BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c28347_g1_i1 len=847 path=[1:0-846]

Length=847
                                                                      Score     E

ref|XP_009627921.1|  PREDICTED: uncharacterized protein LOC104118395    217   2e-66   
ref|XP_006339001.1|  PREDICTED: uncharacterized protein LOC102585649    216   5e-66   
ref|XP_004249554.1|  PREDICTED: uncharacterized protein LOC101267755    216   6e-66   
ref|XP_009794767.1|  PREDICTED: uncharacterized protein LOC104241517    213   5e-65   
emb|CDP06536.1|  unnamed protein product                                213   1e-64   
ref|XP_009787582.1|  PREDICTED: uncharacterized protein LOC104235494    209   1e-63   
ref|XP_006349478.1|  PREDICTED: uncharacterized protein LOC102591129    206   1e-62   
ref|XP_009613648.1|  PREDICTED: uncharacterized protein LOC104106740    202   6e-61   
ref|XP_009783756.1|  PREDICTED: uncharacterized protein LOC104232282    202   6e-61   
ref|XP_004249680.1|  PREDICTED: uncharacterized protein LOC101253546    199   9e-60   
ref|XP_010101846.1|  hypothetical protein L484_023636                   198   2e-59   
ref|XP_008442484.1|  PREDICTED: uncharacterized protein LOC103486338    196   2e-58   
ref|XP_007026832.1|  PAR1 protein                                       195   3e-58   
ref|XP_004302677.1|  PREDICTED: uncharacterized protein LOC101299015    194   2e-57   
gb|EYU41813.1|  hypothetical protein MIMGU_mgv1a014652mg                194   2e-57   
ref|XP_004137744.1|  PREDICTED: uncharacterized protein LOC101218677    192   5e-57   
ref|XP_002276542.1|  PREDICTED: uncharacterized protein LOC100246012    192   7e-57   Vitis vinifera
ref|XP_006488680.1|  PREDICTED: uncharacterized protein DDB_G0271...    191   1e-55   
gb|KHN12948.1|  hypothetical protein glysoja_042216                     187   3e-55   
ref|NP_001242705.1|  uncharacterized protein LOC100815307 precursor     187   6e-55   
ref|XP_006429255.1|  hypothetical protein CICLE_v10012857mg             187   1e-54   
ref|XP_010262709.1|  PREDICTED: uncharacterized protein LOC104601167    187   1e-54   
ref|XP_007207936.1|  hypothetical protein PRUPE_ppa017583mg             186   2e-54   
gb|KHN27004.1|  hypothetical protein glysoja_040812                     185   3e-54   
ref|XP_008388101.1|  PREDICTED: uncharacterized protein LOC103450515    185   4e-54   
ref|NP_001238081.1|  uncharacterized protein LOC100500181 precursor     184   1e-53   
gb|KCW49488.1|  hypothetical protein EUGRSUZ_K03007                     185   3e-53   
ref|XP_010039173.1|  PREDICTED: uncharacterized protein LOC104427850    185   4e-53   
ref|XP_009358815.1|  PREDICTED: uncharacterized protein LOC103949427    182   5e-53   
ref|XP_008239896.1|  PREDICTED: uncharacterized protein LOC103338466    182   1e-52   
gb|EYU26632.1|  hypothetical protein MIMGU_mgv1a014768mg                181   2e-52   
ref|XP_002323542.2|  hypothetical protein POPTR_0016s11600g             180   2e-52   Populus trichocarpa [western balsam poplar]
gb|KHF97273.1|  hypothetical protein F383_36747                         180   4e-52   
ref|XP_011019183.1|  PREDICTED: uncharacterized protein LOC105121988    179   6e-52   
ref|XP_010256734.1|  PREDICTED: uncharacterized protein LOC104597044    179   1e-51   
gb|EYU27489.1|  hypothetical protein MIMGU_mgv1a014649mg                179   1e-51   
ref|XP_002309105.2|  hypothetical protein POPTR_0006s09540g             178   2e-51   Populus trichocarpa [western balsam poplar]
gb|KHG02999.1|  ATP-dependent RNA helicase dbp6                         178   2e-51   
ref|XP_007133951.1|  hypothetical protein PHAVU_010G006000g             177   2e-51   
ref|XP_006848036.1|  hypothetical protein AMTR_s00029p00186810          177   3e-51   
ref|XP_010046385.1|  PREDICTED: uncharacterized protein LOC104435305    177   3e-51   
gb|KEH23077.1|  PAR1 protein                                            176   6e-51   
ref|XP_011012958.1|  PREDICTED: uncharacterized protein LOC105117111    177   6e-51   
ref|XP_011008006.1|  PREDICTED: uncharacterized protein LOC105113506    176   7e-51   
gb|KDP24516.1|  hypothetical protein JCGZ_25080                         177   7e-51   
ref|XP_010553262.1|  PREDICTED: uncharacterized protein LOC104823394    176   9e-51   
ref|XP_011094949.1|  PREDICTED: uncharacterized protein LOC105174518    175   2e-50   
gb|AFK35102.1|  unknown                                                 175   3e-50   
ref|XP_011077605.1|  PREDICTED: uncharacterized protein LOC105161572    175   4e-50   
ref|XP_009370270.1|  PREDICTED: uncharacterized protein LOC103959642    174   5e-50   
gb|KHG11879.1|  uncharacterized protein F383_20075                      175   6e-50   
ref|XP_009370269.1|  PREDICTED: uncharacterized protein LOC103959641    174   6e-50   
ref|XP_003604795.1|  hypothetical protein MTR_4g018860                  174   1e-49   
ref|XP_008370129.1|  PREDICTED: uncharacterized protein LOC103433639    174   2e-49   
ref|XP_003604797.1|  hypothetical protein MTR_4g018880                  173   2e-49   
ref|XP_004506651.1|  PREDICTED: uncharacterized protein LOC101492243    171   6e-49   
ref|XP_009139267.1|  PREDICTED: uncharacterized protein LOC103863264    171   9e-49   
ref|NP_190972.1|  PAR1 protein                                          171   9e-49   Arabidopsis thaliana [mouse-ear cress]
emb|CDP05191.1|  unnamed protein product                                171   1e-48   
ref|XP_004234399.1|  PREDICTED: uncharacterized protein LOC101252465    170   2e-48   
gb|AFK48062.1|  unknown                                                 170   3e-48   
emb|CDY13179.1|  BnaC04g26560D                                          169   4e-48   
ref|XP_011073217.1|  PREDICTED: uncharacterized protein LOC105158241    169   4e-48   
ref|XP_003604794.1|  hypothetical protein MTR_4g018850                  171   5e-48   
gb|KDP46577.1|  hypothetical protein JCGZ_08549                         169   5e-48   
ref|XP_011073208.1|  PREDICTED: uncharacterized protein LOC105158231    169   5e-48   
ref|XP_010044045.1|  PREDICTED: uncharacterized protein LOC104433099    169   6e-48   
ref|XP_002279995.1|  PREDICTED: uncharacterized protein LOC100267406    169   7e-48   Vitis vinifera
ref|NP_001241627.1|  uncharacterized protein LOC100787709 precursor     169   9e-48   
ref|XP_010905376.1|  PREDICTED: uncharacterized protein LOC105032593    169   1e-47   
ref|XP_002877953.1|  hypothetical protein ARALYDRAFT_485800             168   1e-47   
emb|CDX76173.1|  BnaA04g04370D                                          168   1e-47   
ref|XP_010035143.1|  PREDICTED: uncharacterized protein LOC104424423    168   1e-47   
emb|CDY60770.1|  BnaAnng17210D                                          168   2e-47   
ref|XP_009103899.1|  PREDICTED: uncharacterized protein LOC103829...    168   2e-47   
ref|XP_003555381.1|  PREDICTED: uncharacterized protein LOC100784217    167   3e-47   
ref|XP_010662746.1|  PREDICTED: uncharacterized protein LOC100254...    167   3e-47   
ref|XP_011073210.1|  PREDICTED: uncharacterized protein LOC105158233    167   4e-47   
ref|XP_011073219.1|  PREDICTED: uncharacterized protein LOC105158242    166   6e-47   
ref|XP_008811495.1|  PREDICTED: uncharacterized protein LOC103722643    167   6e-47   
ref|XP_008239908.1|  PREDICTED: uncharacterized protein LOC103338475    174   6e-47   
emb|CBI22723.3|  unnamed protein product                                166   9e-47   
ref|XP_011073214.1|  PREDICTED: uncharacterized protein LOC105158237    166   1e-46   
ref|XP_009139268.1|  PREDICTED: uncharacterized protein LOC103863265    166   1e-46   
gb|AFK41674.1|  unknown                                                 166   1e-46   
ref|XP_010035142.1|  PREDICTED: uncharacterized protein LOC104424422    166   1e-46   
ref|XP_010515917.1|  PREDICTED: uncharacterized protein LOC104791676    166   1e-46   
ref|XP_004234398.1|  PREDICTED: uncharacterized protein LOC101252153    166   1e-46   
ref|XP_002267610.1|  PREDICTED: uncharacterized protein LOC100251502    166   2e-46   Vitis vinifera
ref|XP_009388026.1|  PREDICTED: uncharacterized protein LOC103974853    165   2e-46   
ref|XP_010427069.1|  PREDICTED: uncharacterized protein LOC104711981    165   2e-46   
gb|EYU25099.1|  hypothetical protein MIMGU_mgv1a014446mg                166   2e-46   
ref|XP_011073213.1|  PREDICTED: uncharacterized protein LOC105158236    165   2e-46   
ref|XP_010035141.1|  PREDICTED: uncharacterized protein LOC104424421    165   2e-46   
ref|XP_010035139.1|  PREDICTED: uncharacterized protein LOC104424419    165   2e-46   
ref|XP_011081437.1|  PREDICTED: uncharacterized protein LOC105164481    164   2e-46   
ref|XP_010035140.1|  PREDICTED: uncharacterized protein LOC104424420    165   3e-46   
ref|XP_010909892.1|  PREDICTED: uncharacterized protein LOC105035875    165   3e-46   
ref|XP_011094948.1|  PREDICTED: uncharacterized protein LOC105174517    164   3e-46   
emb|CDY66558.1|  BnaC08g48820D                                          164   3e-46   
ref|XP_011073221.1|  PREDICTED: uncharacterized protein LOC105158244    164   4e-46   
ref|XP_011073211.1|  PREDICTED: uncharacterized protein LOC105158234    164   4e-46   
emb|CDY07560.1|  BnaC06g15040D                                          164   4e-46   
ref|XP_002267611.1|  PREDICTED: uncharacterized protein LOC100254...    164   4e-46   Vitis vinifera
ref|XP_010923167.1|  PREDICTED: uncharacterized protein LOC105046...    164   5e-46   
ref|XP_010662745.1|  PREDICTED: uncharacterized protein LOC100254...    164   5e-46   
ref|XP_006421929.1|  hypothetical protein CICLE_v10005988mg             164   5e-46   
ref|XP_007143423.1|  hypothetical protein PHAVU_007G071100g             164   6e-46   
ref|XP_006353293.1|  PREDICTED: uncharacterized protein LOC102592141    164   7e-46   
gb|KEH26321.1|  PAR1 protein                                            164   7e-46   
ref|XP_006363091.1|  PREDICTED: uncharacterized protein LOC102590281    163   1e-45   
ref|XP_003592283.1|  PAR-1a protein                                     164   1e-45   
ref|XP_011073220.1|  PREDICTED: uncharacterized protein LOC105158243    162   1e-45   
ref|XP_010326144.1|  PREDICTED: uncharacterized protein LOC101261443    162   1e-45   
ref|XP_006361911.1|  PREDICTED: uncharacterized protein LOC102603240    163   1e-45   
ref|XP_002520453.1|  conserved hypothetical protein                     163   1e-45   Ricinus communis
ref|XP_010671873.1|  PREDICTED: uncharacterized protein LOC104888552    164   2e-45   
ref|XP_011073222.1|  PREDICTED: uncharacterized protein LOC105158245    162   2e-45   
ref|XP_011032296.1|  PREDICTED: uncharacterized protein LOC105131158    162   2e-45   
ref|XP_010273059.1|  PREDICTED: uncharacterized protein LOC104608702    163   2e-45   
ref|XP_006291916.1|  hypothetical protein CARUB_v10018100mg             162   2e-45   
ref|XP_011078704.1|  PREDICTED: uncharacterized protein LOC105162404    162   2e-45   
ref|XP_004496561.1|  PREDICTED: uncharacterized protein LOC101495651    163   2e-45   
ref|XP_008794209.1|  PREDICTED: uncharacterized protein LOC103710316    162   3e-45   
gb|AFK34890.1|  unknown                                                 162   3e-45   
ref|XP_008798941.1|  PREDICTED: uncharacterized protein LOC103713707    162   4e-45   
ref|XP_011073216.1|  PREDICTED: uncharacterized protein LOC105158240    160   8e-45   
gb|ABK21049.1|  unknown                                                 160   1e-44   Picea sitchensis
ref|XP_010908211.1|  PREDICTED: uncharacterized protein LOC105034670    160   1e-44   
gb|KHF98264.1|  Cytosolic beta-glucosidase                              160   2e-44   
ref|XP_010671872.1|  PREDICTED: uncharacterized protein LOC104888551    161   2e-44   
emb|CAA58732.1|  PAR-1c                                                 160   2e-44   Nicotiana tabacum [American tobacco]
ref|XP_011073223.1|  PREDICTED: uncharacterized protein LOC105158246    159   2e-44   
ref|XP_009421325.1|  PREDICTED: uncharacterized protein LOC104000897    159   3e-44   
ref|XP_008806881.1|  PREDICTED: uncharacterized protein LOC103719421    159   4e-44   
ref|XP_002322474.1|  hypothetical protein POPTR_0015s13050g             159   6e-44   Populus trichocarpa [western balsam poplar]
ref|XP_010553064.1|  PREDICTED: uncharacterized protein LOC104823275    158   1e-43   
ref|XP_007038703.1|  PAR1 protein                                       158   1e-43   
ref|XP_006587314.1|  PREDICTED: uncharacterized protein LOC100778782    158   2e-43   
emb|CAA58731.1|  PAR-1b                                                 157   2e-43   Nicotiana tabacum [American tobacco]
ref|XP_006363092.1|  PREDICTED: uncharacterized protein LOC102590619    157   2e-43   
ref|XP_009604561.1|  PREDICTED: uncharacterized protein LOC104099311    157   2e-43   
ref|XP_011048721.1|  PREDICTED: uncharacterized protein LOC105142675    157   2e-43   
ref|XP_009770389.1|  PREDICTED: uncharacterized protein LOC104221096    157   3e-43   
ref|XP_011073212.1|  PREDICTED: uncharacterized protein LOC105158235    156   3e-43   
ref|XP_009599697.1|  PREDICTED: uncharacterized protein LOC104095302    156   4e-43   
ref|XP_011094947.1|  PREDICTED: uncharacterized protein LOC105174516    156   5e-43   
gb|EPS70832.1|  hypothetical protein M569_03929                         156   5e-43   
ref|XP_008377489.1|  PREDICTED: uncharacterized protein LOC103440565    157   5e-43   
ref|XP_009601817.1|  PREDICTED: uncharacterized protein LOC104097019    156   7e-43   
ref|XP_010529780.1|  PREDICTED: uncharacterized protein LOC104806532    155   7e-43   
emb|CAA58733.1|  PAR-1a                                                 156   7e-43   Nicotiana tabacum [American tobacco]
gb|KDP22273.1|  hypothetical protein JCGZ_26104                         155   1e-42   
ref|XP_009590873.1|  PREDICTED: uncharacterized protein LOC104087977    156   1e-42   
ref|XP_011076161.1|  PREDICTED: uncharacterized protein LOC105160472    155   1e-42   
ref|XP_002510782.1|  conserved hypothetical protein                     155   1e-42   Ricinus communis
ref|XP_011045688.1|  PREDICTED: uncharacterized protein LOC105140517    155   1e-42   
ref|XP_011030114.1|  PREDICTED: uncharacterized protein LOC105129658    155   1e-42   
ref|XP_009763985.1|  PREDICTED: uncharacterized protein LOC104215...    156   1e-42   
ref|XP_002318235.1|  hypothetical protein POPTR_0012s13140g             155   2e-42   Populus trichocarpa [western balsam poplar]
ref|XP_008785460.1|  PREDICTED: uncharacterized protein LOC103704086    155   2e-42   
ref|XP_006827667.1|  hypothetical protein AMTR_s00009p00254330          155   2e-42   
ref|XP_009340031.1|  PREDICTED: uncharacterized protein LOC103932...    155   2e-42   
ref|XP_010482600.1|  PREDICTED: uncharacterized protein LOC104761...    155   2e-42   
ref|XP_010490608.1|  PREDICTED: uncharacterized protein LOC104768360    154   3e-42   
ref|XP_010255407.1|  PREDICTED: uncharacterized protein LOC104596084    155   3e-42   
gb|ABK26953.1|  unknown                                                 155   4e-42   Picea sitchensis
ref|XP_010060939.1|  PREDICTED: uncharacterized protein LOC104448745    154   4e-42   
ref|XP_006388430.1|  hypothetical protein POPTR_0187s00200g             154   4e-42   
ref|XP_004230259.1|  PREDICTED: uncharacterized protein LOC101259981    156   5e-42   
gb|AAM62984.1|  photoassimilate-responsive protein PAR-like protein     154   6e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009342968.1|  PREDICTED: uncharacterized protein LOC103934926    154   6e-42   
emb|CDP09133.1|  unnamed protein product                                153   6e-42   
ref|XP_010482599.1|  PREDICTED: uncharacterized protein LOC104761...    154   7e-42   
ref|XP_009127249.1|  PREDICTED: uncharacterized protein LOC103852106    154   7e-42   
ref|XP_008376590.1|  PREDICTED: uncharacterized protein LOC103439761    154   8e-42   
ref|XP_002862543.1|  hypothetical protein ARALYDRAFT_920570             154   8e-42   
ref|XP_006424982.1|  hypothetical protein CICLE_v10029842mg             152   1e-41   
ref|XP_004240617.1|  PREDICTED: uncharacterized protein LOC101257567    153   1e-41   
ref|XP_004246366.2|  PREDICTED: uncharacterized protein LOC101261147    152   1e-41   
ref|NP_200052.1|  PAR1 protein                                          152   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009599617.1|  PREDICTED: uncharacterized protein LOC104095236    152   2e-41   
ref|XP_010423911.1|  PREDICTED: uncharacterized protein LOC104708952    152   3e-41   
ref|XP_002314136.2|  hypothetical protein POPTR_0009s04480g             152   3e-41   Populus trichocarpa [western balsam poplar]
ref|XP_004308085.1|  PREDICTED: uncharacterized protein LOC101293047    152   3e-41   
ref|XP_002865911.1|  hypothetical protein ARALYDRAFT_918281             152   3e-41   
ref|XP_011073209.1|  PREDICTED: uncharacterized protein LOC105158232    151   3e-41   
ref|XP_006388432.1|  hypothetical protein POPTR_0187s00220g             151   4e-41   
gb|ABK26944.1|  unknown                                                 152   5e-41   Picea sitchensis
ref|XP_011085664.1|  PREDICTED: uncharacterized protein LOC105167590    153   8e-41   
ref|XP_006401831.1|  hypothetical protein EUTSA_v10014733mg             150   9e-41   
ref|XP_009774343.1|  PREDICTED: uncharacterized protein LOC104224406    150   1e-40   
ref|XP_010444786.1|  PREDICTED: uncharacterized protein LOC104727386    150   1e-40   
emb|CDY60088.1|  BnaC02g45000D                                          150   2e-40   
ref|XP_008778806.1|  PREDICTED: uncharacterized protein LOC103698551    149   4e-40   
ref|XP_010909577.1|  PREDICTED: uncharacterized protein LOC105035650    149   5e-40   
ref|XP_006388431.1|  hypothetical protein POPTR_0187s00210g             148   6e-40   
ref|XP_007218440.1|  hypothetical protein PRUPE_ppa011685mg             149   7e-40   
ref|XP_010923168.1|  PREDICTED: uncharacterized protein LOC105046...    148   7e-40   
ref|XP_006358715.1|  PREDICTED: uncharacterized protein LOC102594490    147   1e-39   
emb|CDY27075.1|  BnaA02g10950D                                          153   1e-39   
ref|XP_010504193.1|  PREDICTED: uncharacterized protein LOC104781266    146   2e-39   
ref|XP_008234242.1|  PREDICTED: uncharacterized protein LOC103333213    147   2e-39   
ref|XP_006288746.1|  hypothetical protein CARUB_v10002062mg             146   4e-39   
gb|KFK26839.1|  hypothetical protein AALP_AA8G300600                    146   5e-39   
gb|EYU38454.1|  hypothetical protein MIMGU_mgv1a024144mg                145   7e-39   
ref|XP_006358727.1|  PREDICTED: uncharacterized protein LOC102598423    146   8e-39   
ref|XP_011073591.1|  PREDICTED: uncharacterized protein LOC105158505    145   9e-39   
ref|XP_010934761.1|  PREDICTED: uncharacterized protein LOC105054842    146   2e-38   
ref|XP_006403624.1|  hypothetical protein EUTSA_v10010808mg             142   3e-38   
ref|XP_009420109.1|  PREDICTED: uncharacterized protein LOC103999932    145   5e-38   
ref|XP_009629076.1|  PREDICTED: uncharacterized protein LOC104119315    143   5e-38   
ref|XP_010452028.1|  PREDICTED: uncharacterized protein LOC104734198    143   7e-38   
ref|XP_004140776.1|  PREDICTED: uncharacterized protein LOC101216404    143   1e-37   
ref|XP_006281102.1|  hypothetical protein CARUB_v10027132mg             142   3e-37   
ref|XP_004157197.1|  PREDICTED: uncharacterized protein LOC101225828    142   3e-37   
ref|XP_010923170.1|  PREDICTED: uncharacterized protein LOC105046...    140   5e-37   
emb|CDY13175.1|  BnaC04g26600D                                          141   6e-37   
gb|KDO52035.1|  hypothetical protein CISIN_1g029827mg                   139   6e-37   
gb|ABK27044.1|  unknown                                                 140   7e-37   Picea sitchensis
ref|XP_008439231.1|  PREDICTED: uncharacterized protein LOC103484081    140   1e-36   
ref|XP_009763986.1|  PREDICTED: uncharacterized protein LOC104215...    139   4e-36   
gb|KEH28949.1|  PAR1 protein                                            136   7e-36   
gb|ABK22647.1|  unknown                                                 138   8e-36   Picea sitchensis
ref|XP_009788534.1|  PREDICTED: uncharacterized protein LOC104236325    137   9e-36   
ref|XP_010923169.1|  PREDICTED: uncharacterized protein LOC105046...    136   1e-35   
gb|AFG47187.1|  hypothetical protein 0_8609_01                          135   2e-35   
gb|AFG47186.1|  hypothetical protein 0_8609_01                          135   2e-35   
gb|ABK24725.1|  unknown                                                 136   2e-35   Picea sitchensis
ref|XP_002439633.1|  hypothetical protein SORBIDRAFT_09g017290          135   3e-35   Sorghum bicolor [broomcorn]
ref|XP_010255408.1|  PREDICTED: uncharacterized protein LOC104596085    135   4e-35   
ref|XP_007152257.1|  hypothetical protein PHAVU_004G1144000g            134   6e-35   
ref|XP_009103900.1|  PREDICTED: uncharacterized protein LOC103829...    135   7e-35   
gb|AFG47202.1|  hypothetical protein 0_8609_01                          133   9e-35   
ref|XP_010537178.1|  PREDICTED: LOW QUALITY PROTEIN: sulfated sur...    136   1e-34   
ref|XP_002527887.1|  conserved hypothetical protein                     132   1e-34   Ricinus communis
ref|XP_004962356.1|  PREDICTED: uncharacterized protein LOC101785352    134   1e-34   
ref|XP_010108343.1|  hypothetical protein L484_006498                   135   3e-34   
ref|XP_008649530.1|  PREDICTED: uncharacterized protein LOC103630240    133   3e-34   
emb|CDP09132.1|  unnamed protein product                                133   5e-34   
ref|XP_008439229.1|  PREDICTED: uncharacterized protein LOC103484080    131   2e-33   
ref|XP_011032294.1|  PREDICTED: uncharacterized protein LOC105131157    131   2e-33   
ref|XP_006848035.1|  hypothetical protein AMTR_s00029p00186480          130   2e-33   
ref|XP_010040888.1|  PREDICTED: uncharacterized protein LOC104429762    132   3e-33   
emb|CDP09118.1|  unnamed protein product                                130   2e-31   
ref|XP_004140837.1|  PREDICTED: uncharacterized protein LOC101212311    124   1e-30   
ref|XP_004157223.1|  PREDICTED: uncharacterized protein LOC101232096    124   2e-30   
emb|CDP09117.1|  unnamed protein product                                122   2e-30   
ref|XP_001775001.1|  predicted protein                                  117   5e-29   
gb|KCW44819.1|  hypothetical protein EUGRSUZ_L01611                     116   2e-28   
gb|KGN57378.1|  hypothetical protein Csa_3G182140                       115   1e-27   
ref|XP_002971544.1|  hypothetical protein SELMODRAFT_412333             115   2e-27   
ref|XP_002975599.1|  hypothetical protein SELMODRAFT_103819             114   3e-27   
ref|XP_002993113.1|  hypothetical protein SELMODRAFT_48837              112   1e-26   
ref|XP_002439898.1|  hypothetical protein SORBIDRAFT_09g022170          112   2e-26   Sorghum bicolor [broomcorn]
ref|XP_006403623.1|  hypothetical protein EUTSA_v10011155mg             110   4e-26   
ref|XP_002973571.1|  hypothetical protein SELMODRAFT_99579              110   5e-26   
ref|XP_002439897.1|  hypothetical protein SORBIDRAFT_09g022160          111   6e-26   Sorghum bicolor [broomcorn]
ref|XP_002300182.2|  hypothetical protein POPTR_0001s32040g             106   1e-24   Populus trichocarpa [western balsam poplar]
ref|XP_002971753.1|  hypothetical protein SELMODRAFT_412334             108   1e-24   
ref|XP_008352803.1|  PREDICTED: TMV resistance protein N-like           114   2e-24   
ref|XP_002993093.1|  hypothetical protein SELMODRAFT_431237             107   3e-24   
gb|AFW78200.1|  hypothetical protein ZEAMMB73_055272                    104   2e-23   
ref|XP_002439894.1|  hypothetical protein SORBIDRAFT_09g022140          101   2e-22   Sorghum bicolor [broomcorn]
ref|XP_010058903.1|  PREDICTED: uncharacterized protein LOC104446793    100   2e-21   
gb|AEW08582.1|  hypothetical protein CL606Contig1_05                  85.9    1e-17   
ref|XP_010446049.1|  PREDICTED: uncharacterized protein LOC104728819  84.7    8e-17   
gb|AFG71371.1|  hypothetical protein CL606Contig1_05                  83.2    1e-16   
gb|AFG70528.1|  hypothetical protein CL1287Contig1_05                 82.4    1e-16   
gb|AFG71360.1|  hypothetical protein CL606Contig1_05                  83.2    1e-16   
gb|AEW08703.1|  hypothetical protein CL1287Contig1_05                 82.0    2e-16   
gb|AFG71365.1|  hypothetical protein CL606Contig1_05                  81.3    5e-16   
gb|KHN23208.1|  hypothetical protein glysoja_042488                   80.9    8e-16   
ref|XP_002439896.1|  hypothetical protein SORBIDRAFT_09g022150        82.8    1e-15   Sorghum bicolor [broomcorn]
gb|AFG71368.1|  hypothetical protein CL606Contig1_05                  79.7    2e-15   
gb|AFG65028.1|  hypothetical protein CL4404Contig1_01                 66.2    1e-10   
ref|XP_011079320.1|  PREDICTED: uncharacterized protein LOC105162865  64.3    2e-09   
ref|XP_002439895.1|  hypothetical protein SORBIDRAFT_09g022145        57.4    3e-07   Sorghum bicolor [broomcorn]
gb|KEH23075.1|  PAR1 protein                                          50.4    7e-05   



>ref|XP_009627921.1| PREDICTED: uncharacterized protein LOC104118395 [Nicotiana tomentosiformis]
Length=186

 Score =   217 bits (552),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 133/161 (83%), Gaps = 2/161 (1%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M S MK S +ILFF  +LFL G LG+I CE LPTNVCSF+I++SGKRCLLENS   +G K
Sbjct  1    MASHMKHSSIILFFACTLFLRGALGEIICENLPTNVCSFSIASSGKRCLLENSENKDG-K  59

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
            +EYQCKTSEVVVG+    +IETDECV ACG+DR SVG+SSDSLLEP FTAKLCS  CYQN
Sbjct  60   MEYQCKTSEVVVGNMAE-YIETDECVNACGVDRNSVGISSDSLLEPQFTAKLCSPPCYQN  118

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
            CPN+VDLYFNLAAGEGVYLPDLC+KQRS   R ++EL S+G
Sbjct  119  CPNVVDLYFNLAAGEGVYLPDLCNKQRSSPHRAMIELLSSG  159



>ref|XP_006339001.1| PREDICTED: uncharacterized protein LOC102585649 [Solanum tuberosum]
Length=186

 Score =   216 bits (549),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 131/162 (81%), Gaps = 2/162 (1%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M  SMK S ++LFF  +LFL   LG+ITCE LP N+CSF+IS+SGKRCLLENS  NE  K
Sbjct  1    MALSMKHSSIVLFFASTLFLQVALGEITCENLPINICSFSISSSGKRCLLENS-ANEDGK  59

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
            +EYQCKTSEV+V +    +IETDEC+ +CG+DR SVG+SSDSLLEP FTAKLCS SCY+N
Sbjct  60   LEYQCKTSEVIVANIAE-YIETDECINSCGVDRNSVGISSDSLLEPQFTAKLCSPSCYRN  118

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGG  577
            CPN+VDLYFNLAAGEGVYLPDLC KQRS   R ++EL S+G 
Sbjct  119  CPNVVDLYFNLAAGEGVYLPDLCSKQRSSPHRAMIELLSSGA  160



>ref|XP_004249554.1| PREDICTED: uncharacterized protein LOC101267755 [Solanum lycopersicum]
Length=187

 Score =   216 bits (549),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 130/157 (83%), Gaps = 2/157 (1%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M  SMK S +ILFF  +LFL   LG+ITCE LPTNVCSF+IS+SGKRCLLENS T +G K
Sbjct  1    MALSMKHSSIILFFASTLFLQVALGEITCENLPTNVCSFSISSSGKRCLLENSATEDG-K  59

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
            +EYQCKTSEVVV +    ++ETDEC+ +CG+DR SVG+SSDSLLEP FTAKLCS SCY+N
Sbjct  60   LEYQCKTSEVVVANIAE-YVETDECINSCGVDRNSVGISSDSLLEPQFTAKLCSPSCYRN  118

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVEL  562
            CPN+VDLYFNLAAGEGVYLPDLC KQRS   R ++EL
Sbjct  119  CPNVVDLYFNLAAGEGVYLPDLCSKQRSSPHRAMIEL  155



>ref|XP_009794767.1| PREDICTED: uncharacterized protein LOC104241517 [Nicotiana sylvestris]
Length=181

 Score =   213 bits (542),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 129/154 (84%), Gaps = 2/154 (1%)
 Frame = +2

Query  113  SLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKT  292
            S MILFF  +LFL G LG+I CE LP NVCSF+I++SGKRCLLENS  N+G K+EYQCKT
Sbjct  3    SYMILFFACTLFLQGALGEIICENLPKNVCSFSIASSGKRCLLENSANNDG-KMEYQCKT  61

Query  293  sevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDL  472
            SEVVVG+    +IETDECV ACG+DR SVG+SSDSLLEP FTAKLCS  CYQNCPN+VDL
Sbjct  62   SEVVVGNMAE-YIETDECVNACGVDRNSVGISSDSLLEPHFTAKLCSPPCYQNCPNVVDL  120

Query  473  YFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
            YFNLAAGEGVYLP+LC+KQRS   R ++EL S+G
Sbjct  121  YFNLAAGEGVYLPELCNKQRSSPHRAMIELLSSG  154



>emb|CDP06536.1| unnamed protein product [Coffea canephora]
Length=185

 Score =   213 bits (541),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 135/175 (77%), Gaps = 5/175 (3%)
 Frame = +2

Query  92   MDSSMKLSL-MILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGN  268
            M SS  L+   +LFF  SLFL G  G+I CE LPTNVCSF+I++SGKRCLLEN    +G 
Sbjct  1    MASSSSLTFSFVLFFACSLFLRGTQGEIVCEELPTNVCSFSIASSGKRCLLENLKGKDG-  59

Query  269  KVEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQ  448
            KVEYQC+TSEVVV      HIETDECV ACG+DR +VG+SSD+  EP+FTAKLCS +CYQ
Sbjct  60   KVEYQCRTSEVVVERMAE-HIETDECVSACGVDRNAVGISSDAFFEPLFTAKLCSPACYQ  118

Query  449  NCPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSSEESD  613
            NCPNI+DLYFNLAAGEGVYLP LC+KQRS   R ++EL SNG   A GP++ +S+
Sbjct  119  NCPNIIDLYFNLAAGEGVYLPALCEKQRSRPHRAMIELLSNGA--APGPAAPQSE  171



>ref|XP_009787582.1| PREDICTED: uncharacterized protein LOC104235494 [Nicotiana sylvestris]
 dbj|BAB16427.1| NtEIG-E80 [Nicotiana tabacum]
Length=175

 Score =   209 bits (532),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 131/162 (81%), Gaps = 3/162 (2%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M S++K S MI+FF  +LFL G LG+  CE LPTNVC FAI+TSGKRCLLENS   +G K
Sbjct  1    MASTLKYS-MIIFFASALFLQGTLGNFICEDLPTNVCGFAIATSGKRCLLENSAGEDG-K  58

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
            VEYQCKTSEV+VG+    HIETDECV+ACG DR SVG+SSD+LL+  FT KLCS +CYQ 
Sbjct  59   VEYQCKTSEVIVGNMKE-HIETDECVDACGCDRNSVGISSDALLDSQFTFKLCSPACYQK  117

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGG  577
            C NIVDLYFNLAAGEGVYLPDLC+KQR++  R ++EL+SNG 
Sbjct  118  CANIVDLYFNLAAGEGVYLPDLCNKQRTNPHRAMIELSSNGA  159



>ref|XP_006349478.1| PREDICTED: uncharacterized protein LOC102591129 [Solanum tuberosum]
Length=175

 Score =   206 bits (525),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 125/155 (81%), Gaps = 2/155 (1%)
 Frame = +2

Query  113  SLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKT  292
            S  ILFFV +LFL G LG   CE LPTNVC FAI+TS KRCLLENS  N+G KVEYQCKT
Sbjct  7    SSFILFFVSTLFLQGTLGSFICEELPTNVCGFAIATSAKRCLLENSSGNDG-KVEYQCKT  65

Query  293  sevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDL  472
            SEVVV +    HIETDECV+ACG+DR SVG+SSD+LL+  FT+KLCS  CY +C NI+DL
Sbjct  66   SEVVVANMRE-HIETDECVDACGVDRNSVGISSDALLDSQFTSKLCSLDCYHHCANIIDL  124

Query  473  YFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGG  577
            YFNLAAGEGVYLPDLC+KQR++  R + EL+SNGG
Sbjct  125  YFNLAAGEGVYLPDLCNKQRTNPHRAMAELSSNGG  159



>ref|XP_009613648.1| PREDICTED: uncharacterized protein LOC104106740 [Nicotiana tomentosiformis]
Length=174

 Score =   202 bits (514),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 128/162 (79%), Gaps = 3/162 (2%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M SSMK SL ILFF  SLFL   LG+I CE LPTNVC+F+I++SGKRCLLE S   +G K
Sbjct  1    MASSMKSSL-ILFFTCSLFLQVALGEIICENLPTNVCAFSIASSGKRCLLEKSALEDG-K  58

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
             EYQCKTSEV+VG+    +IETDECV ACG+DR SVG+SSDSLLE  FT+KLCS  CY  
Sbjct  59   SEYQCKTSEVIVGNMRE-YIETDECVNACGVDRNSVGISSDSLLEAQFTSKLCSPDCYHK  117

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGG  577
            CPN+VDLYFNLAAGEGVYLPDLC KQR++  R ++EL S+G 
Sbjct  118  CPNVVDLYFNLAAGEGVYLPDLCKKQRTNPHRAMIELQSSGA  159



>ref|XP_009783756.1| PREDICTED: uncharacterized protein LOC104232282 [Nicotiana sylvestris]
Length=174

 Score =   202 bits (514),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 128/162 (79%), Gaps = 3/162 (2%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M SSMK SL ILFF  SLFL   LG+I CE LPTN+C+F+I++SGKRCLLE S   +G K
Sbjct  1    MASSMKSSL-ILFFTCSLFLQVALGEIICENLPTNICAFSIASSGKRCLLEKSTLEDG-K  58

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
             EYQCKTSEV+VG+    +IETDECV ACG+DR SVG+SSDSLLE  FT+KLCS  CY  
Sbjct  59   SEYQCKTSEVIVGNMRE-YIETDECVNACGVDRNSVGISSDSLLEAQFTSKLCSPDCYHK  117

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGG  577
            CPN+VDLYFNLAAGEGVYLPDLC KQRS+  R ++EL S+G 
Sbjct  118  CPNVVDLYFNLAAGEGVYLPDLCKKQRSNPHRAMIELQSSGA  159



>ref|XP_004249680.1| PREDICTED: uncharacterized protein LOC101253546 [Solanum lycopersicum]
Length=175

 Score =   199 bits (506),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 129/165 (78%), Gaps = 5/165 (3%)
 Frame = +2

