQKTFQGAAVEESVPNFDSQQYYSTMQQVMQNP  120

Query  1057  QFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGP  878
             QFMTMAERLGNALMQDPSMS MLESLSNPAQK+Q+EERMARIKEDPSLKPILEEIE GGP
Sbjct  121   QFMTMAERLGNALMQDPSMSGMLESLSNPAQKEQIEERMARIKEDPSLKPILEEIESGGP  180

Query  877   AAMMRYWNDKDVLKKLGEAMGFPgagetatsget-gtdeaeeasedeSIVHHCASVGDEE  701
             AAMMRYWND++ LKK+GEAMGF   GE ATS    GTDE EEA+EDES+VH CASVGD E
Sbjct  181   AAMMRYWNDQETLKKIGEAMGFAAGGEGATSSAIPGTDETEEANEDESVVHQCASVGDAE  240

Query  700   GLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAA  521
             GLK AL AGADKDEEDSEGRTALHFACGYGEVKCAQILLE+GAKVDALDKNKNTALHYAA
Sbjct  241   GLKAALTAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGAKVDALDKNKNTALHYAA  300

Query  520   GYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             GYGRKECVALLLENGAAVTLQN+DGKTPI+VAKLNNQ +VLKLLEKD FL
Sbjct  301   GYGRKECVALLLENGAAVTLQNLDGKTPIDVAKLNNQQEVLKLLEKDVFL  350



>gb|AAO91861.1| TGB12K interacting protein 2 [Nicotiana tabacum]
Length=349

 Score =   518 bits (1334),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 277/349 (79%), Positives = 308/349 (88%), Gaps = 2/349 (1%)
 Frame = -1

Query  1411  MSQEEKNLPAQ-KQDEKSGAADSKKPLESTSLDTQSgqggaplaagpGMHNPFDFSAMTG  1235
             MS+ +K +PA  K+DEK G+++SK+  ES S + Q+G+     AA  G+ NPFDFSAMTG
Sbjct  1     MSEADKVVPAAAKEDEKPGSSESKRSSESASTEAQTGETRPTSAAAAGLQNPFDFSAMTG  60

Query  1234  LLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQNPQ  1055
             LLNDPSIKELAEQIAKDPSF QMAEQLQ+TFQGAA  +GIP FD QQYY TMQQVMQNPQ
Sbjct  61    LLNDPSIKELAEQIAKDPSFNQMAEQLQKTFQGAAVEEGIPNFDSQQYYSTMQQVMQNPQ  120

Query  1054  FMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPA  875
             FMTMAERLG+ALMQDPSMS MLE+L+NP+QK+Q+EERMARIKEDPSLKPILEEIE GGPA
Sbjct  121   FMTMAERLGSALMQDPSMSGMLENLTNPSQKNQIEERMARIKEDPSLKPILEEIESGGPA  180

Query  874   AMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtd-eaeeasedeSIVHHCASVGDEEG  698
             AMMRYWND+DVLKKLGEAMGF   GE ATS       E E+A+EDES+VH CASVGD EG
Sbjct  181   AMMRYWNDQDVLKKLGEAMGFAVVGEGATSAGVSGTDETEDANEDESVVHQCASVGDAEG  240

Query  697   LKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAG  518
             LK+A+A GADKDEEDSEGRTALHFACGYGEVKCAQ+LLE+GAKVDALDKNKNTALHYAAG
Sbjct  241   LKSAIATGADKDEEDSEGRTALHFACGYGEVKCAQVLLEAGAKVDALDKNKNTALHYAAG  300

Query  517   YGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             YGRKECVALLLENGAAVTLQN+DGKTPI+VAKLNNQN+VLKLLEKDAFL
Sbjct  301   YGRKECVALLLENGAAVTLQNLDGKTPIDVAKLNNQNEVLKLLEKDAFL  349



>gb|AAO91862.1| TGB12K interacting protein 3 [Nicotiana tabacum]
Length=348

 Score =   517 bits (1332),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 278/348 (80%), Positives = 309/348 (89%), Gaps = 1/348 (0%)
 Frame = -1

Query  1411  MSQEEKNLPAQKQDEKSGAADSKKPLESTSLDTQSgqggaplaagpGMHNPFDFSAMTGL  1232
             MS+ +K +PA K+DEK G+++SK+  ES S +  +G+     AA  G+ NPFDFSAMTGL
Sbjct  1     MSEADKVVPAAKEDEKPGSSESKRSSESASTEALTGETRPTSAAAAGLQNPFDFSAMTGL  60

Query  1231  LNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQNPQF  1052
             LNDPSIKELAEQIAKDPSF QMAEQLQ+TFQGAA  + IP FD QQYY TMQQVMQNPQF
Sbjct  61    LNDPSIKELAEQIAKDPSFNQMAEQLQKTFQGAAVEESIPNFDSQQYYSTMQQVMQNPQF  120

Query  1051  MTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAA  872
             MTMAE+LG+ALMQDPSMSSMLE+L+NP+QK+Q+EERMARIKEDPSLKPILEEIE GGPAA
Sbjct  121   MTMAEQLGSALMQDPSMSSMLENLTNPSQKNQIEERMARIKEDPSLKPILEEIESGGPAA  180

Query  871   MMRYWNDKDVLKKLGEAMGFPgagetatsgetgt-deaeeasedeSIVHHCASVGDEEGL  695
             MMRYWND+DVLKKLGEAMGF  AGE ATS      DE EEA+EDES+VH CASVGD EGL
Sbjct  181   MMRYWNDQDVLKKLGEAMGFAVAGEGATSAGVSGPDETEEANEDESVVHQCASVGDAEGL  240

Query  694   KNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGY  515
             KNA+A GADKDEEDSEGRTALHFACGYGEVKCAQ+LLE+GAKVDALDKNKNTALHYAAGY
Sbjct  241   KNAIATGADKDEEDSEGRTALHFACGYGEVKCAQVLLEAGAKVDALDKNKNTALHYAAGY  300

Query  514   GRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             GRKECVALLLENGAAVT+QN+DGKTPI+VAKLNNQN+VLKLLEKDAFL
Sbjct  301   GRKECVALLLENGAAVTVQNLDGKTPIDVAKLNNQNEVLKLLEKDAFL  348



>gb|AAN63819.1| ankyrin domain protein [Nicotiana tabacum]
Length=350

 Score =   513 bits (1322),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 282/350 (81%), Positives = 305/350 (87%), Gaps = 3/350 (1%)
 Frame = -1

Query  1411  MSQEEKNLPAQKQDEKSGAADSKKPLESTSLDTQS--gqggaplaagpGMHNPFDFSAMT  1238
             MS+ EK LP    DEKSGA+++KK  ES+S +  S   +  +  AAG G+ NPFDFSAM+
Sbjct  1     MSEGEKVLPTASADEKSGASENKKSSESSSTEAPSGEARTTSTAAAGAGLQNPFDFSAMS  60

Query  1237  GLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQNP  1058
             GLLNDPSIKELAEQIAKDP+F QMAEQLQ+TFQGAA  + +P FD QQYY TMQQVMQNP
Sbjct  61    GLLNDPSIKELAEQIAKDPAFNQMAEQLQKTFQGAAVEESVPNFDSQQYYSTMQQVMQNP  120

Query  1057  QFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGP  878
             QFMTMAERLGNALMQDPSMS MLESLSNPAQK+Q+EERMARIKEDPSLKPILEEIE GGP
Sbjct  121   QFMTMAERLGNALMQDPSMSGMLESLSNPAQKEQIEERMARIKEDPSLKPILEEIESGGP  180

Query  877   AAMMRYWNDKDVLKKLGEAMGFPgagetatsget-gtdeaeeasedeSIVHHCASVGDEE  701
             AAMMRYWND++ LKK+GEAMGF   GE ATS    GTDE EEASEDES+VH CASVGD E
Sbjct  181   AAMMRYWNDQETLKKIGEAMGFAAGGEGATSSAIPGTDETEEASEDESVVHQCASVGDAE  240

Query  700   GLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAA  521
             GLK AL AGADKDEEDSEGRTALHFACGYGEVKCAQILLE+GAKVDALDKNKNTALHYAA
Sbjct  241   GLKAALTAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGAKVDALDKNKNTALHYAA  300

Query  520   GYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             GYGRKECVALLLENGAAVTLQNMDGKTPI+VAKLNNQ +VLKLLEKD FL
Sbjct  301   GYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNNQQEVLKLLEKDVFL  350



>emb|CDO97545.1| unnamed protein product [Coffea canephora]
Length=369

 Score =   513 bits (1322),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 270/346 (78%), Positives = 302/346 (87%), Gaps = 4/346 (1%)
 Frame = -1

Query  1396  KNLPAQKQDEKSGAADSKKPLESTSLDTQSgqggaplaagpG---MHNPFDFSAMTGLLN  1226
             K+ P+   +EK+GA ++K   ESTS++TQS Q  A          + NPFDFSAMTGLLN
Sbjct  24    KDAPSPAAEEKAGAMENKPSSESTSVETQSEQRRATTTTSAAGVPLQNPFDFSAMTGLLN  83

Query  1225  DPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQNPQFMT  1046
             DPSIKELAEQIAKDPSF QMAEQLQ+TFQG + ++GIPQFD QQYY TMQQVMQNPQFMT
Sbjct  84    DPSIKELAEQIAKDPSFNQMAEQLQKTFQGTSVDEGIPQFDTQQYYTTMQQVMQNPQFMT  143

Query  1045  MAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAAMM  866
             MAERLGNALMQDPSMSSMLE+L+NP  KDQLEERM+RIKEDPSLKPIL+EIE GGPAAMM
Sbjct  144   MAERLGNALMQDPSMSSMLENLTNPVHKDQLEERMSRIKEDPSLKPILDEIETGGPAAMM  203

Query  865   RYWNDKDVLKKLGEAMGFPgage-tatsgetgtdeaeeasedeSIVHHCASVGDEEGLKN  689
             RYWNDK+VL+KLGEAMGF  AGE  +++     DEAEEA+EDESIVHH AS+GD + LKN
Sbjct  204   RYWNDKEVLQKLGEAMGFAVAGEPGSSADNAEPDEAEEANEDESIVHHTASIGDVDRLKN  263

Query  688   ALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGR  509
             ALAAGADKDEEDSEGRTALHFACGYGE KCAQ+LLE+GAKVDALDKNKNTALHYAAGYGR
Sbjct  264   ALAAGADKDEEDSEGRTALHFACGYGEAKCAQVLLEAGAKVDALDKNKNTALHYAAGYGR  323

Query  508   KECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             KECV LLLE+GAAVTLQN+DGKTPI+VAKLNNQ++VLKLLEKDAFL
Sbjct  324   KECVQLLLEHGAAVTLQNLDGKTPIDVAKLNNQHEVLKLLEKDAFL  369



>ref|XP_009800016.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Nicotiana 
sylvestris]
Length=350

 Score =   513 bits (1320),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 282/350 (81%), Positives = 305/350 (87%), Gaps = 3/350 (1%)
 Frame = -1

Query  1411  MSQEEKNLPAQKQDEKSGAADSKKPLESTSLDTQS--gqggaplaagpGMHNPFDFSAMT  1238
             MS+ EK LP    DEKSGA+++KK  ES+S +  S   +  +  AAG G+ NPFDFSAM+
Sbjct  1     MSEGEKVLPTASADEKSGASENKKSSESSSTEAPSGEARTTSTDAAGAGLQNPFDFSAMS  60

Query  1237  GLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQNP  1058
             GLLNDPSIKELAEQIAKDP+F QMAEQLQ+TFQGAA  + +P FD QQYY TMQQVMQNP
Sbjct  61    GLLNDPSIKELAEQIAKDPAFNQMAEQLQKTFQGAAVEESVPNFDSQQYYSTMQQVMQNP  120

Query  1057  QFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGP  878
             QFMTMAERLGNALMQDPSMS MLESLSNPAQK+Q+EERMARIKEDPSLKPILEEIE GGP
Sbjct  121   QFMTMAERLGNALMQDPSMSGMLESLSNPAQKEQIEERMARIKEDPSLKPILEEIESGGP  180

Query  877   AAMMRYWNDKDVLKKLGEAMGFPgagetatsget-gtdeaeeasedeSIVHHCASVGDEE  701
             AAMMRYWND++ LKK+GEAMGF   GE ATS    GTDE EEASEDES+VH CASVGD E
Sbjct  181   AAMMRYWNDQETLKKIGEAMGFAAGGEGATSSAIPGTDETEEASEDESVVHQCASVGDAE  240

Query  700   GLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAA  521
             GLK AL AGADKDEEDSEGRTALHFACGYGEVKCAQILLE+GAKVDALDKNKNTALHYAA
Sbjct  241   GLKAALTAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGAKVDALDKNKNTALHYAA  300

Query  520   GYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             GYGRKECVALLLENGAAVTLQNMDGKTPI+VAKLNNQ +VLKLLEKD FL
Sbjct  301   GYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNNQQEVLKLLEKDVFL  350



>ref|XP_009618229.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Nicotiana 
tomentosiformis]
 gb|AAK18619.1|AF352797_1 ankyrin-repeat protein HBP1 [Nicotiana tabacum]
 gb|ACR78152.1| NTHK1-interacting protein 2 [Nicotiana tabacum]
Length=350

 Score =   511 bits (1317),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 280/350 (80%), Positives = 305/350 (87%), Gaps = 3/350 (1%)
 Frame = -1

Query  1411  MSQEEKNLPAQKQDEKSGAADSKKPLESTSLDTQS--gqggaplaagpGMHNPFDFSAMT  1238
             MS+ EK LP    DEKSGA+++KK  ES+S +  S   +  +  AAG G+ NPFDFSAM+
Sbjct  1     MSEGEKVLPTASADEKSGASENKKSSESSSTEAPSGEARTTSTAAAGAGLQNPFDFSAMS  60

Query  1237  GLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQNP  1058
             GLLNDPSIKELAEQIAKDP+F QMAEQLQ+TFQGAA  + +P FD QQYY TMQQVMQNP
Sbjct  61    GLLNDPSIKELAEQIAKDPAFNQMAEQLQKTFQGAAVEESVPNFDSQQYYSTMQQVMQNP  120

Query  1057  QFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGP  878
             QFMTMAERLGNALMQDPSMS MLESLSNPAQK+Q+EERMARIKEDPSLKPILEEIE GGP
Sbjct  121   QFMTMAERLGNALMQDPSMSGMLESLSNPAQKEQIEERMARIKEDPSLKPILEEIESGGP  180

Query  877   AAMMRYWNDKDVLKKLGEAMGFPgagetatsget-gtdeaeeasedeSIVHHCASVGDEE  701
             AAMMRYWND++ LKK+GEAMGF   GE ATS    GTDE EEA+EDES+VH CASVGD E
Sbjct  181   AAMMRYWNDQETLKKIGEAMGFAAGGEGATSSAIPGTDETEEANEDESVVHQCASVGDAE  240

Query  700   GLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAA  521
             GLK AL AGADKDEEDSEGRTALHFACGYGEVKCAQILLE+GAKVDALDKNKNTALHYAA
Sbjct  241   GLKAALTAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGAKVDALDKNKNTALHYAA  300

Query  520   GYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             GYGRKECVALLLENGAAVTLQN+DGKTPI+VAKLNNQ +VLKLLEKD FL
Sbjct  301   GYGRKECVALLLENGAAVTLQNLDGKTPIDVAKLNNQQEVLKLLEKDVFL  350



>ref|XP_009616704.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Nicotiana 
tomentosiformis]
Length=348

 Score =   510 bits (1313),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 276/348 (79%), Positives = 306/348 (88%), Gaps = 1/348 (0%)
 Frame = -1

Query  1411  MSQEEKNLPAQKQDEKSGAADSKKPLESTSLDTQSgqggaplaagpGMHNPFDFSAMTGL  1232
             MS+ +K +PA K+DEK G+++SKK  ES S +  +G+     AA  G+ NPFDFSAMTGL
Sbjct  1     MSEADKVVPAAKEDEKPGSSESKKSSESASTEALTGETRPTSAAAAGLQNPFDFSAMTGL  60

Query  1231  LNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQNPQF  1052
             LNDPSIKELAEQIAKDPSF QMAEQLQ+TF GAA  + IP FD QQYY TMQQVMQNPQF
Sbjct  61    LNDPSIKELAEQIAKDPSFNQMAEQLQKTFHGAAVEESIPNFDSQQYYSTMQQVMQNPQF  120

Query  1051  MTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAA  872
             MTMAE+LG+ALMQDPSMSSMLE+L+NP+QK+Q+EERMA IKEDPSLKPILEEIE GGPAA
Sbjct  121   MTMAEQLGSALMQDPSMSSMLENLTNPSQKNQIEERMAHIKEDPSLKPILEEIESGGPAA  180

Query  871   MMRYWNDKDVLKKLGEAMGFPgagetatsgetgt-deaeeasedeSIVHHCASVGDEEGL  695
             MMRYWND+DVLKKLGEAMGF  AGE ATS      DE EEA+EDES+VH CASVGD EGL
Sbjct  181   MMRYWNDQDVLKKLGEAMGFAVAGEGATSAGVSGPDETEEANEDESVVHQCASVGDAEGL  240

Query  694   KNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGY  515
             KNA+A GADKDEEDSEGRTALHFACGYGEVKCAQ+LLE+GAKVDALDKNKNTALHYAAGY
Sbjct  241   KNAIATGADKDEEDSEGRTALHFACGYGEVKCAQVLLEAGAKVDALDKNKNTALHYAAGY  300

Query  514   GRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             GRKECVALLLENGAAVT+QN+DGKTPI+VAKLNNQ +VLKLLEKDAFL
Sbjct  301   GRKECVALLLENGAAVTVQNLDGKTPIDVAKLNNQKEVLKLLEKDAFL  348



>gb|ADB57050.1| ankyrin repeat-containing protein [Nicotiana tabacum]
Length=350

 Score =   509 bits (1311),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 281/350 (80%), Positives = 305/350 (87%), Gaps = 3/350 (1%)
 Frame = -1

Query  1411  MSQEEKNLPAQKQDEKSGAADSKKPLESTSLDTQS--gqggaplaagpGMHNPFDFSAMT  1238
             MS+ EK LP    +EKSGA+++KK  ES+S +T S   +  +  AAG G+ NPFDFSAM+
Sbjct  1     MSEGEKVLPTASABEKSGASENKKSSESSSTETPSGEARTTSTAAAGAGLQNPFDFSAMS  60

Query  1237  GLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQNP  1058
             GLLNDPSIKELAEQI KDP+F QMAEQLQ+TFQGAA  + +P FD QQYY TMQQVMQNP
Sbjct  61    GLLNDPSIKELAEQITKDPAFNQMAEQLQKTFQGAAVEESVPNFDSQQYYSTMQQVMQNP  120

Query  1057  QFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGP  878
             QFMTMAERLGNALMQDPSMS MLESLSNPAQK+Q+EERMARIKEDPSLKPILEEIE GGP
Sbjct  121   QFMTMAERLGNALMQDPSMSGMLESLSNPAQKEQIEERMARIKEDPSLKPILEEIESGGP  180

Query  877   AAMMRYWNDKDVLKKLGEAMGFPgagetatsget-gtdeaeeasedeSIVHHCASVGDEE  701
             AAMMRYWND++ LKK+GEAMGF   GE ATS    GTDE EEASEDES+VH CASVGD E
Sbjct  181   AAMMRYWNDQETLKKIGEAMGFAAGGEGATSSAIPGTDETEEASEDESVVHQCASVGDAE  240

Query  700   GLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAA  521
             GLK AL AGADKDEEDSEGRTALHFACGYGEVKCAQILLE+GAKVDALDKNKNTALHYAA
Sbjct  241   GLKAALTAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGAKVDALDKNKNTALHYAA  300

Query  520   GYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             GYGRKECVALLLENGAAVTLQNMDGKTPI+VAKLNNQ +VLKLLEKD FL
Sbjct  301   GYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNNQQEVLKLLEKDVFL  350



>gb|KDP47058.1| hypothetical protein JCGZ_10785 [Jatropha curcas]
Length=350

 Score =   507 bits (1305),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 273/351 (78%), Positives = 304/351 (87%), Gaps = 8/351 (2%)
 Frame = -1

Query  1408  SQEEKNLPAQKQDEKSGAADSKKPLESTS-LDTQSgqggaplaagpGMH--NPFDFSAMT  1238
             S   K++P+   DEK+G+ +SK P   TS  ++Q+GQG +P  AG G    NPFDFSAM+
Sbjct  3     SNSNKDVPS---DEKTGSTESKNPKSETSPAESQAGQGRSPPPAGAGFATPNPFDFSAMS  59

Query  1237  GLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQNP  1058
             GLLNDPSIK+LAEQIAKDP+F QMAEQL +T QG  +++GIPQFD QQYY TMQQVMQNP
Sbjct  60    GLLNDPSIKDLAEQIAKDPAFNQMAEQLHKTLQGVGADEGIPQFDSQQYYSTMQQVMQNP  119

Query  1057  QFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGP  878
             QFMTMAERLGNALMQDPSMS M ESL+NP+QKDQ+EERMARIKEDPSLKPILEEIE GGP
Sbjct  120   QFMTMAERLGNALMQDPSMSQMFESLANPSQKDQIEERMARIKEDPSLKPILEEIENGGP  179

Query  877   AAMMRYWNDKDVLKKLGEAMGFPgagetatsget--gtdeaeeasedeSIVHHCASVGDE  704
             AAMMRYWNDKDVL+KLGEAMG   +GE ATS E     +  E  +EDESIVHHCASVGD 
Sbjct  180   AAMMRYWNDKDVLQKLGEAMGLAVSGEAATSAENPGQDEAEEAGNEDESIVHHCASVGDV  239

Query  703   EGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYA  524
             EGLKNALA+GADKDEEDSEGRTALHFACGYGEVKCAQIL+E+GA VDALDKNKNTALHYA
Sbjct  240   EGLKNALASGADKDEEDSEGRTALHFACGYGEVKCAQILVEAGATVDALDKNKNTALHYA  299

Query  523   AGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             AGYGRKECVALLLENGAAVTLQN+DGKTPI+VAKLNNQ++VLKLLEKDAFL
Sbjct  300   AGYGRKECVALLLENGAAVTLQNLDGKTPIDVAKLNNQHEVLKLLEKDAFL  350



>ref|XP_011040859.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Populus 
euphratica]
 ref|XP_011040860.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Populus 
euphratica]
 ref|XP_011040861.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Populus 
euphratica]
 ref|XP_011040862.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Populus 
euphratica]
Length=365

 Score =   507 bits (1305),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 254/300 (85%), Positives = 272/300 (91%), Gaps = 2/300 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAMTGLLNDPSIKELAEQI+KDPSF QMAEQLQ+TFQGAA+ D IP FD QQYY 
Sbjct  66    NPFDFSAMTGLLNDPSIKELAEQISKDPSFNQMAEQLQKTFQGAAAEDAIPNFDTQQYYS  125

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFMTMAERLGNALMQDPSMS MLES +NP+QKDQ+EERM RI+EDPSLKPI
Sbjct  126   TMQQVMQNPQFMTMAERLGNALMQDPSMSQMLESFTNPSQKDQIEERMTRIREDPSLKPI  185

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetg--tdeaeeasedeSIV  731
             LEEIE GGPAAMMRYWNDKDVL+KLGEAMG   + E  TS ET    +  E  +ED+S+V
Sbjct  186   LEEIESGGPAAMMRYWNDKDVLQKLGEAMGLAVSEEAGTSVETSGHEEAEEAGNEDDSVV  245

Query  730   HHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDK  551
             HHCASVGD EGLKNALA+GADKDEEDSEGRTALHF+CGYGEVKCAQILLE+GA VDALDK
Sbjct  246   HHCASVGDVEGLKNALASGADKDEEDSEGRTALHFSCGYGEVKCAQILLEAGATVDALDK  305

Query  550   NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPI+VAKLNNQ +VLKLLEKDAFL
Sbjct  306   NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNNQQEVLKLLEKDAFL  365



>ref|XP_011092354.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Sesamum 
indicum]
Length=348

 Score =   506 bits (1302),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 266/348 (76%), Positives = 288/348 (83%), Gaps = 1/348 (0%)
 Frame = -1

Query  1411  MSQEEKNLPAQKQDEKSGAADSKKPLESTSLDTQSgqggaplaagpGMHNPFDFSAMTGL  1232
             MS+  K  PA     KS AA SK P+ES S  T SGQ  A  A+  GM NPFDFSAMTGL
Sbjct  1     MSEAVKTPPASADGNKSDAAGSKTPVESASAGTPSGQRTATPASVAGMPNPFDFSAMTGL  60

Query  1231  LNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQNPQF  1052
             LNDPSI ELAEQIAKDP+F QMAEQLQ+TFQGA   DGIP FD QQYY TMQQVMQNPQF
Sbjct  61    LNDPSIMELAEQIAKDPAFNQMAEQLQKTFQGAPVEDGIPNFDTQQYYSTMQQVMQNPQF  120

Query  1051  MTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAA  872
             MTMAERLGNALMQDPSMS MLESL+NP  K+QLEERM+RIKEDPSLKPILEEIE GGPAA
Sbjct  121   MTMAERLGNALMQDPSMSGMLESLTNPTNKEQLEERMSRIKEDPSLKPILEEIENGGPAA  180

Query  871   MMRYWNDKDVLKKLGEAMGFPga-getatsgetgtdeaeeasedeSIVHHCASVGDEEGL  695
             MMRYWNDK+VL+KLGEAMGF       +     G D  EE +++ESIVHH AS+GD EGL
Sbjct  181   MMRYWNDKEVLQKLGEAMGFAVGDTAASAGDVAGEDGTEEVNDEESIVHHTASIGDVEGL  240

Query  694   KNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGY  515
             K ALA GADKDEEDSEGRTALHFACGYGEVKCAQ+LLE+GAKVD LDKNKNT LHYAAGY
Sbjct  241   KGALADGADKDEEDSEGRTALHFACGYGEVKCAQVLLEAGAKVDGLDKNKNTPLHYAAGY  300

Query  514   GRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             GRK+CV LLL+NGAAVTLQN+D KTPI+VAKLNNQN+VL LLEKDAFL
Sbjct  301   GRKDCVELLLKNGAAVTLQNLDEKTPIDVAKLNNQNEVLTLLEKDAFL  348



>emb|CDN40974.1| Ankyrin repeat domain containing protein [Nicotiana benthamiana]
Length=349

 Score =   505 bits (1301),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 279/350 (80%), Positives = 304/350 (87%), Gaps = 4/350 (1%)
 Frame = -1

Query  1411  MSQEEKNLPAQKQDEKSGAADSKKPLESTSLDTQS--gqggaplaagpGMHNPFDFSAMT  1238
             MS+ EK LP    D KSGA+++KK  ES+S +  S   +  +  AAG G+ NPFDFSAM+
Sbjct  1     MSEGEKVLPTASAD-KSGASENKKSSESSSTEAPSGEARTTSTAAAGAGLQNPFDFSAMS  59

Query  1237  GLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQNP  1058
             GLLNDPSIKELAEQIAKDP+F QMAEQLQ+TFQGAA  + +P FD QQYY TMQQVMQNP
Sbjct  60    GLLNDPSIKELAEQIAKDPAFNQMAEQLQKTFQGAAVEESVPNFDSQQYYSTMQQVMQNP  119

Query  1057  QFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGP  878
             QFMTMAERLGNALMQDPSMS MLESLSNPAQK+Q+EERMARIKEDPSLKPILEEIE GGP
Sbjct  120   QFMTMAERLGNALMQDPSMSGMLESLSNPAQKEQIEERMARIKEDPSLKPILEEIESGGP  179

Query  877   AAMMRYWNDKDVLKKLGEAMGFPgagetatsget-gtdeaeeasedeSIVHHCASVGDEE  701
             AAMMRYWND++ LKK+GEAMGF   GE ATS    GTDE EEA+EDES+VH CASVGD E
Sbjct  180   AAMMRYWNDQETLKKIGEAMGFAAGGEGATSSAIPGTDETEEANEDESVVHQCASVGDAE  239

Query  700   GLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAA  521
             GLK AL AGADKDEEDSEGRTALHFACGYGEVKCAQILLE+GAKVDALDKNKNTALHYAA
Sbjct  240   GLKAALTAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGAKVDALDKNKNTALHYAA  299

Query  520   GYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             GYGRKECVALLLENGAAVTLQN+DGKTPI+VAKLNNQ +VLKLLEKD FL
Sbjct  300   GYGRKECVALLLENGAAVTLQNLDGKTPIDVAKLNNQEEVLKLLEKDVFL  349



>ref|XP_007201892.1| hypothetical protein PRUPE_ppa007612mg [Prunus persica]
 gb|EMJ03091.1| hypothetical protein PRUPE_ppa007612mg [Prunus persica]
Length=361

 Score =   505 bits (1301),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 250/300 (83%), Positives = 272/300 (91%), Gaps = 2/300 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAMTGLLNDPSIKELAEQIAKDPSF QMA+QLQ+TFQGA  ++G+PQFD QQYY 
Sbjct  62    NPFDFSAMTGLLNDPSIKELAEQIAKDPSFNQMADQLQKTFQGATIDEGVPQFDSQQYYS  121

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFMTMAERLGNALMQDPSM++MLES +NP  KDQLEERM+RIKEDPSLKPI
Sbjct  122   TMQQVMQNPQFMTMAERLGNALMQDPSMNTMLESFANPTNKDQLEERMSRIKEDPSLKPI  181

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGF--PgagetatsgetgtdeaeeasedeSIV  731
             LEEIE GGPAAMMRYWNDK+VL+KLGEAMG   PG   T+       +  +  +EDESIV
Sbjct  182   LEEIETGGPAAMMRYWNDKEVLQKLGEAMGLAVPGDAATSADNSGPEEVEDAGNEDESIV  241

Query  730   HHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDK  551
             HH ASVGD EGLK+ALA+GADKDEEDSEGRTALHFACGYGEVKCAQ+LLE+GA+VDALDK
Sbjct  242   HHTASVGDVEGLKSALASGADKDEEDSEGRTALHFACGYGEVKCAQVLLEAGARVDALDK  301

Query  550   NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPI+VAKLN+QNDVLKLLEKDAFL
Sbjct  302   NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNSQNDVLKLLEKDAFL  361



>ref|XP_006384892.1| hypothetical protein POPTR_0004s21980g [Populus trichocarpa]
 ref|XP_006384893.1| hypothetical protein POPTR_0004s21980g [Populus trichocarpa]
 gb|ERP62689.1| hypothetical protein POPTR_0004s21980g [Populus trichocarpa]
 gb|ERP62690.1| hypothetical protein POPTR_0004s21980g [Populus trichocarpa]
Length=365

 Score =   506 bits (1302),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 255/300 (85%), Positives = 271/300 (90%), Gaps = 2/300 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAMTGLLNDPSIKELAEQI+KDPSF QMAEQLQ+TFQGA + D IP FD QQYY 
Sbjct  66    NPFDFSAMTGLLNDPSIKELAEQISKDPSFNQMAEQLQKTFQGAPAEDAIPNFDTQQYYS  125

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFMTMAERLGNALMQDPSMS MLES SNP+QKDQ+EERM RI+EDPSLKPI
Sbjct  126   TMQQVMQNPQFMTMAERLGNALMQDPSMSQMLESFSNPSQKDQIEERMTRIREDPSLKPI  185

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetg--tdeaeeasedeSIV  731
             LEEIE GGPAAMMRYWNDKDVL+KLGEAMG   + E  TS ET    +  E  +EDES+V
Sbjct  186   LEEIESGGPAAMMRYWNDKDVLQKLGEAMGLAVSEEAGTSVETSGHEEAEEAGNEDESVV  245

Query  730   HHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDK  551
             HHCASVGD EGLKNALA+GADKDEEDSEGRTALHF+CGYGEVKCAQILLE+GA VDALDK
Sbjct  246   HHCASVGDVEGLKNALASGADKDEEDSEGRTALHFSCGYGEVKCAQILLEAGATVDALDK  305

Query  550   NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPI+VAKLNNQ +VLKLLEKDAFL
Sbjct  306   NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNNQQEVLKLLEKDAFL  365



>ref|XP_008235852.1| PREDICTED: ankyrin repeat domain-containing protein 2 [Prunus 
mume]
Length=361

 Score =   504 bits (1299),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 249/300 (83%), Positives = 272/300 (91%), Gaps = 2/300 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAMTGLLNDPSIKELAEQIAKDPSF QMA+QLQ+TFQGA  ++G+PQFD QQYY 
Sbjct  62    NPFDFSAMTGLLNDPSIKELAEQIAKDPSFNQMADQLQKTFQGATIDEGVPQFDSQQYYS  121

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFMTMAERLGNALMQDPSM++MLES +NP  KDQLEERM+RIKEDPSLKPI
Sbjct  122   TMQQVMQNPQFMTMAERLGNALMQDPSMNTMLESFANPTNKDQLEERMSRIKEDPSLKPI  181

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGF--PgagetatsgetgtdeaeeasedeSIV  731
             LEEIE GGPAAMMRYWNDK+VL+KLGEAMG   PG   T+       +  +  +EDES+V
Sbjct  182   LEEIETGGPAAMMRYWNDKEVLQKLGEAMGLAVPGDAATSADNSGPEEVEDAGNEDESVV  241

Query  730   HHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDK  551
             HH ASVGD EGLK+ALA+GADKDEEDSEGRTALHFACGYGEVKCAQ+LLE+GA+VDALDK
Sbjct  242   HHTASVGDVEGLKSALASGADKDEEDSEGRTALHFACGYGEVKCAQVLLEAGARVDALDK  301

Query  550   NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPI+VAKLN+QNDVLKLLEKDAFL
Sbjct  302   NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNSQNDVLKLLEKDAFL  361



>gb|AIY62315.1| ankyrin repeat domain containing protein 2, partial [Nicotiana 
benthamiana]
Length=348

 Score =   503 bits (1296),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 278/349 (80%), Positives = 303/349 (87%), Gaps = 4/349 (1%)
 Frame = -1

Query  1411  MSQEEKNLPAQKQDEKSGAADSKKPLESTSLDTQS--gqggaplaagpGMHNPFDFSAMT  1238
             MS+ EK LP    D KSGA+++KK  ES+S +  S   +  +  AAG G+ NPFDFSAM+
Sbjct  1     MSEGEKVLPTASAD-KSGASENKKSSESSSTEAPSGEARTTSTAAAGAGLQNPFDFSAMS  59

Query  1237  GLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQNP  1058
             GLLNDPSIKELAEQIAKDP+F QMAEQLQ+TFQGAA  + +P FD QQYY TMQQVMQNP
Sbjct  60    GLLNDPSIKELAEQIAKDPAFNQMAEQLQKTFQGAAVEESVPNFDSQQYYSTMQQVMQNP  119

Query  1057  QFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGP  878
             QFMTMAERLGNALMQDPSMS MLESLSNPAQK+Q+EERMARIKEDPSLKPILEEIE GGP
Sbjct  120   QFMTMAERLGNALMQDPSMSGMLESLSNPAQKEQIEERMARIKEDPSLKPILEEIESGGP  179

Query  877   AAMMRYWNDKDVLKKLGEAMGFPgagetatsget-gtdeaeeasedeSIVHHCASVGDEE  701
             AAMMRYWND++ LKK+GEAMGF   GE ATS    GTDE EEA+EDES+VH CASVGD E
Sbjct  180   AAMMRYWNDQETLKKIGEAMGFAAGGEGATSSAIPGTDETEEANEDESVVHQCASVGDAE  239

Query  700   GLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAA  521
             GLK AL AGADKDEEDSEGRTALHFACGYGEVKCAQILLE+GAKVDALDKNKNTALHYAA
Sbjct  240   GLKAALTAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGAKVDALDKNKNTALHYAA  299

Query  520   GYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAF  374
             GYGRKECVALLLENGAAVTLQN+DGKTPI+VAKLNNQ +VLKLLEKD F
Sbjct  300   GYGRKECVALLLENGAAVTLQNLDGKTPIDVAKLNNQEEVLKLLEKDVF  348



>ref|XP_004230497.1| PREDICTED: ankyrin repeat domain-containing protein 2 [Solanum 
lycopersicum]
Length=349

 Score =   502 bits (1293),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 284/349 (81%), Positives = 308/349 (88%), Gaps = 2/349 (1%)
 Frame = -1

Query  1411  MSQEEKNLPAQKQDEKSGAADSKKPLESTSLDTQSgqggaplaagpG-MHNPFDFSAMTG  1235
             MS+ EK LP   +DEKSGAA+SKK  ES++++  SG+G    AA    + NPFDFSAM+G
Sbjct  1     MSEGEKALPTASKDEKSGAAESKKSPESSTVEAPSGEGRTASAAAGAGVQNPFDFSAMSG  60

Query  1234  LLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQNPQ  1055
             LLNDPSIKELAEQIAKDP+F QMAEQLQ+TFQGAA  + +P FD QQYY TMQQVMQNPQ
Sbjct  61    LLNDPSIKELAEQIAKDPAFNQMAEQLQKTFQGAAVEESVPNFDSQQYYSTMQQVMQNPQ  120

Query  1054  FMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPA  875
             FMTMAERLGNALMQDPSMS MLESLSNPAQK+QLEERMARIKEDPSLKPILEEIE GGPA
Sbjct  121   FMTMAERLGNALMQDPSMSGMLESLSNPAQKEQLEERMARIKEDPSLKPILEEIESGGPA  180

Query  874   AMMRYWNDKDVLKKLGEAMGFPgagetatsget-gtdeaeeasedeSIVHHCASVGDEEG  698
             AMMRYWND+DVLKK+GEAMGF   GE ATS E  G DE EEA+EDES+VH CASVGD EG
Sbjct  181   AMMRYWNDQDVLKKIGEAMGFAAGGEGATSSEIPGPDETEEANEDESVVHQCASVGDAEG  240

Query  697   LKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAG  518
             LK ALAAGADKDEEDSEGRTALHFACGYGE KCAQ+L+E+GAKVDALDKNKNTALHYAAG
Sbjct  241   LKAALAAGADKDEEDSEGRTALHFACGYGEEKCAQLLVEAGAKVDALDKNKNTALHYAAG  300

Query  517   YGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             YGRKECVALLLENGAAVTLQN+DGKTPI+VAKLNNQ DVLKLLEKDAFL
Sbjct  301   YGRKECVALLLENGAAVTLQNLDGKTPIDVAKLNNQQDVLKLLEKDAFL  349



>ref|XP_004290102.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Fragaria 
vesca subsp. vesca]
Length=366

 Score =   502 bits (1293),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 251/304 (83%), Positives = 270/304 (89%), Gaps = 6/304 (2%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQ+TFQGA +++G+PQFD QQYY 
Sbjct  63    NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQKTFQGAPADEGVPQFDSQQYYS  122

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFM MAERLG+ALMQDPSM+SMLES +NP+ KDQLEERMARIKEDPSLKPI
Sbjct  123   TMQQVMQNPQFMNMAERLGSALMQDPSMNSMLESFTNPSNKDQLEERMARIKEDPSLKPI  182

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPg------agetatsgetgtdeaeeased  743
             LEEIE GGPAAMMRYWNDKDVL+KLGEAMG         +  +     +  +  +  +ED
Sbjct  183   LEEIETGGPAAMMRYWNDKDVLQKLGEAMGLAVGPDGAPSEVSGDKPWSPEEAEDAGAED  242

Query  742   eSIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVD  563
             E IVHH ASVGD EGLKNALAAGADKDEEDSEGRTALHFACGYGE KCAQ+LLE+GAKVD
Sbjct  243   EPIVHHTASVGDVEGLKNALAAGADKDEEDSEGRTALHFACGYGEAKCAQVLLEAGAKVD  302

Query  562   ALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEK  383
             ALDKNKNTALHYAAGYGRKECVALLLENGAAVTL NMDGKTPI+VAKLNNQNDVLKLLEK
Sbjct  303   ALDKNKNTALHYAAGYGRKECVALLLENGAAVTLANMDGKTPIDVAKLNNQNDVLKLLEK  362

Query  382   DAFL  371
             DAFL
Sbjct  363   DAFL  366



>ref|XP_011040864.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Populus 
euphratica]
 ref|XP_011040865.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Populus 
euphratica]
Length=363

 Score =   502 bits (1292),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 252/300 (84%), Positives = 268/300 (89%), Gaps = 2/300 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAMTGLLNDPSIKELAEQIAKDPSF QMAEQLQ+TFQGA + D IP FD QQYY 
Sbjct  64    NPFDFSAMTGLLNDPSIKELAEQIAKDPSFNQMAEQLQKTFQGATAEDAIPNFDTQQYYS  123

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFMTMAE LG ALMQDPSMS MLES +NP+QKDQ+EERM RI+EDPSLKPI
Sbjct  124   TMQQVMQNPQFMTMAEHLGTALMQDPSMSQMLESFTNPSQKDQIEERMTRIREDPSLKPI  183

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeasede--SIV  731
             LEEIE GGPAAMMRYWNDKDVL+KLGEAMG   + E  TS ET   E  E + +E  S+V
Sbjct  184   LEEIESGGPAAMMRYWNDKDVLQKLGEAMGLAVSEEAGTSVETSGHEEAEEAGNEDDSVV  243

Query  730   HHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDK  551
             HHCASVGD EGLKNALA+GADKDEEDSEGRTALHF+CGYGEVKCAQILLE+GA VDALDK
Sbjct  244   HHCASVGDVEGLKNALASGADKDEEDSEGRTALHFSCGYGEVKCAQILLEAGATVDALDK  303

Query  550   NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPI+VAKLNNQ +VLKLLEKDAFL
Sbjct  304   NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNNQQEVLKLLEKDAFL  363



>ref|XP_007043143.1| Ankyrin repeat domain-containing protein 2 isoform 1 [Theobroma 
cacao]
 gb|EOX98974.1| Ankyrin repeat domain-containing protein 2 isoform 1 [Theobroma 
cacao]
Length=359

 Score =   501 bits (1291),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 250/300 (83%), Positives = 268/300 (89%), Gaps = 2/300 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAM+GLLNDPSIKELAEQIAKDPSF QMAEQL QTFQGAA  + +PQFD QQYY 
Sbjct  60    NPFDFSAMSGLLNDPSIKELAEQIAKDPSFNQMAEQLTQTFQGAAVEESVPQFDAQQYYS  119

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFMTMAERLGNALMQDP+MSSMLESL+NP  KDQ+EERMARIKEDPSLK I
Sbjct  120   TMQQVMQNPQFMTMAERLGNALMQDPAMSSMLESLTNPQHKDQIEERMARIKEDPSLKHI  179

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPga--getatsgetgtdeaeeasedeSIV  731
             LEEIE GGPAAMMRYWNDK+VL+KLGEAMG   +    T+       +  E  +EDESIV
Sbjct  180   LEEIETGGPAAMMRYWNDKEVLQKLGEAMGLAASGDAATSADNSAADEGDEVGNEDESIV  239

Query  730   HHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDK  551
             HHCASVGD EGLK ALA+GADKDEEDSEGRTALHFACGYGEVKCAQILLE+GA VDALDK
Sbjct  240   HHCASVGDAEGLKAALASGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGATVDALDK  299

Query  550   NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NKNTALHYAAGYGRK+CVALLLENGAAVTLQNMDGKTPI+VAKLNNQ++VLKLLEKDAFL
Sbjct  300   NKNTALHYAAGYGRKDCVALLLENGAAVTLQNMDGKTPIDVAKLNNQHEVLKLLEKDAFL  359



>ref|XP_008382530.1| PREDICTED: ankyrin repeat domain-containing protein 2-like isoform 
X2 [Malus domestica]
Length=358

 Score =   501 bits (1290),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 252/298 (85%), Positives = 273/298 (92%), Gaps = 1/298 (0%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAMTGLLNDPSIKELAEQIAKDPSF QMA+QLQ+TFQG + ++G+PQFD QQYY 
Sbjct  62    NPFDFSAMTGLLNDPSIKELAEQIAKDPSFNQMADQLQKTFQGVSVDEGVPQFDSQQYYS  121

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFMTMAERLG+ALMQDPSM++MLES +NP+ KDQLEERM+RIKEDPSLKPI
Sbjct  122   TMQQVMQNPQFMTMAERLGSALMQDPSMNTMLESFANPSNKDQLEERMSRIKEDPSLKPI  181

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeasedeSIVHH  725
             LEEIE GGPAAMMRYWNDKDVL+KLGEAMG    G+ ATS E   +  +  +EDESIVHH
Sbjct  182   LEEIETGGPAAMMRYWNDKDVLQKLGEAMGL-AVGDAATSTEAPEEAEDAGNEDESIVHH  240

Query  724   CASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNK  545
              ASVGD EGLK ALA+GADKDEEDSEGRTALHFACGYGEVKCAQ LLE+GA+VDALDKNK
Sbjct  241   TASVGDVEGLKAALASGADKDEEDSEGRTALHFACGYGEVKCAQALLEAGARVDALDKNK  300

Query  544   NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPI+VAKLNNQNDVLKLLEKDAFL
Sbjct  301   NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNNQNDVLKLLEKDAFL  358



>ref|XP_008382529.1| PREDICTED: ankyrin repeat domain-containing protein 2-like isoform 
X1 [Malus domestica]
Length=359

 Score =   501 bits (1290),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 252/298 (85%), Positives = 273/298 (92%), Gaps = 1/298 (0%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAMTGLLNDPSIKELAEQIAKDPSF QMA+QLQ+TFQG + ++G+PQFD QQYY 
Sbjct  63    NPFDFSAMTGLLNDPSIKELAEQIAKDPSFNQMADQLQKTFQGVSVDEGVPQFDSQQYYS  122

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFMTMAERLG+ALMQDPSM++MLES +NP+ KDQLEERM+RIKEDPSLKPI
Sbjct  123   TMQQVMQNPQFMTMAERLGSALMQDPSMNTMLESFANPSNKDQLEERMSRIKEDPSLKPI  182

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeasedeSIVHH  725
             LEEIE GGPAAMMRYWNDKDVL+KLGEAMG    G+ ATS E   +  +  +EDESIVHH
Sbjct  183   LEEIETGGPAAMMRYWNDKDVLQKLGEAMGL-AVGDAATSTEAPEEAEDAGNEDESIVHH  241

Query  724   CASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNK  545
              ASVGD EGLK ALA+GADKDEEDSEGRTALHFACGYGEVKCAQ LLE+GA+VDALDKNK
Sbjct  242   TASVGDVEGLKAALASGADKDEEDSEGRTALHFACGYGEVKCAQALLEAGARVDALDKNK  301

Query  544   NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPI+VAKLNNQNDVLKLLEKDAFL
Sbjct  302   NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNNQNDVLKLLEKDAFL  359



>ref|XP_009358926.1| PREDICTED: ankyrin repeat domain-containing protein 2 isoform 
X1 [Pyrus x bretschneideri]
Length=359

 Score =   501 bits (1290),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 251/298 (84%), Positives = 273/298 (92%), Gaps = 1/298 (0%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAMTGLLNDPSIKELAEQI+KDPSF QMA+QLQ+TFQG + ++G+PQFD QQYY 
Sbjct  63    NPFDFSAMTGLLNDPSIKELAEQISKDPSFNQMADQLQKTFQGVSVDEGVPQFDSQQYYS  122

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFMTMAERLGNALMQDPSM++MLES +NP+ KDQLEERM+RIKEDPSLKPI
Sbjct  123   TMQQVMQNPQFMTMAERLGNALMQDPSMNTMLESFANPSNKDQLEERMSRIKEDPSLKPI  182

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeasedeSIVHH  725
             LEEIE GGPAAMMRYWNDKDVL+KLGEAMG    G+ ATS E   +  +  +EDESIVH 
Sbjct  183   LEEIETGGPAAMMRYWNDKDVLQKLGEAMGL-AVGDAATSTEAPEEAEDAGNEDESIVHQ  241

Query  724   CASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNK  545
              ASVGD EGLK ALA+GADKDEEDSEGRTALHFACGYGEVKCAQ+LLE+GA+VDALDKNK
Sbjct  242   TASVGDVEGLKAALASGADKDEEDSEGRTALHFACGYGEVKCAQVLLEAGARVDALDKNK  301

Query  544   NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPI+VAKLNNQNDVLKLLEKDAFL
Sbjct  302   NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNNQNDVLKLLEKDAFL  359



>ref|XP_008356269.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Malus 
domestica]
Length=359

 Score =   500 bits (1288),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 251/298 (84%), Positives = 273/298 (92%), Gaps = 1/298 (0%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAMTGLLNDPSIKELAEQI+KDPSF QMAEQLQ+TFQG + ++G+PQFD Q+YY 
Sbjct  63    NPFDFSAMTGLLNDPSIKELAEQISKDPSFNQMAEQLQKTFQGVSVDEGVPQFDSQEYYS  122

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFMTMAERLGNALMQDPSM++MLES +NP+ KDQLEERM+RIKEDPSLKPI
Sbjct  123   TMQQVMQNPQFMTMAERLGNALMQDPSMNTMLESFANPSSKDQLEERMSRIKEDPSLKPI  182

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeasedeSIVHH  725
             LEEIE GGPAAMMRYWNDKDVL+KLGEAMG    G+ ATS E   +  +  +EDESIVH 
Sbjct  183   LEEIETGGPAAMMRYWNDKDVLQKLGEAMGL-AVGDAATSAEPPEEAEDAGNEDESIVHQ  241

Query  724   CASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNK  545
              ASVGD EGLK ALA+GADKDEEDSEGRTALHFACGYGEVKCAQ+LLE+GA+VDALDKNK
Sbjct  242   TASVGDVEGLKAALASGADKDEEDSEGRTALHFACGYGEVKCAQVLLEAGARVDALDKNK  301

Query  544   NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPI+VAKLNNQNDVLKLLEKDAFL
Sbjct  302   NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNNQNDVLKLLEKDAFL  359



>gb|AEA50964.1| putative PDF1-interacting protein 2, partial [Gossypium barbadense]
Length=371

 Score =   501 bits (1289),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 251/300 (84%), Positives = 270/300 (90%), Gaps = 2/300 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAM+GLLNDPSIKELAEQIAKDPSF QMAEQ  +TFQGAA+ +  PQFDPQQYY 
Sbjct  72    NPFDFSAMSGLLNDPSIKELAEQIAKDPSFNQMAEQPTKTFQGAAAEETTPQFDPQQYYS  131

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFMTMAERLGNALMQDP+MS+ML+SL+NP QKDQ+EERMARIKEDPSLKPI
Sbjct  132   TMQQVMQNPQFMTMAERLGNALMQDPAMSTMLDSLANPQQKDQIEERMARIKEDPSLKPI  191

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPga--getatsgetgtdeaeeasedeSIV  731
             LEEIE GGPAAMMRYWNDKDVL+KLGEAMG        T+       +E E  +EDESIV
Sbjct  192   LEEIESGGPAAMMRYWNDKDVLQKLGEAMGLAVTGDAATSAGNSAADEEDEAGNEDESIV  251

Query  730   HHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDK  551
             HHCASVGD EGLK AL++GADKDEEDSEGRTALHFACGYGEVKC QILLE+GAKVDALDK
Sbjct  252   HHCASVGDVEGLKTALSSGADKDEEDSEGRTALHFACGYGEVKCTQILLEAGAKVDALDK  311

Query  550   NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NKNTALHYAAGYGRK+CVALLLENGAAVTLQNMDGKTPIEVAKLNNQ++VLKLLEKDAFL
Sbjct  312   NKNTALHYAAGYGRKDCVALLLENGAAVTLQNMDGKTPIEVAKLNNQHEVLKLLEKDAFL  371



>ref|XP_010090746.1| Ankyrin repeat domain-containing protein 2 [Morus notabilis]
 gb|EXB40465.1| Ankyrin repeat domain-containing protein 2 [Morus notabilis]
Length=430

 Score =   502 bits (1292),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 253/300 (84%), Positives = 272/300 (91%), Gaps = 2/300 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAM+GLLNDPSIKELAEQIAKDPSF QMAEQLQ+TFQGA+ +DGIPQFD QQYY 
Sbjct  131   NPFDFSAMSGLLNDPSIKELAEQIAKDPSFNQMAEQLQKTFQGASVDDGIPQFDSQQYYS  190

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFMTMAE+LGNALMQDPSMS+MLES +NP  KDQLE+RMARIKEDPSLKPI
Sbjct  191   TMQQVMQNPQFMTMAEQLGNALMQDPSMSTMLESFANPENKDQLEQRMARIKEDPSLKPI  250

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgag--etatsgetgtdeaeeasedeSIV  731
             LEEIE GGPAAMMRYWND+DVLKKLGEAMG   +G   T+       D     +EDESIV
Sbjct  251   LEEIETGGPAAMMRYWNDQDVLKKLGEAMGLAASGDPATSADNAGAEDAEGAGNEDESIV  310

Query  730   HHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDK  551
             HH ASVGD EGLKNALA+GADKDEEDSEGRTALHFACGYGEVKCAQ+LLE+GAKVDALDK
Sbjct  311   HHTASVGDVEGLKNALASGADKDEEDSEGRTALHFACGYGEVKCAQVLLEAGAKVDALDK  370

Query  550   NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NKNTALHYAAGYGRKECVALLLE+GAAVTLQN+DGKTPI+VAKLNNQ+DVLKLLEKDAFL
Sbjct  371   NKNTALHYAAGYGRKECVALLLEHGAAVTLQNLDGKTPIDVAKLNNQHDVLKLLEKDAFL  430



>ref|XP_006384889.1| hypothetical protein POPTR_0004s21970g [Populus trichocarpa]
 ref|XP_006384890.1| hypothetical protein POPTR_0004s21970g [Populus trichocarpa]
 ref|XP_006384891.1| ankyrin repeat-containing protein 2 [Populus trichocarpa]
 gb|ABK94370.1| unknown [Populus trichocarpa]
 gb|ERP62686.1| hypothetical protein POPTR_0004s21970g [Populus trichocarpa]
 gb|ERP62687.1| hypothetical protein POPTR_0004s21970g [Populus trichocarpa]
 gb|ERP62688.1| ankyrin repeat-containing protein 2 [Populus trichocarpa]
Length=366

 Score =   499 bits (1286),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 252/300 (84%), Positives = 269/300 (90%), Gaps = 2/300 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             +PFDFSAMTGLLNDPSIKELAEQIAKDPSF QMAEQLQ+TFQGA + D IP FD QQYY 
Sbjct  67    SPFDFSAMTGLLNDPSIKELAEQIAKDPSFNQMAEQLQKTFQGATAEDAIPNFDTQQYYS  126

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFMTMAE LG ALMQDPSMS MLES +NP+QKDQ+EERM RI+EDPSLKPI
Sbjct  127   TMQQVMQNPQFMTMAEHLGTALMQDPSMSQMLESFTNPSQKDQIEERMTRIREDPSLKPI  186

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetg--tdeaeeasedeSIV  731
             LEEIE GGPAAMMRYWNDKDVL+KLGEAMG   + E  TS ET    +  E  +EDES+V
Sbjct  187   LEEIESGGPAAMMRYWNDKDVLQKLGEAMGLAVSEEAGTSVETSGHEEAEEAGNEDESVV  246

Query  730   HHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDK  551
             HHCASVGD EGLKNALA+GADKDEEDSEGRTALHF+CGYGEVKCAQILLE+GA VDALDK
Sbjct  247   HHCASVGDVEGLKNALASGADKDEEDSEGRTALHFSCGYGEVKCAQILLEAGATVDALDK  306

Query  550   NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPI+VAKLNNQ +VLKLLEKDAFL
Sbjct  307   NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNNQQEVLKLLEKDAFL  366



>ref|XP_009358927.1| PREDICTED: ankyrin repeat domain-containing protein 2 isoform 
X2 [Pyrus x bretschneideri]
Length=367

 Score =   499 bits (1285),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 246/305 (81%), Positives = 266/305 (87%), Gaps = 7/305 (2%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAMTGLLNDPSIKELAEQI+KDPSF QMA+QLQ+TFQG + ++G+PQFD QQYY 
Sbjct  63    NPFDFSAMTGLLNDPSIKELAEQISKDPSFNQMADQLQKTFQGVSVDEGVPQFDSQQYYS  122

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFMTMAERLGNALMQDPSM++MLES +NP+ KDQLEERM+RIKEDPSLKPI
Sbjct  123   TMQQVMQNPQFMTMAERLGNALMQDPSMNTMLESFANPSNKDQLEERMSRIKEDPSLKPI  182

