BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c28321_g1_i1 len=1112 path=[1:0-1111]

Length=1112
                                                                      Score     E

ref|XP_009625321.1|  PREDICTED: acid phosphatase 1-like                 387   2e-130   
ref|XP_009795136.1|  PREDICTED: acid phosphatase 1-like                 384   1e-129   
emb|CDO97963.1|  unnamed protein product                                370   1e-123   
ref|XP_009776612.1|  PREDICTED: acid phosphatase 1-like                 368   4e-123   
ref|XP_004235637.1|  PREDICTED: acid phosphatase 1-like                 367   9e-123   
ref|XP_009787591.1|  PREDICTED: acid phosphatase 1-like                 363   4e-121   
ref|XP_009622654.1|  PREDICTED: acid phosphatase 1-like                 360   4e-120   
ref|XP_010322861.1|  PREDICTED: acid phosphatase 1-like                 358   3e-119   
ref|XP_006356134.1|  PREDICTED: acid phosphatase 1-like                 356   2e-118   
ref|XP_004241953.1|  PREDICTED: acid phosphatase 1                      355   5e-118   
ref|XP_004241952.1|  PREDICTED: acid phosphatase 1-like                 351   2e-116   
gb|AFX66999.1|  putative acid phosphatase                               345   9e-114   
ref|XP_010690146.1|  PREDICTED: acid phosphatase 1-like                 319   8e-104   
ref|XP_004302846.1|  PREDICTED: stem 28 kDa glycoprotein-like           317   5e-103   
emb|CAN82027.1|  hypothetical protein VITISV_000612                     313   1e-101   Vitis vinifera
ref|XP_010654601.1|  PREDICTED: acid phosphatase 1                      311   4e-101   
ref|XP_010033825.1|  PREDICTED: acid phosphatase 1-like                 308   9e-100   
ref|XP_010033711.1|  PREDICTED: acid phosphatase 1-like                 307   2e-99    
ref|XP_002515949.1|  Stem 28 kDa glycoprotein precursor, putative       306   6e-99    Ricinus communis
ref|XP_011000941.1|  PREDICTED: acid phosphatase 1-like                 303   1e-97    
ref|XP_007024338.1|  Stem 28 kDa glycoprotein, putative                 303   1e-97    
ref|XP_010033712.1|  PREDICTED: acid phosphatase 1-like                 302   2e-97    
ref|XP_010033826.1|  PREDICTED: acid phosphatase 1-like                 300   8e-97    
ref|XP_003632911.1|  PREDICTED: acid phosphatase 1-like                 299   3e-96    
ref|XP_002299744.2|  hypothetical protein POPTR_0001s19180g             299   4e-96    Populus trichocarpa [western balsam poplar]
dbj|BAJ34931.1|  hypothetical protein                                   298   5e-96    
ref|XP_010258709.1|  PREDICTED: acid phosphatase 1-like                 297   2e-95    
gb|KDP40846.1|  hypothetical protein JCGZ_24845                         295   8e-95    
ref|XP_007215831.1|  hypothetical protein PRUPE_ppa010152mg             295   1e-94    
ref|XP_006426852.1|  hypothetical protein CICLE_v10026223mg             294   5e-94    
ref|XP_006465744.1|  PREDICTED: acid phosphatase 1-like                 293   8e-94    
ref|XP_008228404.1|  PREDICTED: acid phosphatase 1-like                 292   2e-93    
ref|XP_008798588.1|  PREDICTED: acid phosphatase 1-like                 292   2e-93    
ref|XP_007045549.1|  Stem 28 kDa glycoprotein, putative                 291   5e-93    
ref|XP_004302847.1|  PREDICTED: stem 28 kDa glycoprotein-like           290   1e-92    
ref|XP_006465710.1|  PREDICTED: acid phosphatase 1-like                 289   6e-92    
ref|XP_010033713.1|  PREDICTED: acid phosphatase 1-like                 285   8e-91    
ref|XP_010915365.1|  PREDICTED: acid phosphatase 1-like                 285   1e-90    
ref|XP_010654600.1|  PREDICTED: acid phosphatase 1-like                 281   3e-89    
ref|XP_010033828.1|  PREDICTED: acid phosphatase 1-like                 280   9e-89    
ref|XP_009338743.1|  PREDICTED: acid phosphatase 1-like                 280   1e-88    
gb|AGG23547.1|  acid phosphatase-like protein 1                         280   1e-88    
ref|XP_008380842.1|  PREDICTED: acid phosphatase 1-like                 280   1e-88    
ref|XP_006426853.1|  hypothetical protein CICLE_v10027566mg             278   6e-88    
ref|XP_004510320.1|  PREDICTED: stem 28 kDa glycoprotein-like           276   5e-87    
ref|XP_009344485.1|  PREDICTED: acid phosphatase 1-like                 275   2e-86    
gb|KDO51839.1|  hypothetical protein CISIN_1g036571mg                   274   2e-86    
emb|CBI36038.3|  unnamed protein product                                281   4e-86    
ref|XP_008348489.1|  PREDICTED: acid phosphatase 1-like                 271   4e-85    
ref|XP_008358084.1|  PREDICTED: acid phosphatase 1-like                 269   2e-84    
ref|XP_004305256.1|  PREDICTED: acid phosphatase 1-like                 268   3e-84    
ref|XP_003627057.1|  Acid phosphatase                                   267   1e-83    
ref|XP_006654133.1|  PREDICTED: acid phosphatase 1-like                 267   2e-83    
gb|EMS46715.1|  Stem 28 kDa glycoprotein                                266   3e-83    
gb|AFK46217.1|  unknown                                                 266   3e-83    
ref|XP_009381186.1|  PREDICTED: acid phosphatase 1-like                 266   4e-83    
gb|AFK40440.1|  unknown                                                 264   1e-82    
ref|XP_009797387.1|  PREDICTED: acid phosphatase 1-like                 263   2e-82    
ref|XP_003530059.1|  PREDICTED: stem 28 kDa glycoprotein-like           264   2e-82    
dbj|BAJ94050.1|  predicted protein                                      263   7e-82    
gb|EYU36713.1|  hypothetical protein MIMGU_mgv1a012835mg                261   7e-82    
ref|XP_003627058.1|  Stem 28 kDa glycoprotein                           262   9e-82    
dbj|BAJ94870.1|  predicted protein                                      262   1e-81    
ref|XP_010088387.1|  Stem 28 kDa glycoprotein                           261   1e-81    
emb|CAB71336.2|  putative acid phosphatase                              261   2e-81    Hordeum vulgare [barley]
ref|XP_009625320.1|  PREDICTED: acid phosphatase 1-like                 259   4e-81    
ref|XP_003568779.1|  PREDICTED: stem 28 kDa glycoprotein                261   4e-81    
dbj|BAJ90845.1|  predicted protein                                      260   5e-81    
ref|XP_004960901.1|  PREDICTED: stem 28 kDa glycoprotein-like           260   7e-81    
gb|EMT03894.1|  Stem 28 kDa glycoprotein                                259   2e-80    
gb|KHN39260.1|  Stem 28 kDa glycoprotein                                258   2e-80    
ref|XP_002440748.1|  hypothetical protein SORBIDRAFT_09g006010          259   2e-80    Sorghum bicolor [broomcorn]
ref|XP_007135625.1|  hypothetical protein PHAVU_010G144600g             258   2e-80    
ref|XP_002439412.1|  hypothetical protein SORBIDRAFT_09g005960          258   6e-80    Sorghum bicolor [broomcorn]
gb|EMS66285.1|  Stem 28 kDa glycoprotein                                258   8e-80    
ref|XP_004963522.1|  PREDICTED: stem 28 kDa glycoprotein-like           257   1e-79    
ref|NP_001150932.1|  LOC100284565 precursor                             258   1e-79    Zea mays [maize]
gb|EMS54507.1|  Acid phosphatase 1                                      257   2e-79    
ref|XP_004960902.1|  PREDICTED: acid phosphatase 1-like                 256   4e-79    
ref|XP_006654134.1|  PREDICTED: stem 28 kDa glycoprotein-like           254   9e-79    
ref|XP_006356133.1|  PREDICTED: acid phosphatase 1-like                 251   2e-78    
ref|XP_004960903.1|  PREDICTED: acid phosphatase 1-like                 254   2e-78    
gb|EMT19717.1|  Acid phosphatase 1                                      254   2e-78    
gb|EMS67586.1|  Acid phosphatase 1                                      253   8e-78    
ref|XP_011072446.1|  PREDICTED: acid phosphatase 1-like                 249   1e-77    
gb|KHN05326.1|  Stem 28 kDa glycoprotein                                251   2e-77    
ref|NP_001148494.1|  stem 28 kDa glycoprotein precursor                 247   8e-76    Zea mays [maize]
ref|NP_001236180.1|  acid phosphatase precursor                         246   1e-75    
gb|EAY96842.1|  hypothetical protein OsI_18762                          246   3e-75    Oryza sativa Indica Group [Indian rice]
ref|XP_009607238.1|  PREDICTED: acid phosphatase 1-like                 241   6e-75    
ref|XP_004960899.1|  PREDICTED: stem 28 kDa glycoprotein-like iso...    244   8e-75    
ref|NP_001148296.1|  stem 28 kDa glycoprotein precursor                 244   1e-74    Zea mays [maize]
gb|AFW77368.1|  stem glycoprotein                                       244   1e-74    
ref|XP_004960898.1|  PREDICTED: stem 31 kDa glycoprotein-like iso...    240   2e-73    
ref|XP_002440742.1|  hypothetical protein SORBIDRAFT_09g005940          239   6e-73    Sorghum bicolor [broomcorn]
ref|XP_004960900.1|  PREDICTED: stem 28 kDa glycoprotein-like iso...    239   2e-72    
gb|AFW77369.1|  hypothetical protein ZEAMMB73_279889                    238   3e-72    
ref|XP_011076425.1|  PREDICTED: acid phosphatase 1-like                 237   8e-72    
gb|EMT02057.1|  Stem 28 kDa glycoprotein                                236   1e-71    
gb|KCW53447.1|  hypothetical protein EUGRSUZ_J02693                     234   2e-71    
ref|XP_007215832.1|  hypothetical protein PRUPE_ppa010152mg             234   3e-71    
emb|CBI25273.3|  unnamed protein product                                232   4e-71    
emb|CDO98049.1|  unnamed protein product                                236   4e-71    
emb|CDP05370.1|  unnamed protein product                                234   5e-71    
ref|XP_010098159.1|  Acid phosphatase 1                                 233   2e-70    
ref|XP_006853740.1|  hypothetical protein AMTR_s00056p00177520          233   5e-70    
ref|XP_010662272.1|  PREDICTED: acid phosphatase 1                      230   2e-69    
ref|XP_006357920.1|  PREDICTED: acid phosphatase 1-like                 229   4e-69    
ref|XP_006656617.1|  PREDICTED: acid phosphatase 1-like                 228   4e-69    
ref|XP_011101105.1|  PREDICTED: acid phosphatase 1-like                 229   1e-68    
ref|XP_007135620.1|  hypothetical protein PHAVU_010G144200g             228   1e-68    
ref|XP_009588519.1|  PREDICTED: acid phosphatase 1-like                 227   3e-68    
ref|NP_001056747.1|  Os06g0139800                                       228   3e-68    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ35770.1|  hypothetical protein OsJ_20061                          228   5e-68    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010941067.1|  PREDICTED: acid phosphatase 1-like                 227   6e-68    
gb|EYU20188.1|  hypothetical protein MIMGU_mgv1a011800mg                226   7e-68    
ref|XP_008376378.1|  PREDICTED: acid phosphatase 1                      226   1e-67    
ref|XP_009800382.1|  PREDICTED: acid phosphatase 1-like                 224   2e-67    
ref|XP_010098160.1|  Acid phosphatase 1                                 223   2e-67    
ref|XP_009370433.1|  PREDICTED: acid phosphatase 1-like                 225   3e-67    
ref|NP_001242215.1|  uncharacterized protein LOC100795218 precursor     224   4e-67    
ref|NP_001234071.1|  acid phosphatase 1 precursor                       224   4e-67    
ref|XP_008367296.1|  PREDICTED: acid phosphatase 1-like                 224   4e-67    
ref|XP_006358226.1|  PREDICTED: acid phosphatase 1-like                 224   5e-67    
gb|KHG01291.1|  Acid phosphatase 1                                      224   5e-67    
ref|XP_009372837.1|  PREDICTED: acid phosphatase 1-like                 224   6e-67    
ref|XP_006280976.1|  hypothetical protein CARUB_v10026976mg             224   6e-67    
ref|XP_008801792.1|  PREDICTED: acid phosphatase 1-like                 224   6e-67    
ref|XP_009797620.1|  PREDICTED: acid phosphatase 1-like                 223   1e-66    
ref|XP_010693738.1|  PREDICTED: acid phosphatase 1                      223   1e-66    
ref|XP_004235180.1|  PREDICTED: acid phosphatase 1                      223   2e-66    
ref|XP_002510996.1|  Acid phosphatase 1 precursor, putative             223   2e-66    Ricinus communis
gb|ABK95709.1|  unknown                                                 219   3e-66    Populus trichocarpa [western balsam poplar]
prf||1908418A  acid phosphatase 1                                       222   3e-66 
ref|XP_009362705.1|  PREDICTED: acid phosphatase 1                      222   3e-66    
ref|XP_003620757.1|  Acid phosphatase-like protein                      222   3e-66    
gb|KDP22459.1|  hypothetical protein JCGZ_26290                         222   3e-66    
ref|XP_004511128.1|  PREDICTED: acid phosphatase 1-like                 222   4e-66    
ref|XP_011028463.1|  PREDICTED: acid phosphatase 1                      221   8e-66    
gb|ACU24349.1|  unknown                                                 221   8e-66    Glycine max [soybeans]
gb|AFK34288.1|  unknown                                                 220   2e-65    
gb|AHC69831.1|  acid phosphatase                                        220   2e-65    
gb|AGV54493.1|  acid phosphatase                                        220   2e-65    
ref|NP_001240054.1|  uncharacterized protein LOC100802126 precursor     220   2e-65    
gb|KCW90870.1|  hypothetical protein EUGRSUZ_A02919                     219   2e-65    
ref|XP_004307784.1|  PREDICTED: acid phosphatase 1-like                 219   4e-65    
ref|XP_002867623.1|  hypothetical protein ARALYDRAFT_329150             219   4e-65    
ref|XP_006385121.1|  acid phosphatase family protein                    219   4e-65    
ref|NP_199939.1|  HAD superfamily, subfamily IIIB acid phosphatase      219   5e-65    Arabidopsis thaliana [mouse-ear cress]
gb|EYU31308.1|  hypothetical protein MIMGU_mgv1a011623mg                219   5e-65    
ref|XP_010532228.1|  PREDICTED: acid phosphatase 1-like isoform X1      219   6e-65    
ref|XP_007038298.1|  HAD superfamily, subfamily IIIB acid phospha...    219   7e-65    
gb|KFK26738.1|  acid phosphatase                                        218   1e-64    
ref|XP_010062554.1|  PREDICTED: acid phosphatase 1                      221   2e-64    
ref|XP_010433112.1|  PREDICTED: acid phosphatase 1-like                 217   2e-64    
ref|XP_002436441.1|  hypothetical protein SORBIDRAFT_10g002690          218   3e-64    Sorghum bicolor [broomcorn]
ref|XP_010258799.1|  PREDICTED: acid phosphatase 1                      218   3e-64    
ref|XP_010688366.1|  PREDICTED: acid phosphatase 1-like                 217   3e-64    
gb|EMT02056.1|  Stem 31 kDa glycoprotein                                216   4e-64    
ref|XP_002865848.1|  hypothetical protein ARALYDRAFT_495196             216   4e-64    
ref|NP_194245.1|  HAD superfamily, subfamily IIIB acid phosphatase      216   5e-64    Arabidopsis thaliana [mouse-ear cress]
gb|KDO45271.1|  hypothetical protein CISIN_1g023192mg                   217   6e-64    
ref|XP_010482458.1|  PREDICTED: acid phosphatase 1-like                 216   7e-64    
ref|XP_004513069.1|  PREDICTED: acid phosphatase 1-like                 215   1e-63    
ref|XP_007218818.1|  hypothetical protein PRUPE_ppa010063mg             215   1e-63    
ref|XP_009795729.1|  PREDICTED: acid phosphatase 1-like                 215   1e-63    
gb|AGV54632.1|  stem 28 kDa glycoprotein                                215   2e-63    
ref|XP_007152955.1|  hypothetical protein PHAVU_004G174200g             214   2e-63    
ref|XP_008234437.1|  PREDICTED: acid phosphatase 1                      215   2e-63    
ref|XP_006401998.1|  hypothetical protein EUTSA_v10014448mg             214   2e-63    
ref|XP_007133483.1|  hypothetical protein PHAVU_011G182400g             215   2e-63    
ref|XP_003531798.1|  PREDICTED: acid phosphatase 1-like                 214   2e-63    
ref|XP_010442941.1|  PREDICTED: acid phosphatase 1-like                 214   2e-63    
ref|XP_006490172.1|  PREDICTED: acid phosphatase 1-like                 215   3e-63    
ref|XP_006426851.1|  hypothetical protein CICLE_v10026223mg             213   3e-63    
ref|NP_001150931.1|  acid phosphatase 1 precursor                       215   3e-63    Zea mays [maize]
ref|XP_010536549.1|  PREDICTED: acid phosphatase 1-like                 214   4e-63    
gb|AFW75455.1|  hypothetical protein ZEAMMB73_076415                    215   4e-63    
ref|XP_003557220.2|  PREDICTED: acid phosphatase 1-like                 214   4e-63    
ref|XP_010098162.1|  Stem 28 kDa glycoprotein                           213   6e-63    
gb|ABK23358.1|  unknown                                                 214   7e-63    Picea sitchensis
ref|XP_006837335.1|  hypothetical protein AMTR_s00111p00084650          214   7e-63    
ref|XP_006284361.1|  hypothetical protein CARUB_v10005533mg             213   8e-63    
gb|AFK42878.1|  unknown                                                 213   9e-63    
ref|XP_006421584.1|  hypothetical protein CICLE_v10005566mg             214   1e-62    
ref|XP_010267101.1|  PREDICTED: acid phosphatase 1-like                 213   1e-62    
ref|XP_004287494.1|  PREDICTED: acid phosphatase 1-like                 212   2e-62    
ref|XP_004245159.1|  PREDICTED: acid phosphatase 1-like                 212   3e-62    
gb|ACJ84626.1|  unknown                                                 211   4e-62    Medicago truncatula
ref|XP_008437018.1|  PREDICTED: acid phosphatase 1                      211   4e-62    
gb|EMS60884.1|  Acid phosphatase 1                                      215   4e-62    
gb|ABK21277.1|  unknown                                                 211   4e-62    Picea sitchensis
gb|ACN40876.1|  unknown                                                 211   5e-62    Picea sitchensis
ref|XP_002283385.2|  PREDICTED: acid phosphatase 1-like                 213   5e-62    Vitis vinifera
ref|XP_010915367.1|  PREDICTED: acid phosphatase 1-like isoform X1      211   5e-62    
ref|NP_001151681.1|  acid phosphatase 1 precursor                       212   6e-62    Zea mays [maize]
gb|ABK21327.1|  unknown                                                 211   6e-62    Picea sitchensis
gb|AFW85941.1|  acid phosphatase 1                                      212   7e-62    
ref|XP_004143740.1|  PREDICTED: acid phosphatase 1-like                 211   8e-62    
ref|XP_006359744.1|  PREDICTED: acid phosphatase 1-like                 210   1e-61    
ref|XP_008794092.1|  PREDICTED: acid phosphatase 1-like                 210   1e-61    
ref|XP_006451342.1|  hypothetical protein CICLE_v10009222mg             210   2e-61    
ref|XP_010110867.1|  Acid phosphatase 1                                 209   2e-61    
gb|KDO55859.1|  hypothetical protein CISIN_1g024820mg                   209   2e-61    
ref|XP_010438922.1|  PREDICTED: acid phosphatase 1-like                 209   3e-61    
ref|XP_010433681.1|  PREDICTED: acid phosphatase 1-like                 209   3e-61    
gb|EEE62606.1|  hypothetical protein OsJ_17409                          209   3e-61    Oryza sativa Japonica Group [Japonica rice]
gb|KDP40845.1|  hypothetical protein JCGZ_24844                         209   3e-61    
ref|XP_004964488.1|  PREDICTED: acid phosphatase 1-like isoform X1      212   4e-61    
ref|XP_009127318.1|  PREDICTED: acid phosphatase 1                      209   4e-61    
ref|XP_008798586.1|  PREDICTED: acid phosphatase 1-like                 208   5e-61    
emb|CDP03233.1|  unnamed protein product                                209   5e-61    
ref|XP_008387412.1|  PREDICTED: acid phosphatase 1-like                 208   5e-61    
ref|XP_006284235.1|  hypothetical protein CARUB_v10005397mg             209   7e-61    
ref|XP_009137842.1|  PREDICTED: acid phosphatase 1                      208   7e-61    
ref|XP_010438316.1|  PREDICTED: acid phosphatase 1-like                 208   8e-61    
emb|CDY47773.1|  BnaC07g41870D                                          207   1e-60    
ref|XP_010541530.1|  PREDICTED: vegetative storage protein 2-like       207   1e-60    
ref|NP_001238459.1|  stem 28 kDa glycoprotein precursor                 207   1e-60    
emb|CDY03376.1|  BnaC01g17060D                                          207   1e-60    
ref|XP_004964489.1|  PREDICTED: acid phosphatase 1-like isoform X2      211   1e-60    
emb|CDY34346.1|  BnaA01g14490D                                          207   2e-60    
ref|XP_009138920.1|  PREDICTED: acid phosphatase 1                      207   2e-60    
ref|NP_194656.1|  HAD superfamily, subfamily IIIB acid phosphatase      207   2e-60    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010249468.1|  PREDICTED: acid phosphatase 1-like                 207   2e-60    
ref|XP_009352576.1|  PREDICTED: acid phosphatase 1                      206   4e-60    
gb|ADE76411.1|  unknown                                                 206   4e-60    
ref|XP_002867418.1|  predicted protein                                  206   4e-60    
ref|XP_006413336.1|  hypothetical protein EUTSA_v10026026mg             206   5e-60    
ref|XP_008367917.1|  PREDICTED: acid phosphatase 1-like                 206   5e-60    
ref|XP_010258707.1|  PREDICTED: acid phosphatase 1-like                 207   6e-60    
dbj|BAJ97988.1|  predicted protein                                      206   8e-60    
ref|XP_007202474.1|  hypothetical protein PRUPE_ppa010268mg             205   1e-59    
ref|XP_010448471.1|  PREDICTED: acid phosphatase 1-like                 205   1e-59    
ref|XP_009109048.1|  PREDICTED: acid phosphatase 1-like isoform X2      205   1e-59    
ref|XP_010925513.1|  PREDICTED: acid phosphatase 1-like isoform X1      204   1e-59    
ref|XP_008242463.1|  PREDICTED: acid phosphatase 1                      204   1e-59    
gb|ACU23829.1|  unknown                                                 204   2e-59    Glycine max [soybeans]
ref|XP_007012979.1|  HAD superfamily isoform 2                          204   2e-59    
gb|ABL85037.1|  acid phosphatase                                        204   2e-59    Brachypodium sylvaticum
ref|XP_006412859.1|  hypothetical protein EUTSA_v10026000mg             204   3e-59    
ref|XP_004158153.1|  PREDICTED: acid phosphatase 1-like                 204   3e-59    
gb|EMT19714.1|  Acid phosphatase 1                                      206   3e-59    
ref|XP_010925515.1|  PREDICTED: acid phosphatase 1-like isoform X2      203   4e-59    
prf||1609232A  31kD glycoprotein                                        203   5e-59 
ref|XP_007012978.1|  HAD superfamily isoform 1                          205   6e-59    