Query  113  SLMILFFVGSLFLPGV-LGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCK  289
            S  ILFFV  +FL G  LG   CE L TNVC FAISTSGKRCLLENS   +G KVEYQCK
Sbjct  7    SCFILFFVSMVFLQGTTLGSFICEDLATNVCGFAISTSGKRCLLENSSGKDG-KVEYQCK  65

Query  290  TsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVD  469
            TSEVVV +    HIET+ECV+ACG+DR +VG+SSD+LL+  FT+KLCS  CY +CPNI+D
Sbjct  66   TSEVVVANMRE-HIETEECVDACGVDRNTVGISSDALLDSQFTSKLCSLDCYHHCPNIID  124

Query  470  LYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGG--EKALGPS  598
            LYFNLAAGEGVYLPDLC+KQR++  R ++EL+SNGG  E A  PS
Sbjct  125  LYFNLAAGEGVYLPDLCNKQRTNPHRAIIELSSNGGPIEDAPAPS  169



>ref|XP_010101846.1| hypothetical protein L484_023636 [Morus notabilis]
 gb|EXB89983.1| hypothetical protein L484_023636 [Morus notabilis]
Length=180

 Score =   198 bits (504),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 124/162 (77%), Gaps = 3/162 (2%)
 Frame = +2

Query  122  ILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsev  301
            ++ F+ SLF+   L +I CE LP +VC+FAI++SGKRCLLE +   +  +VE+QC+TSEV
Sbjct  9    VVLFLSSLFIHAALAEIVCEELPLDVCAFAIASSGKRCLLETTAAGKDGRVEHQCRTSEV  68

Query  302  vvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFN  481
            VV      +IETD CVEACG+DRKSVG+SSDSLLEP F AKLC+  C+QNCPNIVDLYFN
Sbjct  69   VVERMAE-YIETDRCVEACGVDRKSVGISSDSLLEPQFMAKLCAQECHQNCPNIVDLYFN  127

Query  482  LAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSSEE  607
            LAAGEGV+LPDLC+KQR    R +VEL S+G   A GP + E
Sbjct  128  LAAGEGVFLPDLCEKQRYSPHRVMVELMSSGA--APGPVATE  167



>ref|XP_008442484.1| PREDICTED: uncharacterized protein LOC103486338 [Cucumis melo]
Length=181

 Score =   196 bits (498),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 124/163 (76%), Gaps = 2/163 (1%)
 Frame = +2

Query  116  LMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTs  295
            L  L F+ SLF+    G+I CE L  +VC+F+I++SGKRCLLE S T EG K EYQC+TS
Sbjct  7    LAFLLFISSLFVSAAFGEIVCEELSVDVCAFSIASSGKRCLLETSETKEG-KFEYQCRTS  65

Query  296  evvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLY  475
            EV+V      +IETD+C+ ACGLDR SVG++SD+LLEP FTAKLCS SCYQ CPNIVDLY
Sbjct  66   EVMVEWMAD-YIETDQCINACGLDRNSVGIASDALLEPQFTAKLCSPSCYQKCPNIVDLY  124

Query  476  FNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSSE  604
            FN+AAGEGV+LPDLC+KQR++  R + EL S+G   A   S+E
Sbjct  125  FNMAAGEGVFLPDLCEKQRTNPHRAMAELLSSGIAAAPMSSAE  167



>ref|XP_007026832.1| PAR1 protein [Theobroma cacao]
 gb|EOY07334.1| PAR1 protein [Theobroma cacao]
Length=179

 Score =   195 bits (496),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 124/162 (77%), Gaps = 4/162 (2%)
 Frame = +2

Query  122  ILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsev  301
            +  F+ SLFL   L +I CE LP +VC+F+I++SGKRCLLE +V  +GN VEYQC+TSEV
Sbjct  8    VFLFISSLFLHASLAEIICEDLPKDVCAFSIASSGKRCLLETAVVKDGN-VEYQCRTSEV  66

Query  302  vvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFN  481
            VV      +IE+DECV ACG+DR S+G+SSDSLLEP  TAKLC+ +CYQ CPNIVDLYFN
Sbjct  67   VVERMAE-YIESDECVRACGVDRSSIGISSDSLLEPQLTAKLCAPACYQKCPNIVDLYFN  125

Query  482  LAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSSEE  607
            LAAGEGV+LPDLC  QR++ RR + EL S+G   A GP S E
Sbjct  126  LAAGEGVFLPDLCHAQRTNPRRTMFELLSSGA--APGPVSSE  165



>ref|XP_004302677.1| PREDICTED: uncharacterized protein LOC101299015 [Fragaria vesca 
subsp. vesca]
Length=183

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 127/168 (76%), Gaps = 3/168 (2%)
 Frame = +2

Query  104  MKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQ  283
            M   L ++ F+ SLF+   L    CE LP +VC+F++S++GKRCL+E    N GN VEYQ
Sbjct  1    MAAKLPLVLFLSSLFIHAALAAFVCEDLPNDVCAFSVSSAGKRCLIETMAKNNGN-VEYQ  59

Query  284  CKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNI  463
            C+TSEV+V      ++ETDECV ACG+DRKSVG+SSDSLLEP F +KLCS +CYQ CPNI
Sbjct  60   CRTSEVMVEGLAE-YMETDECVNACGVDRKSVGISSDSLLEPQFMSKLCSPNCYQKCPNI  118

Query  464  VDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSSEE  607
            V+LYFNLAAGEGV+LPDLC++QRS+  R ++EL S+ GE A GP + E
Sbjct  119  VELYFNLAAGEGVFLPDLCERQRSNPHRAMIELMSS-GEAAPGPVTSE  165



>gb|EYU41813.1| hypothetical protein MIMGU_mgv1a014652mg [Erythranthe guttata]
Length=182

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 130/172 (76%), Gaps = 3/172 (2%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M SSMK SL ILFF  SLF+ G+L ++ CE LP N CSFAI++SGKRC+LEN  ++E   
Sbjct  1    MASSMKSSL-ILFFASSLFVQGILAELICEDLPANRCSFAIASSGKRCVLEN-FSDERGT  58

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
            ++Y CKTSEVVV    G +IETDECV ACG+DR  VG+SSD+ L   FT +LCS +CYQN
Sbjct  59   LDYTCKTSEVVVERLSG-YIETDECVNACGVDRGFVGISSDAFLTADFTPRLCSPACYQN  117

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSSEE  607
            CPNIVDLYFNLAAGEGVYLP LC KQ+S+  R ++EL S+GG  A GP + +
Sbjct  118  CPNIVDLYFNLAAGEGVYLPALCQKQKSNPHRAMLELLSSGGGAAPGPVAAD  169



>ref|XP_004137744.1| PREDICTED: uncharacterized protein LOC101218677 [Cucumis sativus]
 ref|XP_004168412.1| PREDICTED: uncharacterized LOC101218677 [Cucumis sativus]
 gb|KGN58812.1| hypothetical protein Csa_3G732680 [Cucumis sativus]
Length=183

 Score =   192 bits (489),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 124/162 (77%), Gaps = 4/162 (2%)
 Frame = +2

Query  116  LMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTs  295
               LF + SLF+    G+I CE L  +VC+F+I++SGKRCLLE S T EG K EYQC+TS
Sbjct  7    FAFLFCISSLFVSAAFGEIVCEELSVDVCAFSIASSGKRCLLETSETKEG-KFEYQCRTS  65

Query  296  evvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLY  475
            EV+V      +IE+D+C+ ACGLDR SVG++SD+LLEP FTAKLCS SCYQ CPNIVDLY
Sbjct  66   EVIVEWMAD-YIESDQCINACGLDRNSVGIASDALLEPQFTAKLCSPSCYQKCPNIVDLY  124

Query  476  FNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSS  601
            FN+AAGEGV+LPDLC+KQR++ RR + +L S+G   A GP S
Sbjct  125  FNMAAGEGVFLPDLCEKQRTNPRRAMAQLLSSG--VAAGPVS  164



>ref|XP_002276542.1| PREDICTED: uncharacterized protein LOC100246012 [Vitis vinifera]
 emb|CBI30454.3| unnamed protein product [Vitis vinifera]
Length=185

 Score =   192 bits (488),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 124/164 (76%), Gaps = 4/164 (2%)
 Frame = +2

Query  119  MILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTse  298
             ILF V SL L    G+I CE LP + C+F+I++SGKRCLLE     E  ++EYQC+TSE
Sbjct  12   FILFLVSSLLLHAAFGEIICEELPNDKCAFSIASSGKRCLLEK-YARENGEMEYQCRTSE  70

Query  299  vvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYF  478
            V+V      +IETD+CV ACG+DR SVG+SSDSLLEP FTAKLCSS+CY NCPNI+DLYF
Sbjct  71   VIVERMSE-YIETDQCVSACGVDRSSVGISSDSLLEPQFTAKLCSSNCYHNCPNIIDLYF  129

Query  479  NLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSSEES  610
            NLAAGEGV+LPDLC+ +R +  R +VEL S+G   ALGP + +S
Sbjct  130  NLAAGEGVFLPDLCEARRINPHRSMVELLSSGA--ALGPVAPQS  171



>ref|XP_006488680.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Citrus 
sinensis]
 gb|KDO66716.1| hypothetical protein CISIN_1g043358mg [Citrus sinensis]
Length=229

 Score =   191 bits (484),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 123/163 (75%), Gaps = 4/163 (2%)
 Frame = +2

Query  119  MILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTse  298
            +ILF     FL G LG I CE LP  +CS+++S+SGKRCLLEN  +++G  V YQCKTSE
Sbjct  4    IILFLAFCFFLQGALGGIICEQLPKQLCSYSVSSSGKRCLLENFASSDGT-VTYQCKTSE  62

Query  299  vvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYF  478
            V+V       IET+EC  ACG+DRKSVG+SSDSLL+P FTAKLCS +CYQNCPNIVDLYF
Sbjct  63   VIVDVVHD-WIETEECTNACGVDRKSVGISSDSLLQPQFTAKLCSDACYQNCPNIVDLYF  121

Query  479  NLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSSEE  607
            NLA GEGVYLP LC+ QR++ RR + ++ S+G   A GP+S +
Sbjct  122  NLALGEGVYLPSLCEAQRTNPRRAMSDIKSSGA--AWGPASAK  162



>gb|KHN12948.1| hypothetical protein glysoja_042216 [Glycine soja]
Length=180

 Score =   187 bits (476),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 129/174 (74%), Gaps = 6/174 (3%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M  S KL L++LF   SLF+   L ++ CE LP  VC+F++++SGKRCLLE     +G  
Sbjct  1    MSFSTKLPLVLLF--SSLFIHASLAEMVCEDLPKEVCAFSVASSGKRCLLETEKAADGG-  57

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
            VEYQC+TSEVVV      +IETD+CVEACG+DR SVG+SSD+  EP FT KLCS +CYQ 
Sbjct  58   VEYQCRTSEVVVERMAD-YIETDQCVEACGVDRNSVGISSDAFFEPQFTGKLCSPACYQK  116

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSSEESD  613
            CPNIVDL+FNLAAGEGV+LP+LC+K +++ RR +VEL S+G   A GP S+ S+
Sbjct  117  CPNIVDLFFNLAAGEGVFLPELCEKHKTNPRRAMVELVSSGA--APGPVSDVSE  168



>ref|NP_001242705.1| uncharacterized protein LOC100815307 precursor [Glycine max]
 gb|ACU17875.1| unknown [Glycine max]
Length=180

 Score =   187 bits (475),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 129/174 (74%), Gaps = 6/174 (3%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M  S KL L++LF   SLF+   L ++ CE LP  VC+F++++SGKRCLLE     +G  
Sbjct  1    MSFSTKLPLVLLF--SSLFIHASLAEMVCEDLPKEVCAFSVASSGKRCLLETEKAADGG-  57

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
            VEYQC+TSEVVV      +IETD+CVEACG+DR SVG+SSD+  EP FT KLCS +CYQ 
Sbjct  58   VEYQCRTSEVVVERMAD-YIETDQCVEACGVDRNSVGISSDAFFEPQFTDKLCSPACYQK  116

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSSEESD  613
            CPNIVDL+FNLAAGEGV+LP+LC+K +++ RR +VEL S+G   A GP S+ S+
Sbjct  117  CPNIVDLFFNLAAGEGVFLPELCEKHKTNPRRAMVELVSSGA--APGPVSDVSE  168



>ref|XP_006429255.1| hypothetical protein CICLE_v10012857mg [Citrus clementina]
 ref|XP_006480931.1| PREDICTED: uncharacterized protein LOC102628059 [Citrus sinensis]
 gb|ESR42495.1| hypothetical protein CICLE_v10012857mg [Citrus clementina]
 gb|KDO58021.1| hypothetical protein CISIN_1g029564mg [Citrus sinensis]
Length=191

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 125/163 (77%), Gaps = 4/163 (2%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M SS++LS ++  F+ SLFL   L +I CE LP NVC+F+I++SGKRCLLE   T +G+ 
Sbjct  1    MASSLRLSFVL--FLSSLFLHAALAEIECESLPKNVCAFSIASSGKRCLLETYTTKDGS-  57

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
            +E+ CKTS+VVV      +IETD CV+ACG+DR +VG+SSD+LLEP F +KLCS +CYQ 
Sbjct  58   LEFLCKTSDVVVEKMAD-YIETDRCVKACGVDRNAVGISSDALLEPEFASKLCSPACYQK  116

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGE  580
            CPNIVDLYFNLAAGEG YLPD+C   RS+  R +++L S+GG+
Sbjct  117  CPNIVDLYFNLAAGEGAYLPDICQATRSNPHRSMLQLLSSGGD  159



>ref|XP_010262709.1| PREDICTED: uncharacterized protein LOC104601167 [Nelumbo nucifera]
Length=191

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 123/160 (77%), Gaps = 5/160 (3%)
 Frame = +2

Query  116  LMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTs  295
            L+ LFF  S+ L GVLG+I CE LP ++C+F+I++SG+RCLLE  +T+     EYQC+TS
Sbjct  10   LLPLFFSLSVSLHGVLGEIICENLPKDLCAFSIASSGQRCLLETYLTD--GTTEYQCRTS  67

Query  296  evvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLY  475
            +V+V       IE+DECV ACG+DR SVG+SSD+LLEP FTAKLCS +CYQNCPNIVDLY
Sbjct  68   DVIVERMTE-WIESDECVRACGVDRNSVGISSDALLEPQFTAKLCSPACYQNCPNIVDLY  126

Query  476  FNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGP  595
            FNLAAGEG +LPDLC  QR++  R ++EL SNG   A GP
Sbjct  127  FNLAAGEGAFLPDLCMAQRTNPHRAMIELLSNGA--AAGP  164



>ref|XP_007207936.1| hypothetical protein PRUPE_ppa017583mg [Prunus persica]
 gb|EMJ09135.1| hypothetical protein PRUPE_ppa017583mg [Prunus persica]
Length=195

 Score =   186 bits (473),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 128/170 (75%), Gaps = 5/170 (3%)
 Frame = +2

Query  101  SMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEY  280
            S K SL +  F+ SL +  VLG   CE LP +VC+F++S++GKRCLLE     +G+ +EY
Sbjct  5    STKFSLAL--FLSSLCIHAVLGGFICEDLPNDVCAFSVSSAGKRCLLETMAKKDGS-IEY  61

Query  281  QCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPN  460
            QC+TSEV+V      +IETD+CV+ACG+DRKSVG+SSD+LLEP F  KLCS +CYQ CPN
Sbjct  62   QCRTSEVLVQGVAE-YIETDQCVKACGIDRKSVGISSDALLEPQFMTKLCSPTCYQKCPN  120

Query  461  IVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSSEES  610
            IV+LYFNLAAGEG +LPDLCDKQR++  R +++L S+ GE   GP S +S
Sbjct  121  IVELYFNLAAGEGAFLPDLCDKQRTNPHRAMLQLLSS-GEAVAGPVSSKS  169



>gb|KHN27004.1| hypothetical protein glysoja_040812 [Glycine soja]
Length=181

 Score =   185 bits (470),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 126/170 (74%), Gaps = 6/170 (4%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M  S KL L++LF   SLF+   L ++ CE LP  VC+F++++SGKRCLLE     +G  
Sbjct  1    MSFSTKLPLVLLF--SSLFIHASLAEMVCEDLPKEVCAFSLASSGKRCLLETEKVADGG-  57

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
            VEYQC+TSEVVV      +IETD+CVEACG+DR SVG+SSD+  EP FT KLCS +CYQ 
Sbjct  58   VEYQCRTSEVVVERMAE-YIETDQCVEACGVDRNSVGISSDAFFEPQFTGKLCSPACYQK  116

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSS  601
            CPNI+DL+FNLAAGEGV+LP+LC+K +++ RR +VEL S+G   A GP S
Sbjct  117  CPNIIDLFFNLAAGEGVFLPELCEKHKTNPRRAMVELVSSGA--APGPVS  164



>ref|XP_008388101.1| PREDICTED: uncharacterized protein LOC103450515 [Malus domestica]
Length=190

 Score =   185 bits (470),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 137/205 (67%), Gaps = 21/205 (10%)
 Frame = +2

Query  119  MILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTse  298
             +  F+  L +  VLG+  CE LP +VC+F++S++GKRCLLE     +G+ +EYQC+TSE
Sbjct  7    FLALFLSFLSIHAVLGEFICEDLPNDVCAFSVSSAGKRCLLETMSKKDGS-IEYQCRTSE  65

Query  299  vvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYF  478
            VVV      +IETD+CV+ACG+DRKSVG+SSD+LLEP F AKLCS+ CYQ CPNI DLYF
Sbjct  66   VVVEGVAD-YIETDQCVQACGIDRKSVGISSDALLEPQFMAKLCSAPCYQKCPNIADLYF  124

Query  479  NLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSSEESDaaaaplrsprraMVE  658
            NLAAGEGV+LPDLCDKQRS+  R ++ L S+ GE A  P                    +
Sbjct  125  NLAAGEGVFLPDLCDKQRSNPHRSMIALLSS-GEAAPSPHGS-----------------Q  166

Query  659  LSSGSGASTPTPVDAGDAPAAPSSI  733
            L SG  A+ P P +A +  +APS +
Sbjct  167  LPSGLHAAYP-PSEAFEPASAPSPM  190



>ref|NP_001238081.1| uncharacterized protein LOC100500181 precursor [Glycine max]
 gb|ACU15142.1| unknown [Glycine max]
Length=181

 Score =   184 bits (467),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 126/170 (74%), Gaps = 6/170 (4%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M  S KL L++LF   SLF+   L ++ CE LP  VC+F++++SGKRCLLE     +G  
Sbjct  1    MSFSTKLPLVLLF--SSLFIHASLAEMVCEDLPKEVCAFSLASSGKRCLLETEKVADGC-  57

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
            VEYQC+TSEVVV      +IETD+CVEACG+DR SVG+SSD+  EP FT KLCS +CYQ 
Sbjct  58   VEYQCRTSEVVVERMAE-YIETDQCVEACGVDRNSVGISSDAFFEPQFTGKLCSPACYQK  116

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSS  601
            CPNI+DL+FNLAAGEGV+LP+LC+K +++ RR +VEL S+G   A GP S
Sbjct  117  CPNIIDLFFNLAAGEGVFLPELCEKHKTNPRRAMVELVSSGA--APGPVS  164



>gb|KCW49488.1| hypothetical protein EUGRSUZ_K03007 [Eucalyptus grandis]
Length=257

 Score =   185 bits (470),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 124/148 (84%), Gaps = 4/148 (3%)
 Frame = +2

Query  167  DITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETDEC  346
            +ITCE +P ++C+FAI++SGKRCLLE ++T+ G +VEYQC+TSEVVV    G ++E DEC
Sbjct  101  EITCEEIPNDMCAFAIASSGKRCLLE-TLTSAGGEVEYQCRTSEVVVERMAG-YVEGDEC  158

Query  347  VEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLCDK  526
            V+ACG+DR+SVG+SSDSL++P FT++LC+  C+QNCPNIVDLYFNLAAGEGVYLPDLCD 
Sbjct  159  VQACGVDRRSVGISSDSLMDPQFTSRLCAPQCFQNCPNIVDLYFNLAAGEGVYLPDLCDA  218

Query  527  QRSHNRRDLVELNSNGGEKALGPSSEES  610
            QR++  R ++EL S+G   A GP+S +S
Sbjct  219  QRANPHRTMIELLSSGA--APGPASAQS  244



>ref|XP_010039173.1| PREDICTED: uncharacterized protein LOC104427850 [Eucalyptus grandis]
Length=257

 Score =   185 bits (469),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 124/148 (84%), Gaps = 4/148 (3%)
 Frame = +2

Query  167  DITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETDEC  346
            +ITCE +P ++C+FAI++SGKRCLLE ++T+ G +VEYQC+TSEVVV    G ++E DEC
Sbjct  101  EITCEEIPNDMCAFAIASSGKRCLLE-TLTSAGGEVEYQCRTSEVVVERMAG-YVEGDEC  158

Query  347  VEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLCDK  526
            V+ACG+DR+SVG+SSDSL++P FT++LC+  C+QNCPNIVDLYFNLAAGEGVYLPDLCD 
Sbjct  159  VQACGVDRRSVGISSDSLMDPQFTSRLCAPQCFQNCPNIVDLYFNLAAGEGVYLPDLCDA  218

Query  527  QRSHNRRDLVELNSNGGEKALGPSSEES  610
            QR++  R ++EL S+G   A GP+S +S
Sbjct  219  QRANPHRTMIELLSSGA--APGPASAQS  244



>ref|XP_009358815.1| PREDICTED: uncharacterized protein LOC103949427 [Pyrus x bretschneideri]
Length=190

 Score =   182 bits (463),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 132/192 (69%), Gaps = 21/192 (11%)
 Frame = +2

Query  158  VLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIET  337
            VLG+  CE LP +VC+F++S++GKRCLLE     +G+ +EYQC+TSEVVV      +IET
Sbjct  20   VLGEFICEDLPNDVCAFSVSSAGKRCLLETMSKKDGS-IEYQCRTSEVVVEGVAD-YIET  77

Query  338  DECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDL  517
            D+CV+ACG+DRKSVG+SSD+LLEP F AKLCS+ CYQ CPNI DLYFNLAAGEGV+LPDL
Sbjct  78   DQCVQACGIDRKSVGISSDALLEPQFMAKLCSAPCYQKCPNIADLYFNLAAGEGVFLPDL  137

Query  518  CDKQRSHNRRDLVELNSNGGEKALGPSSEESDaaaaplrsprraMVELSSGSGASTPTPV  697
            CDKQRS+  R ++ L S+ GE A  P                    +L SG  A+ P P 
Sbjct  138  CDKQRSNPHRAMIALLSS-GEAAPSPHGS-----------------QLPSGLSAAYP-PS  178

Query  698  DAGDAPAAPSSI  733
            +A +  +APS +
Sbjct  179  EAFEPASAPSPM  190



>ref|XP_008239896.1| PREDICTED: uncharacterized protein LOC103338466 [Prunus mume]
Length=195

 Score =   182 bits (461),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 119/152 (78%), Gaps = 3/152 (2%)
 Frame = +2

Query  155  GVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIE  334
             VLG   CE LP +VC+F++S++GKRCLLE     +G+ +EYQC+TSEV+V      +IE
Sbjct  21   AVLGGFICEDLPNDVCAFSVSSAGKRCLLETMAKKDGS-IEYQCRTSEVLVQGVAE-YIE  78

Query  335  TDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPD  514
            TD+CV+ACG+DRKSVG+SSD+LLEP F  KLCS +CYQ CPNIV+LYFNLAAGEG +LPD
Sbjct  79   TDQCVKACGIDRKSVGISSDALLEPQFMTKLCSPTCYQKCPNIVELYFNLAAGEGAFLPD  138

Query  515  LCDKQRSHNRRDLVELNSNGGEKALGPSSEES  610
            LCDKQR++  R +++L S+ GE A GP S +S
Sbjct  139  LCDKQRTNPHRAMLQLLSS-GEAAPGPVSSKS  169



>gb|EYU26632.1| hypothetical protein MIMGU_mgv1a014768mg [Erythranthe guttata]
Length=179

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 119/162 (73%), Gaps = 3/162 (2%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M SS+KL+L  LFF  SLFL G L ++ CE LP N+CSFAI++SGKRC+LEN   NE  K
Sbjct  1    MASSIKLTLA-LFFTCSLFLQGTLAEVVCENLPENLCSFAIASSGKRCVLEN-YKNEDGK  58

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
            ++Y CK+SEVVV    G +IE+D+C+ ACGLDR  VG+SSD+ L   FT  LCS +CYQN
Sbjct  59   LDYTCKSSEVVVERLSG-YIESDQCIAACGLDRTFVGISSDAFLTQEFTTSLCSPACYQN  117

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGG  577
            CPNIVDLYFNLAAGEGVYLP LC KQ++   R + EL S   
Sbjct  118  CPNIVDLYFNLAAGEGVYLPALCQKQKTSPHRAMFELLSGAA  159



>ref|XP_002323542.2| hypothetical protein POPTR_0016s11600g [Populus trichocarpa]
 gb|EEF05303.2| hypothetical protein POPTR_0016s11600g [Populus trichocarpa]
Length=178

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 114/149 (77%), Gaps = 4/149 (3%)
 Frame = +2

Query  164  GDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETDE  343
             +I CE LP ++C+F IS+SGKRCLLE   T + + VEYQC+TSEVVV      +IETD 
Sbjct  22   AEIVCEELPNDICAFTISSSGKRCLLETYAT-KNDAVEYQCRTSEVVVEKMAD-YIETDA  79

Query  344  CVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLCD  523
            CV+ACG+DR SVG+SSD+LLEP FTAKLCS +CYQNCPNIVDLYFNLAAGEG +LPDLCD
Sbjct  80   CVKACGVDRNSVGISSDALLEPQFTAKLCSPACYQNCPNIVDLYFNLAAGEGAFLPDLCD  139

Query  524  KQRSHNRRDLVELNSNGGEKALGPSSEES  610
              R +  R +++L S+G     GP++ ES
Sbjct  140  AARYNPHRSMIQLMSSGATP--GPAAPES  166



>gb|KHF97273.1| hypothetical protein F383_36747 [Gossypium arboreum]
Length=179

 Score =   180 bits (456),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 126/167 (75%), Gaps = 3/167 (2%)
 Frame = +2

Query  110  LSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCK  289
            L   I+ F+ SL L   L ++ CE LP ++C+F+I++SGKRC+LE +V  EG+ V+YQC+
Sbjct  4    LKFPIVLFISSLLLHSSLAEMICEDLPKDLCAFSIASSGKRCVLETAVKKEGD-VQYQCR  62

Query  290  TsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVD  469
            TSEVVV      +IETDECV ACG DR SVG+SSDSLL+  FTAKLC+ +CYQ CPNIVD
Sbjct  63   TSEVVVERMAE-YIETDECVAACGADRNSVGISSDSLLDQQFTAKLCTPACYQKCPNIVD  121

Query  470  LYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSSEES  610
            LYFNLAAGEGV+LPDLC+ QRS+ RR +VEL  + G  A GP S ++
Sbjct  122  LYFNLAAGEGVFLPDLCNAQRSNPRRSMVELILSSG-VAPGPVSSQA  167



>ref|XP_011019183.1| PREDICTED: uncharacterized protein LOC105121988 [Populus euphratica]
 ref|XP_011019184.1| PREDICTED: uncharacterized protein LOC105121988 [Populus euphratica]
Length=178

 Score =   179 bits (454),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 113/152 (74%), Gaps = 4/152 (3%)
 Frame = +2

Query  155  GVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIE  334
              L +I CE LP +VC+F IS+SGKRCLLE      G  VEYQC+TSEVVV    G +IE
Sbjct  19   AALAEIVCEELPNDVCAFTISSSGKRCLLETYAKQNG-AVEYQCRTSEVVVEKMAG-YIE  76

Query  335  TDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPD  514
            TD CV+ACG+DR SVG+SSD+LLEP FT KLCS +CYQNCPNIVDLYFNLAAGEG +LPD
Sbjct  77   TDACVKACGVDRNSVGISSDALLEPQFTGKLCSPACYQNCPNIVDLYFNLAAGEGAFLPD  136

Query  515  LCDKQRSHNRRDLVELNSNGGEKALGPSSEES  610
            LCD  R +  R +++L S+G   A GP + E+
Sbjct  137  LCDAARYNPHRSMIQLMSSGA--APGPVASET  166



>ref|XP_010256734.1| PREDICTED: uncharacterized protein LOC104597044 [Nelumbo nucifera]
Length=180

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 119/161 (74%), Gaps = 2/161 (1%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M S+ +  L  LF + +    GV   I CE LP N+C+F+IS+SG+RC LE     +GN 
Sbjct  1    MASASEKILTFLFALATYVHGGVGEGIVCEELPKNICAFSISSSGQRCTLETYAAQDGN-  59

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
            VEYQC+TS V V +  G  IETDEC++ACGLDR SVG+SSD+LLE  FTA+LCS  CY N
Sbjct  60   VEYQCRTSNVSVENMAG-WIETDECIQACGLDRNSVGISSDALLESQFTAQLCSIGCYDN  118

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
            CPNIVDLYFNLAAGEGV+LPD+C+ QR++  R+++EL SNG
Sbjct  119  CPNIVDLYFNLAAGEGVFLPDICEAQRNNLHREMIELLSNG  159



>gb|EYU27489.1| hypothetical protein MIMGU_mgv1a014649mg [Erythranthe guttata]
Length=182

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 122/164 (74%), Gaps = 4/164 (2%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVL--GDITCEFLPTNVCSFAISTSGKRCLLENSVTNEG  265
            M SS+KL+L +LFF  SLFL G L  G++ CE LP N+C+FAI++SGKRC+LEN    E 
Sbjct  1    MASSIKLTL-VLFFACSLFLQGTLAVGEVVCENLPENLCAFAIASSGKRCVLENYKNEEE  59

Query  266  NKVEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCY  445
             K++Y CK+SEVVV    G +IE+D+C+ ACG+DR  VG+SSD+ L   FT+ LCS  CY
Sbjct  60   GKLDYTCKSSEVVVERLSG-YIESDQCINACGVDRTFVGISSDAFLTQEFTSSLCSPDCY  118

Query  446  QNCPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGG  577
            +NCPNIVDLYFNLAAGEGVYLP LCDKQ+S   R + EL S+  
Sbjct  119  RNCPNIVDLYFNLAAGEGVYLPALCDKQKSSPHRAMFELLSSAA  162



>ref|XP_002309105.2| hypothetical protein POPTR_0006s09540g [Populus trichocarpa]
 gb|EEE92628.2| hypothetical protein POPTR_0006s09540g [Populus trichocarpa]
Length=178

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 112/152 (74%), Gaps = 4/152 (3%)
 Frame = +2

Query  155  GVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIE  334
              L +I CE LP ++C+F +S+SGKRCLLE      G  VEYQC+TSEVVV      +IE
Sbjct  19   AALAEIVCEELPNDICAFTVSSSGKRCLLETYAKQNG-AVEYQCRTSEVVVEKMAD-YIE  76

Query  335  TDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPD  514
            TD CV+ACG+DR SVG+SSD+LLEP FT KLCS +CYQNCPNIVDLYFNLAAGEG +LPD
Sbjct  77   TDACVKACGVDRNSVGISSDALLEPQFTGKLCSPACYQNCPNIVDLYFNLAAGEGAFLPD  136

Query  515  LCDKQRSHNRRDLVELNSNGGEKALGPSSEES  610
            LCD  R +  R +++L S+G   A GP + E+
Sbjct  137  LCDAARYNPHRSMIQLMSSGA--APGPVASET  166



>gb|KHG02999.1| ATP-dependent RNA helicase dbp6 [Gossypium arboreum]
Length=182

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 125/167 (75%), Gaps = 3/167 (2%)
 Frame = +2

Query  110  LSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCK  289
            L   I  F+ SL L   + +I CE LP +VC+F+I+ SGKRC+LE +  ++ + VE+QC+
Sbjct  4    LKFPIFLFISSLSLHASMAEIICEDLPKDVCAFSIALSGKRCVLETA-ADKDSDVEHQCR  62

Query  290  TsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVD  469
            TSEVVV      +IE+DECV ACG++R S+G+SSDSLL+  FTAKLC+ +CYQNCPN++D
Sbjct  63   TSEVVVERMAD-YIESDECVAACGVNRNSIGISSDSLLDQQFTAKLCAPACYQNCPNVID  121

Query  470  LYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSSEES  610
            LYFNLAAGEGV+LPDLC+ Q S+ RR +V+L S+ G  A GP S ++
Sbjct  122  LYFNLAAGEGVFLPDLCNAQWSNPRRSMVDLISSSG-AAPGPVSSQA  167



>ref|XP_007133951.1| hypothetical protein PHAVU_010G006000g [Phaseolus vulgaris]
 gb|ESW05945.1| hypothetical protein PHAVU_010G006000g [Phaseolus vulgaris]
Length=179

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 118/151 (78%), Gaps = 4/151 (3%)
 Frame = +2

Query  161  LGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETD  340
            LG+I CE LP  VC+F++++SGKRCLLE     +G  VEYQC+TSEVVV      +IETD
Sbjct  22   LGEIVCEDLPKEVCAFSVASSGKRCLLETEKAADGG-VEYQCRTSEVVVERMAE-YIETD  79

Query  341  ECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLC  520
            +CVEACG+DR SVG+SSD+  EP FTAKLCSS CYQ C NIVDL+FNLAAGEGV+LP+LC
Sbjct  80   QCVEACGVDRNSVGISSDAFFEPQFTAKLCSSQCYQKCFNIVDLFFNLAAGEGVFLPELC  139

Query  521  DKQRSHNRRDLVELNSNGGEKALGPSSEESD  613
            ++Q+++ RR +VEL S+G   A GP S+ S+
Sbjct  140  ERQKTNPRRAMVELVSSGA--APGPVSDVSE  168



>ref|XP_006848036.1| hypothetical protein AMTR_s00029p00186810 [Amborella trichopoda]
 gb|ERN09617.1| hypothetical protein AMTR_s00029p00186810 [Amborella trichopoda]
Length=175

 Score =   177 bits (450),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 119/160 (74%), Gaps = 1/160 (1%)
 Frame = +2

Query  119  MILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTse  298
            + LFFV S+ L G   +I CE L  + C+F+IS++GKRC+LE    N+G++ E+QC++SE
Sbjct  3    LALFFVLSMLLHGAFAEIVCENLSKDKCAFSISSAGKRCVLEKYAGNDGDEAEFQCRSSE  62

Query  299  vvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYF  478
            VVV       IET+EC++ACGLDR SVG+SSDSLLEP FTAKLC+++C+ NCPN+VDLY 
Sbjct  63   VVVERLSE-WIETEECIQACGLDRNSVGISSDSLLEPQFTAKLCATACFNNCPNVVDLYV  121

Query  479  NLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPS  598
            NLAAGEGV+LP+LC  QR + RR + EL S+G      PS
Sbjct  122  NLAAGEGVFLPELCQVQRINPRRGMAELLSSGVAGGPEPS  161



>ref|XP_010046385.1| PREDICTED: uncharacterized protein LOC104435305 [Eucalyptus grandis]
Length=185

 Score =   177 bits (450),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 116/159 (73%), Gaps = 3/159 (2%)
 Frame = +2

Query  119  MILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTse  298
            +ILF   S FL G LG+I CE LPT +CSF+I+++G+RC+LEN V+    K+EY+CKTS+
Sbjct  3    LILFLAFSFFLQGALGNIACEQLPTELCSFSIASNGRRCVLENYVSLMDGKMEYECKTSQ  62

Query  299  vvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYF  478
            V V       IETD+C+ ACG+DR+SVG+SSD+LL+P FT KLCS +CY NCPNIVDLYF
Sbjct  63   VAVDIMHE-WIETDDCIRACGVDRQSVGISSDALLQPSFTTKLCSPACYHNCPNIVDLYF  121

Query  479  NLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGP  595
            NLA GEGVYL D C+ +RS+ +R  V     G   A GP
Sbjct  122  NLALGEGVYLADHCEVRRSNPKR--VTREVRGASIASGP  158



>gb|KEH23077.1| PAR1 protein [Medicago truncatula]
Length=169

 Score =   176 bits (447),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 121/158 (77%), Gaps = 4/158 (3%)
 Frame = +2

Query  128  FFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvv  307
             F  SL +   L ++ CE L  ++CSF+I++SGKRCLLE     +G  +EYQC+TSEVV+
Sbjct  1    MFFCSLIIHSSLAEVVCEELQKDLCSFSIASSGKRCLLETEKAADGG-IEYQCRTSEVVL  59

Query  308  gssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLA  487
                G +IETD+CV+ACG++R  VG+SSD+LLEP FTAKLCSSSCYQNCPNIVDLYFNLA
Sbjct  60   ERMAG-YIETDQCVKACGVERNFVGISSDALLEPQFTAKLCSSSCYQNCPNIVDLYFNLA  118

Query  488  AGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSS  601
            AGEGV+LPDLC+ Q+++  R ++EL S+G   A GP S
Sbjct  119  AGEGVFLPDLCEIQKTNPHRAMIELVSSGA--APGPVS  154



>ref|XP_011012958.1| PREDICTED: uncharacterized protein LOC105117111 [Populus euphratica]
 ref|XP_011012960.1| PREDICTED: uncharacterized protein LOC105117111 [Populus euphratica]
 ref|XP_011012961.1| PREDICTED: uncharacterized protein LOC105117111 [Populus euphratica]
Length=178

 Score =   177 bits (448),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 107/138 (78%), Gaps = 2/138 (1%)
 Frame = +2