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeased------  743
             LEEIE GGPAAMMRYWNDKDVL+KLGEAMG        ++      E     E       
Sbjct  183   LEEIETGGPAAMMRYWNDKDVLQKLGEAMGLAVGDAATSTEAPEEAEDAGTEEAEDAGNE  242

Query  742   -eSIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKV  566
              ESIVH  ASVGD EGLK ALA+GADKDEEDSEGRTALHFACGYGEVKCAQ+LLE+GA+V
Sbjct  243   DESIVHQTASVGDVEGLKAALASGADKDEEDSEGRTALHFACGYGEVKCAQVLLEAGARV  302

Query  565   DALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLE  386
             DALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPI+VAKLNNQNDVLKLLE
Sbjct  303   DALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNNQNDVLKLLE  362

Query  385   KDAFL  371
             KDAFL
Sbjct  363   KDAFL  367



>ref|XP_006341819.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Solanum 
tuberosum]
Length=348

 Score =   497 bits (1280),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 275/348 (79%), Positives = 303/348 (87%), Gaps = 1/348 (0%)
 Frame = -1

Query  1411  MSQEEKNLPAQKQDEKSGAADSKKPLESTSLDTQSgqggaplaagpGMHNPFDFSAMTGL  1232
             MSQ EK +   K+DEKSG+++SKK  ES S++ Q+G+     AAG G+ NPFDFSAMTGL
Sbjct  1     MSQAEKVVLTAKEDEKSGSSESKKSSESASMEAQTGETRKTPAAGAGLQNPFDFSAMTGL  60

Query  1231  LNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQNPQF  1052
             LNDPSIKELAEQI KDPSF QMAEQLQ+TFQGAA  D IP FD QQY+ TMQQVMQNPQF
Sbjct  61    LNDPSIKELAEQITKDPSFNQMAEQLQKTFQGAAVEDSIPNFDSQQYFSTMQQVMQNPQF  120

Query  1051  MTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAA  872
             MTMAE+LG+ALMQDPSMSS+LE+L+  +QKDQLEERM  IKEDPSLKPILEEIE GGPAA
Sbjct  121   MTMAEQLGSALMQDPSMSSILENLTKSSQKDQLEERMTCIKEDPSLKPILEEIESGGPAA  180

Query  871   MMRYWNDKDVLKKLGEAMGFPgagetatsgetgt-deaeeasedeSIVHHCASVGDEEGL  695
             MMRYWND+DVLKKLGEAMGF  A E ATS E    DE E+A EDES+VH CASVGD EGL
Sbjct  181   MMRYWNDQDVLKKLGEAMGFAVAEEGATSAEVSGPDETEKADEDESVVHQCASVGDVEGL  240

Query  694   KNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGY  515
             KN +A+GADKDEEDSEGRTALHFACGYGEVKCAQ+LLESGA+VDALDKNKNTALHYA GY
Sbjct  241   KNVIASGADKDEEDSEGRTALHFACGYGEVKCAQVLLESGAEVDALDKNKNTALHYATGY  300

Query  514   GRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             GRKECVALLLENGAAVTLQN+DGKTPI+VAKLNNQN+VL LLEKDAFL
Sbjct  301   GRKECVALLLENGAAVTLQNLDGKTPIDVAKLNNQNEVLTLLEKDAFL  348



>gb|AAQ96339.1| putative ankyrin-repeat protein [Vitis aestivalis]
Length=354

 Score =   497 bits (1279),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 252/308 (82%), Positives = 269/308 (87%), Gaps = 10/308 (3%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAMTGLLNDPSIKELAEQIAKDP+F QMAEQLQ+TF GAA  + IPQFD QQYY 
Sbjct  47    NPFDFSAMTGLLNDPSIKELAEQIAKDPAFNQMAEQLQKTFHGAAVEESIPQFDTQQYYS  106

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLE+L+NP  KDQLEERMARIKEDPSLKPI
Sbjct  107   TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLENLANPTHKDQLEERMARIKEDPSLKPI  166

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetg----------tdeaee  755
             L+EIE GGPAAMMRYWNDKDVL+KLGEAMG   +G+ A S +             DE+  
Sbjct  167   LDEIETGGPAAMMRYWNDKDVLQKLGEAMGLAVSGDAAASADNSGLDEAEELANEDESIA  226

Query  754   asedeSIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESG  575
                 ESIVH  ASVGD EGLKNALA+GADKDEEDSEGRTALHFACGYGEVKCAQIL+E+G
Sbjct  227   HHHSESIVHDTASVGDVEGLKNALASGADKDEEDSEGRTALHFACGYGEVKCAQILVEAG  286

Query  574   AKVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLK  395
             A VDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPI+VAKLNNQ++VLK
Sbjct  287   ATVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNNQHEVLK  346

Query  394   LLEKDAFL  371
             LLEKDAFL
Sbjct  347   LLEKDAFL  354



>ref|XP_011087763.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Sesamum 
indicum]
Length=342

 Score =   496 bits (1278),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 264/348 (76%), Positives = 291/348 (84%), Gaps = 7/348 (2%)
 Frame = -1

Query  1411  MSQEEKNLPAQKQDEKSGAADSKKPLESTSLDTQSgqggaplaagpGMHNPFDFSAMTGL  1232
             MS+  K     K +EKSGAA     + +TS  T SGQG         + NPFDFSAMTGL
Sbjct  1     MSEASKTPLVPKDEEKSGAA-----VSTTSAGTPSGQGRVTPPVTG-IPNPFDFSAMTGL  54

Query  1231  LNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQNPQF  1052
             LNDPSIKELAEQIAKDPSF QMAEQLQ+TFQG + ++GIP FD QQYY TMQQVMQNPQF
Sbjct  55    LNDPSIKELAEQIAKDPSFNQMAEQLQKTFQGVSVDEGIPNFDTQQYYSTMQQVMQNPQF  114

Query  1051  MTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAA  872
             MTMAERLG+ALMQDP+MS MLE+L+NPA KDQLEERMARIKEDPSLKPILEEIE GGPAA
Sbjct  115   MTMAERLGSALMQDPAMSGMLENLTNPANKDQLEERMARIKEDPSLKPILEEIENGGPAA  174

Query  871   MMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeease-deSIVHHCASVGDEEGL  695
             MMRYWNDK+VL+KLGEAMGF    E ATS     ++  E +  +ESIVHH ASVGD EGL
Sbjct  175   MMRYWNDKEVLQKLGEAMGFAVGAEGATSAGEAAEDETEEANDEESIVHHTASVGDVEGL  234

Query  694   KNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGY  515
             K A+A GADKDEEDSEGRTALHFACGYGEVKCAQ+LLE+GAKVDALDKNKNT LHYAAGY
Sbjct  235   KKAIADGADKDEEDSEGRTALHFACGYGEVKCAQVLLEAGAKVDALDKNKNTPLHYAAGY  294

Query  514   GRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             GRK+CV LLL+NGAAVTLQN+DGKTPI+VAKLNNQN+VLKLLEKDAFL
Sbjct  295   GRKDCVELLLKNGAAVTLQNLDGKTPIDVAKLNNQNEVLKLLEKDAFL  342



>ref|XP_010645421.1| PREDICTED: ankyrin repeat domain-containing protein 2 isoform 
X2 [Vitis vinifera]
 ref|XP_010645426.1| PREDICTED: ankyrin repeat domain-containing protein 2 isoform 
X2 [Vitis vinifera]
Length=354

 Score =   497 bits (1279),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 252/308 (82%), Positives = 269/308 (87%), Gaps = 10/308 (3%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAMTGLLNDPSIKELAEQIAKDP+F QMAEQLQ+TF GAA  + IPQFD QQYY 
Sbjct  47    NPFDFSAMTGLLNDPSIKELAEQIAKDPAFNQMAEQLQKTFHGAAVEESIPQFDTQQYYS  106

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLE+L+NP  KDQLEERMARIKEDPSLKPI
Sbjct  107   TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLENLANPTHKDQLEERMARIKEDPSLKPI  166

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetg----------tdeaee  755
             L+EIE GGPAAMMRYWNDKDVL+KLGEAMG   +G+ A S +             DE+  
Sbjct  167   LDEIETGGPAAMMRYWNDKDVLQKLGEAMGLAVSGDAAASADNSGLDEAEELANEDESIA  226

Query  754   asedeSIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESG  575
                 ESIVH  ASVGD EGLKNALA+GADKDEEDSEGRTALHFACGYGEVKCAQIL+E+G
Sbjct  227   HHHSESIVHDTASVGDVEGLKNALASGADKDEEDSEGRTALHFACGYGEVKCAQILVEAG  286

Query  574   AKVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLK  395
             A VDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPI+VAKLNNQ++VLK
Sbjct  287   ATVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNNQHEVLK  346

Query  394   LLEKDAFL  371
             LLEKDAFL
Sbjct  347   LLEKDAFL  354



>ref|XP_002283498.2| PREDICTED: ankyrin repeat domain-containing protein 2 isoform 
X1 [Vitis vinifera]
 ref|XP_010645415.1| PREDICTED: ankyrin repeat domain-containing protein 2 isoform 
X1 [Vitis vinifera]
 emb|CBI37701.3| unnamed protein product [Vitis vinifera]
Length=358

 Score =   497 bits (1279),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 252/308 (82%), Positives = 269/308 (87%), Gaps = 10/308 (3%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAMTGLLNDPSIKELAEQIAKDP+F QMAEQLQ+TF GAA  + IPQFD QQYY 
Sbjct  51    NPFDFSAMTGLLNDPSIKELAEQIAKDPAFNQMAEQLQKTFHGAAVEESIPQFDTQQYYS  110

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLE+L+NP  KDQLEERMARIKEDPSLKPI
Sbjct  111   TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLENLANPTHKDQLEERMARIKEDPSLKPI  170

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetg----------tdeaee  755
             L+EIE GGPAAMMRYWNDKDVL+KLGEAMG   +G+ A S +             DE+  
Sbjct  171   LDEIETGGPAAMMRYWNDKDVLQKLGEAMGLAVSGDAAASADNSGLDEAEELANEDESIA  230

Query  754   asedeSIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESG  575
                 ESIVH  ASVGD EGLKNALA+GADKDEEDSEGRTALHFACGYGEVKCAQIL+E+G
Sbjct  231   HHHSESIVHDTASVGDVEGLKNALASGADKDEEDSEGRTALHFACGYGEVKCAQILVEAG  290

Query  574   AKVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLK  395
             A VDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPI+VAKLNNQ++VLK
Sbjct  291   ATVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNNQHEVLK  350

Query  394   LLEKDAFL  371
             LLEKDAFL
Sbjct  351   LLEKDAFL  358



>ref|XP_002514378.1| ankyrin repeat domain protein, putative [Ricinus communis]
 gb|EEF47974.1| ankyrin repeat domain protein, putative [Ricinus communis]
Length=345

 Score =   496 bits (1277),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 253/303 (83%), Positives = 272/303 (90%), Gaps = 5/303 (2%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQG---AASNDGIPQFDPQQ  1094
             NPFDFSAMTGLLNDPSIKELAEQIAKDP+F QMAEQLQ+T  G   AA+ + IPQFD QQ
Sbjct  43    NPFDFSAMTGLLNDPSIKELAEQIAKDPAFNQMAEQLQKTLHGVGAAAAEESIPQFDSQQ  102

Query  1093  YYGTMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSL  914
             YY TMQQVMQNPQFMTMAERLGNALMQDPSMS MLESL+NP+ KDQ+EERMA+IKEDPSL
Sbjct  103   YYSTMQQVMQNPQFMTMAERLGNALMQDPSMSQMLESLTNPSHKDQIEERMAQIKEDPSL  162

Query  913   KPILEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsget--gtdeaeeasede  740
             KPILEEIE GGPAAMMRYWND+DVLKKLGEAMG   + E A+S E     +  E  +EDE
Sbjct  163   KPILEEIESGGPAAMMRYWNDQDVLKKLGEAMGLAVSEEAASSAENPGQEEAEEAGNEDE  222

Query  739   SIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDA  560
             SIVH+CASVGD EGLK ALA+GADKDEEDSEGRTALHFACGYGEVKCAQ+LLE+GA VDA
Sbjct  223   SIVHNCASVGDIEGLKAALASGADKDEEDSEGRTALHFACGYGEVKCAQVLLEAGATVDA  282

Query  559   LDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKD  380
             LDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPI+VAKLNNQ+DVLKLLEKD
Sbjct  283   LDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNNQHDVLKLLEKD  342

Query  379   AFL  371
             AFL
Sbjct  343   AFL  345



>ref|XP_010327342.1| PREDICTED: ankyrin repeat domain-containing protein 2-like, partial 
[Solanum lycopersicum]
Length=352

 Score =   495 bits (1274),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 263/346 (76%), Positives = 296/346 (86%), Gaps = 1/346 (0%)
 Frame = -1

Query  1405  QEEKNLPAQKQDEKSGAADSKKPLESTSLDTQSgqggaplaagpGMHNPFDFSAMTGLLN  1226
             Q EK +   K+DEKSG++++KK  ES S + Q+G+     AAG G+ NPFDFSAMTGLLN
Sbjct  7     QAEKVVLTAKEDEKSGSSENKKASESASTEAQTGETRKTSAAGAGLQNPFDFSAMTGLLN  66

Query  1225  DPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQNPQFMT  1046
             DPSIKELAEQIAK PSF QM EQLQQTFQGAA  D IP FD QQYY  MQ VMQNPQFM+
Sbjct  67    DPSIKELAEQIAKYPSFNQMTEQLQQTFQGAAEEDNIPNFDSQQYYSAMQHVMQNPQFMS  126

Query  1045  MAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAAMM  866
             MAE+LG+ALMQDPSMSSMLE+L+N +QKDQLEER+  IKEDPSLKPILEEIE GGPAAMM
Sbjct  127   MAEQLGSALMQDPSMSSMLENLTNSSQKDQLEERLTCIKEDPSLKPILEEIESGGPAAMM  186

Query  865   RYWNDKDVLKKLGEAMGFPgagetatsgetgt-deaeeasedeSIVHHCASVGDEEGLKN  689
             RYWND+DVLKKLGEAMGF  AGE ATS E    DE E+A +DES VH CASVGD EGLKN
Sbjct  187   RYWNDQDVLKKLGEAMGFAVAGEGATSAEVSGPDETEKADDDESSVHQCASVGDVEGLKN  246

Query  688   ALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGR  509
              +A+ ADK++EDSEGRT+LHFAC YGEVKCAQ+LLE+GA+VDAL+KNKNTALHYAAGYGR
Sbjct  247   VIASVADKNKEDSEGRTSLHFACEYGEVKCAQVLLEAGAEVDALNKNKNTALHYAAGYGR  306

Query  508   KECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             KECV LLL+NGAAVTLQN+DGKTPI+VAKLNNQN+VL LLEKDAFL
Sbjct  307   KECVVLLLKNGAAVTLQNLDGKTPIDVAKLNNQNEVLTLLEKDAFL  352



>gb|ACU21334.1| unknown [Glycine max]
Length=350

 Score =   494 bits (1273),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 259/352 (74%), Positives = 285/352 (81%), Gaps = 10/352 (3%)
 Frame = -1

Query  1408  SQEEKNLPAQKQDEKSGAADSKKPLESTSLD----TQSgqggaplaagpGMHNPFDFSAM  1241
             S  +K+ PA   D+K+G A++K   + TS       Q         A     NPFDFSAM
Sbjct  3     SDSKKDFPA---DDKAGTAENKASKDETSSKDSPAAQRATTATSGPATGFPGNPFDFSAM  59

Query  1240  TGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQN  1061
             +GLLNDPSIKELAEQIAKDPSF QMAEQLQ+TFQGA   D +P FD QQY+ TMQQVMQN
Sbjct  60    SGLLNDPSIKELAEQIAKDPSFNQMAEQLQKTFQGA-PQDAMPSFDNQQYFSTMQQVMQN  118

Query  1060  PQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGG  881
             P FMTMAERLGNALMQDPSMS+MLES SNP+ KDQLEERM RIKEDPSLK ILEEIE GG
Sbjct  119   PNFMTMAERLGNALMQDPSMSAMLESFSNPSNKDQLEERMTRIKEDPSLKHILEEIETGG  178

Query  880   PAAMMRYWNDKDVLKKLGEAMGFPga--getatsgetgtdeaeeasedeSIVHHCASVGD  707
             PAAMMRYWND++VL+KLG+AMG   +     +       +  +  +EDESIVHH ASVGD
Sbjct  179   PAAMMRYWNDEEVLRKLGQAMGLANSGDVGASAENSGADETEDSGNEDESIVHHTASVGD  238

Query  706   EEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHY  527
              EGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQ+LLE+GAKVDALDKNKNTALHY
Sbjct  239   VEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQVLLEAGAKVDALDKNKNTALHY  298

Query  526   AAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             AAGYGRKECVALLLENGAAVTLQNMDGKTPI+VAKLNNQN+VLKLLEKDAFL
Sbjct  299   AAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNNQNEVLKLLEKDAFL  350



>gb|KHG16227.1| Ankyrin repeat domain-containing 2 -like protein [Gossypium arboreum]
Length=360

 Score =   495 bits (1274),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 245/300 (82%), Positives = 269/300 (90%), Gaps = 2/300 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAM+GLLNDPSIKELAEQIAKDPSFTQMAEQL +TFQGAA+ D +PQFDPQQYY 
Sbjct  61    NPFDFSAMSGLLNDPSIKELAEQIAKDPSFTQMAEQLTKTFQGAATEDSMPQFDPQQYYS  120

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFMTMAERLGNALMQDP+MSSML+S +NP  KDQ+E+RMA IKEDPSLK I
Sbjct  121   TMQQVMQNPQFMTMAERLGNALMQDPAMSSMLDSFTNPQHKDQIEQRMALIKEDPSLKHI  180

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPga--getatsgetgtdeaeeasedeSIV  731
             L+EIE GGPAAMM+YWNDKDVLKKLGEAMG   +    T+       +  E  +EDESIV
Sbjct  181   LDEIETGGPAAMMKYWNDKDVLKKLGEAMGLAVSGDAATSADNSAADEGDEVGNEDESIV  240

Query  730   HHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDK  551
             H+CASVGD EGLK ALA+GADKDEEDSEGRTALHFACGYGEVKCAQ+L+E+GAKVDALDK
Sbjct  241   HNCASVGDVEGLKAALASGADKDEEDSEGRTALHFACGYGEVKCAQVLIEAGAKVDALDK  300

Query  550   NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NKNTALHYAAGYGRK+CVALLLENGAAVTLQNMDGKT I+VAKLNNQ++VLKLLEKDAFL
Sbjct  301   NKNTALHYAAGYGRKDCVALLLENGAAVTLQNMDGKTAIDVAKLNNQHEVLKLLEKDAFL  360



>ref|NP_001241225.1| uncharacterized protein LOC100797622 [Glycine max]
 gb|ACU19895.1| unknown [Glycine max]
 gb|KHN32378.1| Ankyrin repeat domain-containing protein 2 [Glycine soja]
Length=350

 Score =   494 bits (1272),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 263/352 (75%), Positives = 288/352 (82%), Gaps = 10/352 (3%)
 Frame = -1

Query  1408  SQEEKNLPAQKQDEKSGAADSKKPLESTSLD----TQSgqggaplaagpGMHNPFDFSAM  1241
             S  +K+ PA   D+K+G A++K   + TS       Q         A     NPFDFSAM
Sbjct  3     SDSKKDFPA---DDKAGTAENKASKDETSSKDSPAAQRATTATSGPATGFPGNPFDFSAM  59

Query  1240  TGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQN  1061
             +GLLNDPSIKELAEQIAKDPSF QMAEQLQ+TFQGA   D +P FD QQY+ TMQQVMQN
Sbjct  60    SGLLNDPSIKELAEQIAKDPSFNQMAEQLQKTFQGA-PQDAMPSFDNQQYFSTMQQVMQN  118

Query  1060  PQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGG  881
             P FMTMAERLGNALMQDPSMS+MLES SNP+ KDQLEERM RIKEDPSLK ILEEIE GG
Sbjct  119   PNFMTMAERLGNALMQDPSMSAMLESFSNPSNKDQLEERMTRIKEDPSLKHILEEIETGG  178

Query  880   PAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeea--sedeSIVHHCASVGD  707
             PAAMMRYWND++VL+KLG+AMG   +G+   S E    +  E   +EDESIVHH ASVGD
Sbjct  179   PAAMMRYWNDEEVLRKLGQAMGLANSGDVGASAENSGADETEDLGNEDESIVHHTASVGD  238

Query  706   EEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHY  527
              EGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQ+LLE+GAKVDALDKNKNTALHY
Sbjct  239   VEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQVLLEAGAKVDALDKNKNTALHY  298

Query  526   AAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             AAGYGRKECVALLLENGAAVTLQNMDGKTPI+VAKLNNQN+VLKLLEKDAFL
Sbjct  299   AAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNNQNEVLKLLEKDAFL  350



>ref|XP_008448145.1| PREDICTED: ankyrin repeat domain-containing protein 2 [Cucumis 
melo]
Length=359

 Score =   494 bits (1273),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 243/299 (81%), Positives = 264/299 (88%), Gaps = 1/299 (0%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAMTGLLNDPSI+ELA QIAKDP+F QMA QLQ+TFQGA++  GIPQFD QQYY 
Sbjct  61    NPFDFSAMTGLLNDPSIQELASQIAKDPAFNQMASQLQKTFQGASAQQGIPQFDTQQYYS  120

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLE+ +NP+ K+QLEERMA+IKEDPSLKPI
Sbjct  121   TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLETFANPSNKEQLEERMAQIKEDPSLKPI  180

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPga-getatsgetgtdeaeeasedeSIVH  728
             L+EIE GGPAAMMRYWND+DVLKKLGEAMGF               D  E  ++DES+VH
Sbjct  181   LDEIETGGPAAMMRYWNDRDVLKKLGEAMGFAVYGDAANAESSAADDSEEVGNDDESVVH  240

Query  727   HCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKN  548
               ASVGD EGLKNALAAGA+KDEEDSEGRTALHFACGYGE KCAQILLE+G KVDALDKN
Sbjct  241   QTASVGDAEGLKNALAAGANKDEEDSEGRTALHFACGYGEAKCAQILLEAGVKVDALDKN  300

Query  547   KNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             KNTALHYAAGYGRKECVALLLENGAAVTLQN+DGKTPI+VAKLNNQ++VLKLLEKD FL
Sbjct  301   KNTALHYAAGYGRKECVALLLENGAAVTLQNLDGKTPIDVAKLNNQHEVLKLLEKDVFL  359



>ref|XP_009795715.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Nicotiana 
sylvestris]
Length=292

 Score =   491 bits (1264),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 250/292 (86%), Positives = 269/292 (92%), Gaps = 1/292 (0%)
 Frame = -1

Query  1243  MTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQ  1064
             MTGLLNDPSIKELAEQIAKDPSF QMAEQLQ+TFQGAA  +GIP FD QQYY TMQQVMQ
Sbjct  1     MTGLLNDPSIKELAEQIAKDPSFNQMAEQLQKTFQGAAVEEGIPNFDSQQYYSTMQQVMQ  60

Query  1063  NPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQG  884
             NPQFMTMAERLG+ALMQDPSMS MLE+L+NP+QK+Q+EERMARIKEDPSLKPILEEIE G
Sbjct  61    NPQFMTMAERLGSALMQDPSMSGMLENLTNPSQKNQIEERMARIKEDPSLKPILEEIESG  120

Query  883   GPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtd-eaeeasedeSIVHHCASVGD  707
             GPAAMMRYWND+DVLKKLGEAMGF   GE ATS       E E+A+EDES+VH CASVGD
Sbjct  121   GPAAMMRYWNDQDVLKKLGEAMGFAVVGEGATSAGVSGTDETEDANEDESVVHQCASVGD  180

Query  706   EEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHY  527
              EGLK+A+A GADKDEEDSEGRTALHFACGYGEVKCAQ+LLE+GAKVDALDKNKNTALHY
Sbjct  181   AEGLKSAIATGADKDEEDSEGRTALHFACGYGEVKCAQVLLEAGAKVDALDKNKNTALHY  240

Query  526   AAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             AAGYGRKECVALLLENGAAVTLQN+DGKTPI+VAKLNNQN+VLKLLEKDAFL
Sbjct  241   AAGYGRKECVALLLENGAAVTLQNLDGKTPIDVAKLNNQNEVLKLLEKDAFL  292



>gb|AHA84120.1| ankyrin-repeat protein [Phaseolus vulgaris]
Length=347

 Score =   493 bits (1268),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 263/349 (75%), Positives = 293/349 (84%), Gaps = 7/349 (2%)
 Frame = -1

Query  1408  SQEEKNLPAQKQDEKSGAADSKKPL-ESTSLDTQSgqggaplaagpGMHNPFDFSAMTGL  1232
             S  +K+ PA   D+K+G  ++K    E++S D+ +GQ  A   A     NPFDFS M+GL
Sbjct  3     SDSKKDFPA---DDKAGTTENKASHDETSSKDSPAGQRAASGPATGFPGNPFDFSGMSGL  59

Query  1231  LNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQNPQF  1052
             LNDPSIKELAEQIAKDPSF QMAEQLQ+TFQGA   D +P FD QQY+ TMQQVMQNP F
Sbjct  60    LNDPSIKELAEQIAKDPSFNQMAEQLQKTFQGAPP-DSVPNFDNQQYFSTMQQVMQNPNF  118

Query  1051  MTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAA  872
             MTMAERLGNALMQDPSMS+MLES SNP+ KDQLEERMARIKEDPSLK IL+EIE GGPAA
Sbjct  119   MTMAERLGNALMQDPSMSAMLESFSNPSNKDQLEERMARIKEDPSLKHILDEIETGGPAA  178

Query  871   MMRYWNDKDVLKKLGEAMGFPgagetatsge--tgtdeaeeasedeSIVHHCASVGDEEG  698
             MMRYWND+DVL+KLG+AMG P +GE   + E     +  +  +EDESIVHH ASVGD EG
Sbjct  179   MMRYWNDEDVLRKLGQAMGLPNSGEAGATAEILGSDETEDLGNEDESIVHHTASVGDVEG  238

Query  697   LKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAG  518
             LK ALA+GADKDEEDSEGRTALHFACGYGEVKCAQILLE+GAKVDALDKNKNTALHYAAG
Sbjct  239   LKTALASGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGAKVDALDKNKNTALHYAAG  298

Query  517   YGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             YGRK+CVALLLENGAAVTLQNMDGKTPI+VAKLNNQN+VLKLLEKDAFL
Sbjct  299   YGRKDCVALLLENGAAVTLQNMDGKTPIDVAKLNNQNEVLKLLEKDAFL  347



>ref|XP_006492896.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Citrus 
sinensis]
Length=350

 Score =   491 bits (1264),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 247/298 (83%), Positives = 266/298 (89%), Gaps = 1/298 (0%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAM+GLLNDPSIKELAEQIAKDP+F  MAEQLQ+T  GA + + IPQFD  QYY 
Sbjct  54    NPFDFSAMSGLLNDPSIKELAEQIAKDPAFNSMAEQLQKTLHGANAEESIPQFDTTQYYS  113

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFMTMAERLGNALMQDPSMS MLESL+NP +KDQ+EERMA+IKEDPSLKPI
Sbjct  114   TMQQVMQNPQFMTMAERLGNALMQDPSMSHMLESLTNPTKKDQIEERMAKIKEDPSLKPI  173

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeasedeSIVHH  725
             L+EIE GGP+AMM+YWNDKDVL+KLGEAMG    G  AT+        E  +EDESIVHH
Sbjct  174   LDEIESGGPSAMMKYWNDKDVLQKLGEAMGL-AVGGDATTSADNAGADEAGNEDESIVHH  232

Query  724   CASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNK  545
              ASVGD EGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLE+GA VDALDKNK
Sbjct  233   TASVGDAEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGANVDALDKNK  292

Query  544   NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPI+VAKLN+Q+DVLKLLEKDAFL
Sbjct  293   NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNSQHDVLKLLEKDAFL  350



>ref|XP_006577821.1| PREDICTED: uncharacterized protein LOC100797622 isoform X1 [Glycine 
max]
Length=342

 Score =   491 bits (1264),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 250/300 (83%), Positives = 268/300 (89%), Gaps = 3/300 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAM+GLLNDPSIKELAEQIAKDPSF QMAEQLQ+TFQGA   D +P FD QQY+ 
Sbjct  44    NPFDFSAMSGLLNDPSIKELAEQIAKDPSFNQMAEQLQKTFQGA-PQDAMPSFDNQQYFS  102

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNP FMTMAERLGNALMQDPSMS+MLES SNP+ KDQLEERM RIKEDPSLK I
Sbjct  103   TMQQVMQNPNFMTMAERLGNALMQDPSMSAMLESFSNPSNKDQLEERMTRIKEDPSLKHI  162

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeea--sedeSIV  731
             LEEIE GGPAAMMRYWND++VL+KLG+AMG   +G+   S E    +  E   +EDESIV
Sbjct  163   LEEIETGGPAAMMRYWNDEEVLRKLGQAMGLANSGDVGASAENSGADETEDLGNEDESIV  222

Query  730   HHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDK  551
             HH ASVGD EGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQ+LLE+GAKVDALDK
Sbjct  223   HHTASVGDVEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQVLLEAGAKVDALDK  282

Query  550   NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPI+VAKLNNQN+VLKLLEKDAFL
Sbjct  283   NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNNQNEVLKLLEKDAFL  342



>ref|XP_007148690.1| hypothetical protein PHAVU_005G006400g [Phaseolus vulgaris]
 gb|ESW20684.1| hypothetical protein PHAVU_005G006400g [Phaseolus vulgaris]
Length=347

 Score =   490 bits (1262),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 263/349 (75%), Positives = 292/349 (84%), Gaps = 7/349 (2%)
 Frame = -1

Query  1408  SQEEKNLPAQKQDEKSGAADSKKPL-ESTSLDTQSgqggaplaagpGMHNPFDFSAMTGL  1232
             S  +K+ PA   D+K+G  ++K    E++S D+ +GQ  A   A     NPFDFS M+GL
Sbjct  3     SDSKKDFPA---DDKAGTTENKASHDETSSKDSPAGQRAASGPATGFPGNPFDFSGMSGL  59

Query  1231  LNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQNPQF  1052
             LNDPSIKELAEQIAKDPSF QMAEQLQ+TFQGA   D +P FD QQY+ TMQQVMQNP F
Sbjct  60    LNDPSIKELAEQIAKDPSFNQMAEQLQKTFQGAPP-DSVPNFDNQQYFSTMQQVMQNPNF  118

Query  1051  MTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAA  872
             MTMAERLGNALMQDPSMS+MLES SNP+ KDQLEERMARIKEDPSLK IL+EIE GGPAA
Sbjct  119   MTMAERLGNALMQDPSMSAMLESFSNPSNKDQLEERMARIKEDPSLKHILDEIETGGPAA  178

Query  871   MMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeea--sedeSIVHHCASVGDEEG  698
             MMRYWND+DVL+KLG+AMG   +GE   + E    +  E   +EDESIVHH ASVGD EG
Sbjct  179   MMRYWNDEDVLRKLGQAMGLANSGEAGATAENSGVDETEDLGNEDESIVHHTASVGDVEG  238

Query  697   LKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAG  518
             LK ALA+GADKDEEDSEGRTALHFACGYGEVKCAQILLE+GAKVDALDKNKNTALHYAAG
Sbjct  239   LKTALASGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGAKVDALDKNKNTALHYAAG  298

Query  517   YGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             YGRK+CVALLLENGAAVTLQNMDGKTPI+VAKLNNQN+VLKLLEKDAFL
Sbjct  299   YGRKDCVALLLENGAAVTLQNMDGKTPIDVAKLNNQNEVLKLLEKDAFL  347



>ref|XP_004139984.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Cucumis 
sativus]
 ref|XP_004154520.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Cucumis 
sativus]
 gb|KGN46628.1| hypothetical protein Csa_6G115630 [Cucumis sativus]
Length=359

 Score =   490 bits (1262),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 241/299 (81%), Positives = 262/299 (88%), Gaps = 1/299 (0%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAMTGLLNDPSI+ELA QIAKDP+F QMA QLQ+TFQGA++    PQFD QQYY 
Sbjct  61    NPFDFSAMTGLLNDPSIQELASQIAKDPAFNQMASQLQKTFQGASAQQSTPQFDTQQYYS  120

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLE+ +NP+ K+QLEERMA+IKEDPSLKPI
Sbjct  121   TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLETFANPSNKEQLEERMAQIKEDPSLKPI  180

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPga-getatsgetgtdeaeeasedeSIVH  728
             L+EIE GGPAAMMRYWND+DVLKKLGEAMGF               D  E  ++DES+VH
Sbjct  181   LDEIETGGPAAMMRYWNDRDVLKKLGEAMGFAVYGDAANAESSAADDSEEVGNDDESVVH  240

Query  727   HCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKN  548
               ASVGD EGLKNALAAGA+KDEEDSEGRTALHFACGYGE KCAQILLE+G KVDALDKN
Sbjct  241   QTASVGDAEGLKNALAAGANKDEEDSEGRTALHFACGYGETKCAQILLEAGVKVDALDKN  300

Query  547   KNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             KNTALHYAAGYGRKECVALLLENGAAVTLQN+DGKTPI+VAKLNNQ++VLKLLEKD FL
Sbjct  301   KNTALHYAAGYGRKECVALLLENGAAVTLQNLDGKTPIDVAKLNNQHEVLKLLEKDVFL  359



>gb|KDO50173.1| hypothetical protein CISIN_1g018578mg [Citrus sinensis]
 gb|KDO50174.1| hypothetical protein CISIN_1g018578mg [Citrus sinensis]
 gb|KDO50175.1| hypothetical protein CISIN_1g018578mg [Citrus sinensis]
 gb|KDO50176.1| hypothetical protein CISIN_1g018578mg [Citrus sinensis]
Length=353

 Score =   489 bits (1259),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 244/300 (81%), Positives = 265/300 (88%), Gaps = 2/300 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAM+GLLNDPSIKELAEQIAKDP+F  MAEQLQ+T  GA + + IPQFD  QYY 
Sbjct  54    NPFDFSAMSGLLNDPSIKELAEQIAKDPAFNSMAEQLQKTLHGANAEESIPQFDTTQYYS  113

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFMTMAERLGNALMQDPSMS M+ESL+NP +KDQ+EERMA+IKEDPSLKPI
Sbjct  114   TMQQVMQNPQFMTMAERLGNALMQDPSMSHMMESLTNPTKKDQIEERMAKIKEDPSLKPI  173

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPg--agetatsgetgtdeaeeasedeSIV  731
             L+EIE GGP+AMM+YWNDKDVL+KLGEAMG        T+       +  E  +EDESIV
Sbjct  174   LDEIESGGPSAMMKYWNDKDVLQKLGEAMGLAVGGDATTSADNAGADEAEEVGNEDESIV  233

Query  730   HHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDK  551
             HH ASVGD EGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLE+GA VDALDK
Sbjct  234   HHTASVGDAEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGANVDALDK  293

Query  550   NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPI+VAKLN+Q+DVLKLLEKDAFL
Sbjct  294   NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNSQHDVLKLLEKDAFL  353



>ref|NP_001241477.1| uncharacterized protein LOC100784610 [Glycine max]
 ref|XP_006580987.1| PREDICTED: uncharacterized protein LOC100784610 isoform X1 [Glycine 
max]
 gb|ACU23714.1| unknown [Glycine max]
 gb|KHN20584.1| Ankyrin repeat domain-containing protein 2 [Glycine soja]
Length=352

 Score =   487 bits (1253),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 265/354 (75%), Positives = 292/354 (82%), Gaps = 12/354 (3%)
 Frame = -1

Query  1408  SQEEKNLPAQKQDEKSGAADSKKPL-ESTSLDT---QSgqggaplaagpGMH--NPFDFS  1247
             S  +K+ PA   D+K+G  +SK    E++S D+   Q          GP  H  NPFD S
Sbjct  3     SDSKKDFPA---DDKAGTEESKTSKDETSSKDSPAEQRATATFGPRPGPAGHPGNPFDLS  59

Query  1246  AMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVM  1067
             AM+GLLNDPSIKELAEQIAKDPSF QMAEQLQ+TFQGA   D IP FD QQY+ TMQQVM
Sbjct  60    AMSGLLNDPSIKELAEQIAKDPSFNQMAEQLQKTFQGA-PQDAIPSFDNQQYFSTMQQVM  118

Query  1066  QNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQ  887
             QNP FMTMAERLGNALMQDPSMS+MLES SNP+ KDQLEERMARIKEDPSLK ILEEIE 
Sbjct  119   QNPNFMTMAERLGNALMQDPSMSAMLESFSNPSNKDQLEERMARIKEDPSLKHILEEIET  178

Query  886   GGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeea--sedeSIVHHCASV  713
             GGPAAMMRYWN+++VL+KLG+AMG   +G+   S E    +  E   +EDESIVHH ASV
Sbjct  179   GGPAAMMRYWNNEEVLQKLGQAMGLANSGDAGASAENSGADETEDLGNEDESIVHHTASV  238

Query  712   GDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTAL  533
             GD EGLKNALA+GADKDEEDSEGRTALHFACGYGEVKCAQ+LLE+GAKVDALDKNKNTAL
Sbjct  239   GDVEGLKNALASGADKDEEDSEGRTALHFACGYGEVKCAQVLLEAGAKVDALDKNKNTAL  298

Query  532   HYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             HYAAGYGRKECVALLLENGAAVTLQNMDGKTPI+VAKLNNQN+VLKLLEKDAFL
Sbjct  299   HYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNNQNEVLKLLEKDAFL  352



>emb|CDG58550.1| Ankyrin repeat domain containg protein 2 [Cucumis sativus]
Length=359

 Score =   487 bits (1253),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 240/299 (80%), Positives = 261/299 (87%), Gaps = 1/299 (0%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAMTGLLNDPSI+ELA QIAKDP+F QMA QLQ+TFQGA++    PQFD QQYY 
Sbjct  61    NPFDFSAMTGLLNDPSIQELASQIAKDPAFNQMASQLQKTFQGASAQQSTPQFDTQQYYS  120

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLE+ +NP+ K+QLEERMA+IKEDPSLKPI
Sbjct  121   TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLETFANPSNKEQLEERMAQIKEDPSLKPI  180

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPga-getatsgetgtdeaeeasedeSIVH  728
             L+EIE GGPAAMMRYWND+DVLKKLGEAMGF               D  E  ++DES+VH
Sbjct  181   LDEIETGGPAAMMRYWNDRDVLKKLGEAMGFAVYGDAANAESSAADDSEEVGNDDESVVH  240

Query  727   HCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKN  548
               ASVGD EGLKNALAAGA+KDE DSEGRTALHFACGYGE KCAQILLE+G KVDALDKN
Sbjct  241   QTASVGDAEGLKNALAAGANKDEGDSEGRTALHFACGYGETKCAQILLEAGVKVDALDKN  300

Query  547   KNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             KNTALHYAAGYGRKECVALLLENGAAVTLQN+DGKTPI+VAKLNNQ++VLKLLEKD FL
Sbjct  301   KNTALHYAAGYGRKECVALLLENGAAVTLQNLDGKTPIDVAKLNNQHEVLKLLEKDVFL  359



>ref|XP_010686618.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Beta 
vulgaris subsp. vulgaris]
Length=344

 Score =   485 bits (1248),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 251/301 (83%), Positives = 265/301 (88%), Gaps = 5/301 (2%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAM+GLLNDPSIKELAEQIAKDP+F QMAEQLQ+TF G    +  PQFDPQQYY 
Sbjct  46    NPFDFSAMSGLLNDPSIKELAEQIAKDPAFNQMAEQLQKTFHGGPVEE--PQFDPQQYYS  103

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVM+NPQFM MAERLG ALMQDPSMS MLE+L NPAQKDQLEERM+RIKEDP+LKPI
Sbjct  104   TMQQVMENPQFMAMAERLGGALMQDPSMSGMLENLVNPAQKDQLEERMSRIKEDPALKPI  163

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetg---tdeaeeasedeSI  734
             LEEIE GGPAAMMRYWNDKDVL+KLGEAMG    GE ATS E       E     EDESI
Sbjct  164   LEEIETGGPAAMMRYWNDKDVLQKLGEAMGLAVTGEGATSTERSVPDESEEGGNEEDESI  223

Query  733   VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
             VHH ASVGD EGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQ LLE+GAK DALD
Sbjct  224   VHHTASVGDVEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQTLLEAGAKADALD  283

Query  553   KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAF  374
             KNKNTALHYAAGYGRKECVALLLENGAAVTLQN+DGKTPI+VAKLNNQ++VLKLLEKDAF
Sbjct  284   KNKNTALHYAAGYGRKECVALLLENGAAVTLQNLDGKTPIDVAKLNNQHEVLKLLEKDAF  343

Query  373   L  371
             L
Sbjct  344   L  344



>gb|EYU26543.1| hypothetical protein MIMGU_mgv1a009315mg [Erythranthe guttata]
Length=346

 Score =   484 bits (1245),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 242/301 (80%), Positives = 268/301 (89%), Gaps = 1/301 (0%)
 Frame = -1

Query  1270  MHNPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQY  1091
             M NPFDFSAM+GLLNDPSIKELAEQIAKDPSF QMAEQLQ+TFQG A  +GIP FDPQQY
Sbjct  46    MPNPFDFSAMSGLLNDPSIKELAEQIAKDPSFNQMAEQLQKTFQGDAVEEGIPSFDPQQY  105

Query  1090  YGTMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLK  911
             Y TMQQVMQNPQFM MAE+LG+ALMQDP+MS +LE+ +NPA KDQLEERMAR+KEDPSLK
Sbjct  106   YSTMQQVMQNPQFMNMAEKLGSALMQDPAMSGVLENFTNPANKDQLEERMARVKEDPSLK  165

Query  910   PILEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPg-agetatsgetgtdeaeeasedeSI  734
             PILEEIE GGP AMMRYWNDK+VL+KLGEAMGF        ++G+T  DE EE +++ESI
Sbjct  166   PILEEIENGGPTAMMRYWNDKEVLQKLGEAMGFAVGGEGATSAGDTVEDETEEVNDEESI  225

Query  733   VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
             VHH AS+GD EGLK AL+ GADKDEEDSEGRTALHFACGYGEVKC+QILLE+GAKVD LD
Sbjct  226   VHHTASIGDVEGLKKALSEGADKDEEDSEGRTALHFACGYGEVKCSQILLEAGAKVDTLD  285

Query  553   KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAF  374
             KNKNT LHYAAGYGRKECV LLL+NGAAVTLQN+DGKTPI+VAKLNNQ+DVLKLLEKD F
Sbjct  286   KNKNTPLHYAAGYGRKECVELLLKNGAAVTLQNLDGKTPIDVAKLNNQSDVLKLLEKDVF  345

Query  373   L  371
             L
Sbjct  346   L  346



>gb|KEH32864.1| TGB12K interacting protein [Medicago truncatula]
Length=348

 Score =   483 bits (1244),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 252/349 (72%), Positives = 281/349 (81%), Gaps = 6/349 (2%)
 Frame = -1

Query  1408  SQEEKNLPAQKQDEKSGAADSKKPLESTSLDTQSgqggaplaagpGMHNPFDFSAMTGLL  1229
             S  +K++P+   DEK+G+A++K   +  S +   G G           NPFDFSAM+GLL
Sbjct  3     SNSQKDIPS---DEKAGSAENKNTKDEASSNATPGPGTGFPPGTGFQANPFDFSAMSGLL  59

Query  1228  NDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQNPQFM  1049
             NDPSIKELAEQIAKDPSF QMAEQLQ+T  G A  DG+P FD QQY  +MQQVM NP FM
Sbjct  60    NDPSIKELAEQIAKDPSFNQMAEQLQKTLHGGAPQDGLPNFDNQQYLSSMQQVMANPNFM  119

Query  1048  TMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAAM  869
             TMAERLGNALMQDPSMSSMLES +NP+ K QLEERMARIKEDPSLK IL+EIE GGPA M
Sbjct  120   TMAERLGNALMQDPSMSSMLESFTNPSNKVQLEERMARIKEDPSLKHILDEIENGGPAVM  179

Query  868   MRYWNDKDVLKKLGEAMGFPgagetatsgetgt---deaeeasedeSIVHHCASVGDEEG  698
             MRYWND++VLKKLG AMG P     A +    +   +  +  +EDESIVHH ASVGD EG
Sbjct  180   MRYWNDEEVLKKLGLAMGIPPTSGDAAASSENSGPDETEDVGTEDESIVHHTASVGDIEG  239

Query  697   LKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAG  518
             LK ALA+GADKDEEDSEGRTALHFACGYGEVKCAQ LLE+GAKVDALDKNKNTALHYAAG
Sbjct  240   LKAALASGADKDEEDSEGRTALHFACGYGEVKCAQALLEAGAKVDALDKNKNTALHYAAG  299

Query  517   YGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             YGRKECVALLLENGAAVTLQNMDGKTPI+VAKLNNQ+DVL+LLEKD FL
Sbjct  300   YGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNNQDDVLQLLEKDVFL  348



>gb|KHG19795.1| Ankyrin repeat domain-containing 2 -like protein [Gossypium arboreum]
Length=360

 Score =   483 bits (1243),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 241/299 (81%), Positives = 267/299 (89%), Gaps = 1/299 (0%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAM+GLL DPSIK LAEQIAKDPSF QMAEQL   FQGA++ + +P+F+PQQYY 
Sbjct  62    NPFDFSAMSGLLEDPSIKTLAEQIAKDPSFNQMAEQLTMMFQGASAEESLPEFEPQQYYS  121

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFMTMAE LGNALMQDP+ SSMLESLSNP QKDQ+EERMARIKEDPSLK I
Sbjct  122   TMQQVMQNPQFMTMAEHLGNALMQDPATSSMLESLSNPQQKDQIEERMARIKEDPSLKHI  181

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPga-getatsgetgtdeaeeasedeSIVH  728
             LEEIE GGPAAMMRYWNDK+VL+KLGEAMG   +     + G    DE +  +EDESIVH
Sbjct  182   LEEIETGGPAAMMRYWNDKEVLQKLGEAMGLADSGDAAISVGNAAADEDDVGNEDESIVH  241

Query  727   HCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKN  548
             HCASVGD EGLK ALA+GADKDEED+EGRTALHFACGYGE+KCAQIL+E+GA+VDALDKN
Sbjct  242   HCASVGDVEGLKTALASGADKDEEDAEGRTALHFACGYGEMKCAQILVEAGARVDALDKN  301

Query  547   KNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             KNTALHYAAGYGRK+CVALLLENGAAVTLQNMDGKTPIEVAKLNNQ++V+KLLE+DAFL
Sbjct  302   KNTALHYAAGYGRKDCVALLLENGAAVTLQNMDGKTPIEVAKLNNQHEVVKLLEEDAFL  360



>gb|ACJ85238.1| unknown [Medicago truncatula]
Length=348

 Score =   482 bits (1240),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 251/349 (72%), Positives = 280/349 (80%), Gaps = 6/349 (2%)
 Frame = -1

Query  1408  SQEEKNLPAQKQDEKSGAADSKKPLESTSLDTQSgqggaplaagpGMHNPFDFSAMTGLL  1229
             S  +K++P+   DEK+G+A++K   +  S +   G G           NPFDFSAM+GLL
Sbjct  3     SNSQKDIPS---DEKAGSAENKNTKDEASSNATPGPGTGFPPGTGFQANPFDFSAMSGLL  59

Query  1228  NDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQNPQFM  1049
             NDPSIKELAEQIAKDPSF QMAEQLQ+T  G A  DG+P FD QQY  +MQQVM NP FM
Sbjct  60    NDPSIKELAEQIAKDPSFNQMAEQLQKTLHGGAPQDGLPNFDNQQYLSSMQQVMANPNFM  119

Query  1048  TMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAAM  869
             TMAERLGNALMQDPSMSSMLES +NP+ K QLEERM RIKEDPSLK IL+EIE GGPA M
Sbjct  120   TMAERLGNALMQDPSMSSMLESFTNPSNKVQLEERMVRIKEDPSLKHILDEIENGGPAVM  179

Query  868   MRYWNDKDVLKKLGEAMGFPgagetatsgetgt---deaeeasedeSIVHHCASVGDEEG  698
             MRYWND++VLKKLG AMG P     A +    +   +  +  +EDESIVHH ASVGD EG
Sbjct  180   MRYWNDEEVLKKLGLAMGIPPTSGDAAASSENSGPDETEDVGTEDESIVHHTASVGDIEG  239

Query  697   LKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAG  518
             LK ALA+GADKDEEDSEGRTALHFACGYGEVKCAQ LLE+GAKVDALDKNKNTALHYAAG
Sbjct  240   LKAALASGADKDEEDSEGRTALHFACGYGEVKCAQALLEAGAKVDALDKNKNTALHYAAG  299

Query  517   YGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             YGRKECVALLLENGAAVTLQNMDGKTPI+VAKLNNQ+DVL+LLEKD FL
Sbjct  300   YGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNNQDDVLQLLEKDVFL  348



>gb|KHG20995.1| Ankyrin repeat domain-containing 2 -like protein [Gossypium arboreum]
Length=308

 Score =   479 bits (1233),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 241/299 (81%), Positives = 269/299 (90%), Gaps = 1/299 (0%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAM+GLLNDPSIKELAEQIAKDPSF QMAEQL +TFQGAA  + IPQFDPQQYY 
Sbjct  10    NPFDFSAMSGLLNDPSIKELAEQIAKDPSFNQMAEQLSKTFQGAAVEESIPQFDPQQYYS  69

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFM+MAE LGNALMQDP+MSSML+SL+NP  KDQ+EERM+RIKEDPSLK I
Sbjct  70    TMQQVMQNPQFMSMAEHLGNALMQDPAMSSMLDSLTNPQHKDQIEERMSRIKEDPSLKHI  129

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPga-getatsgetgtdeaeeasedeSIVH  728
             LEEIE  GPAAMMRYWNDK+VL+KLGEAMG   +     ++G +  DE +  +EDES+VH
Sbjct  130   LEEIETSGPAAMMRYWNDKEVLQKLGEAMGVASSGDAATSAGNSAADEGDVGNEDESVVH  189

Query  727   HCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKN  548
             +CASVGD EGLK AL +GADKDEEDSEGRTALHFACGYGEVKCAQILLE+GA VDALDKN
Sbjct  190   NCASVGDVEGLKAALDSGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGAAVDALDKN  249

Query  547   KNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             KNTALHYAAGYGRK+CVALLL+NGAAVTLQNMDGKTPI+VAKLN+Q++V+KLLEKDAFL
Sbjct  250   KNTALHYAAGYGRKDCVALLLKNGAAVTLQNMDGKTPIDVAKLNDQHEVVKLLEKDAFL  308



>ref|XP_004499676.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Cicer 
arietinum]
Length=340

 Score =   479 bits (1233),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 245/300 (82%), Positives = 264/300 (88%), Gaps = 3/300 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAM+GLLNDPSIKELAEQIAKDPSF QMAEQLQ+T  GA + +GIP FD QQY+ 
Sbjct  42    NPFDFSAMSGLLNDPSIKELAEQIAKDPSFNQMAEQLQKTLHGA-TQEGIPNFDNQQYFS  100

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNP FMTMAERLGNALMQDPSMSSMLES +NP+ KDQLEERMARIKEDPSLK I
Sbjct  101   TMQQVMQNPNFMTMAERLGNALMQDPSMSSMLESFTNPSNKDQLEERMARIKEDPSLKHI  160

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetg--tdeaeeasedeSIV  731
             L+EIE GGP AMMRYWND++VLKKLG AMG P  G+ A S E     +  +  +EDESIV
Sbjct  161   LDEIETGGPTAMMRYWNDEEVLKKLGLAMGLPTPGDAAASSENSGPDETEDVGNEDESIV  220

Query  730   HHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDK  551
             H  ASVGD EGLK  LA+GADKDEEDSEGRTALHFACGYGEVKCAQ+LLE+GAKVDALDK
Sbjct  221   HQTASVGDVEGLKTVLASGADKDEEDSEGRTALHFACGYGEVKCAQVLLEAGAKVDALDK  280

Query  550   NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPI+VAKLNNQNDVL+LLEKD FL
Sbjct  281   NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNNQNDVLQLLEKDVFL  340



>ref|XP_006349382.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Solanum 
tuberosum]
Length=351

 Score =   473 bits (1216),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 280/351 (80%), Positives = 306/351 (87%), Gaps = 4/351 (1%)
 Frame = -1

Query  1411  MSQEEKNLPAQKQDEKSGAADSKKPLESTSLDT--QSgqggaplaagpGMHNPFDFSAMT  1238
             MS+ EK LP   +DEKSGAA+SKK  ES++++     G+  +  AAG G+ NPFDFSAM+
Sbjct  1     MSEGEKVLPTASKDEKSGAAESKKSSESSTMEAPLGEGRTASTAAAGAGVQNPFDFSAMS  60

Query  1237  GLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQNP  1058
             GLLNDPSIKELAEQIAKDP+F QMAEQLQ+TFQGAA  + +P FD QQYY TMQQVMQNP
Sbjct  61    GLLNDPSIKELAEQIAKDPAFNQMAEQLQKTFQGAAVEESVPNFDSQQYYSTMQQVMQNP  120

Query  1057  QFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGP  878
             QFMTMAERLGNALMQDPSMS MLESLSNPAQK+QLEERMARIKEDPSLKPILEEIE GGP
Sbjct  121   QFMTMAERLGNALMQDPSMSGMLESLSNPAQKEQLEERMARIKEDPSLKPILEEIESGGP  180

Query  877   AAMMRYWNDKDVLKKLGEAMGFPgagetatsgetg--tdeaeeasedeSIVHHCASVGDE  704
             AAMMRYWND+DVLKK+GEAMGF   GE   +       DE EEA+EDES+VH CASVGD 
Sbjct  181   AAMMRYWNDQDVLKKIGEAMGFAAGGEGGATSSEIPGPDETEEANEDESVVHQCASVGDA  240

Query  703   EGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYA  524
             EGLK ALAAGADKDEEDSEGRTALHFACGYGEVKCAQ+L+E+GAKVDALDKNKNTALHYA
Sbjct  241   EGLKAALAAGADKDEEDSEGRTALHFACGYGEVKCAQLLVEAGAKVDALDKNKNTALHYA  300

Query  523   AGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             AGYGRKECVALLLENGAAVTLQN+DGKTPI+VAKLNNQ DVLKLLEKDAFL
Sbjct  301   AGYGRKECVALLLENGAAVTLQNLDGKTPIDVAKLNNQQDVLKLLEKDAFL  351



>gb|EPS72852.1| hypothetical protein M569_01905, partial [Genlisea aurea]
Length=306

 Score =   471 bits (1211),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 236/298 (79%), Positives = 271/298 (91%), Gaps = 0/298 (0%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFS+M+GLLNDPSIK+LAEQIAKDP+F Q+AEQLQ++ QGA +   IP FD QQYY 
Sbjct  9     NPFDFSSMSGLLNDPSIKDLAEQIAKDPAFNQLAEQLQKSLQGAPAEYAIPNFDTQQYYS  68

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFM MA+RLG+ALMQDP+MS MLESLSNPA KDQLEERMARIKEDPSLKPI
Sbjct  69    TMQQVMQNPQFMNMAQRLGSALMQDPAMSGMLESLSNPANKDQLEERMARIKEDPSLKPI  128

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeasedeSIVHH  725
             LEEIE GGPAAMMRYWNDKDVL+KLGEAMGF   GE+ATSG+   +E E+ +++ESIVHH
Sbjct  129   LEEIENGGPAAMMRYWNDKDVLQKLGEAMGFAAGGESATSGDAAEEETEDGNDEESIVHH  188

Query  724   CASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNK  545
              AS+GD+EGLK AL+ GA+KDEED+EGRTALHFACGYGEVKCA+ILL++GAKVD LDKNK
Sbjct  189   TASIGDDEGLKKALSDGANKDEEDAEGRTALHFACGYGEVKCARILLDAGAKVDTLDKNK  248

Query  544   NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NT LHYAAGYGRKECV LLL++GA+VTLQN+DGKTPI+VAKLNNQN++LKLLEK+AFL
Sbjct  249   NTPLHYAAGYGRKECVELLLKHGASVTLQNLDGKTPIDVAKLNNQNELLKLLEKNAFL  306