ref|XP_002867419.1|  acid phosphatase class B family protein            202   7e-59    
gb|KFK29483.1|  hypothetical protein AALP_AA7G140100                    202   7e-59    
gb|ABK92831.1|  unknown                                                 202   8e-59    Populus trichocarpa [western balsam poplar]
ref|XP_002309231.2|  hypothetical protein POPTR_0006s15760g             202   8e-59    Populus trichocarpa [western balsam poplar]
ref|XP_010548683.1|  PREDICTED: acid phosphatase 1-like                 202   1e-58    
ref|XP_002514195.1|  Acid phosphatase 1 precursor, putative             202   1e-58    Ricinus communis
gb|KHN33255.1|  Stem 31 kDa glycoprotein                                201   2e-58    
ref|XP_010047662.1|  PREDICTED: acid phosphatase 1-like                 202   2e-58    
ref|XP_006465709.1|  PREDICTED: acid phosphatase 1-like                 202   2e-58    
gb|EMT02058.1|  Stem 28 kDa glycoprotein                                199   2e-58    
emb|CDY14217.1|  BnaA08g13480D                                          201   3e-58    
ref|NP_194655.1|  HAD superfamily, subfamily IIIB acid phosphatase      201   3e-58    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011078233.1|  PREDICTED: acid phosphatase 1-like                 201   4e-58    
dbj|BAA19152.1|  pod storage protein                                    201   4e-58    Phaseolus vulgaris [French bean]
ref|XP_006426854.1|  hypothetical protein CICLE_v10027612mg             201   5e-58    
ref|XP_003529064.1|  PREDICTED: acid phosphatase 1-like                 200   5e-58    
ref|XP_009109046.1|  PREDICTED: acid phosphatase 1-like isoform X1      200   7e-58    
ref|XP_007135621.1|  hypothetical protein PHAVU_010G144300g             199   1e-57    
gb|ACU24345.1|  unknown                                                 199   1e-57    Glycine max [soybeans]
ref|NP_001241536.1|  stem 31 kDa glycoprotein precursor                 199   1e-57    
ref|XP_010541004.1|  PREDICTED: acid phosphatase 1                      199   1e-57    
ref|XP_010438317.1|  PREDICTED: acid phosphatase 1-like                 199   2e-57    
ref|XP_009388590.1|  PREDICTED: acid phosphatase 1-like                 199   2e-57    
ref|XP_010447874.1|  PREDICTED: acid phosphatase 1-like                 199   2e-57    
emb|CDY05398.1|  BnaC02g41060D                                          199   3e-57    
gb|AFK41939.1|  unknown                                                 196   3e-57    
ref|XP_006284398.1|  hypothetical protein CARUB_v10005568mg             198   3e-57    
emb|CDY62035.1|  BnaC03g77680D                                          198   4e-57    
emb|CDY14216.1|  BnaA08g13470D                                          198   5e-57    
sp|P10742.2|S25K_SOYBN  RecName: Full=Stem 31 kDa glycoprotein; A...    199   5e-57    Glycine max [soybeans]
ref|XP_006429635.1|  hypothetical protein CICLE_v10012544mg             198   5e-57    
gb|AHA84282.1|  pod storage protein                                     198   5e-57    
gb|ADE77538.1|  unknown                                                 198   6e-57    
gb|ACU23890.1|  unknown                                                 195   6e-57    
ref|XP_009128910.1|  PREDICTED: acid phosphatase 1                      197   8e-57    
gb|KDO64169.1|  hypothetical protein CISIN_1g025360mg                   197   9e-57    
ref|XP_009109045.1|  PREDICTED: acid phosphatase 1-like                 197   2e-56    
gb|KFK39517.1|  hypothetical protein AALP_AA3G254300                    197   2e-56    
ref|XP_011007264.1|  PREDICTED: acid phosphatase 1                      196   2e-56    
ref|XP_004141163.1|  PREDICTED: acid phosphatase 1-like                 196   2e-56    
ref|XP_009130001.1|  PREDICTED: vegetative storage protein 2-like       196   2e-56    
ref|XP_010914845.1|  PREDICTED: acid phosphatase 1-like                 196   3e-56    
ref|XP_010447870.1|  PREDICTED: acid phosphatase 1-like                 196   3e-56    
ref|XP_010433115.1|  PREDICTED: acid phosphatase 1-like                 195   5e-56    
gb|AAS07026.1|  vegetative storage protein                              195   6e-56    
ref|XP_009415369.1|  PREDICTED: acid phosphatase 1-like                 195   6e-56    
ref|XP_006412858.1|  hypothetical protein EUTSA_v10025999mg             195   7e-56    
gb|AFX67034.1|  stem 28 kDa glycoprotein                                190   1e-55    
ref|XP_002867417.1|  predicted protein                                  194   2e-55    
ref|XP_008799767.1|  PREDICTED: acid phosphatase 1-like                 194   2e-55    
emb|CDY48606.1|  BnaA01g07590D                                          194   3e-55    
ref|XP_009419864.1|  PREDICTED: acid phosphatase 1-like                 192   3e-55    
ref|XP_010688365.1|  PREDICTED: acid phosphatase 1-like                 193   3e-55    
ref|XP_009773908.1|  PREDICTED: acid phosphatase 1-like                 193   3e-55    
gb|EYU30686.1|  hypothetical protein MIMGU_mgv1a011950mg                193   3e-55    
ref|XP_008388379.1|  PREDICTED: acid phosphatase 1-like                 193   5e-55    
gb|KDP33773.1|  hypothetical protein JCGZ_07344                         192   6e-55    
ref|XP_009602496.1|  PREDICTED: acid phosphatase 1-like isoform X2      192   6e-55    
ref|XP_009337802.1|  PREDICTED: acid phosphatase 1-like                 192   9e-55    
ref|XP_006285610.1|  hypothetical protein CARUB_v10007060mg             191   9e-55    
ref|XP_011001652.1|  PREDICTED: acid phosphatase 1-like                 192   1e-54    
ref|XP_009602493.1|  PREDICTED: acid phosphatase 1-like isoform X1      192   2e-54    
gb|AGV54742.1|  pod storage protein                                     191   2e-54    
emb|CAN82026.1|  hypothetical protein VITISV_000611                     190   2e-54    
ref|XP_006288447.1|  hypothetical protein CARUB_v10001708mg             191   2e-54    
ref|XP_008244569.1|  PREDICTED: acid phosphatase 1                      191   3e-54    
ref|XP_010421320.1|  PREDICTED: vegetative storage protein 2-like       191   3e-54    
ref|XP_004302520.1|  PREDICTED: acid phosphatase 1-like                 191   3e-54    
ref|XP_010454803.1|  PREDICTED: vegetative storage protein 2            191   5e-54    
ref|XP_011095174.1|  PREDICTED: acid phosphatase 1                      190   5e-54    
ref|XP_010043667.1|  PREDICTED: acid phosphatase 1-like isoform X2      190   5e-54    
gb|KCW88400.1|  hypothetical protein EUGRSUZ_A00788                     190   5e-54    
ref|XP_010043658.1|  PREDICTED: acid phosphatase 1-like isoform X1      190   1e-53    
ref|XP_008459051.1|  PREDICTED: acid phosphatase 1-like                 189   1e-53    
ref|XP_006654131.1|  PREDICTED: acid phosphatase 1-like                 189   1e-53    
ref|XP_008370281.1|  PREDICTED: acid phosphatase 1                      189   1e-53    
ref|XP_006654132.1|  PREDICTED: stem 28 kDa glycoprotein-like           189   1e-53    
ref|XP_002323092.1|  hypothetical protein POPTR_0016s14650g             189   1e-53    
ref|XP_010493724.1|  PREDICTED: vegetative storage protein 2-like       189   2e-53    
ref|XP_010505497.1|  PREDICTED: acid phosphatase 1-like                 188   2e-53    
ref|XP_008459056.1|  PREDICTED: acid phosphatase 1-like                 188   2e-53    
gb|EPS70753.1|  hypothetical protein M569_04009                         187   2e-53    
ref|XP_008363936.1|  PREDICTED: acid phosphatase 1-like                 188   2e-53    
gb|AAS07027.1|  vegetative storage protein                              188   3e-53    
gb|KFK27743.1|  hypothetical protein AALP_AA8G423400                    188   3e-53    
ref|XP_004141030.1|  PREDICTED: acid phosphatase 1-like                 188   3e-53    
ref|XP_008355740.1|  PREDICTED: acid phosphatase 1-like                 188   3e-53    
gb|KDP21846.1|  hypothetical protein JCGZ_00633                         188   3e-53    
ref|XP_006341307.1|  PREDICTED: acid phosphatase 1-like                 188   3e-53    
ref|XP_010244565.1|  PREDICTED: acid phosphatase 1                      188   3e-53    
ref|XP_006354440.1|  PREDICTED: acid phosphatase 1-like                 187   4e-53    
emb|CDO98048.1|  unnamed protein product                                186   4e-53    
ref|XP_009370888.1|  PREDICTED: acid phosphatase 1-like                 187   4e-53    
ref|XP_010043653.1|  PREDICTED: acid phosphatase 1-like                 188   4e-53    
ref|XP_010653128.1|  PREDICTED: acid phosphatase 1 isoform X2           187   4e-53    
ref|XP_004247765.1|  PREDICTED: acid phosphatase 1-like                 187   5e-53    
ref|XP_010517161.1|  PREDICTED: acid phosphatase 1-like                 187   5e-53    
ref|XP_010509146.1|  PREDICTED: acid phosphatase 1-like                 187   5e-53    
gb|ABK22580.1|  unknown                                                 188   8e-53    
ref|XP_010653127.1|  PREDICTED: acid phosphatase 1 isoform X1           187   9e-53    
ref|XP_010438315.1|  PREDICTED: acid phosphatase 1-like                 187   9e-53    
ref|NP_001054851.1|  Os05g0192100                                       185   1e-52    
ref|XP_007206281.1|  hypothetical protein PRUPE_ppa016173mg             186   1e-52    
ref|XP_009614482.1|  PREDICTED: acid phosphatase 1                      186   2e-52    
emb|CBI27978.3|  unnamed protein product                                183   3e-52    
ref|NP_568455.1|  acid phosphatase VSP1                                 186   3e-52    
gb|AAB97863.1|  putative vegetative storage protein                     186   3e-52    
gb|ABK27105.1|  unknown                                                 186   3e-52    
gb|ACN40193.1|  unknown                                                 186   3e-52    
gb|KCW88403.1|  hypothetical protein EUGRSUZ_A00791                     185   4e-52    
ref|XP_010468739.1|  PREDICTED: vegetative storage protein 1-like       189   4e-52    
ref|XP_010433111.1|  PREDICTED: acid phosphatase 1-like                 185   5e-52    
ref|XP_010043643.1|  PREDICTED: acid phosphatase 1-like isoform X2      185   5e-52    
gb|KEH18204.1|  plant acid phosphatase                                  184   6e-52    
ref|XP_010043635.1|  PREDICTED: acid phosphatase 1-like isoform X1      186   6e-52    
ref|NP_001054848.1|  Os05g0190500                                       185   7e-52    
ref|XP_010683443.1|  PREDICTED: acid phosphatase 1                      185   7e-52    
ref|XP_004516313.1|  PREDICTED: acid phosphatase 1-like                 184   9e-52    
ref|XP_002531803.1|  Acid phosphatase 1 precursor, putative             184   1e-51    
ref|XP_010043623.1|  PREDICTED: acid phosphatase 1-like isoform X2      184   2e-51    
ref|XP_002879756.1|  acid phosphatase class B family protein            183   2e-51    
gb|EYU42050.1|  hypothetical protein MIMGU_mgv1a013101mg                182   2e-51    
ref|XP_009415619.1|  PREDICTED: acid phosphatase 1-like                 183   2e-51    
pdb|4FYP|A  Chain A, Crystal Structure Of Plant Vegetative Storag...    183   2e-51    
gb|EMS46716.1|  Stem 28 kDa glycoprotein                                182   2e-51    
ref|XP_002967517.1|  hypothetical protein SELMODRAFT_144839             185   2e-51    
ref|XP_002979963.1|  hypothetical protein SELMODRAFT_111877             183   2e-51    
ref|XP_010043614.1|  PREDICTED: acid phosphatase 1-like isoform X1      184   2e-51    
ref|XP_009143372.1|  PREDICTED: acid phosphatase 1-like                 182   4e-51    
emb|CAA56036.1|  vegetative storage product                             183   4e-51    
dbj|BAA22096.1|  vegetative storage protein                             182   5e-51    
ref|XP_010548682.1|  PREDICTED: acid phosphatase 1-like                 182   5e-51    
emb|CDO99288.1|  unnamed protein product                                182   5e-51    
emb|CDY60756.1|  BnaA05g34800D                                          182   6e-51    
ref|XP_004157899.1|  PREDICTED: acid phosphatase 1-like                 182   6e-51    
ref|XP_004141031.1|  PREDICTED: acid phosphatase 1-like                 182   6e-51    
ref|XP_008463285.1|  PREDICTED: acid phosphatase 1                      182   6e-51    
gb|EAY82942.1|  hypothetical protein OsI_38160                          182   6e-51    
ref|NP_001174256.1|  Os05g0190300                                       181   7e-51    
ref|XP_011024457.1|  PREDICTED: acid phosphatase 1                      182   7e-51    
ref|XP_002301854.1|  hypothetical protein POPTR_0002s25950g             182   8e-51    
ref|XP_009783330.1|  PREDICTED: acid phosphatase 1 isoform X2           181   8e-51    
ref|XP_010482978.1|  PREDICTED: acid phosphatase 1-like                 182   9e-51    
gb|AAM61582.1|  vegetative storage protein Vsp2                         182   1e-50    
ref|NP_568454.1|  acid phosphatase VSP2                                 182   1e-50    
ref|XP_002960188.1|  hypothetical protein SELMODRAFT_139413             183   1e-50    
ref|XP_010921196.1|  PREDICTED: acid phosphatase 1                      182   1e-50    
ref|XP_010227605.1|  PREDICTED: acid phosphatase 1-like isoform X2      181   1e-50    
ref|XP_002874222.1|  vegetative storage protein Vsp2                    181   1e-50    
ref|XP_011080101.1|  PREDICTED: acid phosphatase 1-like                 181   1e-50    
ref|XP_009783329.1|  PREDICTED: acid phosphatase 1 isoform X1           182   1e-50    
ref|XP_001768840.1|  predicted protein                                  179   2e-50    
emb|CAC84485.1|  putative acid phosphatase                              179   2e-50    
gb|KGN54464.1|  Acid phosphatase 1                                      181   2e-50    
emb|CDX91480.1|  BnaC04g06700D                                          181   2e-50    
emb|CDY36966.1|  BnaC09g17820D                                          181   2e-50    
gb|AFW82018.1|  Stem glycoprotein                                       179   2e-50    
ref|NP_181394.1|  HAD superfamily, subfamily IIIB acid phosphatase      181   2e-50    
ref|XP_004142728.1|  PREDICTED: acid phosphatase 1-like                 180   2e-50    
ref|XP_006842584.1|  hypothetical protein AMTR_s00077p00160000          180   2e-50    
ref|XP_011091248.1|  PREDICTED: acid phosphatase 1-like                 181   2e-50    
gb|KEH42677.1|  plant acid phosphatase                                  180   2e-50    
ref|NP_001042269.1|  Os01g0191200                                       182   3e-50    
ref|XP_006857494.1|  hypothetical protein AMTR_s00067p00205850          180   4e-50    
ref|XP_004984487.1|  PREDICTED: acid phosphatase 1-like isoform X1      180   4e-50    
ref|XP_009113955.1|  PREDICTED: acid phosphatase 1-like                 180   4e-50    
ref|XP_007134577.1|  hypothetical protein PHAVU_010G058800g             180   4e-50    
ref|XP_007033479.1|  Acid phosphatase 1, putative isoform 1             179   5e-50    
ref|XP_007033481.1|  Acid phosphatase 1, putative isoform 3             180   5e-50    
ref|XP_006304095.1|  hypothetical protein CARUB_v10010000mg             180   6e-50    
ref|XP_006599745.1|  PREDICTED: acid phosphatase 1-like                 179   7e-50    
gb|KHG06095.1|  Acid phosphatase 1                                      179   7e-50    
ref|XP_010542903.1|  PREDICTED: acid phosphatase 1-like                 179   9e-50    
ref|NP_001237136.1|  syringolide-induced protein B15-3-5                178   1e-49    
gb|EAY72856.1|  hypothetical protein OsI_00725                          180   1e-49    
ref|XP_009133272.1|  PREDICTED: acid phosphatase 1                      179   1e-49    
ref|XP_006645592.1|  PREDICTED: stem 28 kDa glycoprotein-like           180   1e-49    
ref|XP_006418175.1|  hypothetical protein EUTSA_v10008462mg             179   1e-49    
ref|XP_008224179.1|  PREDICTED: acid phosphatase 1-like                 179   1e-49    
emb|CDY22316.1|  BnaA06g36380D                                          179   2e-49    
gb|AFK47047.1|  unknown                                                 178   2e-49    
ref|XP_006296330.1|  hypothetical protein CARUB_v10025510mg             178   2e-49    
ref|XP_006411076.1|  hypothetical protein EUTSA_v10017121mg             178   2e-49    
emb|CDY14447.1|  BnaC03g21480D                                          178   2e-49    
ref|XP_007226669.1|  hypothetical protein PRUPE_ppa021353mg             177   2e-49    
gb|EYU30687.1|  hypothetical protein MIMGU_mgv1a011950mg                177   2e-49    
ref|XP_008796365.1|  PREDICTED: acid phosphatase 1                      178   3e-49    
emb|CDO99292.1|  unnamed protein product                                177   3e-49    
ref|NP_199215.1|  HAD superfamily, subfamily IIIB acid phosphatase      178   3e-49    
ref|XP_006288459.1|  hypothetical protein CARUB_v10001720mg             178   3e-49    
ref|XP_009101743.1|  PREDICTED: acid phosphatase 1                      178   3e-49    
ref|XP_010098158.1|  Acid phosphatase 1                                 176   4e-49    
gb|KHN24563.1|  Acid phosphatase 1                                      177   4e-49    
ref|XP_003521996.1|  PREDICTED: acid phosphatase 1-like isoform X1      177   5e-49    
emb|CDX94751.1|  BnaC07g17600D                                          177   5e-49    
gb|KFK31670.1|  hypothetical protein AALP_AA6G143700                    177   5e-49    
dbj|BAD53728.1|  putative Acid phosphatase precursor 1                  177   7e-49    
gb|EAZ01337.1|  hypothetical protein OsI_23372                          177   7e-49    
gb|ACU23922.1|  unknown                                                 176   7e-49    
ref|XP_003548333.1|  PREDICTED: acid phosphatase 1-like                 177   8e-49    
ref|XP_010457427.1|  PREDICTED: acid phosphatase 1-like                 177   8e-49    
gb|KHN42129.1|  Acid phosphatase 1                                      177   8e-49    
ref|NP_001054847.1|  Os05g0189900                                       176   9e-49    
gb|KDP26481.1|  hypothetical protein JCGZ_17639                         176   1e-48    
gb|EMS54945.1|  Acid phosphatase 1                                      174   1e-48    
gb|KHN39261.1|  Stem 28 kDa glycoprotein                                175   1e-48    
ref|XP_009118876.1|  PREDICTED: acid phosphatase 1                      176   2e-48    
ref|XP_010475042.1|  PREDICTED: acid phosphatase 1-like                 176   2e-48    
gb|AAM63804.1|  vegetative storage protein-like                         176   2e-48    
gb|KFK42749.1|  hypothetical protein AALP_AA1G034500                    176   2e-48    
ref|XP_010936027.1|  PREDICTED: acid phosphatase 1 isoform X2           175   3e-48    
ref|NP_563698.1|  HAD superfamily, subfamily IIIB acid phosphatase      175   3e-48    
ref|XP_008235609.1|  PREDICTED: acid phosphatase 1-like isoform X2      175   3e-48    
ref|XP_010553191.1|  PREDICTED: acid phosphatase 1                      174   3e-48    
ref|XP_002865388.1|  hypothetical protein ARALYDRAFT_917224             175   3e-48    
ref|XP_003555748.1|  PREDICTED: acid phosphatase 1-like                 175   4e-48    
emb|CDY10082.1|  BnaC08g43690D                                          175   5e-48    
ref|XP_010529940.1|  PREDICTED: acid phosphatase 1-like                 174   5e-48    
gb|EEE62601.1|  hypothetical protein OsJ_17404                          174   5e-48    
ref|NP_001054846.1|  Os05g0189300                                       174   5e-48    
ref|XP_003628249.1|  Acid phosphatase                                   174   7e-48    
ref|XP_004161712.1|  PREDICTED: acid phosphatase 1-like                 179   8e-48    
dbj|BAA22095.1|  vegetative storage protein                             174   9e-48    
ref|XP_003559787.1|  PREDICTED: acid phosphatase 1-like                 174   1e-47    
ref|XP_003535883.1|  PREDICTED: acid phosphatase 1-like                 173   1e-47    
gb|ACU19317.1|  unknown                                                 173   1e-47    
emb|CDY32525.1|  BnaA09g50710D                                          174   2e-47    
ref|XP_003590156.1|  Stem 28 kDa glycoprotein                           173   2e-47    
ref|XP_010264908.1|  PREDICTED: acid phosphatase 1                      173   2e-47    
ref|XP_004959893.1|  PREDICTED: acid phosphatase 1-like                 173   2e-47    
gb|KHN24673.1|  Acid phosphatase 1                                      172   2e-47    
gb|EAY96836.1|  hypothetical protein OsI_18758                          172   2e-47    
gb|KHN24883.1|  Acid phosphatase 1                                      172   2e-47    
ref|XP_002438575.1|  hypothetical protein SORBIDRAFT_10g022110          173   2e-47    
ref|NP_001242155.1|  uncharacterized protein LOC100802885 precursor     172   2e-47    
ref|XP_006443754.1|  hypothetical protein CICLE_v10021795mg             172   2e-47    
gb|KHG02415.1|  Acid phosphatase 1                                      172   3e-47    
gb|KCW60246.1|  hypothetical protein EUGRSUZ_H02960                     172   4e-47    
ref|XP_002892194.1|  acid phosphatase class B family protein            172   4e-47    
ref|XP_003521307.1|  PREDICTED: acid phosphatase 1-like                 172   4e-47    
ref|XP_010936026.1|  PREDICTED: acid phosphatase 1 isoform X1           172   4e-47    
ref|XP_009123928.1|  PREDICTED: acid phosphatase 1-like                 172   4e-47    
ref|XP_004134400.1|  PREDICTED: acid phosphatase 1-like                 171   5e-47    
emb|CDY06827.1|  BnaC01g09260D                                          172   5e-47    
ref|XP_002308264.1|  hypothetical protein POPTR_0006s11150g             170   6e-47    
ref|XP_008438471.1|  PREDICTED: acid phosphatase 1-like                 171   8e-47    
ref|XP_004960897.1|  PREDICTED: stem 31 kDa glycoprotein-like iso...    173   8e-47    
ref|XP_004510091.1|  PREDICTED: acid phosphatase 1-like isoform X1      172   8e-47    
gb|AGV54508.1|  defense associated acid phosphatase                     171   1e-46    
dbj|BAJ94494.1|  predicted protein                                      171   1e-46    
ref|XP_010023858.1|  PREDICTED: acid phosphatase 1-like isoform X1      171   1e-46    
gb|AAL17638.1|  putative defense associated acid phosphatase            171   1e-46    
ref|XP_009357986.1|  PREDICTED: acid phosphatase 1-like                 172   1e-46    
ref|NP_001130101.1|  acid phosphatase 1 precursor                       171   2e-46    