Query  164  GDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETDE  343
             +I CE LP ++C+F IS+SGKRCLLE   T  G  VEYQC+TSEVVV      +IETD 
Sbjct  22   AEIVCEELPNDICAFTISSSGKRCLLETYATKNG-AVEYQCRTSEVVVEKMAD-YIETDA  79

Query  344  CVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLCD  523
            CV+ACG+DR SVG+SSD+LLEP FTAKLCS +CYQNCPNIVDLYFNLAAGEG +LPDLCD
Sbjct  80   CVKACGVDRNSVGISSDALLEPQFTAKLCSPACYQNCPNIVDLYFNLAAGEGAFLPDLCD  139

Query  524  KQRSHNRRDLVELNSNGG  577
              R +  R +++L S+G 
Sbjct  140  AARYNPHRSMIQLMSSGA  157



>ref|XP_011008006.1| PREDICTED: uncharacterized protein LOC105113506 [Populus euphratica]
Length=171

 Score =   176 bits (447),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 110/150 (73%), Gaps = 2/150 (1%)
 Frame = +2

Query  128  FFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvv  307
            F     F   +  +I CE LP ++C+F IS+SGKRCLLE   T  G  VEYQC+TSEVVV
Sbjct  3    FIKSGWFCFELAAEIVCEELPNDICAFTISSSGKRCLLETYATKNG-AVEYQCRTSEVVV  61

Query  308  gssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLA  487
                  +IETD CV+ACG+DR SVG+SSD+LLEP FTAKLCS +CYQNCPNIVDLYFNLA
Sbjct  62   EKMAD-YIETDACVKACGVDRNSVGISSDALLEPQFTAKLCSPACYQNCPNIVDLYFNLA  120

Query  488  AGEGVYLPDLCDKQRSHNRRDLVELNSNGG  577
            AGEG +LPDLCD  R +  R +++L S+G 
Sbjct  121  AGEGAFLPDLCDAARYNPHRSMIQLMSSGA  150



>gb|KDP24516.1| hypothetical protein JCGZ_25080 [Jatropha curcas]
Length=180

 Score =   177 bits (448),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 113/146 (77%), Gaps = 4/146 (3%)
 Frame = +2

Query  158  VLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIET  337
             L +I CE LP +VC+F+I+ SGKRCLLE     +G KVEYQC+TSEV+V +    +IET
Sbjct  20   ALCEIDCEELPKDVCAFSIAASGKRCLLETYARGDG-KVEYQCRTSEVIVETMAD-YIET  77

Query  338  DECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDL  517
            D+CV+ACG+DR SVG+SSD+LLEP FTAKLCS  CYQ CPNI+DLYFNLAAGEG +LPDL
Sbjct  78   DQCVKACGVDRNSVGISSDALLEPHFTAKLCSPPCYQKCPNIIDLYFNLAAGEGAFLPDL  137

Query  518  CDKQRSHNRRDLVELNSNGGEKALGP  595
            CD  R++  R L++L S+G   A GP
Sbjct  138  CDAARTNPHRSLIQLMSSGA--APGP  161



>ref|XP_010553262.1| PREDICTED: uncharacterized protein LOC104823394 [Tarenaya hassleriana]
Length=162

 Score =   176 bits (445),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 119/168 (71%), Gaps = 7/168 (4%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M SS KL++ I+  V SL L   LGDI CE LP  +C+F+IS SGKRC+LE     E   
Sbjct  1    MSSSFKLAISII--VSSLLLHAALGDIICENLPEEMCAFSISASGKRCVLET----ENVA  54

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
             ++ C+TSEV V   V  H+ETD+C+ ACG+DRK+VG+SSD LLEP F AKLCS +CY N
Sbjct  55   GKFYCRTSEVDVEGMVN-HVETDDCMAACGVDRKTVGISSDKLLEPGFAAKLCSRACYDN  113

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGP  595
            CPNIVDLYFNLAAGEG +LPDLC+  R++  R ++E+ S+G   A  P
Sbjct  114  CPNIVDLYFNLAAGEGAFLPDLCEAHRANPHRSMLEILSSGAALAPAP  161



>ref|XP_011094949.1| PREDICTED: uncharacterized protein LOC105174518 [Sesamum indicum]
Length=175

 Score =   175 bits (444),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 127/168 (76%), Gaps = 4/168 (2%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M  SMKLSL +LFF  SLF+ G   ++ CE LP+N+C+FAI++SGKRC+LE +  NE   
Sbjct  1    MAFSMKLSL-VLFFTCSLFVQGTFAEVLCEKLPSNLCAFAIASSGKRCILE-TYRNEQGD  58

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
            V++ CKT+EVVV    G HIE+D+C+ ACG++R+ +G+S+DS L   FTA LCSS+CY N
Sbjct  59   VDFICKTTEVVVERMAG-HIESDQCINACGVEREFIGISTDSFLSSEFTAHLCSSACYHN  117

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGP  595
            CPN++DL+FNLAAGEGV LP LC++Q+ ++R  L  L+S+GG  A GP
Sbjct  118  CPNVIDLFFNLAAGEGVSLPALCEQQKENHRAMLTLLSSDGG-VAPGP  164



>gb|AFK35102.1| unknown [Lotus japonicus]
Length=183

 Score =   175 bits (443),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 115/155 (74%), Gaps = 4/155 (3%)
 Frame = +2

Query  146  FLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvge  325
            F+     ++ CE LP  VC+F++++SGKRCLLE     +G  VEYQC+TSEVVV      
Sbjct  17   FIHASFAEMVCEDLPKEVCAFSVASSGKRCLLETEKGADGG-VEYQCRTSEVVVERMAE-  74

Query  326  HIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVY  505
            +IETD+CVE+CG+DR SVG+SSD+  EP FT KLCS +CYQ CPNIVDLYFNLAAGEGV+
Sbjct  75   YIETDQCVESCGVDRSSVGISSDAFFEPQFTGKLCSPACYQKCPNIVDLYFNLAAGEGVF  134

Query  506  LPDLCDKQRSHNRRDLVELNSNGGEKALGPSSEES  610
            LP+LC+K RS+  R +VEL S G   A GP+S+ S
Sbjct  135  LPELCEKHRSNPHRAMVELVSFGA--APGPASDVS  167



>ref|XP_011077605.1| PREDICTED: uncharacterized protein LOC105161572 [Sesamum indicum]
Length=186

 Score =   175 bits (443),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 113/144 (78%), Gaps = 2/144 (1%)
 Frame = +2

Query  131  FVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvg  310
            FV SLFLPG L ++ CE LP N+C+FAI+ SGKRC+LEN  + EG+ V+Y CKTSEVVV 
Sbjct  15   FVCSLFLPGTLAEVVCEDLPENLCAFAIAASGKRCVLENYKSEEGS-VDYTCKTSEVVVE  73

Query  311  ssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAA  490
               G ++ETDECV ACG+DR  VG+SSD+ L P F + LCS +CY+NCPNIVDLYFNLAA
Sbjct  74   RLAG-YVETDECVNACGVDRNFVGISSDAFLTPEFISSLCSPACYRNCPNIVDLYFNLAA  132

Query  491  GEGVYLPDLCDKQRSHNRRDLVEL  562
            GEGV+LP LC+KQ++   R ++EL
Sbjct  133  GEGVFLPALCEKQKTSPHRAMLEL  156



>ref|XP_009370270.1| PREDICTED: uncharacterized protein LOC103959642 [Pyrus x bretschneideri]
Length=180

 Score =   174 bits (442),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 122/165 (74%), Gaps = 4/165 (2%)
 Frame = +2

Query  122  ILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsev  301
            +L F   LF+   LG+I CE LP  +C+F++S+SGKRCLLE ++  +G KVE++C+TS V
Sbjct  5    LLLFHSLLFIHAALGEIVCEHLPNEICAFSVSSSGKRCLLE-TMAKKGGKVEHECRTSGV  63

Query  302  vvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFN  481
            VV      +IETDEC++ACG+DRK++G+SSD+LL+P    KLCS++CY  CPNI++LYFN
Sbjct  64   VVEKMAE-YIETDECIKACGVDRKAIGISSDTLLDPRVLNKLCSTACYHKCPNIIELYFN  122

Query  482  LAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALG--PSSEES  610
            +A GEGV+LP LC+KQRS+  R + EL+S G   +    P S+ES
Sbjct  123  MAVGEGVFLPYLCEKQRSNPHRAMEELSSYGDAPSYASSPFSQES  167



>gb|KHG11879.1| uncharacterized protein F383_20075 [Gossypium arboreum]
Length=216

 Score =   175 bits (444),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 115/150 (77%), Gaps = 3/150 (2%)
 Frame = +2

Query  161  LGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETD  340
            L +I CE LP +VC+FAI++SGKRCLLE  +  +  K EYQC+TSEV+V      +IE D
Sbjct  21   LAEIICEDLPNDVCAFAIASSGKRCLLETGL-EKNEKEEYQCRTSEVMVERMAE-YIEND  78

Query  341  ECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLC  520
            +CV ACG+DR S+G+SSDSLLEP FTAKLC+ +C   CPNIVDL+FNLAAGEGV+LPDLC
Sbjct  79   DCVRACGVDRNSIGISSDSLLEPQFTAKLCAPACCHKCPNIVDLFFNLAAGEGVFLPDLC  138

Query  521  DKQRSHNRRDLVELNSNGGEKALGPSSEES  610
            + QR + RR +VEL S+ G  ALGP S E+
Sbjct  139  EAQRVNPRRSMVELMSSSG-AALGPISSEA  167



>ref|XP_009370269.1| PREDICTED: uncharacterized protein LOC103959641 [Pyrus x bretschneideri]
Length=180

 Score =   174 bits (441),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 122/165 (74%), Gaps = 4/165 (2%)
 Frame = +2

Query  122  ILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsev  301
            +L F   LF+   LG+I CE LP  +C+F++S+SGKRCLLE ++  +G KVE++C+TS V
Sbjct  5    LLLFHSFLFIHAALGEIVCEHLPNEICAFSVSSSGKRCLLE-TMAKKGGKVEHECRTSGV  63

Query  302  vvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFN  481
            VV      +IETDEC++ACG+DRK++G+SSD+LL+P    KLCS++CY  CPNI++LYFN
Sbjct  64   VVEKMAE-YIETDECIKACGVDRKAIGISSDTLLDPRVLNKLCSTACYHKCPNIIELYFN  122

Query  482  LAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALG--PSSEES  610
            +A GEGV+LP LC+KQRS+  R + EL+S G   +    P S+ES
Sbjct  123  MAVGEGVFLPYLCEKQRSNPHRAMEELSSYGDAPSYASSPFSQES  167



>ref|XP_003604795.1| hypothetical protein MTR_4g018860 [Medicago truncatula]
 gb|AES86992.1| PAR1 protein [Medicago truncatula]
Length=211

 Score =   174 bits (442),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 122/170 (72%), Gaps = 6/170 (4%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M  S KL L++L  + S  +      + CE LP  VC+F++++SGKRCLLE    N   +
Sbjct  1    MSFSTKLPLVLL--LSSFLIHTSFAMMVCEDLPKEVCAFSVASSGKRCLLETE-KNINGE  57

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
             EYQC+TSEV+V      +IETD+CVEACG+DR SVG+SSD+  EP FT+KLCS SC+  
Sbjct  58   TEYQCRTSEVMVERIAA-YIETDQCVEACGVDRSSVGISSDAFFEPYFTSKLCSPSCFSK  116

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSS  601
            CPNIVDL+FNLAAGEGV+LP+LC+K +++ RR  +EL S+G   ALGP+S
Sbjct  117  CPNIVDLFFNLAAGEGVFLPELCEKHKTNPRRATIELTSSGA--ALGPAS  164



>ref|XP_008370129.1| PREDICTED: uncharacterized protein LOC103433639 [Malus domestica]
Length=228

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 115/157 (73%), Gaps = 12/157 (8%)
 Frame = +2

Query  104  MKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQ  283
            +KL L+I F            +  CE LP +VC+F++S++GKRCLLE     +G+ +EYQ
Sbjct  42   LKLDLIIFFS----------REFICENLPNDVCAFSVSSAGKRCLLETMSKKDGS-IEYQ  90

Query  284  CKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNI  463
            C+TSEVVV       IETDECV+ACG+DRKSVG+SSD+LLEP F AKLCS+ CYQ CPNI
Sbjct  91   CRTSEVVVEGVAE-XIETDECVQACGIDRKSVGISSDTLLEPQFMAKLCSAPCYQKCPNI  149

Query  464  VDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
             DLYFNLAAGEGV+LPDLC KQRS+  R ++ L S+G
Sbjct  150  ADLYFNLAAGEGVFLPDLCGKQRSNPHRAMIALMSSG  186



>ref|XP_003604797.1| hypothetical protein MTR_4g018880 [Medicago truncatula]
 gb|AES86994.1| PAR1 protein [Medicago truncatula]
 gb|AFK33904.1| unknown [Medicago truncatula]
Length=181

 Score =   173 bits (438),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 116/151 (77%), Gaps = 4/151 (3%)
 Frame = +2

Query  161  LGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETD  340
            L ++ CE LP  VC+F++++SGKRCLLE      G ++EYQC+TSEV+V      +IETD
Sbjct  22   LAEMVCEDLPKEVCTFSVASSGKRCLLETQKGVNG-EIEYQCRTSEVIVERISE-YIETD  79

Query  341  ECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLC  520
            +CVEACG+DR SVG+SSD+  EP FT KLCS +CY+ CPNIVDL+FN+AAGEGV+LP+LC
Sbjct  80   QCVEACGVDRSSVGISSDAFFEPQFTGKLCSPACYKKCPNIVDLFFNMAAGEGVFLPELC  139

Query  521  DKQRSHNRRDLVELNSNGGEKALGPSSEESD  613
            +K +++ RR +VEL S+G   A GP+S  S+
Sbjct  140  EKHKTNPRRAMVELVSSGA--AFGPASSVSE  168



>ref|XP_004506651.1| PREDICTED: uncharacterized protein LOC101492243 [Cicer arietinum]
Length=180

 Score =   171 bits (434),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 118/156 (76%), Gaps = 3/156 (2%)
 Frame = +2

Query  146  FLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvge  325
            F+   L ++ CE LP +VC+F++++SGKRCLLE      G ++EY+C+TSEV+V      
Sbjct  17   FIHASLAEMVCEDLPKDVCAFSVASSGKRCLLETEKGMNG-EIEYECRTSEVIVERMAE-  74

Query  326  HIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVY  505
            +IETD+CVE CG+DR SVG+SSD+  EP FTAKLCS  CYQ CPNIVDL+FNLAAGEGV+
Sbjct  75   YIETDQCVEKCGVDRNSVGISSDAFFEPQFTAKLCSPICYQKCPNIVDLFFNLAAGEGVF  134

Query  506  LPDLCDKQRSHNRRDLVELNSNGGEKALGPSSEESD  613
            LP+LC+K +++ RR ++EL S+GG  A  P S+ S+
Sbjct  135  LPELCEKHKTNPRRAMIELVSSGG-AAPAPISDISE  169



>ref|XP_009139267.1| PREDICTED: uncharacterized protein LOC103863264 [Brassica rapa]
 emb|CDX76172.1| BnaA04g04360D [Brassica napus]
Length=183

 Score =   171 bits (434),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 121/172 (70%), Gaps = 10/172 (6%)
 Frame = +2

Query  98   SSMKLSLMILFFVGSLFLPGVLG-DITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKV  274
            SS+KL +   F + S  L   LG DI CE LPTN+C+F+IS SGKRCLLE +        
Sbjct  4    SSLKLPI---FLILSSLLHAALGEDIICENLPTNMCAFSISASGKRCLLETANVAG----  56

Query  275  EYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNC  454
            EY C+TS V V   V  H+E+DECV ACG+DRK+VG+SSD+++E  F AKLCS +C   C
Sbjct  57   EYTCRTSAVEVEGIVN-HVESDECVAACGVDRKTVGISSDAMMEAGFAAKLCSPACLDYC  115

Query  455  PNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSSEES  610
            PNI+DLYFNLAAGEG +LPDLCD QR++  R ++E+ S+GG  A GP SE +
Sbjct  116  PNILDLYFNLAAGEGAFLPDLCDAQRTNPHRSMLEMLSSGG-AAPGPVSETA  166



>ref|NP_190972.1| PAR1 protein [Arabidopsis thaliana]
 emb|CAB88366.1| photoassimilate-responsive protein PAR-1b-like protein [Arabidopsis 
thaliana]
 gb|AAL62396.1| photoassimilate-responsive protein PAR-1b -like protein [Arabidopsis 
thaliana]
 gb|AAM48022.1| photoassimilate-responsive protein PAR-1b-like protein [Arabidopsis 
thaliana]
 gb|AEE79178.1| PAR1 protein [Arabidopsis thaliana]
Length=183

 Score =   171 bits (434),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 117/172 (68%), Gaps = 11/172 (6%)
 Frame = +2

Query  110  LSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCK  289
            L L I   + SL    +  +I CE LPTN+CSF+IS SGKRC+LE +        E+ C+
Sbjct  6    LKLPIFLILSSLLHAAIGENIVCENLPTNMCSFSISASGKRCILETANVAG----EFTCR  61

Query  290  TsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVD  469
            TS V V   V  H+ETDECV ACG+DRK+VG+SSDSL+E  F AKLCSS+C   CPNI+D
Sbjct  62   TSAVDVEGIVN-HVETDECVSACGVDRKTVGISSDSLMEAGFAAKLCSSACLDYCPNILD  120

Query  470  LYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGG------EKALGPSSEE  607
            LYFNLAAGEG +LPDLCD QR + +R ++E  S+G       E A GP+SEE
Sbjct  121  LYFNLAAGEGAFLPDLCDAQRMNPQRSMMEFISSGAAPGPVSEIAPGPTSEE  172



>emb|CDP05191.1| unnamed protein product [Coffea canephora]
Length=187

 Score =   171 bits (434),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 120/167 (72%), Gaps = 6/167 (4%)
 Frame = +2

Query  113  SLMILFFVG---SLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQ  283
            SL++  F+    +L +    G+I CE L  + C++A+S+SGKRC+LE  V   G + +Y 
Sbjct  7    SLIVFAFIALACALCVQSTSGNIACEDLKEDSCAYAVSSSGKRCVLEKHVRRSGEE-KYT  65

Query  284  CKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNI  463
            C+ S++         IETD+C+EACG+DR ++G+SSDSLLEP FT KLCSS+CY++CPNI
Sbjct  66   CRASDIEAEKLKD-WIETDKCIEACGVDRHALGISSDSLLEPQFTHKLCSSACYRSCPNI  124

Query  464  VDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSSE  604
            VDLYFNLAAGEGVYLP LC+ QR+H RR++ E+ S+ G  A GP S+
Sbjct  125  VDLYFNLAAGEGVYLPKLCEAQRAHGRREMAEIKSS-GMVAPGPESD  170



>ref|XP_004234399.1| PREDICTED: uncharacterized protein LOC101252465 [Solanum lycopersicum]
Length=181

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 116/164 (71%), Gaps = 3/164 (2%)
 Frame = +2

Query  113  SLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKT  292
            +L I+ F  + F+   LGDI CE L  + C+FAIS++GKRC+LE  V   G +V Y C+T
Sbjct  6    TLAIVAFALAFFVQVTLGDIACENLNEDSCAFAISSTGKRCVLEKHVRRSGEEV-YICRT  64

Query  293  sevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDL  472
            SE+         IETDEC+EACG+DR ++G+SSD+LLE  FT+KLCSS+CY  CPNI+DL
Sbjct  65   SEIESDKLKD-WIETDECIEACGVDRNALGISSDALLESRFTSKLCSSACYNKCPNIIDL  123

Query  473  YFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSSE  604
            YFNLAAGEGVYLP LC +Q+   RR++ E+ S+G   A  P SE
Sbjct  124  YFNLAAGEGVYLPKLCAEQKGKGRREMAEIRSSGF-VAPAPESE  166



>gb|AFK48062.1| unknown [Lotus japonicus]
Length=183

 Score =   170 bits (430),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 113/155 (73%), Gaps = 4/155 (3%)
 Frame = +2

Query  146  FLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvge  325
            F+     ++ CE LP  VC+F++++SGKRCLLE     +G  VEYQC+TSEVVV      
Sbjct  17   FIHASFAEMVCEDLPKEVCAFSVASSGKRCLLETEKGADGG-VEYQCRTSEVVVERMAE-  74

Query  326  HIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVY  505
            +IETD+CVE+CG+DR SVG+SSD+  EP FT KLCS +CYQ CPNIVDLYFNLAAGEGV+
Sbjct  75   YIETDQCVESCGVDRSSVGISSDAFFEPQFTGKLCSPACYQKCPNIVDLYFNLAAGEGVF  134

Query  506  LPDLCDKQRSHNRRDLVELNSNGGEKALGPSSEES  610
            LP+L +K RS+  R +VEL S G   A GP S+ S
Sbjct  135  LPELYEKHRSNPHRAMVELVSFGA--APGPVSDVS  167



>emb|CDY13179.1| BnaC04g26560D [Brassica napus]
Length=183

 Score =   169 bits (429),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 121/172 (70%), Gaps = 10/172 (6%)
 Frame = +2

Query  98   SSMKLSLMILFFVGSLFLPGVLG-DITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKV  274
            SS+KL +   F + S  L   LG DI CE LPTN+C+F+IS SGKRCLLE +        
Sbjct  4    SSLKLPI---FLILSSLLHAALGEDIICENLPTNMCAFSISASGKRCLLETANVAG----  56

Query  275  EYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNC  454
            EY C+TS V V   V  H+E+DECV ACG+DRK+VG+SSD+++E  F AK+CS +C   C
Sbjct  57   EYTCRTSAVEVEGIVN-HVESDECVAACGVDRKTVGISSDAMMEAGFAAKICSPACLDYC  115

Query  455  PNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSSEES  610
            PNI+DLYFNLAAGEG +LPDLCD QR++  R ++E+ S+GG  A GP SE +
Sbjct  116  PNILDLYFNLAAGEGAFLPDLCDAQRTNPHRSMLEMLSSGG-AAPGPVSETA  166



>ref|XP_011073217.1| PREDICTED: uncharacterized protein LOC105158241 [Sesamum indicum]
Length=173

 Score =   169 bits (428),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 117/159 (74%), Gaps = 6/159 (4%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M SSMKLSL +LFF  SLF+   L D+ CE LPTN+CSFAI++SGKRC+LEN      N 
Sbjct  1    MGSSMKLSL-VLFFTCSLFVQRTLADVICENLPTNLCSFAIASSGKRCVLENC----KNA  55

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
             E +CKTSEVVV    G +IETD+CV+ACG+ R+SVG+SSD+ L   FTA+LCS +CY N
Sbjct  56   QEKKCKTSEVVVEKLSG-YIETDQCVKACGVCRESVGISSDTFLSSEFTARLCSPACYHN  114

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNS  568
            CPNI+DL+FNLAAGEGV LP LC  Q   +R  L  L+S
Sbjct  115  CPNIIDLFFNLAAGEGVSLPALCKNQEEKHREMLAILSS  153



>ref|XP_003604794.1| hypothetical protein MTR_4g018850 [Medicago truncatula]
 gb|AES86991.1| PAR1 protein [Medicago truncatula]
Length=215

 Score =   171 bits (432),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 111/144 (77%), Gaps = 4/144 (3%)
 Frame = +2

Query  170  ITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETDECV  349
            + CE LP  VC+F++++SGKRCLLE    N   + EYQC+TSEV+V      +IETDECV
Sbjct  25   MVCEDLPKEVCAFSVASSGKRCLLETE-KNINGETEYQCRTSEVMVERIAA-YIETDECV  82

Query  350  EACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLCDKQ  529
            EACG+DR SVG+SSD+  EP FT+KLCS SC+  CPNIVDL+FNLAAGEGV+LP+LC+K 
Sbjct  83   EACGVDRSSVGISSDAFFEPYFTSKLCSPSCFSKCPNIVDLFFNLAAGEGVFLPELCEKH  142

Query  530  RSHNRRDLVELNSNGGEKALGPSS  601
            +++ RR  +EL S+G   ALGP+S
Sbjct  143  KNNPRRATIELTSSGA--ALGPAS  164



>gb|KDP46577.1| hypothetical protein JCGZ_08549 [Jatropha curcas]
Length=181

 Score =   169 bits (428),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 126/204 (62%), Gaps = 27/204 (13%)
 Frame = +2

Query  119  MILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTse  298
            +I+F   SL L G LG++ CE LP  +CS++I++S KRCL+EN  T +G K+ YQCKTSE
Sbjct  3    LIIFIAFSLVLHGALGELVCEKLPVELCSYSIASSSKRCLIENFATKDG-KIAYQCKTSE  61

Query  299  vvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYF  478
            VVV       IE+DEC+ ACG+DR +VG+SSD+LL+P F AKLCS+ CYQ+CPNIVDLYF
Sbjct  62   VVVDILHE-WIESDECISACGVDRNTVGISSDTLLQPQFLAKLCSNDCYQSCPNIVDLYF  120

Query  479  NLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSSEESDaaaaplrsprraMVE  658
            NLA GEGV+LPDLC      N R  +    +    A GP+  E                 
Sbjct  121  NLALGEGVFLPDLCT-----NPRRALSATGSSSYVAPGPAFFEV----------------  159

Query  659  LSSGSGASTPTPVDAGDAPAAPSS  730
                S A+ P PVD  D   AP++
Sbjct  160  ----SPAAAPVPVDVVDPACAPTT  179



>ref|XP_011073208.1| PREDICTED: uncharacterized protein LOC105158231 [Sesamum indicum]
Length=173

 Score =   169 bits (428),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 118/161 (73%), Gaps = 6/161 (4%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M SSMKLSL+ LFF  SLF+   L D+ CE LPTN+CSFAI++SGKRC+LEN      N 
Sbjct  1    MGSSMKLSLL-LFFTCSLFVERTLADVICENLPTNLCSFAIASSGKRCVLENC----KNA  55

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
             E +CKTSEVVV    G +IETD+CV ACG+ R+SVG+SSD+ L   FTA LCS +CY N
Sbjct  56   QEKKCKTSEVVVEKLSG-YIETDQCVNACGVCRESVGISSDAFLSSEFTAHLCSPACYHN  114

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
            CPNIVDL+FNLAAGEGV LP LC  Q  ++R  L  L+++G
Sbjct  115  CPNIVDLFFNLAAGEGVSLPALCKNQEENHRSMLAILSNDG  155



>ref|XP_010044045.1| PREDICTED: uncharacterized protein LOC104433099 [Eucalyptus grandis]
 gb|KCW86048.1| hypothetical protein EUGRSUZ_B02754 [Eucalyptus grandis]
Length=181

 Score =   169 bits (428),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 115/152 (76%), Gaps = 4/152 (3%)
 Frame = +2

Query  155  GVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIE  334
              L +I CE LP ++C+F+I++SGKRC LE +  N+   VEYQC+TSEV+V    G +IE
Sbjct  21   ATLAEIVCEELPKDLCAFSIASSGKRCSLE-TYANQSGGVEYQCRTSEVIVERMGG-YIE  78

Query  335  TDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPD  514
            TDECV ACG+DR +VG+SSD+LLEP FTAKLCS +CY+ CPNI+DLY+NLAAGEGV+LPD
Sbjct  79   TDECVRACGVDRDAVGISSDALLEPQFTAKLCSPACYRRCPNIIDLYYNLAAGEGVFLPD  138

Query  515  LCDKQRSHNRRDLVELNSNGGEKALGPSSEES  610
            LC+ Q ++  R ++ L S+G   A  P+  ES
Sbjct  139  LCEMQWTNPHRAMIVLMSSGA--AASPAGSES  168



>ref|XP_002279995.1| PREDICTED: uncharacterized protein LOC100267406 [Vitis vinifera]
Length=180

 Score =   169 bits (428),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 118/161 (73%), Gaps = 8/161 (5%)
 Frame = +2

Query  119  MILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTse  298
             ILFF  SL L G LG++ CE LPT++CSF+I++SGKRCLLE   + +G   E QCKTSE
Sbjct  3    FILFFAFSLLLQGALGELICEGLPTDLCSFSIASSGKRCLLEKCASTDGT-TELQCKTSE  61

Query  299  vvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYF  478
            VVV       IET++C+ ACG+DR S+G+SSDSLL+P FTA+LCS +CYQNCPNI+DLYF
Sbjct  62   VVVDGMSA-WIETEQCIHACGVDRNSIGISSDSLLDPQFTAQLCSLACYQNCPNIIDLYF  120

Query  479  NLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSS  601
            NLA+ EG +LPDLC    ++  R + EL S+G   A GP S
Sbjct  121  NLASAEGGFLPDLC----ANPHRAMSELLSSGA--ASGPIS  155



>ref|NP_001241627.1| uncharacterized protein LOC100787709 precursor [Glycine max]
 gb|ACU20485.1| unknown [Glycine max]
 gb|KHN21748.1| hypothetical protein glysoja_027632 [Glycine soja]
Length=194

 Score =   169 bits (428),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 112/162 (69%), Gaps = 3/162 (2%)
 Frame = +2

Query  92   MDSSMKL-SLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGN  268
            M S+  L +LMI      L L G LG I CE L  + CSFA+S++GKRC+LE  V   G 
Sbjct  1    MASNFSLRTLMIFSLAFWLALKGTLGGIECETLSHDTCSFAVSSAGKRCVLEKRVKRTGE  60

Query  269  KVEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQ  448
            +  Y C+TSE+        HIET++C++ACGLDRKS+G+SSDSLLE  FT KLCS  CYQ
Sbjct  61   EA-YTCRTSEIEADKLKD-HIETEQCIKACGLDRKSLGISSDSLLESTFTQKLCSPHCYQ  118

Query  449  NCPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
             CPN+VDLYFNLAAGEGV+LP LC+ Q  + RR + EL S+G
Sbjct  119  CCPNVVDLYFNLAAGEGVFLPKLCEAQGVNARRGMAELKSSG  160



>ref|XP_010905376.1| PREDICTED: uncharacterized protein LOC105032593 [Elaeis guineensis]
Length=195

 Score =   169 bits (428),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 121/171 (71%), Gaps = 9/171 (5%)
 Frame = +2

Query  83   SRSMDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNE  262
            S+ M  ++ LSL +L F     LP     + CE LP ++C+FAIS++ KRC+LE++  + 
Sbjct  9    SKMMAWALLLSLSVLHF-----LPSASAGVICEDLPQDLCAFAISSASKRCVLESTPRSW  63

Query  263  GNKVEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSC  442
            G   EYQC+TS+VVV       IETDECV ACG+DR SVG+SSDSLLEP FT KLCS +C
Sbjct  64   G-PTEYQCRTSDVVVDQMSD-WIETDECVRACGVDRNSVGISSDSLLEPQFTEKLCSPAC  121

Query  443  YQNCPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGP  595
            +QNCPNIVDL+FNLAAGEGV+LP+LC+ +  +  R +VE  S+G   A GP
Sbjct  122  HQNCPNIVDLFFNLAAGEGVFLPELCEARHVNPHRAMVEFLSSGA--APGP  170



>ref|XP_002877953.1| hypothetical protein ARALYDRAFT_485800 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54212.1| hypothetical protein ARALYDRAFT_485800 [Arabidopsis lyrata subsp. 
lyrata]
Length=183

 Score =   168 bits (426),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 122/177 (69%), Gaps = 15/177 (8%)
 Frame = +2

Query  98   SSMKLSLMILFFVGSLFLPGVLGD-ITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKV  274
            SS+KL +   F + S  L   LG+ I CE LPT +C+F+IS SGKRC+LE +        
Sbjct  4    SSLKLPI---FLILSSLLHAALGENIICENLPTTMCAFSISASGKRCILETANVAG----  56

Query  275  EYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNC  454
            E+ C+TS V V   V  H+ETDECV ACG+DRK+VG+SSDSL+E  F AKLCSS+C   C
Sbjct  57   EFTCRTSAVDVEGIVN-HVETDECVSACGVDRKTVGISSDSLMEAGFAAKLCSSACLDYC  115

Query  455  PNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGG------EKALGPSSEE  607
            PNI+DLYFNLAAGEGV+LPDLCD QR +  R ++E+ S+G       E A GP+SE+
Sbjct  116  PNILDLYFNLAAGEGVFLPDLCDAQRMNPHRSMLEILSSGAAPGPVSEVAPGPTSED  172



>emb|CDX76173.1| BnaA04g04370D [Brassica napus]
Length=182

 Score =   168 bits (426),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 122/176 (69%), Gaps = 15/176 (9%)
 Frame = +2

Query  98   SSMKLSLMILFFVGSLFLPGVLGD-ITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKV  274
            SS+KL +   F + S  L   LG+ I CE LPT++C+F+IS SGKRCLLE +        
Sbjct  4    SSLKLPI---FLILSSLLHAALGEEIICENLPTSMCAFSISASGKRCLLETANV----AG  56

Query  275  EYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNC  454
            EY C+TS V V   V  H+E+DECV ACG+DRK+VG+SSD+++EP F AKLCS +C   C
Sbjct  57   EYTCRTSAVEVEGIVN-HVESDECVAACGVDRKTVGISSDAMMEPGFAAKLCSPACLDYC  115

Query  455  PNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGG------EKALGPSSE  604
            PNI+DLYFNLAAGEG +LPDLCD QR++  R ++E+ S+GG      E A GP S+
Sbjct  116  PNILDLYFNLAAGEGAFLPDLCDAQRTNPHRSMMEMFSSGGAPEPASETAPGPVSD  171



>ref|XP_010035143.1| PREDICTED: uncharacterized protein LOC104424423 [Eucalyptus grandis]
 gb|KCW46436.1| hypothetical protein EUGRSUZ_K00268 [Eucalyptus grandis]
Length=181

 Score =   168 bits (426),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 112/160 (70%), Gaps = 3/160 (2%)
 Frame = +2

Query  116  LMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTs  295
            L ++    +  + G LGDI CE L    C+FA+S++GKRC+LE  V   G +  Y C++S
Sbjct  8    LALVALAIAFCVQGTLGDIACENLDQGSCAFAVSSTGKRCVLEKQVRRSGEEA-YTCRSS  66

Query  296  evvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLY  475
            E+   +    HIETDEC+ ACGLDRK++G+SSDSLLE  FT KLCSS CY+NCPNIVDLY
Sbjct  67   EIEADNLKD-HIETDECIAACGLDRKTLGVSSDSLLESRFTQKLCSSGCYENCPNIVDLY  125

Query  476  FNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGP  595
            F+LAAGEGV+LP LC+ QR   RR + E+ S+ G  A GP
Sbjct  126  FSLAAGEGVFLPKLCEAQRGIARRGMAEIRSS-GHVAPGP  164



>emb|CDY60770.1| BnaAnng17210D [Brassica napus]
Length=181

 Score =   168 bits (425),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 121/177 (68%), Gaps = 14/177 (8%)
 Frame = +2

Query  98   SSMKLSLMILFFVGSLFLPGVLGD-ITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKV  274
            SS+KLS+   F + S  L   LG+ I CE LPTN+C+F+IS SGKRCLLE +        
Sbjct  4    SSLKLSI---FLILSSLLHAALGEGIICENLPTNICAFSISASGKRCLLETANVAG----  56

Query  275  EYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNC  454
            EY C+TS V V   V  H+E+DECV ACG+DRK+VG+SSD+++E  F AKLCS +C   C
Sbjct  57   EYTCRTSAVEVEGIVN-HVESDECVAACGVDRKTVGISSDAMMEAGFAAKLCSPACLDYC  115

Query  455  PNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGG-----EKALGPSSEES  610
            PNI+DLYFNLAAGEG +LPDLCD QR +  R ++E+ S+G      E A GP S+ S
Sbjct  116  PNILDLYFNLAAGEGAFLPDLCDAQRINPHRSMLEMLSSGAAPGPSEPASGPVSDTS  172



>ref|XP_009103899.1| PREDICTED: uncharacterized protein LOC103829961 isoform X1 [Brassica 
rapa]
 emb|CDX67585.1| BnaA07g16250D [Brassica napus]
Length=186

 Score =   168 bits (425),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 121/173 (70%), Gaps = 13/173 (8%)
 Frame = +2

Query  98   SSMKLSLMILFFVGSLFLPGVLG-DITCEFLPTNVCSFAISTSGKRCLLENS-VTNEGNK  271
            SS+KL +   F + S  L   LG DI CE LPTN+C+F+IS SGKRCLLE + VT E   
Sbjct  4    SSLKLPI---FLILSSLLHAALGEDIVCENLPTNMCAFSISASGKRCLLETANVTGE---  57

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
              Y C+TS V V   V  H+E+DECV ACG+DRK+VG+SSD+++E  F AKLCS +C   
Sbjct  58   --YTCRTSAVEVEGIVN-HVESDECVAACGVDRKTVGISSDAMMEAGFAAKLCSPACLDY  114

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSSEES  610
            CPNI+DLYFNLAAGEG +LPDLCD QR +  R ++E+ S+G   A GP SE +
Sbjct  115  CPNILDLYFNLAAGEGAFLPDLCDAQRINPHRSMLEILSSGA--APGPVSETA  165



>ref|XP_003555381.1| PREDICTED: uncharacterized protein LOC100784217 [Glycine max]
 gb|KHN26645.1| hypothetical protein glysoja_041469 [Glycine soja]
Length=194

 Score =   167 bits (424),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 113/162 (70%), Gaps = 3/162 (2%)
 Frame = +2

Query  92   MDSSMKL-SLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGN  268
            M S+  L +LMI     SL L G LG I CE L  + CSFA++++GKRC+LE  V   G 
Sbjct  1    MASNFSLRTLMIFALAFSLALQGTLGGIECESLSHDTCSFAVTSAGKRCVLEKQVKRTGE  60