>ref|XP_006840277.1| hypothetical protein AMTR_s00045p00049310 [Amborella trichopoda]
 gb|ERN01952.1| hypothetical protein AMTR_s00045p00049310 [Amborella trichopoda]
Length=342

 Score =   470 bits (1210),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 244/301 (81%), Positives = 264/301 (88%), Gaps = 4/301 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAM+GLLNDPSIKELAEQIAKDPSF QMAE LQ++ QGA   DGIPQ D QQY+ 
Sbjct  43    NPFDFSAMSGLLNDPSIKELAEQIAKDPSFNQMAEVLQKSVQGAG-QDGIPQLDTQQYFS  101

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFMTM ERLGNALMQDPSMS MLESL+NPAQK+QLEERM+R++EDPSLK I
Sbjct  102   TMQQVMQNPQFMTMTERLGNALMQDPSMSGMLESLTNPAQKEQLEERMSRVREDPSLKHI  161

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetg---tdeaeeasedeSI  734
             +EEIE GGPAAMMRYWND +VL KLG+AMG   AGE ATS E       E E   EDES 
Sbjct  162   IEEIETGGPAAMMRYWNDPEVLSKLGQAMGIGAAGEAATSTEQSGPEEAEEEGGYEDEST  221

Query  733   VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
             VHH ASVGD EGLK+ALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLE+GA VDALD
Sbjct  222   VHHTASVGDVEGLKSALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGAAVDALD  281

Query  553   KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAF  374
             KNKNTALHYAAGYGRKECV LLL++GAAVTLQN+DGK+PI+VAKLNNQ +VLKLLEKDAF
Sbjct  282   KNKNTALHYAAGYGRKECVELLLKSGAAVTLQNLDGKSPIDVAKLNNQQEVLKLLEKDAF  341

Query  373   L  371
             L
Sbjct  342   L  342



>ref|XP_010070187.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Eucalyptus 
grandis]
Length=342

 Score =   466 bits (1199),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 234/298 (79%), Positives = 269/298 (90%), Gaps = 1/298 (0%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAM+ LLNDPSIK+LA+QI+KDP+F +M EQLQ+TFQG+A  +GIPQFDP+QY  
Sbjct  46    NPFDFSAMSNLLNDPSIKDLAQQISKDPAFNEMTEQLQKTFQGSA-GEGIPQFDPRQYQS  104

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFM MAERLG+ALMQDPSMSSMLE+L+NP +K+Q+EERMA +KEDPSLKPI
Sbjct  105   TMQQVMQNPQFMAMAERLGSALMQDPSMSSMLENLANPLRKEQMEERMALMKEDPSLKPI  164

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeasedeSIVHH  725
             LEEIE GGP AMMRYWND+DVLKKLGEAMGFP AG+T TS +   +E +  +EDESIVHH
Sbjct  165   LEEIETGGPTAMMRYWNDRDVLKKLGEAMGFPVAGDTGTSADIPDEEDDAGNEDESIVHH  224

Query  724   CASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNK  545
              ASVGD EGLK AL +GADKDEED+EGRTALHFACGYGEVKC ++LL +GA VDALDKNK
Sbjct  225   TASVGDVEGLKKALDSGADKDEEDAEGRTALHFACGYGEVKCVEVLLGAGATVDALDKNK  284

Query  544   NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NTALHYAAGYGRK+CVALL+++GAAVTLQN+DGKTPI+VAKLNNQ +VLKLLEKDAFL
Sbjct  285   NTALHYAAGYGRKDCVALLVKHGAAVTLQNLDGKTPIDVAKLNNQTEVLKLLEKDAFL  342



>gb|KCW58824.1| hypothetical protein EUGRSUZ_H01461 [Eucalyptus grandis]
Length=348

 Score =   466 bits (1199),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 234/298 (79%), Positives = 269/298 (90%), Gaps = 1/298 (0%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAM+ LLNDPSIK+LA+QI+KDP+F +M EQLQ+TFQG+A  +GIPQFDP+QY  
Sbjct  52    NPFDFSAMSNLLNDPSIKDLAQQISKDPAFNEMTEQLQKTFQGSAG-EGIPQFDPRQYQS  110

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFM MAERLG+ALMQDPSMSSMLE+L+NP +K+Q+EERMA +KEDPSLKPI
Sbjct  111   TMQQVMQNPQFMAMAERLGSALMQDPSMSSMLENLANPLRKEQMEERMALMKEDPSLKPI  170

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeasedeSIVHH  725
             LEEIE GGP AMMRYWND+DVLKKLGEAMGFP AG+T TS +   +E +  +EDESIVHH
Sbjct  171   LEEIETGGPTAMMRYWNDRDVLKKLGEAMGFPVAGDTGTSADIPDEEDDAGNEDESIVHH  230

Query  724   CASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNK  545
              ASVGD EGLK AL +GADKDEED+EGRTALHFACGYGEVKC ++LL +GA VDALDKNK
Sbjct  231   TASVGDVEGLKKALDSGADKDEEDAEGRTALHFACGYGEVKCVEVLLGAGATVDALDKNK  290

Query  544   NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NTALHYAAGYGRK+CVALL+++GAAVTLQN+DGKTPI+VAKLNNQ +VLKLLEKDAFL
Sbjct  291   NTALHYAAGYGRKDCVALLVKHGAAVTLQNLDGKTPIDVAKLNNQTEVLKLLEKDAFL  348



>ref|XP_010250398.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Nelumbo 
nucifera]
Length=352

 Score =   459 bits (1180),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 238/299 (80%), Positives = 262/299 (88%), Gaps = 5/299 (2%)
 Frame = -1

Query  1258  FDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTM  1079
             FDFSAM+ +LNDP IKELAEQIAKDP+FTQMAEQLQ++ +G  S+DGIP FD QQYY TM
Sbjct  56    FDFSAMSNVLNDPVIKELAEQIAKDPAFTQMAEQLQKSVRGT-SDDGIPDFDTQQYYSTM  114

Query  1078  QQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILE  899
             QQVMQNPQFMTMAERLGNALMQDPSMS MLE+L NP+ KD LEERM+RIKEDPSLKPILE
Sbjct  115   QQVMQNPQFMTMAERLGNALMQDPSMSGMLENLVNPSHKD-LEERMSRIKEDPSLKPILE  173

Query  898   EIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetg---tdeaeeasedeSIVH  728
             EIE GGPAAMM+YWND  VL+KLG+AMG    GE ATS +       E E  +EDES VH
Sbjct  174   EIESGGPAAMMKYWNDPVVLQKLGQAMGLAVPGEAATSADLSGPDEGEEETGNEDESSVH  233

Query  727   HCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKN  548
             H AS+GD EGLKN LA+GADKDE+DSEGRTALHFACGYGEVKCAQ+LLE+GA VDALDKN
Sbjct  234   HTASIGDVEGLKNLLASGADKDEQDSEGRTALHFACGYGEVKCAQVLLEAGATVDALDKN  293

Query  547   KNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             KNTALHYAAGYGRKECVA+LLENGAAVTLQN+DGKTPI+VAKLNNQ +VLKLLEKDAFL
Sbjct  294   KNTALHYAAGYGRKECVAILLENGAAVTLQNLDGKTPIDVAKLNNQQEVLKLLEKDAFL  352



>ref|XP_010028894.1| PREDICTED: ankyrin repeat domain-containing protein 2 [Eucalyptus 
grandis]
 gb|KCW55722.1| hypothetical protein EUGRSUZ_I01557 [Eucalyptus grandis]
Length=343

 Score =   456 bits (1173),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 231/300 (77%), Positives = 261/300 (87%), Gaps = 2/300 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFS+M+ +LNDPSIKELAEQIAKDP+F QMAEQLQ+TFQG   ++GIPQFD QQY  
Sbjct  44    NPFDFSSMSNMLNDPSIKELAEQIAKDPAFNQMAEQLQKTFQGVTEDEGIPQFDSQQYMS  103

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             T+QQVM NP FM+MAERLG+ LMQDP+MSSMLE+ SNP+QK+Q+EERMARIK+DPSLK I
Sbjct  104   TIQQVMDNPDFMSMAERLGSVLMQDPAMSSMLENFSNPSQKEQIEERMARIKDDPSLKHI  163

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgt--deaeeasedeSIV  731
             LEEIE+GGP AMMRYWNDKDVL+KLGEAMG    GE ATS +     +E +  +EDE IV
Sbjct  164   LEEIEKGGPPAMMRYWNDKDVLQKLGEAMGLAVTGEAATSAQNSVPDEEDDSGNEDEPIV  223

Query  730   HHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDK  551
             H  AS GD EGLK AL +GADKDE D+EGRTALHFACGYGE KCAQ+LLE+GA VDALDK
Sbjct  224   HQTASAGDVEGLKKALTSGADKDEVDAEGRTALHFACGYGEEKCAQVLLEAGAGVDALDK  283

Query  550   NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NKNTALHYAAGYGRKECV LLL+NGAAVTLQNMDGKTPI+VAKLNNQ++VLKLLEKDAFL
Sbjct  284   NKNTALHYAAGYGRKECVELLLKNGAAVTLQNMDGKTPIDVAKLNNQHEVLKLLEKDAFL  343



>gb|KCW55723.1| hypothetical protein EUGRSUZ_I01557 [Eucalyptus grandis]
 gb|KCW55724.1| hypothetical protein EUGRSUZ_I01557 [Eucalyptus grandis]
Length=313

 Score =   455 bits (1170),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 231/300 (77%), Positives = 261/300 (87%), Gaps = 2/300 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFS+M+ +LNDPSIKELAEQIAKDP+F QMAEQLQ+TFQG   ++GIPQFD QQY  
Sbjct  14    NPFDFSSMSNMLNDPSIKELAEQIAKDPAFNQMAEQLQKTFQGVTEDEGIPQFDSQQYMS  73

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             T+QQVM NP FM+MAERLG+ LMQDP+MSSMLE+ SNP+QK+Q+EERMARIK+DPSLK I
Sbjct  74    TIQQVMDNPDFMSMAERLGSVLMQDPAMSSMLENFSNPSQKEQIEERMARIKDDPSLKHI  133

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgt--deaeeasedeSIV  731
             LEEIE+GGP AMMRYWNDKDVL+KLGEAMG    GE ATS +     +E +  +EDE IV
Sbjct  134   LEEIEKGGPPAMMRYWNDKDVLQKLGEAMGLAVTGEAATSAQNSVPDEEDDSGNEDEPIV  193

Query  730   HHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDK  551
             H  AS GD EGLK AL +GADKDE D+EGRTALHFACGYGE KCAQ+LLE+GA VDALDK
Sbjct  194   HQTASAGDVEGLKKALTSGADKDEVDAEGRTALHFACGYGEEKCAQVLLEAGAGVDALDK  253

Query  550   NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NKNTALHYAAGYGRKECV LLL+NGAAVTLQNMDGKTPI+VAKLNNQ++VLKLLEKDAFL
Sbjct  254   NKNTALHYAAGYGRKECVELLLKNGAAVTLQNMDGKTPIDVAKLNNQHEVLKLLEKDAFL  313



>ref|XP_008776174.1| PREDICTED: LOW QUALITY PROTEIN: ankyrin repeat domain-containing 
protein 2-like [Phoenix dactylifera]
Length=343

 Score =   451 bits (1161),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 238/339 (70%), Positives = 279/339 (82%), Gaps = 5/339 (1%)
 Frame = -1

Query  1375  QDEKSGAADSKKP-LESTSLDTQSgqggaplaagpGMHNPFDFSAMTGLLNDPSIKELAE  1199
             QD+KS + ++K    E++S   QSG   A +       NPFDFS+M+ LLNDP+IK++AE
Sbjct  6     QDDKSSSCENKSSKTEASSAQQQSGHRTASIPTTGFPTNPFDFSSMSNLLNDPTIKDMAE  65

Query  1198  QIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQNPQFMTMAERLGNAL  1019
             QIAKDP F QMAEQLQ++ QGA   DG+PQ DPQQY  TMQQVMQNPQF+TMAERLGNAL
Sbjct  66    QIAKDPVFNQMAEQLQKSVQGAG-QDGLPQLDPQQYISTMQQVMQNPQFITMAERLGNAL  124

Query  1018  MQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAAMMRYWNDKDVL  839
             MQ+P+M+SML++L+NP+QK+QLEER+A +K+DP+LKPIL+EIE GGP AMM+YWND +VL
Sbjct  125   MQEPAMASMLDNLTNPSQKEQLEERLAHVKDDPTLKPILDEIENGGPTAMMKYWNDPEVL  184

Query  838   KKLGEAMGFPgagetatsgetg---tdeaeeasedeSIVHHCASVGDEEGLKNALAAGAD  668
             +KLG+AMG   +GE ATS E       E E   EDES+VHH AS+GD EGLK AL  GAD
Sbjct  185   QKLGQAMGIGSSGEAATSTELSGPEEAEEEGGYEDESVVHHMASIGDVEGLKKALDNGAD  244

Query  667   KDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRKECVALL  488
             KDEEDSEGR ALHFACGYGEVKCAQ+LLE GA VDALDKN NTALHYAAGYGRKECVALL
Sbjct  245   KDEEDSEGRRALHFACGYGEVKCAQVLLEGGATVDALDKNXNTALHYAAGYGRKECVALL  304

Query  487   LENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             LE+GAAVTLQN+DGKTPI+VAKLNNQ +VLKLLEKDAFL
Sbjct  305   LEHGAAVTLQNLDGKTPIDVAKLNNQEEVLKLLEKDAFL  343



>ref|XP_010909790.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Elaeis 
guineensis]
Length=344

 Score =   451 bits (1159),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 238/340 (70%), Positives = 278/340 (82%), Gaps = 6/340 (2%)
 Frame = -1

Query  1375  QDEKSGAADSKKP-LESTSLDTQSgqggaplaagpGM-HNPFDFSAMTGLLNDPSIKELA  1202
             QD+KS + ++K    E++    QSG          G+  NPFDFSAMT LLNDP+IKE+A
Sbjct  6     QDDKSSSGENKSSKTEASCAPQQSGHHRTASTGTTGLPTNPFDFSAMTDLLNDPTIKEMA  65

Query  1201  EQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQNPQFMTMAERLGNA  1022
             EQIA+DP F QMAEQLQ++  GA   +G+PQF+PQQY   MQQ+MQNPQF+TMAE+LGNA
Sbjct  66    EQIARDPVFNQMAEQLQKSVHGAG-QEGLPQFNPQQYISNMQQIMQNPQFVTMAEQLGNA  124

Query  1021  LMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAAMMRYWNDKDV  842
             LMQDP+M+SMLESL+NP+ K+Q+EERMARIK+DPSLKPIL+EIE GGPA MM+YWND +V
Sbjct  125   LMQDPAMTSMLESLTNPSHKEQIEERMARIKDDPSLKPILDEIESGGPATMMKYWNDPEV  184

Query  841   LKKLGEAMGFPgagetatsgetg---tdeaeeasedeSIVHHCASVGDEEGLKNALAAGA  671
             L+KLG+AMG   +GE ATS E       E E   EDES+VHH AS+GD EGLK AL  G 
Sbjct  185   LQKLGQAMGIGSSGEAATSTEHSGPEEAEEEGGYEDESVVHHMASIGDVEGLKKALENGG  244

Query  670   DKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRKECVAL  491
             DKDEEDSEGR ALHF+CGYGEVKCAQ+LLE+GA VDALDKNKNTALHYAAGYGRKECVAL
Sbjct  245   DKDEEDSEGRRALHFSCGYGEVKCAQVLLEAGATVDALDKNKNTALHYAAGYGRKECVAL  304

Query  490   LLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             LLE+GAAVTLQN+DGKTPI+VAKLNNQ +VLKLLEKDAFL
Sbjct  305   LLEHGAAVTLQNLDGKTPIDVAKLNNQEEVLKLLEKDAFL  344



>gb|KDO50178.1| hypothetical protein CISIN_1g018578mg [Citrus sinensis]
Length=334

 Score =   447 bits (1151),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 230/300 (77%), Positives = 248/300 (83%), Gaps = 21/300 (7%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAM+GLLNDPSIKELAEQIAKDP+F  MAEQLQ+T  GA + + IPQFD  QYY 
Sbjct  54    NPFDFSAMSGLLNDPSIKELAEQIAKDPAFNSMAEQLQKTLHGANAEESIPQFDTTQYYS  113

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFMTMAERLGNALMQ                   +EERMA+IKEDPSLKPI
Sbjct  114   TMQQVMQNPQFMTMAERLGNALMQ-------------------IEERMAKIKEDPSLKPI  154

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPga--getatsgetgtdeaeeasedeSIV  731
             L+EIE GGP+AMM+YWNDKDVL+KLGEAMG        T+       +  E  +EDESIV
Sbjct  155   LDEIESGGPSAMMKYWNDKDVLQKLGEAMGLAVGGDATTSADNAGADEAEEVGNEDESIV  214

Query  730   HHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDK  551
             HH ASVGD EGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLE+GA VDALDK
Sbjct  215   HHTASVGDAEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGANVDALDK  274

Query  550   NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPI+VAKLN+Q+DVLKLLEKDAFL
Sbjct  275   NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNSQHDVLKLLEKDAFL  334



>ref|XP_010526861.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Tarenaya 
hassleriana]
Length=335

 Score =   443 bits (1140),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 218/298 (73%), Positives = 257/298 (86%), Gaps = 2/298 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             N FDFS M+ LLNDPSI++LAEQI++DP+F Q+AEQLQ++F    S+D IPQ DPQQYY 
Sbjct  40    NAFDFSNMSSLLNDPSIQQLAEQISQDPAFNQLAEQLQKSFSNTPSDDSIPQIDPQQYYA  99

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TM QVM+NP F TMAERLGNAL+Q+PSMS ++E+L+NP   +Q  ERMAR+KEDPSLKP+
Sbjct  100   TMTQVMENPGFKTMAERLGNALLQEPSMSHLVENLTNPETTEQFAERMARMKEDPSLKPM  159

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeasedeSIVHH  725
             L+EIE GGP+AMM+YWNDKDVLKKLGEAMG   A        + T+ A+E  E+ESIVHH
Sbjct  160   LDEIEAGGPSAMMKYWNDKDVLKKLGEAMGM--AVPVDQPASSETEGADEGEEEESIVHH  217

Query  724   CASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNK  545
              AS+GD EGLKNALA+G DKDEEDSEGRTALHF+CGYGEVKCAQ+LL++GA V+A+DKNK
Sbjct  218   TASLGDVEGLKNALASGCDKDEEDSEGRTALHFSCGYGEVKCAQVLLDAGANVNAVDKNK  277

Query  544   NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NT LHYAAGYGRKECV+LLLENGAAVTLQNMDGKTPI+VAKLNNQ+DV+KLLEKDAFL
Sbjct  278   NTPLHYAAGYGRKECVSLLLENGAAVTLQNMDGKTPIDVAKLNNQHDVVKLLEKDAFL  335



>ref|XP_008462015.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Cucumis 
melo]
Length=357

 Score =   444 bits (1142),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 229/300 (76%), Positives = 254/300 (85%), Gaps = 4/300 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFS+M+ +LNDPSIK LAEQIAKDPSF QMAEQLQQ FQ   + +GI QFDPQQY+ 
Sbjct  60    NPFDFSSMSDILNDPSIKALAEQIAKDPSFNQMAEQLQQ-FQSPPAQEGI-QFDPQQYFS  117

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNP FM+MAERLG+ LMQDPSMS M ES ++P   DQLEERMA+IKEDPSLKPI
Sbjct  118   TMQQVMQNPHFMSMAERLGSTLMQDPSMSRMFESFASPPDGDQLEERMAQIKEDPSLKPI  177

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFP--gagetatsgetgtdeaeeasedeSIV  731
             LEEIE GG  +MM+YWNDK+VL+KLG+AMG P      T+T      D  E  +EDES V
Sbjct  178   LEEIETGGLPSMMKYWNDKEVLQKLGKAMGLPIPAEAATSTDNAAVDDSEEPENEDESAV  237

Query  730   HHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDK  551
             HH AS GD EGLK ALA+GADKDE DSEGRTALHFA GYGEV+CAQ+LLE+GAKVDALDK
Sbjct  238   HHTASTGDVEGLKKALASGADKDEVDSEGRTALHFASGYGEVECAQVLLEAGAKVDALDK  297

Query  550   NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NKNTALHYAAGYGRK+CVALLLENGAAVTL NMDGKTPI+VAKLNNQN+VLKLLEKDAFL
Sbjct  298   NKNTALHYAAGYGRKDCVALLLENGAAVTLTNMDGKTPIDVAKLNNQNEVLKLLEKDAFL  357



>ref|XP_004957326.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Setaria 
italica]
Length=323

 Score =   442 bits (1137),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 222/301 (74%), Positives = 256/301 (85%), Gaps = 4/301 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFS+M+ LLNDPSI+E+AEQIA DP F QMAEQLQ++ QGA    GIP  DPQQY  
Sbjct  24    NPFDFSSMSSLLNDPSIREMAEQIASDPMFNQMAEQLQKSAQGAGEQ-GIPALDPQQYME  82

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQF++MAERLGNALMQDP+MSSMLE+LS+PA K+QLEERMARIKEDPSLKPI
Sbjct  83    TMQQVMQNPQFVSMAERLGNALMQDPAMSSMLENLSSPAHKEQLEERMARIKEDPSLKPI  142

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGF---PgagetatsgetgtdeaeeasedeSI  734
             L+EIE GGP+AM++YWND +VL+K+G+AMG      +  +         E E   +DESI
Sbjct  143   LDEIENGGPSAMVKYWNDPEVLQKIGQAMGVNLPGDSSASTVLSGPEETEEEGGYDDESI  202

Query  733   VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
             VHH ASVGDEEGLK AL  GADKDEED+EGR ALHFACGYGE+KCA+ILLE+GA VDALD
Sbjct  203   VHHTASVGDEEGLKKALDGGADKDEEDAEGRRALHFACGYGELKCAEILLEAGAAVDALD  262

Query  553   KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAF  374
             KNKNT LHYAAGYGRKECV LLL++GAAVT+QN+DGKTPIEVA+LNNQ++VLKLLEKDAF
Sbjct  263   KNKNTPLHYAAGYGRKECVDLLLKHGAAVTVQNLDGKTPIEVARLNNQDEVLKLLEKDAF  322

Query  373   L  371
             L
Sbjct  323   L  323



>ref|XP_010909897.1| PREDICTED: ankyrin repeat domain-containing protein 2-like isoform 
X1 [Elaeis guineensis]
Length=342

 Score =   442 bits (1138),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 233/338 (69%), Positives = 275/338 (81%), Gaps = 4/338 (1%)
 Frame = -1

Query  1375  QDEKSGAADSKKP-LESTSLDTQSgqggaplaagpGMHNPFDFSAMTGLLNDPSIKELAE  1199
             QD+KS + ++K    E+++   QSG   A         N FDFS M+ LLNDP+IKE+AE
Sbjct  6     QDDKSSSGENKSSKTEASAAQQQSGPSTASTPTTGFPTNSFDFSTMSNLLNDPTIKEMAE  65

Query  1198  QIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQNPQFMTMAERLGNAL  1019
             QIA+DP F QMAEQLQ++ QGA   DG+PQ DPQQY  TMQQVMQNPQF+TMAERLGNAL
Sbjct  66    QIARDPVFNQMAEQLQKSVQGAG-QDGLPQLDPQQYISTMQQVMQNPQFITMAERLGNAL  124

Query  1018  MQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAAMMRYWNDKDVL  839
             MQ+P+M+SML+SL+NP+ K+QLEER+A +K+DP+LKPIL+EIE GGP AMM+YWND +VL
Sbjct  125   MQEPAMASMLDSLTNPSHKEQLEERLAHMKDDPTLKPILDEIENGGPTAMMKYWNDPEVL  184

Query  838   KKLGEAMGFPgagetatsgetg--tdeaeeasedeSIVHHCASVGDEEGLKNALAAGADK  665
             +KLG+AMG   +GE ATS E     +  E   EDES+VHH AS+GD EGLK AL  GADK
Sbjct  185   QKLGQAMGIGSSGEAATSTELSGPEEAEEGGYEDESVVHHMASIGDVEGLKKALEDGADK  244

Query  664   DEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRKECVALLL  485
             DEEDSEGR ALHFACGYGEVKCAQ+LL  GA VDALDKNKNTALHYAAGYGR++CVALLL
Sbjct  245   DEEDSEGRRALHFACGYGEVKCAQLLLGVGATVDALDKNKNTALHYAAGYGREDCVALLL  304

Query  484   ENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             E+GAAVTLQN+DGKTPI+VAKLNNQ +VLKLLEKDAFL
Sbjct  305   EHGAAVTLQNLDGKTPIDVAKLNNQEEVLKLLEKDAFL  342



>ref|NP_001183774.1| ankyrin repeat domain-containing protein 2 [Zea mays]
 gb|ACG38603.1| ankyrin repeat domain-containing protein 2 [Zea mays]
 gb|ACR38264.1| unknown [Zea mays]
 tpg|DAA62247.1| TPA: ankyrin repeat domain-containing protein 2 [Zea mays]
Length=323

 Score =   441 bits (1134),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 222/301 (74%), Positives = 255/301 (85%), Gaps = 4/301 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFS+M+ LLNDPSI+E+AEQIA DP F QMAEQLQ++ QGA    GIP  DPQQY  
Sbjct  24    NPFDFSSMSNLLNDPSIREMAEQIASDPVFNQMAEQLQKSAQGAGEQ-GIPALDPQQYME  82

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQF++MAERLGNALMQDP+MSSMLE+L++PA K+QLEERMARIKEDPSLKPI
Sbjct  83    TMQQVMQNPQFVSMAERLGNALMQDPAMSSMLENLTSPAHKEQLEERMARIKEDPSLKPI  142

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGF---PgagetatsgetgtdeaeeasedeSI  734
             L+EIE GGP+AM++YWND +VL+K+G+AMG      +  +         E E   +DESI
Sbjct  143   LDEIENGGPSAMVKYWNDPEVLQKIGQAMGVNLPGDSSVSTVLSGPEETEEEGGDDDESI  202

Query  733   VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
             VHH ASVGDEEGLK AL  GADKDEED+EGR ALHFACGYGE+KCA+ILLE+GA VDALD
Sbjct  203   VHHTASVGDEEGLKKALEGGADKDEEDAEGRRALHFACGYGELKCAEILLEAGAAVDALD  262

Query  553   KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAF  374
             KNKNT LHYAAGYGRKECV LLL+ GAAVTLQN+DGKTPIEVAKLN+Q++VLKLLEKDAF
Sbjct  263   KNKNTPLHYAAGYGRKECVDLLLKYGAAVTLQNLDGKTPIEVAKLNSQDEVLKLLEKDAF  322

Query  373   L  371
             L
Sbjct  323   L  323



>ref|XP_004144559.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Cucumis 
sativus]
 ref|XP_004162882.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Cucumis 
sativus]
 gb|KGN43386.1| hypothetical protein Csa_7G030000 [Cucumis sativus]
Length=357

 Score =   442 bits (1137),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 228/300 (76%), Positives = 256/300 (85%), Gaps = 4/300 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             +PFDFS+M+ +LNDPSIK LAEQIAKDPSF QMAEQLQQ FQ   + +GI QFDPQQY+ 
Sbjct  60    SPFDFSSMSDILNDPSIKSLAEQIAKDPSFNQMAEQLQQ-FQSPPAQEGI-QFDPQQYFS  117

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNP FM+MAERLG+ LMQDPSMS M ES ++P   DQLEERMA+IKEDPSLKPI
Sbjct  118   TMQQVMQNPHFMSMAERLGSTLMQDPSMSRMFESFASPPDGDQLEERMAQIKEDPSLKPI  177

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeea--sedeSIV  731
             LEEIE GG  +MM+YWNDK+VL+KLG+AMG P + E ATS +    +  E   +EDES V
Sbjct  178   LEEIETGGLPSMMKYWNDKEVLQKLGKAMGLPVSAEAATSTDNAGVDDSEEPENEDESAV  237

Query  730   HHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDK  551
             HH AS GD EGLK ALA+GADKDE DSEGRTALHFA GYGEV+CAQ+LLE+GAKVDALD 
Sbjct  238   HHTASTGDVEGLKKALASGADKDEVDSEGRTALHFASGYGEVECAQVLLEAGAKVDALDT  297

Query  550   NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NKNTALHYAAGYGRK+CVALLLENGAAVTL NMDGKTPI+VAKLNNQN+VLKLLEKDAFL
Sbjct  298   NKNTALHYAAGYGRKDCVALLLENGAAVTLTNMDGKTPIDVAKLNNQNEVLKLLEKDAFL  357



>gb|KHG27338.1| Ankyrin repeat domain-containing 2 -like protein [Gossypium arboreum]
Length=385

 Score =   441 bits (1135),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 221/267 (83%), Positives = 238/267 (89%), Gaps = 2/267 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAM+GLLNDPSIKELAEQIAKDPSF QMAEQL +TFQGAA+ +  PQFDPQQYY 
Sbjct  67    NPFDFSAMSGLLNDPSIKELAEQIAKDPSFNQMAEQLTKTFQGAAAEETTPQFDPQQYYS  126

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFMTMAERLGNALMQDP+MS+ML+SL+NP QKDQ+EERMARIKEDPSLKPI
Sbjct  127   TMQQVMQNPQFMTMAERLGNALMQDPAMSTMLDSLANPQQKDQIEERMARIKEDPSLKPI  186

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPga--getatsgetgtdeaeeasedeSIV  731
             LEEIE GGPAAMMRYWNDKDVL+KLGEAMG        T+       +E E  +EDESIV
Sbjct  187   LEEIESGGPAAMMRYWNDKDVLQKLGEAMGLAVTGDAATSAGNSAADEEDEAGNEDESIV  246

Query  730   HHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDK  551
             HHCASVGD EGLK AL++GADKDEEDSEGRTALHFACGYGEVKC QILLE+GAKVDALDK
Sbjct  247   HHCASVGDVEGLKTALSSGADKDEEDSEGRTALHFACGYGEVKCTQILLEAGAKVDALDK  306

Query  550   NKNTALHYAAGYGRKECVALLLENGAA  470
             NKNTALHYAAGYGRK+CVALLLENGAA
Sbjct  307   NKNTALHYAAGYGRKDCVALLLENGAA  333



>ref|XP_002460512.1| hypothetical protein SORBIDRAFT_02g029680 [Sorghum bicolor]
 gb|EER97033.1| hypothetical protein SORBIDRAFT_02g029680 [Sorghum bicolor]
Length=323

 Score =   439 bits (1128),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 220/301 (73%), Positives = 254/301 (84%), Gaps = 4/301 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFS+M+ LLNDPSI+E+AEQIA DP F QMAEQLQ++ QGA    GIP  DPQQY  
Sbjct  24    NPFDFSSMSSLLNDPSIREMAEQIASDPVFNQMAEQLQKSAQGAGEQ-GIPALDPQQYME  82

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQF++MAERLGNALMQDP+MSSMLE+ ++PA K+QLEERMARIKEDPSLKPI
Sbjct  83    TMQQVMQNPQFVSMAERLGNALMQDPAMSSMLENFTSPAHKEQLEERMARIKEDPSLKPI  142

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFP---gagetatsgetgtdeaeeasedeSI  734
             L+EIE GGP+AM++YWND +VL+K+G+AMG      +  +         E E   +DESI
Sbjct  143   LDEIENGGPSAMVKYWNDPEVLQKIGQAMGVGLPGDSSASTALSGPEETEEEGGDDDESI  202

Query  733   VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
             VHH ASVGDEEGLK AL  GADKDEED+EGR ALHFACGYGE+KCA+ILLE+GA VDALD
Sbjct  203   VHHTASVGDEEGLKKALDGGADKDEEDAEGRRALHFACGYGELKCAEILLEAGAAVDALD  262

Query  553   KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAF  374
             KNKNT LHYAAGYGRKECV LLL+ GAAVTLQN+DGKTPIEVA+LN+Q++VLKLLEKDAF
Sbjct  263   KNKNTPLHYAAGYGRKECVDLLLKYGAAVTLQNLDGKTPIEVARLNSQDEVLKLLEKDAF  322

Query  373   L  371
             L
Sbjct  323   L  323



>ref|XP_008801178.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Phoenix 
dactylifera]
Length=344

 Score =   436 bits (1122),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 235/340 (69%), Positives = 273/340 (80%), Gaps = 6/340 (2%)
 Frame = -1

Query  1375  QDEKSGAADSKKP-LESTSLDTQSgqggaplaagpGM-HNPFDFSAMTGLLNDPSIKELA  1202
             QD+KS + ++K    E++S   Q G+         G+  NPFD S MT LLNDP+IKE+A
Sbjct  6     QDDKSSSGENKSSKTEASSASQQPGRHRTASTGTAGLPTNPFDLSTMTDLLNDPTIKEMA  65

Query  1201  EQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQNPQFMTMAERLGNA  1022
             EQIA+DP F QMAEQLQ++  GA   +G PQFDPQQY   MQQ+MQNPQFMTMAE+LG+A
Sbjct  66    EQIARDPVFNQMAEQLQKSVHGAG-QEGPPQFDPQQYISNMQQIMQNPQFMTMAEQLGSA  124

Query  1021  LMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAAMMRYWNDKDV  842
             LMQDPSM+SM E+L+NP+ K+Q+EERMARIK+DPSLKPIL+EIE GGPA MM+YWND +V
Sbjct  125   LMQDPSMTSMFENLTNPSHKEQIEERMARIKDDPSLKPILDEIETGGPATMMKYWNDPEV  184

Query  841   LKKLGEAMGFPgagetatsgetg---tdeaeeasedeSIVHHCASVGDEEGLKNALAAGA  671
             L+KLG+AMG   +GETATS E       E E   EDES VHH AS+GD E LK AL  G 
Sbjct  185   LQKLGQAMGIGSSGETATSTELSGPEEAEEEGGYEDESAVHHMASIGDVECLKKALEDGG  244

Query  670   DKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRKECVAL  491
             DKDEEDSEGR ALHFACGYGEVKCAQ+LLE+GA VDALDKNKNTALHYAAGYGRKECVAL
Sbjct  245   DKDEEDSEGRRALHFACGYGEVKCAQVLLEAGATVDALDKNKNTALHYAAGYGRKECVAL  304

Query  490   LLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             LL++GAAVTLQN+DGKTPI+VAKLN Q +VLKLLEKDAFL
Sbjct  305   LLDHGAAVTLQNLDGKTPIDVAKLNKQEEVLKLLEKDAFL  344



>ref|XP_010530981.1| PREDICTED: LOW QUALITY PROTEIN: ankyrin repeat domain-containing 
protein 2 [Tarenaya hassleriana]
Length=337

 Score =   435 bits (1118),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 221/304 (73%), Positives = 253/304 (83%), Gaps = 7/304 (2%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             N FDFS M  LLNDPSIKELAEQIA+DPSF Q+AEQLQ++FQ A S D IPQ DPQQYY 
Sbjct  35    NAFDFSNMANLLNDPSIKELAEQIAQDPSFNQLAEQLQKSFQTAPSEDSIPQIDPQQYYA  94

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TM QVMQNP F  MAERLGNAL+Q+PSMS ++E+ SNP   +Q  ERMAR+KEDPSLKPI
Sbjct  95    TMTQVMQNPGFKNMAERLGNALLQEPSMSHLVENFSNPETAEQFAERMARMKEDPSLKPI  154

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeasedeSIVHH  725
             L+EIE GGP+AMM+YWNDKDVLKKLGEAMG              ++ AEE  E+ESIVH 
Sbjct  155   LDEIEAGGPSAMMKYWNDKDVLKKLGEAMGM-AVPPVDQPAAAESEGAEEGEEEESIVHQ  213

Query  724   CASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNK  545
              AS+GD EGLKNALA+GADKDEEDSEGRTALHFACGYGE+KCAQ+LL++GA V+A+DKNK
Sbjct  214   TASLGDVEGLKNALASGADKDEEDSEGRTALHFACGYGEMKCAQVLLDAGANVNAVDKNK  273

Query  544   NTALHYAAGYGRK------ECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEK  383
             NT LHYAAGYGR+      ECV+LLLENGAAVTLQN+DGKTPI+VAKLNNQ++V+KLLEK
Sbjct  274   NTPLHYAAGYGREXXXXXXECVSLLLENGAAVTLQNLDGKTPIDVAKLNNQHEVVKLLEK  333

Query  382   DAFL  371
             DAFL
Sbjct  334   DAFL  337



>gb|KDO50179.1| hypothetical protein CISIN_1g018578mg [Citrus sinensis]
Length=321

 Score =   431 bits (1108),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 215/268 (80%), Positives = 233/268 (87%), Gaps = 2/268 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAM+GLLNDPSIKELAEQIAKDP+F  MAEQLQ+T  GA + + IPQFD  QYY 
Sbjct  54    NPFDFSAMSGLLNDPSIKELAEQIAKDPAFNSMAEQLQKTLHGANAEESIPQFDTTQYYS  113

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFMTMAERLGNALMQDPSMS M+ESL+NP +KDQ+EERMA+IKEDPSLKPI
Sbjct  114   TMQQVMQNPQFMTMAERLGNALMQDPSMSHMMESLTNPTKKDQIEERMAKIKEDPSLKPI  173

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPg--agetatsgetgtdeaeeasedeSIV  731
             L+EIE GGP+AMM+YWNDKDVL+KLGEAMG        T+       +  E  +EDESIV
Sbjct  174   LDEIESGGPSAMMKYWNDKDVLQKLGEAMGLAVGGDATTSADNAGADEAEEVGNEDESIV  233

Query  730   HHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDK  551
             HH ASVGD EGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLE+GA VDALDK
Sbjct  234   HHTASVGDAEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGANVDALDK  293

Query  550   NKNTALHYAAGYGRKECVALLLENGAAV  467
             NKNTALHYAAGYGRKECVALLLENGAAV
Sbjct  294   NKNTALHYAAGYGRKECVALLLENGAAV  321



>ref|XP_002445777.1| hypothetical protein SORBIDRAFT_07g025610 [Sorghum bicolor]
 gb|EES15272.1| hypothetical protein SORBIDRAFT_07g025610 [Sorghum bicolor]
Length=335

 Score =   431 bits (1108),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 221/301 (73%), Positives = 256/301 (85%), Gaps = 4/301 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDF++M  LLNDPSIKE+A+QIAKDP+F QMAEQLQ++   +    G+P  DPQQY  
Sbjct  36    NPFDFASMQSLLNDPSIKEMADQIAKDPAFNQMAEQLQKSAH-STGEQGMPPLDPQQYME  94

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQ+VM+NPQFMTMAERLGNALMQDP+MSSMLE+ S+P+ K+QLEERM+RIKEDP++K I
Sbjct  95    TMQKVMENPQFMTMAERLGNALMQDPAMSSMLETFSSPSHKEQLEERMSRIKEDPAMKSI  154

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMG--FP-gagetatsgetgtdeaeeasedeSI  734
             L+E+E GGP+AMM+YWND D L+K+GEAMG  FP GAG +A        E E   +DESI
Sbjct  155   LDELENGGPSAMMKYWNDPDTLQKIGEAMGASFPFGAGSSAEPSGPEETEEEGGDDDESI  214

Query  733   VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
             VHH ASVGDEEGLK AL  GADKDEEDSEGR ALHFACGYGE+KCAQILLE+GA VDALD
Sbjct  215   VHHTASVGDEEGLKKALDGGADKDEEDSEGRRALHFACGYGELKCAQILLEAGAAVDALD  274

Query  553   KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAF  374
             KNKNT LHYAAGYGRKECV LLL++GAAVTLQN+DGKTPI+VAKLNNQ++VLKLLEKD F
Sbjct  275   KNKNTPLHYAAGYGRKECVDLLLKHGAAVTLQNLDGKTPIDVAKLNNQDEVLKLLEKDVF  334

Query  373   L  371
             L
Sbjct  335   L  335



>ref|NP_001142281.1| uncharacterized protein LOC100274450 [Zea mays]
 gb|ACF88080.1| unknown [Zea mays]
 gb|AFW64986.1| hypothetical protein ZEAMMB73_106296 [Zea mays]
Length=335

 Score =   430 bits (1105),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 221/301 (73%), Positives = 257/301 (85%), Gaps = 4/301 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDF +M  LLNDPSIKE+A+QIA+DP+F +MAEQLQ++ Q +    G P  +PQQY  
Sbjct  36    NPFDFGSMQSLLNDPSIKEMADQIARDPAFNRMAEQLQRSAQ-STGEQGTPPLNPQQYME  94

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQ+VM+NPQFMTMAERLGNALMQDP+MSSMLE+ S+P+ K+QLEERM+RIKEDP++K I
Sbjct  95    TMQKVMENPQFMTMAERLGNALMQDPAMSSMLETFSSPSHKEQLEERMSRIKEDPAMKSI  154

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMG--FP-gagetatsgetgtdeaeeasedeSI  734
             L+E+E GGP+AMM+YWND D L+K+GEAMG  FP GAG +A    T   E E   +DESI
Sbjct  155   LDELENGGPSAMMKYWNDPDTLQKIGEAMGASFPFGAGSSAEPSGTEETEEEGGDDDESI  214

Query  733   VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
             VHH ASVGDEEGLK AL  GADKDEEDSEGR ALHFACGYGE+KCAQILLE+GA VDALD
Sbjct  215   VHHTASVGDEEGLKKALDGGADKDEEDSEGRRALHFACGYGELKCAQILLEAGAAVDALD  274

Query  553   KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAF  374
             KNKNT LHYAAGYGRKECV LLL++GAAVTLQN+DGKTPI+VAKLNNQ++VLKLLEKDAF
Sbjct  275   KNKNTPLHYAAGYGRKECVDLLLKHGAAVTLQNLDGKTPIDVAKLNNQDEVLKLLEKDAF  334

Query  373   L  371
             L
Sbjct  335   L  335



>ref|XP_009385507.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Musa 
acuminata subsp. malaccensis]
Length=339

 Score =   429 bits (1104),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 215/300 (72%), Positives = 252/300 (84%), Gaps = 3/300 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFS+M  LLNDP+IKE+AEQIAKDP F+QMAEQLQ++   +   +G+P  DPQQY  
Sbjct  41    NPFDFSSMQNLLNDPTIKEMAEQIAKDPVFSQMAEQLQKSVH-SVGQEGVPPLDPQQYVS  99

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFM MAERLGNA+MQDP MSSML+SL+NPAQK+Q+EERMAR+K+DPSLK I
Sbjct  100   TMQQVMQNPQFMNMAERLGNAIMQDPGMSSMLDSLANPAQKEQIEERMARMKDDPSLKTI  159

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGF--PgagetatsgetgtdeaeeasedeSIV  731
             LEEIE GGP+AMM+YWND +VL+KLG+AMG      G T+T      +  +   EDESIV
Sbjct  160   LEEIESGGPSAMMKYWNDPEVLQKLGQAMGVGPSDDGVTSTELSGPEEAEDGGYEDESIV  219

Query  730   HHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDK  551
             HH AS+GD EGLK AL +G+DKDEEDSEGR ALHFACGYGEVKC QILLE+GA V+ LDK
Sbjct  220   HHTASIGDVEGLKKALDSGSDKDEEDSEGRRALHFACGYGEVKCTQILLEAGAVVNVLDK  279

Query  550   NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NKNT LHYAAGYGRKECVALLLE GA+VT++N+DGKT I+VA+LNNQ++VLKL EKDAFL
Sbjct  280   NKNTPLHYAAGYGRKECVALLLEYGASVTVRNLDGKTAIDVARLNNQDEVLKLFEKDAFL  339



>gb|ACG45923.1| ankyrin repeat domain-containing protein 2 [Zea mays]
Length=335

 Score =   429 bits (1104),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 221/301 (73%), Positives = 257/301 (85%), Gaps = 4/301 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDF +M  LLNDPSIKE+A+QIA+DP+F +MAEQLQ++ Q +    G P  +PQQY  
Sbjct  36    NPFDFGSMQSLLNDPSIKEMADQIARDPAFNRMAEQLQKSAQ-STGEQGTPPLNPQQYME  94

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQ+VM+NPQFMTMAERLGNALMQDP+MSSMLE+ S+P+ K+QLEERM+RIKEDP++K I
Sbjct  95    TMQKVMENPQFMTMAERLGNALMQDPAMSSMLETFSSPSHKEQLEERMSRIKEDPAMKSI  154

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMG--FP-gagetatsgetgtdeaeeasedeSI  734
             L+E+E GGP+AMM+YWND D L+K+GEAMG  FP GAG +A    T   E E   +DESI
Sbjct  155   LDELENGGPSAMMKYWNDPDTLQKIGEAMGASFPFGAGSSAEPSGTEETEEEGGDDDESI  214

Query  733   VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
             VHH ASVGDEEGLK AL  GADKDEEDSEGR ALHFACGYGE+KCAQILLE+GA VDALD
Sbjct  215   VHHTASVGDEEGLKKALDGGADKDEEDSEGRRALHFACGYGELKCAQILLEAGAAVDALD  274

Query  553   KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAF  374
             KNKNT LHYAAGYGRKECV LLL++GAAVTLQN+DGKTPI+VAKLNNQ++VLKLLEKDAF
Sbjct  275   KNKNTPLHYAAGYGRKECVDLLLKHGAAVTLQNLDGKTPIDVAKLNNQDEVLKLLEKDAF  334

Query  373   L  371
             L
Sbjct  335   L  335



>ref|XP_004974059.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Setaria 
italica]
Length=335

 Score =   428 bits (1101),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 221/301 (73%), Positives = 257/301 (85%), Gaps = 4/301 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDF++M  LLNDPSIKE+A+QIA+DP+F QMAEQLQ+  Q +    G+P  DPQQY  
Sbjct  36    NPFDFASMQSLLNDPSIKEMADQIARDPAFNQMAEQLQKGAQ-STGEQGMPPLDPQQYME  94

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQ+VM+NPQFMTMAERLGNALMQDP+MSSMLE+ S+P+ K+QLEERM+RIKEDP++K I
Sbjct  95    TMQKVMENPQFMTMAERLGNALMQDPAMSSMLETFSSPSHKEQLEERMSRIKEDPAMKSI  154

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMG--FP-gagetatsgetgtdeaeeasedeSI  734
             L+E+E GGPAAMM+YWND D L+K+G+AMG  FP GAG +A    T   E E   EDESI
Sbjct  155   LDELENGGPAAMMKYWNDPDTLQKIGQAMGGSFPFGAGSSAEPSGTEEAEEEGGDEDESI  214

Query  733   VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
             VHH ASVGD++GLK AL  GADKDEEDSEGR ALHFACGYGE+KCAQ+LLE+GA VDALD
Sbjct  215   VHHTASVGDDKGLKKALDGGADKDEEDSEGRRALHFACGYGELKCAQVLLEAGAAVDALD  274

Query  553   KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAF  374
             KNKNT LHYAAGYGRKECV LLL++GAAVTLQNMDGKTPI+VAKLNNQ++VLKLLEKD F
Sbjct  275   KNKNTPLHYAAGYGRKECVDLLLKHGAAVTLQNMDGKTPIDVAKLNNQDEVLKLLEKDVF  334

Query  373   L  371
             L
Sbjct  335   L  335



>ref|XP_009411775.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Musa 
acuminata subsp. malaccensis]
Length=341

 Score =   428 bits (1100),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 216/298 (72%), Positives = 250/298 (84%), Gaps = 1/298 (0%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFS+M  LLNDP+IKE+AEQIA+DP F+Q+AEQLQ++   A   D +P  DPQQY  
Sbjct  45    NPFDFSSMQNLLNDPTIKEMAEQIAQDPVFSQIAEQLQKSVHSAGQED-VPSLDPQQYMS  103

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             T+QQVMQNPQF  MAE LGNA+MQDP MSS+LE+LSNPAQK+Q+EERMA +KEDPSLK I
Sbjct  104   TIQQVMQNPQFTKMAEHLGNAIMQDPVMSSVLENLSNPAQKEQMEERMAHMKEDPSLKAI  163

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeasedeSIVHH  725
             LEEIE GGP+ MM+YWND +VL+K+G AMG   +G+ ATS E    E  E  E+ES+VHH
Sbjct  164   LEEIESGGPSTMMKYWNDPEVLQKIGSAMGIAPSGDGATSTEQLGPEETEDDEEESVVHH  223

Query  724   CASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNK  545
              AS+GD EGLK AL +GADKDEEDSEGR  LHFACGYGEVKCAQILLE+GA VDALDKNK
Sbjct  224   TASIGDVEGLKKALDSGADKDEEDSEGRRPLHFACGYGEVKCAQILLEAGAAVDALDKNK  283

Query  544   NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NT LHYAAGYGRKECV LLLE+GAAVTLQN+D KTPI+VAKLN+Q++VLKLLEKD FL
Sbjct  284   NTPLHYAAGYGRKECVGLLLEHGAAVTLQNLDKKTPIDVAKLNDQHEVLKLLEKDVFL  341



>ref|XP_006412101.1| hypothetical protein EUTSA_v10025639mg [Eutrema salsugineum]
 ref|XP_006412102.1| hypothetical protein EUTSA_v10025639mg [Eutrema salsugineum]
 ref|XP_006412103.1| hypothetical protein EUTSA_v10025639mg [Eutrema salsugineum]
 ref|XP_006412104.1| hypothetical protein EUTSA_v10025639mg [Eutrema salsugineum]
 dbj|BAJ33771.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53554.1| hypothetical protein EUTSA_v10025639mg [Eutrema salsugineum]
 gb|ESQ53555.1| hypothetical protein EUTSA_v10025639mg [Eutrema salsugineum]
 gb|ESQ53556.1| hypothetical protein EUTSA_v10025639mg [Eutrema salsugineum]
 gb|ESQ53557.1| hypothetical protein EUTSA_v10025639mg [Eutrema salsugineum]
Length=342

 Score =   427 bits (1099),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 212/298 (71%), Positives = 246/298 (83%), Gaps = 0/298 (0%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             N FDFS M G+LNDPSI+ELAEQIAKDP+F Q+AEQLQ++   AA   G P  DPQQY  
Sbjct  45    NAFDFSNMAGILNDPSIRELAEQIAKDPAFNQLAEQLQRSIPNAAQGGGFPTIDPQQYVS  104

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVM NP+F TMAERLGNAL+QDP MS  L++ SNP   +   ERMAR+KEDP LKPI
Sbjct  105   TMQQVMHNPEFQTMAERLGNALVQDPQMSPFLDAFSNPETAEHFTERMARMKEDPELKPI  164

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeasedeSIVHH  725
             L+EI+ GGP+AMM+YWNDKDVLKKLGEAMG P  G    +     + AEE  E+ESIVH 
Sbjct  165   LDEIDAGGPSAMMKYWNDKDVLKKLGEAMGMPVVGLPEQTASAEPEAAEEGEEEESIVHQ  224

Query  724   CASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNK  545
              AS+GD EGLKNALA+G +KDEEDSEGRTALHFACGYGE+KCAQ+L+++GA V+A+DKNK
Sbjct  225   TASLGDVEGLKNALASGGNKDEEDSEGRTALHFACGYGELKCAQVLIDAGASVNAVDKNK  284

Query  544   NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NT LHYAAGYGRKECV+LLLENGAAVTLQN+D KTPI+VAKLNNQ +V+KLLEKDAFL
Sbjct  285   NTPLHYAAGYGRKECVSLLLENGAAVTLQNLDEKTPIDVAKLNNQLEVVKLLEKDAFL  342



>ref|XP_003574852.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Brachypodium 
distachyon]
Length=337

 Score =   423 bits (1087),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 212/298 (71%), Positives = 250/298 (84%), Gaps = 3/298 (1%)
 Frame = -1

Query  1258  FDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTM  1079
             FDFS+M  LLNDPSIKE+A+QIA+DP+F QMAEQLQ+  Q +A   G P  DP QY  TM
Sbjct  41    FDFSSMQSLLNDPSIKEMADQIARDPAFNQMAEQLQKGAQ-SAGEQGTPPLDPHQYIETM  99

Query  1078  QQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILE  899
             Q+VM+NPQFMTMAERLG+ALMQDP+MSSMLE+L++P  K++LEERM+RIKEDPSLKPIL+
Sbjct  100   QKVMENPQFMTMAERLGSALMQDPAMSSMLENLTSPTHKEELEERMSRIKEDPSLKPILD  159

Query  898   EIEQGGPAAMMRYWNDKDVLKKLGEAMG--FPgagetatsgetgtdeaeeasedeSIVHH  725
             E+E GGPAAM++YWND + L+K+G+AMG   P    ++       +  E+  EDESIVHH
Sbjct  160   ELENGGPAAMIKYWNDPETLQKIGQAMGTTMPFGPVSSAEPSGTEETEEDGDEDESIVHH  219

Query  724   CASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNK  545
              +SVGD+EGLK AL  GADKDEEDSEGR ALHFACGYGE KCAQILLE+GA VDA+DKNK
Sbjct  220   TSSVGDDEGLKKALDGGADKDEEDSEGRRALHFACGYGEFKCAQILLEAGAAVDAVDKNK  279

Query  544   NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NT LHYAAGYGRKECV LLL++GAAVTLQNMDGKTPI+VAKLNNQ++VLKLLEKD FL
Sbjct  280   NTPLHYAAGYGRKECVDLLLKHGAAVTLQNMDGKTPIDVAKLNNQDEVLKLLEKDVFL  337



>gb|ABK23212.1| unknown [Picea sitchensis]
Length=347

 Score =   423 bits (1088),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 211/303 (70%), Positives = 250/303 (83%), Gaps = 6/303 (2%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAM+ LLNDPSIKELA+QIAKDPSF QMAEQLQ+  Q ++    IP+ D +QY+ 
Sbjct  46    NPFDFSAMSSLLNDPSIKELAKQIAKDPSFNQMAEQLQRNVQ-SSGQQSIPELDGEQYFS  104

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
              MQQVMQNPQFM+MAE+LGNALMQDPSMS+ML++L++P+ KDQ+E R+A+++EDPSLKPI
Sbjct  105   AMQQVMQNPQFMSMAEQLGNALMQDPSMSNMLQTLADPSHKDQVEGRLAQVREDPSLKPI  164

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGF-----Pgagetatsgetgtdeaeeasede  740
             L+EIE GGPAAMM+YWND  VL KLG+AMG          +  +  + G ++     EDE
Sbjct  165   LDEIESGGPAAMMKYWNDPTVLTKLGQAMGVGPLADAATSDEPSGADQGEEDDANEEEDE  224

Query  739   SIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDA  560
               VHH ASVGD EGL+N L  GADKDE+D+EGRTALHFACGYGEVKCA++LLE+G  VDA
Sbjct  225   LTVHHTASVGDVEGLRNLLKLGADKDEKDTEGRTALHFACGYGEVKCAEVLLEAGVMVDA  284

Query  559   LDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKD  380
             LDKNKNTALHYAAGYGR+ECV LLL+ GAAVTLQN+DGKTPIEVAKLN Q +VLKLLEKD
Sbjct  285   LDKNKNTALHYAAGYGREECVGLLLKYGAAVTLQNLDGKTPIEVAKLNEQKEVLKLLEKD  344

Query  379   AFL  371
             AFL
Sbjct  345   AFL  347



>ref|XP_006284044.1| hypothetical protein CARUB_v10005165mg [Capsella rubella]
 gb|EOA16942.1| hypothetical protein CARUB_v10005165mg [Capsella rubella]
Length=346

 Score =   422 bits (1085),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 210/298 (70%), Positives = 246/298 (83%), Gaps = 0/298 (0%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             N FDFS M G+LNDPSI+E+AEQIAKDP+F Q+AEQLQ++   AA   G P FDPQQY  
Sbjct  49    NAFDFSNMAGILNDPSIREMAEQIAKDPAFNQLAEQLQRSIPNAAQEGGFPNFDPQQYVN  108

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVM NP+F TMAERLGNAL+QDP MS  L++ SNP   +   ERMAR+KEDP LKPI
Sbjct  109   TMQQVMHNPEFKTMAERLGNALVQDPQMSPFLDAFSNPETAEHFTERMARMKEDPELKPI  168

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeasedeSIVHH  725
             L+EI+ GGP+AMM+YWND DVLKKLGEAMG P AG    +     + AEE  E+ESIVH 
Sbjct  169   LDEIDAGGPSAMMKYWNDPDVLKKLGEAMGMPVAGLPDQTTSAEPEAAEEGEEEESIVHQ  228