>ref|XP_009625321.1| PREDICTED: acid phosphatase 1-like [Nicotiana tomentosiformis]
Length=257

 Score =   387 bits (993),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 178/258 (69%), Positives = 205/258 (79%), Gaps = 2/258 (1%)
 Frame = +2

Query  92   MRAFLLVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRD  271
            MRAF     LL ++   +   SIPNQIH LRP     G H+P +NCLSWRL VE NNI++
Sbjct  1    MRAFFFF--LLISMAAVAAKASIPNQIHPLRPTAGSAGRHVPQINCLSWRLAVETNNIQN  58

Query  272  WAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSN  451
            W +VP QCE YVGHYMLG QYRDDC AV ++A+QYAK   +A DGKD+WVFDI+ETTLSN
Sbjct  59   WKLVPLQCESYVGHYMLGKQYRDDCNAVIVAAIQYAKTLKIAKDGKDVWVFDIDETTLSN  118

Query  452  LPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQF  631
            LPYYARSDVAFGAT +N TKFD W  EG APAVPG + LYRTL+++GIKPVF++GTK++F
Sbjct  119  LPYYARSDVAFGATKFNGTKFDEWTREGKAPAVPGALFLYRTLLAMGIKPVFITGTKEEF  178

Query  632  RKVRIANLKKTGYSHWEKLILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLL  811
            R+VRIANLKK GY  W KLILKG NDT ++V YKS KR ELVK GYRI+GNIGDQWSDLL
Sbjct  179  RQVRIANLKKVGYHSWVKLILKGVNDTGSSVMYKSGKRAELVKAGYRIVGNIGDQWSDLL  238

Query  812  GDNAGARTFKLPDPMYYI  865
            GD  G RTFKLPDPMYYI
Sbjct  239  GDFVGDRTFKLPDPMYYI  256



>ref|XP_009795136.1| PREDICTED: acid phosphatase 1-like [Nicotiana sylvestris]
Length=261

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 181/261 (69%), Positives = 208/261 (80%), Gaps = 2/261 (1%)
 Frame = +2

Query  92   MRA--FLLVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNI  265
            MRA  F L++ + A     SHA SIPNQIH LRP     G H+P +NCLSWRL VE NNI
Sbjct  1    MRAIFFFLLISMAAATAKASHAQSIPNQIHPLRPTAGSAGRHVPQINCLSWRLAVETNNI  60