Query  269  KVEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQ  448
            +  Y C+TSE+        HIET++C++ACGLDRKS+G+SSDSLL+  FT KLCS  CYQ
Sbjct  61   EA-YTCRTSEIEADKLKD-HIETEQCIKACGLDRKSLGISSDSLLQSSFTQKLCSPICYQ  118

Query  449  NCPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
             CPN+VDLYFNLAAGEGV+LP LC+ Q  + RR + EL S+G
Sbjct  119  CCPNVVDLYFNLAAGEGVFLPKLCEAQGLNARRGMAELKSSG  160



>ref|XP_010662746.1| PREDICTED: uncharacterized protein LOC100254969 isoform X3 [Vitis 
vinifera]
Length=186

 Score =   167 bits (423),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 111/154 (72%), Gaps = 2/154 (1%)
 Frame = +2

Query  113  SLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKT  292
            SL IL  V ++ + G LG ITCE L  + C+FA+S+SGKRC+LE  V   G +  Y C+T
Sbjct  9    SLAILALVLAVCVQGSLGGITCENLNKDTCAFAVSSSGKRCVLEKHVRRSGEEA-YVCRT  67

Query  293  sevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDL  472
            SE+         +E+D+C+EACGLDRKS+G+SSDSLLE  FT KLCS+ CY  CPNIVDL
Sbjct  68   SEIEADKVKD-WVESDQCIEACGLDRKSLGISSDSLLECGFTRKLCSTQCYNGCPNIVDL  126

Query  473  YFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
            YFN+AAGEGV+LP LC+ QR   RR++ E+ S+G
Sbjct  127  YFNVAAGEGVFLPKLCEAQRGDARREMAEIRSSG  160



>ref|XP_011073210.1| PREDICTED: uncharacterized protein LOC105158233 [Sesamum indicum]
Length=171

 Score =   167 bits (422),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 117/162 (72%), Gaps = 7/162 (4%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M SSMKLSL ILFF  SLF+   L ++ CE LPTN+CSFAI++SGKRC+LEN  + +G  
Sbjct  1    MGSSMKLSL-ILFFTCSLFVQNTLANVICENLPTNLCSFAIASSGKRCVLENHKSPQGKT  59

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
                CKTSEVVV    G +IETD+CV ACG+ R+S G+SSD+ L   FTA LCSS+C+QN
Sbjct  60   ----CKTSEVVVEKLSG-YIETDQCVNACGVCRESFGISSDAFLSSEFTAHLCSSACFQN  114

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGG  577
            CPNIVDL+FNLAA EGV LP LC  Q   N R L+ + S GG
Sbjct  115  CPNIVDLFFNLAASEGVSLPTLCKNQE-ENHRALLTILSRGG  155



>ref|XP_011073219.1| PREDICTED: uncharacterized protein LOC105158242 [Sesamum indicum]
Length=169

 Score =   166 bits (420),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 115/161 (71%), Gaps = 6/161 (4%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M  SMKLSL +LFF  SLF+   LGD+ CE LPTN+CSFA+++SGKRC+LE     +G K
Sbjct  1    MGFSMKLSL-VLFFTCSLFVQRTLGDVICENLPTNLCSFAVASSGKRCVLEICKNAQGKK  59

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
                CKTSEVVV    G +IETD+CV +CG+ R+SVGLSSD+ L   FTA LCS +CY N
Sbjct  60   ----CKTSEVVVEKLSG-YIETDQCVNSCGVCRESVGLSSDAFLSSKFTAHLCSPACYHN  114

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
            CPNIVDL+FNLAAGEGV LP LC  Q   +R  L  L+S G
Sbjct  115  CPNIVDLFFNLAAGEGVSLPALCKNQEEKHREMLAILSSGG  155



>ref|XP_008811495.1| PREDICTED: uncharacterized protein LOC103722643 [Phoenix dactylifera]
Length=194

 Score =   167 bits (422),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 110/142 (77%), Gaps = 4/142 (3%)
 Frame = +2

Query  170  ITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETDECV  349
            + CE LP ++C+FAIS+S KRC+LE++  N G   EYQC+TS+VVV       IETDECV
Sbjct  32   VICEDLPQDLCAFAISSSSKRCVLESTPHN-GGATEYQCRTSDVVVHRMSAW-IETDECV  89

Query  350  EACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLCDKQ  529
             ACG+DR SVG+SSDSLLEP FT KLCS +C++NCPNIVDLYFNLAAGEGV+LP LC+ +
Sbjct  90   RACGVDRNSVGISSDSLLEPQFTEKLCSPACHRNCPNIVDLYFNLAAGEGVFLPKLCEAR  149

Query  530  RSHNRRDLVELNSNGGEKALGP  595
            R + RR +VEL S+G   A GP
Sbjct  150  RVNPRRAMVELLSSGA--APGP  169



>ref|XP_008239908.1| PREDICTED: uncharacterized protein LOC103338475 [Prunus mume]
Length=468

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 122/166 (73%), Gaps = 4/166 (2%)
 Frame = +2

Query  116  LMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTs  295
            L  + F+  L +   LG+I CE LP +VC+F++S+SGKRCLLE     +G  ++YQC+TS
Sbjct  10   LPFILFLSPLSIHAALGEIVCEHLPNDVCAFSVSSSGKRCLLETMSKQDGT-LQYQCRTS  68

Query  296  evvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLY  475
              VV      +IETD+CV+ACG+DRKS+G+SSD+LL+P F  +LCS +CY+ CPNIV+LY
Sbjct  69   GEVVEKMAE-YIETDQCVKACGVDRKSLGISSDTLLDPYFLNRLCSPACYEKCPNIVELY  127

Query  476  FNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKAL--GPSSEE  607
            FN+A GEGV++P LC+++RS+  R + EL+S+G   A   GP+S+E
Sbjct  128  FNMAEGEGVFMPYLCEQERSNPHRAMSELSSSGPSYAFSYGPNSKE  173



>emb|CBI22723.3| unnamed protein product [Vitis vinifera]
Length=196

 Score =   166 bits (421),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 112/155 (72%), Gaps = 2/155 (1%)
 Frame = +2

Query  110  LSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCK  289
            ++L IL  V ++ + G LG ITCE L  + C+FA+S+SGKRC+LE  V   G +  Y C+
Sbjct  18   ITLAILALVLAVCVQGSLGGITCENLNKDTCAFAVSSSGKRCVLEKHVRRSGEEA-YVCR  76

Query  290  TsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVD  469
            TSE+         +E+D+C+EACGLDRKS+G+SSDSLLE  FT KLCS+ CY  CPNIVD
Sbjct  77   TSEIEADKVKD-WVESDQCIEACGLDRKSLGISSDSLLECGFTRKLCSTQCYNGCPNIVD  135

Query  470  LYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
            LYFN+AAGEGV+LP LC+ QR   RR++ E+ S+G
Sbjct  136  LYFNVAAGEGVFLPKLCEAQRGDARREMAEIRSSG  170



>ref|XP_011073214.1| PREDICTED: uncharacterized protein LOC105158237 [Sesamum indicum]
Length=173

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 115/159 (72%), Gaps = 6/159 (4%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M  SMKLSL  LFF  SLF+   L D+ CE LPTN+CSFAI++SGKRC+LEN      N 
Sbjct  1    MGCSMKLSLF-LFFTCSLFVQRTLADVICENLPTNLCSFAIASSGKRCVLENC----KNA  55

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
             E +CKTSEVVV    G +IETD+CV+ACG+ R+SVG+SSD+ L   FTA+LCS +CY N
Sbjct  56   QEKKCKTSEVVVDKLSG-YIETDQCVKACGVCRESVGISSDTFLSSEFTARLCSPACYHN  114

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNS  568
            CPNI+DL+FNLAAGEGV LP LC  Q   +R  L  L+S
Sbjct  115  CPNIIDLFFNLAAGEGVSLPALCKNQEEKHREMLAILSS  153



>ref|XP_009139268.1| PREDICTED: uncharacterized protein LOC103863265 [Brassica rapa]
Length=182

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 121/172 (70%), Gaps = 11/172 (6%)
 Frame = +2

Query  98   SSMKLSLMILFFVGSLFLPGVLGD-ITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKV  274
            SS+KL +   F + S  L   LG+ I CE LPT++C+F+IS SGKRCLLE +        
Sbjct  4    SSLKLPI---FLILSSLLHAALGEEIICENLPTSMCAFSISASGKRCLLETANVAG----  56

Query  275  EYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNC  454
            EY C+ S V V   V  ++E+DECV ACG+DRK+VG+SSD+++EP F AKLCS +C   C
Sbjct  57   EYTCRNSAVEVKGIVN-YVESDECVAACGVDRKTVGISSDAMMEPGFAAKLCSPACLDYC  115

Query  455  PNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSSEES  610
            PNI+DLYFNLAAGEG +LPDLCD QR++  R ++E+ S+GG  A  PSSE +
Sbjct  116  PNILDLYFNLAAGEGAFLPDLCDAQRTNPHRSMMEMFSSGGAPA--PSSETA  165



>gb|AFK41674.1| unknown [Lotus japonicus]
Length=198

 Score =   166 bits (421),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 109/155 (70%), Gaps = 2/155 (1%)
 Frame = +2

Query  110  LSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCK  289
            +SL IL    SL + G LG I CE L    CSFA+S+ GKRC+LE  V   G +  Y C+
Sbjct  8    MSLAILALTFSLAVQGTLGGIECENLSEETCSFAVSSGGKRCVLEKRVKRTGEEA-YTCR  66

Query  290  TsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVD  469
            TSE+        HIET++CV+ACGLDRKS+G+SSDSLLE  FT +LCS  CYQ+CPN+VD
Sbjct  67   TSEIEADKLKD-HIETEQCVKACGLDRKSLGISSDSLLESRFTHQLCSPQCYQSCPNVVD  125

Query  470  LYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
            LYFNLAAGEGV+LP LC+ +  + RR + EL S+G
Sbjct  126  LYFNLAAGEGVFLPMLCEAEGGNARRGMAELKSSG  160



>ref|XP_010035142.1| PREDICTED: uncharacterized protein LOC104424422 [Eucalyptus grandis]
 gb|KCW46435.1| hypothetical protein EUGRSUZ_K00267 [Eucalyptus grandis]
Length=181

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 108/149 (72%), Gaps = 3/149 (2%)
 Frame = +2

Query  149  LPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeH  328
            + G LGDI CE L    C+FA+S++GKRC+LE  V   G +  Y C++SE+   +    H
Sbjct  19   VQGTLGDIACENLDQGSCAFAVSSTGKRCVLEKQVRRSGEEA-YTCRSSEIEADNLKD-H  76

Query  329  IETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYL  508
            IETDEC+ ACGLDRK++G+SSDSLLE  FT KLCSS CY+NCPNIVDLYF+LAAGEGV+L
Sbjct  77   IETDECIAACGLDRKTLGVSSDSLLESRFTQKLCSSGCYENCPNIVDLYFSLAAGEGVFL  136

Query  509  PDLCDKQRSHNRRDLVELNSNGGEKALGP  595
            P LC+ QR   RR + E+ S+ G  A GP
Sbjct  137  PKLCEAQRGIARRGMGEIRSS-GHVAPGP  164



>ref|XP_010515917.1| PREDICTED: uncharacterized protein LOC104791676 [Camelina sativa]
Length=183

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 121/177 (68%), Gaps = 15/177 (8%)
 Frame = +2

Query  98   SSMKLSLMILFFVGSLFLPGVLGD-ITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKV  274
            SS+KL ++++    S  L   LG+ I CE LPTN+C+F+IS SGKRCLLE +        
Sbjct  4    SSIKLPIVLIL---SSLLHAALGENIICENLPTNMCAFSISASGKRCLLETANVAG----  56

Query  275  EYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNC  454
            EY C+TS V V   V  H+E+DECV ACG+DRK+VG+SSDSL+E  F AK+CS +C   C
Sbjct  57   EYTCRTSAVDVEGIVN-HVESDECVAACGVDRKTVGISSDSLMEAGFAAKICSPACLDYC  115

Query  455  PNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGG------EKALGPSSEE  607
            PNI+DLYFNLAAGEG +LPDLCD  R +  R ++E+ S+G       E A GPSSE+
Sbjct  116  PNILDLYFNLAAGEGAFLPDLCDAHRMNPHRSMLEILSSGAAPGPVSEVAPGPSSED  172



>ref|XP_004234398.1| PREDICTED: uncharacterized protein LOC101252153 [Solanum lycopersicum]
Length=184

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 114/164 (70%), Gaps = 3/164 (2%)
 Frame = +2

Query  113  SLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKT  292
            +L I+ F  +  +   LG I CE L  + C+FAIS++GKRC+LE  V   G +V Y C+T
Sbjct  9    TLAIVAFALAFLVQLTLGHIACENLNEDSCAFAISSTGKRCVLEKHVRRSGEEV-YICRT  67

Query  293  sevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDL  472
            SE+         IETDEC+EACG+DR ++G+SSD+LLE  FT KLCSS+CY NCPNI+DL
Sbjct  68   SEIESDKLKD-WIETDECIEACGVDRNALGISSDALLEYRFTRKLCSSACYNNCPNIIDL  126

Query  473  YFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSSE  604
            YFNLAAGEGVYLP LC +Q+   RR++ E+ S+G   A  P SE
Sbjct  127  YFNLAAGEGVYLPKLCAEQKGKGRREMAEIRSSGF-VAPAPESE  169



>ref|XP_002267610.1| PREDICTED: uncharacterized protein LOC100251502 [Vitis vinifera]
 emb|CBI22724.3| unnamed protein product [Vitis vinifera]
Length=186

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 112/155 (72%), Gaps = 2/155 (1%)
 Frame = +2

Query  110  LSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCK  289
            +SL +L    ++ + G LG ITCE L  + C++A+S+SGKRC+LE  V   G +  Y C+
Sbjct  8    MSLAVLALTLAVCVQGSLGGITCENLNKDTCAYAVSSSGKRCVLEKHVRRSGEEA-YVCR  66

Query  290  TsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVD  469
            TSE+         +E+D+C+EACG+DRKS+G+SSDSLLE  FT KLCSS CY +CPNIVD
Sbjct  67   TSEIEADKVKD-WVESDQCIEACGVDRKSLGISSDSLLECGFTHKLCSSQCYNSCPNIVD  125

Query  470  LYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
            LYFNLAAGEGV+LP LC+ QR   RR++ E+ S+G
Sbjct  126  LYFNLAAGEGVFLPKLCEAQRGDARREMAEIRSSG  160



>ref|XP_009388026.1| PREDICTED: uncharacterized protein LOC103974853 [Musa acuminata 
subsp. malaccensis]
Length=175

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 103/140 (74%), Gaps = 2/140 (1%)
 Frame = +2

Query  152  PGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHI  331
            P  L  + CE LP  +C+FAIS++ KRCLL +S  N+G + EYQC+TSE VV       I
Sbjct  24   PSALAGVICEELPQELCAFAISSTSKRCLL-DSTQNQGGRTEYQCRTSEAVVERMSD-WI  81

Query  332  ETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLP  511
            ETDECV ACG+ R SVG+SSDSL+E  F  KLCS  CY+NCPNIVDLYFNLAAGEGV+LP
Sbjct  82   ETDECVRACGVSRDSVGISSDSLMESDFAQKLCSQPCYRNCPNIVDLYFNLAAGEGVFLP  141

Query  512  DLCDKQRSHNRRDLVELNSN  571
            DLC+ QR + RR + ++ S+
Sbjct  142  DLCEAQRVNPRRSMAQILSS  161



>ref|XP_010427069.1| PREDICTED: uncharacterized protein LOC104711981 [Camelina sativa]
Length=183

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 119/177 (67%), Gaps = 15/177 (8%)
 Frame = +2

Query  98   SSMKLSLMILFFVGSLFLPGVLGD-ITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKV  274
            SS+KL +   F + S  L   LG+ I CE LPTN+C+F+IS SGKRCLLE +        
Sbjct  4    SSLKLPI---FLILSSLLHAALGENIICENLPTNMCAFSISASGKRCLLETANV----AG  56

Query  275  EYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNC  454
            EY C+TS V V   V  H+E+DECV ACG+DRK+VG+SSD+L+E  F AKLCS  C   C
Sbjct  57   EYTCRTSAVDVEGIVN-HVESDECVAACGVDRKTVGISSDTLMEAGFAAKLCSPDCLNYC  115

Query  455  PNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGG------EKALGPSSEE  607
            PNI+DLYFNLAAGEG +LPDLCD  R +  R ++E+ S+G       E A GPSSE+
Sbjct  116  PNILDLYFNLAAGEGAFLPDLCDAHRMNPHRSMLEILSSGAAPGPVSEVAPGPSSED  172



>gb|EYU25099.1| hypothetical protein MIMGU_mgv1a014446mg [Erythranthe guttata]
Length=189

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 112/163 (69%), Gaps = 2/163 (1%)
 Frame = +2

Query  113  SLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKT  292
            S  + FFV +LF+   LG I C+ L  + CS+A+S  GKRC+LE  V   G + EY C T
Sbjct  7    SKTLAFFVFALFVQVALGKIECQNLSKDTCSYAVSYVGKRCVLEKHVRRSGVE-EYTCGT  65

Query  293  sevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDL  472
            SE+     + + IE+DEC++ACGLDR ++G+SSDS+LE  F  KLCS  CY  CPNIVDL
Sbjct  66   SEIEAAGRMKDWIESDECIKACGLDRSALGISSDSMLESHFAGKLCSDECYGGCPNIVDL  125

Query  473  YFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSS  601
            YFNLAAGEGVYLP LC+ Q ++ RR++ E+ S+ G  A GP S
Sbjct  126  YFNLAAGEGVYLPKLCEAQGTNKRREMAEIKSS-GYVAPGPES  167



>ref|XP_011073213.1| PREDICTED: uncharacterized protein LOC105158236 [Sesamum indicum]
Length=167

 Score =   165 bits (417),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 114/157 (73%), Gaps = 6/157 (4%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M SSMKLSL +LFF  S+F+   L D+ CE LPTN+CSFAI++SGKRC+LE       N 
Sbjct  1    MGSSMKLSL-VLFFACSIFVQTTLADVICENLPTNLCSFAIASSGKRCVLEC----HKNT  55

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
             E  CKTSE+VV    G +IETD+CV+ACG+ R+SVGLSSD+LL   FTA LCS +CY N
Sbjct  56   QEKICKTSEIVVEKLSG-YIETDQCVKACGVCRESVGLSSDALLSSEFTAHLCSPACYHN  114

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVEL  562
            CPNIVDL+FNLAAGEGV LP LC  Q  ++R  L  L
Sbjct  115  CPNIVDLFFNLAAGEGVSLPALCKNQEENHRSMLAIL  151



>ref|XP_010035141.1| PREDICTED: uncharacterized protein LOC104424421 [Eucalyptus grandis]
 gb|KCW46434.1| hypothetical protein EUGRSUZ_K00266 [Eucalyptus grandis]
Length=181

 Score =   165 bits (417),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 108/149 (72%), Gaps = 3/149 (2%)
 Frame = +2

Query  149  LPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeH  328
            + G LGDI CE L    C+FA+S++GKRC+LE  V   G +  Y C++SE+   +    H
Sbjct  19   VQGTLGDIACENLDQGSCAFAVSSTGKRCVLEKQVRRSGEE-GYTCRSSEIEADNLKD-H  76

Query  329  IETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYL  508
            IETDEC+ ACGLDRK++G+SSDSLLE  FT KLCSS CY+NCPNIVDLYF+LAAGEGV+L
Sbjct  77   IETDECIAACGLDRKTLGVSSDSLLESRFTQKLCSSGCYENCPNIVDLYFSLAAGEGVFL  136

Query  509  PDLCDKQRSHNRRDLVELNSNGGEKALGP  595
            P LC+ QR   RR + E+ S+ G  A GP
Sbjct  137  PKLCEAQRGIARRGMGEIRSS-GHVAPGP  164



>ref|XP_010035139.1| PREDICTED: uncharacterized protein LOC104424419 [Eucalyptus grandis]
 gb|KCW46433.1| hypothetical protein EUGRSUZ_K00265 [Eucalyptus grandis]
Length=181

 Score =   165 bits (417),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 108/149 (72%), Gaps = 3/149 (2%)
 Frame = +2

Query  149  LPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeH  328
            + G LGDI CE L    C+FA+S++GKRC+LE  V   G +  Y C++SE+   +    H
Sbjct  19   VQGTLGDIACENLDQGSCAFAVSSTGKRCVLEKQVRRSGEE-GYTCRSSEIEADNLKD-H  76

Query  329  IETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYL  508
            IETDEC+ ACGLDRK++G+SSDSLLE  FT KLCSS CY+NCPNIVDLYF+LAAGEGV+L
Sbjct  77   IETDECIAACGLDRKTLGVSSDSLLESRFTQKLCSSGCYENCPNIVDLYFSLAAGEGVFL  136

Query  509  PDLCDKQRSHNRRDLVELNSNGGEKALGP  595
            P LC+ QR   RR + E+ S+ G  A GP
Sbjct  137  PKLCEAQRGIARRGMGEIRSS-GHVAPGP  164



>ref|XP_011081437.1| PREDICTED: uncharacterized protein LOC105164481 [Sesamum indicum]
Length=171

 Score =   164 bits (416),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 116/161 (72%), Gaps = 6/161 (4%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M SSMKLSL ILFF  SLF+ G L D+ C+ LP N+CSFAI++SGKRC+LE+      N 
Sbjct  1    MGSSMKLSL-ILFFTCSLFIQGTLADVICDNLPANLCSFAIASSGKRCVLES----HKNT  55

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
             E +CKTSEVVV    G +IET++CV+ACG+ R+SVG+SSD  L   FTA LCS +CY N
Sbjct  56   QEKKCKTSEVVVEKLSG-YIETEQCVKACGVCRESVGISSDVFLSSEFTAHLCSPACYHN  114

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
            CPNIVDL+FNLAA EGV LP LC  Q  ++R  L  L+ +G
Sbjct  115  CPNIVDLFFNLAASEGVSLPTLCKNQEENHRAMLAILSHDG  155



>ref|XP_010035140.1| PREDICTED: uncharacterized protein LOC104424420 [Eucalyptus grandis]
Length=181

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 108/149 (72%), Gaps = 3/149 (2%)
 Frame = +2

Query  149  LPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeH  328
            + G LGDI CE L    C+FA+S++GKRC+LE  V   G +  Y C++SE+   +    H
Sbjct  19   VQGTLGDIACENLDQGSCAFAVSSTGKRCVLEKQVRRSGEE-GYTCRSSEIEADNLKD-H  76

Query  329  IETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYL  508
            IETDEC+ ACGLDRK++G+SSDSLLE  FT KLCSS CY+NCPNIVDLYF+LAAGEGV+L
Sbjct  77   IETDECIAACGLDRKTLGVSSDSLLESRFTQKLCSSGCYENCPNIVDLYFSLAAGEGVFL  136

Query  509  PDLCDKQRSHNRRDLVELNSNGGEKALGP  595
            P LC+ QR   RR + E+ S+ G  A GP
Sbjct  137  PKLCEAQRGIARRGMGEIRSS-GHVAPGP  164



>ref|XP_010909892.1| PREDICTED: uncharacterized protein LOC105035875 [Elaeis guineensis]
Length=193

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 107/156 (69%), Gaps = 2/156 (1%)
 Frame = +2

Query  110  LSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCK  289
            ++ + L     LF+P VLG +TCE L  + C+FA+S++G RC+LE  V   G + EY C+
Sbjct  2    VAFIALVLALYLFVPHVLGAVTCERLDRSTCAFAVSSAGTRCVLEKRV-RRGGQEEYTCR  60

Query  290  TsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVD  469
             S V        H+ETDEC++ACGL R S+G+SSDSLL+  FT KLCS+ CY  CPNIV+
Sbjct  61   ASRVEADGLKD-HVETDECLKACGLVRGSLGISSDSLLDSRFTQKLCSARCYNGCPNIVN  119

Query  470  LYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGG  577
            LYFNLAAGEGV+LP LC   R+  RR + E+ S+GG
Sbjct  120  LYFNLAAGEGVFLPKLCKTHRASKRRAMAEIRSSGG  155



>ref|XP_011094948.1| PREDICTED: uncharacterized protein LOC105174517 [Sesamum indicum]
Length=176

 Score =   164 bits (416),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 118/168 (70%), Gaps = 5/168 (3%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M SS K SL++ FF  SLF+ G L ++ CE LP N+C+FAI++SGKRC+LE +    G +
Sbjct  1    MASSTKFSLLLFFFACSLFIQGTLAEVICENLPMNLCAFAIASSGKRCVLEKTKNARG-E  59

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
            + + CKTSEVVV    G ++ETD+CV  CGL R+ +GLSSD  +   FTA LCS +C+QN
Sbjct  60   IGFTCKTSEVVVERLSG-YLETDQCVNGCGLHREFIGLSSDVFISSEFTAHLCSPACFQN  118

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGP  595
            CPNIVDLY NLAAGEGV LP LC  Q+ ++R  L  L+++G   A GP
Sbjct  119  CPNIVDLYLNLAAGEGVSLPILCQNQKENHRAMLTILSNDG---ARGP  163



>emb|CDY66558.1| BnaC08g48820D [Brassica napus]
Length=181

 Score =   164 bits (416),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 119/172 (69%), Gaps = 11/172 (6%)
 Frame = +2

Query  98   SSMKLSLMILFFVGSLFLPGVLGD-ITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKV  274
            SS+KLS+   F + S  L   LG+ I CE LPTN+C+F+IS SGKRCLLE +        
Sbjct  4    SSLKLSI---FLILSSLLHAALGEGIICENLPTNICAFSISASGKRCLLETANVAG----  56

Query  275  EYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNC  454
            EY C+TSEV V   V  H+E+D CV ACG+DRK+VG+SSD+++E  F AKLCS +C   C
Sbjct  57   EYTCRTSEVEVEGIVN-HVESDACVAACGVDRKTVGISSDAMMEAGFAAKLCSPACLDYC  115

Query  455  PNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSSEES  610
            PNI+DLYFNLAAGEG +LPDLCD QR +  R ++E+ S+G   A GPS   S
Sbjct  116  PNILDLYFNLAAGEGAFLPDLCDAQRINPHRSMLEMLSSGA--APGPSEPTS  165



>ref|XP_011073221.1| PREDICTED: uncharacterized protein LOC105158244 [Sesamum indicum]
Length=175

 Score =   164 bits (415),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 115/161 (71%), Gaps = 6/161 (4%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M SSMKLSL ILFF  SLF+ G L D+ CE LP N+CSFAI++SGKRC+LE       N 
Sbjct  1    MGSSMKLSL-ILFFTCSLFVQGTLADVICENLPANLCSFAIASSGKRCVLEC----HKNT  55

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
             E +CKTSEVVV    G +IET++CV+ACG+ R+SVG+SSD  L   FTA LCS +CY N
Sbjct  56   QEKKCKTSEVVVEKLSG-YIETEQCVKACGVCRESVGISSDVFLSSEFTAHLCSPACYHN  114

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
            CPNIVDL+FNLAA EGV LP LC  Q  ++R  L  L+ +G
Sbjct  115  CPNIVDLFFNLAASEGVSLPTLCKNQEENHRAMLAILSHDG  155



>ref|XP_011073211.1| PREDICTED: uncharacterized protein LOC105158234 [Sesamum indicum]
Length=171

 Score =   164 bits (415),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 116/162 (72%), Gaps = 7/162 (4%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M SSMKLSL ILFF  SLF+   L ++ CE LPTN+CSFAI++SGKRC+LEN  + +G  
Sbjct  1    MGSSMKLSL-ILFFTCSLFVQNTLANVICENLPTNMCSFAIASSGKRCVLENHKSPQGKT  59

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
                CKTSEVVV    G +IETD+CV ACG+ R++VG+SSD+ L   FTA LCS +C+ N
Sbjct  60   ----CKTSEVVVEKLSG-YIETDQCVNACGVCREAVGISSDAFLSSEFTAHLCSPACFHN  114

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGG  577
            CPNIVDL+FNLAA EGV LP LC  Q   N R L+ + S GG
Sbjct  115  CPNIVDLFFNLAASEGVSLPTLCKNQE-ENHRALLTILSRGG  155



>emb|CDY07560.1| BnaC06g15040D [Brassica napus]
Length=182

 Score =   164 bits (415),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 119/172 (69%), Gaps = 11/172 (6%)
 Frame = +2

Query  98   SSMKLSLMILFFVGSLFLPGVLG-DITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKV  274
            SS+KL +   F + S  L   LG DI CE LPTN+C+F+IS SGKRCLLE +        
Sbjct  4    SSLKLPI---FLILSSLLHAALGEDIVCENLPTNMCAFSISASGKRCLLETANV----AG  56

Query  275  EYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNC  454
            EY C+TS V V   V  H+E+DECV ACG+DRK+VG+SSD+++E  F AKLCS +C   C
Sbjct  57   EYTCRTSAVEVEGIVN-HVESDECVAACGVDRKTVGISSDAMMEEGFAAKLCSPACLDYC  115

Query  455  PNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSSEES  610
            PNI+DLYFNLAAGEG +LPDLCD QR +  R ++E+ S+  + A GP SE +
Sbjct  116  PNILDLYFNLAAGEGAFLPDLCDAQRINPHRSMLEILSS--DAAPGPVSETA  165



>ref|XP_002267611.1| PREDICTED: uncharacterized protein LOC100254969 isoform X2 [Vitis 
vinifera]
 emb|CAN82560.1| hypothetical protein VITISV_031304 [Vitis vinifera]
 emb|CBI22722.3| unnamed protein product [Vitis vinifera]
Length=186

 Score =   164 bits (416),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 109/154 (71%), Gaps = 2/154 (1%)
 Frame = +2

Query  113  SLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKT  292
            SL IL    ++ + G LG  TCE L  + C+FA+S+SGKRC+LE  V   G +  Y C+T
Sbjct  9    SLAILALTLAVCVQGSLGGTTCENLNKDTCAFAVSSSGKRCVLEKHVRRSGEEA-YVCRT  67

Query  293  sevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDL  472
            SE+         +E+D+C+EACGLDRKS+G+SSDSLLE  FT KLCS+ CY  CPNIVDL
Sbjct  68   SEIEADKVKD-WVESDQCIEACGLDRKSLGISSDSLLECGFTRKLCSTQCYNGCPNIVDL  126

Query  473  YFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
            YFNLAAGEGV+LP LC+ QR   RR++ E+ S+G
Sbjct  127  YFNLAAGEGVFLPKLCEAQRGDARREMAEIRSSG  160



>ref|XP_010923167.1| PREDICTED: uncharacterized protein LOC105046307 isoform X1 [Elaeis 
guineensis]
Length=186

 Score =   164 bits (416),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 107/138 (78%), Gaps = 2/138 (1%)
 Frame = +2

Query  170  ITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETDECV  349
            + CE LP ++C+FAIS+S KRC+LE S+ + G   EYQC+TSEVVV       IETDECV
Sbjct  33   VICEDLPQDLCAFAISSSSKRCVLE-SIPHNGGPTEYQCRTSEVVVERMSD-WIETDECV  90

Query  350  EACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLCDKQ  529
            +ACG+DR +VG+SSDSLLEP FT K+CS SC+QNCPNI+DLYFNLAA EGV+LPDLC+ +
Sbjct  91   KACGVDRNTVGISSDSLLEPQFTEKICSPSCHQNCPNIIDLYFNLAAAEGVFLPDLCEAR  150

Query  530  RSHNRRDLVELNSNGGEK  583
            R + RR +  + S+G  K
Sbjct  151  RGNPRRSMQVILSSGVPK  168



>ref|XP_010662745.1| PREDICTED: uncharacterized protein LOC100254969 isoform X1 [Vitis 
vinifera]
Length=186

 Score =   164 bits (415),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 109/154 (71%), Gaps = 2/154 (1%)
 Frame = +2

Query  113  SLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKT  292
            SL IL    ++ + G LG  TCE L  + C+FA+S+SGKRC+LE  V   G +  Y C+T
Sbjct  9    SLAILALTLAVCVQGSLGGTTCENLNKDTCAFAVSSSGKRCVLEKHVRRSGEEA-YVCRT  67

Query  293  sevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDL  472
            SE+         +E+D+C+EACGLDRKS+G+SSDSLLE  FT KLCS+ CY  CPNIVDL
Sbjct  68   SEIEADKVKD-WVESDQCIEACGLDRKSLGISSDSLLECGFTRKLCSTQCYNGCPNIVDL  126

Query  473  YFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
            YFNLAAGEGV+LP LC+ QR   RR++ E+ S+G
Sbjct  127  YFNLAAGEGVFLPKLCEAQRGDARREMAEIRSSG  160



>ref|XP_006421929.1| hypothetical protein CICLE_v10005988mg [Citrus clementina]
 ref|XP_006490398.1| PREDICTED: uncharacterized protein LOC102613323 [Citrus sinensis]
 gb|ESR35169.1| hypothetical protein CICLE_v10005988mg [Citrus clementina]
 gb|KDO52034.1| hypothetical protein CISIN_1g029827mg [Citrus sinensis]
Length=187

 Score =   164 bits (415),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 111/160 (69%), Gaps = 3/160 (2%)
 Frame = +2

Query  95   DSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKV  274
            DS +K+  ++   + +  +   LG++TCE L  N C+FA+S SGKRC+LE  V   G + 
Sbjct  6    DSGLKIFAVVALAI-AFCVQATLGEVTCESLDQNACAFAVSASGKRCVLEKQVKRSGQET  64

Query  275  EYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNC  454
             Y CKTSE+         IETD+C+++CGLDRKS+G+SSDSLLE  FT KLCSS CY +C
Sbjct  65   -YTCKTSEIEAEKLNN-WIETDQCIKSCGLDRKSLGISSDSLLESGFTQKLCSSPCYGSC  122

Query  455  PNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
            PNIVDLYFNLAAGEGV+LP LC+ Q    RR + E+ S+G
Sbjct  123  PNIVDLYFNLAAGEGVFLPKLCEAQGKGARRRMSEIKSSG  162



>ref|XP_007143423.1| hypothetical protein PHAVU_007G071100g [Phaseolus vulgaris]
 gb|ESW15417.1| hypothetical protein PHAVU_007G071100g [Phaseolus vulgaris]
Length=191

 Score =   164 bits (415),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 105/154 (68%), Gaps = 2/154 (1%)
 Frame = +2

Query  113  SLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKT  292
            + M+ F   SL L   LG   CE L    CSFA+S+ GKRC+LE  V   G + EY CKT
Sbjct  9    TFMVFFLAFSLTLEATLGGTECENLSHETCSFAVSSGGKRCVLEKRVKRSGEE-EYTCKT  67

Query  293  sevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDL  472
            S++   +    HIETD+C++ACGLDR S+G+SSDSLLE  FT KLCS  CY  CPN+VDL
Sbjct  68   SDIEAENLKD-HIETDQCIKACGLDRNSLGISSDSLLESTFTHKLCSPHCYHFCPNVVDL  126

Query  473  YFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
            YFNLAAGEGV+LP LC+ +  + RR + EL S+G
Sbjct  127  YFNLAAGEGVFLPKLCEVEGVNARRGMAELRSSG  160



>ref|XP_006353293.1| PREDICTED: uncharacterized protein LOC102592141 [Solanum tuberosum]
Length=184

 Score =   164 bits (414),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 115/164 (70%), Gaps = 3/164 (2%)
 Frame = +2

Query  113  SLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKT  292
            +L I+ F  +  +   LGDI CE L  + C+FAIS++GKRC+LE  +   G +V Y C+T
Sbjct  9    TLAIVAFALAFLVQVTLGDIACENLNEDSCAFAISSTGKRCVLEKHLRRSGEEV-YICRT  67

Query  293  sevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDL  472
            SE+         IETDEC+  CG+DR ++G+SSD+LLE  FT+KLCSS+CY NCPNI+DL
Sbjct  68   SEIEADKLKD-WIETDECIGECGVDRNALGISSDALLESRFTSKLCSSACYNNCPNIIDL  126

Query  473  YFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSSE  604
            YFNLAAGEGVYLP LC +Q+ + RR++ E+ S+G   A  P SE
Sbjct  127  YFNLAAGEGVYLPKLCAEQKGNGRREMAEIRSSGF-VAPAPESE  169



>gb|KEH26321.1| PAR1 protein [Medicago truncatula]
Length=192

 Score =   164 bits (415),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 112/154 (73%), Gaps = 2/154 (1%)
 Frame = +2

Query  113  SLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKT  292
            +L+I+ FV  + + G LG I CE L  + C+FA+S +GKRC+LE  V   G + +Y C+T
Sbjct  3    NLVIVAFVFFVAVEGTLGGIECENLNQDTCAFAVSYAGKRCVLEKHVKRNGEE-KYTCRT  61

Query  293  sevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDL  472
            SE+        HIE+D+C+++CGLDRKS G+SSDSLLE  FT  LCS  CY++CPNIVDL
Sbjct  62   SEIEADKLKD-HIESDQCIKSCGLDRKSFGISSDSLLESSFTKNLCSPQCYKSCPNIVDL  120

Query  473  YFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
            YFNLAAGEGV+LP LC+ Q ++ RR++ E+ S+G
Sbjct  121  YFNLAAGEGVFLPKLCEAQGANARREMAEIKSSG  154



>ref|XP_006363091.1| PREDICTED: uncharacterized protein LOC102590281 [Solanum tuberosum]
Length=173