Query  724   CASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNK  545
              AS+GD EGLK ALA+G +KDEEDSEGRTALHFACGYGE+KCAQ+L+++GA V+A+DKNK
Sbjct  229   TASLGDVEGLKAALASGGNKDEEDSEGRTALHFACGYGELKCAQVLIDAGASVNAVDKNK  288

Query  544   NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NT LHYAAGYGRKECV+LLLENGAAVTLQN+D KTPI+VAKLN+Q +V+KLLEKDAFL
Sbjct  289   NTPLHYAAGYGRKECVSLLLENGAAVTLQNLDEKTPIDVAKLNSQLEVVKLLEKDAFL  346



>ref|XP_010489365.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Camelina 
sativa]
Length=345

 Score =   421 bits (1083),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 214/296 (72%), Positives = 247/296 (83%), Gaps = 2/296 (1%)
 Frame = -1

Query  1258  FDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTM  1079
             FDFS M G+LNDPSIKELAEQIA+DPSF Q+AEQLQ++   A+   G+P FDP+QY  TM
Sbjct  52    FDFSGMAGILNDPSIKELAEQIAQDPSFNQLAEQLQRSVPTASHEGGLPNFDPEQYMKTM  111

Query  1078  QQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILE  899
             QQVM+NP+F TMAERLGNAL+QDP MS  LE+L NPA  +Q  ERMA++K+DP LKPIL 
Sbjct  112   QQVMENPEFRTMAERLGNALVQDPQMSPFLEALGNPAATEQFAERMAQLKDDPELKPILA  171

Query  898   EIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeasedeSIVHHCA  719
             EI+ GGP+AMM+YWNDKDVL KLGEAMG   A     S     +EAEE  E+ESIVH  A
Sbjct  172   EIDAGGPSAMMKYWNDKDVLAKLGEAMGI--AVGGDQSVAPEPEEAEEGEEEESIVHQTA  229

Query  718   SVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNT  539
             S+GD EGLK ALA+G +KDEEDSEGRTALHFACGYGE+KCAQ+LL++GA V+A+DKNKNT
Sbjct  230   SLGDVEGLKAALASGGNKDEEDSEGRTALHFACGYGEMKCAQVLLDAGANVNAVDKNKNT  289

Query  538   ALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
              LHYAAGYGRKECV+LLLENGAAVTLQNMD KTPI+VAKLNNQ DV+KLLEKDAFL
Sbjct  290   PLHYAAGYGRKECVSLLLENGAAVTLQNMDSKTPIDVAKLNNQLDVVKLLEKDAFL  345



>gb|EMT03569.1| hypothetical protein F775_26795 [Aegilops tauschii]
Length=330

 Score =   421 bits (1081),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 212/301 (70%), Positives = 252/301 (84%), Gaps = 4/301 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             +PFDFS M+ LLNDPSI+E+AEQIA DP F QMAEQLQ++ QGA    G+P  DPQ Y  
Sbjct  31    SPFDFSNMSSLLNDPSIREMAEQIASDPVFNQMAEQLQKSAQGAGEQ-GVPNLDPQAYME  89

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TM QVMQNPQFM+MAERLGN LMQDP+MSSMLE+L++PA K+QLEERMARIK+DPSLKPI
Sbjct  90    TMTQVMQNPQFMSMAERLGNTLMQDPAMSSMLENLTSPAHKEQLEERMARIKDDPSLKPI  149

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMG--FPgagetatsget-gtdeaeeasedeSI  734
             L+EIE+GGP+AM++YWND ++L+K+G+AM   FP    T+T        + E   +DESI
Sbjct  150   LDEIERGGPSAMVKYWNDPEILQKIGQAMSLNFPVDAATSTVVSGPQETDEEGEDDDESI  209

Query  733   VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
             VH+ ASVGD EGLK AL  GA+KDEED EGR ALHFACGYGE+KCA+ILLE+GA VDALD
Sbjct  210   VHNTASVGDAEGLKKALDGGANKDEEDVEGRRALHFACGYGELKCAEILLEAGAAVDALD  269

Query  553   KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAF  374
             KNKNT LHYAAGYGRKECV LLL++GAAVTLQN+DGKTPIEVAKLN+Q++V+KLLE+D F
Sbjct  270   KNKNTPLHYAAGYGRKECVDLLLKHGAAVTLQNLDGKTPIEVAKLNSQDEVVKLLEQDVF  329

Query  373   L  371
             L
Sbjct  330   L  330



>ref|XP_010467510.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Camelina 
sativa]
Length=343

 Score =   421 bits (1082),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 214/296 (72%), Positives = 247/296 (83%), Gaps = 2/296 (1%)
 Frame = -1

Query  1258  FDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTM  1079
             FDFS M G+LNDPSIKELAEQIA+DPSF Q+AEQLQ++   A+   G+P FDP+QY  TM
Sbjct  50    FDFSGMAGILNDPSIKELAEQIAQDPSFNQLAEQLQRSVPTASHEGGLPNFDPEQYMKTM  109

Query  1078  QQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILE  899
             QQVM+NP+F TMAERLGNAL+QDP MS  LE+L NPA  +Q  ERMA++K+DP LKPIL 
Sbjct  110   QQVMENPEFRTMAERLGNALVQDPQMSPFLEALGNPAATEQFAERMAQLKDDPELKPILA  169

Query  898   EIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeasedeSIVHHCA  719
             EI+ GGP+AMM+YWNDKDVL KLGEAMG   A     S     +EAEE  E+ESIVH  A
Sbjct  170   EIDAGGPSAMMKYWNDKDVLAKLGEAMGI--AVGGDQSVAPEPEEAEEGEEEESIVHQTA  227

Query  718   SVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNT  539
             S+GD EGLK ALA+G +KDEEDSEGRTALHFACGYGE+KCAQ+LL++GA V+A+DKNKNT
Sbjct  228   SLGDVEGLKAALASGGNKDEEDSEGRTALHFACGYGEMKCAQVLLDAGANVNAVDKNKNT  287

Query  538   ALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
              LHYAAGYGRKECV+LLLENGAAVTLQNMD KTPI+VAKLNNQ DV+KLLEKDAFL
Sbjct  288   PLHYAAGYGRKECVSLLLENGAAVTLQNMDSKTPIDVAKLNNQLDVVKLLEKDAFL  343



>ref|XP_008651816.1| PREDICTED: ankyrin repeat domain-containing protein 2 isoform 
X1 [Zea mays]
Length=302

 Score =   418 bits (1074),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 212/288 (74%), Positives = 243/288 (84%), Gaps = 4/288 (1%)
 Frame = -1

Query  1225  DPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQNPQFMT  1046
             DPSI+E+AEQIA DP F QMAEQLQ++ QGA    GIP  DPQQY  TMQQVMQNPQF++
Sbjct  16    DPSIREMAEQIASDPVFNQMAEQLQKSAQGAGEQ-GIPALDPQQYMETMQQVMQNPQFVS  74

Query  1045  MAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAAMM  866
             MAERLGNALMQDP+MSSMLE+L++PA K+QLEERMARIKEDPSLKPIL+EIE GGP+AM+
Sbjct  75    MAERLGNALMQDPAMSSMLENLTSPAHKEQLEERMARIKEDPSLKPILDEIENGGPSAMV  134

Query  865   RYWNDKDVLKKLGEAMGF---PgagetatsgetgtdeaeeasedeSIVHHCASVGDEEGL  695
             +YWND +VL+K+G+AMG      +  +         E E   +DESIVHH ASVGDEEGL
Sbjct  135   KYWNDPEVLQKIGQAMGVNLPGDSSVSTVLSGPEETEEEGGDDDESIVHHTASVGDEEGL  194

Query  694   KNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGY  515
             K AL  GADKDEED+EGR ALHFACGYGE+KCA+ILLE+GA VDALDKNKNT LHYAAGY
Sbjct  195   KKALEGGADKDEEDAEGRRALHFACGYGELKCAEILLEAGAAVDALDKNKNTPLHYAAGY  254

Query  514   GRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             GRKECV LLL+ GAAVTLQN+DGKTPIEVAKLN+Q++VLKLLEKDAFL
Sbjct  255   GRKECVDLLLKYGAAVTLQNLDGKTPIEVAKLNSQDEVLKLLEKDAFL  302



>gb|EMS52688.1| Ankyrin repeat domain-containing protein 2 [Triticum urartu]
Length=357

 Score =   420 bits (1079),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 211/301 (70%), Positives = 251/301 (83%), Gaps = 4/301 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             +PFDFS M+ LLNDPSI+E+AEQIA DP F QMAEQLQ++ QG     G+P  DPQ Y  
Sbjct  58    SPFDFSNMSSLLNDPSIREMAEQIASDPVFNQMAEQLQKSAQGTGEQ-GVPNLDPQAYME  116

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TM QVMQNPQFM+MAERLGN LMQDP+MSSMLE+L++PA K+QLEERM+RIK+DPSLKPI
Sbjct  117   TMTQVMQNPQFMSMAERLGNTLMQDPAMSSMLENLTSPAHKEQLEERMSRIKDDPSLKPI  176

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMG--FPgagetatsget-gtdeaeeasedeSI  734
             L+EIE+GGP+AM++YWND ++L+K+G+AM   FP    T+T        + E   +DESI
Sbjct  177   LDEIERGGPSAMVKYWNDPEILQKIGQAMSLNFPVDAATSTVLSGPQETDEEGEDDDESI  236

Query  733   VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
             VH+ ASVGD EGLK AL  GA+KDEED EGR ALHFACGYGE+KCA+ILLE+GA VDALD
Sbjct  237   VHNTASVGDAEGLKKALDGGANKDEEDVEGRRALHFACGYGELKCAEILLEAGAAVDALD  296

Query  553   KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAF  374
             KNKNT LHYAAGYGRKECV LLL++GAAVTLQN+DGKTPIEVAKLNNQ++V+KLLE+D F
Sbjct  297   KNKNTPLHYAAGYGRKECVDLLLKHGAAVTLQNLDGKTPIEVAKLNNQDEVVKLLEQDVF  356

Query  373   L  371
             L
Sbjct  357   L  357



>ref|XP_006660835.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Oryza 
brachyantha]
Length=330

 Score =   419 bits (1076),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 217/302 (72%), Positives = 250/302 (83%), Gaps = 5/302 (2%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFS  + LLNDPSIKE+AEQIA DP FTQMAEQLQ++ Q      G P  DPQQY  
Sbjct  30    NPFDFSQFSNLLNDPSIKEMAEQIANDPVFTQMAEQLQKSAQTTGEQGG-PSLDPQQYME  88

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TM QVMQNPQFM+MAERLGN LMQDP MSSMLESL++P+ K+ LEERMARIKEDPSLKPI
Sbjct  89    TMTQVMQNPQFMSMAERLGNTLMQDPGMSSMLESLTSPSHKELLEERMARIKEDPSLKPI  148

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMG--FPgagetatsge--tgtdeaeeasedeS  737
             L+EIE GGP+AM++YWND +VL+K+G+AM   FPG   T+T+      T+E     +DES
Sbjct  149   LDEIESGGPSAMVKYWNDPEVLQKIGQAMSINFPGDAATSTTLSGPEETEEDGGDDDDES  208

Query  736   IVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDAL  557
             IVHH ASVGD EGLK AL  GAD DEED+EGR ALHFACGYGE+KCA+ILLE+GA V+AL
Sbjct  209   IVHHTASVGDAEGLKKALDEGADMDEEDAEGRRALHFACGYGELKCAEILLEAGAAVNAL  268

Query  556   DKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDA  377
             DKNKNT LHYAAGYGR ECV LLL++GAAVT+QN+DGKTPIEVAKLNNQ++VLK+LEKDA
Sbjct  269   DKNKNTPLHYAAGYGRNECVDLLLKHGAAVTIQNLDGKTPIEVAKLNNQDEVLKVLEKDA  328

Query  376   FL  371
             FL
Sbjct  329   FL  330



>ref|XP_003578420.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Brachypodium 
distachyon]
Length=330

 Score =   418 bits (1075),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 214/303 (71%), Positives = 253/303 (83%), Gaps = 4/303 (1%)
 Frame = -1

Query  1270  MHNPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQY  1091
             + +PFDFS M+ LLNDPSI+E+AEQIA DP F Q+AE+LQ++ Q A    G+P  DPQQY
Sbjct  29    LGSPFDFSNMSSLLNDPSIREMAEQIASDPVFNQIAEKLQKSAQ-ATGEQGVPILDPQQY  87

Query  1090  YGTMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLK  911
               TM QVMQNPQF++MAERLGN LMQDP+MSSMLE+L++P  K+QLEERMARIK+DPSLK
Sbjct  88    METMTQVMQNPQFVSMAERLGNTLMQDPAMSSMLENLTSPVHKEQLEERMARIKDDPSLK  147

Query  910   PILEEIEQGGPAAMMRYWNDKDVLKKLGEAMG--FPgagetatsget-gtdeaeeasede  740
             PIL+EIE GGP+AM++YWND ++L+K+G+AM   FPG G T+T        E E   +DE
Sbjct  148   PILDEIESGGPSAMVKYWNDPEILQKIGQAMSINFPGDGATSTVLSGPQETEEEGEYDDE  207

Query  739   SIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDA  560
             SIVHH ASVGD EGLK AL  GA+KDEED+EGR ALHFACGYGE+KCA+ILLE+GA VDA
Sbjct  208   SIVHHTASVGDAEGLKKALDGGANKDEEDAEGRRALHFACGYGELKCAEILLEAGAAVDA  267

Query  559   LDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKD  380
             LDKNKNT LHYAAGYGRKECV LLL++GAAVTLQN+DGKTPIEVAKLN+Q +VLKLLEKD
Sbjct  268   LDKNKNTPLHYAAGYGRKECVDLLLKHGAAVTLQNLDGKTPIEVAKLNSQEEVLKLLEKD  327

Query  379   AFL  371
              FL
Sbjct  328   VFL  330



>ref|XP_006297928.1| hypothetical protein CARUB_v10013970mg, partial [Capsella rubella]
 gb|EOA30826.1| hypothetical protein CARUB_v10013970mg, partial [Capsella rubella]
Length=374

 Score =   420 bits (1079),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 215/296 (73%), Positives = 246/296 (83%), Gaps = 2/296 (1%)
 Frame = -1

Query  1258  FDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTM  1079
             FDFS M G+LNDPSIKELAEQIAKDPSF Q+AEQLQ++   A+   G+P FDPQQY  TM
Sbjct  81    FDFSGMAGILNDPSIKELAEQIAKDPSFNQLAEQLQRSVPTASHEGGLPNFDPQQYMQTM  140

Query  1078  QQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILE  899
             QQVM+NP+F TMAERLG+AL+QDP MS  LE+L NP   +Q  ERMA++KEDP LKPIL 
Sbjct  141   QQVMENPEFRTMAERLGSALVQDPQMSPFLEALGNPEATEQFAERMAQMKEDPELKPILA  200

Query  898   EIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeasedeSIVHHCA  719
             EI+ GGP+AMM+YWNDKDVL KLGEAMG   A     S     +EAEE  E+ESIVH  A
Sbjct  201   EIDAGGPSAMMKYWNDKDVLAKLGEAMGI--AVGADQSVAPEPEEAEEGEEEESIVHQTA  258

Query  718   SVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNT  539
             S+GD EGLK ALA+G +KDEEDSEGRTALHFACGYGE+KCAQ+LL++GA V+A+DKNKNT
Sbjct  259   SLGDVEGLKAALASGGNKDEEDSEGRTALHFACGYGEMKCAQVLLDAGANVNAVDKNKNT  318

Query  538   ALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
              LHYAAGYGRKECV+LLLENGAAVTLQNMD KTPI+VAKLNNQ DV+KLLEKDAFL
Sbjct  319   PLHYAAGYGRKECVSLLLENGAAVTLQNMDSKTPIDVAKLNNQLDVVKLLEKDAFL  374



>ref|NP_179331.1| ankyrin repeat-containing 2B [Arabidopsis thaliana]
 gb|ABD59068.1| At2g17390 [Arabidopsis thaliana]
 gb|AEC06620.1| ankyrin repeat-containing 2B [Arabidopsis thaliana]
Length=344

 Score =   418 bits (1075),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 212/298 (71%), Positives = 244/298 (82%), Gaps = 2/298 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             N FDFS M G+LNDPSIKELAEQIAKDPSF Q+AEQLQ++    +   G+P FDPQQY  
Sbjct  49    NAFDFSGMAGILNDPSIKELAEQIAKDPSFNQLAEQLQRSVPTGSHEGGLPNFDPQQYMQ  108

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVM+NP+F TMAERLGNAL+QDP MS  LE+L NPA  +Q  ERMA++KEDP LKPI
Sbjct  109   TMQQVMENPEFRTMAERLGNALVQDPQMSPFLEALGNPAASEQFAERMAQMKEDPELKPI  168

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeasedeSIVHH  725
             L EI+ GGP+AMM+YWNDKDVL KLGEAMG   A     +     +EAEE  E+ESIVH 
Sbjct  169   LAEIDAGGPSAMMKYWNDKDVLAKLGEAMGI--AVGADQTVAAEPEEAEEGEEEESIVHQ  226

Query  724   CASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNK  545
              AS+GD EGLK ALA+G +KDEEDSEGRTALHFACGYGEV+CAQ+LL++GA  +A+DKNK
Sbjct  227   TASLGDVEGLKAALASGGNKDEEDSEGRTALHFACGYGEVRCAQVLLDAGANANAIDKNK  286

Query  544   NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NT LHYAAGYGRKECV+LLLENGAAVT QNMD K PI+VA+LNNQ DV+KLLEKDAFL
Sbjct  287   NTPLHYAAGYGRKECVSLLLENGAAVTQQNMDNKNPIDVARLNNQLDVVKLLEKDAFL  344



>gb|EMS53267.1| Ankyrin repeat domain-containing protein 2 [Triticum urartu]
Length=339

 Score =   418 bits (1074),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 213/303 (70%), Positives = 250/303 (83%), Gaps = 4/303 (1%)
 Frame = -1

Query  1270  MHNPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQY  1091
             +  PFDFS+M  LLNDPSIKE+A+QIA+DP+F QMAEQLQ+  Q  A   G+P  DP QY
Sbjct  38    LSGPFDFSSMQSLLNDPSIKEMADQIARDPAFNQMAEQLQKGAQ-TAGEQGMPPLDPHQY  96

Query  1090  YGTMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLK  911
               TMQ+VM+NPQFMTMAERLG ALMQDP+MSSMLE+L++P+ K++LEERM+RIK+DP+LK
Sbjct  97    METMQRVMENPQFMTMAERLGTALMQDPAMSSMLENLTSPSHKEELEERMSRIKDDPALK  156

Query  910   PILEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFP---gagetatsgetgtdeaeeasede  740
             PIL+E+E GGPAAM++YWND + L+K+G+AMG         TA    T   E E   EDE
Sbjct  157   PILDELENGGPAAMIKYWNDPETLQKIGQAMGTTMPFSTVSTAEPSGTEETEEEGEDEDE  216

Query  739   SIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDA  560
             SIVHH ASVGD EGLK AL  GADKDEEDSEGR ALHFACGYGE KCA+ILLE+GA VDA
Sbjct  217   SIVHHTASVGDGEGLKKALDGGADKDEEDSEGRRALHFACGYGEFKCAEILLEAGAAVDA  276

Query  559   LDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKD  380
             +DKNKNT LHYAAGYGR+ECV LLL++GAAVTLQNMDGKTPI+VAKLNNQ++VLKLLEKD
Sbjct  277   MDKNKNTPLHYAAGYGREECVDLLLKHGAAVTLQNMDGKTPIDVAKLNNQDEVLKLLEKD  336

Query  379   AFL  371
              FL
Sbjct  337   VFL  339



>ref|XP_010515096.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Camelina 
sativa]
Length=341

 Score =   417 bits (1071),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 212/296 (72%), Positives = 246/296 (83%), Gaps = 2/296 (1%)
 Frame = -1

Query  1258  FDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTM  1079
             FDFS M G+LNDPSIKELAEQIA+DPSF Q+AEQLQ++   A+   G+P FDP+QY  TM
Sbjct  48    FDFSGMAGILNDPSIKELAEQIAQDPSFNQLAEQLQRSVPTASHEGGLPNFDPEQYMKTM  107

Query  1078  QQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILE  899
             QQVM+NP+F TMAERLGNAL+QDP MS  LE+L NPA  +Q  ERMA++K+DP LKPIL 
Sbjct  108   QQVMENPEFRTMAERLGNALVQDPQMSPFLEALGNPAATEQFAERMAQMKDDPELKPILA  167

Query  898   EIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeasedeSIVHHCA  719
             EI+ GGP+AMM+YWNDKDVL KLGEAMG   A     S     +EAEE  E+ESIVH  A
Sbjct  168   EIDAGGPSAMMKYWNDKDVLAKLGEAMGI--AVGGDQSVAPKPEEAEEGEEEESIVHQTA  225

Query  718   SVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNT  539
             S GD EGLK ALA+G +KDEEDSEGRTALHFACGYGE+KCAQ+LL++GA V+A+DKNKNT
Sbjct  226   SFGDVEGLKAALASGGNKDEEDSEGRTALHFACGYGEMKCAQVLLDAGANVNAVDKNKNT  285

Query  538   ALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
              LHYAAGYGRKECV+LLL+NGAAVTLQN+D KTPI+VAKLNNQ DV+KLLEKDAFL
Sbjct  286   PLHYAAGYGRKECVSLLLDNGAAVTLQNLDSKTPIDVAKLNNQLDVVKLLEKDAFL  341



>emb|CDY41654.1| BnaC03g62300D [Brassica napus]
Length=337

 Score =   416 bits (1070),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 215/302 (71%), Positives = 248/302 (82%), Gaps = 4/302 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTF----QGAASNDGIPQFDPQ  1097
             N FDFS M G+LNDPSI+ELAEQIAKDP+F Q+AEQLQ++     QG  +  G P  DPQ
Sbjct  36    NAFDFSNMAGILNDPSIRELAEQIAKDPAFNQLAEQLQRSIPNAAQGGGAAGGFPNIDPQ  95

Query  1096  QYYGTMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPS  917
             QY  TMQQVM NP+F TMAERLG AL+QDP MS  LE+ SNP   + L ERMAR+KEDP 
Sbjct  96    QYVSTMQQVMHNPEFQTMAERLGKALVQDPQMSPFLEAFSNPETAEHLTERMARMKEDPE  155

Query  916   LKPILEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeasedeS  737
             LKPIL+EI+ GGP+AMM+YWNDKDVLKKLGEAMG P AG    +     + AEE  E+ES
Sbjct  156   LKPILDEIDAGGPSAMMKYWNDKDVLKKLGEAMGMPIAGLPHQAASAAPEVAEEEEEEES  215

Query  736   IVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDAL  557
             IVHH AS GD EGLKNALA+G +KDEEDSEGRTALHFACGYGE+KCAQ+L+++GA V+A+
Sbjct  216   IVHHTASRGDVEGLKNALASGGNKDEEDSEGRTALHFACGYGELKCAQVLIDAGASVNAV  275

Query  556   DKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDA  377
             DKNKNT LHYAAGYGRKECV+LLLENGAAVTLQN+D KTPI+VAKLNNQ +V+KLLEKDA
Sbjct  276   DKNKNTPLHYAAGYGRKECVSLLLENGAAVTLQNLDEKTPIDVAKLNNQLEVVKLLEKDA  335

Query  376   FL  371
             FL
Sbjct  336   FL  337



>ref|XP_004981022.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Setaria 
italica]
Length=348

 Score =   417 bits (1071),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 220/347 (63%), Positives = 260/347 (75%), Gaps = 14/347 (4%)
 Frame = -1

Query  1375  QDEKSGAADSKKPLESTSLDTQSgqggaplaagpGMHNPFDFSAMTGLLNDPSIKELAEQ  1196
             Q+EK+    +++P  S + + Q   G    A      NPFDFS M  LLNDPSIKE+AEQ
Sbjct  4     QEEKTATVKTEEP--SPAEEQQPAAGATRRAGPSAPANPFDFSTMMNLLNDPSIKEMAEQ  61

Query  1195  IAKDPSFTQMAEQLQQTF----QGAASNDGIPQ----FDPQQYYGTMQQVMQNPQFMTMA  1040
             IAKDP+FTQMAEQLQ+T     Q  A+   +PQ     DPQ+Y  TMQQ+MQNPQF+ MA
Sbjct  62    IAKDPAFTQMAEQLQKTVVSPRQAPAAKQAVPQAAAALDPQKYVATMQQLMQNPQFVAMA  121

Query  1039  ERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAAMMRY  860
             ERLG+ALMQDP+M++ML  L+NPA K+QLE R+AR+KEDP+LKPIL+EIE GGPAAMM+Y
Sbjct  122   ERLGSALMQDPAMATMLGGLTNPAHKEQLEARIARMKEDPTLKPILDEIETGGPAAMMKY  181

Query  859   WNDKDVLKKLGEAMGF----PgagetatsgetgtdeaeeasedeSIVHHCASVGDEEGLK  692
             WND + L+K G AMG       AG      E    E E   E+ SI+HH ASVGD EGLK
Sbjct  182   WNDPEALQKFGRAMGVGPSSEAAGAEHDEAEEEAGEEEGEYEESSIIHHTASVGDVEGLK  241

Query  691   NALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYG  512
              AL  G DKDEEDSEGR  LHFACGYGE+ CAQ+LL++GA VDA+DKN NTALHYAAGYG
Sbjct  242   KALEDGVDKDEEDSEGRRGLHFACGYGELNCAQVLLDAGAAVDAVDKNNNTALHYAAGYG  301

Query  511   RKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             RK+CVALLLE+GAAVTLQN+DGKTPI+VAKLNNQ DVLKLLEK AF+
Sbjct  302   RKDCVALLLESGAAVTLQNLDGKTPIDVAKLNNQEDVLKLLEKHAFV  348



>dbj|BAJ99212.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=321

 Score =   415 bits (1067),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 209/301 (69%), Positives = 250/301 (83%), Gaps = 4/301 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             +PFDFS M+ LLNDPSI+E+AEQIA DP F QMAEQLQ++ QG     G+P  DPQ Y  
Sbjct  22    SPFDFSNMSSLLNDPSIREMAEQIASDPVFNQMAEQLQKSAQGTGEQ-GVPSLDPQAYLE  80

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TM +VMQNPQFM+MAERLGN+LMQDP+MSSMLE+L++PA K+QLEERM RIK+DPSLKPI
Sbjct  81    TMTKVMQNPQFMSMAERLGNSLMQDPAMSSMLENLTSPAHKEQLEERMTRIKDDPSLKPI  140

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMG--FPgagetatsget-gtdeaeeasedeSI  734
             L+EIE+GGP+AM++YWND ++L+K+GEAM   FP    T+T        + E   +DESI
Sbjct  141   LDEIERGGPSAMVKYWNDPEILQKIGEAMSLNFPVDAATSTVLSGPQETDEEGEDDDESI  200

Query  733   VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
             VH+ ASVGD EGLK AL  GA+KDEED EGR ALHFACGYGE+KCA+ILLE+GA VDALD
Sbjct  201   VHNTASVGDAEGLKKALDGGANKDEEDVEGRRALHFACGYGELKCAEILLEAGAAVDALD  260

Query  553   KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAF  374
             KNKNT LHYAAGYGRKECV LLL++GAAV LQN+DGKTPIEVAKLN+Q++V+KLLE+D F
Sbjct  261   KNKNTPLHYAAGYGRKECVDLLLKHGAAVMLQNLDGKTPIEVAKLNSQDEVVKLLEQDVF  320

Query  373   L  371
             L
Sbjct  321   L  321



>ref|NP_195270.1| ankyrin repeat domain-containing protein 2 [Arabidopsis thaliana]
 ref|NP_849497.1| ankyrin repeat domain-containing protein 2 [Arabidopsis thaliana]
 ref|NP_849498.1| ankyrin repeat domain-containing protein 2 [Arabidopsis thaliana]
 sp|Q9SAR5.2|AKR2_ARATH RecName: Full=Ankyrin repeat domain-containing protein 2; Short=AtAKR2 
[Arabidopsis thaliana]
 gb|AAK62427.1|AF386982_1 ankyrin repeat-containing protein 2 [Arabidopsis thaliana]
 emb|CAB54873.1| ankyrin repeat-containing protein 2 [Arabidopsis thaliana]
 emb|CAB80261.1| ankyrin repeat-containing protein 2 [Arabidopsis thaliana]
 gb|AAM10039.1| ankyrin repeat-containing protein 2 [Arabidopsis thaliana]
 gb|AAM64927.1| ankyrin repeat-containing protein 2 [Arabidopsis thaliana]
 dbj|BAH19543.1| AT4G35450 [Arabidopsis thaliana]
 dbj|BAH19853.1| AT4G35450 [Arabidopsis thaliana]
 gb|AEE86513.1| ankyrin repeat domain-containing protein 2 [Arabidopsis thaliana]
 gb|AEE86515.1| ankyrin repeat domain-containing protein 2 [Arabidopsis thaliana]
 gb|AEE86516.1| ankyrin repeat domain-containing protein 2 [Arabidopsis thaliana]
Length=342

 Score =   412 bits (1060),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 205/298 (69%), Positives = 243/298 (82%), Gaps = 0/298 (0%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             N FDFS M  +LNDPSI+E+AEQIAKDP+F Q+AEQLQ++   A    G P FDPQQY  
Sbjct  45    NAFDFSNMASILNDPSIREMAEQIAKDPAFNQLAEQLQRSIPNAGQEGGFPNFDPQQYVN  104

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVM NP+F TMAE+LG AL+QDP MS  L++ SNP   +   ERMAR+KEDP LKPI
Sbjct  105   TMQQVMHNPEFKTMAEKLGTALVQDPQMSPFLDAFSNPETAEHFTERMARMKEDPELKPI  164

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeasedeSIVHH  725
             L+EI+ GGP+AMM+YWND +VLKKLGEAMG P AG    +     + AEE  E+ESIVH 
Sbjct  165   LDEIDAGGPSAMMKYWNDPEVLKKLGEAMGMPVAGLPDQTVSAEPEVAEEGEEEESIVHQ  224

Query  724   CASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNK  545
              AS+GD EGLK ALA+G +KDEEDSEGRTALHFACGYGE+KCAQ+L+++GA V+A+DKNK
Sbjct  225   TASLGDVEGLKAALASGGNKDEEDSEGRTALHFACGYGELKCAQVLIDAGASVNAVDKNK  284

Query  544   NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NT LHYAAGYGRKECV+LLLENGAAVTLQN+D KTPI+VAKLN+Q +V+KLLEKDAFL
Sbjct  285   NTPLHYAAGYGRKECVSLLLENGAAVTLQNLDEKTPIDVAKLNSQLEVVKLLEKDAFL  342



>ref|NP_849499.1| ankyrin repeat domain-containing protein 2 [Arabidopsis thaliana]
 gb|AEE86514.1| ankyrin repeat domain-containing protein 2 [Arabidopsis thaliana]
Length=304

 Score =   411 bits (1056),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 205/298 (69%), Positives = 243/298 (82%), Gaps = 0/298 (0%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             N FDFS M  +LNDPSI+E+AEQIAKDP+F Q+AEQLQ++   A    G P FDPQQY  
Sbjct  7     NAFDFSNMASILNDPSIREMAEQIAKDPAFNQLAEQLQRSIPNAGQEGGFPNFDPQQYVN  66

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVM NP+F TMAE+LG AL+QDP MS  L++ SNP   +   ERMAR+KEDP LKPI
Sbjct  67    TMQQVMHNPEFKTMAEKLGTALVQDPQMSPFLDAFSNPETAEHFTERMARMKEDPELKPI  126

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeasedeSIVHH  725
             L+EI+ GGP+AMM+YWND +VLKKLGEAMG P AG    +     + AEE  E+ESIVH 
Sbjct  127   LDEIDAGGPSAMMKYWNDPEVLKKLGEAMGMPVAGLPDQTVSAEPEVAEEGEEEESIVHQ  186

Query  724   CASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNK  545
              AS+GD EGLK ALA+G +KDEEDSEGRTALHFACGYGE+KCAQ+L+++GA V+A+DKNK
Sbjct  187   TASLGDVEGLKAALASGGNKDEEDSEGRTALHFACGYGELKCAQVLIDAGASVNAVDKNK  246

Query  544   NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NT LHYAAGYGRKECV+LLLENGAAVTLQN+D KTPI+VAKLN+Q +V+KLLEKDAFL
Sbjct  247   NTPLHYAAGYGRKECVSLLLENGAAVTLQNLDEKTPIDVAKLNSQLEVVKLLEKDAFL  304



>gb|EAY77663.1| hypothetical protein OsI_32702 [Oryza sativa Indica Group]
Length=329

 Score =   411 bits (1056),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 214/301 (71%), Positives = 246/301 (82%), Gaps = 4/301 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFS  + LLNDPSIKE+AEQIA DP FTQMAEQLQ++        G P  DPQQY  
Sbjct  30    NPFDFSQFSNLLNDPSIKEMAEQIASDPVFTQMAEQLQKSAH-VTGEQGGPALDPQQYME  88

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TM QVMQNPQFM+MAERLGN LMQDP MSSMLESL+NP+ K+ LEERM+RIKEDPSLK I
Sbjct  89    TMTQVMQNPQFMSMAERLGNTLMQDPGMSSMLESLTNPSHKELLEERMSRIKEDPSLKGI  148

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMG--FPgagetatsget-gtdeaeeasedeSI  734
             L+EIE GGP+AM++YWND +VL+K+G+AM   FPG   T+T+       E +   +DESI
Sbjct  149   LDEIESGGPSAMVKYWNDPEVLQKIGQAMSINFPGDAATSTTLSGPEETEEDGGDDDESI  208

Query  733   VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
             VHH ASVGD EGLK AL  GAD DEED+EGR ALHFACGYGE+KCA+ILLE+GA V+ALD
Sbjct  209   VHHTASVGDAEGLKKALEDGADMDEEDAEGRRALHFACGYGELKCAEILLEAGAAVNALD  268

Query  553   KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAF  374
             KNKNT LHYAAGYGRKECV LLL++GAAVT QN+DGKTPIEVAKLNNQ++VLK+LE DAF
Sbjct  269   KNKNTPLHYAAGYGRKECVDLLLKHGAAVTPQNLDGKTPIEVAKLNNQDEVLKVLEMDAF  328

Query  373   L  371
             L
Sbjct  329   L  329



>ref|XP_009121121.1| PREDICTED: ankyrin repeat domain-containing protein 2 [Brassica 
rapa]
 ref|XP_009121122.1| PREDICTED: ankyrin repeat domain-containing protein 2 [Brassica 
rapa]
 ref|XP_009121123.1| PREDICTED: ankyrin repeat domain-containing protein 2 [Brassica 
rapa]
 emb|CDY24333.1| BnaA07g02580D [Brassica napus]
Length=342

 Score =   411 bits (1057),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 206/300 (69%), Positives = 246/300 (82%), Gaps = 3/300 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDG-IPQFDPQQYY  1088
             N FDFS+M G+LNDPSIKELAEQIAKDP+F Q+AEQLQ++   A+S +G +P FDP+QY 
Sbjct  44    NAFDFSSMAGILNDPSIKELAEQIAKDPTFNQLAEQLQKSVPSASSTEGALPNFDPEQYM  103

Query  1087  GTMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKP  908
              TM QVM NP+F TMAE+LGNAL+QDP MSS +E+ +NP   +Q  ERMA++KEDP+LKP
Sbjct  104   ATMNQVMGNPEFRTMAEKLGNALVQDPQMSSFMEAFANPGATEQFTERMAQMKEDPTLKP  163

Query  907   ILEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPg-agetatsgetgtdeaeeasedeSIV  731
             IL EI+   P+AMM+YWNDKDVLKKLGEAMG    A +   +     +  E   E+ESIV
Sbjct  164   ILAEID-ADPSAMMKYWNDKDVLKKLGEAMGIAVGAEQNVAAEPEPEEAEEGEDEEESIV  222

Query  730   HHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDK  551
             H  AS+GD EGLK ALA+G +KDEEDSEGRTALHFACGYGEVKCAQ+L+++GA V+A+DK
Sbjct  223   HQTASLGDVEGLKAALASGGNKDEEDSEGRTALHFACGYGEVKCAQVLVDAGANVNAVDK  282

Query  550   NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NKNT LHYAAGYGRKECV+LLLENGAAVTLQN D KTP++VAKLNNQ DV+KLLEKDAFL
Sbjct  283   NKNTPLHYAAGYGRKECVSLLLENGAAVTLQNTDSKTPVDVAKLNNQLDVVKLLEKDAFL  342



>emb|CDX72536.1| BnaC07g45580D [Brassica napus]
Length=345

 Score =   411 bits (1056),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 225/353 (64%), Positives = 267/353 (76%), Gaps = 17/353 (5%)
 Frame = -1

Query  1408  SQEEKNLPAQKQDEKSGAADSKKPLESTSLDTQSgqggaplaagpGMHNPFDFSAMTGLL  1229
             S  +KNL     DEK+G+ +S KP        +S   G+  ++     N FDFS M G+L
Sbjct  3     SNPDKNL--SPSDEKTGSTESPKP--------ESTASGSSPSSAALNFNAFDFSNMAGIL  52

Query  1228  NDPSIKELAEQIAKDPSFTQMAEQLQQTF----QGAASNDGIPQFDPQQYYGTMQQVMQN  1061
             NDPSI+ELAEQIAKDP+F Q+AEQLQ++     QG A     P  DPQQY  TMQQVM N
Sbjct  53    NDPSIRELAEQIAKDPAFNQLAEQLQRSIPNAAQGGAGEGSFPNIDPQQYVSTMQQVMHN  112

Query  1060  PQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGG  881
             P+F TMAERLG AL+QDP MS  LE+ SNP   +   ERMAR+KEDP LKPIL+EI+ GG
Sbjct  113   PEFQTMAERLGKALVQDPQMSPFLEAFSNPETAEHFTERMARMKEDPELKPILDEIDAGG  172

Query  880   PAAMMRYWNDKDVLKKLGEAMGFPgag---etatsgetgtdeaeeasedeSIVHHCASVG  710
             P+AMM+YWNDKDVLKKLGEAMG P AG   +TA++      E  E  E+ES+VH  AS+G
Sbjct  173   PSAMMKYWNDKDVLKKLGEAMGMPVAGLPGQTASAEPEVAAEEGEEEEEESVVHQTASLG  232

Query  709   DEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALH  530
             D EGLKNAL +G +KDEEDSEGRTALHFACGYGE+KCAQ+L+++GA V+A+DKNKNT LH
Sbjct  233   DVEGLKNALESGGNKDEEDSEGRTALHFACGYGELKCAQVLIDAGASVNAVDKNKNTPLH  292

Query  529   YAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             YAAGYGRKECV+LLLENGAAVTLQN D KTPI+VAKLNNQ +V+KLLEKDAFL
Sbjct  293   YAAGYGRKECVSLLLENGAAVTLQNQDEKTPIDVAKLNNQVEVVKLLEKDAFL  345



>gb|AAC33264.1| AFT protein [Arabidopsis thaliana]
Length=368

 Score =   412 bits (1058),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 205/298 (69%), Positives = 242/298 (81%), Gaps = 0/298 (0%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             N FDFS M  +LNDPSI+E+AEQIAKDP+F Q+AEQLQ++   A    G P FDPQQY  
Sbjct  71    NAFDFSNMASILNDPSIREMAEQIAKDPAFNQLAEQLQRSIPNAGQEGGFPNFDPQQYVN  130

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVM NP+F TMAE+LG AL+QDP MS  L++ SNP   +   ERMAR+KEDP LKPI
Sbjct  131   TMQQVMHNPEFKTMAEKLGTALVQDPQMSPFLDAFSNPETAEHFTERMARMKEDPELKPI  190

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeasedeSIVHH  725
             L+EI+ GGP+AMM+YWND +VLKKLGEAMG P AG    +     + AEE  E+ESIVH 
Sbjct  191   LDEIDAGGPSAMMKYWNDPEVLKKLGEAMGMPVAGLPDQTVSAEPEVAEEGEEEESIVHQ  250

Query  724   CASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNK  545
              AS+GD EGLK ALA+G  KDEEDSEGRTALHFACGYGE+KCAQ+L+++GA V+A+DKNK
Sbjct  251   TASLGDVEGLKAALASGGTKDEEDSEGRTALHFACGYGELKCAQVLIDAGASVNAVDKNK  310

Query  544   NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NT LHYAAGYGRKECV+LLLENGAAVTLQN+D KTPI+VAKLN+Q +V+KLLEKDAFL
Sbjct  311   NTPLHYAAGYGRKECVSLLLENGAAVTLQNLDEKTPIDVAKLNSQLEVVKLLEKDAFL  368



>emb|CDY49426.1| BnaC07g06450D [Brassica napus]
Length=340

 Score =   410 bits (1054),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 206/300 (69%), Positives = 245/300 (82%), Gaps = 3/300 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDG-IPQFDPQQYY  1088
             N FDFS+M G+LNDPSIKELAEQIAKDP+F Q+AEQLQ++   A+S +G +P FDP+QY 
Sbjct  42    NAFDFSSMAGILNDPSIKELAEQIAKDPTFNQLAEQLQKSVPSASSTEGALPNFDPEQYM  101

Query  1087  GTMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKP  908
              TM QVM NP+F TMAE+LGNAL+QDP MSS +E+ +NP   +Q  ERMA++KEDP+LKP
Sbjct  102   ATMNQVMGNPEFRTMAEKLGNALVQDPQMSSFMEAFANPGATEQFTERMAQMKEDPTLKP  161

Query  907   ILEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPg-agetatsgetgtdeaeeasedeSIV  731
             IL EI+   P+AMM+YWNDKDVLKKLGEAMG    A +   +     +  E   E+ESIV
Sbjct  162   ILAEID-ADPSAMMKYWNDKDVLKKLGEAMGIAVGAEQNVAAEPEPEEAEEGEDEEESIV  220

Query  730   HHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDK  551
             H  AS+GD EGLK ALA+G +KDEEDSEGRTALHFACGYGEVKCAQ+L++ GA V+A+DK
Sbjct  221   HQTASLGDVEGLKAALASGGNKDEEDSEGRTALHFACGYGEVKCAQVLVDCGANVNAVDK  280

Query  550   NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NKNT LHYAAGYGRKECV+LLLENGAAVTLQN D KTP++VAKLNNQ DV+KLLEKDAFL
Sbjct  281   NKNTPLHYAAGYGRKECVSLLLENGAAVTLQNTDSKTPVDVAKLNNQLDVVKLLEKDAFL  340



>ref|NP_001063647.1| Os09g0513000 [Oryza sativa Japonica Group]
 dbj|BAF25561.1| Os09g0513000, partial [Oryza sativa Japonica Group]
Length=352

 Score =   410 bits (1053),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 213/301 (71%), Positives = 246/301 (82%), Gaps = 4/301 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFS  + LLNDPSIKE+AEQIA DP FTQMAEQLQ++        G P  DPQQY  
Sbjct  53    NPFDFSQFSNLLNDPSIKEMAEQIASDPVFTQMAEQLQKSAH-VTGEQGGPALDPQQYME  111

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TM QVMQNPQFM+MAERLGN LMQDP MSSMLESL++P+ K+ LEERM+RIKEDPSLK I
Sbjct  112   TMTQVMQNPQFMSMAERLGNTLMQDPGMSSMLESLTSPSHKELLEERMSRIKEDPSLKGI  171

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMG--FPgagetats-getgtdeaeeasedeSI  734
             L+EIE GGP+AM++YWND +VL+K+G+AM   FPG   T+T+       E +   +DESI
Sbjct  172   LDEIESGGPSAMVKYWNDPEVLQKIGQAMSINFPGDAATSTTLSGPEETEEDGGDDDESI  231

Query  733   VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
             VHH ASVGD EGLK AL  GAD DEED+EGR ALHFACGYGE+KCA+ILLE+GA V+ALD
Sbjct  232   VHHTASVGDAEGLKKALEDGADMDEEDAEGRRALHFACGYGELKCAEILLEAGAAVNALD  291

Query  553   KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAF  374
             KNKNT LHYAAGYGRKECV LLL++GAAVT QN+DGKTPIEVAKLNNQ++VLK+LE DAF
Sbjct  292   KNKNTPLHYAAGYGRKECVDLLLKHGAAVTPQNLDGKTPIEVAKLNNQDEVLKVLEMDAF  351

Query  373   L  371
             L
Sbjct  352   L  352



>dbj|BAD34416.1| putative TGB12K interacting protein 3 [Oryza sativa Japonica 
Group]
 gb|EAZ12772.1| hypothetical protein OsJ_02689 [Oryza sativa Japonica Group]
Length=329

 Score =   409 bits (1051),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 213/301 (71%), Positives = 246/301 (82%), Gaps = 4/301 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFS  + LLNDPSIKE+AEQIA DP FTQMAEQLQ++        G P  DPQQY  
Sbjct  30    NPFDFSQFSNLLNDPSIKEMAEQIASDPVFTQMAEQLQKSAH-VTGEQGGPALDPQQYME  88

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TM QVMQNPQFM+MAERLGN LMQDP MSSMLESL++P+ K+ LEERM+RIKEDPSLK I
Sbjct  89    TMTQVMQNPQFMSMAERLGNTLMQDPGMSSMLESLTSPSHKELLEERMSRIKEDPSLKGI  148

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMG--FPgagetatsget-gtdeaeeasedeSI  734
             L+EIE GGP+AM++YWND +VL+K+G+AM   FPG   T+T+       E +   +DESI
Sbjct  149   LDEIESGGPSAMVKYWNDPEVLQKIGQAMSINFPGDAATSTTLSGPEETEEDGGDDDESI  208

Query  733   VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
             VHH ASVGD EGLK AL  GAD DEED+EGR ALHFACGYGE+KCA+ILLE+GA V+ALD
Sbjct  209   VHHTASVGDAEGLKKALEDGADMDEEDAEGRRALHFACGYGELKCAEILLEAGAAVNALD  268

Query  553   KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAF  374
             KNKNT LHYAAGYGRKECV LLL++GAAVT QN+DGKTPIEVAKLNNQ++VLK+LE DAF
Sbjct  269   KNKNTPLHYAAGYGRKECVDLLLKHGAAVTPQNLDGKTPIEVAKLNNQDEVLKVLEMDAF  328

Query  373   L  371
             L
Sbjct  329   L  329



>ref|XP_010437471.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Camelina 
sativa]
 ref|XP_010437472.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Camelina 
sativa]
Length=344

 Score =   409 bits (1052),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 206/300 (69%), Positives = 244/300 (81%), Gaps = 2/300 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDG-IPQFDPQQYY  1088
             N FDFS M  +LNDPSI+E+AEQIAKDP+F Q+AEQLQ++   A + +G  P FDPQQY 
Sbjct  45    NAFDFSNMASILNDPSIREMAEQIAKDPAFNQLAEQLQRSIPNAGAQEGGFPNFDPQQYV  104

Query  1087  GTMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKP  908
              TMQQVM NP+F TMAERLG+AL+QDP MS  L++ SNP   +   ERMAR+KEDP LKP
Sbjct  105   NTMQQVMHNPEFKTMAERLGSALVQDPQMSPFLDAFSNPETAEHFTERMARMKEDPELKP  164

Query  907   ILEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgag-etatsgetgtdeaeeasedeSIV  731
             IL+EI+ GGP+AMM+YWND DVLKKLGEAMG P AG    T+        E   E+ESIV
Sbjct  165   ILDEIDAGGPSAMMKYWNDPDVLKKLGEAMGMPVAGLPDQTASAEPEAPEEGEEEEESIV  224

Query  730   HHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDK  551
             H  AS+GD EGLK ALA+G +KDEEDSEGRTALHFACGYGE+KCAQ+L+++GA V+A+DK
Sbjct  225   HQTASLGDVEGLKAALASGGNKDEEDSEGRTALHFACGYGELKCAQVLIDAGASVNAVDK  284

Query  550   NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NKNT LHYAAGYGRKECV+LLLENGAAVTLQN+D KTPI+VAKLN+Q +V+KLLEKDAFL
Sbjct  285   NKNTPLHYAAGYGRKECVSLLLENGAAVTLQNLDEKTPIDVAKLNSQLEVVKLLEKDAFL  344



>ref|NP_001140813.1| ankyrin repeat domain-containing protein 2 [Zea mays]
 gb|ACF84686.1| unknown [Zea mays]
 gb|ACG37148.1| ankyrin repeat domain-containing protein 2 [Zea mays]
 gb|ACR38421.1| unknown [Zea mays]
 gb|ACR38499.1| unknown [Zea mays]
 tpg|DAA52532.1| TPA: ankyrin repeat domain-containing protein 2 [Zea mays]
Length=359

 Score =   410 bits (1053),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 212/309 (69%), Positives = 246/309 (80%), Gaps = 11/309 (4%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTF------QGAASNDGIPQFD  1103
             NPFDFS M  LLNDPSIKE+AEQIAKDP+FT+MAEQLQ+T       Q   +     Q D
Sbjct  51    NPFDFSTMMNLLNDPSIKEMAEQIAKDPAFTEMAEQLQKTVVSPRQQQQQQARQQQQQLD  110

Query  1102  PQQYYGTMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKED  923
             PQ+Y  TMQQ+MQNPQF+ MAERLG+ALMQDP+MS+ML  L+NPA K+QLE R+AR+KED
Sbjct  111   PQKYVATMQQLMQNPQFVAMAERLGSALMQDPAMSAMLGGLTNPAHKEQLEARVARMKED  170

Query  922   PSLKPILEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeased  743
             P+LKPIL+EIE GGPAAMM+YWND + L+K G AMG          G    +  ++A E+
Sbjct  171   PTLKPILDEIESGGPAAMMKYWNDPEALQKFGRAMGVGVGPSGEAGGAEHAEAEDDAGEE  230

Query  742   -----eSIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLES  578
                  ESIVHH ASVGD EGLK AL  GADKDEEDSEGR  LHFACGYGE++CAQ LLE+
Sbjct  231   GEYEDESIVHHTASVGDVEGLKKALEDGADKDEEDSEGRRGLHFACGYGELQCAQALLEA  290

Query  577   GAKVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVL  398
             GA VDA+DKNKNTALHYAAGYGRK+CVALLLE+GAAVTLQN+DGKTPI+VAKLNNQ+DVL
Sbjct  291   GAAVDAVDKNKNTALHYAAGYGRKDCVALLLESGAAVTLQNLDGKTPIDVAKLNNQDDVL  350

Query  397   KLLEKDAFL  371
             KLLEK AF+
Sbjct  351   KLLEKHAFV  359



>gb|AAD10949.1| ankyrin repeat-containing protein 2 [Arabidopsis thaliana]
Length=342

 Score =   409 bits (1051),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 204/298 (68%), Positives = 242/298 (81%), Gaps = 0/298 (0%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             N FDFS M  +LNDPSI+E+AEQIAKDP+F Q+AEQLQ++   A    G P FDPQQY  
Sbjct  45    NAFDFSNMASILNDPSIREMAEQIAKDPAFNQLAEQLQRSIPNAGQEGGFPNFDPQQYVN  104

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVM NP+F TMAE+LG AL+QDP MS  L++ SNP   +   ERMAR+KEDP LKPI
Sbjct  105   TMQQVMHNPEFKTMAEKLGTALVQDPQMSPFLDAFSNPETAEHFTERMARMKEDPELKPI  164

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeasedeSIVHH  725
             L+EI+ GGP+AMM+YWND +VLKKLGEAMG P AG    +     + AEE  E+ESIVH 
Sbjct  165   LDEIDAGGPSAMMKYWNDPEVLKKLGEAMGMPVAGLPDQTVSAEPEVAEEGEEEESIVHQ  224

Query  724   CASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNK  545
              AS+GD EGLK ALA+G +KDEEDSEGRTALHFACGYGE+KCAQ+L+++GA V+A+DKNK
Sbjct  225   TASLGDVEGLKAALASGGNKDEEDSEGRTALHFACGYGELKCAQVLIDAGASVNAVDKNK  284

Query  544   NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NT LHYAAGYGRKE V+LLLENGAAVTLQN+D KTPI+VAKLN+Q +V+KLLEKDAFL
Sbjct  285   NTPLHYAAGYGRKESVSLLLENGAAVTLQNLDEKTPIDVAKLNSQLEVVKLLEKDAFL  342



>ref|XP_006409315.1| hypothetical protein EUTSA_v10022709mg [Eutrema salsugineum]
 gb|ESQ50768.1| hypothetical protein EUTSA_v10022709mg [Eutrema salsugineum]
Length=405

 Score =   411 bits (1056),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 210/297 (71%), Positives = 241/297 (81%), Gaps = 1/297 (0%)
 Frame = -1

Query  1258  FDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTM  1079
             FDFS+M  +LNDPSIKELAEQIAKDP+F Q+AEQLQ++   A+   G+P FDP QY  TM
Sbjct  109   FDFSSMASILNDPSIKELAEQIAKDPAFNQLAEQLQRSVPSASQEGGLPNFDPDQYMNTM  168

Query  1078  QQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILE  899
              QVM NP+F TMAERLGNAL+QDP MS  LE+  NPA  +Q  ERMA++KEDP LKPIL 
Sbjct  169   NQVMGNPEFRTMAERLGNALVQDPQMSPFLEAFGNPAATEQFAERMAQMKEDPVLKPILA  228

Query  898   EIEQGG-PAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeasedeSIVHHC  722
             EI+  G P+AMM+YWNDKDVLKKLGEAMG     +   + E    EAEE  E+ESIVH  
Sbjct  229   EIDASGDPSAMMKYWNDKDVLKKLGEAMGLAVGADQDVAAEPEEAEAEEGEEEESIVHQT  288

Query  721   ASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKN  542
             AS+GD EGLK ALA+G +KDEEDSEGRTALHFACGYGE+KCAQ+LL+ GA V+A+DKN N
Sbjct  289   ASLGDVEGLKTALASGGNKDEEDSEGRTALHFACGYGEMKCAQVLLDGGANVNAVDKNNN  348

Query  541   TALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             T LHYAAGYGRKECV+LLLENGAAVTLQNMD KTPI+VAKLNNQ DV+KLLEKDAFL
Sbjct  349   TPLHYAAGYGRKECVSLLLENGAAVTLQNMDSKTPIDVAKLNNQLDVVKLLEKDAFL  405



>ref|XP_010909898.1| PREDICTED: ankyrin repeat domain-containing protein 2-like isoform 
X2 [Elaeis guineensis]
Length=280

 Score =   406 bits (1044),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 209/281 (74%), Positives = 242/281 (86%), Gaps = 3/281 (1%)
 Frame = -1

Query  1207  LAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQNPQFMTMAERLG  1028
             +AEQIA+DP F QMAEQLQ++ QGA   DG+PQ DPQQY  TMQQVMQNPQF+TMAERLG
Sbjct  1     MAEQIARDPVFNQMAEQLQKSVQGAG-QDGLPQLDPQQYISTMQQVMQNPQFITMAERLG  59

Query  1027  NALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAAMMRYWNDK  848
             NALMQ+P+M+SML+SL+NP+ K+QLEER+A +K+DP+LKPIL+EIE GGP AMM+YWND 
Sbjct  60    NALMQEPAMASMLDSLTNPSHKEQLEERLAHMKDDPTLKPILDEIENGGPTAMMKYWNDP  119

Query  847   DVLKKLGEAMGFPgagetatsgetg--tdeaeeasedeSIVHHCASVGDEEGLKNALAAG  674
             +VL+KLG+AMG   +GE ATS E     +  E   EDES+VHH AS+GD EGLK AL  G
Sbjct  120   EVLQKLGQAMGIGSSGEAATSTELSGPEEAEEGGYEDESVVHHMASIGDVEGLKKALEDG  179

Query  673   ADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRKECVA  494
             ADKDEEDSEGR ALHFACGYGEVKCAQ+LL  GA VDALDKNKNTALHYAAGYGR++CVA
Sbjct  180   ADKDEEDSEGRRALHFACGYGEVKCAQLLLGVGATVDALDKNKNTALHYAAGYGREDCVA  239

Query  493   LLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             LLLE+GAAVTLQN+DGKTPI+VAKLNNQ +VLKLLEKDAFL
Sbjct  240   LLLEHGAAVTLQNLDGKTPIDVAKLNNQEEVLKLLEKDAFL  280