Query  266  RDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTL  445
            ++W +VP QCE YVGHYMLG QYRDDC AV ++A+QYAK   +A DGKD+WVFDI+ETTL
Sbjct  61   QNWKLVPLQCESYVGHYMLGKQYRDDCNAVVVAAIQYAKTLKIAKDGKDVWVFDIDETTL  120

Query  446  SNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQ  625
            SNLPYYARSDVAFGAT +N TKFD W  EG APAVPG + LYRTL+++GIKPVF++GTK+
Sbjct  121  SNLPYYARSDVAFGATKFNGTKFDGWTREGKAPAVPGALFLYRTLLAMGIKPVFITGTKE  180

Query  626  QFRKVRIANLKKTGYSHWEKLILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSD  805
            +FR+VRIANLKK GY  W KLILKG NDT ++V YKS KR ELVK GYRI+GNIGDQWSD
Sbjct  181  EFRQVRIANLKKVGYHSWVKLILKGVNDTGSSVMYKSGKRAELVKAGYRIVGNIGDQWSD  240

Query  806  LLGDNAGARTFKLPDPMYYIA  868
            LLGD  G RTFKLPDPMYYI 
Sbjct  241  LLGDFVGDRTFKLPDPMYYIG  261



>emb|CDO97963.1| unnamed protein product [Coffea canephora]
Length=278

 Score =   370 bits (949),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 171/249 (69%), Positives = 202/249 (81%), Gaps = 0/249 (0%)
 Frame = +2

Query  119  LLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCE  298
            LL      SHA+ I + IH LRP +   GH++P +NCLSWRL VE  N+R+W +VP+ CE
Sbjct  29   LLTDDDQTSHAECITSPIHLLRPKSGAAGHNVPQINCLSWRLAVETYNLRNWKLVPESCE  88

Query  299  EYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDV  478
             YVGHYMLG QYR+DC AVA  A+ YAKN TLA DGK+IWVFDI+ET+LSN PYYARSDV
Sbjct  89   NYVGHYMLGKQYREDCDAVADIAIAYAKNLTLAGDGKEIWVFDIDETSLSNAPYYARSDV  148

Query  479  AFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLK  658
             FGA  YN TKF+AWV+EG APAVPG +RLY+TL+SLGIKPVF+SGTK+ +R+VRI+NLK
Sbjct  149  QFGAIPYNDTKFNAWVAEGAAPAVPGVLRLYKTLLSLGIKPVFISGTKEVYREVRISNLK  208

Query  659  KTGYSHWEKLILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTF  838
              GY +WEKLILKG NDT +AV YKS KRTELV+ GYRI+GNIGDQWSDLLG N G RTF
Sbjct  209  NVGYRNWEKLILKGENDTGSAVVYKSNKRTELVEAGYRIVGNIGDQWSDLLGTNVGDRTF  268

Query  839  KLPDPMYYI  865
            K+PDPMY+I
Sbjct  269  KVPDPMYFI  277



>ref|XP_009776612.1| PREDICTED: acid phosphatase 1-like [Nicotiana sylvestris]
Length=266

 Score =   368 bits (944),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 163/264 (62%), Positives = 211/264 (80%), Gaps = 2/264 (1%)
 Frame = +2

Query  80   RKLTMRAFLLVVVLLATIPTFSHADSIPN--QIHSLRPHTAGGGHHIPGVNCLSWRLGVE  253
            R   +  F+  +V +    TF++ + I    +IH LRP T   G+ +P ++CLSWRL VE
Sbjct  2    RSFALLFFISTIVAVTVASTFNNVEVISQVVEIHRLRPQTGSAGYRVPQLDCLSWRLAVE  61

Query  254  ANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIE  433
             NN+++W +VP  CE Y+GHYMLG QYR DC AVA +A++YAK+  L+ DGKD+WVFDI+
Sbjct  62   TNNLQNWKLVPISCENYIGHYMLGKQYRHDCEAVANAAIEYAKSLKLSGDGKDVWVFDID  121

Query  434  ETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLS  613
            ETTLSNLPYYARSDVAFGA  +N+TKF+AWV+EG APA+P  + +Y+T++SLGIKPVF++
Sbjct  122  ETTLSNLPYYARSDVAFGAIPFNSTKFNAWVAEGKAPAIPSILGVYKTVLSLGIKPVFIT  181

Query  614  GTKQQFRKVRIANLKKTGYSHWEKLILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIGD  793
            GT++ F++VRI NLKK GYS+W KL+LKG ND+ TAVE+KS KRTELVK GYRI+GNIGD
Sbjct  182  GTRESFKQVRITNLKKAGYSNWAKLVLKGDNDSGTAVEFKSSKRTELVKAGYRIVGNIGD  241

Query  794  QWSDLLGDNAGARTFKLPDPMYYI  865
            QWSD+LGDN G+RTFK+PDPMYYI
Sbjct  242  QWSDILGDNVGSRTFKVPDPMYYI  265



>ref|XP_004235637.1| PREDICTED: acid phosphatase 1-like [Solanum lycopersicum]
Length=255

 Score =   367 bits (941),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 167/241 (69%), Positives = 190/241 (79%), Gaps = 0/241 (0%)
 Frame = +2

Query  146  HADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLG  325
            HADSIP QIH L P T   G  +P +NCLSWRL VE NNI+DW  VP QCE+YVGHYMLG
Sbjct  15   HADSIPKQIHPLHPKTGSSGSQVPQINCLSWRLAVETNNIQDWTSVPLQCEDYVGHYMLG  74

Query  326  HQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNA  505
             QYRDDC  V  +A+QYAK   +  +GKDIWVFDI+ETTLSNLPYYARSDVAFG+  YN 
Sbjct  75   KQYRDDCYNVVAAAIQYAKTIKIGKNGKDIWVFDIDETTLSNLPYYARSDVAFGSIKYNG  134

Query  506  TKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEK  685
            TKFD W  EG AP VP  + LY TL+S+GIKPVF+SGTK++FR++RI NL K GY  W +
Sbjct  135  TKFDEWTREGKAPPVPAALFLYNTLLSMGIKPVFISGTKEEFRQIRITNLNKVGYHSWIR  194

Query  686  LILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            LILKG NDT ++V+YKS KR ELVK GYRI+GNIGDQWSDLLGD  G RTFKLPDPMYYI
Sbjct  195  LILKGVNDTGSSVKYKSGKRGELVKDGYRIVGNIGDQWSDLLGDYVGQRTFKLPDPMYYI  254

Query  866  A  868
            A
Sbjct  255  A  255



>ref|XP_009787591.1| PREDICTED: acid phosphatase 1-like [Nicotiana sylvestris]
Length=268

 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 165/258 (64%), Positives = 204/258 (79%), Gaps = 3/258 (1%)
 Frame = +2

Query  101  FLLVVVLLATIPTFSHADSIPNQ---IHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRD  271
            F L  ++  T+ + SH     +Q   IH LR  T   G+ +P ++CLSWRL VE NN+++
Sbjct  10   FFLSTIVAVTVASTSHNVEFTSQVVEIHCLRLQTGAAGYRVPQLDCLSWRLAVETNNLQN  69

Query  272  WAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSN  451
            W +VP  CE Y+GHY+LG QYR DC AVA +A++YAK+  L  DGKD+WVFDI+ETTLSN
Sbjct  70   WKLVPSACENYIGHYILGKQYRHDCEAVANAAIEYAKSVKLGGDGKDVWVFDIDETTLSN  129

Query  452  LPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQF  631
            LPYYARSDVAFGA  YN TKF+AWV+EG APA+P  + +Y+T++SLGIK VF++GT++ F
Sbjct  130  LPYYARSDVAFGAIPYNNTKFNAWVAEGKAPAIPSILGVYKTVLSLGIKTVFITGTRESF  189

Query  632  RKVRIANLKKTGYSHWEKLILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLL  811
            RKVRI NLKK GY++W KLILKG NDTR+AVEYKS KR ELVK GYRIIGNIGDQWSDL+
Sbjct  190  RKVRITNLKKAGYTNWAKLILKGENDTRSAVEYKSSKRRELVKAGYRIIGNIGDQWSDLI  249

Query  812  GDNAGARTFKLPDPMYYI  865
            GDN GARTFK+PDP+YYI
Sbjct  250  GDNLGARTFKVPDPLYYI  267



>ref|XP_009622654.1| PREDICTED: acid phosphatase 1-like [Nicotiana tomentosiformis]
Length=267

 Score =   360 bits (925),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 166/267 (62%), Positives = 209/267 (78%), Gaps = 10/267 (4%)
 Frame = +2

Query  92   MRAFLLVVVLLATIPTFSHADSIPN---------QIHSLRPHTAGGGHHIPGVNCLSWRL  244
            MR F L+  L++TI   +   S  N         +IH LRP T   G+ +P ++CLSWRL
Sbjct  1    MRCFPLLF-LISTIVAVTAVASTSNNVEVISQVVEIHRLRPQTGSAGYRVPQLDCLSWRL  59

Query  245  GVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVF  424
             VE NN+++W +VP  CE Y+GHY+LG QYR DC AVA +A++YAK+  L  DGKD+WVF
Sbjct  60   AVETNNLQNWKLVPSACENYIGHYILGKQYRHDCEAVANAAIEYAKSLKLGGDGKDVWVF  119

Query  425  DIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPV  604
            DI+ETTLSNLPYYARSDVAFGA  YN TKF+AWV+EG APA+P  + +Y+T++SLGIKPV
Sbjct  120  DIDETTLSNLPYYARSDVAFGAIPYNNTKFNAWVAEGKAPAIPSILGVYKTVLSLGIKPV  179

Query  605  FLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDTRTAVEYKSKKRTELVKKGYRIIGN  784
            F++GT++ F++VRIANLKK GYS+W KL LKG ND+ TAVE+KS KRTELVK GYRI+GN
Sbjct  180  FITGTRESFKQVRIANLKKAGYSNWAKLALKGDNDSATAVEFKSSKRTELVKAGYRIVGN  239

Query  785  IGDQWSDLLGDNAGARTFKLPDPMYYI  865
            IGDQWSDL+G+N G+RTFK+PDPMYYI
Sbjct  240  IGDQWSDLIGENVGSRTFKVPDPMYYI  266



>ref|XP_010322861.1| PREDICTED: acid phosphatase 1-like [Solanum lycopersicum]
Length=266

 Score =   358 bits (918),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 161/266 (61%), Positives = 208/266 (78%), Gaps = 7/266 (3%)
 Frame = +2

Query  92   MRAFLLVVVLLATIPTFSHAD-------SIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGV  250
            MR F +++   + +   S +D       S   +IH LRP T   G+ +P ++CLSWRL V
Sbjct  1    MRCFTILLFFSSIVAVGSASDVEDEGMISQVVEIHRLRPQTGSAGYTVPQLDCLSWRLAV  60

Query  251  EANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDI  430
            E NN+++W +VP++CE YVGHYMLG QYR DC  VA  A++YAK   L  DGKD+WVFDI
Sbjct  61   ETNNLQNWRLVPKECENYVGHYMLGKQYRRDCEYVAKQAIEYAKALKLGGDGKDVWVFDI  120

Query  431  EETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFL  610
            +ETTLSNLPYYARSDVAFGA AYN TKF+AW++EG APA+P  + +Y+T++SLGIKPVF+
Sbjct  121  DETTLSNLPYYARSDVAFGAIAYNNTKFNAWIAEGKAPAIPSILGVYKTVLSLGIKPVFI  180

Query  611  SGTKQQFRKVRIANLKKTGYSHWEKLILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIG  790
            +GT++ F++VRI NLKK GYS+W  LILKG ND+ +AV++KS KRTELVK GYRI+GNIG
Sbjct  181  TGTRENFKQVRIVNLKKVGYSNWAALILKGENDSGSAVQFKSSKRTELVKAGYRIVGNIG  240

Query  791  DQWSDLLGDNAGARTFKLPDPMYYIA  868
            DQW+DL+G+N GARTFK+PDPMYYI+
Sbjct  241  DQWTDLIGENVGARTFKVPDPMYYIS  266



>ref|XP_006356134.1| PREDICTED: acid phosphatase 1-like [Solanum tuberosum]
Length=264

 Score =   356 bits (913),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 159/263 (60%), Positives = 203/263 (77%), Gaps = 0/263 (0%)
 Frame = +2

Query  80   RKLTMRAFLLVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEAN  259
            R  T+  F   +V++A         S   +IH LRP T   G+ +P ++CLSWRL VE N
Sbjct  2    RCFTILFFFSAIVVVALASNVEEVISQVVEIHRLRPQTGSAGYTVPQLDCLSWRLAVETN  61

Query  260  NIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEET  439
            N+++W +VP++C  YVGHYMLG QYR DC  VA  A++YAK   L  DGKD+WVFDI+ET
Sbjct  62   NLQNWKLVPKECTNYVGHYMLGKQYRRDCEYVAKQAIEYAKTLKLGGDGKDVWVFDIDET  121

Query  440  TLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGT  619
            TLSN PYYARSDVAFGA AYN TKF AW++EG APA+P  + +Y+T++SLGIKPVF++GT
Sbjct  122  TLSNSPYYARSDVAFGAIAYNNTKFSAWLAEGKAPAIPSILGVYKTVLSLGIKPVFITGT  181

Query  620  KQQFRKVRIANLKKTGYSHWEKLILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQW  799
            ++ F++VRI NLKK GYS+W  LILKG ND+ +AV++KS KRTELVK GYRI+GNIGDQW
Sbjct  182  RENFKQVRIVNLKKVGYSNWAALILKGENDSGSAVQFKSSKRTELVKAGYRIVGNIGDQW  241

Query  800  SDLLGDNAGARTFKLPDPMYYIA  868
            +DL+G+N GARTFK+PDPMYYI+
Sbjct  242  TDLIGENVGARTFKVPDPMYYIS  264



>ref|XP_004241953.1| PREDICTED: acid phosphatase 1 [Solanum lycopersicum]
Length=278

 Score =   355 bits (912),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 161/266 (61%), Positives = 206/266 (77%), Gaps = 1/266 (0%)
 Frame = +2

Query  71   IKKRKLTMRAFLLVVVLLATIPTFSHA-DSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLG  247
            +K R  T+  F   +V +A       A  S   +IH LRP T   G+ +P ++CLSWRL 
Sbjct  12   VKMRCFTLLLFFSSIVAVALASNVEEAVISQVVEIHRLRPQTGSAGYTVPQLDCLSWRLA  71

Query  248  VEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFD  427
            +E NN+++W  VP++C  Y+GHYM+G QYR DC  VA  A++YAK+  L+ DGKD+WVFD
Sbjct  72   IETNNLQNWRSVPKECTNYLGHYMMGKQYRHDCEYVAKQAIEYAKSLKLSGDGKDVWVFD  131

Query  428  IEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVF  607
            I+ETTLSN PYYARSDVAFGA  YNATKFDAW++EG APA+P  +++Y T++SLGIKP+F
Sbjct  132  IDETTLSNSPYYARSDVAFGAKPYNATKFDAWIAEGKAPAIPSILKVYNTVLSLGIKPIF  191

Query  608  LSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDTRTAVEYKSKKRTELVKKGYRIIGNI  787
            ++GTKQ F++VRI NLK+ GY++W  LILKGANDT +AV++KS KRT LVK GYRIIGNI
Sbjct  192  ITGTKQNFKQVRIVNLKEAGYANWAALILKGANDTGSAVKFKSSKRTALVKAGYRIIGNI  251

Query  788  GDQWSDLLGDNAGARTFKLPDPMYYI  865
            GDQWSDL+G+N GARTFK+PDPMYYI
Sbjct  252  GDQWSDLIGENVGARTFKVPDPMYYI  277



>ref|XP_004241952.1| PREDICTED: acid phosphatase 1-like [Solanum lycopersicum]
Length=266

 Score =   351 bits (901),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 162/267 (61%), Positives = 202/267 (76%), Gaps = 9/267 (3%)
 Frame = +2

Query  92   MRAFLLVVVLLATIPTFSHADSIPNQ--------IHSLRPHTAGGGHHIPGVNCLSWRLG  247
            MR F  +++  ++I     A  + +Q        IH LRP T   G+ +P ++CLSWRL 
Sbjct  1    MRCFT-IILFFSSIVAVGLASDVEDQGIISQVVEIHRLRPRTGSAGYAVPQLDCLSWRLA  59

Query  248  VEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFD  427
            VE NN+RDW +VP +C  YVGHYMLG QYR DC AVA +A++YAK   L+ DGKD+WVFD
Sbjct  60   VETNNVRDWKLVPNECSNYVGHYMLGKQYRRDCEAVADAAIEYAKGLKLSGDGKDVWVFD  119