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 111/151 (74%), Gaps = 8/151 (5%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLG----DITCEFLPTNVCSFAISTSGKRCLLENSVTN  259
            M SSMK SL ILFF  SLFL         ++ CE LP   C+FAIS++GKRC+LE + T 
Sbjct  1    MASSMKSSL-ILFFTCSLFLQVTYAVYKTEVKCESLPNGDCAFAISSTGKRCILEKATTP  59

Query  260  EGNKV--EYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCS  433
            + + +  EY+CKTSEV+V +    HIETDEC+E+CGL+R   G+SSD LLEP F +KLC+
Sbjct  60   KDDLISSEYECKTSEVIVENMKE-HIETDECIESCGLNRNFFGISSDDLLEPQFVSKLCA  118

Query  434  SSCYQNCPNIVDLYFNLAAGEGVYLPDLCDK  526
             +CYQ CPNIVDLYFNLAAGEG YLPDLC+K
Sbjct  119  PACYQECPNIVDLYFNLAAGEGAYLPDLCNK  149



>ref|XP_003592283.1| PAR-1a protein [Medicago truncatula]
 gb|AES62534.1| PAR1 protein [Medicago truncatula]
Length=198

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 106/154 (69%), Gaps = 2/154 (1%)
 Frame = +2

Query  113  SLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKT  292
            SL+I     SL + G LG I CE L    CSFA+S+S KRC+LE  V   G +  Y CKT
Sbjct  9    SLLIASLAISLAVQGTLGGIECENLSKETCSFAVSSSSKRCVLEKHVKRTGEEA-YTCKT  67

Query  293  sevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDL  472
             E+        HIE+D+C++AC LDRKS+G+SSDSLLE  FT KLCS  CY++CPN+VDL
Sbjct  68   LEIEADKLKD-HIESDQCIKACDLDRKSLGISSDSLLESSFTKKLCSPQCYKSCPNVVDL  126

Query  473  YFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
            YFNLAAGEGV+LP LC+ Q  + RR + EL S+G
Sbjct  127  YFNLAAGEGVFLPKLCEVQGGNARRGMAELKSSG  160



>ref|XP_011073220.1| PREDICTED: uncharacterized protein LOC105158243 [Sesamum indicum]
Length=171

 Score =   162 bits (411),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 114/161 (71%), Gaps = 6/161 (4%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M SSMKLSL ILFF  SLF+ G L D+ CE LP N+CSFAI++SGKRC+LE       N 
Sbjct  1    MGSSMKLSL-ILFFTCSLFVQGTLADVICENLPANLCSFAIASSGKRCVLEC----HKNT  55

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
             E +CK+ EVVV    G +IET++CV+ACG+ R+SVG+SSD  L   FTA LCS +CY N
Sbjct  56   QEKKCKSLEVVVEKLSG-YIETEQCVKACGVCRESVGISSDVFLSSEFTAHLCSPACYHN  114

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
            CPNIVDL+FNLAA EGV LP LC  Q  ++R  L  L+ +G
Sbjct  115  CPNIVDLFFNLAASEGVSLPTLCKNQEENHRAMLAILSHDG  155



>ref|XP_010326144.1| PREDICTED: uncharacterized protein LOC101261443 [Solanum lycopersicum]
Length=168

 Score =   162 bits (411),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 112/149 (75%), Gaps = 5/149 (3%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M SSMK SL ILFF  SLFL  V   + CE LP + C+FAIS++GKRC+LE +   + + 
Sbjct  1    MGSSMKSSL-ILFFTCSLFL-QVAYAVKCESLPNSDCAFAISSTGKRCVLEKAKKPKDDL  58

Query  272  V--EYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCY  445
            +  EY+CKTSEV+V +    HIETDEC+E+CGL+R   G+SSD LLEP F +KLC+ +CY
Sbjct  59   ISSEYECKTSEVMVQNMKE-HIETDECIESCGLNRNFFGISSDDLLEPRFVSKLCAPACY  117

Query  446  QNCPNIVDLYFNLAAGEGVYLPDLCDKQR  532
            Q CPNIVDLYFNLAAGEG YLPD+C+K +
Sbjct  118  QQCPNIVDLYFNLAAGEGAYLPDICNKNK  146



>ref|XP_006361911.1| PREDICTED: uncharacterized protein LOC102603240 [Solanum tuberosum]
Length=186

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 113/154 (73%), Gaps = 1/154 (1%)
 Frame = +2

Query  113  SLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKT  292
            +L I+ F  +L +   LG ITCE L  + C+FAIS++GKRC+LE S+   G +V Y C+T
Sbjct  10   TLAIVAFTLALCVQVTLGSITCENLNKDSCAFAISSTGKRCVLEKSLRRSGEQV-YTCRT  68

Query  293  sevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDL  472
            SE+   + +   IETD C+++CG++R ++G+SSDSLLE  FT KLCS  CY++CPNIVDL
Sbjct  69   SEIEADNKLKNRIETDNCIQSCGVNRNTLGISSDSLLECHFTKKLCSPECYKHCPNIVDL  128

Query  473  YFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
            YFNLAAGEGVYLP LC++Q  + RR + E+ S+G
Sbjct  129  YFNLAAGEGVYLPRLCEEQGGNGRRGMAEIRSSG  162



>ref|XP_002520453.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41866.1| conserved hypothetical protein [Ricinus communis]
Length=180

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 101/138 (73%), Gaps = 1/138 (1%)
 Frame = +2

Query  119  MILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTse  298
            +I+F   SL L G LG++ CE LP  +CS+++++ GKRCLLE   T E  +V YQCKTSE
Sbjct  3    LIIFLAVSLLLHGALGELVCEQLPVELCSYSVASFGKRCLLETFATEEDREVIYQCKTSE  62

Query  299  vvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYF  478
            VVV       IE+DECV ACGLDR +VG+SSD+L EP   AKLCSS  YQ+CPNI+DLYF
Sbjct  63   VVVDVIQE-RIESDECVNACGLDRNTVGISSDTLFEPHLLAKLCSSDSYQSCPNIIDLYF  121

Query  479  NLAAGEGVYLPDLCDKQR  532
            NLA GEG+YLPD+C   R
Sbjct  122  NLALGEGIYLPDICANPR  139



>ref|XP_010671873.1| PREDICTED: uncharacterized protein LOC104888552 [Beta vulgaris 
subsp. vulgaris]
Length=214

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 114/165 (69%), Gaps = 3/165 (2%)
 Frame = +2

Query  107  KLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQC  286
            K+SL+ L F+ SL +   LG++TCE L    C+FA+S+ GKRC+LE  V   G +  Y+C
Sbjct  7    KISLITLAFLSSLLVQCTLGEVTCEQLNKEACAFAVSSIGKRCVLEKYVRRSGLEA-YKC  65

Query  287  KTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIV  466
             T+  +    + + +E++ C+EACGLDR ++G+SSDSLLE  FT KLCS  CYQ CPN++
Sbjct  66   -TTSAIDTDELKDMVESNHCIEACGLDRDTLGISSDSLLESRFTRKLCSPQCYQKCPNVI  124

Query  467  DLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSS  601
            DLYFNLAAGEGV+LP LC  QR + RR L E+ S+ G  A GP S
Sbjct  125  DLYFNLAAGEGVFLPKLCASQRENPRRGLSEIKSS-GIAAPGPMS  168



>ref|XP_011073222.1| PREDICTED: uncharacterized protein LOC105158245 [Sesamum indicum]
Length=171

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 115/162 (71%), Gaps = 7/162 (4%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M SSMKLSL I+FF  SLF+   L ++ CE LPTN+CSFAI++SGKRC+LEN  + +G  
Sbjct  1    MGSSMKLSL-IIFFTCSLFVQNTLANVICENLPTNMCSFAIASSGKRCVLENHKSPQGKT  59

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
                CKTSEVVV    G +IETD+CV ACG+ R+ VG+SSD+ L   FTA LCS +C QN
Sbjct  60   ----CKTSEVVVEKLSG-YIETDQCVNACGVCREVVGISSDAFLSSEFTAHLCSPACLQN  114

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGG  577
            CPNIVDL+FNLAA EGV LP LC  Q   N R L+ + S GG
Sbjct  115  CPNIVDLFFNLAASEGVSLPTLCKNQE-ENHRALLTILSRGG  155



>ref|XP_011032296.1| PREDICTED: uncharacterized protein LOC105131158 [Populus euphratica]
Length=179

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 112/161 (70%), Gaps = 7/161 (4%)
 Frame = +2

Query  119  MILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTse  298
            +I F   SL L G LG++ CE LP + CS++I+TSGKRCLLEN  T +G  V+YQCKTSE
Sbjct  3    LIAFLALSLLLNGALGELVCEQLPVDFCSYSIATSGKRCLLENYATKDGG-VKYQCKTSE  61

Query  299  vvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYF  478
            VVV       IE DEC+ ACGL+R +VG+SSDSLL+P F  KLCS SC Q CPNIVDLY 
Sbjct  62   VVVDKLNE-WIEIDECITACGLNRNTVGISSDSLLQPQFLTKLCSKSCSQACPNIVDLYS  120

Query  479  NLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSS  601
            NLA  EGVYLP+LC    +  RR + +  SN G+ A  P+S
Sbjct  121  NLALAEGVYLPNLC----ASPRRAMYQTRSN-GDAAPAPAS  156



>ref|XP_010273059.1| PREDICTED: uncharacterized protein LOC104608702 [Nelumbo nucifera]
Length=200

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 105/140 (75%), Gaps = 2/140 (1%)
 Frame = +2

Query  155  GVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIE  334
            G LG ITCE L  N C+FA+S+SG RC+LE  V   G++V Y C+TSE+         +E
Sbjct  24   GTLGGITCEHLDKNTCAFAVSSSGTRCVLEKHVKRSGDEV-YTCRTSEIEADKLKD-WVE  81

Query  335  TDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPD  514
            TDEC++ACGL+R ++G+SSD+L+EP F  KLCSS CY NCPNI+DLYFNLAAGEG++LP 
Sbjct  82   TDECIQACGLNRNTLGISSDALVEPCFVHKLCSSRCYDNCPNIIDLYFNLAAGEGIFLPK  141

Query  515  LCDKQRSHNRRDLVELNSNG  574
            LC+ Q ++ RR++ E+ S+G
Sbjct  142  LCEAQGANARREMSEIRSSG  161



>ref|XP_006291916.1| hypothetical protein CARUB_v10018100mg [Capsella rubella]
 gb|EOA24814.1| hypothetical protein CARUB_v10018100mg [Capsella rubella]
Length=181

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 118/170 (69%), Gaps = 11/170 (6%)
 Frame = +2

Query  98   SSMKLSLMILFFVGSLFLPGVLGD-ITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKV  274
            SS+KL +   F + S  L   LG+ I CE LPTN+C+F+IS SGKRCLLE +        
Sbjct  4    SSLKLPI---FLILSSLLHAALGENIICENLPTNMCAFSISASGKRCLLETANV----AG  56

Query  275  EYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNC  454
            E+ C+TS V V   V  H+E+DECV ACG+DRK+VG+SSD+L+E  F +KLCS +C   C
Sbjct  57   EFTCRTSAVDVEGIVN-HVESDECVSACGVDRKTVGISSDALMESGFASKLCSPACLDYC  115

Query  455  PNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSSE  604
            PNI+DLYFNLAAGEG +LPDLCD QR +  R ++E+ S+G   A GP SE
Sbjct  116  PNILDLYFNLAAGEGAFLPDLCDAQRMNPHRSMLEILSSGA--APGPVSE  163



>ref|XP_011078704.1| PREDICTED: uncharacterized protein LOC105162404 [Sesamum indicum]
Length=171

 Score =   162 bits (410),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 115/158 (73%), Gaps = 3/158 (2%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M SSM+ SL+I FF  SLF+ G L ++ CE LP N+CSFAIS++GKRC+LE+     G +
Sbjct  1    MTSSMRFSLVI-FFACSLFVQGTLAEVVCENLPANLCSFAISSTGKRCVLESYKIGRG-E  58

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
            ++Y C+TSEVVV    G +IE+D CV+ACG+ R+S  +SSD  L   FTA LCS +CYQN
Sbjct  59   IDYMCRTSEVVVERLYG-YIESDHCVKACGVHRESTSISSDVFLSSEFTAHLCSPACYQN  117

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELN  565
            CPNIV+L+FNLAAGEG+ LP LC  Q+ ++R  L  LN
Sbjct  118  CPNIVELFFNLAAGEGLSLPTLCHNQKENHRTMLAILN  155



>ref|XP_004496561.1| PREDICTED: uncharacterized protein LOC101495651 [Cicer arietinum]
Length=197

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 109/155 (70%), Gaps = 3/155 (2%)
 Frame = +2

Query  113  SLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKT  292
            S +IL F  SL + G LGDI CE L    C+FA+S+S KRC+LE  V   G +  Y C+T
Sbjct  9    SFVILAFAISLVVQGTLGDIECENLNEKTCAFAVSSSSKRCVLEKHVKRTGEEA-YTCRT  67

Query  293  sevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDL  472
            S++        HIE+D+C+++C LDRKS+G+SSDSLLE  FT KLCS  CY++CPN+VDL
Sbjct  68   SDIEADKLKD-HIESDQCIKSCDLDRKSLGISSDSLLESRFTEKLCSPQCYKSCPNVVDL  126

Query  473  YFNLAAGEGVYLPDLCDKQRSHN-RRDLVELNSNG  574
            YFNLAAGEGV+LP LC+ Q   N RR + EL S+G
Sbjct  127  YFNLAAGEGVFLPKLCEVQGGFNVRRGMAELKSSG  161



>ref|XP_008794209.1| PREDICTED: uncharacterized protein LOC103710316 [Phoenix dactylifera]
Length=199

 Score =   162 bits (411),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 107/154 (69%), Gaps = 2/154 (1%)
 Frame = +2

Query  113  SLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKT  292
            + + +    +L +P VLG +TCE L  + C+FA+S++G RC+LE  V   G + EY C+ 
Sbjct  9    AFIAIILALNLLVPQVLGAVTCERLDRSTCAFAVSSAGTRCVLEKRV-RRGGQEEYTCRA  67

Query  293  sevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDL  472
            S +        H+ETDEC+EACGL R ++G+SSDSLL+  FT KLCS+ C+  CPNIV+L
Sbjct  68   SRIEADGLKD-HVETDECLEACGLGRDTLGISSDSLLDSRFTQKLCSARCFNGCPNIVNL  126

Query  473  YFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
            YFNLAAGEGV+LP LC+  R+ NRR + E+ S+G
Sbjct  127  YFNLAAGEGVFLPKLCETHRTSNRRTMAEIRSSG  160



>gb|AFK34890.1| unknown [Medicago truncatula]
Length=198

 Score =   162 bits (411),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 105/154 (68%), Gaps = 2/154 (1%)
 Frame = +2

Query  113  SLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKT  292
            SL+I     SL + G LG I CE L    CSFA+S+S KRC+LE      G +  Y CKT
Sbjct  9    SLLIASLAISLAVQGTLGGIECENLSKETCSFAVSSSSKRCVLEKHAKRTGEEA-YTCKT  67

Query  293  sevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDL  472
             E+        HIE+D+C++AC LDRKS+G+SSDSLLE  FT KLCS  CY++CPN+VDL
Sbjct  68   LEIEADKLKD-HIESDQCIKACDLDRKSLGISSDSLLESSFTKKLCSPQCYKSCPNVVDL  126

Query  473  YFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
            YFNLAAGEGV+LP LC+ Q  + RR + EL S+G
Sbjct  127  YFNLAAGEGVFLPKLCEVQGGNARRGMAELKSSG  160



>ref|XP_008798941.1| PREDICTED: uncharacterized protein LOC103713707 [Phoenix dactylifera]
Length=192

 Score =   162 bits (410),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 107/141 (76%), Gaps = 2/141 (1%)
 Frame = +2

Query  149  LPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeH  328
            +P     +TCE LP ++C+FAIS+S KRC+LE S  + G   EYQC+TSEVVV       
Sbjct  22   IPSTSAGVTCEDLPQDLCAFAISSSSKRCVLE-STQHSGRPTEYQCRTSEVVVARMSNW-  79

Query  329  IETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYL  508
            IETDECV+ACG+DR SVG+SSDSLLEP FT KLCS +C++NCPNI+DLYFNLAAGEGV L
Sbjct  80   IETDECVKACGVDRNSVGISSDSLLEPQFTEKLCSPACHENCPNIIDLYFNLAAGEGVLL  139

Query  509  PDLCDKQRSHNRRDLVELNSN  571
            P+LC+ +R +  R ++ + S+
Sbjct  140  PELCEARRVNPHRSMMTILSS  160



>ref|XP_011073216.1| PREDICTED: uncharacterized protein LOC105158240 [Sesamum indicum]
Length=170

 Score =   160 bits (406),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 114/162 (70%), Gaps = 7/162 (4%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLG-DITCEFLPTNVCSFAISTSGKRCLLENSVTNEGN  268
            M SS+KLSL+ LFF  SLF+   +  D+ CE LPTN+CSFAI++SGKRC+LEN     G 
Sbjct  1    MGSSVKLSLL-LFFTCSLFVQITIAEDVICENLPTNLCSFAIASSGKRCVLENHKNAHGK  59

Query  269  KVEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQ  448
                 CKTSEVVV    G +IETDECV+ACG+ R+SVGLSSD+ L   FTA LCS +CY 
Sbjct  60   ----TCKTSEVVVDKLSG-YIETDECVKACGVCRESVGLSSDAFLSSKFTAHLCSPACYH  114

Query  449  NCPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
             CPNIVDL+FNLAAGEGV LP LC  Q   +R  L  L+ +G
Sbjct  115  KCPNIVDLFFNLAAGEGVSLPALCKNQEDKHREMLASLSGDG  156



>gb|ABK21049.1| unknown [Picea sitchensis]
Length=182

 Score =   160 bits (405),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 116/176 (66%), Gaps = 10/176 (6%)
 Frame = +2

Query  107  KLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQC  286
            +L   I   +  + L  V G I CE LP  VC+F++STSG RC+LE S+ ++GN V+Y+C
Sbjct  5    RLLFTISALISVISLRVVFGGIVCEKLPVEVCAFSVSTSGARCVLEKSILSDGN-VQYEC  63

Query  287  KTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIV  466
            + SEV+  +     IET+ECV ACG++R +VG+S+DSL E  FT KLCS+ CY NCPNIV
Sbjct  64   QRSEVIAENLNEL-IETEECVNACGVERMTVGMSTDSLAERGFTNKLCSTRCYNNCPNIV  122

Query  467  DLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG--------GEKALGPSSEES  610
            DLYFNLAAGEGVYLP LC+  RS  RR + E+ S          G+  + P+S  S
Sbjct  123  DLYFNLAAGEGVYLPRLCEAHRSGARRMISEVTSFAVAPATIGFGDTTISPTSAPS  178



>ref|XP_010908211.1| PREDICTED: uncharacterized protein LOC105034670 [Elaeis guineensis]
Length=191

 Score =   160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 101/135 (75%), Gaps = 2/135 (1%)
 Frame = +2

Query  152  PGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHI  331
            P     + CE LP ++C+FAIS+S KRC+LE S  + G   EYQC+TSEVVV       I
Sbjct  23   PSTSAGVVCEDLPQDLCAFAISSSSKRCVLE-STQHSGRPTEYQCRTSEVVVERMSD-WI  80

Query  332  ETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLP  511
            ETDECV ACG DR SVG+SSDSLLEP FT KLCS +C++NCPNI+DLYFNLAAGEGV+LP
Sbjct  81   ETDECVRACGADRNSVGISSDSLLEPQFTEKLCSPACHENCPNIIDLYFNLAAGEGVFLP  140

Query  512  DLCDKQRSHNRRDLV  556
            DLC+ +R +  R ++
Sbjct  141  DLCEARRVNPHRSMM  155



>gb|KHF98264.1| Cytosolic beta-glucosidase [Gossypium arboreum]
Length=184

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 112/161 (70%), Gaps = 7/161 (4%)
 Frame = +2

Query  101  SMKLSLMILFFVGSLF---LPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            SMK++L IL    SLF   L   LG+I CE L  + C++A++++GKRC+LE  V   G +
Sbjct  6    SMKMTLAILAL--SLFSSCLQATLGEIICEHLDQDTCAYAVASTGKRCVLEKHVKRSGEE  63

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
             EY C+TSE+         IETD+CV++CGLDRKS G+SSDSLLE  FT  LCS  CY  
Sbjct  64   -EYTCRTSEIEADKINN-WIETDQCVKSCGLDRKSFGISSDSLLESRFTEMLCSPQCYNG  121

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
            CPN++DLYFNLAAGEG++LP LC+ Q+ + RR + E+ S+G
Sbjct  122  CPNVIDLYFNLAAGEGIFLPKLCEAQKGNIRRGMSEIRSSG  162



>ref|XP_010671872.1| PREDICTED: uncharacterized protein LOC104888551 [Beta vulgaris 
subsp. vulgaris]
Length=231

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 113/164 (69%), Gaps = 3/164 (2%)
 Frame = +2

Query  110  LSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCK  289
            ++L+ L  + SL + G LG++TCE L    C+FA+S+ GKRC+LE  V   G +  Y+C 
Sbjct  8    ITLVFLALLSSLLIQGTLGEVTCEQLNKEACAFAVSSIGKRCVLEKYVRRSGLEA-YKC-  65

Query  290  TsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVD  469
            T+  +    + + +E++ C+EACGLDR ++G+SSDSLLE  FT KLCS  CYQ CPN+VD
Sbjct  66   TTSAIDTDELKDMVESNHCIEACGLDRDTLGISSDSLLESRFTRKLCSPQCYQKCPNVVD  125

Query  470  LYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSS  601
            LYFNLAAGEGV+LP LC+ Q  + RR L E+ S+ G  A GP S
Sbjct  126  LYFNLAAGEGVFLPKLCESQSQNPRRGLSEIKSS-GIAAPGPMS  168



>emb|CAA58732.1| PAR-1c [Nicotiana tabacum]
Length=183

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 114/167 (68%), Gaps = 6/167 (4%)
 Frame = +2

Query  113  SLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKT  292
            +L I+    S F+   LG I CE L  + C+FAIS++GKRC+LE  +   G +  Y C+T
Sbjct  9    TLAIVALAISYFVQVTLGGIACENLNEDSCAFAISSNGKRCVLEKHLRRSGEE-GYTCRT  67

Query  293  sevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDL  472
            SE+         IETDEC+EACG+DR ++G+SSD+LLE  FT KLCS +CY++CPNIVDL
Sbjct  68   SEIEADKLKD-WIETDECIEACGVDRNALGISSDALLESRFTNKLCSPACYKHCPNIVDL  126

Query  473  YFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG----GEKALGPSS  601
            YFNLAAGEGVYLP LC +Q    RR++ E+ S+G    GE  + PS+
Sbjct  127  YFNLAAGEGVYLPKLCAEQGGKARREIAEIRSSGLVAPGESEVKPSN  173



>ref|XP_011073223.1| PREDICTED: uncharacterized protein LOC105158246 [Sesamum indicum]
Length=171

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 115/161 (71%), Gaps = 6/161 (4%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M SSMKLSL ILFF  SLF+ G L  + CE LP N+CSFAI++SG+RC+LE+      N 
Sbjct  1    MGSSMKLSL-ILFFTCSLFVQGTLAYVICENLPVNLCSFAIASSGERCVLES----HKNT  55

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
             E +CK+SEVVV    G +IET++CV+ACG+ R+SVG+SSD  L   FTA LCS +CY N
Sbjct  56   QEKKCKSSEVVVEKLSG-YIETEQCVKACGVCRESVGISSDVFLSSEFTAHLCSPACYHN  114

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
            CPNIVDL+FNLAA EGV LP LC  Q  ++R  L  L+ +G
Sbjct  115  CPNIVDLFFNLAASEGVSLPTLCKNQEENHRAMLAILSHDG  155



>ref|XP_009421325.1| PREDICTED: uncharacterized protein LOC104000897 [Musa acuminata 
subsp. malaccensis]
Length=175

 Score =   159 bits (402),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 100/140 (71%), Gaps = 2/140 (1%)
 Frame = +2

Query  152  PGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHI  331
            P     + CE LP ++C+FA+S++ KRCLLEN+    G + +YQC+TSE V        I
Sbjct  24   PSATAGVICEDLPQDLCAFAVSSASKRCLLENTQLG-GGRTDYQCRTSEAVAEGISD-WI  81

Query  332  ETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLP  511
            ETDECV ACG+ R +VG+SSDSLLEP F  K+CS+ CY NCPNIVDLYFNLA+GEGV+LP
Sbjct  82   ETDECVRACGVARGNVGISSDSLLEPDFVQKICSAECYSNCPNIVDLYFNLASGEGVFLP  141

Query  512  DLCDKQRSHNRRDLVELNSN  571
            DLC+ QR   RR + E  S+
Sbjct  142  DLCEAQRGDPRRAMAEFLSS  161



>ref|XP_008806881.1| PREDICTED: uncharacterized protein LOC103719421 [Phoenix dactylifera]
Length=191

 Score =   159 bits (403),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 113/167 (68%), Gaps = 8/167 (5%)
 Frame = +2

Query  104  MKLSLMILFFVGSLFLPGVLGD-ITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEY  280
            + L+L++LFFV      G LG  ITCE L  + C++A+S++G RC+LE  V   G +V Y
Sbjct  7    ISLALVLLFFVS-----GALGGGITCESLEKSTCAYAVSSAGMRCVLEKRVRRGGQEV-Y  60

Query  281  QCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPN  460
             C TS++         +ETD CVEACGLDR ++G+SSDSLL+  F  KLCS +CY+ CPN
Sbjct  61   TCGTSDIQADGVKN-RVETDACVEACGLDRGTLGISSDSLLDSNFRQKLCSPACYRGCPN  119

Query  461  IVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSS  601
            +VDLYFNLAAGEGV+LP LC+ Q ++ RR + E+ S+G   A  P S
Sbjct  120  VVDLYFNLAAGEGVFLPKLCEVQETNARRAMAEIRSSGAALAASPGS  166



>ref|XP_002322474.1| hypothetical protein POPTR_0015s13050g [Populus trichocarpa]
 gb|ABK94866.1| unknown [Populus trichocarpa]
 gb|EEF06601.1| hypothetical protein POPTR_0015s13050g [Populus trichocarpa]
Length=193

 Score =   159 bits (402),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 113/168 (67%), Gaps = 3/168 (2%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M SS  + L +L    ++ + G LG+ITCE L  + C++AIS+SGKRC+LE SV   G +
Sbjct  1    MTSSFNI-LSVLALALTICVQGTLGEITCEHLDQDTCAYAISSSGKRCVLEKSVKRTGEE  59

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
              Y C+TSE+         IETD+C++ACGLDRKS+G+SSDSLLE  F  +LCS  CY +
Sbjct  60   A-YTCRTSEIDADRLRN-WIETDQCIKACGLDRKSLGISSDSLLESRFAQQLCSPQCYDS  117

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGP  595
            CPN+VDLYFNLAA EGV+LP LC+ Q  + RR L+    + G  A GP
Sbjct  118  CPNVVDLYFNLAAAEGVFLPGLCEAQEGNVRRGLMADIKSAGFVAPGP  165



>ref|XP_010553064.1| PREDICTED: uncharacterized protein LOC104823275 [Tarenaya hassleriana]
Length=179

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 115/161 (71%), Gaps = 4/161 (2%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M S  + SLM+L    S F P    +I CE LP ++C+F+IS +GKRCLLE      G  
Sbjct  1    MVSIFRTSLMVLISFYS-FDPS-HANIICEDLPEDICAFSISGAGKRCLLETEARFAGG-  57

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
            V+++C+TSE+ VG     ++E+D CV ACG+DR+SVG+SSD LL+P FTAKLCS  C+ N
Sbjct  58   VDFRCRTSEIEVGRMTN-YVESDACVHACGVDRRSVGISSDGLLDPDFTAKLCSPECFDN  116

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
            CPNIVDLYFNLAAGEG +LPD+C  +R++  R +VE+ S+G
Sbjct  117  CPNIVDLYFNLAAGEGAFLPDVCAARRANPHRTMVEILSSG  157



>ref|XP_007038703.1| PAR1 protein [Theobroma cacao]
 gb|EOY23204.1| PAR1 protein [Theobroma cacao]
Length=183

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 107/148 (72%), Gaps = 3/148 (2%)
 Frame = +2

Query  158  VLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIET  337
             +G+ITCE L  + C++A+S++GKRC+LE  V   G + EY C+TSE+         IET
Sbjct  25   TIGEITCEHLDQDTCTYAVSSTGKRCVLEKHVRRSGEE-EYTCRTSEIEADKIKN-WIET  82

Query  338  DECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDL  517
            D+CV+ACGLDRKS G+SSDSLL+  FT  LCS  CY +CPN+VDLYFNLAAGEGV+LP L
Sbjct  83   DQCVKACGLDRKSFGISSDSLLDSRFTEMLCSPQCYNSCPNVVDLYFNLAAGEGVFLPKL  142

Query  518  CDKQRSHNRRDLVELNSNGGEKALGPSS  601
            C+ Q ++ RR + E+ S+ G  A GP+S
Sbjct  143  CEAQGANARRGMAEIRSS-GMVAPGPAS  169



>ref|XP_006587314.1| PREDICTED: uncharacterized protein LOC100778782 [Glycine max]
Length=199

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 104/143 (73%), Gaps = 2/143 (1%)
 Frame = +2

Query  149  LPGVLGD-ITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvge  325
            + G LG+ + CE L  + C+FA+S+ GKRC+LE  V   G +  Y C+TSE+ V   +  
Sbjct  21   IQGTLGETLECENLSHDTCAFAVSSEGKRCVLEKRVKRTGEEA-YTCRTSEIEVEKQIKG  79

Query  326  HIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVY  505
            HIE+DEC++ACGLDRKS G+SSDSL+E  FT  LCS  CYQ+CPNIVDLYFNLAAGEGV+
Sbjct  80   HIESDECIKACGLDRKSFGISSDSLMERGFTQNLCSPQCYQSCPNIVDLYFNLAAGEGVF  139

Query  506  LPDLCDKQRSHNRRDLVELNSNG  574
            LP LC  + ++ RR + E+ S+G
Sbjct  140  LPKLCAAKGANARRQMAEIKSSG  162



>emb|CAA58731.1| PAR-1b [Nicotiana tabacum]
Length=185

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 106/148 (72%), Gaps = 5/148 (3%)
 Frame = +2

Query  161  LGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETD  340
            LG ITCE L  + C+FAIS++GKRC+LE  +   G +V Y CKTSE+         IETD
Sbjct  25   LGSITCENLNKDSCAFAISSTGKRCVLEKRLQRSGEEV-YTCKTSEIEADKLKD-WIETD  82

Query  341  ECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLC  520
            +C++ACG+DR + G+SSDSLLE  FT KLCS  CY++CPNI+DLYFNLAAGEGVYLP LC
Sbjct  83   QCIQACGVDRNTFGISSDSLLECHFTQKLCSPQCYKHCPNIIDLYFNLAAGEGVYLPRLC  142

Query  521  DKQRSHNRRDLVELNSNGGEKALGPSSE  604
            ++Q  + RR + E+ S+G    L PS E
Sbjct  143  EEQGGNARRGMAEIKSSG---ILAPSPE  167



>ref|XP_006363092.1| PREDICTED: uncharacterized protein LOC102590619 [Solanum tuberosum]
Length=169

 Score =   157 bits (397),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 108/149 (72%), Gaps = 8/149 (5%)
 Frame = +2

Query  104  MKLSLMILFFVGSLFLPGVLG----DITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            MK SL ILF   SLFL         ++ CE LP   C+FAIS++GKRC+LE + T + + 
Sbjct  1    MKSSL-ILFLTCSLFLQVAYAVYKTEVKCESLPNGDCAFAISSTGKRCVLEKATTPKDDL  59

Query  272  V--EYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCY  445
            +  EY+CKTSEV+V +    HIETDEC+E+CGL+R   G+SSD LLEP F +KLC+ +CY
Sbjct  60   ISSEYECKTSEVIVENMKE-HIETDECIESCGLNRNFFGISSDDLLEPQFVSKLCAPACY  118

Query  446  QNCPNIVDLYFNLAAGEGVYLPDLCDKQR  532
            Q CPNIVDLYFNLAAGEG YLPDLC+K +
Sbjct  119  QECPNIVDLYFNLAAGEGAYLPDLCNKNK  147



>ref|XP_009604561.1| PREDICTED: uncharacterized protein LOC104099311 [Nicotiana tomentosiformis]
Length=185

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 106/148 (72%), Gaps = 5/148 (3%)
 Frame = +2

Query  161  LGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETD  340
            LG ITCE L  + C+FAIS++GKRC+LE  +   G +V Y CKTSE+         IETD
Sbjct  25   LGSITCENLNKDSCAFAISSTGKRCVLEKRLQRSGEEV-YTCKTSEIEADKLKD-WIETD  82

Query  341  ECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLC  520
            +C++ACG+DR + G+SSDSLLE  FT KLCS  CY++CPNI+DLYFNLAAGEGVYLP LC
Sbjct  83   QCIQACGVDRNTFGISSDSLLECHFTQKLCSLQCYKHCPNIIDLYFNLAAGEGVYLPRLC  142

Query  521  DKQRSHNRRDLVELNSNGGEKALGPSSE  604
            ++Q  + RR + E+ S+G    L PS E
Sbjct  143  EEQVGNARRGMAEIKSSG---ILAPSPE  167



>ref|XP_011048721.1| PREDICTED: uncharacterized protein LOC105142675 [Populus euphratica]
Length=194

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 112/168 (67%), Gaps = 3/168 (2%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M SS  + L +L    ++ + G LG+ITCE L  + C++AIS+SGKRC+LE SV   G +
Sbjct  1    MTSSFHI-LSVLALALTICVQGTLGEITCEHLDQDTCAYAISSSGKRCVLEKSVKRTGEE  59

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
              Y C+ SE+         IETD+C++ACGLDRKS+G+SSDSLLE  F  +LCS  CY +
Sbjct  60   A-YTCRASEIEADRLRN-WIETDQCIKACGLDRKSLGISSDSLLESRFAQQLCSPQCYDS  117

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGP  595
            CPN+VDLYFNLAA EGV+LP LC+ Q  + RR L+    + G  A GP
Sbjct  118  CPNVVDLYFNLAAAEGVFLPGLCEAQEGNVRRGLMADIKSSGFVAPGP  165



>ref|XP_009770389.1| PREDICTED: uncharacterized protein LOC104221096 [Nicotiana sylvestris]
Length=185

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 104/147 (71%), Gaps = 3/147 (2%)
 Frame = +2

Query  161  LGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETD  340
            LG ITCE L  + C+FAIS++GKRC+LE  +   G +V Y CKT E+         IETD
Sbjct  25   LGSITCENLNKDSCTFAISSTGKRCVLEKHLRRSGEEV-YACKTLEIEADKLKN-WIETD  82

Query  341  ECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLC  520
            +C++ACG+DR ++G+SSDSLLE  FT KLCS  CY++CPNIVDLYFNLAAGEGVYLP LC
Sbjct  83   QCIQACGVDRNTLGISSDSLLECHFTQKLCSPQCYKHCPNIVDLYFNLAAGEGVYLPRLC  142

Query  521  DKQRSHNRRDLVELNSNGGEKALGPSS  601
            +KQ  + RR + E+  N G  A  P S
Sbjct  143  EKQGGNARRGMAEIK-NSGIVAPAPES  168



>ref|XP_011073212.1| PREDICTED: uncharacterized protein LOC105158235 [Sesamum indicum]
Length=171

 Score =   156 bits (395),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 115/168 (68%), Gaps = 8/168 (5%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M  SMKLSL +LFF  SLF+   LGD+ CE LPTN+CSFAI++SGKRC+LEN      N 
Sbjct  1    MGFSMKLSL-VLFFTCSLFVQRTLGDVICENLPTNLCSFAIASSGKRCVLENC----KNT  55

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
             E +CKTSEVVV    G +IETD+CV ACG+ R+SVG+SSD+ L   FTA LCS +C+ N
Sbjct  56   QEKKCKTSEVVVEKLSG-YIETDQCVNACGVCRESVGISSDAFLSSKFTAHLCSPACFHN  114

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGP  595
            CPNIVDL+ NLAA EGV L  LC  Q   +R  L  L+   G+   GP
Sbjct  115  CPNIVDLFVNLAASEGVSLSTLCKNQEEIHRSMLAILSH--GDVTPGP  160



>ref|XP_009599697.1| PREDICTED: uncharacterized protein LOC104095302, partial [Nicotiana 
tomentosiformis]
Length=180

 Score =   156 bits (395),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 113/163 (69%), Gaps = 9/163 (6%)
 Frame = +2

Query  116  LMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTs  295
            L+I+FF+         GDI CE L  + C+FAIS++GKRC+LE  +   G +V Y C+TS
Sbjct  12   LIIIFFLIHA------GDIACENLNEDSCAFAISSNGKRCVLEKHLRRSGEEV-YTCRTS  64

Query  296  evvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLY  475
            E+         IET+EC+EACG+DR ++G+SSD+LLE  FT KLCS +CY++CPNIVDLY
Sbjct  65   EIEADKLKD-WIETNECIEACGVDRNALGISSDALLESRFTNKLCSLACYKHCPNIVDLY  123

Query  476  FNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSSE  604
            FNLAAGEGVYLP LC +Q    RR++ E+ S+ G  A  P SE
Sbjct  124  FNLAAGEGVYLPKLCAEQGKSARREIAEIRSS-GLVAPAPESE  165



>ref|XP_011094947.1| PREDICTED: uncharacterized protein LOC105174516 [Sesamum indicum]
Length=176