>emb|CDY40634.1| BnaA03g53290D [Brassica napus]
Length=349

 Score =   409 bits (1050),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 224/353 (63%), Positives = 263/353 (75%), Gaps = 13/353 (4%)
 Frame = -1

Query  1408  SQEEKNLPAQKQDEKSGAADSKKPLESTSLDTQSgqggaplaagpGMHNPFDFSAMTGLL  1229
             S  +KNL     DEK+G+ +S KP  + S  + S     P        N FDFS M G+L
Sbjct  3     SSPDKNL--SPSDEKTGSTESPKPESAASGSSPSSANNPPALN----FNAFDFSNMAGIL  56

Query  1228  NDPSIKELAEQIAKDPSFTQMAEQLQQTF---QGAASNDGIPQFDPQQYYGTMQQVMQNP  1058
             NDPSI+ELAEQIAKDP+F Q+AEQLQ++        +  G P  DPQQY  TMQQVM NP
Sbjct  57    NDPSIRELAEQIAKDPAFNQLAEQLQRSIPDAAQGGAGGGFPNIDPQQYVSTMQQVMHNP  116

Query  1057  QFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGP  878
             +F TMAERLG AL+QDP MS  LE+ SNP   +   ERMAR+KEDP LKPIL+EI+ GGP
Sbjct  117   EFQTMAERLGKALVQDPQMSPFLEAFSNPETAEHFTERMARMKEDPELKPILDEIDAGGP  176

Query  877   AAMMRYWNDKDVLKKLGEAMGFPga----getatsgetgtdeaeeasedeSIVHHCASVG  710
             +AMM+YWNDKDVLKKLGEAMG P A       +   E   +E EE  E+ESIVH  AS+G
Sbjct  177   SAMMKYWNDKDVLKKLGEAMGMPVAGLPGQTASAEPEVAAEEGEEEEEEESIVHQTASLG  236

Query  709   DEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALH  530
             D EGLKNAL +G +KDEEDSEGRTALHFACGYGE+KCAQ+L+++GA V+A+DKNKNT LH
Sbjct  237   DVEGLKNALESGGNKDEEDSEGRTALHFACGYGELKCAQVLIDAGASVNAVDKNKNTPLH  296

Query  529   YAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             YAAGYGRKECV+LLLENGAAVTLQN D KTPI+VAKLNNQ +V+KLLEKDAFL
Sbjct  297   YAAGYGRKECVSLLLENGAAVTLQNQDEKTPIDVAKLNNQAEVVKLLEKDAFL  349



>ref|XP_010432283.1| PREDICTED: ankyrin repeat domain-containing protein 2 [Camelina 
sativa]
Length=344

 Score =   408 bits (1049),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 206/300 (69%), Positives = 244/300 (81%), Gaps = 2/300 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDG-IPQFDPQQYY  1088
             N FDFS M  +LNDPSI+E+AEQIAKDP+F Q+AEQLQ++   A + +G  P FDPQQY 
Sbjct  45    NAFDFSNMASILNDPSIREMAEQIAKDPAFNQLAEQLQRSIPNAGAQEGGFPNFDPQQYV  104

Query  1087  GTMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKP  908
              TMQQVM NP+F TMAERLG+AL+QDP MS  L++ SNP   +   ERMAR+KEDP LKP
Sbjct  105   NTMQQVMHNPEFKTMAERLGSALVQDPQMSPFLDAFSNPETAEHFTERMARMKEDPELKP  164

Query  907   ILEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgage-tatsgetgtdeaeeasedeSIV  731
             IL+EI+ GGP+AMM+YWND DVLKKLGEAMG P AG    T+        E   E+ESIV
Sbjct  165   ILDEIDAGGPSAMMKYWNDPDVLKKLGEAMGMPVAGLPDQTASAEPEAAEEGEEEEESIV  224

Query  730   HHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDK  551
             H  AS+GD EGLK ALA+G +KDEEDSEGRTALHFACGYGE+KCAQ+L+++GA V+A+DK
Sbjct  225   HQTASLGDVEGLKAALASGGNKDEEDSEGRTALHFACGYGELKCAQVLIDAGASVNAVDK  284

Query  550   NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NKNT LHYAAGYGRKECV+LLLENGAAVTLQN+D KTPI+VAKLN+Q +V+KLLEKDAFL
Sbjct  285   NKNTPLHYAAGYGRKECVSLLLENGAAVTLQNLDEKTPIDVAKLNSQLEVVKLLEKDAFL  344



>ref|XP_009138358.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Brassica 
rapa]
Length=350

 Score =   407 bits (1047),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 223/354 (63%), Positives = 262/354 (74%), Gaps = 14/354 (4%)
 Frame = -1

Query  1408  SQEEKNLPAQKQDEKSGAADSKKPLESTSLDTQSgqggaplaagpGMHNPFDFSAMTGLL  1229
             S  +KNL     DEK+G+ +S KP  + S  + S     P        N FDFS M G+L
Sbjct  3     SSPDKNL--SPSDEKTGSTESPKPESAASGSSPSSANNPPALN----FNAFDFSNMAGIL  56

Query  1228  NDPSIKELAEQIAKDPSFTQMAEQLQQTF---QGAASNDGIPQFDPQQYYGTMQQVMQNP  1058
             NDPSI+ELAEQIAKDP+F Q+AEQLQ++        +  G P  DPQQY  TMQQVM NP
Sbjct  57    NDPSIRELAEQIAKDPAFNQLAEQLQRSIPDAAQGGAGGGFPNIDPQQYVSTMQQVMHNP  116

Query  1057  QFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGP  878
             +F TMAERLG AL+QDP MS  LE+ SNP   +   ERMAR+KEDP LKPIL+EI+ GGP
Sbjct  117   EFQTMAERLGKALVQDPQMSPFLEAFSNPETAEHFTERMARMKEDPELKPILDEIDAGGP  176

Query  877   AAMMRYWNDKDVLKKLGEAMGFPga-----getatsgetgtdeaeeasedeSIVHHCASV  713
             +AMM+YWNDKDVLKKLGEAMG P A       +A       +  EE  E+ESIVH  AS+
Sbjct  177   SAMMKYWNDKDVLKKLGEAMGMPVAGLPGQTASAEPEGAAEEGEEEEEEEESIVHQTASL  236

Query  712   GDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTAL  533
             GD EGLKNAL +G +KDEEDSEGRTALHFACGYGE+KCAQ+L+++GA V+A+DKNKNT L
Sbjct  237   GDVEGLKNALESGGNKDEEDSEGRTALHFACGYGELKCAQVLIDAGASVNAVDKNKNTPL  296

Query  532   HYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             HYAAGYGRKECV+LLLENGAAVTLQN D KTPI+VAKLNNQ +V+KLLEKDAFL
Sbjct  297   HYAAGYGRKECVSLLLENGAAVTLQNQDEKTPIDVAKLNNQAEVVKLLEKDAFL  350



>emb|CDY24811.1| BnaA08g14990D [Brassica napus]
Length=348

 Score =   407 bits (1047),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 214/304 (70%), Positives = 245/304 (81%), Gaps = 6/304 (2%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDG----IPQFDPQ  1097
             N FDFS M G+LNDPSI+ELAEQIAKDP+F Q+AEQLQ++   AA         P  DPQ
Sbjct  45    NAFDFSNMAGILNDPSIRELAEQIAKDPAFNQLAEQLQRSIPNAAQGGAGGGGFPNIDPQ  104

Query  1096  QYYGTMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPS  917
             QY  TMQQVM NP+F TMAERLG AL+QDP MS  LE+ SNP   + L ERMAR+KEDP 
Sbjct  105   QYVSTMQQVMHNPEFQTMAERLGKALVQDPQMSPFLEAFSNPETAEHLTERMARMKEDPE  164

Query  916   LKPILEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgag--etatsgetgtdeaeeased  743
             LKPIL+EI+ GGP+AMM+YWNDKDVLKKL EAMG P AG  + A S E    E E   E+
Sbjct  165   LKPILDEIDAGGPSAMMKYWNDKDVLKKLSEAMGMPIAGLPDQAASAEAEVAEEEGEEEE  224

Query  742   eSIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVD  563
             ESIVH  AS GD EGLKNALA+G +KDEEDSEGRTALHFACGYGE+KCAQ+L+++GA V+
Sbjct  225   ESIVHQTASRGDVEGLKNALASGGNKDEEDSEGRTALHFACGYGELKCAQVLIDAGASVN  284

Query  562   ALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEK  383
             A+DKNKNT LHYAAGYGRKECV+LLLENGAAVTLQN+D KTPI+VAKLNNQ +V+KLLEK
Sbjct  285   AVDKNKNTPLHYAAGYGRKECVSLLLENGAAVTLQNLDEKTPIDVAKLNNQLEVVKLLEK  344

Query  382   DAFL  371
             DAFL
Sbjct  345   DAFL  348



>ref|NP_001190925.1| ankyrin repeat domain-containing protein 2 [Arabidopsis thaliana]
 gb|AEE86517.1| ankyrin repeat domain-containing protein 2 [Arabidopsis thaliana]
Length=350

 Score =   406 bits (1044),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 206/306 (67%), Positives = 243/306 (79%), Gaps = 8/306 (3%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             N FDFS M  +LNDPSI+E+AEQIAKDP+F Q+AEQLQ++   A    G P FDPQQY  
Sbjct  45    NAFDFSNMASILNDPSIREMAEQIAKDPAFNQLAEQLQRSIPNAGQEGGFPNFDPQQYVN  104

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVM NP+F TMAE+LG AL+QDP MS  L++ SNP   +   ERMAR+KEDP LKPI
Sbjct  105   TMQQVMHNPEFKTMAEKLGTALVQDPQMSPFLDAFSNPETAEHFTERMARMKEDPELKPI  164

Query  904   LEEIEQGGPAAMM--------RYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeas  749
             L+EI+ GGP+AMM        RYWND +VLKKLGEAMG P AG    +     + AEE  
Sbjct  165   LDEIDAGGPSAMMKKNYLFCFRYWNDPEVLKKLGEAMGMPVAGLPDQTVSAEPEVAEEGE  224

Query  748   edeSIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAK  569
             E+ESIVH  AS+GD EGLK ALA+G +KDEEDSEGRTALHFACGYGE+KCAQ+L+++GA 
Sbjct  225   EEESIVHQTASLGDVEGLKAALASGGNKDEEDSEGRTALHFACGYGELKCAQVLIDAGAS  284

Query  568   VDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
             V+A+DKNKNT LHYAAGYGRKECV+LLLENGAAVTLQN+D KTPI+VAKLN+Q +V+KLL
Sbjct  285   VNAVDKNKNTPLHYAAGYGRKECVSLLLENGAAVTLQNLDEKTPIDVAKLNSQLEVVKLL  344

Query  388   EKDAFL  371
             EKDAFL
Sbjct  345   EKDAFL  350



>ref|XP_002466088.1| hypothetical protein SORBIDRAFT_01g000990 [Sorghum bicolor]
 gb|EER93086.1| hypothetical protein SORBIDRAFT_01g000990 [Sorghum bicolor]
Length=351

 Score =   406 bits (1043),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 213/311 (68%), Positives = 248/311 (80%), Gaps = 13/311 (4%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTF--------QGAASNDGIPQ  1109
             NPFDFS M  LLNDPSIKE+AEQIAKDP+FT+MAEQLQ+T         Q AAS     Q
Sbjct  41    NPFDFSTMMNLLNDPSIKEMAEQIAKDPAFTEMAEQLQKTVVSPRQRQQQQAASAAAAAQ  100

Query  1108  FDPQQYYGTMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIK  929
              DPQ+Y  TMQQ+MQNPQF+ MAERLG+ALMQDP++S+ML  L+NPA K+QLE R+AR+K
Sbjct  101   LDPQKYVATMQQLMQNPQFVAMAERLGSALMQDPAVSTMLGGLTNPAHKEQLEARVARMK  160

Query  928   EDPSLKPILEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeas  749
             +DP LKPIL+EIE GGPAAMM+YWND + L+K G AMG  G       G    +  ++A 
Sbjct  161   DDPDLKPILDEIESGGPAAMMKYWNDPEALQKFGRAMGVGGGPSGEAGGAEHAEAEDDAG  220

Query  748   ed-----eSIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILL  584
             E+     ESIVHH AS+GD EGLK AL  GADKDEEDSEGR  LHFACGYGE++CAQ LL
Sbjct  221   EEGEYEDESIVHHTASIGDVEGLKKALEDGADKDEEDSEGRRGLHFACGYGELQCAQALL  280

Query  583   ESGAKVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQND  404
             E+GA VDA+DKNKNTALHYAAGYGRK+CVALLLE+GAAVTLQN+DGKTPI+VAKLNNQ+D
Sbjct  281   EAGAAVDAVDKNKNTALHYAAGYGRKDCVALLLESGAAVTLQNLDGKTPIDVAKLNNQDD  340

Query  403   VLKLLEKDAFL  371
             VLKLLEK AF+
Sbjct  341   VLKLLEKHAFV  351



>ref|XP_006650906.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Oryza 
brachyantha]
Length=350

 Score =   406 bits (1043),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 208/309 (67%), Positives = 241/309 (78%), Gaps = 11/309 (4%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQG------AASNDGIPQFD  1103
             NPFDFS M  LLNDPSIKE+AEQIAKDP+FT+MAEQLQ+T Q         +   +P  D
Sbjct  42    NPFDFSTMMNLLNDPSIKEMAEQIAKDPAFTEMAEQLQKTVQSPRGAASPEAAAAVPALD  101

Query  1102  PQQYYGTMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKED  923
             P +Y  TMQQ+MQNPQF+ MAERLG+ALMQDP+MS+ML  L+NPA K+QLE R+AR+KED
Sbjct  102   PTKYVSTMQQLMQNPQFVAMAERLGSALMQDPAMSTMLGGLTNPAHKEQLEARIARMKED  161

Query  922   PSLKPILEEIEQGGPAAMMRYWNDKDVLKKLGEAMGF-----Pgagetatsgetgtdeae  758
             PSLKPIL+EIE GGPAAMM+YWND + L+K G AMG        A              E
Sbjct  162   PSLKPILDEIESGGPAAMMKYWNDPEALQKFGRAMGVGPSSEAAAAAGEHEEAEEDAGEE  221

Query  757   easedeSIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLES  578
                EDESI+HH ASVGD EGLK AL  G DKDEEDSEGR  LHFACGYGE++CAQ+LLE+
Sbjct  222   GEYEDESIIHHTASVGDVEGLKKALEEGVDKDEEDSEGRRGLHFACGYGELQCAQVLLEA  281

Query  577   GAKVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVL  398
             GA VDA+DKNKNTALHYAAGYGRK+CVALLL++GAAVT+QN+DGKT I+VAKLNNQ DVL
Sbjct  282   GAAVDAVDKNKNTALHYAAGYGRKDCVALLLDHGAAVTVQNLDGKTAIDVAKLNNQEDVL  341

Query  397   KLLEKDAFL  371
             KLLEK AF+
Sbjct  342   KLLEKHAFV  350



>ref|XP_009109291.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Brassica 
rapa]
Length=349

 Score =   404 bits (1038),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 214/305 (70%), Positives = 245/305 (80%), Gaps = 7/305 (2%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTF-----QGAASNDGIPQFDP  1100
             N FDFS M G+LNDPSI+ELAEQIAKDP+F Q+AEQLQ++       G A   G P  DP
Sbjct  45    NAFDFSNMAGILNDPSIRELAEQIAKDPAFNQLAEQLQRSIPNAAQGGGAGGGGFPNIDP  104

Query  1099  QQYYGTMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDP  920
             QQY  TMQQVM NP+F TMAERLG AL+QDP MS  LE+ SN    + L ERMAR+KEDP
Sbjct  105   QQYVSTMQQVMHNPEFQTMAERLGKALVQDPQMSPFLEAFSNAETAEHLTERMARMKEDP  164

Query  919   SLKPILEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgag--etatsgetgtdeaeease  746
              LKPIL+EI+ GGP+AMM+YWNDKDVLKKL EAMG P AG  + A S E    E E   E
Sbjct  165   ELKPILDEIDAGGPSAMMKYWNDKDVLKKLSEAMGMPIAGLPDQAASAEAEVAEEEGEEE  224

Query  745   deSIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKV  566
             +ESIVH  AS GD EGLKNALA+G +KDEEDSEGRTALHFACGYGE+KCAQ+L+++GA V
Sbjct  225   EESIVHQTASRGDVEGLKNALASGGNKDEEDSEGRTALHFACGYGELKCAQVLIDAGASV  284

Query  565   DALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLE  386
             +A+DKNKNT LHYAAGYGRKECV+LLLENGAAVTLQN+D KTPI+VAKLNNQ +V+KLLE
Sbjct  285   NAVDKNKNTPLHYAAGYGRKECVSLLLENGAAVTLQNLDEKTPIDVAKLNNQLEVVKLLE  344

Query  385   KDAFL  371
             KDAFL
Sbjct  345   KDAFL  349



>emb|CDX69141.1| BnaC01g03120D [Brassica napus]
Length=346

 Score =   404 bits (1037),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 210/303 (69%), Positives = 242/303 (80%), Gaps = 5/303 (2%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDG---IPQFDPQQ  1094
             N FDFS M  +LNDPSI+ELAEQIAKDP+F ++AEQLQ +   AA   G    P  DPQQ
Sbjct  44    NAFDFSNMASILNDPSIRELAEQIAKDPAFNKLAEQLQSSIPNAAEGGGAGGFPNIDPQQ  103

Query  1093  YYGTMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSL  914
             Y  TMQQVM NP+F TMAERLGNAL++DP MS  L++ SNP   +   ERMAR+KEDP L
Sbjct  104   YVSTMQQVMHNPEFQTMAERLGNALVKDPQMSPFLDAFSNPETAEHFTERMARMKEDPEL  163

Query  913   KPILEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPga--getatsgetgtdeaeeasede  740
             KPIL+EI+ GGP+AMM+YWNDKDVLKKLGEAMG P A     A S E    E E   E+E
Sbjct  164   KPILDEIDAGGPSAMMKYWNDKDVLKKLGEAMGMPVAGLPAQAASAEPEVAEEEGEEEEE  223

Query  739   SIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDA  560
             SIVH  AS+GD EGLK AL AG +KDEEDSEGRTALHFACGYGE+KCAQ+L+++GA V+A
Sbjct  224   SIVHQTASLGDVEGLKTALEAGGNKDEEDSEGRTALHFACGYGELKCAQVLIDAGASVNA  283

Query  559   LDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKD  380
             +DKNKNT LHYAAGYGRKECV+LLLENGAAVTLQN+D KTPI+VAKLNNQ +V+KLLEKD
Sbjct  284   VDKNKNTPLHYAAGYGRKECVSLLLENGAAVTLQNLDEKTPIDVAKLNNQLEVVKLLEKD  343

Query  379   AFL  371
             AFL
Sbjct  344   AFL  346



>ref|NP_001051917.1| Os03g0851700 [Oryza sativa Japonica Group]
 gb|AAO20057.1| unknown protein [Oryza sativa Japonica Group]
 gb|ABF99933.1| Ankyrin repeat domain protein 2, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13831.1| Os03g0851700 [Oryza sativa Japonica Group]
 gb|EAY92612.1| hypothetical protein OsI_14356 [Oryza sativa Indica Group]
 dbj|BAG90747.1| unnamed protein product [Oryza sativa Japonica Group]
Length=350

 Score =   403 bits (1035),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 208/312 (67%), Positives = 241/312 (77%), Gaps = 14/312 (4%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQG--------AASNDGIPQ  1109
             NPFDFS M  LLNDPSIKE+AEQIAKDP+FT+MAEQLQ+T Q          A+    P 
Sbjct  39    NPFDFSTMMNLLNDPSIKEMAEQIAKDPAFTEMAEQLQKTVQSPPARGAAQEAAAAAAPA  98

Query  1108  FDPQQYYGTMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIK  929
              DP +Y  TMQQ+MQNPQF+ MAERLG+ALMQDP+MSSML  L+NPA K+QLE R+AR+K
Sbjct  99    LDPSKYVSTMQQLMQNPQFVAMAERLGSALMQDPAMSSMLGGLTNPAHKEQLEARIARMK  158

Query  928   EDPSLKPILEEIEQGGPAAMMRYWNDKDVLKKLGEAMGF------Pgagetatsgetgtd  767
             +DPSLKPIL+EIE GGPAAMM+YWND + L+K G AMG         A            
Sbjct  159   DDPSLKPILDEIENGGPAAMMKYWNDPEALQKFGRAMGVGPSGEGAAAAGGEHEEAEEEG  218

Query  766   eaeeasedeSIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQIL  587
               E   EDES++HH ASVGD EGLK AL  G DKDEEDSEGR  LHFACGYGE+KCAQ+L
Sbjct  219   GEEGEYEDESVIHHTASVGDVEGLKKALEEGVDKDEEDSEGRRGLHFACGYGELKCAQVL  278

Query  586   LESGAKVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQN  407
             LE+GA VDA+DKNKNTALHYAAGYGRK+CVALLL++GAAVT+QN+DGKT I+VAKLNNQ 
Sbjct  279   LEAGAAVDAVDKNKNTALHYAAGYGRKDCVALLLDHGAAVTVQNLDGKTAIDVAKLNNQE  338

Query  406   DVLKLLEKDAFL  371
             +VLKLLEK AF+
Sbjct  339   EVLKLLEKHAFV  350



>gb|ABF99934.1| Ankyrin repeat domain protein 2, putative, expressed [Oryza sativa 
Japonica Group]
Length=349

 Score =   403 bits (1035),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 208/312 (67%), Positives = 241/312 (77%), Gaps = 14/312 (4%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQG--------AASNDGIPQ  1109
             NPFDFS M  LLNDPSIKE+AEQIAKDP+FT+MAEQLQ+T Q          A+    P 
Sbjct  38    NPFDFSTMMNLLNDPSIKEMAEQIAKDPAFTEMAEQLQKTVQSPPARGAAQEAAAAAAPA  97

Query  1108  FDPQQYYGTMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIK  929
              DP +Y  TMQQ+MQNPQF+ MAERLG+ALMQDP+MSSML  L+NPA K+QLE R+AR+K
Sbjct  98    LDPSKYVSTMQQLMQNPQFVAMAERLGSALMQDPAMSSMLGGLTNPAHKEQLEARIARMK  157

Query  928   EDPSLKPILEEIEQGGPAAMMRYWNDKDVLKKLGEAMGF------Pgagetatsgetgtd  767
             +DPSLKPIL+EIE GGPAAMM+YWND + L+K G AMG         A            
Sbjct  158   DDPSLKPILDEIENGGPAAMMKYWNDPEALQKFGRAMGVGPSGEGAAAAGGEHEEAEEEG  217

Query  766   eaeeasedeSIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQIL  587
               E   EDES++HH ASVGD EGLK AL  G DKDEEDSEGR  LHFACGYGE+KCAQ+L
Sbjct  218   GEEGEYEDESVIHHTASVGDVEGLKKALEEGVDKDEEDSEGRRGLHFACGYGELKCAQVL  277

Query  586   LESGAKVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQN  407
             LE+GA VDA+DKNKNTALHYAAGYGRK+CVALLL++GAAVT+QN+DGKT I+VAKLNNQ 
Sbjct  278   LEAGAAVDAVDKNKNTALHYAAGYGRKDCVALLLDHGAAVTVQNLDGKTAIDVAKLNNQE  337

Query  406   DVLKLLEKDAFL  371
             +VLKLLEK AF+
Sbjct  338   EVLKLLEKHAFV  349



>ref|XP_001753287.1| predicted protein [Physcomitrella patens]
 gb|EDQ81916.1| predicted protein [Physcomitrella patens]
Length=343

 Score =   402 bits (1032),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 217/303 (72%), Positives = 245/303 (81%), Gaps = 6/303 (2%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAM+GLLNDPSIKE+AEQIAKDP+FTQMA+QLQ + Q A S  G PQ DP QY  
Sbjct  42    NPFDFSAMSGLLNDPSIKEMAEQIAKDPAFTQMAQQLQSSVQSAGSG-GAPQLDPNQYIN  100

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
              MQQVMQNPQFMTMAERLGNALMQDP+MS ML +L+NPA K+QLE+RMA ++EDP+LKP+
Sbjct  101   AMQQVMQNPQFMTMAERLGNALMQDPAMSGMLSNLTNPAHKEQLEQRMAAVREDPTLKPV  160

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgageta-----tsgetgtdeaeeasede  740
             LEEIE GGPAAMM+YWND  VL +LG+AMG    G         S     +E  E  +DE
Sbjct  161   LEEIETGGPAAMMKYWNDPAVLSRLGQAMGVGVPGADGLQIPGESANDEEEEEGEEEDDE  220

Query  739   SIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDA  560
               VHH AS GD EGLK  L  GADKDE+D+EGRTALHFACGYGEVKCA+ LLE+GA  DA
Sbjct  221   LTVHHTASTGDVEGLKILLRDGADKDEKDAEGRTALHFACGYGEVKCAEALLEAGAAADA  280

Query  559   LDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKD  380
             LDKN NTALHYAAGYGR ECV LLL+NGAAVTLQN+DGKTPI+VAKLNNQ+ VL+LLEKD
Sbjct  281   LDKNNNTALHYAAGYGRAECVELLLKNGAAVTLQNLDGKTPIDVAKLNNQDKVLQLLEKD  340

Query  379   AFL  371
             AFL
Sbjct  341   AFL  343



>ref|XP_009101799.1| PREDICTED: ankyrin repeat domain-containing protein 2 [Brassica 
rapa]
 ref|XP_009101875.1| PREDICTED: ankyrin repeat domain-containing protein 2 [Brassica 
rapa]
Length=346

 Score =   402 bits (1032),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 209/303 (69%), Positives = 242/303 (80%), Gaps = 5/303 (2%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDG---IPQFDPQQ  1094
             N FDFS M  +LNDPSI+ELAEQIAKDP+F ++AEQLQ +   AA   G    P  DPQQ
Sbjct  44    NAFDFSNMASILNDPSIRELAEQIAKDPAFNKLAEQLQSSIPNAAEGGGAAGFPNIDPQQ  103

Query  1093  YYGTMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSL  914
             Y  TMQQVM NP+F TMAERLGNAL++DP MS  L++ SNP   +   ERMAR+KEDP L
Sbjct  104   YVSTMQQVMHNPEFQTMAERLGNALVKDPQMSPFLDAFSNPETAEHFTERMARMKEDPEL  163

Query  913   KPILEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPg--agetatsgetgtdeaeeasede  740
             KPIL+EI+ GGP+AMM+YWNDKDVLKKLGEAMG P     + A S E    E E   E+E
Sbjct  164   KPILDEIDAGGPSAMMKYWNDKDVLKKLGEAMGMPVGGLPDQAASVEPEVAEEEGEEEEE  223

Query  739   SIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDA  560
             SIVH  AS+GD EGLK AL AG +KDEEDSEGRTALHFACGYGE+KCAQ+L+++GA V+A
Sbjct  224   SIVHQTASLGDVEGLKTALEAGGNKDEEDSEGRTALHFACGYGELKCAQVLIDAGASVNA  283

Query  559   LDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKD  380
             +DKNKNT LHYAAGYGRKECV+LLLENGAAVTLQN+D KTPI+VAKLNNQ +V+KLLEKD
Sbjct  284   VDKNKNTPLHYAAGYGRKECVSLLLENGAAVTLQNLDEKTPIDVAKLNNQLEVVKLLEKD  343

Query  379   AFL  371
             AFL
Sbjct  344   AFL  346



>ref|XP_002983736.1| hypothetical protein SELMODRAFT_180340 [Selaginella moellendorffii]
 gb|EFJ15232.1| hypothetical protein SELMODRAFT_180340 [Selaginella moellendorffii]
Length=321

 Score =   400 bits (1028),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 198/299 (66%), Positives = 244/299 (82%), Gaps = 3/299 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             N FD SAMT LLNDPSIK++AEQIAKDP+F +MA+QL ++ Q A   DG+PQ D  QY+ 
Sbjct  25    NAFDMSAMTSLLNDPSIKDMAEQIAKDPAFNRMAQQLSESVQTAG--DGVPQLDTNQYFQ  82

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
              MQQVMQNPQFM+MAERLGNALMQDPSM++ML++++NPA K+QLE RM++I+EDP+LKP+
Sbjct  83    AMQQVMQNPQFMSMAERLGNALMQDPSMAAMLQNMTNPAHKEQLEARMSQIREDPALKPV  142

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeasedeSI-VH  728
             L+EIEQGGPAAMM+YWND DVL KLG AMG  G        E   +   E  E+E + +H
Sbjct  143   LDEIEQGGPAAMMKYWNDPDVLNKLGRAMGVGGPQHFGLPREEVEEAEAEGEEEEELTLH  202

Query  727   HCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKN  548
             H AS GD EGLK  LA GA+KDE+DSEGRTALHFACGYGE+KCA+ LLE+GA VD++DKN
Sbjct  203   HTASTGDIEGLKVLLADGANKDEKDSEGRTALHFACGYGELKCAEALLEAGAFVDSVDKN  262

Query  547   KNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
              NT LHYA GYGRKECV LLL+NGAAVT++NMD KTP++VAKLNNQ+++++LL+ D FL
Sbjct  263   NNTPLHYAGGYGRKECVELLLKNGAAVTVRNMDSKTPMDVAKLNNQDEIVQLLQNDVFL  321



>emb|CDX75504.1| BnaA01g01980D [Brassica napus]
Length=346

 Score =   401 bits (1030),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 209/303 (69%), Positives = 242/303 (80%), Gaps = 5/303 (2%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDG---IPQFDPQQ  1094
             N FDFS M  +LNDPSI+ELAEQIAKDP+F ++AEQLQ +   AA   G    P  DPQQ
Sbjct  44    NAFDFSNMASILNDPSIRELAEQIAKDPAFNKLAEQLQSSIPNAAEGGGAAGFPNIDPQQ  103

Query  1093  YYGTMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSL  914
             Y  TMQQVM NP+F TMAERLGNAL++DP MS  L++ SNP   +   ERMAR+KEDP L
Sbjct  104   YVSTMQQVMHNPEFQTMAERLGNALVKDPQMSPFLDAFSNPETAEHFTERMARMKEDPEL  163

Query  913   KPILEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPg--agetatsgetgtdeaeeasede  740
             KPIL+EI+ GGP+AMM+YWNDKDVLKKLGEAMG P     + A S E    E E   E+E
Sbjct  164   KPILDEIDAGGPSAMMKYWNDKDVLKKLGEAMGMPVGGLPDQAASAEPEVAEEEGEEEEE  223

Query  739   SIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDA  560
             SIVH  AS+GD EGLK AL AG +KDEEDSEGRTALHFACGYGE+KCAQ+L+++GA V+A
Sbjct  224   SIVHQTASLGDVEGLKTALEAGGNKDEEDSEGRTALHFACGYGELKCAQVLIDAGASVNA  283

Query  559   LDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKD  380
             +DKNKNT LHYAAGYGRKECV+LLLENGAAVTLQN+D KTPI+VAKLNNQ +V+KLLEKD
Sbjct  284   VDKNKNTPLHYAAGYGRKECVSLLLENGAAVTLQNLDEKTPIDVAKLNNQLEVVKLLEKD  343

Query  379   AFL  371
             AFL
Sbjct  344   AFL  346



>dbj|BAK07558.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=379

 Score =   402 bits (1033),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 208/309 (67%), Positives = 246/309 (80%), Gaps = 11/309 (4%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGA-ASNDGIPQ-----FD  1103
             +PFDFS M  LLNDPSIKE+AEQIAKDPSF++MAEQLQ+T   A AS+   PQ      D
Sbjct  71    SPFDFSTMMNLLNDPSIKEMAEQIAKDPSFSEMAEQLQKTVAPAPASSARSPQEVAAALD  130

Query  1102  PQQYYGTMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKED  923
             PQ+Y  TMQQ+MQNPQF+ MAERLG+ALMQDP+MSS+L  L+NPAQK+QLE R+AR+K+D
Sbjct  131   PQKYVSTMQQLMQNPQFVAMAERLGSALMQDPAMSSVLGGLTNPAQKEQLEARVARMKDD  190

Query  922   PSLKPILEEIEQGGPAAMMRYWNDKDVLKKLGEAMGF-----Pgagetatsgetgtdeae  758
             PSLKPIL+EIE GGPAAMM+YWND + L+K G AMG        AG  A   E      E
Sbjct  191   PSLKPILDEIESGGPAAMMKYWNDPEALQKFGRAMGVGPSGAAAAGAEAEEEEVVAGGEE  250

Query  757   easedeSIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLES  578
                E+ES++H  ASVGD EGL+ ALA G DKDEEDSEGR  LHFACGYGE+KCAQ LLE+
Sbjct  251   GEYEEESVIHQTASVGDVEGLQKALADGVDKDEEDSEGRRGLHFACGYGELKCAQALLEA  310

Query  577   GAKVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVL  398
             GA  DA+DKNKNTALHYAAGYGRKECVALLL++GA+VTLQN+DGKT I+VA+LN+Q +VL
Sbjct  311   GAAADAVDKNKNTALHYAAGYGRKECVALLLDHGASVTLQNLDGKTAIDVARLNSQEEVL  370

Query  397   KLLEKDAFL  371
             KLLEK A++
Sbjct  371   KLLEKHAYV  379



>ref|XP_002990522.1| hypothetical protein SELMODRAFT_185403 [Selaginella moellendorffii]
 gb|EFJ08399.1| hypothetical protein SELMODRAFT_185403 [Selaginella moellendorffii]
Length=323

 Score =   399 bits (1026),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 197/301 (65%), Positives = 243/301 (81%), Gaps = 5/301 (2%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             N FD SAMT LLNDPSIK++AEQIAKDP+F +MA+QL ++ Q A   DG+PQ D  QY+ 
Sbjct  25    NAFDMSAMTSLLNDPSIKDMAEQIAKDPAFNRMAQQLSESVQTAG--DGVPQLDTNQYFQ  82

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
              MQQVMQNPQFM+MAERLGNALMQDPSM++ML++++NPA K+QLE RM++I+EDP+LKP+
Sbjct  83    AMQQVMQNPQFMSMAERLGNALMQDPSMAAMLQNMTNPAHKEQLEARMSQIREDPALKPV  142

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGF--PgagetatsgetgtdeaeeasedeSI-  734
             L+EIEQGGPAAMM+YWND DVL KLG AMG   P             +   E  E+E + 
Sbjct  143   LDEIEQGGPAAMMKYWNDPDVLNKLGRAMGVGGPQHFGLPREEVEEAEAEGEGEEEEELT  202

Query  733   VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
             +HH AS GD EGLK  LA GA+KDE+DSEGRTALHFACGYGE+KCA+ LLE+GA VD++D
Sbjct  203   LHHTASTGDIEGLKVLLADGANKDEKDSEGRTALHFACGYGELKCAEALLEAGAFVDSVD  262

Query  553   KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAF  374
             KN NT LHYA GYGRKECV LLL+NGAAVT++NMD KTP++VAKLNNQ+++++LL+ D F
Sbjct  263   KNNNTPLHYAGGYGRKECVELLLKNGAAVTVRNMDSKTPMDVAKLNNQDEIVQLLQNDVF  322

Query  373   L  371
             L
Sbjct  323   L  323



>gb|ABR16551.1| unknown [Picea sitchensis]
Length=270

 Score =   394 bits (1011),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 202/271 (75%), Positives = 224/271 (83%), Gaps = 6/271 (2%)
 Frame = -1

Query  1168  MAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQNPQFMTMAERLGNALMQDPSMSSML  989
             MAEQLQQ+ Q  A  DGIPQ D QQY+ TMQQVMQNPQFMTMAERLGNALMQDPSMSSML
Sbjct  1     MAEQLQQSVQ-HAGQDGIPQLDTQQYFSTMQQVMQNPQFMTMAERLGNALMQDPSMSSML  59

Query  988   ESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFP  809
             E+LSNPA K+QLEERMA I+ED SLKPILEEIE GGPAAMM+YWND  VL KLG+AMG  
Sbjct  60    ENLSNPAHKEQLEERMASIREDESLKPILEEIESGGPAAMMKYWNDPAVLTKLGQAMGVG  119

Query  808   ga-----getatsgetgtdeaeeasedeSIVHHCASVGDEEGLKNALAAGADKDEEDSEG  644
              +         T  +   ++  +  +DE  VHH AS GD +GLKN LA GADKDE DSEG
Sbjct  120   ISGDTPASNEGTGADEAEEDNGDDDDDELTVHHTASAGDVQGLKNVLAMGADKDEADSEG  179

Query  643   RTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRKECVALLLENGAAVT  464
             RTALHFACGYGEVKCA+ILLE+GA VDALDKNKNTALHYAAGYGRKECV LLL++GAAVT
Sbjct  180   RTALHFACGYGEVKCAEILLEAGAAVDALDKNKNTALHYAAGYGRKECVELLLKHGAAVT  239

Query  463   LQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             LQN+DGKTPI+VAKLN+Q+ VLKLLEKDAFL
Sbjct  240   LQNLDGKTPIDVAKLNSQDAVLKLLEKDAFL  270



>gb|EMT24146.1| hypothetical protein F775_31155 [Aegilops tauschii]
Length=316

 Score =   395 bits (1015),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 203/288 (70%), Positives = 236/288 (82%), Gaps = 4/288 (1%)
 Frame = -1

Query  1225  DPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQNPQFMT  1046
             DPSIKE+A+QIA+DP+F QMAEQLQ+  Q  A   G+P  DP QY  TMQ+VM+NPQFMT
Sbjct  30    DPSIKEMADQIARDPAFNQMAEQLQKGAQ-TAGEQGMPPLDPHQYMETMQKVMENPQFMT  88

Query  1045  MAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAAMM  866
             MAERLG ALMQDP+MSSMLE+L++P  K++LEERM+RI EDP+LKPIL+E+E GGPAAM+
Sbjct  89    MAERLGTALMQDPAMSSMLENLTSPTHKEELEERMSRINEDPALKPILDELENGGPAAMI  148

Query  865   RYWNDKDVLKKLGEAMGFP---gagetatsgetgtdeaeeasedeSIVHHCASVGDEEGL  695
             +YWND + L+K+G+AMG         TA    T   E E   EDESIVHH ASVGD EGL
Sbjct  149   KYWNDPETLQKIGQAMGTTMPFSTVSTADPSGTEETEEEGEDEDESIVHHTASVGDGEGL  208

Query  694   KNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGY  515
             K AL  GADKDEEDSEGR ALHFACGYGE KCA+ILLE+GA VDA+DKNKNT LHYAAGY
Sbjct  209   KKALDGGADKDEEDSEGRRALHFACGYGEFKCAEILLEAGAAVDAMDKNKNTPLHYAAGY  268

Query  514   GRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             GRK+C  LLL++GAAVTLQNMDGKTPI+VAKLNNQ++VLKLLEKD FL
Sbjct  269   GRKQCEELLLKHGAAVTLQNMDGKTPIDVAKLNNQDEVLKLLEKDVFL  316



>tpg|DAA52534.1| TPA: hypothetical protein ZEAMMB73_896450 [Zea mays]
Length=290

 Score =   377 bits (967),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 198/290 (68%), Positives = 229/290 (79%), Gaps = 11/290 (4%)
 Frame = -1

Query  1207  LAEQIAKDPSFTQMAEQLQQTF------QGAASNDGIPQFDPQQYYGTMQQVMQNPQFMT  1046
             +AEQIAKDP+FT+MAEQLQ+T       Q   +     Q DPQ+Y  TMQQ+MQNPQF+ 
Sbjct  1     MAEQIAKDPAFTEMAEQLQKTVVSPRQQQQQQARQQQQQLDPQKYVATMQQLMQNPQFVA  60

Query  1045  MAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAAMM  866
             MAERLG+ALMQDP+MS+ML  L+NPA K+QLE R+AR+KEDP+LKPIL+EIE GGPAAMM
Sbjct  61    MAERLGSALMQDPAMSAMLGGLTNPAHKEQLEARVARMKEDPTLKPILDEIESGGPAAMM  120

Query  865   RYWNDKDVLKKLGEAMGFPg-----agetatsgetgtdeaeeasedeSIVHHCASVGDEE  701
             +YWND + L+K G AMG        AG    +        E   EDESIVHH ASVGD E
Sbjct  121   KYWNDPEALQKFGRAMGVGVGPSGEAGGAEHAEAEDDAGEEGEYEDESIVHHTASVGDVE  180

Query  700   GLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAA  521
             GLK AL  GADKDEEDSEGR  LHFACGYGE++CAQ LLE+GA VDA+DKNKNTALHYAA
Sbjct  181   GLKKALEDGADKDEEDSEGRRGLHFACGYGELQCAQALLEAGAAVDAVDKNKNTALHYAA  240

Query  520   GYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             GYGRK+CVALLLE+GAAVTLQN+DGKTPI+VAKLNNQ+DVLKLLEK AF+
Sbjct  241   GYGRKDCVALLLESGAAVTLQNLDGKTPIDVAKLNNQDDVLKLLEKHAFV  290



>dbj|BAD33145.1| putative ankyrin domain protein [Oryza sativa Japonica Group]
Length=331

 Score =   367 bits (943),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 190/298 (64%), Positives = 238/298 (80%), Gaps = 6/298 (2%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             N FDF+++  LLNDPS+KE+A+QIAKDP+FTQMAEQ     +G     G+P  DP  Y  
Sbjct  40    NTFDFASLHSLLNDPSVKEIADQIAKDPAFTQMAEQ---ALEGEGEQ-GMPAIDP--YIE  93

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQ+ M++P F TMAERLG+AL++DP+MSS+LE+L++P    ++EER++R+KEDP++K I
Sbjct  94    TMQKFMESPHFFTMAERLGDALVKDPAMSSLLENLTSPMHNAKIEERVSRMKEDPAVKSI  153

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeasedeSIVHH  725
             ++E+E G PAA+++YWND +  +K+ +AMG  G  + A    T   E E   EDESIVHH
Sbjct  154   MDELETGDPAALIKYWNDPETFRKISQAMGPLGGPDFAEPSGTEGTEEEGEYEDESIVHH  213

Query  724   CASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNK  545
              ASVGD+EGLK AL  GADKDEEDSEGR ALHFACGYGE+KCAQ+LLE+GA VDALDKNK
Sbjct  214   TASVGDDEGLKKALDGGADKDEEDSEGRRALHFACGYGELKCAQVLLEAGAAVDALDKNK  273

Query  544   NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             NT LHYAAGYG K CV LLL+NGAAVTL+NMDGKT I+VAKLNNQ++VL+LLEKDAFL
Sbjct  274   NTPLHYAAGYGMKGCVDLLLKNGAAVTLENMDGKTAIDVAKLNNQDEVLRLLEKDAFL  331



>gb|ABK96395.1| unknown [Populus trichocarpa x Populus deltoides]
Length=332

 Score =   362 bits (929),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 202/303 (67%), Positives = 221/303 (73%), Gaps = 39/303 (13%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             +PFDFSAMTGLLNDPSIKELAEQIAKDPSF QMAEQLQ+TFQGA + D IP FD QQYY 
Sbjct  64    SPFDFSAMTGLLNDPSIKELAEQIAKDPSFNQMAEQLQKTFQGATAEDAIPNFDTQQYYS  123

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFMTMAE LG ALMQDPSMS MLES +NP+QKDQ+EERM RI+EDPSLKPI
Sbjct  124   TMQQVMQNPQFMTMAEHLGTALMQDPSMSQMLESFTNPSQKDQIEERMTRIREDPSLKPI  183

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetg--tdeaeeasedeSIV  731
             LEEIE GGPAAMMRYWNDKDVL+KLGEAMG   + E  TS ET    +  E  +EDES+V
Sbjct  184   LEEIESGGPAAMMRYWNDKDVLQKLGEAMGLAVSEEAGTSVETSGHEEAEEAGNEDESVV  243

Query  730   HHCASVGDEEGLKNA---LAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDA  560
             HHCASVGD E +K A   L AGA  D  D    TALH+A GYG  +C  +LLE+G     
Sbjct  244   HHCASVGDVE-VKCAQILLEAGATVDALDKNKNTALHYAAGYGRKECVALLLENG-----  297

Query  559   LDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKD  380
                                         AAVTLQNMDGKTPI+VAKLNNQ +VLKLLEKD
Sbjct  298   ----------------------------AAVTLQNMDGKTPIDVAKLNNQQEVLKLLEKD  329

Query  379   AFL  371
             AFL
Sbjct  330   AFL  332



>dbj|BAG93777.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00450.1| unnamed protein product [Oryza sativa Japonica Group]
Length=298

 Score =   359 bits (921),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 188/270 (70%), Positives = 217/270 (80%), Gaps = 4/270 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFS  + LLNDPSIKE+AEQIA DP FTQMAEQLQ++        G P  DPQQY  
Sbjct  30    NPFDFSQFSNLLNDPSIKEMAEQIASDPVFTQMAEQLQKSAH-VTGEQGGPALDPQQYME  88

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TM QVMQNPQFM+MAERLGN LMQDP MSSMLESL++P+ K+ LEERM+RIKEDPSLK I
Sbjct  89    TMTQVMQNPQFMSMAERLGNTLMQDPGMSSMLESLTSPSHKELLEERMSRIKEDPSLKGI  148

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMG--FPgagetatsget-gtdeaeeasedeSI  734
             L+EIE GGP+AM++YWND +VL+K+G+AM   FPG   T+T+       E +   +DESI
Sbjct  149   LDEIESGGPSAMVKYWNDPEVLQKIGQAMSINFPGDAATSTTLSGPEETEEDGGDDDESI  208

Query  733   VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
             VHH ASVGD EGLK AL  GAD DEED+EGR ALHFACGYGE+KCA+ILLE+GA V+ALD
Sbjct  209   VHHTASVGDAEGLKKALEDGADMDEEDAEGRRALHFACGYGELKCAEILLEAGAAVNALD  268

Query  553   KNKNTALHYAAGYGRKECVALLLENGAAVT  464
             KNKNT LHYAAGYGRKECV LLL++GAAVT
Sbjct  269   KNKNTPLHYAAGYGRKECVDLLLKHGAAVT  298



>gb|EEC83962.1| hypothetical protein OsI_30076 [Oryza sativa Indica Group]
Length=346

 Score =   357 bits (916),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 185/287 (64%), Positives = 229/287 (80%), Gaps = 6/287 (2%)
 Frame = -1

Query  1231  LNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQNPQF  1052
             L DPS+KE+A+QIAKDP+FTQMAEQ     +G     G+P  DP  Y  TMQ+ M++P F
Sbjct  66    LLDPSVKEIADQIAKDPAFTQMAEQ---ALEGEGEQ-GMPAIDP--YIETMQKFMESPHF  119

Query  1051  MTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAA  872
              TMAERLG+AL++DP+MSS+LE+L++P    ++EER++R+KEDP++K I++E+E G PAA
Sbjct  120   FTMAERLGDALVKDPAMSSLLENLTSPMHNAKIEERVSRMKEDPAVKSIMDELETGDPAA  179

Query  871   MMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeasedeSIVHHCASVGDEEGLK  692
             +++YWND +  +K+ +AMG  G  + A    T   E E   ED SIVHH ASVGD+EGLK
Sbjct  180   LIKYWNDPETFRKISQAMGPLGGPDFAEPSGTEGTEEEGEYEDGSIVHHTASVGDDEGLK  239

Query  691   NALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYG  512
              AL  GADKDEEDSEGR ALHFACGYGE+KCAQ+LLE+GA VDALDKNKNT LHYAAGYG
Sbjct  240   KALDGGADKDEEDSEGRRALHFACGYGELKCAQVLLEAGAAVDALDKNKNTPLHYAAGYG  299

Query  511   RKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
              KECV LLL+NGAAVTL+NMDGKT I+VAKLNNQ++VLKLLEKDAFL
Sbjct  300   MKECVDLLLKNGAAVTLENMDGKTAIDVAKLNNQDEVLKLLEKDAFL  346



>ref|XP_007043144.1| Ankyrin repeat domain-containing protein 2 isoform 2, partial 
[Theobroma cacao]
 gb|EOX98975.1| Ankyrin repeat domain-containing protein 2 isoform 2, partial 
[Theobroma cacao]
Length=286

 Score =   353 bits (905),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 177/224 (79%), Positives = 192/224 (86%), Gaps = 2/224 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAM+GLLNDPSIKELAEQIAKDPSF QMAEQL QTFQGAA  + +PQFD QQYY 
Sbjct  60    NPFDFSAMSGLLNDPSIKELAEQIAKDPSFNQMAEQLTQTFQGAAVEESVPQFDAQQYYS  119

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFMTMAERLGNALMQDP+MSSMLESL+NP  KDQ+EERMARIKEDPSLK I
Sbjct  120   TMQQVMQNPQFMTMAERLGNALMQDPAMSSMLESLTNPQHKDQIEERMARIKEDPSLKHI  179

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPga--getatsgetgtdeaeeasedeSIV  731
             LEEIE GGPAAMMRYWNDK+VL+KLGEAMG   +    T+       +  E  +EDESIV
Sbjct  180   LEEIETGGPAAMMRYWNDKEVLQKLGEAMGLAASGDAATSADNSAADEGDEVGNEDESIV  239

Query  730   HHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKC  599
             HHCASVGD EGLK ALA+GADKDEEDSEGRTALHFACGYGE++ 
Sbjct  240   HHCASVGDAEGLKAALASGADKDEEDSEGRTALHFACGYGEMRS  283



>gb|EEE69079.1| hypothetical protein OsJ_28115 [Oryza sativa Japonica Group]
Length=365

 Score =   354 bits (908),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 184/290 (63%), Positives = 230/290 (79%), Gaps = 6/290 (2%)
 Frame = -1

Query  1240  TGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQN  1061
             T +  DPS+KE+A+QIAKDP+FTQMAEQ     +G     G+P  DP  Y  TMQ+ M++
Sbjct  82    TNVFQDPSVKEIADQIAKDPAFTQMAEQ---ALEGEGEQ-GMPAIDP--YIETMQKFMES  135

Query  1060  PQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGG  881
             P F TMAERLG+AL++DP+MSS+LE+L++P    ++EER++R+KEDP++K I++E+E G 
Sbjct  136   PHFFTMAERLGDALVKDPAMSSLLENLTSPMHNAKIEERVSRMKEDPAVKSIMDELETGD  195

Query  880   PAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeasedeSIVHHCASVGDEE  701
             PAA+++YWND +  +K+ +AMG  G  + A    T   E E   EDESIVHH ASVGD+E
Sbjct  196   PAALIKYWNDPETFRKISQAMGPLGGPDFAEPSGTEGTEEEGEYEDESIVHHTASVGDDE  255

Query  700   GLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAA  521
             GLK AL  GADKDEEDSEGR ALHFACGYGE+KCAQ+LLE+GA VDALDKNKNT LHYAA
Sbjct  256   GLKKALDGGADKDEEDSEGRRALHFACGYGELKCAQVLLEAGAAVDALDKNKNTPLHYAA  315

Query  520   GYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             GYG K CV LLL+NGAAVTL+NMDGKT I+VAKLNNQ++VL+LLEKDAFL
Sbjct  316   GYGMKGCVDLLLKNGAAVTLENMDGKTAIDVAKLNNQDEVLRLLEKDAFL  365



>gb|ACN40670.1| unknown [Picea sitchensis]
Length=354

 Score =   345 bits (885),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 168/302 (56%), Positives = 225/302 (75%), Gaps = 6/302 (2%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             +PFDFS+M+ LLNDPSIKELA+ ++KDP+F +MA+QLQQ+ +GA  +   PQ DP++Y  
Sbjct  52    SPFDFSSMSSLLNDPSIKELAKDVSKDPAFRKMAQQLQQSVKGAG-HCATPQLDPEKYAK  110

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             +MQQVMQNPQFMTMA  L ++LMQDP++ +M+++LSNP QK Q E +MA++K DPSLKP+
Sbjct  111   SMQQVMQNPQFMTMAHHLRHSLMQDPAVMNMIKTLSNPTQKMQFEAQMAQLKNDPSLKPV  170

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAM-----GFPgagetatsgetgtdeaeeasede  740
             L+EI +GGP AMM+YWND  VL KLG+A      G     + +   +      +   E  
Sbjct  171   LDEISKGGPPAMMKYWNDPVVLSKLGKAFQMGSSGDMSVSKQSDKNKREETSEDTEKETP  230

Query  739   SIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDA  560
               + H AS GD + L++ LA G DKD++DS+GRTALHFACGYG  +C ++LLE+GA VD 
Sbjct  231   LTLTHVASTGDVKELQSLLAKGVDKDKKDSQGRTALHFACGYGNARCVEVLLEAGALVDP  290

Query  559   LDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKD  380
             LDKN NT LHYA+GYG+ EC  LLL+ GAAVTL N++GKTP++VAKLN +  V++LLEK+
Sbjct  291   LDKNNNTPLHYASGYGQYECAELLLKGGAAVTLVNLEGKTPMDVAKLNKRMQVIRLLEKN  350

Query  379   AF  374
             AF
Sbjct  351   AF  352



>gb|ABK23231.1| unknown [Picea sitchensis]
Length=354

 Score =   344 bits (882),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 167/302 (55%), Positives = 224/302 (74%), Gaps = 6/302 (2%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             +PFDFS+M+ LLNDPSIKELA+ ++KDP+F +MA+QLQQ+ +GA  +   PQ DP++Y  
Sbjct  52    SPFDFSSMSSLLNDPSIKELAKDVSKDPAFRKMAQQLQQSVKGAG-HCATPQLDPEKYAK  110

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             +MQQVMQNPQFMTMA  L ++LMQDP++ +M+++LSNP QK Q E +MA++K DPSLKP+
Sbjct  111   SMQQVMQNPQFMTMAHHLRHSLMQDPAVMNMIKTLSNPTQKMQFEAQMAQLKNDPSLKPV  170

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAM-----GFPgagetatsgetgtdeaeeasede  740
             L+EI +GGP AMM+YWND  VL KLG+A      G     + +   +      +   E  
Sbjct  171   LDEISKGGPPAMMKYWNDPVVLSKLGKAFQMGSSGDMSVSKQSDKNKREETSEDTEKETP  230

Query  739   SIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDA  560
               + H AS GD + L++ LA G DKD++DS+GRTALHF CGYG  +C ++LLE+GA VD 
Sbjct  231   LTLTHVASTGDVKELQSLLAKGVDKDKKDSQGRTALHFVCGYGNARCVEVLLEAGALVDP  290

Query  559   LDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKD  380
             LDKN NT LHYA+GYG+ EC  LLL+ GAAVTL N++GKTP++VAKLN +  V++LLEK+
Sbjct  291   LDKNNNTPLHYASGYGQYECAELLLKGGAAVTLVNLEGKTPMDVAKLNKRMQVIRLLEKN  350

Query  379   AF  374
             AF
Sbjct  351   AF  352



>gb|KDO50180.1| hypothetical protein CISIN_1g018578mg [Citrus sinensis]
Length=280

 Score =   340 bits (872),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 171/222 (77%), Positives = 188/222 (85%), Gaps = 2/222 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAM+GLLNDPSIKELAEQIAKDP+F  MAEQLQ+T  GA + + IPQFD  QYY 
Sbjct  54    NPFDFSAMSGLLNDPSIKELAEQIAKDPAFNSMAEQLQKTLHGANAEESIPQFDTTQYYS  113

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFMTMAERLGNALMQDPSMS M+ESL+NP +KDQ+EERMA+IKEDPSLKPI
Sbjct  114   TMQQVMQNPQFMTMAERLGNALMQDPSMSHMMESLTNPTKKDQIEERMAKIKEDPSLKPI  173

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPg--agetatsgetgtdeaeeasedeSIV  731
             L+EIE GGP+AMM+YWNDKDVL+KLGEAMG        T+       +  E  +EDESIV
Sbjct  174   LDEIESGGPSAMMKYWNDKDVLQKLGEAMGLAVGGDATTSADNAGADEAEEVGNEDESIV  233

Query  730   HHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEV  605
             HH ASVGD EGLKNALAAGADKDEEDSEGRTALHFACGYGEV
Sbjct  234   HHTASVGDAEGLKNALAAGADKDEEDSEGRTALHFACGYGEV  275



>gb|EYU35447.1| hypothetical protein MIMGU_mgv1a0083451mg, partial [Erythranthe 
guttata]
Length=215