Query  428  IEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVF  607
            ++ETTLSNLPYYARSDVAFGA A+N+T+F+AWV EGTAPA+P  +RLY+T++SLGIKPV 
Sbjct  120  VDETTLSNLPYYARSDVAFGAKAFNSTRFNAWVMEGTAPAIPATLRLYKTVLSLGIKPVI  179

Query  608  LSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDTRTAVEYKSKKRTELVKKGYRIIGNI  787
            L+GT +  R+ R+ NLKK GY+ W KLILKG ND+  +V YKS KRTELV  GYRI+GN 
Sbjct  180  LTGTPEFTREGRVTNLKKAGYTSWLKLILKGENDSPKSVVYKSNKRTELVIAGYRIVGNT  239

Query  788  GDQWSDLLGDNAGARTFKLPDPMYYIA  868
            GDQWSDL+G NAGARTFK+PDPMYYI 
Sbjct  240  GDQWSDLIGKNAGARTFKVPDPMYYIG  266



>gb|AFX66999.1| putative acid phosphatase [Solanum tuberosum]
Length=284

 Score =   345 bits (884),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 155/264 (59%), Positives = 202/264 (77%), Gaps = 6/264 (2%)
 Frame = +2

Query  92   MRAFLLVVVLLATIPTFSHADSIPN------QIHSLRPHTAGGGHHIPGVNCLSWRLGVE  253
            MR+   +++L + I   + A ++        +IH LRP T   G+ +P ++CLSWRL VE
Sbjct  1    MRSCFTILLLFSAIVAVALASNVEEVISQVVEIHRLRPQTGSAGYTVPHLDCLSWRLAVE  60

Query  254  ANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIE  433
             NN++ W +VP++C  YVGHYMLG QYR DC  VA  A++YAK+  L  DG D+WVFDI+
Sbjct  61   TNNLQYWKLVPKECTNYVGHYMLGKQYRHDCEYVAKQAIEYAKSLKLGGDGMDVWVFDID  120

Query  434  ETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLS  613
            ETTLSNLPYYARSDVAFGA AYN+TKF  W++EG APA+P  + LY+ ++SLGIKPVF++
Sbjct  121  ETTLSNLPYYARSDVAFGAIAYNSTKFHEWIAEGKAPAIPSVLGLYKIVLSLGIKPVFIT  180

Query  614  GTKQQFRKVRIANLKKTGYSHWEKLILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIGD  793
            GT++ F +VRIANLKK GY++W  LILKG N + +AV++KS KRT LVK GYRI+GNIGD
Sbjct  181  GTRENFEQVRIANLKKVGYTNWAALILKGENYSGSAVKFKSSKRTALVKAGYRIVGNIGD  240

Query  794  QWSDLLGDNAGARTFKLPDPMYYI  865
            QW+DL+G+N GARTFKLPDPMYY+
Sbjct  241  QWTDLIGENVGARTFKLPDPMYYV  264



>ref|XP_010690146.1| PREDICTED: acid phosphatase 1-like [Beta vulgaris subsp. vulgaris]
Length=266

 Score =   319 bits (817),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 144/257 (56%), Positives = 190/257 (74%), Gaps = 2/257 (1%)
 Frame = +2

Query  101  FLLVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAM  280
            FLL V++++  P  ++A + PN I+ L PH+   GH +PG+NCLSWRL VE  N+R+W  
Sbjct  11   FLLGVLVISHFPN-ANAHAYPNPINLLMPHSGSAGHRVPGLNCLSWRLAVETYNLREWRT  69

Query  281  VPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPY  460
            +P++CE YVGHYM+G QYR DC+AV  +A  Y K+ +L  DGKD+WVFDI+ET+LSNLPY
Sbjct  70   IPEECEGYVGHYMMGSQYRKDCLAVTSAAYDYIKSLSLNKDGKDVWVFDIDETSLSNLPY  129

Query  461  YARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKV  640
            YAR  V FGA  YNAT FD W  E  +PA+P  +  Y+ LV  G+K VFLSG+ ++FR+ 
Sbjct  130  YARPSVGFGANPYNATAFDEWQKEMKSPAIPSVLSFYKKLVRYGVKIVFLSGSHEEFRQF  189

Query  641  RIANLKKTGYSHWEKLILKGANDTR-TAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGD  817
            +  N+K  GY+ W+ +ILK A++++  AVEYKS  RT+L K GYRIIGN+GDQWSDL+GD
Sbjct  190  KERNMKNIGYTKWDMMILKQASESKLKAVEYKSAHRTKLEKMGYRIIGNMGDQWSDLIGD  249

Query  818  NAGARTFKLPDPMYYIA  868
            + G RTFKLPDPMYYI 
Sbjct  250  HPGMRTFKLPDPMYYIG  266



>ref|XP_004302846.1| PREDICTED: stem 28 kDa glycoprotein-like [Fragaria vesca subsp. 
vesca]
Length=265

 Score =   317 bits (811),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 152/262 (58%), Positives = 184/262 (70%), Gaps = 3/262 (1%)
 Frame = +2

Query  86   LTMRAFLLVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNI  265
            LT   F ++  L+A   +   A SI +QIH LRP T  GG HIPGV+CLSWRLGVE  NI
Sbjct  6    LTALVFFILATLVAATKSSDGAKSISHQIHLLRPQTGSGGRHIPGVSCLSWRLGVETRNI  65

Query  266  RDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTL  445
             DW  VP  CE YVGHYMLGHQYR D  AV   A  YAK+  L  D K++W+FDI+ET+L
Sbjct  66   IDWTTVPAACEGYVGHYMLGHQYRKDSKAVTYEAYLYAKSLNLTEDDKNLWIFDIDETSL  125

Query  446  SNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQ  625
            SNLPYY      FG   YN+T FDAWV EGTAPA+P  ++LY+ L +LG+K  F++G  +
Sbjct  126  SNLPYYVHH--GFGVEVYNSTTFDAWVLEGTAPALPESLKLYKKLSTLGVKVAFITGRGE  183

Query  626  QFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKKGYRIIGNIGDQWS  802
              R V   NLKK GY  WEKL+LK ++ + +TAV YKS +R +L +KGYRIIGNIGDQWS
Sbjct  184  SQRSVTETNLKKVGYHTWEKLVLKDSSYSGKTAVVYKSTERKKLEEKGYRIIGNIGDQWS  243

Query  803  DLLGDNAGARTFKLPDPMYYIA  868
            DLLG N G RTFK+PDPMYYI+
Sbjct  244  DLLGTNVGNRTFKMPDPMYYIS  265



>emb|CAN82027.1| hypothetical protein VITISV_000612 [Vitis vinifera]
Length=255

 Score =   313 bits (802),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/255 (58%), Positives = 185/255 (73%), Gaps = 2/255 (1%)
 Frame = +2

Query  104  LLVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMV  283
            +LV +L     T   +  I  +IH LRP     GHH+PG++CLSWRLGVE +NI +W+ V
Sbjct  3    VLVQLLFLLASTVELSPGISLEIHLLRPQLGSSGHHVPGLSCLSWRLGVETHNIIEWSTV  62

Query  284  PQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYY  463
            PQ CE YVGHYMLG QYR D  AV   A+ +A++  LA DGKDIWVFDI+ET+LSNLPY+
Sbjct  63   PQVCESYVGHYMLGDQYRKDSGAVVYEAISHAQSLKLAGDGKDIWVFDIDETSLSNLPYF  122

Query  464  ARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVR  643
            A+    FG  AYN+T+F+ W+ EG AP +P  ++LY+ L SLGIKPVF++G  +  R V 
Sbjct  123  AKH--GFGVEAYNSTQFNNWIYEGKAPPLPESLKLYKKLQSLGIKPVFITGRPEAQRNVT  180

Query  644  IANLKKTGYSHWEKLILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNA  823
             ANL+  GY  WEKLILKG++ T TAV YKS +R +L + GYRI+GNIGDQWSD+LG N 
Sbjct  181  AANLQNAGYHTWEKLILKGSSVTGTAVAYKSNERKKLEQSGYRIVGNIGDQWSDILGTNV  240

Query  824  GARTFKLPDPMYYIA  868
            G RTFKLPDPMYYI+
Sbjct  241  GNRTFKLPDPMYYIS  255



>ref|XP_010654601.1| PREDICTED: acid phosphatase 1 [Vitis vinifera]
Length=255

 Score =   311 bits (798),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 146/255 (57%), Positives = 184/255 (72%), Gaps = 2/255 (1%)
 Frame = +2

Query  104  LLVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMV  283
            +LV +L     T   +  I  +IH LRP     GHH+PG++CLSWRLGVE +NI +W+ V
Sbjct  3    VLVQLLFLLASTVELSPGISLEIHLLRPQLGSSGHHVPGLSCLSWRLGVETHNIIEWSTV  62

Query  284  PQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYY  463
            PQ CE YVGHYMLG QYR D   V   A+ +A++  LA DGKDIWVFDI+ET+LSNLPY+
Sbjct  63   PQACESYVGHYMLGDQYRKDSGVVVYEAITHAQSLKLAGDGKDIWVFDIDETSLSNLPYF  122

Query  464  ARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVR  643
            A+    FG  AYN+T+F+ W+ EG AP +P  ++LY+ L SLGIKPVF++G  +  R V 
Sbjct  123  AKH--GFGVEAYNSTQFNNWIYEGKAPPLPESLKLYKKLQSLGIKPVFITGRPEAQRNVT  180

Query  644  IANLKKTGYSHWEKLILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNA  823
             ANL+  GY  WEKLILKG++ T TAV YKS +R +L + GYRI+GNIGDQWSD+LG N 
Sbjct  181  AANLQNAGYHTWEKLILKGSSVTGTAVAYKSNERKKLEQSGYRIVGNIGDQWSDILGTNV  240

Query  824  GARTFKLPDPMYYIA  868
            G RTFKLPDPMYYI+
Sbjct  241  GNRTFKLPDPMYYIS  255



>ref|XP_010033825.1| PREDICTED: acid phosphatase 1-like [Eucalyptus grandis]
 gb|KCW53660.1| hypothetical protein EUGRSUZ_J02927 [Eucalyptus grandis]
Length=262

 Score =   308 bits (789),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 148/258 (57%), Positives = 185/258 (72%), Gaps = 1/258 (0%)
 Frame = +2

Query  98   AFLLVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWA  277
            + LL+ + +A   + + A  +PN+IH LRP    GGHHIPGV+C SWRL VE +NI+DW 
Sbjct  5    SLLLLFLAIAVPASLTLAGDMPNKIHPLRPQVGSGGHHIPGVSCQSWRLAVETDNIKDWD  64

Query  278  MVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLP  457
            +VP  CE YVG+YMLGHQYR DC A   +A  YAK  TL  DGKD+W+FDI+ET LSNLP
Sbjct  65   VVPMVCENYVGNYMLGHQYRKDCNAAGWAAYDYAKGLTLKKDGKDVWIFDIDETALSNLP  124

Query  458  YYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRK  637
            YYAR D AFGA  YN T F  W  EG APAVP  + LY+ L+ LG K VF+SG  +  R 
Sbjct  125  YYARPDNAFGAKEYNETTFKEWELEGKAPAVPAILYLYKRLLKLGFKIVFISGKSESLRS  184

Query  638  VRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLG  814
            + + N+KK GY  WEKLILK  +++  TA+ YKSKKR EL + GYRI+GN+GDQWSDL+G
Sbjct  185  ITVYNMKKVGYHTWEKLILKQTSESGTTAMVYKSKKRKELEEAGYRILGNMGDQWSDLMG  244

Query  815  DNAGARTFKLPDPMYYIA  868
             + G RTFK+P+PM+YIA
Sbjct  245  SHVGNRTFKVPNPMFYIA  262



>ref|XP_010033711.1| PREDICTED: acid phosphatase 1-like [Eucalyptus grandis]
 gb|KCW53446.1| hypothetical protein EUGRSUZ_J02693 [Eucalyptus grandis]
Length=262

 Score =   307 bits (787),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/258 (57%), Positives = 185/258 (72%), Gaps = 1/258 (0%)
 Frame = +2

Query  98   AFLLVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWA  277
            + LL+ + +A   + + A  +P++IH LRP    GGHHIPGV+C SWRL VE +NI+DW 
Sbjct  5    SLLLLFLAIAVSASLTLAGDVPDKIHPLRPQVGSGGHHIPGVSCQSWRLAVETDNIKDWD  64

Query  278  MVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLP  457
            +VP  CE YVG+YMLGHQYR DC A   +A  YAK  TL  DGKD+W+FDI+ET LSNLP
Sbjct  65   VVPMVCENYVGNYMLGHQYRKDCNAAGWAAYDYAKGLTLKKDGKDVWIFDIDETALSNLP  124

Query  458  YYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRK  637
            YYAR D AFGA  YN T F  W  EG APAVP  + LY+ L+ LG K VF+SG  +  R 
Sbjct  125  YYARPDNAFGAKEYNETTFKEWELEGKAPAVPAILYLYKRLLKLGFKIVFISGKSESLRS  184

Query  638  VRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLG  814
            + + N+KK GY  WEKLILK  +++  TA+ YKSKKR EL + GYRI+GN+GDQWSDL+G
Sbjct  185  ITVYNMKKVGYHTWEKLILKQTSESGTTAMVYKSKKRKELEEAGYRILGNMGDQWSDLMG  244

Query  815  DNAGARTFKLPDPMYYIA  868
             + G RTFK+P+PM+YIA
Sbjct  245  SHVGNRTFKVPNPMFYIA  262



>ref|XP_002515949.1| Stem 28 kDa glycoprotein precursor, putative [Ricinus communis]
 gb|EEF46369.1| Stem 28 kDa glycoprotein precursor, putative [Ricinus communis]
Length=258

 Score =   306 bits (784),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/258 (59%), Positives = 181/258 (70%), Gaps = 5/258 (2%)
 Frame = +2

Query  104  LLVVVLLATIPTFSHADS--IPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWA  277
            L  ++ LA I   SH     +P+QIH LRP +   GHH+PGV+CLSWRLGVE NNI  W 
Sbjct  3    LFQLLFLAIILATSHGSEMGVPHQIHLLRPQSGTAGHHVPGVSCLSWRLGVETNNIIGWT  62

Query  278  MVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLP  457
             VP +CE YVGHYMLGHQYR D   +A  A  YAK+  L+ DGKDIWVFDI+ETTLSNLP
Sbjct  63   TVPAECEGYVGHYMLGHQYRKDSKIIADEAFLYAKSLELSGDGKDIWVFDIDETTLSNLP  122

Query  458  YYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRK  637
            YYA     FGA  YN+T F+ WV    APA+P  + LY+ L+SLGIK VF++G  +  R 
Sbjct  123  YYAEH--GFGAEPYNSTLFNKWVVTSKAPALPESLSLYKRLLSLGIKIVFITGRTEDQRT  180

Query  638  VRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLG  814
            V   NLKK GY  W KL+LK ++ + +TAV YKS +R +LVK GYRI GNIGDQWSDLLG
Sbjct  181  VTTNNLKKAGYHTWMKLVLKTSSYSGKTAVFYKSSERGKLVKSGYRITGNIGDQWSDLLG  240

Query  815  DNAGARTFKLPDPMYYIA  868
               G RTFKLPDPMYYI+
Sbjct  241  TYTGNRTFKLPDPMYYIS  258



>ref|XP_011000941.1| PREDICTED: acid phosphatase 1-like [Populus euphratica]
Length=271

 Score =   303 bits (776),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/268 (56%), Positives = 186/268 (69%), Gaps = 6/268 (2%)
 Frame = +2

Query  77   KRKLTMRAFLLVVVLLATIPTFSHADSI---PNQIHSLRPHTAGGGHHIPGVNCLSWRLG  247
            +++ TM + +L +  LA I   S    +   P QIH LR     GGHHIPG++CLSWRL 
Sbjct  6    EQQNTMASLILQIFFLAVILAISQGSPLSYEPLQIHLLRSKWGSGGHHIPGMSCLSWRLA  65

Query  248  VEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFD  427
            VE NN+  W+ VP+ CE+YVGHYMLG QYR+D   +   A  +AK   L  DGKDIWVFD
Sbjct  66   VETNNVIGWSTVPEDCEDYVGHYMLGSQYREDSALITDEAFAHAKTFKLDGDGKDIWVFD  125

Query  428  IEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVF  607
            ++ETTLSNLPYYA+    FGA  YN+T F+ WV  G A A+P  ++LYR L+S+GIK VF
Sbjct  126  VDETTLSNLPYYAKH--GFGAEPYNSTAFNQWVFTGKALALPESLKLYRRLLSIGIKVVF  183

Query  608  LSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKKGYRIIGN  784
            L+G  +  R V   NLK  GY  WEKLILK ++ + +TAV YKS +R +L KKGYRIIGN
Sbjct  184  LTGRSEDQRAVTSTNLKNAGYHIWEKLILKSSSYSGKTAVFYKSSERAKLEKKGYRIIGN  243