 Score =   156 bits (394),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 114/161 (71%), Gaps = 4/161 (2%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M SSMK +  +LFF  SLF+ G L ++ CE LP N+CSFA+++SGKRC+L++   N   K
Sbjct  1    MASSMKFAF-VLFFACSLFVQGTLAEVICENLPKNLCSFAVASSGKRCVLDHH-KNAQEK  58

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
             +  CKTSEVVV    G +IE+D+CV ACG+ R+S  +SSD  L   FTA+LCS +CYQN
Sbjct  59   TDCTCKTSEVVVERLSG-YIESDQCVNACGVHRESAEISSDVFLSSEFTARLCSPACYQN  117

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
            CPNIV+L+ NLAAGEGV LP LC  Q+  N R ++ + SNG
Sbjct  118  CPNIVELFVNLAAGEGVSLPTLCQDQK-ENHRAMLAILSNG  157



>gb|EPS70832.1| hypothetical protein M569_03929 [Genlisea aurea]
Length=177

 Score =   156 bits (394),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 111/163 (68%), Gaps = 2/163 (1%)
 Frame = +2

Query  122  ILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsev  301
            IL    S      L ++ CE LPT++C+FAI++SGKRC+LEN+V N G + E+ C+TS V
Sbjct  8    ILIVAFSFLFQQTLAEVICEELPTDLCAFAIASSGKRCVLENTV-NGGGESEFTCETSPV  66

Query  302  vvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFN  481
            VV S  G +IETD+CV ACG DR  VG+SSD+ L P FT+ LC+  C+QNCPNIVDLY +
Sbjct  67   VVESLPG-YIETDQCVAACGADRNFVGISSDAFLSPSFTSSLCADECFQNCPNIVDLYVD  125

Query  482  LAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSSEES  610
            LAA EGV LPDLC  Q+ +  R ++ + S+ G   L  SS  S
Sbjct  126  LAAAEGVNLPDLCRMQKENPHRSMLAVLSSNGAAGLDASSPAS  168



>ref|XP_008377489.1| PREDICTED: uncharacterized protein LOC103440565 [Malus domestica]
Length=198

 Score =   157 bits (396),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 103/140 (74%), Gaps = 2/140 (1%)
 Frame = +2

Query  155  GVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIE  334
              LG ITCE L  + C+FA+S+SGKRC+LE  V   G +  Y C+TSE+   +     IE
Sbjct  23   ATLGGITCENLEHDACAFAVSSSGKRCVLEKHVKRSGEEA-YTCRTSEIEADNLKD-WIE  80

Query  335  TDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPD  514
            +++C+++CGLDRKS G+SSDSLLE  FT KLCS  CY NCPNIVDLYFNLAAGEGV+LP 
Sbjct  81   SEKCIKSCGLDRKSYGISSDSLLESRFTQKLCSPQCYGNCPNIVDLYFNLAAGEGVFLPK  140

Query  515  LCDKQRSHNRRDLVELNSNG  574
            LC+ Q ++ RR++ E+ S+G
Sbjct  141  LCEAQEANARREMSEIRSSG  160



>ref|XP_009601817.1| PREDICTED: uncharacterized protein LOC104097019 [Nicotiana tomentosiformis]
Length=186

 Score =   156 bits (394),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 114/166 (69%), Gaps = 5/166 (3%)
 Frame = +2

Query  113  SLMILFFVGSLFLPGVLGDITCEFL--PTNVCSFAISTSGKRCLLENSVTNEGNKVEYQC  286
            +L I+    S F+   LGDI CE L    + C+FAIS++GKRC+LE  +   G +V Y C
Sbjct  9    TLAIVALAISSFVQVTLGDIACENLNEXEDSCAFAISSNGKRCVLEKHLRRSGEEV-YTC  67

Query  287  KTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIV  466
            +TSE+         IET+EC+EACG+DR ++G+SSD+LLE  FT KLCS +CY++CPNIV
Sbjct  68   RTSEIEADKLKD-WIETNECIEACGVDRNALGISSDALLESRFTNKLCSLACYKHCPNIV  126

Query  467  DLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSSE  604
            DLYFNLAAGEGVYLP LC +Q    RR++ E+ S+ G  A  P SE
Sbjct  127  DLYFNLAAGEGVYLPKLCAEQGKSARREIAEIRSS-GLVAPAPESE  171



>ref|XP_010529780.1| PREDICTED: uncharacterized protein LOC104806532 [Tarenaya hassleriana]
Length=168

 Score =   155 bits (393),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 102/138 (74%), Gaps = 5/138 (4%)
 Frame = +2

Query  164  GDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETDE  343
            G+I CE LP   C+F+IS +GKRCLLE     E    ++ C+TSEV V   +  H+ETD+
Sbjct  23   GEIICEDLPAKTCAFSISAAGKRCLLET----ENVAGKFYCRTSEVDVEGILN-HVETDD  77

Query  344  CVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLCD  523
            CV ACG+DRK+VG+SSD+LLEP F AKLCSS+CY  CPNIVDLYFNLA GEG +LPDLC+
Sbjct  78   CVAACGVDRKTVGISSDALLEPGFAAKLCSSACYDFCPNIVDLYFNLAVGEGAFLPDLCE  137

Query  524  KQRSHNRRDLVELNSNGG  577
              R++  R ++E+ S+G 
Sbjct  138  AHRANPDRSMLEILSSGA  155



>emb|CAA58733.1| PAR-1a [Nicotiana tabacum]
Length=185

 Score =   156 bits (394),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 104/147 (71%), Gaps = 3/147 (2%)
 Frame = +2

Query  161  LGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETD  340
            LG ITCE L  + C+FAIS++GKRC+LE  +   G +V Y CKT E+         IETD
Sbjct  25   LGSITCENLNKDSCTFAISSTGKRCVLEKHLRRSGEEV-YACKTLEIEADKLKN-WIETD  82

Query  341  ECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLC  520
            +C++ACG+DR ++G+SSDSLLE  FT KLCS  CY++CPNIVDLYFNLAAG+GVYLP LC
Sbjct  83   QCIQACGVDRNTLGISSDSLLECHFTQKLCSPQCYKHCPNIVDLYFNLAAGQGVYLPRLC  142

Query  521  DKQRSHNRRDLVELNSNGGEKALGPSS  601
            +KQ  + RR + E+  N G  A  P S
Sbjct  143  EKQGGNARRGMAEIK-NSGIVAPAPES  168



>gb|KDP22273.1| hypothetical protein JCGZ_26104 [Jatropha curcas]
Length=184

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 105/149 (70%), Gaps = 2/149 (1%)
 Frame = +2

Query  149  LPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeH  328
            + G LG+I CE L  + CS+AIS++GKRC+LE  V   G +  Y C+TSE+         
Sbjct  18   VQGTLGEIKCEHLDQDTCSYAISSTGKRCVLEKHVKRSGQE-SYNCRTSEIEADRLRNW-  75

Query  329  IETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYL  508
            IE+D+C++ACGLDRK++G+SSDSLL+  FT  LCSS CY +CPN+VDLYFNLAAGEGV+L
Sbjct  76   IESDQCIKACGLDRKTLGISSDSLLDSCFTKHLCSSECYNSCPNVVDLYFNLAAGEGVFL  135

Query  509  PDLCDKQRSHNRRDLVELNSNGGEKALGP  595
            P LC+ +  + RR+L+    + G  A GP
Sbjct  136  PKLCEAKEGNGRRELIADIKSSGIVATGP  164



>ref|XP_009590873.1| PREDICTED: uncharacterized protein LOC104087977 [Nicotiana tomentosiformis]
Length=213

 Score =   156 bits (395),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 116/165 (70%), Gaps = 6/165 (4%)
 Frame = +2

Query  119  MILFFVGSLFLPGVLG--DITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKT  292
            + +F V SL + G LG  +I CE L    C++++++SGKRC LE   ++EG +  YQCKT
Sbjct  3    LTIFLVFSLLIHGALGNGEIVCEDLSVGKCAYSVASSGKRCTLETYESSEGTR-GYQCKT  61

Query  293  sevvvgssvgeH-IETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVD  469
            SEVVV  +   + IE+DEC+ ACG +R SVG+SSD LLE  FT+KLCS  CYQ CPNIVD
Sbjct  62   SEVVVAINGIANWIESDECISACGANRDSVGISSDYLLESSFTSKLCSQECYQKCPNIVD  121

Query  470  LYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSSE  604
            LY+NLA GEGVYLP  C  ++ + RR++ ++ S+G   AL P+S+
Sbjct  122  LYYNLALGEGVYLPAFCKGKKLNGRREMSQIQSSG--AALAPASD  164



>ref|XP_011076161.1| PREDICTED: uncharacterized protein LOC105160472 [Sesamum indicum]
Length=189

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 99/144 (69%), Gaps = 2/144 (1%)
 Frame = +2

Query  143  LFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvg  322
             F+ G  G I CE L  + C+FA+S++GKRC+LE  V   G + EY C TS++       
Sbjct  22   FFVQGTFGTIECENLNKDSCAFAVSSTGKRCVLEKHVRRSGAE-EYACATSQIEADKMKN  80

Query  323  eHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGV  502
              IETD C++ACGLDR ++G+SSDSLLE  F  KLCS  CY+ CPN+VDLYFNLAAGEG 
Sbjct  81   -WIETDACIDACGLDRSALGISSDSLLESRFVRKLCSQQCYRGCPNVVDLYFNLAAGEGA  139

Query  503  YLPDLCDKQRSHNRRDLVELNSNG  574
            YLP LC+ Q +  RR++ E+ S+G
Sbjct  140  YLPKLCEAQGAKARREMAEIKSSG  163



>ref|XP_002510782.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51384.1| conserved hypothetical protein [Ricinus communis]
Length=185

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 100/147 (68%), Gaps = 2/147 (1%)
 Frame = +2

Query  155  GVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIE  334
            G LG+ITCE L    CS+A+S+SGKRC+LE  V   G K  Y C+ SE+         IE
Sbjct  20   GTLGEITCENLDQETCSYAVSSSGKRCVLETHVKRSG-KASYACRNSEIEADRLRN-WIE  77

Query  335  TDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPD  514
            TD+C++ACGLDRKS+G+SSDSLLE  FT +LCS  CY +CPNI+DLYFNLAAGEGV+LP 
Sbjct  78   TDQCIKACGLDRKSLGISSDSLLESSFTKQLCSPQCYDSCPNIIDLYFNLAAGEGVFLPK  137

Query  515  LCDKQRSHNRRDLVELNSNGGEKALGP  595
            LC   + + RR+L     + G  A  P
Sbjct  138  LCQATKGNARRELTADIRSSGMVAPAP  164



>ref|XP_011045688.1| PREDICTED: uncharacterized protein LOC105140517 [Populus euphratica]
Length=163

 Score =   155 bits (391),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 110/163 (67%), Gaps = 11/163 (7%)
 Frame = +2

Query  119  MILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTse  298
            +I+F   +L L G LG++ CE LP ++C+++I+TSG+RCLLEN   N+G  V+YQCKT+E
Sbjct  3    LIIFLAFALLLHGALGELICEQLPVDLCAYSIATSGQRCLLENYEENDGT-VKYQCKTTE  61

Query  299  vvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYF  478
            + V       IE+DECV +CGL R++VG+SSD+LL+P F AKLCS  CYQ CPNIVDLY 
Sbjct  62   IFVDILNE-WIESDECVSSCGLHRETVGVSSDTLLQPQFLAKLCSDECYQACPNIVDLYS  120

Query  479  NLAAGEGVYLPDLCDKQ--RSHNRRDLVELNSNGGEKALGPSS  601
            N+A GEG YLP LC       H  R       + G+ A  P+S
Sbjct  121  NMALGEGTYLPTLCANPCLAKHQAR-------SNGDAAPAPAS  156



>ref|XP_011030114.1| PREDICTED: uncharacterized protein LOC105129658 [Populus euphratica]
Length=191

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 112/168 (67%), Gaps = 3/168 (2%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M SS  + L +L  V ++ + G LG+I CE L  + C++AIS++GKRC+LE  V   G +
Sbjct  1    MASSFGI-LSVLAIVLAICVQGTLGEIACEHLDQDTCAYAISSAGKRCVLEKRVKRTGEE  59

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
              Y C+TSE+         IETD+C++ACGLDRKS+G+S+DSLLE  F  +LCS  CY +
Sbjct  60   A-YTCRTSEIEADRLRN-WIETDQCIKACGLDRKSLGISTDSLLESSFAQQLCSPQCYDS  117

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGP  595
            CPN++DLYFNLAA EGV+LP LC+ Q  + RR L+    + G  A GP
Sbjct  118  CPNVIDLYFNLAAAEGVFLPKLCEAQEGNARRGLMADIKSSGFVAPGP  165



>ref|XP_009763985.1| PREDICTED: uncharacterized protein LOC104215785 isoform X1 [Nicotiana 
sylvestris]
Length=209

 Score =   156 bits (394),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 114/165 (69%), Gaps = 6/165 (4%)
 Frame = +2

Query  119  MILFFVGSLFLPGVLG--DITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKT  292
            +I+F V S  + G LG  +I CE L    C+++++ SGKRC LE   ++EG    YQCKT
Sbjct  3    LIIFLVFSFLIHGALGNGEIVCEDLSVGKCAYSVAFSGKRCTLETYESSEGT-TGYQCKT  61

Query  293  sevvvgssvgeH-IETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVD  469
            SEVVV  +   + IE+DEC+ ACG +R SVG+SSDSLLE  FT+KLCS  CYQ CPNIVD
Sbjct  62   SEVVVAINGIANWIESDECISACGANRDSVGISSDSLLESSFTSKLCSQQCYQKCPNIVD  121

Query  470  LYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSSE  604
            LY+NLA GEGVYLP  C  +  + RR++ ++ S+G   AL P+S+
Sbjct  122  LYYNLALGEGVYLPAFCKGKNLNGRREMSQIQSSG--AALAPASD  164



>ref|XP_002318235.1| hypothetical protein POPTR_0012s13140g [Populus trichocarpa]
 gb|EEE96455.1| hypothetical protein POPTR_0012s13140g [Populus trichocarpa]
Length=191

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 112/168 (67%), Gaps = 3/168 (2%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            M SS ++ L +L    ++ + G LG+I CE L  + C++AIS++GKRC+LE  V   G +
Sbjct  1    MASSFRI-LSVLAIALAICVQGTLGEIACEHLDQDTCAYAISSAGKRCVLEKRVKRTGEE  59

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
              Y C+TSE+         IETD+C++ACGLDRKS+G+S+DSLLE  F  +LCS  CY +
Sbjct  60   A-YTCRTSEIEADRLRN-WIETDQCIKACGLDRKSLGISTDSLLESRFAQQLCSPQCYYS  117

Query  452  CPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGP  595
            CPN++DLYFNLAA EGV+LP LC+ Q  + RR L+    + G  A GP
Sbjct  118  CPNVIDLYFNLAAAEGVFLPKLCEAQEGNARRGLMADIKSSGFVAPGP  165



>ref|XP_008785460.1| PREDICTED: uncharacterized protein LOC103704086 [Phoenix dactylifera]
Length=174

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 104/140 (74%), Gaps = 3/140 (2%)
 Frame = +2

Query  152  PGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHI  331
            P  L  + CE LP ++C+FAIS+S KRC+LE ++  +G   +YQC+TSEVVV    G  I
Sbjct  14   PSALAGVICEDLPQDLCAFAISSSSKRCVLE-TIPRKGGPTKYQCQTSEVVVERMPG-WI  71

Query  332  ETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLP  511
            ETD+CV ACG+DR SVG+SSDSLLEP FT  LCS +C+QNCPNI+DLYFNLAA E V+LP
Sbjct  72   ETDKCVRACGVDRNSVGISSDSLLEPQFTENLCSPACHQNCPNIIDLYFNLAAAEDVFLP  131

Query  512  DLCDKQRSHN-RRDLVELNS  568
            DLC  ++  N RR ++ L S
Sbjct  132  DLCKARQGRNPRRSMLILRS  151



>ref|XP_006827667.1| hypothetical protein AMTR_s00009p00254330 [Amborella trichopoda]
 gb|ERM95083.1| hypothetical protein AMTR_s00009p00254330 [Amborella trichopoda]
Length=186

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 103/152 (68%), Gaps = 2/152 (1%)
 Frame = +2

Query  119  MILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTse  298
            M++  V ++        I CE L  + C+F++S+SG RC+LE  +T+     EY+CK SE
Sbjct  13   MLMMLVVTIQHTSATAKIVCEQLHKDKCAFSVSSSGTRCVLEQRMTH-STSTEYECKASE  71

Query  299  vvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYF  478
            +         IETD+C+EACGL+R  VG+SSD LLEP F  KLC++ CY  CPNI++LYF
Sbjct  72   IAAAHLSNW-IETDKCLEACGLNRNMVGISSDFLLEPQFVKKLCATQCYHGCPNILNLYF  130

Query  479  NLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
            NLAAGEGVYLP LC+ QR+ +RR + E+ S+G
Sbjct  131  NLAAGEGVYLPKLCEAQRASSRRAMAEIRSSG  162



>ref|XP_009340031.1| PREDICTED: uncharacterized protein LOC103932203 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009340032.1| PREDICTED: uncharacterized protein LOC103932203 isoform X2 [Pyrus 
x bretschneideri]
Length=198

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 103/140 (74%), Gaps = 2/140 (1%)
 Frame = +2

Query  155  GVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIE  334
              LG ITCE L  + C+FA+S+SGKRC+LE  V   G +  Y C+TSE+   +     IE
Sbjct  23   ATLGGITCENLEHDACAFAVSSSGKRCVLEKHVRRSGEEA-YTCRTSEIEADNLKD-WIE  80

Query  335  TDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPD  514
            +++C+++CGLDRKS G+SSDSLLE  FT KLCS  CY NCPNIVDLYFNLAAGEGV+LP 
Sbjct  81   SEKCIKSCGLDRKSYGISSDSLLESRFTQKLCSPQCYGNCPNIVDLYFNLAAGEGVFLPK  140

Query  515  LCDKQRSHNRRDLVELNSNG  574
            LC+ Q ++ RR++ E+ S+G
Sbjct  141  LCEAQGANARREMSEIRSSG  160



>ref|XP_010482600.1| PREDICTED: uncharacterized protein LOC104761248 isoform X2 [Camelina 
sativa]
Length=195

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 112/166 (67%), Gaps = 9/166 (5%)
 Frame = +2

Query  119  MILFFVGSLFLPGV-----LG-DITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEY  280
            M   FV S+ L  +     LG ++ CE L  + C+FA+S++GKRC+LE SV   G +V Y
Sbjct  3    MKTVFVTSMLLLAIYSQTTLGHEVKCENLDEDTCAFAVSSTGKRCVLEKSVRRSGIEV-Y  61

Query  281  QCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPN  460
             C++S +         IE++EC+EACGLDRKS+G+SSD+LLE  FT KLCS+ C+  CPN
Sbjct  62   SCRSSGIESDKVTNI-IESNECIEACGLDRKSLGISSDALLESRFTQKLCSAKCFNQCPN  120

Query  461  IVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG-GEKALGP  595
            +VDL+FNLAAGEGV+LP LC+ QR   RR + E+ S+G     LGP
Sbjct  121  VVDLFFNLAAGEGVFLPKLCESQRGKTRRAMSEIRSSGIAMDTLGP  166



>ref|XP_010490608.1| PREDICTED: uncharacterized protein LOC104768360 [Camelina sativa]
Length=182

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 108/148 (73%), Gaps = 3/148 (2%)
 Frame = +2

Query  164  GDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETDE  343
             ++ CE LP ++CSF+IS SGKRC+LE  V   G  V+Y+C++SE+ V  ++  +IETDE
Sbjct  23   ANVICEDLPDDICSFSISASGKRCVLETEVRQTGG-VDYRCQSSEIDVDGTMANYIETDE  81

Query  344  CVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLCD  523
            CV ACG+DR+SVG+SSD+LLEP F  KLC+  C ++CPNI DLYFNL A EG +LPDLC 
Sbjct  82   CVNACGVDRRSVGISSDALLEPGFAVKLCTPQCLEDCPNIADLYFNLVAAEGSHLPDLCA  141

Query  524  KQRSHNRRDLVELNSNGGEKALGPSSEE  607
             +R++  R + E+ S+G  +ALG  S E
Sbjct  142  ARRNNPHRSMFEILSSG--EALGTFSGE  167



>ref|XP_010255407.1| PREDICTED: uncharacterized protein LOC104596084 [Nelumbo nucifera]
Length=204

 Score =   155 bits (392),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 112/166 (67%), Gaps = 11/166 (7%)
 Frame = +2

Query  83   SRSMDSSMKLSLMILFFVGSLFLPGVLGD--ITCEFLPTNVCSFAISTSGKRCLLENSVT  256
            SR++ + + L+L I        + G LG   I CE L  + C+FA+S+SG RC+LE  V 
Sbjct  9    SRTLMACLALALTIC-------VKGTLGGGGIRCENLGKDSCAFAVSSSGTRCVLEKKVR  61

Query  257  NEGNKVEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSS  436
              G +V Y C++SE+         IE+DEC+EACGL R SVG+SSD+LLEP FT  LCSS
Sbjct  62   RSGEEV-YTCRSSEIEADKLKD-WIESDECIEACGLSRNSVGISSDALLEPCFTQHLCSS  119

Query  437  SCYQNCPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
             CY NCPNIVDLYFNLAAGEGV+LP LC+ Q ++ RR + E+ S+G
Sbjct  120  HCYANCPNIVDLYFNLAAGEGVFLPKLCEVQGTNARRQMSEIRSSG  165



>gb|ABK26953.1| unknown [Picea sitchensis]
Length=208

 Score =   155 bits (391),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 111/154 (72%), Gaps = 6/154 (4%)
 Frame = +2

Query  122  ILFFVGSLF----LPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCK  289
            IL  V +L     L GVLG I CE LP  VC+F++S+SG RC+LE S+  +GN V+Y+C+
Sbjct  6    ILLTVSALISVISLQGVLGGIVCENLPMEVCAFSVSSSGARCVLEKSILRDGN-VQYECQ  64

Query  290  TsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVD  469
            +S+V+  +     IETDEC+ ACG++R +VG+S+D+L++   T KLCS +CY  CPNI++
Sbjct  65   SSDVIAETIKE-WIETDECMNACGVERMAVGISTDALVDGRSTRKLCSPNCYNKCPNILE  123

Query  470  LYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSN  571
            LYFNLAAGEG+YLP LC+  RS +RR + E+ S 
Sbjct  124  LYFNLAAGEGIYLPRLCEAHRSGDRRMISEVISK  157



>ref|XP_010060939.1| PREDICTED: uncharacterized protein LOC104448745 [Eucalyptus grandis]
 gb|KCW90697.1| hypothetical protein EUGRSUZ_A02782 [Eucalyptus grandis]
Length=183

 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 102/142 (72%), Gaps = 2/142 (1%)
 Frame = +2

Query  149  LPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeH  328
            + G LG I CE L  + C+FA+S+SGKRC+LE  VT  G +  Y C+ S +  G     +
Sbjct  22   VTGTLGGIVCENLNHDSCAFAVSSSGKRCVLEKQVTRSGEEA-YTCRQSGIEAGGLRD-Y  79

Query  329  IETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYL  508
            IETD+C+ +CG+DR+++G++SD+LLEP F  +LCSS CY +CPNIVDLYFNLAAGEGV+L
Sbjct  80   IETDQCIGSCGVDRRTLGIASDALLEPHFAQQLCSSKCYGSCPNIVDLYFNLAAGEGVFL  139

Query  509  PDLCDKQRSHNRRDLVELNSNG  574
            P LC+ +R   RR + E+ S G
Sbjct  140  PKLCEAERQEKRRGMAEIVSWG  161



>ref|XP_006388430.1| hypothetical protein POPTR_0187s00200g [Populus trichocarpa]
 gb|ERP47344.1| hypothetical protein POPTR_0187s00200g [Populus trichocarpa]
Length=180

 Score =   154 bits (388),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 103/138 (75%), Gaps = 5/138 (4%)
 Frame = +2

Query  161  LGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETD  340
            LG++ CE LP ++CS++I+TSGKRCLLEN  T +G  V+YQCKTSEVVVG  + E IE D
Sbjct  17   LGELVCEQLPVDLCSYSIATSGKRCLLENYATKDGG-VKYQCKTSEVVVGIVLSEWIEID  75

Query  341  ECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLC  520
            EC+ ACGL R +VG+SSDSLL+P F  KLCS SC Q CPNIVDLY NLA  EGVYLP+LC
Sbjct  76   ECITACGLSRNTVGISSDSLLQPQFLTKLCSKSCSQACPNIVDLYSNLALAEGVYLPNLC  135

Query  521  DKQRSHNRRDLVELNSNG  574
                +  RR + +  SNG
Sbjct  136  ----ASPRRAMYQTRSNG  149



>ref|XP_004230259.1| PREDICTED: uncharacterized protein LOC101259981 [Solanum lycopersicum]
Length=258

 Score =   156 bits (394),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 111/161 (69%), Gaps = 4/161 (2%)
 Frame = +2

Query  119  MILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTse  298
             ILFF  SLFL G LG++ CE LP  +C+ +IS+ GKRC+LE+  + EGN  E +C+TSE
Sbjct  21   FILFFALSLFLQGALGELICEELPVEMCALSISSDGKRCVLESRPSEEGNN-EVECQTSE  79

Query  299  v-vvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLY  475
                   + E+IETDECV ACG+DR+S+GLSSD+L++  F AKLCS  CY NCPNI+DLY
Sbjct  80   AFASNKMLQEYIETDECVGACGVDRQSLGLSSDALVDSKFVAKLCSHHCYNNCPNIIDLY  139

Query  476  FNLAAGEGVYLPDLCDKQRSHNRRDLVE--LNSNGGEKALG  592
             ++A+ EG+ LP +C  Q++  RR + +    S+G    +G
Sbjct  140  SSVASAEGLSLPKMCASQKTRPRRGMSQSAFRSSGAAALVG  180



>gb|AAM62984.1| photoassimilate-responsive protein PAR-like protein [Arabidopsis 
thaliana]
Length=195

 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 112/167 (67%), Gaps = 4/167 (2%)
 Frame = +2

Query  101  SMKLSLMILFFVGSLFLPGVLGD-ITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVE  277
            ++K  L+    + +++     GD + CE L  N C+FA+S++GKRC+LE S+   G +V 
Sbjct  2    ALKTVLVAFMLLLAIYSQTTFGDDVKCENLDENTCAFAVSSTGKRCVLEKSMKRTGIEV-  60

Query  278  YQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCP  457
            Y C++SE+         IE+DEC++ACGLDRK++G+SSD+LLE  FT KLCS  C   CP
Sbjct  61   YTCRSSEIEANKVTNI-IESDECIKACGLDRKALGISSDALLESQFTHKLCSVKCLNQCP  119

Query  458  NIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG-GEKALGP  595
            N+VDLYFNLAAGEGVYLP LC+ Q   +RR + E+ S+G     LGP
Sbjct  120  NVVDLYFNLAAGEGVYLPKLCESQEGKSRRAMSEIRSSGIAMDTLGP  166



>ref|XP_009342968.1| PREDICTED: uncharacterized protein LOC103934926 [Pyrus x bretschneideri]
Length=198

 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 113/162 (70%), Gaps = 3/162 (2%)
 Frame = +2

Query  92   MDSSMKL-SLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGN  268
            M S+M L ++ +L    ++ +   LG ITCE L  + C+FA+S+SGKRC+LE  V   G 
Sbjct  1    MASTMCLKNIAVLALSLAVCVQATLGGITCENLNHDACAFAVSSSGKRCVLEKHVRRSGE  60

Query  269  KVEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQ  448
            +  Y C+TSE+ V       IE++ C+++CGLDRKS G+SSDSLLE  FT KLCS  CY 
Sbjct  61   EA-YTCRTSEIEVDKLKD-WIESETCIKSCGLDRKSYGISSDSLLESRFTQKLCSPQCYG  118

Query  449  NCPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
            +CPNIVDLYFNLAAGEGV+LP LC  Q ++ RR+L E+ S+G
Sbjct  119  SCPNIVDLYFNLAAGEGVFLPTLCAAQGANARRELSEIRSSG  160



>emb|CDP09133.1| unnamed protein product [Coffea canephora]
Length=178

 Score =   153 bits (387),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 111/165 (67%), Gaps = 6/165 (4%)
 Frame = +2

Query  110  LSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCK  289
            + LMI+    SLFL G LG++ CE LP  +CSFA+++SGKRC LE     +G K+  QC+
Sbjct  1    MELMIILLAVSLFLQGALGELVCEELPIKMCSFAVASSGKRCSLETYAAKDG-KIGLQCR  59

Query  290  TsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVD  469
            +SE++   ++ EHIE DEC+ ACG+ RK+VG+SSD+L +P  T K+CS  C  NC NIVD
Sbjct  60   SSEILASDNIHEHIEKDECISACGVSRKTVGISSDNLFQPRHTHKICSPKCQHNCLNIVD  119

Query  470  LYFNLAAGEGVYLPDLCDKQ-RSHNRRDLVELNSNGGEKALGPSS  601
            LY NLA  EG+YLP +C K   S +R+++ E+    G   + PSS
Sbjct  120  LYSNLALAEGLYLPGVCKKALESGSRQEMSEI----GSSEIAPSS  160



>ref|XP_010482599.1| PREDICTED: uncharacterized protein LOC104761248 isoform X1 [Camelina 
sativa]
Length=195

 Score =   154 bits (388),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 112/166 (67%), Gaps = 9/166 (5%)
 Frame = +2

Query  119  MILFFVGSLFLPGV-----LG-DITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEY  280
            M   FV S+ L  +     LG ++ CE L  + C+FA+S++GKRC+LE S+   G +V Y
Sbjct  3    MKTVFVTSMLLLAIYSQTTLGHEVKCENLDEDTCAFAVSSTGKRCVLEKSLRRSGIEV-Y  61

Query  281  QCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPN  460
             C++S +         IE++EC+EACGLDRKS+G+SSD+LLE  FT KLCS+ C+  CPN
Sbjct  62   SCRSSGIESDKVTNI-IESNECIEACGLDRKSLGISSDALLESRFTQKLCSAKCFNQCPN  120

Query  461  IVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG-GEKALGP  595
            +VDL+FNLAAGEGV+LP LC+ QR   RR + E+ S+G     LGP
Sbjct  121  VVDLFFNLAAGEGVFLPKLCESQRGKTRRAMSEIRSSGIAMDTLGP  166



>ref|XP_009127249.1| PREDICTED: uncharacterized protein LOC103852106 [Brassica rapa]
Length=210

 Score =   154 bits (389),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 114/167 (68%), Gaps = 4/167 (2%)
 Frame = +2

Query  101  SMKLSLMILFFVGSLFLPGVLG-DITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVE  277
            +MK   ++   + +++L   LG ++ CE L  + C+FA+S++GKRC+LE S+   G +  
Sbjct  2    AMKTFFVVSMLLLAVYLQTTLGNEVKCEKLDKDTCAFAVSSTGKRCVLEQSIKRSGIE-G  60

Query  278  YQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCP  457
            Y C++SE+         IE+DEC++ACGLDRKS+G+SSD+LLE  FT KLCS  C   CP
Sbjct  61   YTCRSSEIEADKVTNI-IESDECIKACGLDRKSLGISSDALLESRFTQKLCSVKCLTQCP  119

Query  458  NIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEK-ALGP  595
            N+VDL+FNLAAGEGVYLP LC+ Q   +RR + EL S+G  +  LGP
Sbjct  120  NVVDLFFNLAAGEGVYLPKLCESQEGQSRRAMSELRSSGIVRDTLGP  166



>ref|XP_008376590.1| PREDICTED: uncharacterized protein LOC103439761 [Malus domestica]
Length=198

 Score =   154 bits (388),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 112/162 (69%), Gaps = 3/162 (2%)
 Frame = +2

Query  92   MDSSMKL-SLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGN  268
            M S+M L ++ +L    ++ +   LG ITCE L  + C+FA+S+SGKRC+LE  V   G 
Sbjct  1    MASTMCLKNIAVLALSLAVCVQATLGGITCENLDHDACAFAVSSSGKRCVLEKHVRRSGE  60

Query  269  KVEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQ  448
            +  Y C+TSE+         IE++ C+++CGLDRKS G+SSDSLLE  FT KLCS  CY 
Sbjct  61   EA-YTCRTSEIEADKLKD-WIESETCIKSCGLDRKSYGISSDSLLESSFTQKLCSPQCYG  118

Query  449  NCPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
            +CPNIVDLYFNLAAGEGV+LP LC  Q ++ RR++ E+ S+G
Sbjct  119  SCPNIVDLYFNLAAGEGVFLPTLCAAQGANARREMSEIRSSG  160



>ref|XP_002862543.1| hypothetical protein ARALYDRAFT_920570 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38801.1| hypothetical protein ARALYDRAFT_920570 [Arabidopsis lyrata subsp. 
lyrata]
Length=193

 Score =   154 bits (388),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 110/158 (70%), Gaps = 3/158 (2%)
 Frame = +2

Query  104  MKLSLMILFFVGSLFLPGVLG-DITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEY  280
            M LSL    ++ S  +  ++G D+ CE L  + C+FA+S++GKRC+LE SV   G +V Y
Sbjct  1    MLLSLHAHIYILSSIVINLVGHDVKCENLDEDTCAFAVSSTGKRCVLEKSVRRSGIEV-Y  59

Query  281  QCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPN  460
             C++SE+         IE+DEC++ACGLDRKS+G+SSD+LLE  FT KLCS  C   CPN
Sbjct  60   TCRSSEIEADKVTNI-IESDECIKACGLDRKSLGISSDALLESRFTQKLCSVKCLNQCPN  118

Query  461  IVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
            +VDL+FNLAAGEGVYLP LC+ Q   +RR + E+ S+G
Sbjct  119  VVDLFFNLAAGEGVYLPKLCESQEGKSRRAMSEIRSSG  156



>ref|XP_006424982.1| hypothetical protein CICLE_v10029842mg [Citrus clementina]
 gb|ESR38222.1| hypothetical protein CICLE_v10029842mg [Citrus clementina]
Length=157

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 97/127 (76%), Gaps = 2/127 (2%)
 Frame = +2

Query  161  LGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETD  340
            +G I CE LP  +CS+++S+SGKRCLLEN  +++G  V YQCKTSEV+V       IET+
Sbjct  22   VGGIICEQLPKQLCSYSVSSSGKRCLLENFASSDGT-VTYQCKTSEVIVDVVHD-WIETE  79

Query  341  ECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLC  520
            EC  ACG+DRKSVG+SSDSLL+P FTAKLCS +CYQNCPNIVDLYFNLA GEG + P +C
Sbjct  80   ECTNACGVDRKSVGISSDSLLQPQFTAKLCSDACYQNCPNIVDLYFNLALGEGKFHPTIC  139

Query  521  DKQRSHN  541
              Q S  
Sbjct  140  LAQLSRK  146



>ref|XP_004240617.1| PREDICTED: uncharacterized protein LOC101257567 [Solanum lycopersicum]
Length=191

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 127/203 (63%), Gaps = 19/203 (9%)
 Frame = +2

Query  119  MILFFVGSLFLPGVL---GDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCK  289
            +I+F V S  + G L   G+I CE L   +C++++++SGKRC LE+  + +G +  YQCK
Sbjct  3    LIIFLVFSFVIHGALASNGEIVCEDLSVGLCAYSVASSGKRCSLESYESIKGTR-GYQCK  61

Query  290  TsevvvgssvgeH-IETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIV  466
            TS+V+V +    + IE+DEC+ ACG DR S+G+SSDSLLE  FT+KLCS  C Q CPNIV
Sbjct  62   TSDVLVSNIDITNSIESDECISACGADRNSLGISSDSLLESTFTSKLCSQECNQKCPNIV  121

Query  467  DLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSSEESDaaaaplrsprr  646
            DLY+NLA GEGVYLP  C  +  + RR++ ++ S+G   A GPS+  S            
Sbjct  122  DLYYNLALGEGVYLPAFCKGRNLNGRREMSQIQSSG--VAWGPSAPSSGYGR--------  171

Query  647  aMVELSSGSGASTPTPVDAGDAP  715
               +LS G  AS     +A DAP
Sbjct  172  ---QLSEGPAASVALTFEA-DAP  190



>ref|XP_004246366.2| PREDICTED: uncharacterized protein LOC101261147 [Solanum lycopersicum]
Length=169

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 105/147 (71%), Gaps = 8/147 (5%)
 Frame = +2

Query  104  MKLSLMILFFVGSLFLPGVLG----DITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            MK SL ILF   SLFL         ++ CE LP   C+FAIS++GKRC+LE + T + + 
Sbjct  1    MKSSL-ILFLTCSLFLQVTYAVYKTEVKCESLPNGDCAFAISSTGKRCVLEKAKTPKDDL  59

Query  272  V--EYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCY  445
            +  EY+CKTSEV+V +    HIETDEC+E+CGL+R   G+SSD LLEP F +KLC+ +CY
Sbjct  60   ISSEYECKTSEVMVQNMKE-HIETDECIESCGLNRNFFGISSDDLLEPQFVSKLCAPACY  118

Query  446  QNCPNIVDLYFNLAAGEGVYLPDLCDK  526
            Q CPNIVDLYFNLA  EG YLPDLC+K
Sbjct  119  QQCPNIVDLYFNLAVAEGAYLPDLCNK  145