 Score =   332 bits (852),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 171/215 (80%), Positives = 192/215 (89%), Gaps = 1/215 (0%)
 Frame = -1

Query  1012  DPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAAMMRYWNDKDVLKK  833
             DP+MS MLE+L+NPA KDQLEERM R+KEDPSLKPIL+EIE GGPAAMMRYWNDK+VL+K
Sbjct  1     DPAMSGMLENLTNPANKDQLEERMTRVKEDPSLKPILDEIENGGPAAMMRYWNDKEVLQK  60

Query  832   LGEAMGFPgagetatsge-tgtdeaeeasedeSIVHHCASVGDEEGLKNALAAGADKDEE  656
             LGEAMGF      A++G+    DE EE +++ESIVHH ASVGD EGLK+ALA GADKDEE
Sbjct  61    LGEAMGFSVGESAASAGDGADEDETEEVNDEESIVHHSASVGDVEGLKSALADGADKDEE  120

Query  655   DSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRKECVALLLENG  476
             DSEGRTALHFACGYGE+KCAQILLE+GAKVD LDKNKNT LHYAAGYGRK+CV LLL+NG
Sbjct  121   DSEGRTALHFACGYGEIKCAQILLEAGAKVDTLDKNKNTPLHYAAGYGRKDCVELLLKNG  180

Query  475   AAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             AAVTLQN+DGKTPIEVAKLNNQ++VL LLEKDAFL
Sbjct  181   AAVTLQNLDGKTPIEVAKLNNQDEVLSLLEKDAFL  215



>ref|XP_003559134.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Brachypodium 
distachyon]
Length=364

 Score =   329 bits (843),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 193/315 (61%), Positives = 236/315 (75%), Gaps = 19/315 (6%)
 Frame = -1

Query  1258  FDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQ--FDPQQYYG  1085
             FDFS M  LLNDPSIKE+AEQIAKDPSF++MAEQLQ+T    +S+        DP +Y  
Sbjct  50    FDFSTMMNLLNDPSIKEMAEQIAKDPSFSEMAEQLQRTVAPPSSSPAPAAAALDPHKYVS  109

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPA-------QKDQLEERMARIKE  926
             TMQQ+MQNPQF+ MAERLG+ALMQDP+MSSML  L+  +       Q+ QLE R+AR+KE
Sbjct  110   TMQQLMQNPQFVAMAERLGSALMQDPAMSSMLGGLTGGSGSGAGAAQRQQLEARVARMKE  169

Query  925   DPSLKPILEEIEQGGPAAMMRYWNDKDVLKKLGEAMGF---------Pgagetatsgetg  773
             DPSL+PIL+EIE GGPAAMM+YWND + L+K G AMG             GE+A +   G
Sbjct  170   DPSLRPILDEIESGGPAAMMKYWNDPEALQKFGRAMGVGPSSAAAGAGEEGESAAAAAAG  229

Query  772   tdeaeeasedeSIVHHCASVGDEEGLKNALAAGAD-KDEEDSEGRTALHFACGYGEVKCA  596
              +E EE  E ES +H  ASVGD E LK AL  G +  DEED+EGR  LHFACGYGE+ CA
Sbjct  230   AEEEEEEYEPESAIHQAASVGDVEALKAALQEGGNGADEEDAEGRRGLHFACGYGELACA  289

Query  595   QILLESGAKVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLN  416
             Q LL++GA  DA+D+NKNTALHYAAGYGR++CVALLL++GA+VTLQN+DGKT I+VA+LN
Sbjct  290   QALLDAGAAADAVDRNKNTALHYAAGYGRRDCVALLLDHGASVTLQNLDGKTAIDVARLN  349

Query  415   NQNDVLKLLEKDAFL  371
             +Q +VLKLLEK AF+
Sbjct  350   SQEEVLKLLEKHAFV  364



>gb|EAZ29329.1| hypothetical protein OsJ_13395 [Oryza sativa Japonica Group]
Length=352

 Score =   309 bits (791),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 163/257 (63%), Positives = 188/257 (73%), Gaps = 14/257 (5%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQG--------AASNDGIPQ  1109
             NPFDFS M  LLNDPSIKE+AEQIAKDP+FT+MAEQLQ+T Q          A+    P 
Sbjct  39    NPFDFSTMMNLLNDPSIKEMAEQIAKDPAFTEMAEQLQKTVQSPPARGAAQEAAAAAAPA  98

Query  1108  FDPQQYYGTMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIK  929
              DP +Y  TMQQ+MQNPQF+ MAERLG+ALMQDP+MSSML  L+NPA K+QLE R+AR+K
Sbjct  99    LDPSKYVSTMQQLMQNPQFVAMAERLGSALMQDPAMSSMLGGLTNPAHKEQLEARIARMK  158

Query  928   EDPSLKPILEEIEQGGPAAMMRYWNDKDVLKKLGEAMGF------Pgagetatsgetgtd  767
             +DPSLKPIL+EIE GGPAAMM+YWND + L+K G AMG         A            
Sbjct  159   DDPSLKPILDEIENGGPAAMMKYWNDPEALQKFGRAMGVGPSGEGAAAAGGEHEEAEEEG  218

Query  766   eaeeasedeSIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQIL  587
               E   EDES++HH ASVGD EGLK AL  G DKDEEDSEGR  LHFACGYGE+KCAQ+L
Sbjct  219   GEEGEYEDESVIHHTASVGDVEGLKKALEEGVDKDEEDSEGRRGLHFACGYGELKCAQVL  278

Query  586   LESGAKVDALDKNKNTA  536
             LE+GA VDA+DKNKNT 
Sbjct  279   LEAGAAVDAVDKNKNTG  295



>gb|AAA80576.1| possible apospory-associated protein, partial [Cenchrus ciliaris]
Length=210

 Score =   291 bits (745),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 172/206 (83%), Gaps = 3/206 (1%)
 Frame = -1

Query  979  SNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAAMMRYWNDKDVLKKLGEAMGF---P  809
            S PA K+QLEERMARIKEDPSLKPIL+EIE GGP+AM++YWND +VL+K+G+AMG     
Sbjct  5    SGPAHKEQLEERMARIKEDPSLKPILDEIENGGPSAMVKYWNDPEVLQKIGQAMGVNLPG  64

Query  808  gagetatsgetgtdeaeeasedeSIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALH  629
             +  +         E E   +DESIVHH ASVGD EGLK AL  GADKDEED+EGR ALH
Sbjct  65   DSSASTVLSGPEETEEEGGYDDESIVHHTASVGDAEGLKKALDGGADKDEEDAEGRRALH  124

Query  628  FACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMD  449
            FACGYGE+KCA+ILLE+GA VDALDKNKNT LHYAAGYGRKECV LLL++GAAVT+QN+D
Sbjct  125  FACGYGELKCAEILLEAGAAVDALDKNKNTPLHYAAGYGRKECVDLLLKHGAAVTVQNLD  184

Query  448  GKTPIEVAKLNNQNDVLKLLEKDAFL  371
            GKTPIEVA+LNNQ++VLKLLEKDAFL
Sbjct  185  GKTPIEVARLNNQDEVLKLLEKDAFL  210



>gb|AAL83986.1| apospory-associated protein [Oryza sativa]
Length=215

 Score =   287 bits (734),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 180/214 (84%), Gaps = 3/214 (1%)
 Frame = -1

Query  1003  MSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAAMMRYWNDKDVLKKLGE  824
             MSSMLESL++P+ K+ LEERM+RIKEDPSLK IL+EIE GGP+AM++YWND +VL+K+G+
Sbjct  2     MSSMLESLTSPSHKELLEERMSRIKEDPSLKGILDEIESGGPSAMVKYWNDPEVLQKIGQ  61

Query  823   AMG--FPgagetatsget-gtdeaeeasedeSIVHHCASVGDEEGLKNALAAGADKDEED  653
             AM   FPG   T+T+       E +   +DESIVHH ASVGD EGLK AL  GAD DEED
Sbjct  62    AMSINFPGDAATSTTLSGPEETEEDGGDDDESIVHHTASVGDAEGLKKALEDGADMDEED  121

Query  652   SEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRKECVALLLENGA  473
             +EGR ALHFACGYGE+KCA+ILLE+GA V+ALDKNKNT LHYAAGYGRKECV LLL++GA
Sbjct  122   AEGRRALHFACGYGELKCAEILLEAGAAVNALDKNKNTPLHYAAGYGRKECVDLLLKHGA  181

Query  472   AVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             AVT QN+DGKTPIEVAKLNNQ++VLK+LE DAFL
Sbjct  182   AVTPQNLDGKTPIEVAKLNNQDEVLKVLEMDAFL  215



>dbj|BAG88211.1| unnamed protein product [Oryza sativa Japonica Group]
Length=214

 Score =   287 bits (734),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 180/214 (84%), Gaps = 3/214 (1%)
 Frame = -1

Query  1003  MSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAAMMRYWNDKDVLKKLGE  824
             MSSMLESL++P+ K+ LEERM+RIKEDPSLK IL+EIE GGP+AM++YWND +VL+K+G+
Sbjct  1     MSSMLESLTSPSHKELLEERMSRIKEDPSLKGILDEIESGGPSAMVKYWNDPEVLQKIGQ  60

Query  823   AMG--FPgagetatsget-gtdeaeeasedeSIVHHCASVGDEEGLKNALAAGADKDEED  653
             AM   FPG   T+T+       E +   +DESIVHH ASVGD EGLK AL  GAD DEED
Sbjct  61    AMSINFPGDAATSTTLSGPEETEEDGGDDDESIVHHTASVGDAEGLKKALEDGADMDEED  120

Query  652   SEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRKECVALLLENGA  473
             +EGR ALHFACGYGE+KCA+ILLE+GA V+ALDKNKNT LHYAAGYGRKECV LLL++GA
Sbjct  121   AEGRRALHFACGYGELKCAEILLEAGAAVNALDKNKNTPLHYAAGYGRKECVDLLLKHGA  180

Query  472   AVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             AVT QN+DGKTPIEVAKLNNQ++VLK+LE DAFL
Sbjct  181   AVTPQNLDGKTPIEVAKLNNQDEVLKVLEMDAFL  214



>ref|XP_002508384.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69642.1| predicted protein [Micromonas sp. RCC299]
Length=350

 Score =   285 bits (729),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 153/320 (48%), Positives = 207/320 (65%), Gaps = 24/320 (8%)
 Frame = -1

Query  1258  FDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQ----------  1109
             FD S +  +L DPSIKE+A+QI++DPSF  MAE +QQ      +    P           
Sbjct  31    FDMSKIKEMLEDPSIKEMAKQISEDPSFKAMAENMQQAMAAGGAIGAGPGGAGGMTMPGM  90

Query  1108  ------FDPQQYYGTMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEE  947
                    DP+     MQ VM+NP FM MAE+LG  +MQDP M+SM+ S+ +PA  ++++ 
Sbjct  91    PPGMPPIDPKAAMEAMQGVMKNPAFMQMAEKLGTQMMQDPQMASMMASMQDPATTEKMKA  150

Query  946   RMARIKEDPSLKPILEEIEQGGPAAMMRYWNDKDVLKKLGEAMG--FPg------ageta  791
             +M  +KEDP +  I++EIE GGP+AMM+YWND  VL+K+  AMG   PG           
Sbjct  151   KMEALKEDPEMAEIMKEIETGGPSAMMKYWNDPKVLQKISGAMGDVMPGFGAGGPVQAET  210

Query  790   tsgetgtdeaeeasedeSIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYG  611
                    +E E+  + E  V   AS GD + L   +AAGAD +  DSEGRTALHFACGYG
Sbjct  211   EEDGEDEEEGEDEDDGEETVMTAASAGDADALSELIAAGADVNASDSEGRTALHFACGYG  270

Query  610   EVKCAQILLESGAKVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIE  431
             E+KCA++L+++ A  DA+DKNKNT LHYAAGYGR + V LL++ GA+VTL+N+DGK+P++
Sbjct  271   EMKCAEMLIDAKANADAVDKNKNTPLHYAAGYGRADVVKLLVDAGASVTLRNLDGKSPLD  330

Query  430   VAKLNNQNDVLKLLEKDAFL  371
             VAKLN+Q DV++ LE D FL
Sbjct  331   VAKLNDQEDVVQALEADVFL  350



>gb|AFK38221.1| unknown [Medicago truncatula]
Length=243

 Score =   279 bits (714),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 153/242 (63%), Positives = 177/242 (73%), Gaps = 6/242 (2%)
 Frame = -1

Query  1408  SQEEKNLPAQKQDEKSGAADSKKPLESTSLDTQSgqggaplaagpGMHNPFDFSAMTGLL  1229
             S  +K++P+   DEK+G+A++K   +  S +   G G           NPFDFSAM+GLL
Sbjct  3     SNSQKDIPS---DEKAGSAENKNTKDEASSNATPGPGTGFPPGTGFQANPFDFSAMSGLL  59

Query  1228  NDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQNPQFM  1049
             NDPSIKELAEQIAKDPSF QMAEQLQ+T  G A  DG+P FD QQY  +MQQVM NP FM
Sbjct  60    NDPSIKELAEQIAKDPSFNQMAEQLQKTLHGGAPQDGLPNFDNQQYLSSMQQVMANPNFM  119

Query  1048  TMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAAM  869
             TMAERLGNALMQDPSMSSMLES +NP+ K QLEERMARIKEDPSLK IL+EIE GGPA M
Sbjct  120   TMAERLGNALMQDPSMSSMLESFTNPSNKVQLEERMARIKEDPSLKHILDEIENGGPAVM  179

Query  868   MRYWNDKDVLKKLGEAMGFPgagetatsgetgt---deaeeasedeSIVHHCASVGDEEG  698
             MRYWND++VLKKLG AMG P     A +    +   +  +  +EDESIVHH ASVGD EG
Sbjct  180   MRYWNDEEVLKKLGLAMGIPPTSGDAAASSENSGPDETEDVGTEDESIVHHTASVGDIEG  239

Query  697   LK  692
             LK
Sbjct  240   LK  241



>ref|XP_006429824.1| hypothetical protein CICLE_v10012463mg [Citrus clementina]
 gb|ESR43064.1| hypothetical protein CICLE_v10012463mg [Citrus clementina]
Length=271

 Score =   275 bits (704),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 142/196 (72%), Positives = 158/196 (81%), Gaps = 2/196 (1%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAM+GLLNDPSIKELAEQIAKDP+F  MAEQLQ+T  GA + + IPQFD  QYY 
Sbjct  57    NPFDFSAMSGLLNDPSIKELAEQIAKDPAFNSMAEQLQKTLHGANAEESIPQFDTTQYYS  116

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFMTMAERLGNALMQDPSMS MLESL+NP +KDQ+EERMA+IKEDPSLKPI
Sbjct  117   TMQQVMQNPQFMTMAERLGNALMQDPSMSHMLESLTNPTKKDQIEERMAKIKEDPSLKPI  176

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPg--agetatsgetgtdeaeeasedeSIV  731
             L+EIE GGP+AMM+YWNDKDVL+KLGEAMG        T+       +  E  +EDESIV
Sbjct  177   LDEIESGGPSAMMKYWNDKDVLQKLGEAMGLAVGGDATTSADNAGADEAEEVGNEDESIV  236

Query  730   HHCASVGDEEGLKNAL  683
             HH ASVGD E   N L
Sbjct  237   HHTASVGDAEVWLNLL  252



>ref|XP_001784591.1| predicted protein [Physcomitrella patens]
 gb|EDQ50610.1| predicted protein [Physcomitrella patens]
Length=213

 Score =   269 bits (687),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 162/214 (76%), Gaps = 6/214 (3%)
 Frame = -1

Query  1231  LNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQNPQF  1052
             + DPSIKE+AEQIAKDP+FTQMA+QLQ + Q A S  G PQ DP QY   MQQVMQNPQF
Sbjct  1     VQDPSIKEMAEQIAKDPAFTQMAQQLQSSVQSAGSG-GAPQLDPNQYINAMQQVMQNPQF  59

Query  1051  MTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAA  872
             MTMAERLGNALMQDP+MS ML +L+NPA K+QLE+RMA ++EDP+LKP+LEEIE GGPAA
Sbjct  60    MTMAERLGNALMQDPAMSGMLSNLTNPAHKEQLEQRMAAVREDPTLKPVLEEIETGGPAA  119

Query  871   MMRYWNDKDVLKKLGEAMGFPgageta-----tsgetgtdeaeeasedeSIVHHCASVGD  707
             MM+YWND  VL +LG+AMG    G         S     +E  E  +DE  VHH AS GD
Sbjct  120   MMKYWNDPAVLSRLGQAMGVGVPGADGLQIPGESANDEEEEEGEEEDDELTVHHTASTGD  179

Query  706   EEGLKNALAAGADKDEEDSEGRTALHFACGYGEV  605
              EGLK  L  GADKDE+D+EGRTALHFACGYGEV
Sbjct  180   VEGLKILLRDGADKDEKDAEGRTALHFACGYGEV  213



>ref|XP_003062959.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52898.1| predicted protein [Micromonas pusilla CCMP1545]
Length=355

 Score =   273 bits (699),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 149/317 (47%), Positives = 202/317 (64%), Gaps = 21/317 (7%)
 Frame = -1

Query  1258  FDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQ----------  1109
             FD S +  +L DP+IK++A+QIA+DPSF  MAE +Q           +            
Sbjct  39    FDMSKIKEMLEDPAIKDMAKQIAEDPSFKTMAENMQSAMANGGMPGMLGGAGGAAAAGPM  98

Query  1108  -----FDPQQYYGTMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEER  944
                   DP      MQ VMQNP FM MAE+LG ++M DP+M++M+  + +P   ++++ +
Sbjct  99    GMPPGLDPAAAMEAMQGVMQNPAFMQMAEKLGKSMMADPAMANMMSQMQDPETTEKMKAK  158

Query  943   MARIKEDPSLKPILEEIEQGGPAAMMRYWNDKDVLKKLGEAMG--FP----gagetatsg  782
             M  +KEDP +  I++EIE GGPAAMM+YWND  VL+K+  AMG   P     A   A   
Sbjct  159   MEALKEDPEMADIMKEIESGGPAAMMKYWNDPKVLQKISGAMGDVMPGFGGAAAPPAAPA  218

Query  781   etgtdeaeeasedeSIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVK  602
             E   +E EE  + E  VH  AS G+ E L+  +  GAD +  D EGRTALHFACGYGE+K
Sbjct  219   EEEEEEEEEEEDGEETVHTAASAGEAETLQELIDGGADVNATDGEGRTALHFACGYGEIK  278

Query  601   CAQILLESGAKVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAK  422
             CA IL ++ A V+A+DKNKNT LHYAAGYG  E V LL++ GA+VTL+N+DGK+P++VAK
Sbjct  279   CATILCDAKADVNAVDKNKNTPLHYAAGYGNGEVVKLLVDAGASVTLRNLDGKSPLDVAK  338

Query  421   LNNQNDVLKLLEKDAFL  371
             LN+Q++V+  LE D FL
Sbjct  339   LNDQDEVVAALEADVFL  355



>emb|CEF96911.1| Ankyrin repeat [Ostreococcus tauri]
Length=350

 Score =   272 bits (696),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 153/327 (47%), Positives = 203/327 (62%), Gaps = 29/327 (9%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTF-----QGAASNDGIPQFDP  1100
             +PFD   +  +L+DPSIKE+AEQI+ DP+F  MAEQ+Q        Q  A   GI    P
Sbjct  24    SPFDMDKLREMLDDPSIKEMAEQISSDPNFKVMAEQMQANMANMQAQMGALPPGIGGVAP  83

Query  1099  -------------------QQYYGTMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLS  977
                                Q     MQ VMQNP FM MA++LG  +MQ+P M SM+++++
Sbjct  84    NMMGGMMPGMAGMPGGADQQAAMEAMQNVMQNPAFMKMAQKLGEQMMQNPEMQSMMQTMN  143

Query  976   NPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAAMMRYWNDKDVLKKLGEAMG-----F  812
             +P   ++++ +M  +K DP +  I+ EIE GGP AMM+YWND  VLKK+  AMG     F
Sbjct  144   DPETAEKMKAKMEELKNDPEMADIMSEIETGGPQAMMKYWNDPKVLKKINGAMGDIMPTF  203

Query  811   PgagetatsgetgtdeaeeasedeSIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTAL  632
                 +   S     +EA E  ++E  V   AS GD E +   + AG D +  DSEGRT L
Sbjct  204   GAVADDDESEVVEEEEAAEEEDEEESVITAASEGDHEAMMAFIKAGQDVNMTDSEGRTGL  263

Query  631   HFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNM  452
             HFACGYGE+KCA++L++ GA V+A DKNKNT LHYAAGYGR + V LL+E G +VT+ N 
Sbjct  264   HFACGYGELKCAELLVKEGADVNASDKNKNTPLHYAAGYGRSDLVELLVEAGGSVTMVNN  323

Query  451   DGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             DGK+P++VAKLN+Q DV+K LEKD FL
Sbjct  324   DGKSPLDVAKLNDQEDVVKALEKDVFL  350



>gb|AFK36388.1| unknown [Medicago truncatula]
Length=176

 Score =   265 bits (678),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 150/175 (86%), Gaps = 3/175 (2%)
 Frame = -1

Query  886  GGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgt---deaeeasedeSIVHHCAS  716
            GGPA MMRYWND++VLKKLG AMG P     A +    +   +  +  +EDESIVHH AS
Sbjct  2    GGPAVMMRYWNDEEVLKKLGLAMGIPPTSGDAAASSENSGPDETEDVGTEDESIVHHTAS  61

Query  715  VGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTA  536
            VGD EGLK ALA+GADKDEEDSEGRTALHFACGYGEVKCAQ LLE+GAKVDALDKNKNTA
Sbjct  62   VGDIEGLKAALASGADKDEEDSEGRTALHFACGYGEVKCAQALLEAGAKVDALDKNKNTA  121

Query  535  LHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
            LHYAAGYGRKECVALLLENGAAVTLQNMDGKTPI+VAKLNNQ+DVL+LLEKD FL
Sbjct  122  LHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNNQDDVLQLLEKDVFL  176



>ref|XP_001415679.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO93971.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=352

 Score =   266 bits (681),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 153/332 (46%), Positives = 205/332 (62%), Gaps = 37/332 (11%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQ------QTFQGA-ASNDGIP--  1112
             +PFD + +  +L+DP+IKE+AEQI+ DP+F  MAEQ+Q      Q   GA     G+P  
Sbjct  24    SPFDMAKLREMLDDPAIKEMAEQISSDPNFKVMAEQMQANMANMQAQMGALPPGMGMPAG  83

Query  1111  ----------------QFDPQQYYGTMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESL  980
                               D       MQ VMQNP FM MA++LG  +M++P M +M+ ++
Sbjct  84    GMTGMMPGMPGMGGMPGMDQPAAMEAMQGVMQNPAFMQMAQKLGEQMMENPEMKAMMNTM  143

Query  979   SNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAAMMRYWNDKDVLKKLGEAMG-----  815
             ++P   ++++ +M  +K DP +  I++EIE GGP AMM+YWND  VLKK+  AMG     
Sbjct  144   NDPETAEKMKAKMEELKNDPEMSEIMKEIETGGPQAMMKYWNDPKVLKKINAAMGDVAPM  203

Query  814   ----FPgagetatsgetgtdeaeeasedeSIVHHCASVGDEEGLKNALAAGADKDEEDSE  647
                  P         E   +E  E  E    V   AS GD E L+  L  G D + +DSE
Sbjct  204   FGGGVPAEEADEEEDEEDEEEEGEEEES---VLTAASEGDHEALQAFLKEGQDVNMKDSE  260

Query  646   GRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRKECVALLLENGAAV  467
             GRTALHFACGYGE+KCA+IL++ G+ V+A DKNKNT LHYAAGYGR + V LL+E GA+V
Sbjct  261   GRTALHFACGYGEMKCAEILVKEGSDVNATDKNKNTPLHYAAGYGRVDLVELLVEGGASV  320

Query  466   TLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             TL N DGK+P++VAKLN+Q+DV+K LEKD FL
Sbjct  321   TLVNNDGKSPLDVAKLNDQDDVVKALEKDVFL  352



>ref|XP_007508763.1| predicted protein [Bathycoccus prasinos]
 emb|CCO19849.1| predicted protein [Bathycoccus prasinos]
Length=369

 Score =   254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 146/343 (43%), Positives = 197/343 (57%), Gaps = 47/343 (14%)
 Frame = -1

Query  1258  FDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAE-------QLQQTFQ----GAASNDGIP  1112
             FD   +  +L DPSIKE AE IA DP+F QM E       ++QQ+ Q    G +S   + 
Sbjct  27    FDVEKIRQMLEDPSIKEAAEAIASDPAFKQMQENMASQIAKMQQSGQALGAGPSSAAELQ  86

Query  1111  QF----------------DPQQYYGTMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESL  980
             Q                 DPQQ    M+ VM+NP F  MA++LG  +MQDP+M SM+  +
Sbjct  87    QMMMQGGVPGGGMMGQGVDPQQAMQAMEGVMKNPAFAQMAQKLGEQMMQDPTMQSMMSEM  146

Query  979   SNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgag  800
             +NP    +++E+M ++KEDP + PI+++IEQGGP AMM+YWND + LKK+ EAM     G
Sbjct  147   NNPETTRKMKEKMDKLKEDPEMGPIMKDIEQGGPQAMMKYWNDPETLKKINEAMADVMPG  206

Query  799   etatsgetgtdeaeeasedeSI--------------------VHHCASVGDEEGLKNALA  680
                            A   E +                    V   AS GD E LK  + 
Sbjct  207   MGGMMPPGFGGGGGHADVAEQMKNLNVDNEEEEEEEEDEEDSVLTAASAGDVELLKQLIE  266

Query  679   AGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRKEC  500
                D ++ D EGRTALHFA GYGE++C ++L+E+ A   A DKN NT +HYAAGYGR + 
Sbjct  267   EKEDVNKSDGEGRTALHFAAGYGEMECCKMLIEAKADASAKDKNNNTPMHYAAGYGRVDI  326

Query  499   VALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             V LL+E G +VT +N+DGK+P++VAKLN+Q DV+K LEKD FL
Sbjct  327   VELLVEAGGSVTTKNVDGKSPLDVAKLNDQEDVVKALEKDVFL  369



>gb|KDO50177.1| hypothetical protein CISIN_1g018578mg [Citrus sinensis]
Length=251

 Score =   247 bits (630),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPFDFSAM+GLLNDPSIKELAEQIAKDP+F  MAEQLQ+T  GA + + IPQFD  QYY 
Sbjct  54    NPFDFSAMSGLLNDPSIKELAEQIAKDPAFNSMAEQLQKTLHGANAEESIPQFDTTQYYS  113

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             TMQQVMQNPQFMTMAERLGNALMQDPSMS M+ESL+NP +KDQ+EERMA+IKEDPSLKPI
Sbjct  114   TMQQVMQNPQFMTMAERLGNALMQDPSMSHMMESLTNPTKKDQIEERMAKIKEDPSLKPI  173

Query  904   LEEIEQGGPAAMMRYWNDKD  845
             L+EIE GGP+AMM+YWNDKD
Sbjct  174   LDEIESGGPSAMMKYWNDKD  193


 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 65/75 (87%), Gaps = 3/75 (4%)
 Frame = -1

Query  586  LESG---AKVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLN  416
            +ESG   A +   +   NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPI+VAKLN
Sbjct  177  IESGGPSAMMKYWNDKDNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLN  236

Query  415  NQNDVLKLLEKDAFL  371
            +Q+DVLKLLEKDAFL
Sbjct  237  SQHDVLKLLEKDAFL  251



>gb|ABR16530.1| unknown [Picea sitchensis]
Length=308

 Score =   242 bits (618),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 120/225 (53%), Positives = 162/225 (72%), Gaps = 6/225 (3%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             +PFDFS+M+ LLNDPSIKELA+ ++KDP+F +MA+QLQQ+ +GA  +   PQ DP++Y  
Sbjct  52    SPFDFSSMSSLLNDPSIKELAKDVSKDPAFRKMAQQLQQSVKGAG-HCATPQLDPEKYAK  110

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             +MQQVMQNPQFMTMA  L ++LMQDP++ +M+++LSNP QK Q E +MA++K DPSLKP+
Sbjct  111   SMQQVMQNPQFMTMAHHLRHSLMQDPAVMNMIKTLSNPTQKMQFEAQMAQLKNDPSLKPV  170

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAM-----GFPgagetatsgetgtdeaeeasede  740
             L+EI +GGP AMM+YWND  VL KLG+A      G     + +   +      +   E  
Sbjct  171   LDEISKGGPPAMMKYWNDPVVLSKLGKAFQMGSSGDMSVSKQSDKNKREETSEDTEKETP  230

Query  739   SIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEV  605
               + H AS GD + L++ LA G DKD++DS+GRTALHFACGYG V
Sbjct  231   LTLTHVASTGDVKELQSLLAKGVDKDKKDSQGRTALHFACGYGNV  275



>ref|XP_001703461.1| hypothetical protein CHLREDRAFT_127770 [Chlamydomonas reinhardtii]
 gb|AAO32623.1| CR074 protein [Chlamydomonas reinhardtii]
 gb|EDP06143.1| predicted protein [Chlamydomonas reinhardtii]
Length=368

 Score =   234 bits (598),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 127/242 (52%), Positives = 173/242 (71%), Gaps = 2/242 (1%)
 Frame = -1

Query  1108  FDPQQYYGTMQQVMQNPQFMTMAERLGNALMQ-DPSMSSMLESLSNPAQKDQLEERMARI  932
             FDP +Y   MQ + QNP FM MAE+LG ++++ DP+M++M++++ +P  K ++E+ +  +
Sbjct  114   FDPSKYMEAMQGMFQNPSFMQMAEKLGKSIIEADPNMANMMKAMQDPDYKTKVEDALKGL  173

Query  931   KEDPSLKPILEEIEQGGPAAMMRYWNDKDVLKKLGEAMG-FPgagetatsgetgtdeaee  755
             K+DP LKPILEE+E  GPAAMM+ WN+ +VL KLG+AMG          +GE G  E EE
Sbjct  174   KDDPELKPILEELESQGPAAMMKMWNNPEVLGKLGKAMGGVFDFEGALEAGEAGEGEEEE  233

Query  754   asedeSIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESG  575
               E E  VH  AS GD E LK  LA GA+ DE D EGRTALHFA GYGE++C ++L+++ 
Sbjct  234   DGEVEETVHGAASAGDVELLKKLLAEGANADEADEEGRTALHFAAGYGELECVRMLIDAK  293

Query  574   AKVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLK  395
             AK+DA+D N+NTALHYAAGYG+ E V +LL +GA  T +N+DGKT +EVA+LN Q DV+ 
Sbjct  294   AKLDAVDTNQNTALHYAAGYGQAESVKILLSSGADRTSKNLDGKTALEVAELNEQADVIA  353

Query  394   LL  389
              L
Sbjct  354   AL  355


 Score = 59.3 bits (142),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  1258  FDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTF  1142
             FDFSA+   LNDPSIK++AEQIA DPSF ++A+Q+Q++F
Sbjct  18    FDFSALQSALNDPSIKQMAEQIANDPSFKEIAKQMQESF  56



>ref|XP_001703462.1| hypothetical protein CHLREDRAFT_127770 [Chlamydomonas reinhardtii]
 gb|EDP06144.1| predicted protein [Chlamydomonas reinhardtii]
Length=389

 Score =   234 bits (598),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 127/242 (52%), Positives = 173/242 (71%), Gaps = 2/242 (1%)
 Frame = -1

Query  1108  FDPQQYYGTMQQVMQNPQFMTMAERLGNALMQ-DPSMSSMLESLSNPAQKDQLEERMARI  932
             FDP +Y   MQ + QNP FM MAE+LG ++++ DP+M++M++++ +P  K ++E+ +  +
Sbjct  135   FDPSKYMEAMQGMFQNPSFMQMAEKLGKSIIEADPNMANMMKAMQDPDYKTKVEDALKGL  194

Query  931   KEDPSLKPILEEIEQGGPAAMMRYWNDKDVLKKLGEAMG-FPgagetatsgetgtdeaee  755
             K+DP LKPILEE+E  GPAAMM+ WN+ +VL KLG+AMG          +GE G  E EE
Sbjct  195   KDDPELKPILEELESQGPAAMMKMWNNPEVLGKLGKAMGGVFDFEGALEAGEAGEGEEEE  254

Query  754   asedeSIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESG  575
               E E  VH  AS GD E LK  LA GA+ DE D EGRTALHFA GYGE++C ++L+++ 
Sbjct  255   DGEVEETVHGAASAGDVELLKKLLAEGANADEADEEGRTALHFAAGYGELECVRMLIDAK  314

Query  574   AKVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLK  395
             AK+DA+D N+NTALHYAAGYG+ E V +LL +GA  T +N+DGKT +EVA+LN Q DV+ 
Sbjct  315   AKLDAVDTNQNTALHYAAGYGQAESVKILLSSGADRTSKNLDGKTALEVAELNEQADVIA  374

Query  394   LL  389
              L
Sbjct  375   AL  376


 Score = 59.3 bits (142),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  1258  FDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTF  1142
             FDFSA+   LNDPSIK++AEQIA DPSF ++A+Q+Q++F
Sbjct  18    FDFSALQSALNDPSIKQMAEQIANDPSFKEIAKQMQESF  56



>gb|EEC83963.1| hypothetical protein OsI_30078 [Oryza sativa Indica Group]
Length=291

 Score =   221 bits (563),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 156/212 (74%), Gaps = 6/212 (3%)
 Frame = -1

Query  1240  TGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQN  1061
             T +  DPS+KE+A+QIAKDP+FTQMAEQ     +G     G+P  DP  Y  TMQ+ M++
Sbjct  82    TNVFQDPSVKEIADQIAKDPAFTQMAEQ---ALEGEGEQ-GMPAIDP--YIETMQKFMES  135

Query  1060  PQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGG  881
             P F TMAERLG+AL++DP+MSS+LE+L++P    ++EER++R+KEDP++K I++E+E G 
Sbjct  136   PHFFTMAERLGDALVKDPAMSSLLENLTSPMHNAKIEERVSRMKEDPAVKSIMDELETGD  195

Query  880   PAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeasedeSIVHHCASVGDEE  701
             PAA+++YWND +  +K+ +AMG  G  + A    T   E E   EDESIVHH ASVGD+E
Sbjct  196   PAALIKYWNDPETFRKISQAMGPLGGPDFAEPSGTEGTEEEGEYEDESIVHHTASVGDDE  255

Query  700   GLKNALAAGADKDEEDSEGRTALHFACGYGEV  605
             GLK AL  GADKDEED EGR ALHF CGYGEV
Sbjct  256   GLKKALDGGADKDEEDLEGRRALHFVCGYGEV  287



>pdb|4TUM|A Chain A, Crystal Structure Of Ankyrin Repeat Domain Of Akr2
 pdb|4TUM|B Chain B, Crystal Structure Of Ankyrin Repeat Domain Of Akr2
 pdb|4TUM|C Chain C, Crystal Structure Of Ankyrin Repeat Domain Of Akr2
 pdb|4TUM|D Chain D, Crystal Structure Of Ankyrin Repeat Domain Of Akr2
 pdb|4TUM|E Chain E, Crystal Structure Of Ankyrin Repeat Domain Of Akr2
Length=132

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = -1

Query  736  IVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDAL  557
            IVH  AS+GD EGLK ALA+G +KDEEDSEGRTALHFACGYGE+KCAQ+L+++GA V+A+
Sbjct  11   IVHQTASLGDVEGLKAALASGGNKDEEDSEGRTALHFACGYGELKCAQVLIDAGASVNAV  70

Query  556  DKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDA  377
            DKNKNT LHYAAGYGRKECV+LLLENGAAVTLQN+D KTPI+VAKLN+Q +V+KLLEKDA
Sbjct  71   DKNKNTPLHYAAGYGRKECVSLLLENGAAVTLQNLDEKTPIDVAKLNSQLEVVKLLEKDA  130

Query  376  FL  371
            FL
Sbjct  131  FL  132



>gb|KFM25201.1| Ankyrin repeat domain-containing protein 2 [Auxenochlorella protothecoides]
Length=324

 Score =   209 bits (533),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 123/309 (40%), Positives = 177/309 (57%), Gaps = 29/309 (9%)
 Frame = -1

Query  1234  LLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASN-----------------DGIPQF  1106
             L+ DP+I+ + E IA DP F ++A+++Q++      N                  G+P  
Sbjct  15    LMQDPTIQRMTEAIASDPEFMEIAKEMQESMLSGNMNGLNLGGEAGGSGAGGMPPGMPNV  74

Query  1105  DPQQYYGTMQQVMQNPQFMTMAERLGNALMQ---DPSMSSMLESLSNPAQKDQLEERMAR  935
             DP +Y   MQ+VM NPQF+  AE LG +L+    DP M+S++E  SNP   + L+ ++  
Sbjct  75    DPAKYMSAMQRVMGNPQFLEAAESLGKSLLTQAADPQMASLMELFSNPEHSELLKGKLED  134

Query  934   IKEDPSLKPILEEIEQGGPAAMMRYWNDKDVLKKLG----EAMGFPgagetatsgetgtd  767
             +K DP L+PILE+IE  G  AM++Y  D D++ KLG    EAM  P       S      
Sbjct  135   LKSDPELRPILEDIEANGQEAMLKYMGDTDIMSKLGRKFQEAMADPEMQARLGSRAATDA  194

Query  766   eaeeasedeSIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQIL  587
                 A    +     A +   E LK     G   DE+D EGRT LHFA GYGE++C ++L
Sbjct  195   NGTPAVSGGAGAGDAAGL--AELLKQE---GVKPDEKDEEGRTPLHFAAGYGELECMEVL  249

Query  586   LESGAKVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQN  407
             L++GA +DA+D N NTALHYAAGYG  E   LL++  A V+++N +GKT  EVA+LN Q 
Sbjct  250   LDAGADIDAVDANNNTALHYAAGYGNVETATLLIKRKADVSIKNSEGKTAGEVAELNEQA  309

Query  406   DVLKLLEKD  380
             ++++LL+ D
Sbjct  310   ELVELLKGD  318



>gb|AAP80627.1|AF475105_1 apomixis-associated protein [Triticum aestivum]
Length=144

 Score =   201 bits (511),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -1

Query  736  IVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDAL  557
            IVH+ ASVGD EGLK AL  GA+KDEED EGR ALHFACGYGE+KCA+ILLE+GA VDAL
Sbjct  23   IVHNTASVGDAEGLKKALDGGANKDEEDLEGRRALHFACGYGELKCAEILLEAGAAVDAL  82

Query  556  DKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDA  377
            DKNKNT LHYAAGYGRKECV LLL++GAAVTLQN+DGKTPIEVAKLN+Q +V+KLLE+D 
Sbjct  83   DKNKNTPLHYAAGYGRKECVDLLLKHGAAVTLQNLDGKTPIEVAKLNSQGEVVKLLEQDV  142

Query  376  FL  371
            FL
Sbjct  143  FL  144



>ref|XP_010040103.1| PREDICTED: ankyrin repeat domain-containing protein 2-like, partial 
[Eucalyptus grandis]
Length=115

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 107/112 (96%), Gaps = 0/112 (0%)
 Frame = -1

Query  706  EEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHY  527
            ++GLK AL +GADKDEED+EGRTALHFACGYGEVKCA++LL +GA VDALDKNKNTALHY
Sbjct  4    DQGLKKALDSGADKDEEDAEGRTALHFACGYGEVKCAEVLLGAGATVDALDKNKNTALHY  63

Query  526  AAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
            +AGYGRK+CVALL+++GAAVTLQN+DGKTPI+VAKLNNQ +VLKLLEKDAFL
Sbjct  64   SAGYGRKDCVALLVKHGAAVTLQNLDGKTPIDVAKLNNQTEVLKLLEKDAFL  115



>ref|NP_001062378.1| Os08g0539600 [Oryza sativa Japonica Group]
 dbj|BAF24292.1| Os08g0539600 [Oryza sativa Japonica Group]
Length=122

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -1

Query  718  SVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNT  539
            S+GD+EGLK AL  GADKDEEDSEGR ALHFACGYGE+KCAQ+LLE+GA VDALDKNKNT
Sbjct  7    SIGDDEGLKKALDGGADKDEEDSEGRRALHFACGYGELKCAQVLLEAGAAVDALDKNKNT  66

Query  538  ALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             LHYAAGYG K CV LLL+NGAAVTL+NMDGKT I+VAKLNNQ++VL+LLEKDAFL
Sbjct  67   PLHYAAGYGMKGCVDLLLKNGAAVTLENMDGKTAIDVAKLNNQDEVLRLLEKDAFL  122



>gb|EMT04865.1| hypothetical protein F775_19878 [Aegilops tauschii]
Length=287

 Score =   198 bits (504),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 117/217 (54%), Positives = 146/217 (67%), Gaps = 26/217 (12%)
 Frame = -1

Query  1003  MSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAAMMRYWNDKDVLKKLGE  824
              S+M+  L++P+ K+  E+    I +DPS   + E++++                 K G 
Sbjct  91    FSTMMNLLNDPSIKEMAEQ----IAKDPSFSEMAEQLQK----------------TKFGR  130

Query  823   AMGF------PgagetatsgetgtdeaeeasedeSIVHHCASVGDEEGLKNALAAGADKD  662
             AMG        GAG  A   E      E   E+ESI+H  ASVGD EGLK ALA G DKD
Sbjct  131   AMGVGPSGAAAGAGTEAEEEEEVVAGEEGEYEEESIIHQTASVGDVEGLKKALADGVDKD  190

Query  661   EEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRKECVALLLE  482
             EEDSEGR  LHFACGYGE+ CAQ LLE+GA  DA+DKNKNTALHYAAGYGRKECVALL++
Sbjct  191   EEDSEGRRGLHFACGYGELGCAQALLEAGAAADAVDKNKNTALHYAAGYGRKECVALLVD  250

Query  481   NGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
             +GA+VTLQN+DGKT I+VA+LN+Q +VLKLLEK A++
Sbjct  251   HGASVTLQNLDGKTAIDVARLNSQEEVLKLLEKHAYV  287


 Score = 73.2 bits (178),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDG  1118
             +PFDFS M  LLNDPSIKE+AEQIAKDPSF++MAEQLQ+T  G A   G
Sbjct  87    SPFDFSTMMNLLNDPSIKEMAEQIAKDPSFSEMAEQLQKTKFGRAMGVG  135



>dbj|BAJ91053.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=107

 Score =   186 bits (471),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = -1

Query  688  ALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGR  509
            AL  GADKDEEDSEGR ALHFACGYGE KCA+ILLE+GA VDA+DKNKNT LHYAAGYGR
Sbjct  2    ALDGGADKDEEDSEGRRALHFACGYGEFKCAEILLEAGAAVDAMDKNKNTPLHYAAGYGR  61

Query  508  KECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAFL  371
            KECV LLL++GAAVTLQNMDGKTPI+VAKLNNQ++VLKLLEKD FL
Sbjct  62   KECVDLLLKHGAAVTLQNMDGKTPIDVAKLNNQDEVLKLLEKDVFL  107



>tpg|DAA52533.1| TPA: hypothetical protein ZEAMMB73_896450 [Zea mays]
Length=190

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 113/140 (81%), Gaps = 6/140 (4%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTF------QGAASNDGIPQFD  1103
             NPFDFS M  LLNDPSIKE+AEQIAKDP+FT+MAEQLQ+T       Q   +     Q D
Sbjct  51    NPFDFSTMMNLLNDPSIKEMAEQIAKDPAFTEMAEQLQKTVVSPRQQQQQQARQQQQQLD  110

Query  1102  PQQYYGTMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKED  923
             PQ+Y  TMQQ+MQNPQF+ MAERLG+ALMQDP+MS+ML  L+NPA K+QLE R+AR+KED
Sbjct  111   PQKYVATMQQLMQNPQFVAMAERLGSALMQDPAMSAMLGGLTNPAHKEQLEARVARMKED  170

Query  922   PSLKPILEEIEQGGPAAMMR  863
             P+LKPIL+EIE GGPAAMM+
Sbjct  171   PTLKPILDEIESGGPAAMMK  190



>ref|XP_003074674.1| ankyrin repeat family protein / AFT protein (ISS) [Ostreococcus 
tauri]
Length=324

 Score =   192 bits (488),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 136/206 (66%), Gaps = 5/206 (2%)
 Frame = -1

Query  973  PAQKDQLEERMARIKEDPSLKPILEEIEQGGPAAMMRYWNDKDVLKKLGEAMG-----FP  809
            P    + E +M  +K DP +  I+ EIE GGP AMM+YWND  VLKK+  AMG     F 
Sbjct  119  PGDGGEDEAKMEELKNDPEMADIMSEIETGGPQAMMKYWNDPKVLKKINGAMGDIMPTFG  178

Query  808  gagetatsgetgtdeaeeasedeSIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALH  629
               +   S     +EA E  ++E  V   AS GD E +   + AG D +  DSEGRT LH
Sbjct  179  AVADDDESEVVEEEEAAEEEDEEESVITAASEGDHEAMMAFIKAGQDVNMTDSEGRTGLH  238

Query  628  FACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMD  449
            FACGYGE+KCA++L++ GA V+A DKNKNT LHYAAGYGR + V LL+E G +VT+ N D
Sbjct  239  FACGYGELKCAELLVKEGADVNASDKNKNTPLHYAAGYGRSDLVELLVEAGGSVTMVNND  298

Query  448  GKTPIEVAKLNNQNDVLKLLEKDAFL  371
            GK+P++VAKLN+Q DV+K LEKD FL
Sbjct  299  GKSPLDVAKLNDQEDVVKALEKDVFL  324



>ref|XP_006301730.1| hypothetical protein CARUB_v10022191mg, partial [Capsella rubella]
 gb|EOA34628.1| hypothetical protein CARUB_v10022191mg, partial [Capsella rubella]
Length=179

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 123/181 (68%), Gaps = 3/181 (2%)
 Frame = -1

Query  916  LKPILEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeasedeS  737
            L  IL+EI   GP A+M++W+D+DV KKL + M      ET +  +      +   E   
Sbjct  1    LVSILDEINATGPNAIMKFWDDEDVCKKLSQPMVI-ADHETPSPSDDKESVFKRLDEVMG  59

Query  736  IVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDAL  557
            IVH  A+ GD +GLK ALA  A+KD+EDSEGRTALH AC  GEVKCA++LL++G  ++A+
Sbjct  60   IVHKTATSGDVKGLKTALAT-ANKDDEDSEGRTALHLACSRGEVKCAKVLLKAGENLNAV  118

Query  556  DKNKNTALHYAAGYGRKECVALLLENGAAV-TLQNMDGKTPIEVAKLNNQNDVLKLLEKD  380
            DKNK+T LHYAA  GRK CV+ LL+      +LQNMDGKTPI +AKLN   +V+ LLEKD
Sbjct  119  DKNKSTPLHYAANCGRKGCVSFLLKKVLQCNSLQNMDGKTPIYLAKLNYHLNVVNLLEKD  178

Query  379  A  377
            A
Sbjct  179  A  179



>emb|CAE54081.1| ankyrin-repeat protein [Fagus sylvatica]
Length=178

 Score =   164 bits (415),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 108/143 (76%), Gaps = 9/143 (6%)
 Frame = -1

Query  1408  SQEEKNLPAQKQDEKSGAADSKKPLESTSLDTQSgqggaplaagpGMHNPFDFSAMTGLL  1229
             S   K+LPA   DEK+G+       E T+  +++  G AP        NPFDFSAMTGLL
Sbjct  21    SNSPKDLPA---DEKAGST------EKTNSKSETSSGEAPPPGPGFPANPFDFSAMTGLL  71

Query  1228  NDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQNPQFM  1049
             NDPSIK+LAEQI++DP+F QMAEQLQ+TFQG A  +G+PQFD QQYY TMQQVMQNPQFM
Sbjct  72    NDPSIKDLAEQISRDPAFNQMAEQLQKTFQGPAVEEGLPQFDSQQYYNTMQQVMQNPQFM  131

Query  1048  TMAERLGNALMQDPSMSSMLESL  980
             TMAERLGNALMQDPSM+++LE  
Sbjct  132   TMAERLGNALMQDPSMANVLEKF  154



>ref|XP_003603722.1| Ankyrin repeat domain-containing protein [Medicago truncatula]
 gb|AES73973.1| hypothetical protein MTR_3g113040 [Medicago truncatula]
Length=377

 Score =   169 bits (429),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 125/189 (66%), Gaps = 7/189 (4%)
 Frame = -1

Query  1258  FDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTM  1079
              DFSA   LLNDP+IKELAE + K PSF Q+AEQLQ+T  GA + D +P+ + ++Y  TM
Sbjct  50    LDFSA---LLNDPNIKELAEHVEKYPSFNQIAEQLQETLHGA-TRDRLPKSNDRKYVSTM  105

Query  1078  QQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILE  899
             Q+++ N     M ERL + LMQDPS SS+ E   NP+ K Q ++RMA I++DP LK IL+
Sbjct  106   QKIINNLDLWKMFERLSDVLMQDPSTSSVPEIFVNPSNKGQRKQRMAHIQKDPCLKLILD  165

Query  898   EIEQGGPAAMMRYWNDKDVLKKLGEAMG---FPgagetatsgetgtdeaeeasedeSIVH  728
             EIE GGPA MMRYWND+++LK  G AMG   +      ++      +  +   EDESI+H
Sbjct  166   EIENGGPAVMMRYWNDENILKMFGLAMGIIPYSEDAVASSENSGPDETEDMRYEDESIIH  225

Query  727   HCASVGDEE  701
             H A+VGD E
Sbjct  226   HTANVGDVE  234



>ref|XP_010507312.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Camelina 
sativa]
Length=121

 Score =   159 bits (403),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 96/119 (81%), Gaps = 1/119 (1%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            VH  A+  D EGLK ALA  A+KDEEDSEGRT LH AC YG+VKCA++LLE+GA ++A+D
Sbjct  4    VHKTATSSDVEGLKTALAT-ANKDEEDSEGRTGLHLACSYGKVKCAKVLLEAGANLNAVD  62

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDA  377
            KNKNT LHYA   GRK+CV+LLL+ G+A TLQN DGK PI++AKLN Q DV+ LLEKDA
Sbjct  63   KNKNTPLHYAGNCGRKKCVSLLLKKGSAETLQNKDGKNPIDLAKLNYQLDVVNLLEKDA  121



>gb|EYU35446.1| hypothetical protein MIMGU_mgv1a0083452mg, partial [Erythranthe 
guttata]
Length=162

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -1

Query  1270  MHNPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQY  1091
             M NPFDFSAMTGLLNDPSIKELAEQIAKDPSF QMAEQLQ+TFQG    D IP FD QQY
Sbjct  77    MPNPFDFSAMTGLLNDPSIKELAEQIAKDPSFNQMAEQLQKTFQGGPVEDSIPNFDTQQY  136

Query  1090  YGTMQQVMQNPQFMTMAERLGNALMQ  1013
             Y TMQQVMQNPQFMTMAERLGNALMQ
Sbjct  137   YSTMQQVMQNPQFMTMAERLGNALMQ  162



>ref|XP_001691759.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP04867.1| predicted protein [Chlamydomonas reinhardtii]
Length=298

 Score =   147 bits (371),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 91/279 (33%), Positives = 148/279 (53%), Gaps = 16/279 (6%)
 Frame = -1

Query  1195  IAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTMQQVMQNPQFMTMAERLGNALM  1016
             I + P+    A+ + ++        G PQ  P+Q    MQQ M++P F    + +   +M
Sbjct  10    IGRRPAPFSSAQPVARSLVRVKIGGGAPQMTPEQMQA-MQQAMKDPAFAKRMQEM-QEMM  67

Query  1015  QDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAAMMRYWNDKDVLK  836
             + P +   + ++    Q   L++RMA +K+DP    I  +I++GG  A+M+Y+ND + L 
Sbjct  68    KRPEVQQQMAAMQAAMQNQALQQRMASLKDDPEFADIFADIQKGGMQALMKYYNDPEFLA  127

Query  835   KLGEAMG------------FPgagetatsgetgtdeaeeasedeSIV--HHCASVGDEEG  698
             KLG+ +G             P  G    +       A   +   + +  H     GDEE 
Sbjct  128   KLGDKLGSSPTTGVRQQSDVPAHGPALHTKMHMDTRAPWLTSVATFICKHTHNRYGDEEA  187

Query  697   LKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAG  518
             +++ +A G D +E D++GRTALH++  Y     A++L++ GA ++A D   NT LHYAAG
Sbjct  188   VEDFIAIGKDLNEPDAQGRTALHYSVAYDHPVIAKMLVDEGANLEARDSLNNTPLHYAAG  247

Query  517   YGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDV  401
             YGR     +LL+ GA  T+QN  GKTPI++AKL+ +N +
Sbjct  248   YGRVALARMLLDAGADKTVQNNTGKTPIDLAKLDGRNPI  286



>ref|XP_010452180.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Camelina 
sativa]
Length=240

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 85/229 (37%), Positives = 125/229 (55%), Gaps = 37/229 (16%)
 Frame = -1

Query  1204  AEQIAKDPSFTQMAEQLQQTFQGAASNDG-IPQFDPQQYYGTMQQVMQNPQFMTMAERLG  1028
             AE++   P + Q+A++LQ++   A +  G I +FD + Y      V++NPQ   + E   
Sbjct  45    AEKVDTVPRYIQLAKELQRSIPVAWNQHGSITEFDEELYNNRKALVLENPQIQKLME---  101

Query  1027  NALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAAMMRYWNDK  848
                 QDP  S  L++L NP   D+  E M ++++D  L+ I+ EI+   PAAM++YWNDK
Sbjct  102   ---CQDPQSS--LKALGNPEASDKFAELMVQLEKDAELESIVAEIKASPPAAMLKYWNDK  156

Query  847   DVLKKLGEAMGFPgagetatsgetgtdeaeeasedeSIVHHCASVGDEEGLKN-ALAAGA  671
              VLKKLG++M                          SIVH  +++GD E LK  A  +G 
Sbjct  157   IVLKKLGKSMS-------------------------SIVHDTSTLGDVEDLKTLASGSGD  191

Query  670   DKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDK--NKNTALH  530
             D DE+ SEGR AL  AC + ++KC +ILLE+  K +A+DK   K   LH
Sbjct  192   DNDEQVSEGRKALKIACEHTKMKCIKILLEAEEKANAVDKGRKKKIPLH  240



>ref|XP_002949641.1| hypothetical protein VOLCADRAFT_120788 [Volvox carteri f. nagariensis]
 gb|EFJ49193.1| hypothetical protein VOLCADRAFT_120788 [Volvox carteri f. nagariensis]
Length=268

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/236 (33%), Positives = 126/236 (53%), Gaps = 18/236 (8%)
 Frame = -1

Query  1057  QFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMAR----------------IKE  926
             +F  + E +  A MQDP+    ++ +    ++ +++++MA                 +K 
Sbjct  22    RFRMLQEMMAKA-MQDPNFQKQMQQMQEMMKRPEVQKQMAEMQAAAQNQQLQQRMQVLKN  80

Query  925   DPSLKPILEEIEQGGPAAMMRYWNDKDVLKKLGEAMG-FPgagetatsgetgtdeaeeas  749
             DP    +  +I++ G  A+M+Y+ND   L KLG  +G    + + A+            +
Sbjct  81    DPEFAEVFADIQKNGMQALMKYYNDPAFLSKLGSKIGDVGQSADAASPVAPAAVPPPAPA  140

Query  748   edeSIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAK  569
              + + +   A  GDEE +++ +A G D +E D++GRTALH+A  Y     A++LL+ GA 
Sbjct  141   PEINNIRDAARWGDEEAVEDFIAIGKDINEPDTQGRTALHYAVAYDHAVIAKMLLDEGAN  200

Query  568   VDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDV  401
             V+A D   NT LHYA GYGR     LLL+ GA   +QN  GKTP+E+AKL+ +N V
Sbjct  201   VEARDSMNNTPLHYACGYGRAPLARLLLKAGANKGVQNNTGKTPLELAKLDPRNPV  256



>ref|XP_003603781.1| Ankyrin repeat domain-containing protein [Medicago truncatula]
 gb|AES74032.1| hypothetical protein MTR_3g114110 [Medicago truncatula]
Length=374