Query  785  IGDQWSDLLGDNAGARTFKLPDPMYYIA  868
            IGDQWSDLLG + G RTFKLPDPMYYI+
Sbjct  244  IGDQWSDLLGTSVGNRTFKLPDPMYYIS  271



>ref|XP_007024338.1| Stem 28 kDa glycoprotein, putative [Theobroma cacao]
 gb|EOY26960.1| Stem 28 kDa glycoprotein, putative [Theobroma cacao]
Length=259

 Score =   303 bits (775),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/259 (56%), Positives = 186/259 (72%), Gaps = 6/259 (2%)
 Frame = +2

Query  104  LLVVVLLAT---IPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDW  274
            L + + LAT   I   S  D++ ++IH LRP +   G+H+PG++CLSWRLGVE NN+  W
Sbjct  3    LFLFLFLATTLGISQGSDQDTVTHKIHLLRPQSGAAGNHVPGLSCLSWRLGVETNNVVGW  62

Query  275  AMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNL  454
              VP++CEEYVGHYMLGHQYR D   VA  A+ YA++ +LA D KD+WVFDI+ET LSNL
Sbjct  63   ITVPEECEEYVGHYMLGHQYRKDSRVVANQALLYAQSLSLARDCKDVWVFDIDETALSNL  122

Query  455  PYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFR  634
            PYYA+    FG   YN T F+ WV EG APA+P  + LY+ L+SLG K VFL+G  +  R
Sbjct  123  PYYAQH--GFGVEQYNPTLFNKWVMEGKAPALPETLNLYKKLLSLGTKVVFLTGRPEYQR  180

Query  635  KVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLL  811
             V   NL+K GY  WEKLILKG++ + ++AV YKS +R +L   GY+IIGN+GDQWSDLL
Sbjct  181  SVTANNLRKAGYQTWEKLILKGSSYSGKSAVVYKSSERKKLAMSGYKIIGNMGDQWSDLL  240

Query  812  GDNAGARTFKLPDPMYYIA  868
            G + G RTFK+PDPMYYI+
Sbjct  241  GTDVGNRTFKMPDPMYYIS  259



>ref|XP_010033712.1| PREDICTED: acid phosphatase 1-like [Eucalyptus grandis]
 gb|KCW53448.1| hypothetical protein EUGRSUZ_J02694 [Eucalyptus grandis]
Length=258

 Score =   302 bits (774),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/238 (60%), Positives = 177/238 (74%), Gaps = 3/238 (1%)
 Frame = +2

Query  158  IPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYR  337
            IP +IH LRP +   G  + G++CLSWRLGVE NNI++W  VP +CE YVGHYMLGHQYR
Sbjct  23   IPREIHLLRPRSGSAGERVHGLSCLSWRLGVETNNIKNWTTVPLECEGYVGHYMLGHQYR  82

Query  338  DDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFD  517
            +D   VA  AV YAK+  LA DGKD+WVFD++ET LSNLPYYA+    FGA  YN+T F+
Sbjct  83   EDSKVVAREAVLYAKSLKLAGDGKDVWVFDVDETLLSNLPYYAKH--GFGAEPYNSTLFN  140

Query  518  AWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILK  697
             WV  G APA+P  + LYR L+ LGIKP+FL+G  +  RK+  +NL+  G+S+WE LILK
Sbjct  141  QWVLTGKAPALPETLELYRELLKLGIKPIFLTGRTEDQRKITSSNLRNAGFSNWEMLILK  200

Query  698  GAN-DTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
            G+     TAV YKS +R ++ + GYRI+GNIGDQWSDLLG +AG RTFKLPDPMYYI+
Sbjct  201  GSTYSGTTAVVYKSSERRKVEESGYRIVGNIGDQWSDLLGIHAGNRTFKLPDPMYYIS  258



>ref|XP_010033826.1| PREDICTED: acid phosphatase 1-like [Eucalyptus grandis]
 gb|KCW53661.1| hypothetical protein EUGRSUZ_J02928 [Eucalyptus grandis]
Length=258

 Score =   300 bits (769),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 142/238 (60%), Positives = 176/238 (74%), Gaps = 3/238 (1%)
 Frame = +2

Query  158  IPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYR  337
            IP +IH LRP +   G  + G++CLSWRLGVE NNI++W  VP +CE YVGHYMLGHQYR
Sbjct  23   IPREIHLLRPRSGSAGERVHGLSCLSWRLGVETNNIKNWTTVPLECEGYVGHYMLGHQYR  82

Query  338  DDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFD  517
            +D   VA  AV YAK+  LA DGKD+WVFD++ET LSNLPYYA+    FGA  YN+T F+
Sbjct  83   EDSKVVAREAVLYAKSLKLAGDGKDVWVFDVDETLLSNLPYYAKH--GFGAEPYNSTLFN  140

Query  518  AWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILK  697
             WV  G APA+P  + LYR L+ LGIKP+FL+G  +  RK+  +NL+  G+ +WE LILK
Sbjct  141  QWVLTGKAPALPETLELYRELLKLGIKPIFLTGRTEDQRKITSSNLRNAGFRNWEMLILK  200

Query  698  G-ANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
            G A    TAV YKS +R ++ + GYRI+GNIGDQWSDLLG +AG RTFKLPDPMYYI+
Sbjct  201  GSAYSGTTAVVYKSSERRKVEESGYRIVGNIGDQWSDLLGIHAGNRTFKLPDPMYYIS  258



>ref|XP_003632911.1| PREDICTED: acid phosphatase 1-like [Vitis vinifera]
Length=255

 Score =   299 bits (765),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/237 (59%), Positives = 172/237 (73%), Gaps = 2/237 (1%)
 Frame = +2

Query  158  IPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYR  337
            I ++IH LRP  A G H   G++C SWRL VE NNI +W  VPQ CE YVGHYMLGHQYR
Sbjct  21   ISHEIHLLRPRLASGVHPASGLSCPSWRLAVETNNIINWETVPQACESYVGHYMLGHQYR  80

Query  338  DDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFD  517
             D   V   A+ YA++  L  DGKD+WVFDI+ETTLSNLPYYA +   FGA  +N T F+
Sbjct  81   QDSRVVVYEAIAYAESLKLGGDGKDVWVFDIDETTLSNLPYYAEN--GFGAEVFNETSFN  138

Query  518  AWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILK  697
             WV +G APA+P  ++LY  LVSLGIK VFL+G  +  R V +ANLKK GY  WEKLIL+
Sbjct  139  EWVMKGEAPALPESLKLYNKLVSLGIKVVFLTGKGEDERNVTVANLKKVGYHTWEKLILR  198

Query  698  GANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
             ++D  TA+ YKS +R ++ + GY+I+GN+GDQWSD+LG N G RTFKLPDPMYYIA
Sbjct  199  KSSDGSTALVYKSNQRKKVEESGYKIVGNMGDQWSDILGTNTGNRTFKLPDPMYYIA  255



>ref|XP_002299744.2| hypothetical protein POPTR_0001s19180g [Populus trichocarpa]
 gb|EEE84549.2| hypothetical protein POPTR_0001s19180g [Populus trichocarpa]
Length=261

 Score =   299 bits (765),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 148/263 (56%), Positives = 183/263 (70%), Gaps = 6/263 (2%)
 Frame = +2

Query  92   MRAFLLVVVLLATIPTFSHADSI---PNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANN  262
            M + +L +  LA I   S    +   P +IH LR     G HHIPG++CLSWRL VE NN
Sbjct  1    MASLILQIFFLAVILATSQGSPLSYYPLRIHLLRSKWGSGDHHIPGMSCLSWRLAVETNN  60

Query  263  IRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETT  442
            +  W+ VP++CE+YVGHYMLG QYR+D   +   A  +AK   LA DGKDIWVFD++ETT
Sbjct  61   VIGWSTVPEECEDYVGHYMLGSQYREDSAVITDEAFAHAKTFKLAGDGKDIWVFDVDETT  120

Query  443  LSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTK  622
            LSNLPYYA+    FGA  YN+T F+ WV  G A A+P  ++LYR L+S+GIK VFL+G  
Sbjct  121  LSNLPYYAKH--GFGAEPYNSTAFNQWVFTGKALALPESLKLYRNLLSIGIKVVFLTGRT  178

Query  623  QQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKKGYRIIGNIGDQW  799
            +  R V   NLK  GY  WEKLILK ++ + +TAV YKS +R +L KKGYRIIGNIGDQW
Sbjct  179  EDQRAVTSNNLKNAGYHIWEKLILKSSSYSGKTAVFYKSSERAKLEKKGYRIIGNIGDQW  238

Query  800  SDLLGDNAGARTFKLPDPMYYIA  868
            SDLLG + G RTFKLPDPMYYI+
Sbjct  239  SDLLGTSVGNRTFKLPDPMYYIS  261



>dbj|BAJ34931.1| hypothetical protein [Vitis hybrid cultivar]
Length=237

 Score =   298 bits (762),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 139/237 (59%), Positives = 171/237 (72%), Gaps = 2/237 (1%)
 Frame = +2

Query  158  IPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYR  337
            I ++IH LRP    GGH    ++C SWRL VE NNI +W  VPQ CE YVGHYMLGHQYR
Sbjct  3    ISHEIHLLRPRLGSGGHPASNLSCPSWRLAVETNNIINWETVPQACESYVGHYMLGHQYR  62

Query  338  DDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFD  517
             D   V   A+ YA++  L  DGKD+WVFDI+ETTLSNLPYYA +   FGA  +N T F+
Sbjct  63   QDSRVVVYEAIAYAESLKLGGDGKDVWVFDIDETTLSNLPYYAEN--GFGAEVFNETSFN  120

Query  518  AWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILK  697
             WV +G APA+P  ++LY  LVSLGIK VFL+G  +  R V +ANLKK GY  WEKLIL+
Sbjct  121  EWVMKGEAPALPESLKLYNKLVSLGIKVVFLTGKGEDERNVTVANLKKVGYHTWEKLILR  180

Query  698  GANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
             ++D  TA+ YKS +R ++ + GY+I+GN+GDQWSD+LG N G RTFKLPDPMYYIA
Sbjct  181  KSSDGSTALVYKSNQRKKVEESGYKIVGNMGDQWSDILGTNTGNRTFKLPDPMYYIA  237



>ref|XP_010258709.1| PREDICTED: acid phosphatase 1-like [Nelumbo nucifera]
Length=260

 Score =   297 bits (760),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/256 (56%), Positives = 177/256 (69%), Gaps = 3/256 (1%)
 Frame = +2

Query  104  LLVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMV  283
             L+  +LAT      + S P+ IH LRP    GGH + GV+CLSWR GVE NNIR W  +
Sbjct  7    FLIATILATSHASPSSSSEPHLIHLLRPKHGAGGHALKGVSCLSWRFGVETNNIRGWKTI  66

Query  284  PQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYY  463
            P +CE+YVGHYMLG  YR DC  V   A+ YA+N  L  DGKD+W+FDI+ET LSNLPYY
Sbjct  67   PSKCEDYVGHYMLGSLYRKDCKVVVDEAILYAENLKLTGDGKDVWIFDIDETILSNLPYY  126

Query  464  ARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVR  643
            AR    FG   +N+T F+ WV+ G AP +P  +RLYR L+SLG+K VFL+G  +  RK  
Sbjct  127  ARH--GFGVEPFNSTLFNEWVNTGEAPPLPESLRLYRKLLSLGLKIVFLTGRSEDQRKAT  184

Query  644  IANLKKTGYSHWEKLIL-KGANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDN  820
              NLKK G+  WEKLIL K +N   TAV YKS +R  L + GYRI+GNIGDQWSD+LG+N
Sbjct  185  STNLKKAGFHTWEKLILKKSSNQGTTAVVYKSGERKTLEESGYRIVGNIGDQWSDILGNN  244

Query  821  AGARTFKLPDPMYYIA  868
             G RTFKLPDPMYY++
Sbjct  245  TGNRTFKLPDPMYYLS  260



>gb|KDP40846.1| hypothetical protein JCGZ_24845 [Jatropha curcas]
Length=262

 Score =   295 bits (756),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 146/252 (58%), Positives = 173/252 (69%), Gaps = 3/252 (1%)
 Frame = +2

Query  116  VLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQC  295
            +  A     S   SIP+QIH LRP     G  + G+ CLSWRLGVE NNI  W  VP++C
Sbjct  13   IFFAATSCASAEVSIPHQIHLLRPQAGAAGSKVTGLTCLSWRLGVETNNIVGWKTVPEEC  72

Query  296  EEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSD  475
            E YVGHYMLGHQYR D  AV   A  YAK+  LA DGKD+WVFDI+ETTLSNLPYYA   
Sbjct  73   EGYVGHYMLGHQYRLDSKAVTDEAFVYAKSHVLAGDGKDLWVFDIDETTLSNLPYYASH-  131

Query  476  VAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANL  655
              FGA  YN T F+ WV    APA+P  ++LY+ L++LG+K VF++G  +  R     NL
Sbjct  132  -GFGAEPYNFTLFNKWVLTSKAPALPESLQLYKRLIALGLKIVFITGRPEDQRAATTDNL  190

Query  656  KKTGYSHWEKLILKGAN-DTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGAR  832
            KK GY  W KL+LK ++   +TAV YKS +R +LVK GYRIIGNIGDQWSDLLG N G R
Sbjct  191  KKAGYGAWLKLVLKASSYSGKTAVFYKSSERAKLVKSGYRIIGNIGDQWSDLLGTNTGNR  250

Query  833  TFKLPDPMYYIA  868
            TFKLPDPMYYI+
Sbjct  251  TFKLPDPMYYIS  262



>ref|XP_007215831.1| hypothetical protein PRUPE_ppa010152mg [Prunus persica]
 gb|EMJ17030.1| hypothetical protein PRUPE_ppa010152mg [Prunus persica]
Length=261

 Score =   295 bits (756),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 147/256 (57%), Positives = 179/256 (70%), Gaps = 5/256 (2%)
 Frame = +2

Query  110  VVVLLATI--PTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMV  283
            +V  LATI   T  +   + + IH L P T G    +PG++CLSWRL VE NNI +W  V
Sbjct  8    LVFFLATIVSTTQGYEPVLTHHIHLLTPKTGGARGSVPGLSCLSWRLAVETNNIINWKTV  67

Query  284  PQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYY  463
            P +CE YVGHYMLGHQYR D   V   A  YAK+  L  DGK++WVFDI+ETTLSNLPYY
Sbjct  68   PAECEGYVGHYMLGHQYRKDSKVVTNGAWLYAKSLNLTKDGKNVWVFDIDETTLSNLPYY  127

Query  464  ARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVR  643
            A +   FG   YNAT FD WV +GTAPA+P  ++LY+ L++LG+K VFL+G  +  R V 
Sbjct  128  AVN--GFGTELYNATSFDEWVLKGTAPALPESLKLYQKLLTLGVKVVFLTGRGEDKRNVT  185

Query  644  IANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDN  820
              NLK  GY  WEKLILKG+  T +T+  YKS +RT+LVK G+RIIGN GDQWSD+LG N
Sbjct  186  TTNLKNVGYHTWEKLILKGSAYTGKTSYVYKSAERTKLVKSGFRIIGNAGDQWSDILGTN  245

Query  821  AGARTFKLPDPMYYIA  868
             G RTFKLPDPMYYI+
Sbjct  246  VGNRTFKLPDPMYYIS  261



>ref|XP_006426852.1| hypothetical protein CICLE_v10026223mg [Citrus clementina]
 gb|ESR40092.1| hypothetical protein CICLE_v10026223mg [Citrus clementina]
Length=283

 Score =   294 bits (753),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 155/277 (56%), Positives = 193/277 (70%), Gaps = 7/277 (3%)
 Frame = +2

Query  53   PLTSYIIKKRKLTMRAFLLVV--VLLATIPTFSHADS--IPNQIHSLRPHTAGGGHHIPG  220
            PL  + +     T   F + +  + LATIP  SH  S  IP+QIH LRP      + +PG
Sbjct  9    PLLFFFLATISATSHGFSMDIRHLFLATIPATSHGFSMDIPHQIHLLRPKAGSRNNDVPG  68

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            ++CLSWRLGVE NN+  WA VP++C +YVGHYMLG QYR D   VA  A+ +A++ TLA 
Sbjct  69   LSCLSWRLGVETNNVIGWATVPEKCADYVGHYMLGQQYRLDSEVVANEAILHAQSLTLAG  128