>ref|NP_200052.1| PAR1 protein [Arabidopsis thaliana]
 dbj|BAB10536.1| photoassimilate-responsive protein PAR-like protein [Arabidopsis 
thaliana]
 gb|AAM14066.1| putative photoassimilate-responsive protein PAR [Arabidopsis 
thaliana]
 gb|AAM67513.1| putative photoassimilate-responsive protein PAR [Arabidopsis 
thaliana]
 gb|AED96208.1| PAR1 protein [Arabidopsis thaliana]
Length=195

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 107/155 (69%), Gaps = 4/155 (3%)
 Frame = +2

Query  110  LSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCK  289
            ++ MIL  + S    G   D+ CE L  N C+FA+S++GKRC+LE S+   G +V Y C+
Sbjct  8    VAFMILLAIYSQTTFG--DDVKCENLDENTCAFAVSSTGKRCVLEKSMKRSGIEV-YTCR  64

Query  290  TsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVD  469
            +SE+         IE+DEC++ACGLDRK++G+SSD+LLE  FT KLCS  C   CPN+VD
Sbjct  65   SSEIEANKVTNI-IESDECIKACGLDRKALGISSDALLESQFTHKLCSVKCLNQCPNVVD  123

Query  470  LYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
            LYFNLAAGEGVYLP LC+ Q   +RR + E+ S+G
Sbjct  124  LYFNLAAGEGVYLPKLCESQEGKSRRAMSEIRSSG  158



>ref|XP_009599617.1| PREDICTED: uncharacterized protein LOC104095236 [Nicotiana tomentosiformis]
Length=185

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 100/138 (72%), Gaps = 2/138 (1%)
 Frame = +2

Query  161  LGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETD  340
            LG ITCE L  + C FAIS++GKRC LE  +   G +V Y CKTSE+         IETD
Sbjct  25   LGSITCENLNKDSCEFAISSTGKRCALEKHLRRSGEEV-YTCKTSEIEADKLKD-WIETD  82

Query  341  ECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLC  520
            +C++ACG+DR ++G+SSDSLLE  FT KLCS  CY++CPNI+DLYFNLAAGEG+YLP LC
Sbjct  83   QCIQACGVDRNTLGISSDSLLECHFTQKLCSPQCYKHCPNIIDLYFNLAAGEGIYLPRLC  142

Query  521  DKQRSHNRRDLVELNSNG  574
            ++Q  + RR + E+  +G
Sbjct  143  EEQGGNARRGMAEIKRSG  160



>ref|XP_010423911.1| PREDICTED: uncharacterized protein LOC104708952 [Camelina sativa]
Length=183

 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 107/148 (72%), Gaps = 3/148 (2%)
 Frame = +2

Query  164  GDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETDE  343
             ++ CE LP ++CSF+IS SGKRC+LE  V   G  V+Y+C+ SEV V  ++  +IETDE
Sbjct  23   ANVICEDLPDDICSFSISASGKRCVLETEVRQTGG-VDYRCRGSEVDVDGTMANYIETDE  81

Query  344  CVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLCD  523
            CV ACG+DR+S+G+SSD+LL+P F  KLC+  C ++CPNI DLYFNL A EG +LPDLC 
Sbjct  82   CVNACGVDRRSIGISSDALLDPGFAVKLCTPECLEDCPNIADLYFNLVAAEGSHLPDLCA  141

Query  524  KQRSHNRRDLVELNSNGGEKALGPSSEE  607
             +R++  R + E+ S+G  +ALG  S E
Sbjct  142  ARRNNPHRSMFEILSSG--EALGTFSGE  167



>ref|XP_002314136.2| hypothetical protein POPTR_0009s04480g [Populus trichocarpa]
 gb|EEE88091.2| hypothetical protein POPTR_0009s04480g [Populus trichocarpa]
Length=179

 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 105/147 (71%), Gaps = 7/147 (5%)
 Frame = +2

Query  161  LGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETD  340
            LG++ CE LP ++CS++I+TSGKRCLLEN  T +G  V+YQCKTSEVVV       IE D
Sbjct  17   LGELVCEQLPVDLCSYSIATSGKRCLLENYATKDGG-VKYQCKTSEVVVDKLNE-WIEID  74

Query  341  ECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLC  520
            EC+ ACGL R +VG+SSDSLL+P F  KLCS SC Q CPNIVDLY NLA  EGVYLP+LC
Sbjct  75   ECITACGLSRNTVGISSDSLLQPQFLTKLCSKSCSQACPNIVDLYSNLALAEGVYLPNLC  134

Query  521  DKQRSHNRRDLVELNSNGGEKALGPSS  601
                +  RR + +  SN G+ A  P+S
Sbjct  135  ----ASPRRAMYQTRSN-GDAAPAPAS  156



>ref|XP_004308085.1| PREDICTED: uncharacterized protein LOC101293047 [Fragaria vesca 
subsp. vesca]
Length=197

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 100/140 (71%), Gaps = 2/140 (1%)
 Frame = +2

Query  155  GVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIE  334
            G LG +TCE L  + C+FA+S+S KRC+LE  +   G +  Y C+TSE+         IE
Sbjct  23   GTLGGVTCENLDESTCAFAVSSSAKRCVLEKHIKRSGEEA-YTCRTSEIEADKLKD-WIE  80

Query  335  TDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPD  514
            ++EC+++CGLDRKS G+SSDSLLE  F  KLCS  CY +CPNIVDLYFNLAAGEGV+LP 
Sbjct  81   SEECIKSCGLDRKSYGISSDSLLESCFAQKLCSPQCYGSCPNIVDLYFNLAAGEGVFLPK  140

Query  515  LCDKQRSHNRRDLVELNSNG  574
            LC+ Q ++ RR + E+ S+G
Sbjct  141  LCEAQGANARRQMSEIRSSG  160



>ref|XP_002865911.1| hypothetical protein ARALYDRAFT_918281 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42170.1| hypothetical protein ARALYDRAFT_918281 [Arabidopsis lyrata subsp. 
lyrata]
Length=192

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 110/159 (69%), Gaps = 3/159 (2%)
 Frame = +2

Query  101  SMKLSLMILFFVGSLFLPGVLG-DITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVE  277
            ++K   + +  + +++    LG D+ CE L  + C+FA+S++GKRC+LE SV   G +V 
Sbjct  2    ALKTVFVAITLLLAIYSQTTLGHDVKCENLDEDTCAFAVSSTGKRCVLEKSVRRSGIEV-  60

Query  278  YQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCP  457
            Y C++SE+         IE+DEC++ACGLDRKS+G+SSD+LLE  FT KLCS  C   CP
Sbjct  61   YTCRSSEIEADKVTNI-IESDECIKACGLDRKSLGISSDALLESRFTQKLCSVKCLNQCP  119

Query  458  NIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
            N+VDL+FNLAAGEGVYLP LC+ Q   +RR + E+ S+G
Sbjct  120  NVVDLFFNLAAGEGVYLPKLCESQEGKSRRAMSEIRSSG  158



>ref|XP_011073209.1| PREDICTED: uncharacterized protein LOC105158232 [Sesamum indicum]
Length=170

 Score =   151 bits (381),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 110/162 (68%), Gaps = 7/162 (4%)
 Frame = +2

Query  92   MDSSMKLSLMILFFVGSLFLPGVLG-DITCEFLPTNVCSFAISTSGKRCLLENSVTNEGN  268
            M SS+KLSL+ LFF  SLF+   +  D+ CE L TN+CSFAI++SGKRC+LEN     G 
Sbjct  1    MGSSVKLSLL-LFFTCSLFVQRTIAEDVICENLSTNLCSFAIASSGKRCVLENHKNAHGK  59

Query  269  KVEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQ  448
                 CKTSEVVV    G +IETDECV+ACG+ R+SVGLSSD  L   FTA LCS +CY 
Sbjct  60   ----TCKTSEVVVDKLSG-YIETDECVKACGVCRESVGLSSDVFLSSEFTAHLCSPACYH  114

Query  449  NCPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
             CPNIVDL+ NLAAGEGV LP LC  Q   +R  L  L+  G
Sbjct  115  KCPNIVDLFSNLAAGEGVSLPALCKNQEDKHREMLAILSGGG  156



>ref|XP_006388432.1| hypothetical protein POPTR_0187s00220g [Populus trichocarpa]
 gb|ERP47346.1| hypothetical protein POPTR_0187s00220g [Populus trichocarpa]
Length=179

 Score =   151 bits (382),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 105/147 (71%), Gaps = 7/147 (5%)
 Frame = +2

Query  161  LGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETD  340
            LG++ CE LP ++CS++I+TSGKRCLLEN  T +G  V+YQCKTSEVVV       IE D
Sbjct  17   LGELVCEQLPVDLCSYSIATSGKRCLLENYATKDGG-VKYQCKTSEVVVDKLNEL-IEID  74

Query  341  ECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLC  520
            EC+ ACGL R +VG+SSDSLL+P F  KLCS SC Q CPNIVDLY NLA  EGVYLP+LC
Sbjct  75   ECITACGLSRNTVGISSDSLLQPQFLTKLCSKSCSQACPNIVDLYSNLALAEGVYLPNLC  134

Query  521  DKQRSHNRRDLVELNSNGGEKALGPSS  601
                +  RR + +  SN G+ A  P+S
Sbjct  135  ----ASPRRAMYQTRSN-GDAAPAPAS  156



>gb|ABK26944.1| unknown [Picea sitchensis]
Length=208

 Score =   152 bits (383),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 110/154 (71%), Gaps = 6/154 (4%)
 Frame = +2

Query  122  ILFFVGSLF----LPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCK  289
            IL  V +L     L GVLG I CE LP  VC+F++S+SG RC+LE S+  +GN V+Y+C+
Sbjct  6    ILLTVSALISVISLQGVLGGIVCENLPMEVCAFSVSSSGARCVLEKSILRDGN-VQYECQ  64

Query  290  TsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVD  469
            +S+V+        IET+EC+ ACG++R +VG+S+D+L++   T KLCS +CY  CPNI++
Sbjct  65   SSDVIAEIIKE-WIETEECMNACGVERMAVGMSTDALVDGRSTRKLCSPNCYNKCPNILE  123

Query  470  LYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSN  571
            LYFNLAAGEG+YLP LC+  RS +RR + E+ S 
Sbjct  124  LYFNLAAGEGIYLPRLCEAHRSGDRRMISEVISK  157



>ref|XP_011085664.1| PREDICTED: uncharacterized protein LOC105167590 [Sesamum indicum]
Length=254

 Score =   153 bits (386),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 105/137 (77%), Gaps = 3/137 (2%)
 Frame = +2

Query  167  DITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETDEC  346
            D+ CE LPT +CSFA+++SGKRC+LEN    +G K +Y CKTSEVVV    G +IET++C
Sbjct  107  DVICENLPTKLCSFAVASSGKRCVLENYKNAQG-KTDYTCKTSEVVVEKLSG-YIETNQC  164

Query  347  VEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLCDK  526
            + ACG+ R+ +G+SS++ L   FTA+LCSS+CYQNCPNIVDL+FNLA GEG+ LP LC  
Sbjct  165  MNACGVHREFIGISSEAFLSSEFTARLCSSACYQNCPNIVDLFFNLAVGEGISLPALCQN  224

Query  527  QRSHNRRDLVELNSNGG  577
            Q+  N R ++E+ SNGG
Sbjct  225  QK-ENHRAILEILSNGG  240



>ref|XP_006401831.1| hypothetical protein EUTSA_v10014733mg [Eutrema salsugineum]
 gb|ESQ43284.1| hypothetical protein EUTSA_v10014733mg [Eutrema salsugineum]
Length=195

 Score =   150 bits (380),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 107/158 (68%), Gaps = 3/158 (2%)
 Frame = +2

Query  104  MKLSLMILFFVGSLFLPGVLG-DITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEY  280
            +K   ++   + +++L   LG ++ CE L  + C+FA+S +GKRC+LE SV   G +V Y
Sbjct  3    LKTVFVVSMLLLAVYLQTTLGHEVKCENLDKDTCAFAVSAAGKRCVLEKSVKRSGIEV-Y  61

Query  281  QCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPN  460
             C+ SE+         IE+DEC++ACGLDRKS+G+SSD  LE  FT KLCS  C   CPN
Sbjct  62   MCRASEIEADKVTNI-IESDECIKACGLDRKSLGISSDGFLESRFTQKLCSVKCLTQCPN  120

Query  461  IVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
            IVDL++NLAAGEGVYLP LC+ Q+  +RR + E+ S+G
Sbjct  121  IVDLFYNLAAGEGVYLPKLCESQQGKSRRAMSEIRSSG  158



>ref|XP_009774343.1| PREDICTED: uncharacterized protein LOC104224406, partial [Nicotiana 
sylvestris]
Length=179

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = +2

Query  164  GDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETDE  343
            G I CE L  + C+FAIS++GKRC+LE  +   G +  Y C+TSE+         IETDE
Sbjct  21   GGIACENLNEDSCAFAISSNGKRCVLEKHLRRSGEE-GYTCRTSEIEADKLKDW-IETDE  78

Query  344  CVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLCD  523
            C+EACG+DR ++G+SSD+LLE  FT KLCS +CY++CPNIVDLYFNLAAGEGVYLP LC 
Sbjct  79   CIEACGVDRNALGISSDALLESRFTNKLCSPACYKHCPNIVDLYFNLAAGEGVYLPKLCA  138

Query  524  KQRSHNRRDLVELNSNG  574
            +Q    RR++ E+ S+G
Sbjct  139  EQGKSARREIAEIRSSG  155



>ref|XP_010444786.1| PREDICTED: uncharacterized protein LOC104727386 [Camelina sativa]
Length=195

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 110/162 (68%), Gaps = 9/162 (6%)
 Frame = +2

Query  131  FVGSLFLPGV-----LG-DITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKT  292
            FV S+ L  +     LG ++ CE L  + C+FA+S++GKRC+LE SV   G +V Y C++
Sbjct  7    FVTSMLLLAIYSQTTLGHEVKCENLDEDTCAFAVSSTGKRCVLEKSVRRSGIEV-YSCRS  65

Query  293  sevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDL  472
            S +         IE++EC+EACGLDRKS+G+SSD+LLE  FT KLCS  C++ CPN+VDL
Sbjct  66   SGIESDKVTNI-IESNECIEACGLDRKSLGISSDALLESRFTQKLCSDKCFKQCPNVVDL  124

Query  473  YFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG-GEKALGP  595
            ++NLAAGEGV+LP LC+ Q    RR + E+ S+G     LGP
Sbjct  125  FYNLAAGEGVFLPKLCESQEGKTRRAMSEIRSSGIAMDTLGP  166



>emb|CDY60088.1| BnaC02g45000D [Brassica napus]
Length=210

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 113/167 (68%), Gaps = 4/167 (2%)
 Frame = +2

Query  101  SMKLSLMILFFVGSLFLPGVLG-DITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVE  277
            +MK   ++   + +++L   LG ++ CE L  + C+FA+S++GKRC+LE S+   G +  
Sbjct  2    AMKTFFVVSMLLLAVYLQTTLGNEVKCEKLDKDTCAFAVSSTGKRCVLEQSIKRSGIE-G  60

Query  278  YQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCP  457
            Y C++SE+         IE+DEC++ACGLDRKS+G+SSD+LLE  FT KLCS  C   CP
Sbjct  61   YTCRSSEIEADKVTNI-IESDECIKACGLDRKSLGISSDALLESRFTQKLCSVKCLTQCP  119

Query  458  NIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEK-ALGP  595
            N+VDL+ NLAAGEGVYLP LC+ Q   +RR + EL S+G  +  LGP
Sbjct  120  NVVDLFSNLAAGEGVYLPKLCESQEGQSRRAMSELRSSGIVRDTLGP  166



>ref|XP_008778806.1| PREDICTED: uncharacterized protein LOC103698551 [Phoenix dactylifera]
 ref|XP_008779191.1| PREDICTED: uncharacterized protein LOC103698922 [Phoenix dactylifera]
Length=192

 Score =   149 bits (376),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 97/136 (71%), Gaps = 3/136 (2%)
 Frame = +2

Query  158  VLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIET  337
             LG ITCE L  N C+FA+S+SG RC+LEN V   G + E+ C TS++   +     +ET
Sbjct  24   TLGGITCESLARNTCAFAVSSSGMRCVLENRV-RRGGQEEFSCSTSDIEAENLKD-WVET  81

Query  338  DECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDL  517
            DEC++ACGL R +VG+SSDSLL+P F  KLCS  CYQ CPNIVDLYFNLAAGEGV+LP L
Sbjct  82   DECIKACGLTRSTVGISSDSLLDPRFAQKLCSPPCYQECPNIVDLYFNLAAGEGVFLPKL  141

Query  518  CDKQRSHNRRDLVELN  565
            C +  S+ RR + E+ 
Sbjct  142  C-QASSNARRGMEEIK  156



>ref|XP_010909577.1| PREDICTED: uncharacterized protein LOC105035650 [Elaeis guineensis]
Length=199

 Score =   149 bits (376),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 99/138 (72%), Gaps = 3/138 (2%)
 Frame = +2

Query  158  VLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIET  337
             LG ITCE L  + C+FA+S+SG RC+LEN +   G + E+ C+TS++   +     +ET
Sbjct  24   TLGGITCESLDRSTCAFAVSSSGMRCVLENRL-RRGGQEEFSCRTSDIEAENLKD-WVET  81

Query  338  DECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDL  517
            D+C+ ACGL R +VG+SSDSLLEP F  KLCS  CYQ CPN+VDLYFNLAAGEGV+LP L
Sbjct  82   DKCINACGLTRNTVGISSDSLLEPQFAQKLCSPQCYQECPNVVDLYFNLAAGEGVFLPKL  141

Query  518  CDKQRSHNRRDLVELNSN  571
            C +  S+ RR + E+ S+
Sbjct  142  C-QASSNARRSMAEIKSS  158



>ref|XP_006388431.1| hypothetical protein POPTR_0187s00210g, partial [Populus trichocarpa]
 gb|ERP47345.1| hypothetical protein POPTR_0187s00210g, partial [Populus trichocarpa]
Length=184

 Score =   148 bits (374),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 104/147 (71%), Gaps = 7/147 (5%)
 Frame = +2

Query  161  LGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETD  340
            LG++ CE LP ++CS++I+TSGKRCLLEN  T +G  V+YQCKTSEVVV       IE D
Sbjct  22   LGELVCEQLPVDLCSYSIATSGKRCLLENYATKDGG-VKYQCKTSEVVVDKLNEL-IEID  79

Query  341  ECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLC  520
            EC+ ACGL R +VG+SSDSLL+P F  KLCS SC Q CPNIVDLY NL+  EGVYLP+LC
Sbjct  80   ECITACGLSRNTVGISSDSLLQPQFLTKLCSKSCSQACPNIVDLYSNLSLAEGVYLPNLC  139

Query  521  DKQRSHNRRDLVELNSNGGEKALGPSS  601
                +  RR + +  SN G+ A  P S
Sbjct  140  ----ASPRRAMYQTRSN-GDAAPAPVS  161



>ref|XP_007218440.1| hypothetical protein PRUPE_ppa011685mg [Prunus persica]
 gb|EMJ19639.1| hypothetical protein PRUPE_ppa011685mg [Prunus persica]
Length=200

 Score =   149 bits (375),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 98/140 (70%), Gaps = 2/140 (1%)
 Frame = +2

Query  155  GVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIE  334
              LG ITCE L  + C+FA+S+S KRC+LE  V   G +  Y C+TSE+         +E
Sbjct  23   ATLGAITCEDLDKDTCAFAVSSSSKRCVLEKHVRRSGEEA-YTCRTSEIEADKLKD-WVE  80

Query  335  TDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPD  514
            +++C+++CGLDRKS G+ SDSLLE  FT KLCS  CY  CPNIVDLYFNLAAGEGV+LP 
Sbjct  81   SEQCIKSCGLDRKSYGICSDSLLESRFTQKLCSPQCYNTCPNIVDLYFNLAAGEGVFLPK  140

Query  515  LCDKQRSHNRRDLVELNSNG  574
            LC+ Q ++ RR + E+ S+G
Sbjct  141  LCEAQGANARRQMSEIRSSG  160



>ref|XP_010923168.1| PREDICTED: uncharacterized protein LOC105046307 isoform X2 [Elaeis 
guineensis]
Length=181

 Score =   148 bits (373),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 102/138 (74%), Gaps = 7/138 (5%)
 Frame = +2

Query  170  ITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETDECV  349
            + CE LP ++C+FAIS+S KRC+LE S+ + G   EYQC+TSEVVV       IETDECV
Sbjct  33   VICEDLPQDLCAFAISSSSKRCVLE-SIPHNGGPTEYQCRTSEVVVERMSD-WIETDECV  90

Query  350  EACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLCDKQ  529
            +ACG+DR +VG+SSDSLLEP FT K+CS SC+QNCPNI+DLYFNLAA E     DLC+ +
Sbjct  91   KACGVDRNTVGISSDSLLEPQFTEKICSPSCHQNCPNIIDLYFNLAAAE-----DLCEAR  145

Query  530  RSHNRRDLVELNSNGGEK  583
            R + RR +  + S+G  K
Sbjct  146  RGNPRRSMQVILSSGVPK  163



>ref|XP_006358715.1| PREDICTED: uncharacterized protein LOC102594490 [Solanum tuberosum]
Length=177

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 115/167 (69%), Gaps = 6/167 (4%)
 Frame = +2

Query  110  LSLMILFFVGSLFLPGVLG--DITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQ  283
            + L+ +F   SL + G LG  +I CE L   +C++++++SGKRC LE+  + EG +  YQ
Sbjct  1    MELITIFLGFSLLVHGALGSGEIVCEDLSIGMCAYSVASSGKRCSLESYESIEGRR-GYQ  59

Query  284  CKTsevvvgssvgeH-IETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPN  460
            CKTSEV+V +    + IE+DEC+ ACG DR S+G+SSDSLLE  FT+KLCS  C Q CPN
Sbjct  60   CKTSEVLVSNIGITNLIESDECISACGADRNSLGISSDSLLESSFTSKLCSQQCCQKCPN  119

Query  461  IVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSS  601
            IVDLY+NLA GEGVYLP  C  +  + RR++ ++ S+G   A  PS+
Sbjct  120  IVDLYYNLALGEGVYLPAFCKGRDLNGRREMSQIQSSG--VACAPSA  164



>emb|CDY27075.1| BnaA02g10950D [Brassica napus]
Length=401

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 115/168 (68%), Gaps = 6/168 (4%)
 Frame = +2

Query  101  SMKLSLMILFFVGSLFLPGVLG-DITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVE  277
            +MK   ++   + +++L   LG ++ CE L  + C+FA+S++GKRC+LE S+   G  +E
Sbjct  2    AMKTFFVVSMLLLAVYLQTTLGNEVKCEKLDKDTCAFAVSSTGKRCVLEQSIKRSG--IE  59

Query  278  -YQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNC  454
             Y C++SE+         IE+DEC++ACGLDRKS+G+SSD+LLE  FT KLCS  C   C
Sbjct  60   GYTCRSSEIEADKVTNI-IESDECIKACGLDRKSLGISSDALLESRFTQKLCSVKCLTQC  118

Query  455  PNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEK-ALGP  595
            PN+VDL+FNLAAGEGVYLP LC+ Q   +RR + EL S+G  +  LGP
Sbjct  119  PNVVDLFFNLAAGEGVYLPKLCESQEGQSRRAMSELRSSGIVRDTLGP  166



>ref|XP_010504193.1| PREDICTED: uncharacterized protein LOC104781266 [Camelina sativa]
Length=149

 Score =   146 bits (368),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 100/143 (70%), Gaps = 11/143 (8%)
 Frame = +2

Query  197  VCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETDECVEACGLDRKS  376
            +C+F+IS SGKRCLLE +        EY C+TS V V   V  H+E+DECV ACG+DRK+
Sbjct  1    MCAFSISASGKRCLLETANVAG----EYTCRTSAVDVEGIVN-HVESDECVAACGVDRKT  55

Query  377  VGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLV  556
            VG+SSDSL+E  F AK+CS +C   CPNI+DLYFNLAAGEG +LPDLCD  R +  R ++
Sbjct  56   VGISSDSLMEAGFAAKICSPACLDYCPNILDLYFNLAAGEGAFLPDLCDAHRMNPHRSML  115

Query  557  ELNSNGG------EKALGPSSEE  607
            E+ S+G       E A GPSS+E
Sbjct  116  EILSSGAAPGPVSEVAPGPSSKE  138



>ref|XP_008234242.1| PREDICTED: uncharacterized protein LOC103333213 [Prunus mume]
Length=200

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 98/140 (70%), Gaps = 2/140 (1%)
 Frame = +2

Query  155  GVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIE  334
              LG I+CE L  + C+FA+S+S KRC+LE  V   G +  Y C+TSE+         +E
Sbjct  23   ATLGAISCEDLDQDTCAFAVSSSSKRCVLEKHVRRSGEEA-YTCRTSEIEADKLKD-WVE  80

Query  335  TDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPD  514
            +++C+++CGLDRKS G+ SDSLLE  FT KLCS  CY  CPNIVDLYFNLAAGEGV+LP 
Sbjct  81   SEQCIKSCGLDRKSYGICSDSLLESRFTQKLCSPQCYDTCPNIVDLYFNLAAGEGVFLPK  140

Query  515  LCDKQRSHNRRDLVELNSNG  574
            LC+ Q ++ RR + E+ S+G
Sbjct  141  LCEAQGANARRQMSEIRSSG  160



>ref|XP_006288746.1| hypothetical protein CARUB_v10002062mg [Capsella rubella]
 gb|EOA21644.1| hypothetical protein CARUB_v10002062mg [Capsella rubella]
Length=183

 Score =   146 bits (368),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 103/152 (68%), Gaps = 1/152 (1%)
 Frame = +2

Query  122  ILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsev  301
            +L F+          ++ CE +P ++CSF+IS  GKRC+LE  V   G  + Y+C++SEV
Sbjct  9    LLMFITFCSFTSSHANVICEDIPDDMCSFSISALGKRCVLETEVRQTGG-INYRCRSSEV  67

Query  302  vvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFN  481
             V  ++  +IETDECV ACG+DR+SVG+SSD+LLEP F  KLC+  C ++CPNI DLY N
Sbjct  68   DVDVTLANYIETDECVNACGVDRRSVGISSDALLEPGFAVKLCTPECLEDCPNIADLYSN  127

Query  482  LAAGEGVYLPDLCDKQRSHNRRDLVELNSNGG  577
            L A EG +LPDLC  +R++  R + E+ S+G 
Sbjct  128  LVAAEGSFLPDLCAARRNNPHRSMFEILSSGA  159



>gb|KFK26839.1| hypothetical protein AALP_AA8G300600 [Arabis alpina]
Length=196

 Score =   146 bits (369),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 109/162 (67%), Gaps = 9/162 (6%)
 Frame = +2

Query  131  FVGSLFLPGV-----LG-DITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKT  292
            FV S+ L  +     LG ++ CE L  + C+FA+S++GKRC+LE SV   G ++ Y C+ 
Sbjct  7    FVASMLLVAIYLQTTLGHEVKCENLNKDTCAFAVSSTGKRCVLEKSVRRSGIEM-YTCRA  65

Query  293  sevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDL  472
            SE+         IE+DEC+ +CGLDR+S+G+SSD+LLE  FT KLCS+ C   CPN+VDL
Sbjct  66   SEIEADKITNI-IESDECINSCGLDRRSLGISSDALLESRFTQKLCSAKCLNQCPNVVDL  124

Query  473  YFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG-GEKALGP  595
            +FNLAAGEGV+LP LC+ Q   +RR + E+ S+G     LGP
Sbjct  125  FFNLAAGEGVFLPKLCESQEGKSRRVMSEIRSSGIVMDTLGP  166



>gb|EYU38454.1| hypothetical protein MIMGU_mgv1a024144mg [Erythranthe guttata]
Length=174

 Score =   145 bits (366),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 103/154 (67%), Gaps = 3/154 (2%)
 Frame = +2

Query  119  MILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTse  298
            M +  + S  +P   G++ CE LP  VCSF+I++SGKRC+LE   ++      YQCKTSE
Sbjct  1    MKILSLNSYSIPNNAGELVCEELPVEVCSFSIASSGKRCVLETWESSLPGI--YQCKTSE  58

Query  299  vvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYF  478
            V V   +  +IE D+CV ACG+DR +VG+SSDSL+E  FT  LCS  CY NCPNIVDLY+
Sbjct  59   VAVAIGMQGYIENDDCVSACGVDRNTVGISSDSLMETQFTFNLCSPQCYDNCPNIVDLYY  118

Query  479  NLAAGEGVYLPDLCDKQR-SHNRRDLVELNSNGG  577
            NLA  EGV L +LC  QR + +RR  ++L S+  
Sbjct  119  NLALAEGVVLGELCKSQRTTSSRRSAIQLQSSSA  152



>ref|XP_006358727.1| PREDICTED: uncharacterized protein LOC102598423 [Solanum tuberosum]
Length=208

 Score =   146 bits (369),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 112/159 (70%), Gaps = 7/159 (4%)
 Frame = +2

Query  128  FFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvv  307
            FFV SLF     G+I CE L   +C++++++SGKRC LE+  + EG +  YQCKTSEV+V
Sbjct  29   FFV-SLF--DNTGEIVCEDLSVGLCAYSVASSGKRCSLESYESIEGTR-GYQCKTSEVLV  84

Query  308  gssvgeH-IETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNL  484
             +    + IE+DEC+ ACG DR S+G+SSDSLLE  FT+KLCS  C Q CPNIVDLY+NL
Sbjct  85   SNIDITNLIESDECISACGADRNSLGISSDSLLESTFTSKLCSQQCNQKCPNIVDLYYNL  144

Query  485  AAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSS  601
            A GEGVYLP  C  +  + RR++ ++ S+G   A GPS+
Sbjct  145  ALGEGVYLPSFCKGRNLNGRREMSQIQSSG--VAWGPSA  181



>ref|XP_011073591.1| PREDICTED: uncharacterized protein LOC105158505 [Sesamum indicum]
Length=202

 Score =   145 bits (367),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 98/137 (72%), Gaps = 5/137 (4%)
 Frame = +2

Query  164  GDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETDE  343
             D+ CE LPTN+CSFA+++SGKRC+LE     +G K    CKTSEVVV    G +IETD+
Sbjct  57   ADVVCENLPTNLCSFAVASSGKRCVLEICKNAQGKK----CKTSEVVVEKLSG-YIETDQ  111

Query  344  CVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLCD  523
            CV +CG+ R+SVGLSSD+ L   FTA LCS +CY NCPNIVDL+FNLAAGEGV LP LC 
Sbjct  112  CVNSCGVCRESVGLSSDAFLSSKFTAHLCSPACYHNCPNIVDLFFNLAAGEGVSLPALCK  171

Query  524  KQRSHNRRDLVELNSNG  574
             Q   +R  L  L+S G
Sbjct  172  NQEEKHREMLAILSSGG  188



>ref|XP_010934761.1| PREDICTED: uncharacterized protein LOC105054842 [Elaeis guineensis]
Length=233

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 96/134 (72%), Gaps = 2/134 (1%)
 Frame = +2

Query  164  GDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETDE  343
            G ITCE L  + C++A+S++G RCLLE  V   G +V Y C TS++         +ETDE
Sbjct  68   GGITCESLGKSTCAYAVSSAGMRCLLEKHVRRGGQEV-YTCGTSDIEADGIKD-RVETDE  125

Query  344  CVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLCD  523
            CVEACGL+R ++G+SSDSLL+  F  KLCS +CY+ CPN+VDLYFNLAAGEGV+LP LC+
Sbjct  126  CVEACGLNRGTLGISSDSLLDSNFRQKLCSPACYRGCPNVVDLYFNLAAGEGVFLPKLCE  185

Query  524  KQRSHNRRDLVELN  565
             Q ++ RR + E+ 
Sbjct  186  AQETNVRRAMAEIR  199



>ref|XP_006403624.1| hypothetical protein EUTSA_v10010808mg [Eutrema salsugineum]
 gb|ESQ45077.1| hypothetical protein EUTSA_v10010808mg [Eutrema salsugineum]
Length=140

 Score =   142 bits (359),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 99/138 (72%), Gaps = 7/138 (5%)
 Frame = +2

Query  197  VCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETDECVEACGLDRKS  376
            +C+F+IS SGKRCLLE +        EY C+TS V V   V  H+E+D CV ACG+DRK+
Sbjct  1    MCAFSISASGKRCLLETANVAG----EYTCRTSTVEVEGIVN-HVESDACVSACGVDRKT  55

Query  377  VGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLV  556
            VG+SSD+++E  F AKLCS +C   CPNI+DLYFNLAAGEG +LPDLCD QR + RR ++
Sbjct  56   VGISSDTMMEAGFAAKLCSPACLDYCPNILDLYFNLAAGEGAFLPDLCDAQRINPRRSML  115

Query  557  ELNSNGGEKALGPSSEES  610
            ++ S+G   A GP S+ S
Sbjct  116  DILSSGA--APGPISDVS  131



>ref|XP_009420109.1| PREDICTED: uncharacterized protein LOC103999932 [Musa acuminata 
subsp. malaccensis]
Length=233

 Score =   145 bits (365),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 111/164 (68%), Gaps = 13/164 (8%)
 Frame = +2

Query  131  FVGSLFLPGVLGDITCEFLPTN---------VCSFAISTSGKRCLLENSVTNEGNKVEYQ  283
            F    +LP  L   +  F P++         VC+FA+S+S  RCLLE+S  + GN V YQ
Sbjct  58   FNRQAWLPLQLLRWSLRFRPSSPSSFVLLLEVCAFAVSSSSNRCLLESSQDSGGNTV-YQ  116

Query  284  CKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNI  463
            C+ SE+VV       IET++CV  CG+DR +VG+SSD+LLEP FT +LCS++C+QNCPNI
Sbjct  117  CRASEIVVERLRDW-IETEQCVSVCGVDRNAVGISSDALLEPHFTQQLCSAACHQNCPNI  175

Query  464  VDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGP  595
            +DL+ +LAA EG++LPDLC+ QR +  R +VE+ S+G   A GP
Sbjct  176  IDLHLDLAAAEGIFLPDLCEAQRVNPHRAMVEILSSGA--APGP  217



>ref|XP_009629076.1| PREDICTED: uncharacterized protein LOC104119315 [Nicotiana tomentosiformis]
Length=177

 Score =   143 bits (360),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 114/155 (74%), Gaps = 1/155 (1%)
 Frame = +2

Query  110  LSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCK  289
            ++   LF    LFL GVLGD+ CE LP  +C+F+I++SGKRCLLE+ V++EGN +E +C+
Sbjct  1    MNFTTLFLALCLFLQGVLGDLICEELPEEMCTFSIASSGKRCLLESHVSSEGN-LEMECQ  59

Query  290  TsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVD  469
            TSEV   + + E+IETDEC+ ACG+DR+S+GLSSDSLL+  F AKLCS+ CY NCPNIVD
Sbjct  60   TSEVFATNKMQEYIETDECIGACGVDRQSLGLSSDSLLDSKFIAKLCSAQCYNNCPNIVD  119

Query  470  LYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG  574
            LY NLA+ EG+ L  LC  Q++       +L S+G
Sbjct  120  LYSNLASAEGISLHGLCLSQKTRAHHGTSQLLSSG  154



>ref|XP_010452028.1| PREDICTED: uncharacterized protein LOC104734198 [Camelina sativa]
Length=183

 Score =   143 bits (360),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 106/148 (72%), Gaps = 3/148 (2%)
 Frame = +2

Query  164  GDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETDE  343
             ++ CE LP ++ SF+IS SGKRC+LE  +   G  V+Y+C++SEV V  ++  +IETDE
Sbjct  23   ANVICEDLPDDIYSFSISASGKRCVLETEMRQTGG-VDYRCRSSEVDVDGTMANYIETDE  81

Query  344  CVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLCD  523
            CV ACG+DR+S+G+SSD+LL+P F  KLC+  C ++CPNI DLY  L A EG +LPDLC 
Sbjct  82   CVNACGVDRRSLGISSDALLDPGFAVKLCTPECLEDCPNIADLYSILVAAEGSHLPDLCA  141

Query  524  KQRSHNRRDLVELNSNGGEKALGPSSEE  607
             +R++  R + E+ S+G  +ALG  SEE
Sbjct  142  ARRNNPHRSMFEILSSG--EALGTFSEE  167



>ref|XP_004140776.1| PREDICTED: uncharacterized protein LOC101216404 [Cucumis sativus]
 gb|KGN57379.1| hypothetical protein Csa_3G182150 [Cucumis sativus]
Length=206

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 95/135 (70%), Gaps = 2/135 (1%)
 Frame = +2

Query  170  ITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETDECV  349
            I CE L  N C+FA+S SGKRC+LE SV   G    + C+TSE+         +ET+ECV
Sbjct  33   IKCESLEKNKCAFAVSWSGKRCVLEKSVKRSGEDA-FTCRTSEIEADRLQNI-VETEECV  90

Query  350  EACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLCDKQ  529
            E CG+DR ++G+SSDSLL+  FT KLCSS CY +C N+VDL+FNLAAGEGV+LP LC+ Q
Sbjct  91   EGCGIDRNTLGISSDSLLDTSFTRKLCSSRCYNHCANVVDLFFNLAAGEGVFLPKLCEVQ  150

Query  530  RSHNRRDLVELNSNG  574
              + RR + E+ S+G
Sbjct  151  GGNARRGMSEIRSSG  165



>ref|XP_006281102.1| hypothetical protein CARUB_v10027132mg [Capsella rubella]
 gb|EOA14000.1| hypothetical protein CARUB_v10027132mg [Capsella rubella]
Length=210

 Score =   142 bits (358),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 105/160 (66%), Gaps = 5/160 (3%)
 Frame = +2