 Score =   125 bits (314),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 109/191 (57%), Gaps = 24/191 (13%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPF+FS+   LL D +IK+LAEQ  K PSF QMA+Q           DG+ +   ++ + 
Sbjct  45    NPFNFSS---LLYDTNIKKLAEQAEKYPSFNQMAQQ-----------DGLLKSHKRKTFS  90

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
              M++++ +    T+AERL +AL+QDPS SSMLE     + + + +   A++  DP LK I
Sbjct  91    IMRRIIFSDDLWTLAERLSDALVQDPSTSSMLEIYVKLSFEGKRKRGTAQVDRDPCLKLI  150

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeasedeSIVHH  725
             L+EIE GGPA +MRYWND+ VLK  G  MG             G  +A  +    S VHH
Sbjct  151   LDEIESGGPAVLMRYWNDERVLKMFGLVMGI----------SLGPGDAVYSENFGSFVHH  200

Query  724   CASVGDEEGLK  692
              A +G+ + LK
Sbjct  201   TAIIGNVKNLK  211



>gb|KEH36257.1| hypothetical protein MTR_3g114110 [Medicago truncatula]
Length=316

 Score =   124 bits (310),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 94/151 (62%), Gaps = 14/151 (9%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPF+FS+   LL D +IK+LAEQ  K PSF QMA+Q           DG+ +   ++ + 
Sbjct  45    NPFNFSS---LLYDTNIKKLAEQAEKYPSFNQMAQQ-----------DGLLKSHKRKTFS  90

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
              M++++ +    T+AERL +AL+QDPS SSMLE     + + + +   A++  DP LK I
Sbjct  91    IMRRIIFSDDLWTLAERLSDALVQDPSTSSMLEIYVKLSFEGKRKRGTAQVDRDPCLKLI  150

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGF  812
             L+EIE GGPA +MRYWND+ VLK  G  MG 
Sbjct  151   LDEIESGGPAVLMRYWNDERVLKMFGLVMGI  181



>gb|KEH41753.1| hypothetical protein MTR_1g054540 [Medicago truncatula]
Length=396

 Score =   125 bits (314),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 90/149 (60%), Gaps = 17/149 (11%)
 Frame = -1

Query  1258  FDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTM  1079
             FDFSA   LLNDP+I++LAEQ             LQ+T   A  +D     DP+ Y  TM
Sbjct  40    FDFSA---LLNDPNIRKLAEQ-------------LQETLHEAPQDDLSNSRDPK-YASTM  82

Query  1078  QQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILE  899
              Q+ +N  F TM  RL  ALMQDPSMSSM+E  ++P+ + Q + R A + +D  LK IL+
Sbjct  83    LQIGKNLDFKTMVRRLIWALMQDPSMSSMVEIYTDPSLEGQRKRRTAHLNKDQCLKLILD  142

Query  898   EIEQGGPAAMMRYWNDKDVLKKLGEAMGF  812
             EIE GGP  MMRYWND+ VLK  G  MG 
Sbjct  143   EIENGGPEVMMRYWNDEKVLKMFGLVMGI  171



>ref|XP_003603780.1| Ankyrin repeat domain-containing protein [Medicago truncatula]
 gb|AES74031.1| hypothetical protein MTR_3g114110 [Medicago truncatula]
Length=378

 Score =   124 bits (312),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 94/151 (62%), Gaps = 14/151 (9%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPF+FS+   LL D +IK+LAEQ  K PSF QMA+Q           DG+ +   ++ + 
Sbjct  45    NPFNFSS---LLYDTNIKKLAEQAEKYPSFNQMAQQ-----------DGLLKSHKRKTFS  90

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
              M++++ +    T+AERL +AL+QDPS SSMLE     + + + +   A++  DP LK I
Sbjct  91    IMRRIIFSDDLWTLAERLSDALVQDPSTSSMLEIYVKLSFEGKRKRGTAQVDRDPCLKLI  150

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGF  812
             L+EIE GGPA +MRYWND+ VLK  G  MG 
Sbjct  151   LDEIESGGPAVLMRYWNDERVLKMFGLVMGI  181



>gb|KEH41766.1| hypothetical protein MTR_1g054620 [Medicago truncatula]
Length=385

 Score =   124 bits (312),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 90/149 (60%), Gaps = 17/149 (11%)
 Frame = -1

Query  1258  FDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTM  1079
             FDFSA   LLNDP+I++LAEQ             LQ+T   A  +D     DP+ Y  TM
Sbjct  18    FDFSA---LLNDPNIRKLAEQ-------------LQETLHEAPQDDLSNSRDPK-YASTM  60

Query  1078  QQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILE  899
              Q+ +N  F TM  RL  ALMQDPSMSSM+E  ++P+ + Q + R A + +D  LK IL+
Sbjct  61    LQIGKNLDFKTMVRRLIWALMQDPSMSSMVEIYTDPSLEGQRKRRTAHLNKDQCLKLILD  120

Query  898   EIEQGGPAAMMRYWNDKDVLKKLGEAMGF  812
             EIE GGP  MMRYWND+ VLK  G  MG 
Sbjct  121   EIENGGPEVMMRYWNDEKVLKMFGLVMGI  149



>gb|KEH41767.1| hypothetical protein MTR_1g054620 [Medicago truncatula]
Length=384

 Score =   124 bits (312),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 90/149 (60%), Gaps = 17/149 (11%)
 Frame = -1

Query  1258  FDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTM  1079
             FDFSA   LLNDP+I++LAEQ             LQ+T   A  +D     DP+ Y  TM
Sbjct  18    FDFSA---LLNDPNIRKLAEQ-------------LQETLHEAPQDDLSNSRDPK-YASTM  60

Query  1078  QQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILE  899
              Q+ +N  F TM  RL  ALMQDPSMSSM+E  ++P+ + Q + R A + +D  LK IL+
Sbjct  61    LQIGKNLDFKTMVRRLIWALMQDPSMSSMVEIYTDPSLEGQRKRRTAHLNKDQCLKLILD  120

Query  898   EIEQGGPAAMMRYWNDKDVLKKLGEAMGF  812
             EIE GGP  MMRYWND+ VLK  G  MG 
Sbjct  121   EIENGGPEVMMRYWNDEKVLKMFGLVMGI  149



>ref|XP_002502361.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63619.1| predicted protein [Micromonas sp. RCC299]
Length=336

 Score =   120 bits (302),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 74/226 (33%), Positives = 121/226 (54%), Gaps = 13/226 (6%)
 Frame = -1

Query  1021  LMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAAMMRYWNDKDV  842
             +M +P +   +++++N      ++ R+A +K+DP  +    ++++ GP+AMM+Y ND   
Sbjct  107   MMNNPMVQKQMQAMNNMISNPDMQRRIAALKDDPDFQDFFNDVQKNGPSAMMKYSNDAAF  166

Query  841   LKKLGEAMGFPgagetatsge------tgtdeaeeasedeSIVHHCASVGDEEGLKNALA  680
             LKKL + +G   A   A  G            A   + +   +H  A  GD E +++ +A
Sbjct  167   LKKLNDKLGGEDAIRAAVGGSIPGEPAAAPAAAAAPTPEVETLHDAARYGDVEAVEDFIA  226

Query  679   AGADKDEEDSEGRTALHFACGYGEVKCAQ----ILLESGAKVDALDKNKNTALHYAAGYG  512
              G D +  DS  RT LH+A  +G+    +     L+E+ + + A+D+ KNT LHYA GYG
Sbjct  227   IGKDVNARDSSQRTPLHYAIAFGKGDAGEEIFNQLIEADSDLTAVDEKKNTPLHYACGYG  286

Query  511   RKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDV---LKLLEK  383
             +   V  LLE G  +T QN  GKTPI++ KL  +N +     L+EK
Sbjct  287   KTFAVRALLEKGCDITAQNGTGKTPIDLVKLEAKNPINEETDLIEK  332



>gb|KEH25793.1| hypothetical protein MTR_6g034405 [Medicago truncatula]
Length=382

 Score =   120 bits (302),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 107/191 (56%), Gaps = 22/191 (12%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPF+FS+   LL D +IK+LAEQ  K PSF QMA+Q           DG+ +    + + 
Sbjct  50    NPFNFSS---LLYDTNIKKLAEQAEKYPSFNQMAQQ-----------DGLLKSHKLKTFS  95

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
              M +++ +    T+AERL +AL+QDPS SSMLE     + +   +  +A++  DP LK I
Sbjct  96    IMSRIIFSFDLWTLAERLSDALVQDPSTSSMLEIYVKLSFEGFRKLGIAQVDRDPCLKLI  155

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeasedeSIVHH  725
             L+EIE GGPA +MRYWND+ VLK  G  MG         S    + +A       S VHH
Sbjct  156   LDEIEIGGPAVLMRYWNDEWVLKMFGLVMGI--------SLGPDSGDAVYHENSGSFVHH  207

Query  724   CASVGDEEGLK  692
              A +G+ + LK
Sbjct  208   TAIIGNVKNLK  218



>gb|KEH25792.1| hypothetical protein MTR_6g034405 [Medicago truncatula]
Length=386

 Score =   120 bits (300),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 92/151 (61%), Gaps = 14/151 (9%)
 Frame = -1

Query  1264  NPFDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYG  1085
             NPF+FS+   LL D +IK+LAEQ  K PSF QMA+Q           DG+ +    + + 
Sbjct  50    NPFNFSS---LLYDTNIKKLAEQAEKYPSFNQMAQQ-----------DGLLKSHKLKTFS  95

Query  1084  TMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
              M +++ +    T+AERL +AL+QDPS SSMLE     + +   +  +A++  DP LK I
Sbjct  96    IMSRIIFSFDLWTLAERLSDALVQDPSTSSMLEIYVKLSFEGFRKLGIAQVDRDPCLKLI  155

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGF  812
             L+EIE GGPA +MRYWND+ VLK  G  MG 
Sbjct  156   LDEIEIGGPAVLMRYWNDEWVLKMFGLVMGI  186



>emb|CEG00021.1| Ankyrin repeat [Ostreococcus tauri]
Length=258

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/250 (30%), Positives = 134/250 (54%), Gaps = 22/250 (9%)
 Frame = -1

Query  1075  QVMQNPQFMT-----MAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLK  911
             + M+NP+        MA+  G  +M++P +   +++++N     ++++R+A +K+DP+  
Sbjct  10    EAMKNPETAKKVQEQMAQMQG--MMKNPMVQQQMQAMNNMVANPEMQKRIASLKDDPAFA  67

Query  910   PILEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetat-----sgetgtdeaeease  746
                +++ + GP AMM++ ND++ L++L +A+G   A   A              A   + 
Sbjct  68    DFFDDLRKNGPGAMMKWANDREFLQRLNDALGGEEAIRAAAGGVAPPEAMSAPAAAAPTP  127

Query  745   deSIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQ----ILLES  578
             +   +H  A  GD E +++ +A G + +  DS  RT +H+A  +G+    +    +LLE+
Sbjct  128   EVETLHDAARYGDVEAVEDFIAVGKNINARDSSSRTPIHYAIAFGKGDAGEEIFNLLLEA  187

Query  577   GAKVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKL------N  416
             GA + A D+ KNT LHYA GYG+   V  LL+ G     +N  GK PI++ KL      N
Sbjct  188   GADLTATDEKKNTPLHYACGYGKPFAVRALLDKGCDKQAKNGTGKAPIDLVKLEPKNPIN  247

Query  415   NQNDVLKLLE  386
             N ++++  LE
Sbjct  248   NDSELIAKLE  257



>ref|XP_003082507.1| putative ankyrin-repeat protein (ISS) [Ostreococcus tauri]
Length=277

 Score =   117 bits (293),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 74/250 (30%), Positives = 134/250 (54%), Gaps = 22/250 (9%)
 Frame = -1

Query  1075  QVMQNPQFMT-----MAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLK  911
             + M+NP+        MA+  G  +M++P +   +++++N     ++++R+A +K+DP+  
Sbjct  29    EAMKNPETAKKVQEQMAQMQG--MMKNPMVQQQMQAMNNMVANPEMQKRIASLKDDPAFA  86

Query  910   PILEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetat-----sgetgtdeaeease  746
                +++ + GP AMM++ ND++ L++L +A+G   A   A              A   + 
Sbjct  87    DFFDDLRKNGPGAMMKWANDREFLQRLNDALGGEEAIRAAAGGVAPPEAMSAPAAAAPTP  146

Query  745   deSIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQ----ILLES  578
             +   +H  A  GD E +++ +A G + +  DS  RT +H+A  +G+    +    +LLE+
Sbjct  147   EVETLHDAARYGDVEAVEDFIAVGKNINARDSSSRTPIHYAIAFGKGDAGEEIFNLLLEA  206

Query  577   GAKVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKL------N  416
             GA + A D+ KNT LHYA GYG+   V  LL+ G     +N  GK PI++ KL      N
Sbjct  207   GADLTATDEKKNTPLHYACGYGKPFAVRALLDKGCDKQAKNGTGKAPIDLVKLEPKNPIN  266

Query  415   NQNDVLKLLE  386
             N ++++  LE
Sbjct  267   NDSELIAKLE  276



>ref|XP_001753203.1| predicted protein [Physcomitrella patens]
 gb|EDQ81832.1| predicted protein [Physcomitrella patens]
Length=82

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -1

Query  610  EVKCAQILLESGAKVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIE  431
            +VKCA+ LLE+GA  DALDKN NTALHYAAGYGR ECV LLL+NGAAVTLQN+DGKTPI+
Sbjct  3    QVKCAEALLEAGAAADALDKNNNTALHYAAGYGRAECVELLLKNGAAVTLQNLDGKTPID  62

Query  430  VAKLNNQNDVLKLLEKDAFL  371
            VAKLNNQ+ VL+LLEKDAFL
Sbjct  63   VAKLNNQDKVLQLLEKDAFL  82



>ref|XP_005649242.1| ankyrin [Coccomyxa subellipsoidea C-169]
 gb|EIE24698.1| ankyrin [Coccomyxa subellipsoidea C-169]
Length=296

 Score =   110 bits (275),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/204 (33%), Positives = 109/204 (53%), Gaps = 13/204 (6%)
 Frame = -1

Query  1018  MQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAAMMRYWNDKDVL  839
             ++ P +++ +E ++   Q  QL++R+A++K+DP L  + E+I++ G  A+M+YWND   L
Sbjct  14    VKKPEIAAQVEQMTAAMQDQQLQQRIAQLKDDPELAGMFEDIQKNGMGALMKYWNDPATL  73

Query  838   KKLGEAMGFPgagetatsgetgtdeaeeasedeSIVHH---CASVGDEEGLKNALAAGAD  668
              K+GE MG   AG                +     +++    A  GD E +++ +A G D
Sbjct  74    AKIGERMGPVEAGAGPAPAAPAAQAQAAPAASMPEINNLLDAAKHGDLEAVQDFIAIGKD  133

Query  667   KDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRKECVALL  488
              +E D +GR+ALH+A  Y               V+ LD  KNT LHYAAGYGR   V  L
Sbjct  134   VNERDGDGRSALHYAVAYSHADI----------VEELDSKKNTPLHYAAGYGRSALVRQL  183

Query  487   LENGAAVTLQNMDGKTPIEVAKLN  416
             LE GA     N  G++ ++++ ++
Sbjct  184   LEAGAKAAADNASGQSALDLSTID  207



>ref|XP_001695823.1| flagellar associated protein [Chlamydomonas reinhardtii]
 gb|EDP01160.1| flagellar associated protein [Chlamydomonas reinhardtii]
Length=309

 Score =   105 bits (262),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 72/246 (29%), Positives = 119/246 (48%), Gaps = 6/246 (2%)
 Frame = -1

Query  1120  GIPQFDPQQYYGTMQQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERM  941
             G+P    Q     ++    NP     A      +M+ P M+    ++S P Q   + ER+
Sbjct  50    GMPAAQAQALVAYLKS---NPAAAKAAYEHAQKVMKTPGMAGAFANMSAP-QNPVMMERL  105

Query  940   ARIKEDPSLKPILEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdea  761
               +K+DP LK + E+++  G  A  +YW+D D++ K+   +               + E 
Sbjct  106   NLLKDDPELKDMFEDMKTNGADAFQKYWDDTDLMLKISRKLRELNVDGAPAPEAPASAEG  165

Query  760   eeasedeSI--VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQIL  587
               A   + I  +H  A  GD E     +  GAD +  +  G +AL  A G+  ++  ++L
Sbjct  166   APAPAKKLIENLHDAAKHGDMEAATRLIEEGADVNALNDRGISALGVAVGFNRLEVVKLL  225

Query  586   LESGAKVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQN  407
             + +GA +   D  KN+ +HYAAGYGR      LL  GA ++ QN   +TP +VAKLN + 
Sbjct  226   IAAGADLTFRDPKKNSLMHYAAGYGRMAIAKALLGAGAELSAQNDAKQTPADVAKLNGEK  285

Query  406   DVLKLL  389
             +++K L
Sbjct  286   EMVKFL  291



>gb|KEH41763.1| hypothetical protein MTR_1g054600 [Medicago truncatula]
Length=217

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 78/129 (60%), Gaps = 17/129 (13%)
 Frame = -1

Query  1258  FDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTM  1079
             FDFSA   LLNDP+I++LAEQ             LQ+T   A  +D     DP+ Y  TM
Sbjct  86    FDFSA---LLNDPNIRKLAEQ-------------LQETLHEAPQDDLTNSRDPK-YASTM  128

Query  1078  QQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILE  899
              Q+ +N    TM  RL  ALMQDPS+SSM+E  ++P+ + Q + R A + +DP LK IL+
Sbjct  129   LQIRKNLDLKTMVRRLICALMQDPSLSSMVEIYTDPSLEGQRKRRTAHLNKDPCLKLILD  188

Query  898   EIEQGGPAA  872
             EIE GGPAA
Sbjct  189   EIENGGPAA  197



>gb|KEH41755.1| hypothetical protein MTR_1g054550 [Medicago truncatula]
Length=229

 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 80/149 (54%), Gaps = 36/149 (24%)
 Frame = -1

Query  1258  FDFSAMTGLLNDPSIKELAEQIAKDPSFTQMAEQLQQTFQGAASNDGIPQFDPQQYYGTM  1079
             FDFSA   LLNDP+I++LAEQ             LQ+T   A  +D     DP+      
Sbjct  18    FDFSA---LLNDPNIRKLAEQ-------------LQETLHEAPQDDLSNSRDPK------  55

Query  1078  QQVMQNPQFMTMAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPILE  899
                           RL  ALMQDPSMSSM+E  ++P+ + Q + R A + +D  LK IL+
Sbjct  56    --------------RLIWALMQDPSMSSMVEIYTDPSLEGQRKRRTAHLNKDQCLKLILD  101

Query  898   EIEQGGPAAMMRYWNDKDVLKKLGEAMGF  812
             EIE GGP  MMRYWND+ VLK  G  MG 
Sbjct  102   EIENGGPEVMMRYWNDEKVLKMFGLVMGI  130



>ref|XP_007514863.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15103.1| predicted protein [Bathycoccus prasinos]
Length=336

 Score =   103 bits (256),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 79/271 (29%), Positives = 136/271 (50%), Gaps = 28/271 (10%)
 Frame = -1

Query  1117  IPQFDPQ---QYYGTMQQVMQNPQFMT-MAERLGN--ALMQDPSMSSMLESLSNPAQKDQ  956
             +P  DP+   +     Q+ M+NP+    + E++     +M +P +   ++++ N  Q + 
Sbjct  64    MPGMDPEKMKEMQAAYQEAMKNPETAKKLQEQMKQMQGMMSNPMVQQQMQAMQNMVQNED  123

Query  955   LEERMARIKEDPSLKPILEEIEQGGPAAMMRYWNDKDVLKKLGEAMG-----------FP  809
             ++ ++A +K+DP  K   +++   GP AMM+Y  D+  LKKL + +G             
Sbjct  124   MQRKIAGLKDDPEFKDFFDDLRANGPGAMMKYSTDQAFLKKLNDKLGGEEAIRAAAGGAI  183

Query  808   gagetatsgetgtdeaeeasedeSIVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALH  629
              A      G      A     +   +H  A  GD E +++ LA G D +  DS  RT +H
Sbjct  184   PAEAVPPGGAAPPPAAPAPPPEVETLHDAARYGDIEAVEDFLAIGKDVNARDSSQRTPIH  243

Query  628   FACGYGEVKCAQ----ILLESGA-KVDALDKNKNTALHYAAGYGRKECVALLLENGAAVT  464
             +A  +G+    +    +L+E+ +  + A D+ +NT LHYA GYG+   V  LLE  + VT
Sbjct  244   YAIAFGKGSAGEEIFDLLIEADSIDLSARDEKQNTPLHYACGYGKIFAVKKLLEMNSDVT  303

Query  463   LQNMDGKTPIEVAKLNNQN------DVLKLL  389
              +N  GKTP+++ KL  +N      ++LKLL
Sbjct  304   AKNGTGKTPLDLVKLEAKNPINEDAELLKLL  334



>ref|XP_010471941.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Camelina 
sativa]
Length=163

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 82/157 (52%), Gaps = 38/157 (24%)
 Frame = -1

Query  1066  QNPQFMTMAERLG----NALMQDPSMSSM-LESLSNPAQKDQLEERMARIKEDPSLKPIL  902
             ++P F+ + E LG     A  Q+ S  ++ LE+L N    D+    MAR+K+DP L+PIL
Sbjct  7     RDPGFIQLTEELGRNFPTAWTQEISERALSLETLWNTEASDKC---MARMKKDPELEPIL  63

Query  901   EEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeasedeSIVHHC  722
              EIE  GP+AM +YWND+DVLKKLG AM                                
Sbjct  64    SEIEAAGPSAMFKYWNDEDVLKKLGAAM------------------------------DT  93

Query  721   ASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYG  611
              ++ D EGLK +LA+G +KDEE  EGR AL   C Y 
Sbjct  94    LTLSDVEGLKMSLASGGNKDEELFEGRKALEIVCEYA  130



>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural 
Genomics Consortium Target Or265.
 pdb|4HQD|B Chain B, Crystal Structure Of Engineered Protein. Northeast Structural 
Genomics Consortium Target Or265.
Length=169

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 75/117 (64%), Gaps = 0/117 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H+ A  G +E +K  ++ GAD + +DS+GRT LH+A   G  +  ++L+  GA V+A D
Sbjct  41   LHYAAKEGHKEIVKLLISKGADVNAKDSDGRTPLHYAAKEGHKEIVKLLISKGADVNAKD  100

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEK  383
             +  T LHYAA  G KE V LL+  GA V   + DG+TP+++A+ +   +++KLLEK
Sbjct  101  SDGRTPLHYAAKEGHKEIVKLLISKGADVNTSDSDGRTPLDLAREHGNEEIVKLLEK  157


 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 67/112 (60%), Gaps = 0/112 (0%)
 Frame = -1

Query  724  CASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNK  545
             A  G+++ +K+ +  GAD +  DS+GRT LH+A   G  +  ++L+  GA V+A D + 
Sbjct  11   AAENGNKDRVKDLIENGADVNASDSDGRTPLHYAAKEGHKEIVKLLISKGADVNAKDSDG  70

Query  544  NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
             T LHYAA  G KE V LL+  GA V  ++ DG+TP+  A      +++KLL
Sbjct  71   RTPLHYAAKEGHKEIVKLLISKGADVNAKDSDGRTPLHYAAKEGHKEIVKLL  122


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 50/87 (57%), Gaps = 0/87 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H+ A  G +E +K  ++ GAD + +DS+GRT LH+A   G  +  ++L+  GA V+  D
Sbjct  74   LHYAAKEGHKEIVKLLISKGADVNAKDSDGRTPLHYAAKEGHKEIVKLLISKGADVNTSD  133

Query  553  KNKNTALHYAAGYGRKECVALLLENGA  473
             +  T L  A  +G +E V LL + G 
Sbjct  134  SDGRTPLDLAREHGNEEIVKLLEKQGG  160



>ref|XP_006394994.1| hypothetical protein EUTSA_v10005721mg [Eutrema salsugineum]
 gb|ESQ32280.1| hypothetical protein EUTSA_v10005721mg [Eutrema salsugineum]
Length=70

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 59/73 (81%), Gaps = 4/73 (5%)
 Frame = -1

Query  607  VKCAQILLESGAKVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEV  428
            +KCA++LL++GA  +A+DK+ NT LH+AA  GRK CV LLLE GAAVTL+N+D KTPI+V
Sbjct  1    MKCAKVLLDAGANANAVDKHNNTPLHFAAYRGRKNCVRLLLEKGAAVTLKNLDNKTPIDV  60

Query  427  AKLNNQNDVLKLL  389
            AKL    DV+KLL
Sbjct  61   AKL----DVVKLL  69



>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural 
Genomics Consortium Target Or264.
 pdb|4GPM|B Chain B, Crystal Structure Of Engineered Protein. Northeast Structural 
Genomics Consortium Target Or264.
Length=169

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 74/117 (63%), Gaps = 0/117 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +HH A  G +E +K  ++ GAD + +DS+GRT LH A   G  +  ++L+  GA V+A D
Sbjct  41   LHHAAENGHKEVVKLLISKGADVNAKDSDGRTPLHHAAENGHKEVVKLLISKGADVNAKD  100

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEK  383
             +  T LH+AA  G KE V LL+  GA V   + DG+TP+++A+ +   +V+KLLEK
Sbjct  101  SDGRTPLHHAAENGHKEVVKLLISKGADVNTSDSDGRTPLDLAREHGNEEVVKLLEK  157


 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 67/112 (60%), Gaps = 0/112 (0%)
 Frame = -1

Query  724  CASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNK  545
             A  G+++ +K+ +  GAD +  DS+GRT LH A   G  +  ++L+  GA V+A D + 
Sbjct  11   AAENGNKDRVKDLIENGADVNASDSDGRTPLHHAAENGHKEVVKLLISKGADVNAKDSDG  70

Query  544  NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
             T LH+AA  G KE V LL+  GA V  ++ DG+TP+  A  N   +V+KLL
Sbjct  71   RTPLHHAAENGHKEVVKLLISKGADVNAKDSDGRTPLHHAAENGHKEVVKLL  122


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 49/87 (56%), Gaps = 0/87 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +HH A  G +E +K  ++ GAD + +DS+GRT LH A   G  +  ++L+  GA V+  D
Sbjct  74   LHHAAENGHKEVVKLLISKGADVNAKDSDGRTPLHHAAENGHKEVVKLLISKGADVNTSD  133

Query  553  KNKNTALHYAAGYGRKECVALLLENGA  473
             +  T L  A  +G +E V LL + G 
Sbjct  134  SDGRTPLDLAREHGNEEVVKLLEKQGG  160



>gb|AGW45418.1| hypothetical protein, partial [Silene otites]
Length=47

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 43/47 (91%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = -1

Query  607  VKCAQILLESGAKVDALDKNKNTALHYAAGYGRKECVALLLENGAAV  467
            VKCAQ+LLE+GAKVD+LDKNKNTALHYAAGYGRKECVALLLE+GAAV
Sbjct  1    VKCAQVLLENGAKVDSLDKNKNTALHYAAGYGRKECVALLLESGAAV  47



>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural 
Genomics Consortium Target Or267.
 pdb|4HB5|B Chain B, Crystal Structure Of Engineered Protein. Northeast Structural 
Genomics Consortium Target Or267.
Length=169

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 73/117 (62%), Gaps = 0/117 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H+ A  G +E +K  L+ GAD + +DS+GRT LH+A   G  +  ++LL  GA  +A D
Sbjct  41   LHYAAENGHKEIVKLLLSKGADPNAKDSDGRTPLHYAAENGHKEIVKLLLSKGADPNAKD  100

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEK  383
             +  T LHYAA  G KE V LLL  GA     + DG+TP+++A+ +   +++KLLEK
Sbjct  101  SDGRTPLHYAAENGHKEIVKLLLSKGADPNTSDSDGRTPLDLAREHGNEEIVKLLEK  157


 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 66/112 (59%), Gaps = 0/112 (0%)
 Frame = -1

Query  724  CASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNK  545
             A  G+++ +K+ L  GAD +  DS+GRT LH+A   G  +  ++LL  GA  +A D + 
Sbjct  11   AAENGNKDRVKDLLENGADPNASDSDGRTPLHYAAENGHKEIVKLLLSKGADPNAKDSDG  70

Query  544  NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
             T LHYAA  G KE V LLL  GA    ++ DG+TP+  A  N   +++KLL
Sbjct  71   RTPLHYAAENGHKEIVKLLLSKGADPNAKDSDGRTPLHYAAENGHKEIVKLL  122


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 49/87 (56%), Gaps = 0/87 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H+ A  G +E +K  L+ GAD + +DS+GRT LH+A   G  +  ++LL  GA  +  D
Sbjct  74   LHYAAENGHKEIVKLLLSKGADPNAKDSDGRTPLHYAAENGHKEIVKLLLSKGADPNTSD  133

Query  553  KNKNTALHYAAGYGRKECVALLLENGA  473
             +  T L  A  +G +E V LL + G 
Sbjct  134  SDGRTPLDLAREHGNEEIVKLLEKQGG  160



>gb|KFM24339.1| Ankyrin repeat domain-containing protein 2 [Auxenochlorella protothecoides]
Length=251

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 120/241 (50%), Gaps = 25/241 (10%)
 Frame = -1

Query  1081  MQQVMQNPQFMT-MAERLGNALMQDPSMSSMLESLSNPAQKDQLEERMARIKEDPSLKPI  905
             M Q MQNPQF+  MAE      +  P +  +L + +N           A ++EDP LKP+
Sbjct  24    MMQTMQNPQFIARMAELKSGRNLHIPFL--VLIAGTN----------TATLQEDPDLKPL  71

Query  904   LEEIEQGGPAAMMRYWNDKDVLKKLGEAMGFPgagetatsgetgtdeaeeasedeSIVHH  725
              EEI++ G + +M+Y ND  +L K+G+ +G              T    E +   +I+  
Sbjct  72    FEEIKKEGMSGLMKYMNDPVLLSKVGQKLG-DLGAGGPAPVAGATAPPAEEAPIRNILDA  130

Query  724   CASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDAL---D  554
             C + GD E +++  A G  +  +D EGR ALH+A  +G  +   +LLE       L   D
Sbjct  131   CKA-GDLEAVEDYAAVGKGR-LQDEEGRCALHYAAAFGRPEVVGLLLEGPDAAFLLACPD  188

Query  553   KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAK------LNNQNDVLKL  392
                 T +HYAAGYG  + +A LLE G     +  DG++ +++ +      +N + D+++ 
Sbjct  189   GQGMTPIHYAAGYGHPDILAALLEAGGDAGARTGDGRSALDIVRQAPANPVNRREDLVRR  248

Query  391   L  389
             L
Sbjct  249   L  249



>ref|XP_001328182.1| hypothetical protein [Trichomonas vaginalis G3]
 gb|EAY15959.1| conserved hypothetical protein [Trichomonas vaginalis G3]
Length=881

 Score = 96.3 bits (238),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 74/116 (64%), Gaps = 0/116 (0%)
 Frame = -1

Query  736  IVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDAL  557
            I+HH A     + L+  +  G + + +D  G+TALH A  Y  ++ AQIL+E+GA V++ 
Sbjct  269  ILHHAAWKNSIDFLETLILKGVNVNLKDQNGQTALHQAVYYNNLEVAQILVENGAVVNSQ  328

Query  556  DKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
             +NK T LHYAA Y RKE   LL+ +GA +  ++  GKTP++ A L N +DVLK+L
Sbjct  329  YENKWTPLHYAAYYNRKEIAELLISSGAEILAKSNSGKTPLQYATLRNNSDVLKVL  384


 Score = 65.1 bits (157),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 56/93 (60%), Gaps = 1/93 (1%)
 Frame = -1

Query  685  LAAGADKDEEDSE-GRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGR  509
            L+ G + +E+D E G+T LH A      +  +ILL+ GA ++A D ++ T LHYAA   +
Sbjct  705  LSKGFNVNEKDHESGKTPLHIAAENNSSEVIEILLDIGANINAKDNSERTPLHYAAQNNK  764

Query  508  KECVALLLENGAAVTLQNMDGKTPIEVAKLNNQ  410
            K  V +L+ +GA +  ++ +G +P+  A +N Q
Sbjct  765  KAAVEILISHGANINAKDKNGYSPLHYAAINRQ  797


 Score = 57.0 bits (136),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/104 (30%), Positives = 58/104 (56%), Gaps = 1/104 (1%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVK-CAQILLESGAKVDAL  557
            +H+ A    +  ++  ++ GA+ + +D  G + LH+A    + K   + L+ +GA++++ 
Sbjct  756  LHYAAQNNKKAAVEILISHGANINAKDKNGYSPLHYAAINRQGKEMVEFLISNGARINSK  815

Query  556  DKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVA  425
            DK+  T LH+A    RK    LL+ENG+ +   + DG TP+  A
Sbjct  816  DKDGYTPLHHAVMNNRKLTAELLIENGSYLNSHDKDGNTPMASA  859


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 64/118 (54%), Gaps = 3/118 (3%)
 Frame = -1

Query  736  IVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFAC--GYGEVKCAQILLESGAKVD  563
            I+HH     +   L++ +  GAD + +D+ G TALH A    Y + +  ++L+  GA V+
Sbjct  169  ILHHAILDKNLVILEDLIINGADLNVKDNNGFTALHHAALNRYSK-ETLELLISHGASVN  227

Query  562  ALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
            A+D N+ + LH AA     E + ++L +GA +  ++  G+T +  A   N  D L+ L
Sbjct  228  AIDNNEQSPLHIAAWNNDIEFLEVMLSHGAFINAKDNSGETILHHAAWKNSIDFLETL  285


 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 50/105 (48%), Gaps = 0/105 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H+       + L      GAD + +D EG+TA H+A     ++  + L+   A ++A D
Sbjct  71   LHYAVENNSNDALDILAGYGADINSKDFEGKTAFHYAVENNNLELIETLINYWADINAQD  130

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKL  419
            K   T LHY+     K     L+ NGA +  ++ DG T +  A L
Sbjct  131  KEGKTPLHYSEKNNLKTITDFLIMNGADINSKDDDGLTILHHAIL  175


 Score = 53.1 bits (126),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 53/116 (46%), Gaps = 1/116 (1%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSE-GRTALHFACGYGEVKCAQILLESGAKVDAL  557
            +H  A    +   K  +  GAD +  D+E GRT LH+A          IL   GA +++ 
Sbjct  37   LHIAAWNNSKSTCKILITHGADLNIRDNEYGRTPLHYAVENNSNDALDILAGYGADINSK  96

Query  556  DKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
            D    TA HYA      E +  L+   A +  Q+ +GKTP+  ++ NN   +   L
Sbjct  97   DFEGKTAFHYAVENNNLELIETLINYWADINAQDKEGKTPLHYSEKNNLKTITDFL  152


 Score = 53.1 bits (126),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 59/104 (57%), Gaps = 2/104 (2%)
 Frame = -1

Query  676  GADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAA-GYGRKEC  500
            GAD + +D +G T LH A     +   + L+ +GA ++  D N  TALH+AA     KE 
Sbjct  156  GADINSKDDDGLTILHHAILDKNLVILEDLIINGADLNVKDNNGFTALHHAALNRYSKET  215

Query  499  VALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLK-LLEKDAFL  371
            + LL+ +GA+V   + + ++P+ +A  NN  + L+ +L   AF+
Sbjct  216  LELLISHGASVNAIDNNEQSPLHIAAWNNDIEFLEVMLSHGAFI  259



>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical 
Consensus Repeats
Length=126

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 52/115 (45%), Positives = 70/115 (61%), Gaps = 0/115 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H  A  G  E +K  L AGAD + +D  GRT LH A   G ++  ++LLE+GA V+A D
Sbjct  6    LHLAARNGHLEVVKLLLEAGADVNAKDKNGRTPLHLAARNGHLEVVKLLLEAGADVNAKD  65

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
            KN  T LH AA  G  E V LLLE GA V  ++ +G+TP+ +A  N   +V+KLL
Sbjct  66   KNGRTPLHLAARNGHLEVVKLLLEAGADVNAKDKNGRTPLHLAARNGHLEVVKLL  120


 Score = 74.3 bits (181),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 41/86 (48%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = -1

Query  646  GRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRKECVALLLENGAAV  467
            GRT LH A   G ++  ++LLE+GA V+A DKN  T LH AA  G  E V LLLE GA V
Sbjct  2    GRTPLHLAARNGHLEVVKLLLEAGADVNAKDKNGRTPLHLAARNGHLEVVKLLLEAGADV  61

Query  466  TLQNMDGKTPIEVAKLNNQNDVLKLL  389
              ++ +G+TP+ +A  N   +V+KLL
Sbjct  62   NAKDKNGRTPLHLAARNGHLEVVKLL  87


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 42/87 (48%), Positives = 52/87 (60%), Gaps = 0/87 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H  A  G  E +K  L AGAD + +D  GRT LH A   G ++  ++LLE+GA V+A D
Sbjct  39   LHLAARNGHLEVVKLLLEAGADVNAKDKNGRTPLHLAARNGHLEVVKLLLEAGADVNAKD  98

Query  553  KNKNTALHYAAGYGRKECVALLLENGA  473
            KN  T LH AA  G  E V LLLE GA
Sbjct  99   KNGRTPLHLAARNGHLEVVKLLLEAGA  125



>ref|XP_006487159.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Citrus 
sinensis]
Length=93

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  700  GLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNK  545
            G+K  LAA A+KDEED EGRT LHFACGYGEV+CAQ+LLE+GA VDA+DKNK
Sbjct  35   GMKYKLAASANKDEEDLEGRTTLHFACGYGEVECAQLLLEAGANVDAVDKNK  86



>ref|XP_001421038.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO99331.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=109

 Score = 84.3 bits (207),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 46/109 (42%), Positives = 63/109 (58%), Gaps = 4/109 (4%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQ----ILLESGAKV  566
            +H  A  GD E +++ +A G D +  DS  RT +H+A  +G+    +    +LLE+GA +
Sbjct  1    LHDAARYGDVEAVEDFIAVGKDINARDSSSRTPIHYAIAFGKGDAGEEIFNLLLEAGADL  60

Query  565  DALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKL  419
             A D+ KNT LHYA GYG+   V  LLE G   T  N  GK PIE+ KL
Sbjct  61   TATDEKKNTPLHYACGYGKPFAVKALLEKGCDKTATNGTGKKPIELVKL  109



>ref|XP_004347155.1| bromodomain domain containing protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR21773.1| bromodomain domain containing protein [Acanthamoeba castellanii 
str. Neff]
Length=904

 Score = 89.0 bits (219),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 63/116 (54%), Gaps = 1/116 (1%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADK-DEEDSEGRTALHFACGYGEVKCAQILLESGAKVDAL  557
            +H  A  G EE L+  +       +EED  G T LH AC  G   C ++LL +GA+VD  
Sbjct  3    IHEAAEDGREEELQKLIQRNIQAVNEEDEYGETPLHLACMAGHPNCVKLLLHNGAQVDCQ  62

Query  556  DKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
            + N  T LHYAA YGR+ CV LLL NGA V  ++    TP+  A +N Q     LL
Sbjct  63   NSNGTTPLHYAARYGRQACVTLLLRNGANVARKDNAHWTPLHYAAINAQTKCAALL  118


 Score = 74.3 bits (181),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 79/146 (54%), Gaps = 9/146 (6%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H+ A  G +  +   L  GA+   +D+   T LH+A    + KCA +L+E GA  +AL 
Sbjct  70   LHYAARYGRQACVTLLLRNGANVARKDNAHWTPLHYAAINAQTKCAALLIEKGADANALT  129

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEV------AKLNNQNDVLKL  392
             + N+ LH AA  G  +CV LL+++GA +  +N +G TP+ +      A ++ + + L+ 
Sbjct  130  SDHNSPLHLAASAGVLDCVLLLVKHGAKLNAKNKEGNTPLSLLTIKAKAAVDKEKNSLQR  189

Query  391  LEKDAFL*AGMHL*ITYARVCWVSEG  314
            L +D     G+    TYA V ++ EG
Sbjct  190  LSEDL---RGLVNDKTYADVAFIIEG  212


 Score = 67.0 bits (162),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 56/117 (48%), Gaps = 0/117 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H     G    +K  L  GA  D ++S G T LH+A  YG   C  +LL +GA V   D
Sbjct  37   LHLACMAGHPNCVKLLLHNGAQVDCQNSNGTTPLHYAARYGRQACVTLLLRNGANVARKD  96

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEK  383
                T LHYAA   + +C ALL+E GA       D  +P+ +A      D + LL K
Sbjct  97   NAHWTPLHYAAINAQTKCAALLIEKGADANALTSDHNSPLHLAASAGVLDCVLLLVK  153



>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural 
Genomics Consortium Target Or266.
 pdb|4GMR|B Chain B, Crystal Structure Of Engineered Protein. Northeast Structural 
Genomics Consortium Target Or266.
Length=169

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 70/117 (60%), Gaps = 0/117 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H  A  G +E +K  L+ GAD + +DS+G+T LH A   G  +  ++LL  GA  +A D
Sbjct  41   LHLAAENGHKEVVKLLLSQGADPNAKDSDGKTPLHLAAENGHKEVVKLLLSQGADPNAKD  100

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEK  383
             +  T LH AA  G KE V LLL  GA     + DG+TP+++A+ +   +V+KLLEK
Sbjct  101  SDGKTPLHLAAENGHKEVVKLLLSQGADPNTSDSDGRTPLDLAREHGNEEVVKLLEK  157


 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 65/112 (58%), Gaps = 0/112 (0%)
 Frame = -1

Query  724  CASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNK  545
             A  G+++ +K+ L  GAD +  DS+G+T LH A   G  +  ++LL  GA  +A D + 
Sbjct  11   AAENGNKDRVKDLLENGADVNASDSDGKTPLHLAAENGHKEVVKLLLSQGADPNAKDSDG  70

Query  544  NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
             T LH AA  G KE V LLL  GA    ++ DGKTP+ +A  N   +V+KLL
Sbjct  71   KTPLHLAAENGHKEVVKLLLSQGADPNAKDSDGKTPLHLAAENGHKEVVKLL  122


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 47/87 (54%), Gaps = 0/87 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H  A  G +E +K  L+ GAD + +DS+G+T LH A   G  +  ++LL  GA  +  D
Sbjct  74   LHLAAENGHKEVVKLLLSQGADPNAKDSDGKTPLHLAAENGHKEVVKLLLSQGADPNTSD  133

Query  553  KNKNTALHYAAGYGRKECVALLLENGA  473
             +  T L  A  +G +E V LL + G 
Sbjct  134  SDGRTPLDLAREHGNEEVVKLLEKQGG  160



>ref|XP_005484011.1| PREDICTED: ankyrin repeat domain-containing protein 6 isoform 
X2 [Zonotrichia albicollis]
Length=727

 Score = 87.4 bits (215),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 72/117 (62%), Gaps = 0/117 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H  A VG+ + +   +  G   D +D +G TALH AC +G  + A++L+++GA V A +
Sbjct  79   LHRAAVVGNTDIIATLIQEGCALDRQDKDGNTALHEACWHGFSQSAKVLVKAGANVLAKN  138

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEK  383
            K  +TALH AA    K+ V LLLE GA  ++ N  G+TP+EVA+ +N  +V  LL K
Sbjct  139  KAGDTALHVAAALNHKKVVKLLLEAGADASVVNNAGQTPLEVARQHNNPEVALLLTK  195


 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 58/115 (50%), Gaps = 0/115 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H  A  G    ++  L AG D D +D   +TALH A   G       L++ G  +D  D
Sbjct  46   LHLAAYKGHLHVVQVLLKAGCDLDIQDDGDQTALHRAAVVGNTDIIATLIQEGCALDRQD  105

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
            K+ NTALH A  +G  +   +L++ GA V  +N  G T + VA   N   V+KLL
Sbjct  106  KDGNTALHEACWHGFSQSAKVLVKAGANVLAKNKAGDTALHVAAALNHKKVVKLL  160


 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 47/88 (53%), Gaps = 0/88 (0%)
 Frame = -1

Query  646  GRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRKECVALLLENGAAV  467
            GRT LH A   G +   Q+LL++G  +D  D    TALH AA  G  + +A L++ G A+
Sbjct  42   GRTPLHLAAYKGHLHVVQVLLKAGCDLDIQDDGDQTALHRAAVVGNTDIIATLIQEGCAL  101

Query  466  TLQNMDGKTPIEVAKLNNQNDVLKLLEK  383
              Q+ DG T +  A  +  +   K+L K
Sbjct  102  DRQDKDGNTALHEACWHGFSQSAKVLVK  129



>gb|KEH36341.1| TGB12K interacting protein [Medicago truncatula]
Length=108

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 47/99 (47%), Positives = 60/99 (61%), Gaps = 3/99 (3%)
 Frame = -1

Query  1003  MSSMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIEQGGPAAMMRYWNDKDVLKKLGE  824
             MSSMLE  +NP+ + + ++  A   +DP LK IL+E E GGPA MMRYWND+ VLK  G 
Sbjct  1     MSSMLEIYANPSLRRKRKQETAHFNQDPCLKLILDETENGGPAVMMRYWNDEKVLKMFGL  60

Query  823   AMGFPgagetatsgetgtdeaeeasedeSIVHHCASVGD  707
              MG P     A+      +     +EDESIVHH A +GD
Sbjct  61    VMGIP---LVASENSRLCETENMGNEDESIVHHTAIIGD  96



>ref|XP_001469053.1| putative ankyrin repeat protein [Leishmania infantum JPCM5]
 ref|XP_003864850.1| ankyrin repeat protein, putative [Leishmania donovani]
 emb|CAM72150.1| putative ankyrin repeat protein [Leishmania infantum JPCM5]
 emb|CBZ38170.1| ankyrin repeat protein, putative [Leishmania donovani]
Length=173

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 68/121 (56%), Gaps = 4/121 (3%)
 Frame = -1

Query  736  IVHHCASVGDEEGLKNAL----AAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAK  569
            ++HH A  G+   +K  L    A   + D  D+EG T LH+A   G  +  + LL+ GA 
Sbjct  53   LLHHAAFSGNSAFVKAILDRSDAQQVNIDAADNEGWTPLHYAADRGHARVVEALLDEGAN  112

Query  568  VDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
            V+A D  K T +H AA  GR E VA+LL NGA+ T +N+ G  P++ AK  NQ  V+  L
Sbjct  113  VNARDAAKRTPMHLAALSGRAEVVAVLLRNGASKTARNVAGMIPMDCAKQTNQAAVIAQL  172

Query  388  E  386
            E
Sbjct  173  E  173



>pdb|4HRM|B Chain B, Structural Basis For Eliciting A Cytotoxic Effect In 
Her2- Overexpressing Cancer Cells Via Binding To The Extracellular 
Domain Of Her2
 pdb|4HRM|D Chain D, Structural Basis For Eliciting A Cytotoxic Effect In 
Her2- Overexpressing Cancer Cells Via Binding To The Extracellular 
Domain Of Her2
Length=172

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 70/121 (58%), Gaps = 0/121 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H  A+ G  E ++  L  GAD +  D  G T LH A  YG ++  ++LL+ GA V+A+D
Sbjct  51   LHLAAAYGHLEIVEVLLKHGADVNAHDWNGWTPLHLAAKYGHLEIVEVLLKHGADVNAID  110

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDAF  374
                T LH AA +G  E V +LL+ GA V  Q+  GKTP ++A  N   D+ ++L+K A 
Sbjct  111  NAGKTPLHLAAAHGHLEIVEVLLKYGADVNAQDKFGKTPFDLAIDNGNEDIAEVLQKAAK  170

Query  373  L  371
            L
Sbjct  171  L  171


 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 68/114 (60%), Gaps = 0/114 (0%)
 Frame = -1

Query  724  CASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNK  545
             A  G ++ ++  +A GAD + +D  G T LH A  YG ++  ++LL+ GA V+A D N 
Sbjct  21   AARAGQDDEVRILMANGADVNAKDFYGITPLHLAAAYGHLEIVEVLLKHGADVNAHDWNG  80

Query  544  NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEK  383
             T LH AA YG  E V +LL++GA V   +  GKTP+ +A  +   +++++L K
Sbjct  81   WTPLHLAAKYGHLEIVEVLLKHGADVNAIDNAGKTPLHLAAAHGHLEIVEVLLK  134



>emb|CCX10138.1| Similar to Ankyrin repeat domain-containing protein 50; acc. 
no. Q9ULJ7 [Pyronema omphalodes CBS 100304]
Length=164

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 69/117 (59%), Gaps = 2/117 (2%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFAC-GYGEVKCAQILLESGAKVDAL  557
            + H A  G  + ++  L  GA+ D +D  GRT L FA   YG  +  ++LLE GA+VD+ 
Sbjct  32   LFHAARKGHLKTVELLLERGAEVDSKDKNGRTPLSFAAKAYGSFETVKLLLERGAEVDSK  91

Query  556  DKNKNTALHYAAG-YGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
            +KN  T L +AA  YG  E V LLLE GA +  ++ DG+TP+  A LN+   ++ L+
Sbjct  92   NKNGRTPLSFAANEYGSLETVQLLLERGAEIDWKDKDGRTPLSYATLNDNTKIVALI  148


 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 50/81 (62%), Gaps = 1/81 (1%)
 Frame = -1

Query  664  DEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAA-GYGRKECVALL  488
            D  D +G TAL  A   G +K  ++LLE GA+VD+ DKN  T L +AA  YG  E V LL
Sbjct  22   DCRDCDGLTALFHAARKGHLKTVELLLERGAEVDSKDKNGRTPLSFAAKAYGSFETVKLL  81

Query  487  LENGAAVTLQNMDGKTPIEVA  425
            LE GA V  +N +G+TP+  A
Sbjct  82   LERGAEVDSKNKNGRTPLSFA  102


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 48/83 (58%), Gaps = 1/83 (1%)
 Frame = -1

Query  718  SVGDEEGLKNALAAGADKDEEDSEGRTALHFACG-YGEVKCAQILLESGAKVDALDKNKN  542
            + G  E +K  L  GA+ D ++  GRT L FA   YG ++  Q+LLE GA++D  DK+  
Sbjct  71   AYGSFETVKLLLERGAEVDSKNKNGRTPLSFAANEYGSLETVQLLLERGAEIDWKDKDGR  130

Query  541  TALHYAAGYGRKECVALLLENGA  473
            T L YA      + VAL+LE GA
Sbjct  131  TPLSYATLNDNTKIVALILERGA  153



>pdb|4HLL|A Chain A, Crystal Structure Of Artificial Ankyrin Repeat Protein_ank(gag)1d4
Length=173

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 65/114 (57%), Gaps = 0/114 (0%)
 Frame = -1

Query  724  CASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNK  545
             A  G ++ ++  L  GAD +  DS G T LH A  YG ++  ++LLE GA V+A D   
Sbjct  24   AARAGQDDEVRLLLEHGADVNARDSIGSTPLHLAAYYGHLEIVRLLLEHGADVNARDSTG  83

Query  544  NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEK  383
             T LHYAA  G  E V LLLE+GA V  ++  G TP+ +A      ++++LL K
Sbjct  84   TTPLHYAARLGHLEIVRLLLEHGADVNARDAMGWTPLHLAAKKGHLEIVRLLLK  137


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 64/116 (55%), Gaps = 0/116 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H  A  G  E ++  L  GAD +  DS G T LH+A   G ++  ++LLE GA V+A D
Sbjct  54   LHLAAYYGHLEIVRLLLEHGADVNARDSTGTTPLHYAARLGHLEIVRLLLEHGADVNARD  113

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLE  386
                T LH AA  G  E V LLL++GA V   +  GKT  +++  N   D+ ++L+
Sbjct  114  AMGWTPLHLAAKKGHLEIVRLLLKHGADVNANDHFGKTAFDISIDNGNEDLAEILQ  169



>gb|KFA63315.1| hypothetical protein S40285_01859 [Stachybotrys chlorohalonata 
IBT 40285]
Length=859

 Score = 85.9 bits (211),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 57/96 (59%), Gaps = 0/96 (0%)
 Frame = -1

Query  673  ADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRKECVA  494
            A+   E + GR  LH A   G+V   +  L  G  ++ LD   N ALHYAAG G+ +CV 
Sbjct  118  ANSSVEGTHGRIYLHIAAARGQVNTVETWLRCGVDINMLDDEGNNALHYAAGNGKPDCVP  177

Query  493  LLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLE  386
            +LL NG    ++N +G TPIE+AK +  N+++ +LE
Sbjct  178  ILLRNGCRSDVKNHNGATPIELAKADGHNEIVDMLE  213



>ref|XP_001315403.1| ankyrin repeat protein [Trichomonas vaginalis G3]
 gb|EAY03180.1| ankyrin repeat protein, putative [Trichomonas vaginalis G3]
Length=735

 Score = 85.5 bits (210),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 70/115 (61%), Gaps = 0/115 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H+ A  G  E  +  ++ GA  +E+D  GRTALH A  Y   +  ++L+  GA ++  D
Sbjct  580  LHYAAQYGTTETCEILISHGAKINEKDKNGRTALHIAAEYNNKEIVELLVSHGANINEKD  639

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
            K KN+ALHYAA YG  E   +L+ +GA +  ++ +G+T +  A L+N  ++++LL
Sbjct  640  KFKNSALHYAAQYGTTEICEILISHGANINEKDKNGRTALHNAALHNSKEIVELL  694


 Score = 70.1 bits (170),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 69/131 (53%), Gaps = 10/131 (8%)
 Frame = -1

Query  685  LAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRK  506
            L+ GA  +++D+ G TALH       V   ++LL  GAK++  +    TALHYAA YG  
Sbjct  530  LSHGAKVNQKDNHGSTALHAIVRRNNVAEVKVLLSHGAKINEQNDEGKTALHYAAQYGTT  589

Query  505  ECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL--------EKDAFL*AGMHL*  350
            E   +L+ +GA +  ++ +G+T + +A   N  ++++LL        EKD F  + +H  
Sbjct  590  ETCEILISHGAKINEKDKNGRTALHIAAEYNNKEIVELLVSHGANINEKDKFKNSALHYA  649

Query  349  ITY--ARVCWV  323
              Y    +C +
Sbjct  650  AQYGTTEICEI  660


 Score = 66.6 bits (161),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 62/115 (54%), Gaps = 0/115 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H+ A    +E  +  ++ G + +E+D  G+ ALH A      + A+ LL  GAK++  D
Sbjct  349  LHYAAENNSKETAELLVSHGTNINEKDKSGKIALHEAAINNNKEIAEFLLSHGAKINETD  408

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
             +K TALHYAA     E   LL+   A +  ++ + KTP+  A  NN  ++ KLL
Sbjct  409  DSKKTALHYAAENNNNETAELLVSRKAKINEKDKNAKTPLHYASYNNNIEMAKLL  463


 Score = 65.5 bits (158),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H  A   ++E ++  ++ GA+ +E+D    +ALH+A  YG  +  +IL+  GA ++  D
Sbjct  613  LHIAAEYNNKEIVELLVSHGANINEKDKFKNSALHYAAQYGTTEICEILISHGANINEKD  672

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEV  428
            KN  TALH AA +  KE V LL+  GA +  +++ G T + +
Sbjct  673  KNGRTALHNAALHNSKEIVELLVSLGANINEKDIYGNTALSI  714


 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 53/99 (54%), Gaps = 0/99 (0%)
 Frame = -1

Query  685  LAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRK  506
            L  GA+ + +D  G+TALH+      ++ A++LL    K++  D    TALHYAA    K
Sbjct  299  LNHGANINGKDLFGKTALHYTAVNNSIETAKLLLSRDIKINEKDNYGKTALHYAAENNSK  358

Query  505  ECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
            E   LL+ +G  +  ++  GK  +  A +NN  ++ + L
Sbjct  359  ETAELLVSHGTNINEKDKSGKIALHEAAINNNKEIAEFL  397


 Score = 56.6 bits (135),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 58/115 (50%), Gaps = 0/115 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H+ A     E  K  L+     +E+D+ G+TALH+A      + A++L+  G  ++  D
Sbjct  316  LHYTAVNNSIETAKLLLSRDIKINEKDNYGKTALHYAAENNSKETAELLVSHGTNINEKD  375