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DGKDIWVFDI+ET+L NLPYYA++   FG   YN T F+ WV+ G AP +P  ++LY+ L
Sbjct  129  DGKDIWVFDIDETSLCNLPYYAKN--GFGVKPYNPTMFNEWVNTGKAPPLPESLKLYKKL  186

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELV  757
            + LGIK VFL+G  +  R V  ANLK  G++ WEKLILKG++ +  TAV YKS +R +L 
Sbjct  187  LLLGIKIVFLTGRPEDQRNVTEANLKHAGFNTWEKLILKGSSHSGETAVVYKSSERKKLE  246

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
             KGYRIIGNIGDQWSDLLG NAG RTFKLPDPMYYI 
Sbjct  247  MKGYRIIGNIGDQWSDLLGTNAGNRTFKLPDPMYYIG  283



>ref|XP_006465744.1| PREDICTED: acid phosphatase 1-like [Citrus sinensis]
Length=264

 Score =   293 bits (750),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 142/260 (55%), Positives = 183/260 (70%), Gaps = 5/260 (2%)
 Frame = +2

Query  98   AFLLVVVLLATIPTFSHAD--SIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRD  271
            +F L +   A +   S      IP+QIH LRP +    + +P ++CLSWRL VE NNI  
Sbjct  7    SFFLFLATQALVAATSRGTYLEIPHQIHLLRPKSGARTNDVPDLSCLSWRLAVETNNIIG  66

Query  272  WAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSN  451
            W  +P++CE Y+GHYMLG QYR+D  AVA  A+ YA++  LA DG++IW+FDI+ET+LSN
Sbjct  67   WKTIPEKCEGYLGHYMLGQQYREDSEAVAYEAIVYAQSLELAGDGREIWIFDIDETSLSN  126

Query  452  LPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQF  631
            LPYYA+    FG   +N+T F+ WV++G AP++P  + LY+ L+SLGIK VFL+G  +  
Sbjct  127  LPYYAKH--GFGVEPFNSTLFNEWVNKGEAPSLPESLNLYKKLLSLGIKIVFLTGRPEDQ  184

Query  632  RKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKKGYRIIGNIGDQWSDL  808
            R V   NLK  G+  WE LILKG++ +  TAV YKS +R  L KKGYRIIGNIGDQWSDL
Sbjct  185  RSVTENNLKNVGFYTWENLILKGSSYSGETAVAYKSNERKRLEKKGYRIIGNIGDQWSDL  244

Query  809  LGDNAGARTFKLPDPMYYIA  868
            LG NAG RTFKLPDPMYYI+
Sbjct  245  LGTNAGNRTFKLPDPMYYIS  264



>ref|XP_008228404.1| PREDICTED: acid phosphatase 1-like [Prunus mume]
Length=265

 Score =   292 bits (748),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/270 (54%), Positives = 184/270 (68%), Gaps = 7/270 (3%)
 Frame = +2

Query  62   SYIIKKRKLTMRAFLLVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWR  241
            SYI++   + +  FL  +VL     T  +   + + IH L P T G    +PG++CLSWR
Sbjct  2    SYIMEILPVALVFFLATIVL----TTQGYEPVLTHHIHLLTPKTGGARGSVPGLSCLSWR  57

Query  242  LGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWV  421
            L VE NNI +W  VP +CE YVGHYMLGHQYR D   V   A  YAK+  L  DGK++WV
Sbjct  58   LAVETNNIINWKTVPAECEGYVGHYMLGHQYRKDSKVVTNGAWLYAKSLNLTKDGKNVWV  117

Query  422  FDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKP  601
            FDI+ETTLSNLPYYA +   FG   YN+T F+ WV +G APA+P  ++LY+ L++LG+K 
Sbjct  118  FDIDETTLSNLPYYAVN--GFGTELYNSTSFNEWVLKGIAPALPESLKLYQKLLTLGVKV  175

Query  602  VFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKKGYRII  778
            VFL+G  +  R V   NLK  GY  WEKLILKG+  T +T+  YKS +RT+LVK G+RII
Sbjct  176  VFLTGRGEDQRNVTTTNLKNVGYHTWEKLILKGSAYTGKTSYVYKSAERTKLVKSGFRII  235

Query  779  GNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
            GN GDQWSD+LG N G RTFK+PDPMYYI+
Sbjct  236  GNAGDQWSDILGTNVGNRTFKVPDPMYYIS  265



>ref|XP_008798588.1| PREDICTED: acid phosphatase 1-like [Phoenix dactylifera]
Length=262

 Score =   292 bits (747),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/260 (55%), Positives = 178/260 (68%), Gaps = 8/260 (3%)
 Frame = +2

Query  107  LVVVLLATIPTFSHADS------IPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIR  268
            + +VLLA + T SHA S       P  IH LRP +  G H + GV C SWR+ VEANN+R
Sbjct  5    VAIVLLAALVTSSHASSRVEDPPFPLPIHLLRPLSGSGAHRLSGVTCESWRVAVEANNMR  64

Query  269  DWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLS  448
             W  +P+ CE YVGHYMLG  YR D   VA  A +YA++  L  DGKD+WVFD++ETTLS
Sbjct  65   GWKTIPRTCEGYVGHYMLGGLYRRDSAVVAGEAAKYAESLDLRADGKDVWVFDVDETTLS  124

Query  449  NLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQ  628
            NLPYYAR    FG   YNAT F+AWV +G APA+P  + LY+ L+SLGIK VFL+G  + 
Sbjct  125  NLPYYARH--GFGVELYNATSFNAWVMKGKAPALPESLELYKKLLSLGIKIVFLTGRTED  182

Query  629  FRKVRIANLKKTGYSHWEKLILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDL  808
             R +   NLK  GY  WEKL+LKG N + ++V YKS  R +L ++GY ++GNIGDQWSD+
Sbjct  183  QRDITAHNLKMVGYHTWEKLLLKGLNVSGSSVAYKSGMRQKLEEEGYSVVGNIGDQWSDI  242

Query  809  LGDNAGARTFKLPDPMYYIA  868
            LG   G RTFK+PDPMYYI+
Sbjct  243  LGQPEGGRTFKVPDPMYYIS  262



>ref|XP_007045549.1| Stem 28 kDa glycoprotein, putative [Theobroma cacao]
 gb|EOY01381.1| Stem 28 kDa glycoprotein, putative [Theobroma cacao]
Length=260

 Score =   291 bits (745),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 149/260 (57%), Positives = 183/260 (70%), Gaps = 7/260 (3%)
 Frame = +2

Query  104  LLVVVLLATIPTFSHADSIP----NQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRD  271
            LL+V+ LA I T S   S P     QIH LRP +  GG  +PG++CLSWRLGVE NNI  
Sbjct  3    LLLVLFLANILTLSQGSSQPAHVHRQIHLLRPQSGAGGDLVPGLSCLSWRLGVETNNIIG  62

Query  272  WAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSN  451
            W  +PQ+CE YVGHYMLG QYR D  AVA  A  YA++  L  DGKD+W+FD++ETTLSN
Sbjct  63   WKTIPQECEGYVGHYMLGKQYRKDSKAVADEAFLYAQSLKLPRDGKDVWIFDVDETTLSN  122

Query  452  LPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQF  631
            LPYYA     FG   YNAT F+ WV EG APA+P  ++LY+ L+SLGIK VF++G  +  
Sbjct  123  LPYYAEH--GFGVEPYNATLFNKWVMEGKAPALPESLKLYKKLLSLGIKAVFITGRAEDQ  180

Query  632  RKVRIANLKKTGYSHWEKLILKGAN-DTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDL  808
            R +   NLKK G+  WEKLILK ++   +T+V YKS +R +L K GY+I+GNIGDQWSDL
Sbjct  181  RSITATNLKKVGFHSWEKLILKESSYSGKTSVGYKSNERKKLEKNGYKIVGNIGDQWSDL  240

Query  809  LGDNAGARTFKLPDPMYYIA  868
            LG   G RTFKLPDPMYYI+
Sbjct  241  LGTYTGNRTFKLPDPMYYIS  260



>ref|XP_004302847.1| PREDICTED: stem 28 kDa glycoprotein-like [Fragaria vesca subsp. 
vesca]
Length=262

 Score =   290 bits (742),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/243 (57%), Positives = 172/243 (71%), Gaps = 3/243 (1%)
 Frame = +2

Query  143  SHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYML  322
            S   +I  QIH LRP T   G H+PG++C+SWRLGVE +NI  W  +P  CE YVG+YML
Sbjct  22   SSDGAISRQIHLLRPQTGSQGRHVPGISCMSWRLGVETHNIVGWTTIPAACERYVGNYML  81

Query  323  GHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYN  502
            GHQYR D  AV   A+ YAK+  L  DGK++WVFDI+ET+LSNLPYYA     FG   YN
Sbjct  82   GHQYRQDSRAVTNEALLYAKSLNLTKDGKNLWVFDIDETSLSNLPYYAHH--GFGVELYN  139

Query  503  ATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWE  682
            +T F+AWV EG APA+P  ++LY  L++LGIK  F++G  +  R V   NL+  GY  WE
Sbjct  140  STAFNAWVLEGKAPALPESLKLYNKLLALGIKVAFITGRGESQRSVTEINLRYVGYLTWE  199

Query  683  KLILKGANDT-RTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMY  859
            KLILK ++ T  T+V YKS ++ +L + GYRIIGNIGDQWSDLLG N G RTFKLPDPMY
Sbjct  200  KLILKNSSYTGNTSVVYKSSEKKKLEESGYRIIGNIGDQWSDLLGTNVGDRTFKLPDPMY  259

Query  860  YIA  868
            YI+
Sbjct  260  YIS  262



>ref|XP_006465710.1| PREDICTED: acid phosphatase 1-like [Citrus sinensis]
 gb|KDO51840.1| hypothetical protein CISIN_1g023352mg [Citrus sinensis]
Length=283

 Score =   289 bits (739),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 154/277 (56%), Positives = 190/277 (69%), Gaps = 7/277 (3%)
 Frame = +2

Query  53   PLTSYIIKKRKLTMRAFLLVV--VLLATIPTFSHADS--IPNQIHSLRPHTAGGGHHIPG  220
            PL  + +     T   F + +  + LATI   SH  S  IP+QIH LRP      + +PG
Sbjct  9    PLFFFFLATISATSHGFSMDIRHLFLATISATSHGFSMDIPHQIHLLRPKAGSRNNDVPG  68

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            ++CLSWRLGVE NN+  WA VP++C  YVGHYMLG QYR D   VA  A+ YA++  LA 
Sbjct  69   LSCLSWRLGVETNNVIGWATVPEKCAGYVGHYMLGQQYRMDSEVVANEAILYAQSLKLAG  128

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DGK+IWVFDI+ET+LSNLPYYA++   FG   YN T F+ WV+ G AP +P  ++LY+ L
Sbjct  129  DGKNIWVFDIDETSLSNLPYYAKN--GFGVKPYNPTLFNEWVNTGKAPPLPESLKLYKKL  186

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELV  757
            + LGIK VFL+G  +  R V  ANLK  G+  WEKLILKG++ +  TAV YKS +R +L 
Sbjct  187  LLLGIKIVFLTGRPEDQRNVTEANLKHAGFDTWEKLILKGSSHSGETAVVYKSSERKKLE  246

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
             KGYRIIGNIGDQWSDLLG NAG RTFKLPDPMYYI 
Sbjct  247  MKGYRIIGNIGDQWSDLLGTNAGNRTFKLPDPMYYIG  283



>ref|XP_010033713.1| PREDICTED: acid phosphatase 1-like [Eucalyptus grandis]
 gb|KCW53450.1| hypothetical protein EUGRSUZ_J02696 [Eucalyptus grandis]
Length=257

 Score =   285 bits (729),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 137/238 (58%), Positives = 172/238 (72%), Gaps = 4/238 (2%)
 Frame = +2

Query  158  IPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYR  337
            IP +IH LRPH+   G  + G+ CLSWRLGVE +NI++W  VP++CE YVGHYML HQYR
Sbjct  23   IPREIHLLRPHSGSAGERVHGLYCLSWRLGVETHNIKNWNTVPRECEGYVGHYML-HQYR  81

Query  338  DDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFD  517
            +D   VA  AV YAK+  LA DGKD+WVFDI+ET+LSNLPYYA  +  FG    NAT+F 
Sbjct  82   EDSKVVAREAVLYAKSLKLAGDGKDVWVFDIDETSLSNLPYYA--EHGFGVEPLNATQFG  139

Query  518  AWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILK  697
             W+  G APA+P  + LYR L+ LGIKP+FL+G  +  R +  +NL+  G+  WE LILK
Sbjct  140  QWILTGKAPALPETLELYRELLKLGIKPIFLTGRPEDARNITSSNLRNAGFRTWEMLILK  199

Query  698  G-ANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
            G A    TAV YKS +R ++ + GYRI+GNIGDQWSDLLG + G RTFKLP+PMYYI+
Sbjct  200  GSAYSETTAVVYKSSERRKVEESGYRIVGNIGDQWSDLLGIHVGNRTFKLPNPMYYIS  257



>ref|XP_010915365.1| PREDICTED: acid phosphatase 1-like [Elaeis guineensis]
Length=262

 Score =   285 bits (728),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/248 (56%), Positives = 168/248 (68%), Gaps = 8/248 (3%)
 Frame = +2

Query  143  SHADS------IPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEY  304
            SHA S       P  IH LRP +  GGH + GV+C+SWR+GVEANN+RDW  +P  CE Y
Sbjct  17   SHASSRVEGPPFPLPIHFLRPLSGSGGHPLIGVSCVSWRVGVEANNVRDWKTIPSTCEGY  76

Query  305  VGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAF  484
            VGHYMLG  YR D   V   A  YA+   L  DGKD+WVFDI+ETTLSNLPYYA     F
Sbjct  77   VGHYMLGDLYRQDSALVTAEAANYAEGLNLQGDGKDVWVFDIDETTLSNLPYYAHH--GF  134

Query  485  GATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKT  664
            G   YNAT F+AWV +G APA+P  + LY+ L+SLGIK VFL+G  +  R +   NL+  
Sbjct  135  GVELYNATSFNAWVMKGEAPALPESLGLYKKLLSLGIKIVFLTGRTEDQRNITAHNLRMV  194

Query  665  GYSHWEKLILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKL  844
            GY  WEKL+LK  N   ++V YKS  R +L+ +GYRI+GN+GDQWSD+LG   G RTFK 
Sbjct  195  GYHTWEKLLLKALNVRGSSVAYKSGMRQKLIDEGYRIVGNMGDQWSDILGQPKGDRTFKF  254

Query  845  PDPMYYIA  868
            PDPMYYI+
Sbjct  255  PDPMYYIS  262



>ref|XP_010654600.1| PREDICTED: acid phosphatase 1-like [Vitis vinifera]
Length=255

 Score =   281 bits (718),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 145/255 (57%), Positives = 182/255 (71%), Gaps = 3/255 (1%)
 Frame = +2

Query  104  LLVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMV  283
            +LV+ LL        +  I ++IH LRP     GHH+PG++CLSWRLGVEA+NI +W+ V
Sbjct  4    VLVIWLLLFAGAVELSLGISHEIHLLRPQLGSSGHHVPGLSCLSWRLGVEAHNIIEWSTV  63

Query  284  PQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYY  463
            PQ CE YVGHYMLGHQYR D  AV   A+ YA++  LA DGKDIWVFD++ET+ SNLPYY
Sbjct  64   PQACESYVGHYMLGHQYRKDSRAVVYEALTYAQSLKLAVDGKDIWVFDVDETSPSNLPYY  123

Query  464  ARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVR  643
            A+    F   AYN+T+F+ WV EG APA+P  ++LY+ L+SLGIK VF++G  +  R V 
Sbjct  124  AKH--GFRVEAYNSTQFNNWVYEGKAPALPESLKLYKKLLSLGIKAVFITGRPEAQRNVT  181

Query  644  IANLKKTGYSHWEKLILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNA  823
             ANL+  GY  WEKLILKG++   T V YKS +R +L K GYRII NIGDQWSD+LG N 
Sbjct  182  AANLRNVGYHTWEKLILKGSS-AGTIVVYKSNERKKLKKSGYRIIDNIGDQWSDILGTNT  240

Query  824  GARTFKLPDPMYYIA  868
              RTFKL +PMYYI+
Sbjct  241  ENRTFKLSNPMYYIS  255



>ref|XP_010033828.1| PREDICTED: acid phosphatase 1-like [Eucalyptus grandis]
 gb|KCW53662.1| hypothetical protein EUGRSUZ_J02929 [Eucalyptus grandis]
Length=257

 Score =   280 bits (716),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 170/238 (71%), Gaps = 4/238 (2%)
 Frame = +2