Query  119  MILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTse  298
            M+LF + S    G   ++ CE L  + C+FA+S +GKRC+LE S+   G +V Y C++S 
Sbjct  11   MLLFAIYSQTALG--SEVKCENLDEDTCAFAVSATGKRCVLEKSMRRSGIEV-YSCRSSG  67

Query  299  vvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYF  478
            +         +E++EC+ ACGL RKS+G+SSD+LLE  FT KLCS  C  +CPN+VDL+F
Sbjct  68   IESDKVTNI-VESNECINACGLGRKSLGISSDALLESRFTQKLCSVKCLNHCPNVVDLFF  126

Query  479  NLAAGEGVYLPDLCDKQRSHNRRDLVELNSNG-GEKALGP  595
            NLAAGEGV+LP LC+ Q    RR + E+ S+G     LGP
Sbjct  127  NLAAGEGVFLPKLCESQEGKTRRAMSEIRSSGIAMDTLGP  166



>ref|XP_004157197.1| PREDICTED: uncharacterized protein LOC101225828 [Cucumis sativus]
Length=206

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 95/135 (70%), Gaps = 2/135 (1%)
 Frame = +2

Query  170  ITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETDECV  349
            I CE L  N C+FA+S SGKRC+LE SV   G    + C+TSE+         +ET+ECV
Sbjct  33   IKCESLEKNKCAFAVSWSGKRCVLEKSVKRSGEDA-FTCRTSEIEADRLQNI-VETEECV  90

Query  350  EACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLCDKQ  529
            E CG+DR ++G+SSDSLL+  FT KLCSS CY +C N+VDL+FNLAAGEGV+LP LC+ Q
Sbjct  91   EGCGVDRNTLGISSDSLLDTSFTRKLCSSRCYNHCANVVDLFFNLAAGEGVFLPKLCEVQ  150

Query  530  RSHNRRDLVELNSNG  574
              + RR + E+ S+G
Sbjct  151  GGNVRRGMSEIRSSG  165



>ref|XP_010923170.1| PREDICTED: uncharacterized protein LOC105046307 isoform X4 [Elaeis 
guineensis]
Length=157

 Score =   140 bits (352),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 96/126 (76%), Gaps = 7/126 (6%)
 Frame = +2

Query  170  ITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETDECV  349
            + CE LP ++C+FAIS+S KRC+LE S+ + G   EYQC+TSEVVV       IETDECV
Sbjct  33   VICEDLPQDLCAFAISSSSKRCVLE-SIPHNGGPTEYQCRTSEVVVERMSD-WIETDECV  90

Query  350  EACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLCDKQ  529
            +ACG+DR +VG+SSDSLLEP FT K+CS SC+QNCPNI+DLYFNLAA E     ++ +K+
Sbjct  91   KACGVDRNTVGISSDSLLEPQFTEKICSPSCHQNCPNIIDLYFNLAAAE-----EIGNKE  145

Query  530  RSHNRR  547
            RS  RR
Sbjct  146  RSSIRR  151



>emb|CDY13175.1| BnaC04g26600D [Brassica napus]
Length=203

 Score =   141 bits (355),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 114/174 (66%), Gaps = 13/174 (7%)
 Frame = +2

Query  98   SSMKLSLMILFFVGSLFLPGVLGD-ITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKV  274
            SS+KL +   F + S  L   LG+ I CE LPT++C+F+IS +GKRCLLE +        
Sbjct  27   SSLKLPI---FLILSSLLHAALGEEIICENLPTSICAFSISATGKRCLLETANVAG----  79

Query  275  EYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNC  454
            EY C+ S V V   V  H+E+DECV ACG+DRK+VG+SSD+++EP F AKLCS +C+  C
Sbjct  80   EYTCRNSAVEVEGIVN-HVESDECVAACGVDRKTVGISSDAMMEPGFAAKLCSPACFDYC  138

Query  455  PNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLV--ELNSNGG--EKALGPSSE  604
            PNI+DLYFNLAAGEG  L        ++ ++  +  E+ S+GG  E A GP S+
Sbjct  139  PNILDLYFNLAAGEGKILSFFLFSLHAYKKKIYIYMEMFSSGGAPEPAPGPVSD  192



>gb|KDO52035.1| hypothetical protein CISIN_1g029827mg [Citrus sinensis]
Length=158

 Score =   139 bits (351),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 95/135 (70%), Gaps = 3/135 (2%)
 Frame = +2

Query  95   DSSMKLSLMILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKV  274
            DS +K+  ++   + +  +   LG++TCE L  N C+FA+S SGKRC+LE  V   G + 
Sbjct  6    DSGLKIFAVVALAI-AFCVQATLGEVTCESLDQNACAFAVSASGKRCVLEKQVKRSGQET  64

Query  275  EYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNC  454
             Y CKTSE+         IETD+C+++CGLDRKS+G+SSDSLLE  FT KLCSS CY +C
Sbjct  65   -YTCKTSEIEAEKLNNW-IETDQCIKSCGLDRKSLGISSDSLLESGFTQKLCSSPCYGSC  122

Query  455  PNIVDLYFNLAAGEG  499
            PNIVDLYFNLAAGEG
Sbjct  123  PNIVDLYFNLAAGEG  137



>gb|ABK27044.1| unknown [Picea sitchensis]
Length=190

 Score =   140 bits (354),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 104/147 (71%), Gaps = 3/147 (2%)
 Frame = +2

Query  122  ILFFVGSLFLPGVLGDIT-CEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTse  298
            +L  + ++ +PGV   I  CE LP  +C+F+IS+SG RC+LE  +  +G  +++QC++S 
Sbjct  19   LLIILMAITVPGVQSAIIKCEELPAELCAFSISSSGNRCVLEKDLMMDGT-LQFQCQSSV  77

Query  299  vvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYF  478
            V V   V   IE++EC+ ACGL+R +VG+S+DSLLEP F+AKLCSS C  NCPNIVDLY 
Sbjct  78   VSVEKLVE-WIESEECINACGLERMAVGMSTDSLLEPEFSAKLCSSECRNNCPNIVDLYV  136

Query  479  NLAAGEGVYLPDLCDKQRSHNRRDLVE  559
            NLAAGEG+ L  +C   ++ +R+ + E
Sbjct  137  NLAAGEGISLSSMCASHKNRSRKVIKE  163



>ref|XP_008439231.1| PREDICTED: uncharacterized protein LOC103484081 [Cucumis melo]
Length=206

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 96/135 (71%), Gaps = 2/135 (1%)
 Frame = +2

Query  170  ITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETDECV  349
            I C+ L  N C+FA+S SGKRC+LE SV   G +  + C+TSE+         +ET+ECV
Sbjct  33   IKCKSLEKNKCAFAVSWSGKRCVLEKSVKRSGEEA-FTCRTSEIEADRLQNI-VETEECV  90

Query  350  EACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLCDKQ  529
            + CGLDR ++G+SSDSLL+  FT KLCSS CY +C N+VDL+FNLAAGEGV+LP LC+ Q
Sbjct  91   KGCGLDRNTLGISSDSLLDTSFTRKLCSSRCYNHCANVVDLFFNLAAGEGVFLPKLCEVQ  150

Query  530  RSHNRRDLVELNSNG  574
              + RR + E+ S+G
Sbjct  151  GGNVRRGMSEIRSSG  165



>ref|XP_009763986.1| PREDICTED: uncharacterized protein LOC104215785 isoform X2 [Nicotiana 
sylvestris]
Length=204

 Score =   139 bits (350),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 109/165 (66%), Gaps = 11/165 (7%)
 Frame = +2

Query  119  MILFFVGSLFLPGVLG--DITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKT  292
            +I+F V S  + G LG  +I CE L    C+++++ SGKRC LE   ++EG    YQCKT
Sbjct  3    LIIFLVFSFLIHGALGNGEIVCEDLSVGKCAYSVAFSGKRCTLETYESSEGT-TGYQCKT  61

Query  293  sevvvgssvgeH-IETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVD  469
            SEVVV  +   + IE+DEC+ ACG +R SVG+SSDSLLE  FT+KLCS  CYQ CPNIVD
Sbjct  62   SEVVVAINGIANWIESDECISACGANRDSVGISSDSLLESSFTSKLCSQQCYQKCPNIVD  121

Query  470  LYFNLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSSE  604
            LY+NLA GE       C  +  + RR++ ++ S+G   AL P+S+
Sbjct  122  LYYNLALGEA-----FCKGKNLNGRREMSQIQSSG--AALAPASD  159



>gb|KEH28949.1| PAR1 protein [Medicago truncatula]
Length=138

 Score =   136 bits (343),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 88/113 (78%), Gaps = 2/113 (2%)
 Frame = +2

Query  161  LGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETD  340
            L ++ CE LP  VC+F++++SGKRCLLE      G ++EYQC+TSEV+V      +IETD
Sbjct  22   LAEMVCEDLPKEVCTFSVASSGKRCLLETQKGVNG-EIEYQCRTSEVIVERISE-YIETD  79

Query  341  ECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEG  499
            +CVEACG+DR SVG+SSD+  EP FT KLCS +CY+ CPNIVDL+FN+AAGEG
Sbjct  80   QCVEACGVDRSSVGISSDAFFEPQFTGKLCSPACYKKCPNIVDLFFNMAAGEG  132



>gb|ABK22647.1| unknown [Picea sitchensis]
 gb|ABK27026.1| unknown [Picea sitchensis]
 gb|ABR18111.1| unknown [Picea sitchensis]
 gb|ACN40842.1| unknown [Picea sitchensis]
Length=202

 Score =   138 bits (347),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 97/130 (75%), Gaps = 2/130 (2%)
 Frame = +2

Query  170  ITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETDECV  349
            +TCE LP  VC+F++S+SG RC+LE ++  +G  +++QC++S VV        IE++EC+
Sbjct  36   MTCEELPVEVCAFSVSSSGNRCVLEKALMMDGT-LQFQCQSSVVVAEKLAE-WIESEECI  93

Query  350  EACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLCDKQ  529
             ACGL+R +VG+S+DSLLEP F+ KLCSS C  +CPNIVDLY NLAAGEG+ LP +C+ Q
Sbjct  94   NACGLERMAVGMSTDSLLEPEFSRKLCSSQCRNSCPNIVDLYVNLAAGEGISLPRMCESQ  153

Query  530  RSHNRRDLVE  559
            ++ +R  + E
Sbjct  154  KTRSRILIAE  163



>ref|XP_009788534.1| PREDICTED: uncharacterized protein LOC104236325 [Nicotiana sylvestris]
Length=176

 Score =   137 bits (345),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 104/131 (79%), Gaps = 3/131 (2%)
 Frame = +2

Query  155  GVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIE  334
            GVLGD+ CE LP  +CSF+I++SGKRCLLE+ V+ EGN +E +C+TSEV   + + E+IE
Sbjct  15   GVLGDLICEELPEEMCSFSIASSGKRCLLESHVSAEGN-LEMECQTSEVFATNKMQEYIE  73

Query  335  TDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPD  514
            TDEC+ ACG+DR+S+GLSSDSLL+P F AK+CS+ CY NCPNIVDLY NLA+ EGV L  
Sbjct  74   TDECIGACGVDRQSLGLSSDSLLDPKFIAKICSAQCYNNCPNIVDLYSNLASAEGVSLHG  133

Query  515  LC--DKQRSHN  541
            LC   K R+H+
Sbjct  134  LCLTQKTRAHH  144



>ref|XP_010923169.1| PREDICTED: uncharacterized protein LOC105046307 isoform X3 [Elaeis 
guineensis]
Length=169

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = +2

Query  170  ITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETDECV  349
            + CE LP ++C+FAIS+S KRC+LE S+ + G   EYQC+TSEVVV       IETDECV
Sbjct  33   VICEDLPQDLCAFAISSSSKRCVLE-SIPHNGGPTEYQCRTSEVVVERMSD-WIETDECV  90

Query  350  EACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLCDKQ  529
            +ACG+DR +VG+SSDSLLEP FT K+CS SC+QNCPNI+DLYFNLAA E      L   Q
Sbjct  91   KACGVDRNTVGISSDSLLEPQFTEKICSPSCHQNCPNIIDLYFNLAAAEDGRYTTLMSNQ  150

Query  530  RS  535
             S
Sbjct  151  HS  152



>gb|AFG47187.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47188.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47191.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47192.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47193.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47195.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47196.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47197.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47198.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47199.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47200.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
Length=142

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 98/143 (69%), Gaps = 10/143 (7%)
 Frame = +2

Query  197  VCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETDECVEACGLDRKS  376
            VC+F++S+SG RC+LE S+  +GN ++Y+C++SEV+  +     IETDEC+ ACG++R +
Sbjct  2    VCAFSVSSSGARCVLEKSILRDGN-MQYECQSSEVIAENMKE-WIETDECMNACGVERMT  59

Query  377  VGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLV  556
            VG+S+DS+ E  FT  LC   CY  CPNI+DLYFNLAAGEGVYLP LC   RS +RR + 
Sbjct  60   VGMSTDSIAERGFTGNLCLPRCYNKCPNIIDLYFNLAAGEGVYLPRLCQAHRSGDRRMMT  119

Query  557  ELNSNG--------GEKALGPSS  601
            E  S          G+ A+ P+S
Sbjct  120  EFVSFAAAPATIGFGDIAISPTS  142



>gb|AFG47186.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47189.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47190.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47194.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47201.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
Length=142

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 96/135 (71%), Gaps = 6/135 (4%)
 Frame = +2

Query  197  VCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETDECVEACGLDRKS  376
            VC+F++S+SG RC+LE S+  +GN ++Y+C++SEV+  +     IETDEC+ ACG++R +
Sbjct  2    VCAFSVSSSGARCVLEKSILRDGN-MQYECQSSEVIAENMKE-WIETDECMNACGVERMT  59

Query  377  VGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLV  556
            VG+S+DS+ E  FT  LC   CY  CPNI+DLYFNLAAGEGVYLP LC   RS +RR + 
Sbjct  60   VGMSTDSIAERGFTGNLCLPRCYNKCPNIIDLYFNLAAGEGVYLPRLCQAHRSGDRRMMT  119

Query  557  ELNSNGGEKALGPSS  601
            E  S     A GP++
Sbjct  120  EFVS----FAAGPAT  130



>gb|ABK24725.1| unknown [Picea sitchensis]
Length=167

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 95/126 (75%), Gaps = 2/126 (2%)
 Frame = +2

Query  170  ITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETDECV  349
            I CE LP  +C+F+IS+SG RC+LE  +  +G  +++QC++S V+V   V   IE++EC+
Sbjct  13   IKCEELPAELCAFSISSSGNRCVLEKDLMMDGT-LQFQCQSSVVLVEKLVE-WIESEECI  70

Query  350  EACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLCDKQ  529
             ACGL+R +VG+S+DSLLEP F+AKLCSS C  NCPNIVDLY NLAAGEG+ L  +C  Q
Sbjct  71   NACGLERMAVGMSTDSLLEPEFSAKLCSSECRNNCPNIVDLYVNLAAGEGISLSSMCASQ  130

Query  530  RSHNRR  547
            ++ +R+
Sbjct  131  KNRSRK  136



>ref|XP_002439633.1| hypothetical protein SORBIDRAFT_09g017290 [Sorghum bicolor]
 gb|EES18063.1| hypothetical protein SORBIDRAFT_09g017290 [Sorghum bicolor]
Length=182

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 98/147 (67%), Gaps = 5/147 (3%)
 Frame = +2

Query  170  ITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeH-IETDEC  346
            + CE L   +C+FA+S++ +RC+LEN+    G   EYQC+TSEVVV        +ETD C
Sbjct  30   VVCEQLTAELCAFAVSSTSRRCVLENT-HCAGRATEYQCRTSEVVVEDGRLSGLVETDGC  88

Query  347  VEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLCDK  526
            V ACG+DR +VG+SSDSLL+P     +CS +C + CPNIVDLY NLAAGEGV   +LC+ 
Sbjct  89   VRACGVDRATVGISSDSLLDPRVAGAVCSPACLRGCPNIVDLYSNLAAGEGVAFSELCEV  148

Query  527  QRSHNRRDLVELNSNG---GEKALGPS  598
             RS+ RR L +L S+G   G  A  PS
Sbjct  149  HRSNPRRALAQLQSSGEAHGTPASAPS  175



>ref|XP_010255408.1| PREDICTED: uncharacterized protein LOC104596085 [Nelumbo nucifera]
Length=172

 Score =   135 bits (340),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 91/124 (73%), Gaps = 2/124 (2%)
 Frame = +2

Query  164  GDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETDE  343
            G ITCE LP   C+F++S++G RC+LE       + V+  CK+S+V+V ++    +E D+
Sbjct  28   GGITCENLPNEYCAFSVSSAGFRCVLEKYEAG-ADGVKLGCKSSDVLVENTAS-WVEIDD  85

Query  344  CVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLCD  523
            C+E+CGL RKSVG+SSDSLLEP F  KLCS  C+Q CPNIVDLYFNLAA EGVYLP LC 
Sbjct  86   CIESCGLKRKSVGISSDSLLEPNFLHKLCSPKCFQFCPNIVDLYFNLAAAEGVYLPKLCQ  145

Query  524  KQRS  535
            K RS
Sbjct  146  KMRS  149



>ref|XP_007152257.1| hypothetical protein PHAVU_004G1144000g, partial [Phaseolus vulgaris]
 gb|ESW24251.1| hypothetical protein PHAVU_004G1144000g, partial [Phaseolus vulgaris]
Length=134

 Score =   134 bits (336),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 92/135 (68%), Gaps = 5/135 (4%)
 Frame = +2

Query  101  SMKLSLMILFFVGSLF---LPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNK  271
            ++ +S   L  V  LF   L G LG++ CE L  + C+FA+S  GKRC+LE  V   G +
Sbjct  2    ALNVSFRCLTMVAILFFATLQGTLGEVECERLSKDTCAFAVSWEGKRCVLEKRVKRSGEE  61

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
              Y C++SE+   S  G HIET+EC++ CGL+RKS G+SSDSLLE  FT  LCS  CYQN
Sbjct  62   A-YTCRSSEIETESEKG-HIETEECIKGCGLNRKSFGISSDSLLEVGFTQNLCSPRCYQN  119

Query  452  CPNIVDLYFNLAAGE  496
            CPNIVDLYFNLAAGE
Sbjct  120  CPNIVDLYFNLAAGE  134



>ref|XP_009103900.1| PREDICTED: uncharacterized protein LOC103829961 isoform X2 [Brassica 
rapa]
Length=183

 Score =   135 bits (339),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 98/139 (71%), Gaps = 11/139 (8%)
 Frame = +2

Query  98   SSMKLSLMILFFVGSLFLPGVLG-DITCEFLPTNVCSFAISTSGKRCLLENS-VTNEGNK  271
            SS+KL +   F + S  L   LG DI CE LPTN+C+F+IS SGKRCLLE + VT E   
Sbjct  4    SSLKLPI---FLILSSLLHAALGEDIVCENLPTNMCAFSISASGKRCLLETANVTGE---  57

Query  272  VEYQCKTsevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQN  451
              Y C+TS V V   V  H+E+DECV ACG+DRK+VG+SSD+++E  F AKLCS +C   
Sbjct  58   --YTCRTSAVEVEGIVN-HVESDECVAACGVDRKTVGISSDAMMEAGFAAKLCSPACLDY  114

Query  452  CPNIVDLYFNLAAGEGVYL  508
            CPNI+DLYFNLAAGEG  L
Sbjct  115  CPNILDLYFNLAAGEGTIL  133



>gb|AFG47202.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
Length=142

 Score =   133 bits (335),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 97/143 (68%), Gaps = 10/143 (7%)
 Frame = +2

Query  197  VCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETDECVEACGLDRKS  376
            VC+F++S+SG RC+LE S+  +GN ++Y+C++SEV+  +     IETDEC+ ACG++R +
Sbjct  2    VCAFSVSSSGARCVLEKSILRDGN-MQYECQSSEVIAENMKE-WIETDECMNACGVERMT  59

Query  377  VGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLV  556
            VG+S+DS+ E  F   LC   CY  CPNI+DLYFNLAAGEGVYLP LC   RS +RR + 
Sbjct  60   VGMSTDSIAERGFIGNLCLPRCYNKCPNIIDLYFNLAAGEGVYLPRLCQAHRSGDRRMMT  119

Query  557  ELNSNG--------GEKALGPSS  601
            E  S          G+ A+ P+S
Sbjct  120  EFVSFAAAPATIGFGDIAISPTS  142



>ref|XP_010537178.1| PREDICTED: LOW QUALITY PROTEIN: sulfated surface glycoprotein 
185 [Tarenaya hassleriana]
Length=229

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 102/152 (67%), Gaps = 11/152 (7%)
 Frame = +2

Query  125  LFFVGSLFLPGVLG-DITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsev  301
            L  + +L    VLG ++TCE L  + C+FA+S++GKR          G +V Y C+ SE+
Sbjct  15   LLVLTTLSFQTVLGHEVTCESLSEDTCAFAVSSTGKR-------XRSGVEV-YTCRASEI  66

Query  302  vvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFN  481
                     IE++ CV+ CGLDRK++G+SSD+LLEP FT KLCS  C+ +CPN+VDLYFN
Sbjct  67   EADKVANV-IESERCVKDCGLDRKTLGISSDALLEPRFTRKLCSPQCFNHCPNVVDLYFN  125

Query  482  LAAGEGVYLPDLCDKQRSHN-RRDLVELNSNG  574
            LAAGEGV+LP LC+ Q   N RR++ E+ S+G
Sbjct  126  LAAGEGVFLPKLCEAQNEKNKRREMSEIRSSG  157



>ref|XP_002527887.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34518.1| conserved hypothetical protein [Ricinus communis]
Length=109

 Score =   132 bits (332),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 77/95 (81%), Gaps = 2/95 (2%)
 Frame = +2

Query  326  HIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVY  505
            +IE+DECV+ACG+DR SVG+SSD+LLEP FTAKLCS +CYQ C NIVDLYFNLAAGEG +
Sbjct  4    YIESDECVKACGVDRNSVGISSDALLEPQFTAKLCSPACYQKCSNIVDLYFNLAAGEGAF  63

Query  506  LPDLCDKQRSHNRRDLVELNSNGGEKALGPSSEES  610
            LPDLCD  R++  R +++L S+G   A GP + E+
Sbjct  64   LPDLCDASRTNPHRSMIQLMSSG--VAPGPITSEA  96



>ref|XP_004962356.1| PREDICTED: uncharacterized protein LOC101785352 [Setaria italica]
Length=191

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 99/145 (68%), Gaps = 4/145 (3%)
 Frame = +2

Query  170  ITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvg-ssvgeHIETDEC  346
            + CE L   +C+FA+S++ +RC+LEN+    G    YQC+TSEVVV    +   +ETD C
Sbjct  31   VVCEQLAAELCAFAVSSTSRRCVLENT-HCAGRPTAYQCRTSEVVVEDGRLAGTVETDRC  89

Query  347  VEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLCDK  526
            V ACG+DR +VG+SSDSLL+P     +CS +C Q CPNIV+LY NLAAGEGV   +LC+ 
Sbjct  90   VRACGVDRATVGISSDSLLDPRVAGAVCSPACLQGCPNIVNLYANLAAGEGVAFSELCEV  149

Query  527  QRSHNRRDLVELNSNGGEKALGPSS  601
             R++ RR + +L S+G  KA G S+
Sbjct  150  HRANPRRAMAQLQSSG--KAHGAST  172



>ref|XP_010108343.1| hypothetical protein L484_006498 [Morus notabilis]
 gb|EXC19134.1| hypothetical protein L484_006498 [Morus notabilis]
Length=227

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 104/190 (55%), Gaps = 45/190 (24%)
 Frame = +2

Query  155  GVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIE  334
            G LG ITCE L  + C+FA+S+SGKRC+LE  V   G K  Y C+ S++         IE
Sbjct  21   GTLGGITCEKLDQDTCAFAVSSSGKRCVLEKHVKRSG-KEAYTCRASDIEADKLKDV-IE  78

Query  335  TDECVEACGLDR-------------------------------------------KSVGL  385
            +DEC++ACGLDR                                           +++G+
Sbjct  79   SDECIKACGLDRRTLGISSDSLLESRFTRQLCSPNCYDACHNVVDLYFNLAAGEVRTLGI  138

Query  386  SSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDLVELN  565
            SSDSLLE  FT +LCS +CY  C N+VDLYFNLAAGEGV+LP LC+ Q  + RR++ EL 
Sbjct  139  SSDSLLESRFTRQLCSPNCYDACHNVVDLYFNLAAGEGVFLPKLCEAQAGNVRREMAELR  198

Query  566  SNGGEKALGP  595
            S+G   A GP
Sbjct  199  SSGFVVAPGP  208



>ref|XP_008649530.1| PREDICTED: uncharacterized protein LOC103630240 [Zea mays]
 gb|AFW77700.1| hypothetical protein ZEAMMB73_689082 [Zea mays]
Length=178

 Score =   133 bits (335),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 98/148 (66%), Gaps = 3/148 (2%)
 Frame = +2

Query  170  ITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeH-IETDEC  346
            + CE L   VC+FA+S++ +RC+LE +    G   EY+C+TSEVV         +ETD C
Sbjct  28   VVCEQLTAEVCAFAVSSTSRRCVLETT-HCAGRPTEYECRTSEVVAADGRLSGLVETDAC  86

Query  347  VEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLCDK  526
            V ACG+DR +VG+SSDSLL+P     +CS++C + CPNIVDLY NLAAGEGV   +LC+ 
Sbjct  87   VRACGVDRATVGISSDSLLDPRVAGAVCSAACLRGCPNIVDLYANLAAGEGVAFSELCEV  146

Query  527  QRSHNRRDLVELNSNGGEKALGPSSEES  610
             R++ RR + +L S+ GE    P+S  S
Sbjct  147  HRANPRRAMSQLQSS-GEAHDAPASAPS  173



>emb|CDP09132.1| unnamed protein product [Coffea canephora]
Length=188

 Score =   133 bits (334),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 93/136 (68%), Gaps = 1/136 (1%)
 Frame = +2

Query  155  GVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIE  334
            G  G++ CE LP  +C+F+IS+SGKRCLLE     +     YQCKTSEV    ++  H+E
Sbjct  15   GAFGELICEELPAEMCAFSISSSGKRCLLETYAPTDATTT-YQCKTSEVAANINMNGHVE  73

Query  335  TDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPD  514
            T+EC++ACGL R  VG+SSD+LL+  F ++LCS  C +NCPNIVDLY +LA  EG+ L +
Sbjct  74   TEECIKACGLQRNVVGISSDTLLDSGFASELCSQDCSENCPNIVDLYNDLALAEGLNLSE  133

Query  515  LCDKQRSHNRRDLVEL  562
            +C   ++  RR + ++
Sbjct  134  MCKALKNSPRRIMAQV  149



>ref|XP_008439229.1| PREDICTED: uncharacterized protein LOC103484080 [Cucumis melo]
Length=174

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +2

Query  161  LGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETD  340
            +  I CE L  N+C+FA+S  GKRC+LE +V ++G +  + C+ S+++    +   +ETD
Sbjct  1    MKKIKCEDLGINMCAFAVSWWGKRCVLEKTVKHDGEE-GFTCQISKIMEVKKLRNRVETD  59

Query  341  ECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLC  520
            +CV  CGLDR ++G+SSDSLL+  FT  LC S CY +CPNIV L+ NLAA EG+YLP LC
Sbjct  60   KCVRRCGLDRNTLGISSDSLLDTRFTCNLCFSHCYNHCPNIVHLFTNLAAAEGLYLPKLC  119

Query  521  DKQRSHNRRDLVELNSNG  574
            + +  + RR++  + S+G
Sbjct  120  NAEGGNVRREMSNIRSSG  137



>ref|XP_011032294.1| PREDICTED: uncharacterized protein LOC105131157 [Populus euphratica]
Length=170

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 106/164 (65%), Gaps = 16/164 (10%)
 Frame = +2

Query  119  MILFFVGSLFLPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTse  298
            +I F   SL L G LG++ CE LP ++CS++I+TSGKRCLLEN  T +G  V+YQCKTSE
Sbjct  3    LIAFLALSLLLNGALGELVCEQLPVDLCSYSIATSGKRCLLENYATKDGG-VKYQCKTSE  61

Query  299  vvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYF  478
            VVVG      IE DEC+ ACGL R +VG+SSDSLL+P F  KLCS SC Q C        
Sbjct  62   VVVGILNE-WIEIDECITACGLSRNTVGISSDSLLQPQFLTKLCSQSCSQAC--------  112

Query  479  NLAAGEGVYLPDLCDKQRSHNRRDLVELNSNGGEKALGPSSEES  610
             LA G  VYLP+LC    ++ RR + +  SN G+ A  P S ++
Sbjct  113  GLAYGR-VYLPNLC----ANPRRAMYQTRSN-GDAAPAPVSIDA  150



>ref|XP_006848035.1| hypothetical protein AMTR_s00029p00186480 [Amborella trichopoda]
 gb|ERN09616.1| hypothetical protein AMTR_s00029p00186480 [Amborella trichopoda]
Length=150

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 86/113 (76%), Gaps = 1/113 (1%)
 Frame = +2

Query  164  GDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETDE  343
             +I CE L    C+F+IS++GKRC+LE    N+G + E++C TS  V    + E IE +E
Sbjct  37   AEIVCENLSKEECAFSISSAGKRCVLEKYTGNDGEEGEFKC-TSSEVEVERLSEWIEIEE  95

Query  344  CVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGV  502
            C+++CGLDR SVG+SSDSLL+P FTAKLC+S C+ NCPN+VDLYFNLAAGEG+
Sbjct  96   CIQSCGLDRNSVGISSDSLLDPQFTAKLCASPCFDNCPNVVDLYFNLAAGEGI  148



>ref|XP_010040888.1| PREDICTED: uncharacterized protein LOC104429762 [Eucalyptus grandis]
Length=217

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 84/113 (74%), Gaps = 2/113 (2%)
 Frame = +2

Query  149  LPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeH  328
            + G LGDI CE L    C+FA+S++GKRC+LE  V   G +  Y C++SE+   +    H
Sbjct  19   VQGTLGDIACENLDQGSCAFAVSSTGKRCVLEKQVRRSGEE-GYTCRSSEIEADNLKD-H  76

Query  329  IETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLA  487
            IETDEC+ ACGLDRK++G+SSDSLLE  FT KLCSS CY+NCPNIVDLYF+LA
Sbjct  77   IETDECIAACGLDRKTLGVSSDSLLESRFTQKLCSSGCYENCPNIVDLYFSLA  129



>emb|CDP09118.1| unnamed protein product [Coffea canephora]
Length=349

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 109/191 (57%), Gaps = 20/191 (10%)
 Frame = +2

Query  164  GDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETDE  343
            G++ C+ LP  +C+F+IS+SGKRC LE S         +QCKTSE++V      HIETDE
Sbjct  125  GELICDELPVGMCAFSISSSGKRCSLETS----DEPGVFQCKTSEILVHKIRE-HIETDE  179

Query  344  CVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLCD  523
            C+ ACG DR   G+SSD L +P+FTAKLCS+ C  NCPN+VDLY NLA  EG  L   C 
Sbjct  180  CITACGADRNVTGISSDFLFDPIFTAKLCSNRCLNNCPNMVDLYSNLALAEGKLLSKRCK  239

Query  524  KQRSHN--RRDLVELNSNGGEKALGPSSEESDaaaaplrsprraMVELSSGSGASTPTPV  697
             Q +H   RR + E  S+G   A  P S  S +            V + +   A + +PV
Sbjct  240  AQETHGTPRRAMSEFQSSG--IAFAPLSAPSASP-----------VPVFAPVSAPSASPV  286

Query  698  DAGDAPAAPSS  730
             A    +APS+
Sbjct  287  PAFAPVSAPSA  297


 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 88/129 (68%), Gaps = 6/129 (5%)
 Frame = +2

Query  116  LMILFFVGSLFLPGVL-GDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKT  292
            +MI+F   SL L G L G++ C+ LP  +C+F+IS+SGKRC LE S         +QCKT
Sbjct  2    VMIIFLALSLLLQGALAGELICDELPVGMCAFSISSSGKRCSLETS----DEPGVFQCKT  57

Query  293  sevvvgssvgeHIETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDL  472
            SE++V      HIETDEC+ ACG DR   G+SSD L +P+FTAKLCS+ C  NCPN+VDL
Sbjct  58   SEILVHKIRE-HIETDECITACGADRNVTGISSDFLFDPIFTAKLCSNRCLNNCPNMVDL  116

Query  473  YFNLAAGEG  499
            Y NLA  EG
Sbjct  117  YSNLALAEG  125



>ref|XP_004140837.1| PREDICTED: uncharacterized protein LOC101212311 [Cucumis sativus]
Length=202

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 94/139 (68%), Gaps = 2/139 (1%)
 Frame = +2

Query  161  LGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETD  340
            L  I CE L  N+C+FA+S  G RC+LE +V  +G +  + C+TS+++    +   +ET+
Sbjct  28   LKKIKCEDLEINMCAFAVSWWGNRCVLEKTVKLDGEE-GFTCRTSKIMEVKKLRNRVETE  86

Query  341  ECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLC  520
            +CV  CGLDR ++G+SSDSLL+  FT  LCSS CY +CPNIV L+ NLAA EG+ LP LC
Sbjct  87   KCVRRCGLDRNTLGISSDSLLDTRFTQNLCSSRCYNHCPNIVHLFTNLAAAEGLSLPKLC  146

Query  521  DKQRSHNR-RDLVELNSNG  574
            + +  + R R++  + S+G
Sbjct  147  NAEGGNMRSREMSNIRSSG  165



>ref|XP_004157223.1| PREDICTED: uncharacterized protein LOC101232096 [Cucumis sativus]
Length=199

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 94/139 (68%), Gaps = 2/139 (1%)
 Frame = +2

Query  161  LGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETD  340
            L  I CE L  N+C+FA+S  G RC+LE +V  +G +  + C+TS+++    +   +ET+
Sbjct  25   LKKIKCEDLEINMCAFAVSWWGNRCVLEKTVKLDGEE-GFTCRTSKIMEVKKLRNRVETE  83

Query  341  ECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLC  520
            +CV  CGLDR ++G+SSDSLL+  FT  LCSS CY +CPNIV L+ NLAA EG+ LP LC
Sbjct  84   KCVRRCGLDRNTLGISSDSLLDTRFTQNLCSSRCYNHCPNIVHLFTNLAAAEGLSLPKLC  143

Query  521  DKQRSHNR-RDLVELNSNG  574
            + +  + R R++  + S+G
Sbjct  144  NAEGGNMRSREMSNIRSSG  162



>emb|CDP09117.1| unnamed protein product [Coffea canephora]
Length=162

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 85/127 (67%), Gaps = 7/127 (6%)
 Frame = +2

Query  197  VCSFAISTSGKRCLLENSVTNEGNKVEY-QCKTsevvvgssvgeHIETDECVEACGLDRK  373
            +C+ ++++SGKRC LE      G++    QCKTSE+ V      HIETDECV ACG DR 
Sbjct  1    MCALSVASSGKRCSLE-----AGDEPGLPQCKTSEISVHGIRE-HIETDECVAACGSDRN  54

Query  374  SVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLCDKQRSHNRRDL  553
              G+SSDSLL+P+FTAKLCS  C  NCPNIVDLY NLA+ EGV L  LC    +  RR +
Sbjct  55   VTGISSDSLLDPIFTAKLCSKHCVNNCPNIVDLYSNLASAEGVLLSKLCKSLETSPRRAM  114

Query  554  VELNSNG  574
             +L S+G
Sbjct  115  SQLQSSG  121



>ref|XP_001775001.1| predicted protein [Physcomitrella patens]
 gb|EDQ60108.1| predicted protein [Physcomitrella patens]
Length=120

 Score =   117 bits (294),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 85/122 (70%), Gaps = 2/122 (2%)
 Frame = +2

Query  164  GDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeHIETDE  343
            G++ CE LP   C+F++++SG RC+LE     +G  + Y+C++S  +        IE+DE
Sbjct  1    GNLECEDLPIEYCAFSVASSGTRCVLEKYRGKDG-IILYECQSSMTMAEREEE-WIESDE  58

Query  344  CVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVYLPDLCD  523
            C+ +CG++R SVGLS+D L++  FT  LCSS C  NCPN++DLY +LAAGEG+YLP LC 
Sbjct  59   CIISCGMERISVGLSTDLLMDSHFTKMLCSSECLNNCPNLIDLYTSLAAGEGMYLPQLCK  118

Query  524  KQ  529
            +Q
Sbjct  119  EQ  120



>gb|KCW44819.1| hypothetical protein EUGRSUZ_L01611, partial [Eucalyptus grandis]
Length=121

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 76/105 (72%), Gaps = 2/105 (2%)
 Frame = +2

Query  149  LPGVLGDITCEFLPTNVCSFAISTSGKRCLLENSVTNEGNKVEYQCKTsevvvgssvgeH  328
            + G LGDI CE L    C+FA+S++GKRC+LE  V   G +  Y C++SE+   +    H
Sbjct  19   VQGTLGDIACENLDQGSCAFAVSSTGKRCVLEKQVRRSGEE-GYTCRSSEIEADNLKD-H  76

Query  329  IETDECVEACGLDRKSVGLSSDSLLEPVFTAKLCSSSCYQNCPNI  463
            IETDEC+ ACGLDRK++G+SSDSLLE  FT KLCSS CY+NCPNI
Sbjct  77   IETDECIAACGLDRKTLGVSSDSLLESRFTQKLCSSGCYENCPNI  121



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1690861144275