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
            K+   ALH AA    KE    LL +GA +   +   KT +  A  NN N+  +LL
Sbjct  376  KSGKIALHEAAINNNKEIAEFLLSHGAKINETDDSKKTALHYAAENNNNETAELL  430


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H  A   ++E  +  L+ GA  +E D   +TALH+A      + A++L+   AK++  D
Sbjct  382  LHEAAINNNKEIAEFLLSHGAKINETDDSKKTALHYAAENNNNETAELLVSRKAKINEKD  441

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVA  425
            KN  T LHYA+     E   LLL +GA    ++  G+ P+  A
Sbjct  442  KNAKTPLHYASYNNNIEMAKLLLSHGAKTNEKDKSGQIPLHNA  484


 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/115 (30%), Positives = 61/115 (53%), Gaps = 0/115 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H+ A   + E  +  ++  A  +E+D   +T LH+A     ++ A++LL  GAK +  D
Sbjct  415  LHYAAENNNNETAELLVSRKAKINEKDKNAKTPLHYASYNNNIEMAKLLLSHGAKTNEKD  474

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
            K+    LH AA +  KE + LLL + A V  ++  G +P++ A    + +  +LL
Sbjct  475  KSGQIPLHNAANFYYKEMIELLLSHKAKVNQKDELGFSPLQYAVYGTKTETTELL  529



>emb|CDJ91582.1| Pleckstrin homology and Arf GTPase activating protein and Ankyrin 
domain containing protein [Haemonchus contortus]
Length=776

 Score = 85.5 bits (210),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 64/117 (55%), Gaps = 1/117 (1%)
 Frame = -1

Query  736  IVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDAL  557
            IV  CA  GD  GL  +LA GAD +   S G TALH A   G+    + LL +GAK++ L
Sbjct  622  IVSECARCGDVLGLLRSLAGGADINSARS-GTTALHIATKNGQTAAVEFLLLNGAKINVL  680

Query  556  DKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLE  386
            D   NT LH AA  G    V  LL+ GA  +L+N DG TP+E+A      D++ L  
Sbjct  681  DDKLNTPLHLAAAKGNTLQVCQLLKRGADKSLKNADGVTPLEIAVEGKHADIVTLFR  737



>ref|XP_002738132.1| PREDICTED: ankyrin repeat and EF-hand domain-containing protein 
1-like, partial [Saccoglossus kowalevskii]
Length=516

 Score = 84.7 bits (208),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 69/115 (60%), Gaps = 0/115 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +++ A +GD E LK A   G + D  D   +T L  AC YG  +  Q L+E+GA V+A D
Sbjct  226  INNAAKMGDVESLKRAFWEGRNVDTRDKYFKTPLMVACHYGNFEMVQFLVENGADVNAKD  285

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
              K TALH+A   G+ + V +L+E GA + ++ M+G TP+  A  +++ DV++ L
Sbjct  286  NFKWTALHHACHAGQMDIVEMLVERGAEIEVKAMNGGTPLMRAVQSSRPDVVQYL  340


 Score = 54.7 bits (130),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 58/109 (53%), Gaps = 0/109 (0%)
 Frame = -1

Query  712  GDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTAL  533
            G+ E ++  +  GAD + +D+   TALH AC  G++   ++L+E GA+++    N  T L
Sbjct  266  GNFEMVQFLVENGADVNAKDNFKWTALHHACHAGQMDIVEMLVERGAEIEVKAMNGGTPL  325

Query  532  HYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLE  386
              A    R + V  L++ GA V  +N  G   +++A       VL++++
Sbjct  326  MRAVQSSRPDVVQYLIDKGAKVQQENRKGDNVMDIAMWWADPRVLEIVK  374



>ref|XP_008620665.1| hypothetical protein SDRG_16243 [Saprolegnia diclina VS20]
 gb|EQC25910.1| hypothetical protein SDRG_16243 [Saprolegnia diclina VS20]
Length=321

 Score = 82.8 bits (203),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 64/112 (57%), Gaps = 0/112 (0%)
 Frame = -1

Query  724  CASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNK  545
             A  GD EG++  LA G D +   ++G TALH+A   G  +   +LL  GA+VD  +   
Sbjct  7    AAKRGDLEGVRALLAEGVDPNRRFNDGYTALHWAAYEGHDRVIDLLLRRGARVDITNDFG  66

Query  544  NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
            NT LH+AA  GR +   LLL+ GA +  QN DG TP+  A   ++  V++LL
Sbjct  67   NTPLHWAAWGGRVQAAILLLDTGANIGRQNNDGDTPLHFAAREDRAAVVRLL  118


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 58/117 (50%), Gaps = 0/117 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H  A  G +  +   L  GA  D  +  G T LH+A   G V+ A +LL++GA +   +
Sbjct  37   LHWAAYEGHDRVIDLLLRRGARVDITNDFGNTPLHWAAWGGRVQAAILLLDTGANIGRQN  96

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEK  383
             + +T LH+AA   R   V LLL   A V L+N  G     +A       +L+LL++
Sbjct  97   NDGDTPLHFAAREDRAAVVRLLLNREADVNLRNHAGHAAYALAFERGHASILRLLDQ  153


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 45/83 (54%), Gaps = 0/83 (0%)
 Frame = -1

Query  637  ALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQ  458
            AL+ A   G+      LL SG   D   ++ NT LH+AA  G +  V LLLE+GA V  +
Sbjct  160  ALYDAAKKGQTDRVGALLGSGVHPDVRMEDNNTPLHWAAWEGHEAVVRLLLEHGATVDSE  219

Query  457  NMDGKTPIEVAKLNNQNDVLKLL  389
            N  G TP++ A    Q+  ++LL
Sbjct  220  NRYGNTPLQWASWGGQDRAVQLL  242



>ref|XP_002486819.1| ankyrin repeat-containing protein, putative [Talaromyces stipitatus 
ATCC 10500]
 gb|EED12708.1| ankyrin repeat-containing protein, putative [Talaromyces stipitatus 
ATCC 10500]
Length=1071

 Score = 85.1 bits (209),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 71/118 (60%), Gaps = 0/118 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H  +S G  + ++  L  GA+ D +   GR+ALHFA         ++LL +GAK+D  D
Sbjct  89   LHLASSEGRTDVVELLLENGANIDLQSQSGRSALHFASFERRADVVEVLLRNGAKIDVTD  148

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKD  380
            ++  +ALH A+  GR + V LLLENGA + L N  G++P+ +A    + DV+++L ++
Sbjct  149  EDGESALHIASSEGRTDVVELLLENGANIDLANKQGRSPLHLASFEGRADVVEVLLRN  206


 Score = 80.1 bits (196),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 68/111 (61%), Gaps = 1/111 (1%)
 Frame = -1

Query  712  GDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTAL  533
            GDE  +++  + GA  D  D++G T LH A   G     ++LLE+GA++D LD+   +AL
Sbjct  31   GDEVTVRST-SRGATSDTTDNDGFTPLHRASYRGHRDVVKLLLENGAEIDLLDEGGQSAL  89

Query  532  HYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKD  380
            H A+  GR + V LLLENGA + LQ+  G++ +  A    + DV+++L ++
Sbjct  90   HLASSEGRTDVVELLLENGANIDLQSQSGRSALHFASFERRADVVEVLLRN  140


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 65/115 (57%), Gaps = 0/115 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H  +SVG +  ++  L   A  D  D EG+TALH +   G     ++LL +GA +D L+
Sbjct  386  LHMASSVGRKGMVELLLRNRAKIDLPDKEGQTALHLSSSEGRTDIVELLLRNGAIIDLLN  445

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
                +ALH A+  GRKE V LLL+NGA + L N    T + +A    + DV+KLL
Sbjct  446  SEGQSALHLASSEGRKEIVQLLLQNGANIDLANKKRWTALHLAIFKGRTDVIKLL  500


 Score = 76.3 bits (186),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 64/114 (56%), Gaps = 1/114 (1%)
 Frame = -1

Query  727  HCASVGDEEGLKNALA-AGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDK  551
            H AS G  E +   L  +GA  D  D EG +ALH A   G     ++LL + AK+D  DK
Sbjct  354  HLASTGGREEVAELLIQSGAKLDLTDEEGHSALHMASSVGRKGMVELLLRNRAKIDLPDK  413

Query  550  NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
               TALH ++  GR + V LLL NGA + L N +G++ + +A    + ++++LL
Sbjct  414  EGQTALHLSSSEGRTDIVELLLRNGAIIDLLNSEGQSALHLASSEGRKEIVQLL  467


 Score = 75.9 bits (185),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 66/114 (58%), Gaps = 1/114 (1%)
 Frame = -1

Query  727  HCASV-GDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDK  551
            H AS  G  + ++  L  GA  D  D EGR+ALH A   G     ++LL++GAK+D   +
Sbjct  189  HLASFEGRADVVEVLLRNGAKTDVTDEEGRSALHIASSEGRTDVVELLLKNGAKIDLQSQ  248

Query  550  NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
            +  +ALH+A+  G  + V +LL NGA + L + DG++ + +A    +  +++LL
Sbjct  249  SSGSALHFASYRGGTDIVEVLLRNGAKIDLTDEDGQSALHIASCKRRTGIVELL  302


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 66/115 (57%), Gaps = 0/115 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H  +  G  + +K  L  GA+ D  D  G++ALH A   G     ++LLE+GA +D   
Sbjct  56   LHRASYRGHRDVVKLLLENGAEIDLLDEGGQSALHLASSEGRTDVVELLLENGANIDLQS  115

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
            ++  +ALH+A+   R + V +LL NGA + + + DG++ + +A    + DV++LL
Sbjct  116  QSGRSALHFASFERRADVVEVLLRNGAKIDVTDEDGESALHIASSEGRTDVVELL  170


 Score = 72.0 bits (175),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 64/115 (56%), Gaps = 0/115 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H  +S G  + ++  L  GA  D +     +ALHFA   G     ++LL +GAK+D  D
Sbjct  221  LHIASSEGRTDVVELLLKNGAKIDLQSQSSGSALHFASYRGGTDIVEVLLRNGAKIDLTD  280

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
            ++  +ALH A+   R   V LLL+NGA + L +  G++P+ +A      DV++LL
Sbjct  281  EDGQSALHIASCKRRTGIVELLLQNGANIDLADKQGRSPLHLASFEGWKDVVELL  335


 Score = 72.0 bits (175),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 65/118 (55%), Gaps = 0/118 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H  +S G  + ++  L  GA+ D  + +GR+ LH A   G     ++LL +GAK D  D
Sbjct  155  LHIASSEGRTDVVELLLENGANIDLANKQGRSPLHLASFEGRADVVEVLLRNGAKTDVTD  214

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKD  380
            +   +ALH A+  GR + V LLL+NGA + LQ+    + +  A      D++++L ++
Sbjct  215  EEGRSALHIASSEGRTDVVELLLKNGAKIDLQSQSSGSALHFASYRGGTDIVEVLLRN  272


 Score = 71.6 bits (174),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 69/120 (58%), Gaps = 7/120 (6%)
 Frame = -1

Query  727  HCASVGDEEGLKNA----LAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDA  560
            H AS    EG K+     L   A  + E S G TALH A   G  + A++L++SGAK+D 
Sbjct  321  HLASF---EGWKDVVELLLQRNAKVNLEHSTGWTALHLASTGGREEVAELLIQSGAKLDL  377

Query  559  LDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKD  380
             D+  ++ALH A+  GRK  V LLL N A + L + +G+T + ++    + D+++LL ++
Sbjct  378  TDEEGHSALHMASSVGRKGMVELLLRNRAKIDLPDKEGQTALHLSSSEGRTDIVELLLRN  437


 Score = 70.5 bits (171),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = -1

Query  685  LAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRK  506
            L  GA  D  D +G +ALH A   G     ++LLE+GA +D  +K   + LH A+  GR 
Sbjct  138  LRNGAKIDVTDEDGESALHIASSEGRTDVVELLLENGANIDLANKQGRSPLHLASFEGRA  197

Query  505  ECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKD  380
            + V +LL NGA   + + +G++ + +A    + DV++LL K+
Sbjct  198  DVVEVLLRNGAKTDVTDEEGRSALHIASSEGRTDVVELLLKN  239


 Score = 70.1 bits (170),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 68/115 (59%), Gaps = 0/115 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H  +S G  + ++  L  GA  D  +SEG++ALH A   G  +  Q+LL++GA +D  +
Sbjct  419  LHLSSSEGRTDIVELLLRNGAIIDLLNSEGQSALHLASSEGRKEIVQLLLQNGANIDLAN  478

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
            K + TALH A   GR + + LLL+N A + L + +G++ + +A      ++++LL
Sbjct  479  KKRWTALHLAIFKGRTDVIKLLLQNRARIDLTDENGQSALHLASSQGSREIVELL  533


 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 61/103 (59%), Gaps = 0/103 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H  +S G +E ++  L  GA+ D  + +  TALH A   G     ++LL++ A++D  D
Sbjct  452  LHLASSEGRKEIVQLLLQNGANIDLANKKRWTALHLAIFKGRTDVIKLLLQNRARIDLTD  511

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVA  425
            +N  +ALH A+  G +E V LLL NGA + L + +G + +++A
Sbjct  512  ENGQSALHLASSQGSREIVELLLLNGANIDLADNEGASALDLA  554



>ref|XP_003722660.1| putative ankyrin repeat protein [Leishmania major strain Friedlin]
 emb|CBZ12894.1| putative ankyrin repeat protein [Leishmania major strain Friedlin]
Length=173

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 70/122 (57%), Gaps = 6/122 (5%)
 Frame = -1

Query  736  IVHHCASVGDEEGLKNALAAGADK-----DEEDSEGRTALHFACGYGEVKCAQILLESGA  572
            ++HH A  G+   +K A+  G+D      D  DSEG T LH+A   G V+  + LL+ GA
Sbjct  53   LLHHAAFSGNNAFVK-AILDGSDAQQVNIDAADSEGWTPLHYAADRGHVRVVEALLDEGA  111

Query  571  KVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKL  392
             V+A D  K T +H AA  GR E VA+LL NGA+   +N+ G +P++ A+   Q  V+  
Sbjct  112  NVNARDAAKRTPMHLAALSGRAEVVAVLLRNGASKAAKNVAGMSPMDCAQQTGQAAVVAQ  171

Query  391  LE  386
            LE
Sbjct  172  LE  173



>ref|WP_029520633.1| hypothetical protein, partial [Persephonella sp. IF05-L8]
Length=185

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 66/117 (56%), Gaps = 0/117 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H  A  G+ E ++  +  GAD + +D    T LH A G G +   +ILL+ GA ++A  
Sbjct  39   LHEAAFKGNVEIVEYLIKHGADVNAKDDNWETPLHLAAGQGNLNTVKILLKYGADINART  98

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEK  383
            KN +T LHYAA +G  + V  L+E+GA V   + DG TP+  +   N  +V KLL K
Sbjct  99   KNGSTPLHYAARHGHVDVVKYLVEHGANVNAVDEDGDTPLHESVFWNHKEVAKLLIK  155


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 61/112 (54%), Gaps = 0/112 (0%)
 Frame = -1

Query  724  CASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNK  545
              S G+ + +K  +  GAD + +D+ G T LH A   G V+  + L++ GA V+A D N 
Sbjct  9    AVSEGNIKLIKELIQKGADVNSKDAIGWTPLHEAAFKGNVEIVEYLIKHGADVNAKDDNW  68

Query  544  NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
             T LH AAG G    V +LL+ GA +  +  +G TP+  A  +   DV+K L
Sbjct  69   ETPLHLAAGQGNLNTVKILLKYGADINARTKNGSTPLHYAARHGHVDVVKYL  120


 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 63/117 (54%), Gaps = 3/117 (3%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H  A  G+   +K  L  GAD +     G T LH+A  +G V   + L+E GA V+A+D
Sbjct  72   LHLAAGQGNLNTVKILLKYGADINARTKNGSTPLHYAARHGHVDVVKYLVEHGANVNAVD  131

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEK  383
            ++ +T LH +  +  KE   LL++ GA   +++  G TP +  +     + LK+L+K
Sbjct  132  EDGDTPLHESVFWNHKEVAKLLIKLGADPNIKDKFGHTPKDYTQ---DPEFLKILKK  185



>gb|EKC39541.1| Ankyrin repeat domain-containing protein 39 [Crassostrea gigas]
Length=186

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 65/114 (57%), Gaps = 0/114 (0%)
 Frame = -1

Query  721  ASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKN  542
            A  GD E ++  L  G + +  DS G TALH+A     +   ++LL SGA V+++ K+  
Sbjct  37   AVSGDLEEVQRHLGKGENANRMDSSGYTALHYASRNNHLSICELLLRSGADVNSITKSGV  96

Query  541  TALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKD  380
            T LH AA  G  E V LLL  GA  TLQ+ DGK P+  A    ++D++ +L K+
Sbjct  97   TPLHRAAYRGNTEIVQLLLRRGACPTLQDSDGKIPLHKAVEMEKSDIIDILVKE  150



>ref|XP_006155359.1| PREDICTED: ankyrin repeat domain-containing protein 6-like isoform 
X4 [Tupaia chinensis]
Length=412

 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 70/117 (60%), Gaps = 0/117 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H    VG+ E +   +  G   D +D +G TALH A  +G  + A++L+++GA V A +
Sbjct  79   LHRATVVGNTEVIAALIQEGCALDRQDKDGNTALHEASWHGFSQSAKLLVKAGANVLARN  138

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEK  383
            K  +TALH AA    K+ V +LLE GA VT+ N  G+TP+E A+ +N  +V  LL K
Sbjct  139  KAGDTALHIAAALNHKKVVKILLEAGADVTIVNNAGQTPLETARYHNNPEVALLLTK  195


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 61/115 (53%), Gaps = 0/115 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H  A+ G    ++  L AG D D +D   +TALH A   G  +    L++ G  +D  D
Sbjct  46   LHLAANKGHLSVVQILLKAGCDLDVQDDGDQTALHRATVVGNTEVIAALIQEGCALDRQD  105

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
            K+ NTALH A+ +G  +   LL++ GA V  +N  G T + +A   N   V+K+L
Sbjct  106  KDGNTALHEASWHGFSQSAKLLVKAGANVLARNKAGDTALHIAAALNHKKVVKIL  160


 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 46/89 (52%), Gaps = 0/89 (0%)
 Frame = -1

Query  649  EGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRKECVALLLENGAA  470
             GRT LH A   G +   QILL++G  +D  D    TALH A   G  E +A L++ G A
Sbjct  41   HGRTPLHLAANKGHLSVVQILLKAGCDLDVQDDGDQTALHRATVVGNTEVIAALIQEGCA  100

Query  469  VTLQNMDGKTPIEVAKLNNQNDVLKLLEK  383
            +  Q+ DG T +  A  +  +   KLL K
Sbjct  101  LDRQDKDGNTALHEASWHGFSQSAKLLVK  129



>ref|XP_008772242.1| PREDICTED: ankyrin repeat domain-containing protein 62-like isoform 
X3 [Rattus norvegicus]
Length=510

 Score = 83.2 bits (204),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 69/120 (58%), Gaps = 0/120 (0%)
 Frame = -1

Query  736  IVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDAL  557
            ++H+  + G  + +   ++   D +  DS+  TAL  A  Y + +CA ILL+ GA V+A 
Sbjct  9    LLHYACAYGHPDIVTLLISWNCDLNLRDSDNSTALIKASQYKQEECATILLKHGADVNAT  68

Query  556  DKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDA  377
            DKN+NTALHYA  +      A LL + A +T++N D  TP+ VA L N   V + L+K A
Sbjct  69   DKNRNTALHYAVWFNNTSMTANLLVHNADITIRNEDNFTPVIVALLKNNECVSQFLDKKA  128



>ref|XP_010702677.1| ankyrin repeat protein, putative [Leishmania panamensis]
 gb|AIO01877.1| ankyrin repeat protein, putative [Leishmania panamensis]
Length=173

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 67/121 (55%), Gaps = 4/121 (3%)
 Frame = -1

Query  736  IVHHCASVGDEEGLKNALAAGADK----DEEDSEGRTALHFACGYGEVKCAQILLESGAK  569
            ++HH A  G+   +K  L     +    D  D EG T LH+A   G  + A  LL+ GA 
Sbjct  53   LLHHAAFSGNMAFVKAILDRSGTQQVMIDAADREGWTPLHYAADRGHTQVAAALLDEGAS  112

Query  568  VDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
            V+A D  K T +H AA  GR + VA+LL NGA+ T +N+ G TP++ AK  +Q  V+  L
Sbjct  113  VNARDTAKRTPMHLAALSGRADVVAMLLRNGASKTAKNVAGMTPVDCAKEADQAAVIAQL  172

Query  388  E  386
            E
Sbjct  173  E  173



>ref|XP_003723231.1| putative ankyrin repeat protein [Leishmania braziliensis MHOM/BR/75/M2904]
 emb|CBZ14836.1| putative ankyrin repeat protein [Leishmania braziliensis MHOM/BR/75/M2904]
Length=173

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 67/121 (55%), Gaps = 4/121 (3%)
 Frame = -1

Query  736  IVHHCASVGDEEGLKNALAAGADK----DEEDSEGRTALHFACGYGEVKCAQILLESGAK  569
            ++HH A  G+   +K  L     +    D  D EG T LH+A   G  + A  LL+ GA 
Sbjct  53   LLHHAAFSGNVAFVKAILDRSGTQQVMIDAADREGWTPLHYAADRGHTQVAAALLDEGAS  112

Query  568  VDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
            V+A D  K T +H AA  GR + VA+LL NGA+ T +N+ G TP++ AK  +Q  V+  L
Sbjct  113  VNARDTAKRTPMHLAALSGRADVVAMLLRNGASKTAKNVAGMTPVDCAKEADQAAVIAQL  172

Query  388  E  386
            E
Sbjct  173  E  173



>ref|XP_009527661.1| hypothetical protein PHYSODRAFT_504685 [Phytophthora sojae]
 gb|EGZ18603.1| hypothetical protein PHYSODRAFT_504685 [Phytophthora sojae]
Length=122

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 45/100 (45%), Positives = 61/100 (61%), Gaps = 0/100 (0%)
 Frame = -1

Query  685  LAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRK  506
            L  GA  + +  +GRTALH A   G      +LL  GA VDA + +K T L  AA  G K
Sbjct  16   LGKGASVELKTEDGRTALHIAAEEGRADVIGLLLRRGANVDAANLSKWTPLMLAAYRGHK  75

Query  505  ECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLE  386
            E V LL++ GA++T++N DG    E+AKLNN+ D+L LL+
Sbjct  76   ETVKLLVKEGASLTVKNKDGAKAAEIAKLNNRTDLLDLLQ  115



>ref|XP_003731399.1| PREDICTED: uncharacterized protein LOC100891178 [Strongylocentrotus 
purpuratus]
Length=1185

 Score = 84.0 bits (206),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 67/115 (58%), Gaps = 0/115 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H     G  +  +  L AG+  D ++S G T LH AC YG++ CA+IL+ +   ++  +
Sbjct  30   IHLACQHGHNQSTRILLKAGSHPDVKNSSGETPLHIACLYGQITCARILISAECDINMKN  89

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
            K+ NT LH AAG G+ +   LLLE+   V ++N   +TP++VA+  +Q D   L+
Sbjct  90   KDGNTPLHIAAGLGKLKIARLLLESLCEVKIRNKSNQTPLDVARQTDQRDAALLI  144


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 43/77 (56%), Gaps = 0/77 (0%)
 Frame = -1

Query  655  DSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRKECVALLLENG  476
            +  G  A+H AC +G  +  +ILL++G+  D  + +  T LH A  YG+  C  +L+   
Sbjct  23   NKNGERAIHLACQHGHNQSTRILLKAGSHPDVKNSSGETPLHIACLYGQITCARILISAE  82

Query  475  AAVTLQNMDGKTPIEVA  425
              + ++N DG TP+ +A
Sbjct  83   CDINMKNKDGNTPLHIA  99



>emb|CAQ52948.1| CD4-specific ankyrin repeat protein D2.1 [synthetic construct]
Length=169

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 68/114 (60%), Gaps = 0/114 (0%)
 Frame = -1

Query  724  CASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNK  545
             A  G ++ ++  +A GAD +  D+ G T+LH A   G ++  ++LL+ GA V+A D   
Sbjct  21   AARAGQDDEVRILMANGADVNAFDANGITSLHLAAMGGHLEIVEVLLKYGADVNAWDSWG  80

Query  544  NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEK  383
             T LH AA YG  E V +LL+NGA V   ++DG TP+ +A  N   +++++L K
Sbjct  81   YTPLHLAAAYGHLEIVEVLLKNGADVNASDIDGWTPLHLAASNGHLEIVEVLLK  134


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 67/117 (57%), Gaps = 0/117 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H  A  G  E ++  L  GAD +  DS G T LH A  YG ++  ++LL++GA V+A D
Sbjct  51   LHLAAMGGHLEIVEVLLKYGADVNAWDSWGYTPLHLAAAYGHLEIVEVLLKNGADVNASD  110

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEK  383
             +  T LH AA  G  E V +LL++ A V  Q+  GKT  +++  N   D+ ++L+K
Sbjct  111  IDGWTPLHLAASNGHLEIVEVLLKHSADVNTQDKFGKTAFDISIDNGNKDLAEILQK  167



>ref|XP_005872151.1| PREDICTED: ankyrin repeat domain-containing protein 6 isoform 
X7 [Myotis brandtii]
Length=683

 Score = 83.2 bits (204),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 69/117 (59%), Gaps = 0/117 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H  A VG+ E +      G   D +D +G TALH A  +G  +  ++L+++GA V A +
Sbjct  104  LHRAAVVGNTEVISALTQEGCALDRQDKDGNTALHEASWHGFSQSVKLLVKAGANVLAKN  163

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEK  383
            K  +TALH AA    K+ V +LLE GA VT+ N  G+TP+E A+ +N  +V  LL K
Sbjct  164  KAGDTALHVAASLNHKKVVKILLEAGADVTIVNNAGQTPLETARYHNNPEVALLLTK  220


 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 52/94 (55%), Gaps = 1/94 (1%)
 Frame = -1

Query  667  KDEEDSEG-RTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRKECVAL  491
            + E + EG +TALH A   G  +    L + G  +D  DK+ NTALH A+ +G  + V L
Sbjct  92   RSEREKEGDQTALHRAAVVGNTEVISALTQEGCALDRQDKDGNTALHEASWHGFSQSVKL  151

Query  490  LLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
            L++ GA V  +N  G T + VA   N   V+K+L
Sbjct  152  LVKAGANVLAKNKAGDTALHVAASLNHKKVVKIL  185



>gb|KDR21653.1| Ankyrin-2 [Zootermopsis nevadensis]
Length=234

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 65/116 (56%), Gaps = 0/116 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            VH  A  G  + LK     GAD + +   G TALHFA  +G   C ++LLE+GA V + +
Sbjct  95   VHVGAKRGHLDLLKALFEHGADLNTKTVYGNTALHFAAMWGHFSCTELLLENGADVHSRN  154

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLE  386
            K   T LH AA  G  +CV+ L+ENGA   L++ +G T ++VAK N  N    +L 
Sbjct  155  KKGYTPLHCAADSGHADCVSTLIENGAPPNLRDYNGATALDVAKRNENNKCTDVLS  210


 Score = 62.8 bits (151),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 53/108 (49%), Gaps = 0/108 (0%)
 Frame = -1

Query  712  GDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTAL  533
            GD   L+N L+ GAD    +    T LH A   G + C ++LL+SGA V       +T L
Sbjct  3    GDVTALRNLLSHGADIHAANKNSETPLHAAVIEGHLSCVKMLLDSGADVRKKTLRGDTPL  62

Query  532  HYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
            H AA  G   C  LLLE+G  +   N  G+T + V       D+LK L
Sbjct  63   HAAAFCGSVLCAGLLLEHGCDIHATNNRGETAVHVGAKRGHLDLLKAL  110


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 49/99 (49%), Gaps = 0/99 (0%)
 Frame = -1

Query  685  LAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRK  506
            L  G D    ++ G TA+H     G +   + L E GA ++      NTALH+AA +G  
Sbjct  78   LEHGCDIHATNNRGETAVHVGAKRGHLDLLKALFEHGADLNTKTVYGNTALHFAAMWGHF  137

Query  505  ECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
             C  LLLENGA V  +N  G TP+  A  +   D +  L
Sbjct  138  SCTELLLENGADVHSRNKKGYTPLHCAADSGHADCVSTL  176



>gb|KFA73903.1| hypothetical protein S40288_00891 [Stachybotrys chartarum IBT 
40288]
Length=859

 Score = 83.2 bits (204),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 59/103 (57%), Gaps = 0/103 (0%)
 Frame = -1

Query  694  KNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGY  515
            +N +   A+   E + GR  LH A   G+V   +  L  G  ++ LD   N ALHYAAG 
Sbjct  111  RNMMRDYANSSVEGTHGRIYLHIAAARGQVDTVETWLRCGVDINMLDDEGNNALHYAAGN  170

Query  514  GRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLE  386
            G+ +CV  LL NG    ++N +G TP+++AK +  N+++ +LE
Sbjct  171  GKPDCVPTLLRNGCRSDVKNHNGATPVDLAKADGHNEIVGMLE  213



>ref|XP_006778324.1| PREDICTED: ankyrin repeat domain-containing protein 6 isoform 
X7 [Myotis davidii]
Length=683

 Score = 83.2 bits (204),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 69/117 (59%), Gaps = 0/117 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H  A VG+ E +      G   D +D +G TALH A  +G  +  ++L+++GA V A +
Sbjct  104  LHRAAVVGNTEVISALTQEGCALDRQDKDGNTALHEASWHGFSQSVKLLVKAGANVLAKN  163

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEK  383
            K  +TALH AA    K+ V +LLE GA VT+ N  G+TP+E A+ +N  +V  LL K
Sbjct  164  KAGDTALHVAASLNHKKVVKILLEAGADVTIVNNAGQTPLETARYHNNPEVALLLTK  220


 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 52/94 (55%), Gaps = 1/94 (1%)
 Frame = -1

Query  667  KDEEDSEG-RTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRKECVAL  491
            + E + EG +TALH A   G  +    L + G  +D  DK+ NTALH A+ +G  + V L
Sbjct  92   RSEREKEGDQTALHRAAVVGNTEVISALTQEGCALDRQDKDGNTALHEASWHGFSQSVKL  151

Query  490  LLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
            L++ GA V  +N  G T + VA   N   V+K+L
Sbjct  152  LVKAGANVLAKNKAGDTALHVAASLNHKKVVKIL  185



>ref|XP_006222512.2| PREDICTED: ankyrin repeat domain-containing protein 26-like isoform 
X2 [Rattus norvegicus]
Length=531

 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 69/120 (58%), Gaps = 0/120 (0%)
 Frame = -1

Query  736  IVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDAL  557
            ++H+  + G  + +   ++   D +  DS+  TAL  A  Y + +CA ILL+ GA V+A 
Sbjct  86   LLHYACAYGHPDIVTLLISWNCDLNLRDSDNSTALIKASQYKQEECATILLKHGADVNAT  145

Query  556  DKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDA  377
            DKN+NTALHYA  +      A LL + A +T++N D  TP+ VA L N   V + L+K A
Sbjct  146  DKNRNTALHYAVWFNNTSMTANLLVHNADITIRNEDNFTPVIVALLKNNECVSQFLDKKA  205



>emb|CAQ52951.1| CD4-specific ankyrin repeat protein D5.1 [synthetic construct]
Length=169

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 68/114 (60%), Gaps = 0/114 (0%)
 Frame = -1

Query  724  CASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNK  545
             A  G ++ ++  +A GAD +  D+ G T+LH A   G ++  ++LL+ GA V+A D   
Sbjct  21   AARAGQDDEVRILMANGADVNAFDANGITSLHLAAMGGHLEIVEVLLKYGADVNAWDSWG  80

Query  544  NTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEK  383
             T LH AA YG  E V +LL+NGA V   ++DG TP+ +A  N   +++++L K
Sbjct  81   YTPLHLAAAYGHLEIVEVLLKNGADVNASDIDGWTPLHLAASNGHLEIVEVLLK  134


 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 68/117 (58%), Gaps = 0/117 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H  A  G  E ++  L  GAD +  DS G T LH A  YG ++  ++LL++GA V+A D
Sbjct  51   LHLAAMGGHLEIVEVLLKYGADVNAWDSWGYTPLHLAAAYGHLEIVEVLLKNGADVNASD  110

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEK  383
             +  T LH AA  G  E V +LL++GA V  Q+  GKT  +++  N   D+ ++L+K
Sbjct  111  IDGWTPLHLAASNGHLEIVEVLLKHGADVNAQDKFGKTAFDISIDNGNKDLAEILQK  167



>ref|XP_008772241.1| PREDICTED: ankyrin repeat domain-containing protein 26-like isoform 
X1 [Rattus norvegicus]
Length=587

 Score = 82.8 bits (203),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 69/120 (58%), Gaps = 0/120 (0%)
 Frame = -1

Query  736  IVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDAL  557
            ++H+  + G  + +   ++   D +  DS+  TAL  A  Y + +CA ILL+ GA V+A 
Sbjct  86   LLHYACAYGHPDIVTLLISWNCDLNLRDSDNSTALIKASQYKQEECATILLKHGADVNAT  145

Query  556  DKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDA  377
            DKN+NTALHYA  +      A LL + A +T++N D  TP+ VA L N   V + L+K A
Sbjct  146  DKNRNTALHYAVWFNNTSMTANLLVHNADITIRNEDNFTPVIVALLKNNECVSQFLDKKA  205



>ref|XP_001323837.1| ankyrin repeat protein [Trichomonas vaginalis G3]
 gb|EAY11614.1| ankyrin repeat protein, putative [Trichomonas vaginalis G3]
Length=809

 Score = 82.8 bits (203),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 79/142 (56%), Gaps = 8/142 (6%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H  A    +E LK  L+ GA+ +E+D +G  ALH A  Y +++ A++LL  GA ++  D
Sbjct  555  LHIAADYNYKEILKLLLSHGANINEKDKDGSAALHIAAQYNKIELAELLLSHGANINEKD  614

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL-----  389
            K+  TALH A  Y R E   LLL +GA +  ++ DG+T + +A   N  ++L+LL     
Sbjct  615  KDGKTALHIAVLYYRIETAKLLLSHGANINEKDKDGRTALHIAVNYNYKEILELLLLHGA  674

Query  388  ---EKDAFL*AGMHL*ITYARV  332
               EKD      +H+ + Y R+
Sbjct  675  NINEKDKDGSTALHIAVLYYRI  696


 Score = 80.5 bits (197),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 79/142 (56%), Gaps = 8/142 (6%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H  A    +E LK  L+ GA+ +E+D +G  ALH A  Y +++ A++LL  GA ++  D
Sbjct  489  LHIAADYNYKEILKLLLSHGANINEKDKDGSAALHIAARYNKIELAELLLSHGANINEKD  548

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL-----  389
            K+  TALH AA Y  KE + LLL +GA +  ++ DG   + +A   N+ ++ +LL     
Sbjct  549  KDGKTALHIAADYNYKEILKLLLSHGANINEKDKDGSAALHIAAQYNKIELAELLLSHGA  608

Query  388  ---EKDAFL*AGMHL*ITYARV  332
               EKD      +H+ + Y R+
Sbjct  609  NINEKDKDGKTALHIAVLYYRI  630


 Score = 79.0 bits (193),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 78/142 (55%), Gaps = 8/142 (6%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H  A    +E  +  L+ GA+ +E+D +G+TALH A  Y   +  ++LL  GA ++  D
Sbjct  456  LHVAAQCNKKESAEILLSHGANINEKDKDGKTALHIAADYNYKEILKLLLSHGANINEKD  515

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL-----  389
            K+ + ALH AA Y + E   LLL +GA +  ++ DGKT + +A   N  ++LKLL     
Sbjct  516  KDGSAALHIAARYNKIELAELLLSHGANINEKDKDGKTALHIAADYNYKEILKLLLSHGA  575

Query  388  ---EKDAFL*AGMHL*ITYARV  332
               EKD    A +H+   Y ++
Sbjct  576  NINEKDKDGSAALHIAAQYNKI  597


 Score = 76.3 bits (186),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 62/99 (63%), Gaps = 0/99 (0%)
 Frame = -1

Query  685  LAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRK  506
            L+ GA+ +E+D +G+TALH A  Y  ++ A++LL  GA ++  DK+  TALH A  Y  K
Sbjct  604  LSHGANINEKDKDGKTALHIAVLYYRIETAKLLLSHGANINEKDKDGRTALHIAVNYNYK  663

Query  505  ECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
            E + LLL +GA +  ++ DG T + +A L  + +  KLL
Sbjct  664  EILELLLLHGANINEKDKDGSTALHIAVLYYRIETAKLL  702


 Score = 76.3 bits (186),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 73/135 (54%), Gaps = 8/135 (6%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H   +   +E L+  L  GA+ +E+D +G TALH A  Y  ++ A++LL  G  ++  D
Sbjct  654  LHIAVNYNYKEILELLLLHGANINEKDKDGSTALHIAVLYYRIETAKLLLSIGVNINEKD  713

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL-----  389
            K+  T  H AA Y +KE   LLL +GA +  ++ DGKTP+ +   +N  ++ + L     
Sbjct  714  KDGKTPFHIAAQYNKKELAELLLSHGANINEKDKDGKTPLHILAFHNNKEIAEHLIAHGA  773

Query  388  ---EKDAFL*AGMHL  353
               EKD +    +H+
Sbjct  774  NINEKDNYGNTALHI  788


 Score = 74.7 bits (182),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 62/105 (59%), Gaps = 0/105 (0%)
 Frame = -1

Query  703  EGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYA  524
            E  K  L+ GA+ +E+D +GRTALH A  Y   +  ++LL  GA ++  DK+ +TALH A
Sbjct  631  ETAKLLLSHGANINEKDKDGRTALHIAVNYNYKEILELLLLHGANINEKDKDGSTALHIA  690

Query  523  AGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
              Y R E   LLL  G  +  ++ DGKTP  +A   N+ ++ +LL
Sbjct  691  VLYYRIETAKLLLSIGVNINEKDKDGKTPFHIAAQYNKKELAELL  735


 Score = 73.9 bits (180),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 76/138 (55%), Gaps = 8/138 (6%)
 Frame = -1

Query  721  ASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKN  542
            A    +E +++ +A GA+ +E+D+ G+TALH A  Y   +  ++LL  GA ++  D +  
Sbjct  394  AECQSKEMVEHLIAHGANINEKDNYGKTALHIASNYNYKEILKLLLSHGANINEKDDHGK  453

Query  541  TALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL--------E  386
            T LH AA   +KE   +LL +GA +  ++ DGKT + +A   N  ++LKLL        E
Sbjct  454  TPLHVAAQCNKKESAEILLSHGANINEKDKDGKTALHIAADYNYKEILKLLLSHGANINE  513

Query  385  KDAFL*AGMHL*ITYARV  332
            KD    A +H+   Y ++
Sbjct  514  KDKDGSAALHIAARYNKI  531


 Score = 72.4 bits (176),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 69/123 (56%), Gaps = 8/123 (7%)
 Frame = -1

Query  685  LAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRK  506
            L+ GA+ +E+D +G+TALH A  Y   +  ++LL  GA ++  DK+ + ALH AA Y + 
Sbjct  538  LSHGANINEKDKDGKTALHIAADYNYKEILKLLLSHGANINEKDKDGSAALHIAAQYNKI  597

Query  505  ECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL--------EKDAFL*AGMHL*  350
            E   LLL +GA +  ++ DGKT + +A L  + +  KLL        EKD      +H+ 
Sbjct  598  ELAELLLSHGANINEKDKDGKTALHIAVLYYRIETAKLLLSHGANINEKDKDGRTALHIA  657

Query  349  ITY  341
            + Y
Sbjct  658  VNY  660


 Score = 72.0 bits (175),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 68/115 (59%), Gaps = 0/115 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H  ++   +E LK  L+ GA+ +E+D  G+T LH A    + + A+ILL  GA ++  D
Sbjct  423  LHIASNYNYKEILKLLLSHGANINEKDDHGKTPLHVAAQCNKKESAEILLSHGANINEKD  482

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
            K+  TALH AA Y  KE + LLL +GA +  ++ DG   + +A   N+ ++ +LL
Sbjct  483  KDGKTALHIAADYNYKEILKLLLSHGANINEKDKDGSAALHIAARYNKIELAELL  537


 Score = 62.8 bits (151),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 59/104 (57%), Gaps = 0/104 (0%)
 Frame = -1

Query  736  IVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDAL  557
            ++H+ A   ++E     +  GA+ +E+D +G+TAL+ A      +  + L+  GA ++  
Sbjct  356  VLHYAAENNNKEIADFFILYGANINEKDKDGKTALYIAAECQSKEMVEHLIAHGANINEK  415

Query  556  DKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVA  425
            D    TALH A+ Y  KE + LLL +GA +  ++  GKTP+ VA
Sbjct  416  DNYGKTALHIASNYNYKEILKLLLSHGANINEKDDHGKTPLHVA  459


 Score = 59.3 bits (142),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 57/105 (54%), Gaps = 0/105 (0%)
 Frame = -1

Query  703  EGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYA  524
            E  K  L+ G + +E+D +G+T  H A  Y + + A++LL  GA ++  DK+  T LH  
Sbjct  697  ETAKLLLSIGVNINEKDKDGKTPFHIAAQYNKKELAELLLSHGANINEKDKDGKTPLHIL  756

Query  523  AGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
            A +  KE    L+ +GA +  ++  G T + +A   N N  +++L
Sbjct  757  AFHNNKEIAEHLIAHGANINEKDNYGNTALHIAAFYNNNKKVEVL  801


 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 55/99 (56%), Gaps = 0/99 (0%)
 Frame = -1

Query  685  LAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRK  506
            L+ GAD +E+   G+T LH+A      + A   +  GA ++  DK+  TAL+ AA    K
Sbjct  340  LSYGADINEKGYYGKTVLHYAAENNNKEIADFFILYGANINEKDKDGKTALYIAAECQSK  399

Query  505  ECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
            E V  L+ +GA +  ++  GKT + +A   N  ++LKLL
Sbjct  400  EMVEHLIAHGANINEKDNYGKTALHIASNYNYKEILKLL  438



>gb|KDO22630.1| TKL protein kinase [Saprolegnia parasitica CBS 223.65]
Length=1055

 Score = 82.8 bits (203),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 69/118 (58%), Gaps = 0/118 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H+ AS G  + ++  L  GA  D   ++G T LH A   G V   ++LL+ GA VDA +
Sbjct  41   LHYAASKGHVDVVRLLLDKGAKFDACTTDGSTLLHCAASNGHVDVVRLLLDKGADVDASN  100

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKD  380
             N +T LH+AA   + E V LLLE GA V  +N +GKTP+EVA+    ND +  + +D
Sbjct  101  ANGSTPLHHAAQANKPEMVQLLLEKGAKVDAKNREGKTPLEVAEARGSNDPVATVLRD  158


 Score = 66.2 bits (160),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 51/89 (57%), Gaps = 0/89 (0%)
 Frame = -1

Query  655  DSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRKECVALLLENG  476
            D  G T LH+A   G V   ++LL+ GAK DA   + +T LH AA  G  + V LLL+ G
Sbjct  34   DCSGWTPLHYAASKGHVDVVRLLLDKGAKFDACTTDGSTLLHCAASNGHVDVVRLLLDKG  93

Query  475  AAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
            A V   N +G TP+  A   N+ ++++LL
Sbjct  94   ADVDASNANGSTPLHHAAQANKPEMVQLL  122



>ref|XP_008770070.1| PREDICTED: putative ankyrin repeat domain-containing protein 
26-like protein isoform X4 [Rattus norvegicus]
Length=570

 Score = 82.4 bits (202),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 69/120 (58%), Gaps = 0/120 (0%)
 Frame = -1

Query  736  IVHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDAL  557
            ++H+  + G  + +   ++   D +  DS+  TAL  A  Y + +CA ILL+ GA V+A 
Sbjct  86   LLHYACAYGHPDIVTLLISWNCDLNLRDSDNSTALIKASQYKQEECATILLKHGADVNAT  145

Query  556  DKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEKDA  377
            DKN+NTALHYA  +      A LL + A +T++N D  TP+ VA L N   V + L+K A
Sbjct  146  DKNRNTALHYAVWFNNTSMTANLLVHNADITIRNEDNFTPVIVALLKNNECVSQFLDKKA  205



>ref|XP_006091864.1| PREDICTED: ankyrin repeat domain-containing protein 6 isoform 
X6 [Myotis lucifugus]
Length=658

 Score = 82.4 bits (202),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 69/117 (59%), Gaps = 0/117 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H  A VG+ E +      G   D +D +G TALH A  +G  +  ++L+++GA V A +
Sbjct  79   LHRAAVVGNTEVISALTQEGCALDRQDKDGNTALHEASWHGFSQSVKLLVKAGANVLAKN  138

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEK  383
            K  +TALH AA    K+ V +LLE GA VT+ N  G+TP+E A+ +N  +V  LL K
Sbjct  139  KAGDTALHVAASLNHKKVVKILLEAGADVTIVNNAGQTPLETARYHNNPEVALLLTK  195


 Score = 65.9 bits (159),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 61/115 (53%), Gaps = 0/115 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H  A+ G    ++  L AG D D +D   +TALH A   G  +    L + G  +D  D
Sbjct  46   LHLAANKGHLAVVQILLKAGCDLDVQDDGDQTALHRAAVVGNTEVISALTQEGCALDRQD  105

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
            K+ NTALH A+ +G  + V LL++ GA V  +N  G T + VA   N   V+K+L
Sbjct  106  KDGNTALHEASWHGFSQSVKLLVKAGANVLAKNKAGDTALHVAASLNHKKVVKIL  160


 Score = 62.0 bits (149),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 47/88 (53%), Gaps = 0/88 (0%)
 Frame = -1

Query  646  GRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRKECVALLLENGAAV  467
            GRT LH A   G +   QILL++G  +D  D    TALH AA  G  E ++ L + G A+
Sbjct  42   GRTPLHLAANKGHLAVVQILLKAGCDLDVQDDGDQTALHRAAVVGNTEVISALTQEGCAL  101

Query  466  TLQNMDGKTPIEVAKLNNQNDVLKLLEK  383
              Q+ DG T +  A  +  +  +KLL K
Sbjct  102  DRQDKDGNTALHEASWHGFSQSVKLLVK  129



>ref|XP_001583641.1| ankyrin repeat protein [Trichomonas vaginalis G3]
 gb|EAY22655.1| ankyrin repeat protein, putative [Trichomonas vaginalis G3]
Length=587

 Score = 82.4 bits (202),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 73/115 (63%), Gaps = 0/115 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H+ A+   +E ++  ++ GA+ +E+D +GRTALH+A      +  ++L+  GA ++  D
Sbjct  415  LHYAANCNSKETVEVFISHGANINEKDEDGRTALHYATWENNKETVEVLISYGANINERD  474

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
            ++  TALHYAA Y  KE V +L+ +GA +  ++ DG+T + +A   N  +++++L
Sbjct  475  EDGQTALHYAAFYNSKETVEILISHGANINEKDKDGQTALHIAANKNNTEIVEVL  529


 Score = 74.3 bits (181),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 68/115 (59%), Gaps = 0/115 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H+     ++E ++  ++ GA+ +E D +G+TALH+A  Y   +  +IL+  GA ++  D
Sbjct  448  LHYATWENNKETVEVLISYGANINERDEDGQTALHYAAFYNSKETVEILISHGANINEKD  507

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
            K+  TALH AA     E V +L+ +G  +  ++ DGKT + +A   N  +++++L
Sbjct  508  KDGQTALHIAANKNNTEIVEVLISHGVNINEKDKDGKTALHIAANKNNTEIVEVL  562


 Score = 70.5 bits (171),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 66/115 (57%), Gaps = 0/115 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H+ A    +E +K  ++ GA+ +E+D +GRTAL+ A      +  + L+  GA ++  D
Sbjct  349  LHYAAWKNSKETVKVLISHGANINEKDRDGRTALYDAAYCNSKEIVEFLISHGANINERD  408

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
            ++  TALHYAA    KE V + + +GA +  ++ DG+T +  A   N  + +++L
Sbjct  409  RDGETALHYAANCNSKETVEVFISHGANINEKDEDGRTALHYATWENNKETVEVL  463


 Score = 65.9 bits (159),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 61/111 (55%), Gaps = 0/111 (0%)
 Frame = -1

Query  721  ASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKN  542
            A    +E ++  ++ GA+ +E D +G TALH+A      +  ++ +  GA ++  D++  
Sbjct  386  AYCNSKEIVEFLISHGANINERDRDGETALHYAANCNSKETVEVFISHGANINEKDEDGR  445

Query  541  TALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
            TALHYA     KE V +L+  GA +  ++ DG+T +  A   N  + +++L
Sbjct  446  TALHYATWENNKETVEVLISYGANINERDEDGQTALHYAAFYNSKETVEIL  496


 Score = 65.9 bits (159),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 57/99 (58%), Gaps = 0/99 (0%)
 Frame = -1

Query  685  LAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRK  506
            L+ G + +E+     TALH+A  Y  ++  + L+  GA ++  ++N  TALHYAA    K
Sbjct  299  LSQGVNINEKVENRETALHYAAYYNNIETVEFLISHGANINEKNENGRTALHYAAWKNSK  358

Query  505  ECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
            E V +L+ +GA +  ++ DG+T +  A   N  ++++ L
Sbjct  359  ETVKVLISHGANINEKDRDGRTALYDAAYCNSKEIVEFL  397


 Score = 63.2 bits (152),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/115 (29%), Positives = 65/115 (57%), Gaps = 0/115 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H+ A   + E ++  ++ GA+ +E++  GRTALH+A      +  ++L+  GA ++  D
Sbjct  316  LHYAAYYNNIETVEFLISHGANINEKNENGRTALHYAAWKNSKETVKVLISHGANINEKD  375

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
            ++  TAL+ AA    KE V  L+ +GA +  ++ DG+T +  A   N  + +++ 
Sbjct  376  RDGRTALYDAAYCNSKEIVEFLISHGANINERDRDGETALHYAANCNSKETVEVF  430


 Score = 57.0 bits (136),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 50/87 (57%), Gaps = 0/87 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H+ A    +E ++  ++ GA+ +E+D +G+TALH A      +  ++L+  G  ++  D
Sbjct  481  LHYAAFYNSKETVEILISHGANINEKDKDGQTALHIAANKNNTEIVEVLISHGVNINEKD  540

Query  553  KNKNTALHYAAGYGRKECVALLLENGA  473
            K+  TALH AA     E V +L+ +GA
Sbjct  541  KDGKTALHIAANKNNTEIVEVLISHGA  567



>ref|XP_001325696.1| ankyrin repeat protein [Trichomonas vaginalis G3]
 gb|EAY13473.1| ankyrin repeat protein, putative [Trichomonas vaginalis G3]
Length=185

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 58/92 (63%), Gaps = 0/92 (0%)
 Frame = -1

Query  685  LAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRK  506
            ++ GA+ +E+D  G TALHFA      + A++L+  GA ++  DKN  TALH AA Y  K
Sbjct  78   ISHGANINEKDKNGETALHFAAINNSKETAEVLISHGANINEKDKNGETALHIAAKYNSK  137

Query  505  ECVALLLENGAAVTLQNMDGKTPIEVAKLNNQ  410
            E   +L+ +GA +  +N DG+TP+++A L N 
Sbjct  138  ETAEVLISHGANINEKNEDGETPLDIAALMNN  169


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 61/99 (62%), Gaps = 0/99 (0%)
 Frame = -1

Query  685  LAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRK  506
            ++ GA+ +E+D +G+TALH A  Y   + A++L+  GA ++  DKN  TALH+AA    K
Sbjct  45   ISHGANINEKDIKGKTALHIAVKYNSKETAEVLISHGANINEKDKNGETALHFAAINNSK  104

Query  505  ECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
            E   +L+ +GA +  ++ +G+T + +A   N  +  ++L
Sbjct  105  ETAEVLISHGANINEKDKNGETALHIAAKYNSKETAEVL  143


 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 52/96 (54%), Gaps = 0/96 (0%)
 Frame = -1

Query  676  GADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRKECV  497
            G  K+++   G+TALH A  Y      ++L+  GA ++  D    TALH A  Y  KE  
Sbjct  15   GVSKNKKYHYGKTALHNAARYNSNLTVEVLISHGANINEKDIKGKTALHIAVKYNSKETA  74

Query  496  ALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLL  389
             +L+ +GA +  ++ +G+T +  A +NN  +  ++L
Sbjct  75   EVLISHGANINEKDKNGETALHFAAINNSKETAEVL  110



>gb|EAL59787.1| ankyrin repeat domain protein [Wolbachia endosymbiont of Drosophila 
simulans]
Length=414

 Score = 81.3 bits (199),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 62/101 (61%), Gaps = 0/101 (0%)
 Frame = -1

Query  685  LAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRK  506
            L  G D + +D +G T LH+A  YG V+ A+ L+++GA VDA DK+  T LHYAA    K
Sbjct  69   LENGEDINAQDKDGVTHLHYAATYGYVEIAEYLIDNGADVDAQDKDGVTPLHYAAAKSAK  128

Query  505  ECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLEK  383
            E V LL++  A +  Q+ DG TP+  A  N+  ++ KLL K
Sbjct  129  ESVKLLIKRKANINAQDKDGHTPLYFAVANDNKELAKLLIK  169


 Score = 52.8 bits (125),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 51/91 (56%), Gaps = 0/91 (0%)
 Frame = -1

Query  733  VHHCASVGDEEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALD  554
            +H+ A+ G  E  +  +  GAD D +D +G T LH+A      +  ++L++  A ++A D
Sbjct  86   LHYAATYGYVEIAEYLIDNGADVDAQDKDGVTPLHYAAAKSAKESVKLLIKRKANINAQD  145

Query  553  KNKNTALHYAAGYGRKECVALLLENGAAVTL  461
            K+ +T L++A     KE   LL++ GA  +L
Sbjct  146  KDGHTPLYFAVANDNKELAKLLIKYGADRSL  176



>ref|XP_001782585.1| predicted protein [Physcomitrella patens]
 gb|EDQ52574.1| predicted protein [Physcomitrella patens]
Length=121

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 40/76 (53%), Positives = 51/76 (67%), Gaps = 2/76 (3%)
 Frame = -1

Query  655  DSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGYGRKECVALLLENG  476
            D +GRTALHFACG     CA++LL++GA V A DK+  T LH AAGYGR  CV LLL++G
Sbjct  1    DEKGRTALHFACGMVPADCARLLLDAGADVHARDKDGYTPLHMAAGYGRCNCVKLLLDHG  60

Query  475  AAVTLQNM--DGKTPI  434
                L +   +GKT +
Sbjct  61   KLTELSHWTSEGKTAL  76


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 32/98 (33%), Positives = 44/98 (45%), Gaps = 2/98 (2%)
 Frame = -1

Query  685  LAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESG--AKVDALDKNKNTALHYAAGYG  512
            L AGAD    D +G T LH A GYG   C ++LL+ G   ++        TAL +A    
Sbjct  24   LDAGADVHARDKDGYTPLHMAAGYGRCNCVKLLLDHGKLTELSHWTSEGKTALMHAVSRN  83

Query  511  RKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVL  398
              E    LL  GA +   + +G T +     NN  + L
Sbjct  84   CVEATESLLNGGAEINAGDGEGFTALHHGARNNSAECL  121



>gb|KFA46967.1| hypothetical protein S40293_10036 [Stachybotrys chartarum IBT 
40293]
Length=859

 Score = 82.4 bits (202),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 58/103 (56%), Gaps = 0/103 (0%)
 Frame = -1

Query  694  KNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLESGAKVDALDKNKNTALHYAAGY  515
            +N +   A+   E + GR  LH A   G+V   +  L  G  ++ LD   N ALHYAAG 
Sbjct  111  RNMMRDYANSSVEGTHGRIYLHIAAARGQVDTVETWLRCGVDINMLDDEGNNALHYAAGN  170

Query  514  GRKECVALLLENGAAVTLQNMDGKTPIEVAKLNNQNDVLKLLE  386
            G+ +CV  LL NG    ++N +G TP ++AK +  N+++ +LE
Sbjct  171  GKPDCVPTLLRNGCRSDVKNHNGATPFDLAKADGHNEIVGMLE  213



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4282802373808