Query  158  IPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYR  337
            IP +IH LRPH+   G  + G+ CLSWRLGVE +NI++W  VP++CE YVGHYML +QYR
Sbjct  23   IPREIHLLRPHSGSAGERVHGLYCLSWRLGVETHNIKNWNTVPRECEGYVGHYML-YQYR  81

Query  338  DDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFD  517
            +D   VA  AV Y K+  LA DGKD+WVFDI+ET+LSNLPYYA  +  FG    N T+F 
Sbjct  82   EDSKVVAREAVLYVKSLKLAGDGKDVWVFDIDETSLSNLPYYA--EHGFGVEPLNPTQFG  139

Query  518  AWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILK  697
             W+  G APA+P  + LYR L+ LGIKP+FL+G  +  R +  +NL+  G+  WE LILK
Sbjct  140  QWILTGKAPALPETLELYRELLKLGIKPIFLTGRSEDARNITSSNLRNAGFRTWEMLILK  199

Query  698  G-ANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
            G A    TAV YKS +R ++ + GYRI+GNIGDQWSDLLG + G RTFKLP+PMYYI+
Sbjct  200  GSAYSETTAVVYKSSERRKVEESGYRIVGNIGDQWSDLLGIHVGNRTFKLPNPMYYIS  257



>ref|XP_009338743.1| PREDICTED: acid phosphatase 1-like [Pyrus x bretschneideri]
Length=261

 Score =   280 bits (716),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 143/260 (55%), Positives = 180/260 (69%), Gaps = 7/260 (3%)
 Frame = +2

Query  104  LLVVVLLATIPTFSHADS----IPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRD  271
            L VV+L      FS + +    I + IH LRP +  GG  +PGV+CLSWRLGVE  NI +
Sbjct  4    LTVVLLFFLALVFSTSQAYEPLINHHIHLLRPKSGAGGGSVPGVSCLSWRLGVETRNIIN  63

Query  272  WAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSN  451
            W  VP +CE YVGHYMLGHQYR D   VA  A  +A++  L  DGK++WVFDI+ETTLSN
Sbjct  64   WKTVPAECESYVGHYMLGHQYRKDSKVVADEAWLHAQSLNLTKDGKNVWVFDIDETTLSN  123

Query  452  LPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQF  631
            LPYYAR    FG   YNAT F+ WV EGTAPA+P  ++LY+ L+ LG+K VF++G  +  
Sbjct  124  LPYYARH--GFGTEVYNATAFNEWVFEGTAPALPESLKLYKKLLRLGVKVVFITGRGEDQ  181

Query  632  RKVRIANLKKTGYSHWEKLILKGAN-DTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDL  808
            R V   NLK  GY  W+KL+LKG+N   +T+  YKS +R +L K G+RIIGN+GDQWSD+
Sbjct  182  RSVTTTNLKNAGYDTWKKLVLKGSNYSGKTSYVYKSAEREKLEKNGFRIIGNMGDQWSDI  241

Query  809  LGDNAGARTFKLPDPMYYIA  868
            LG   G RTFKLPDP+YYI+
Sbjct  242  LGTTVGNRTFKLPDPLYYIS  261



>gb|AGG23547.1| acid phosphatase-like protein 1 [Malus hupehensis]
Length=261

 Score =   280 bits (716),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 146/256 (57%), Positives = 180/256 (70%), Gaps = 3/256 (1%)
 Frame = +2

Query  104  LLVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMV  283
            LL  + +    T ++   I +QIH LRP +  GG  +PGV+CLSWRLGVE  NI +W  V
Sbjct  8    LLFFLAIFFSTTQAYEPLINHQIHLLRPKSGAGGSSVPGVSCLSWRLGVEVRNIINWKTV  67

Query  284  PQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYY  463
            P QCE YVGHYMLGHQYR D  AV   A  YAK+  L  DGK++WVFDI+ETTLSNLPYY
Sbjct  68   PAQCESYVGHYMLGHQYRKDSKAVTDVAWLYAKSLNLTKDGKNVWVFDIDETTLSNLPYY  127

Query  464  ARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVR  643
            AR    FG   YN+T F+ WV EGTAPA+P  ++LY+ L+ LG+K VF++G  +  R V 
Sbjct  128  ARH--GFGTEVYNSTSFNEWVLEGTAPALPESLQLYKKLLKLGVKVVFITGRGEDQRSVT  185

Query  644  IANLKKTGYSHWEKLILKG-ANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDN  820
            I NLK  GY  WEKL+LKG A   +T+  YKS +R +L K G+RIIGNIGDQWSD+LG +
Sbjct  186  ITNLKNVGYHTWEKLVLKGSAYSGKTSYVYKSAEREKLEKSGFRIIGNIGDQWSDILGTS  245

Query  821  AGARTFKLPDPMYYIA  868
             G RTFKLPDP+YYI+
Sbjct  246  VGNRTFKLPDPLYYIS  261



>ref|XP_008380842.1| PREDICTED: acid phosphatase 1-like [Malus domestica]
Length=274

 Score =   280 bits (716),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 145/257 (56%), Positives = 181/257 (70%), Gaps = 5/257 (2%)
 Frame = +2

Query  101  FLLVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAM  280
              L+ +  +T  T ++   I + IH LRP +  GG  +PGV+CLSWRLGVE  NI +W  
Sbjct  22   LFLLAIFFST--TQAYEPLINHHIHLLRPKSGAGGSSVPGVSCLSWRLGVEVRNIINWKT  79

Query  281  VPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPY  460
            VP QCE YVGHYMLGHQYR D  AV   A  YAK+  L  DGK++WVFDI+ETTLSNLPY
Sbjct  80   VPAQCESYVGHYMLGHQYRKDSKAVTDVAWLYAKSLNLTKDGKNVWVFDIDETTLSNLPY  139

Query  461  YARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKV  640
            YAR    FG   YN+T F+ WV EGTAPA+P  ++LY+ L+ LG+K VF++G  +  R V
Sbjct  140  YARH--GFGTEVYNSTSFNEWVLEGTAPALPESLQLYKKLLKLGVKVVFITGRGEDQRSV  197

Query  641  RIANLKKTGYSHWEKLILKG-ANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGD  817
             I NLK  GY  WEKL+LKG A   +T+ EYKS +R +L K G+RIIGN+GDQWSD+LG 
Sbjct  198  TIXNLKNVGYHTWEKLVLKGSAYSGKTSYEYKSAEREKLEKSGFRIIGNMGDQWSDILGT  257

Query  818  NAGARTFKLPDPMYYIA  868
            + G RTFKLPDP+YYI+
Sbjct  258  SVGNRTFKLPDPLYYIS  274



>ref|XP_006426853.1| hypothetical protein CICLE_v10027566mg [Citrus clementina]
 gb|ESR40093.1| hypothetical protein CICLE_v10027566mg [Citrus clementina]
Length=264

 Score =   278 bits (711),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 143/260 (55%), Positives = 183/260 (70%), Gaps = 5/260 (2%)
 Frame = +2

Query  98   AFLLVVVLLATIPTFSHAD--SIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRD  271
            +F L +  LA +   S      IP+QIH LRP +    +  P ++CLSWRL VE NNI  
Sbjct  7    SFFLFLATLALVAATSRGTYLEIPHQIHLLRPKSGARTNDFPDLSCLSWRLAVETNNIIG  66

Query  272  WAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSN  451
            W   P++CE Y+GHYMLG QYR+D  AVA  A+ YA++  LA DG++IW+FDI+ET+LSN
Sbjct  67   WKTTPEKCEGYLGHYMLGQQYREDSEAVAYEAIVYAQSLELAGDGREIWIFDIDETSLSN  126

Query  452  LPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQF  631
            LPYYA+    FG   +N+T F+ WV++G AP++P  ++LY+ L+SLGIK VFL+G  +  
Sbjct  127  LPYYAKH--GFGVEPFNSTLFNEWVNKGEAPSLPESLKLYKKLLSLGIKIVFLTGRPEDQ  184

Query  632  RKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKKGYRIIGNIGDQWSDL  808
            R V   NLK  G+  WE LILKG++ +  TAV YKS +R  L KKGYRIIGNIGDQWSDL
Sbjct  185  RSVTENNLKNVGFYTWENLILKGSSYSGETAVVYKSSERKRLEKKGYRIIGNIGDQWSDL  244

Query  809  LGDNAGARTFKLPDPMYYIA  868
            LG NAG RTFKLPDPMYYI+
Sbjct  245  LGTNAGNRTFKLPDPMYYIS  264



>ref|XP_004510320.1| PREDICTED: stem 28 kDa glycoprotein-like [Cicer arietinum]
Length=262

 Score =   276 bits (705),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 138/259 (53%), Positives = 171/259 (66%), Gaps = 6/259 (2%)
 Frame = +2

Query  104  LLVVVLLATIP--TFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWA  277
              VV+ LAT       H     NQI  L+  +  GGH+IP ++C SWR+GVEA+NI +W 
Sbjct  6    FFVVIFLATCDGNVLKHEHGSTNQIFPLQMKSGPGGHYIPDLSCASWRVGVEAHNIINWK  65

Query  278  MVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLP  457
             +P++CE+YVG+YMLG QYR D   V      YAK   ++ DGKDIWVFDI+ETTLSNLP
Sbjct  66   TIPKECEKYVGNYMLGAQYRADSKYVNREGYYYAKTLNISGDGKDIWVFDIDETTLSNLP  125

Query  458  YYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRK  637
            YYA+    FG   YN   F+ WV  G APA+P   +LY  L+SLGIK VFL+G   + + 
Sbjct  126  YYAKH--GFGVEPYNEVAFNEWVEVGAAPALPESQKLYNKLLSLGIKIVFLTGRPLKQKN  183

Query  638  VRIANLKKTGYSHWEKLILKGAND--TRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLL  811
                NLK  GY  WEKLILK       +TAV YKS +R +L K+GYRI+GNIGDQWSD+L
Sbjct  184  STATNLKNAGYHTWEKLILKDTTKYHGKTAVTYKSSERKKLEKEGYRIVGNIGDQWSDIL  243

Query  812  GDNAGARTFKLPDPMYYIA  868
            G N G RTFKLPDP+YYI+
Sbjct  244  GTNIGQRTFKLPDPLYYIS  262



>ref|XP_009344485.1| PREDICTED: acid phosphatase 1-like [Pyrus x bretschneideri]
Length=274

 Score =   275 bits (702),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 144/256 (56%), Positives = 177/256 (69%), Gaps = 3/256 (1%)
 Frame = +2

Query  104  LLVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMV  283
            LL  + +    T ++   I + IH LR  +  GG  +PGV+CLSWRLGVE  NI +W  V
Sbjct  21   LLFFLAIFFSTTQAYEPLINHHIHLLRSKSGAGGSSVPGVSCLSWRLGVEVRNIINWKTV  80

Query  284  PQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYY  463
            P QCE YVGHYMLGHQYR D  AV   A  YAK+  L  DGK++WVFDI+ETTLSNLPYY
Sbjct  81   PAQCESYVGHYMLGHQYRKDSKAVTDVAWLYAKSLNLTKDGKNVWVFDIDETTLSNLPYY  140

Query  464  ARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVR  643
            AR    FG   YN+T FD WV EGTAPA+P  ++LY+ L+ LG+K VF++G  +  R V 
Sbjct  141  ARH--GFGTEVYNSTSFDEWVLEGTAPALPESLQLYKKLLKLGVKVVFITGRGEDRRSVT  198

Query  644  IANLKKTGYSHWEKLILKG-ANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDN  820
              NLK  GY  WEKL+LKG A   +T+  YKS +R +L K G+RIIGNIGDQWSD+LG +
Sbjct  199  TTNLKNVGYRTWEKLVLKGSAYSGKTSYVYKSAEREKLEKSGFRIIGNIGDQWSDILGTS  258

Query  821  AGARTFKLPDPMYYIA  868
             G RTFKLPDP+YYI+
Sbjct  259  VGNRTFKLPDPLYYIS  274



>gb|KDO51839.1| hypothetical protein CISIN_1g036571mg, partial [Citrus sinensis]
Length=251

 Score =   274 bits (700),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/238 (58%), Positives = 174/238 (73%), Gaps = 3/238 (1%)
 Frame = +2

Query  158  IPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYR  337
            IP+QIH LRP +    +  P ++CLSWRL VE NNI  W   P++CE Y+GHYMLG QYR
Sbjct  16   IPHQIHLLRPKSGARTNDFPDLSCLSWRLAVETNNIIGWKTTPEKCEGYLGHYMLGQQYR  75

Query  338  DDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFD  517
            +D  AVA  A+ YA++  LA DG++IW+FDI+ET+LSNLPYYA+    FG   +N+T F+
Sbjct  76   EDSEAVAYEAIVYAQSLELAGDGREIWIFDIDETSLSNLPYYAKH--GFGVEPFNSTLFN  133

Query  518  AWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILK  697
             WV++G AP++P  ++LY+ L+SLGIK VFL+G  +  R V   NLK  G+  WE LILK
Sbjct  134  EWVNKGEAPSLPESLKLYKKLLSLGIKIVFLTGRPEDQRSVTENNLKNVGFYTWENLILK  193

Query  698  GAN-DTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
            G++    TAV YKS +R  L KKGYRIIGNIGDQWSDLLG NAG RTFKLPDPMYYI+
Sbjct  194  GSSYSGETAVVYKSSERKRLEKKGYRIIGNIGDQWSDLLGTNAGNRTFKLPDPMYYIS  251



>emb|CBI36038.3| unnamed protein product [Vitis vinifera]
Length=501

 Score =   281 bits (719),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 145/255 (57%), Positives = 182/255 (71%), Gaps = 3/255 (1%)
 Frame = +2

Query  104  LLVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMV  283
            +LV+ LL        +  I ++IH LRP     GHH+PG++CLSWRLGVEA+NI +W+ V
Sbjct  250  VLVIWLLLFAGAVELSLGISHEIHLLRPQLGSSGHHVPGLSCLSWRLGVEAHNIIEWSTV  309

Query  284  PQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYY  463
            PQ CE YVGHYMLGHQYR D  AV   A+ YA++  LA DGKDIWVFD++ET+ SNLPYY
Sbjct  310  PQACESYVGHYMLGHQYRKDSRAVVYEALTYAQSLKLAVDGKDIWVFDVDETSPSNLPYY  369

Query  464  ARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVR  643
            A+    F   AYN+T+F+ WV EG APA+P  ++LY+ L+SLGIK VF++G  +  R V 
Sbjct  370  AKH--GFRVEAYNSTQFNNWVYEGKAPALPESLKLYKKLLSLGIKAVFITGRPEAQRNVT  427

Query  644  IANLKKTGYSHWEKLILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNA  823
             ANL+  GY  WEKLILKG++   T V YKS +R +L K GYRII NIGDQWSD+LG N 
Sbjct  428  AANLRNVGYHTWEKLILKGSS-AGTIVVYKSNERKKLKKSGYRIIDNIGDQWSDILGTNT  486

Query  824  GARTFKLPDPMYYIA  868
              RTFKL +PMYYI+
Sbjct  487  ENRTFKLSNPMYYIS  501


 Score =   220 bits (561),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 133/180 (74%), Gaps = 2/180 (1%)
 Frame = +2

Query  317  MLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATA  496
            MLG QYR D   V   A+ +A++  LA DGKDIWVFDI+ET+LSNLPY+A+    FG  A
Sbjct  1    MLGDQYRKDSGVVVYEAITHAQSLKLAGDGKDIWVFDIDETSLSNLPYFAKH--GFGVEA  58

Query  497  YNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSH  676
            YN+T+F+ W+ EG AP +P  ++LY+ L SLGIKPVF++G  +  R V  ANL+  GY  
Sbjct  59   YNSTQFNNWIYEGKAPPLPESLKLYKKLQSLGIKPVFITGRPEAQRNVTAANLQNAGYHT  118

Query  677  WEKLILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPM  856
            WEKLILKG++ T TAV YKS +R +L + GYRI+GNIGDQWSD+LG N G RTFKLPDP+
Sbjct  119  WEKLILKGSSVTGTAVAYKSNERKKLEQSGYRIVGNIGDQWSDILGTNVGNRTFKLPDPI  178



>ref|XP_008348489.1| PREDICTED: acid phosphatase 1-like [Malus domestica]
Length=274

 Score =   271 bits (693),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 141/274 (51%), Positives = 189/274 (69%), Gaps = 7/274 (3%)
 Frame = +2

Query  50   CPLTSYIIKKRKLTMRAFLLVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNC  229
             P +S+ +++    +  FL  V+  +T  T ++   I +QIH LRP +  GG  +PG++C
Sbjct  7    SPKSSHTMERLPGVLLFFL--VIFFST--TQAYEPLINHQIHLLRPKSGAGGSSVPGLSC  62

Query  230  LSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGK  409
            LSWRL VE  NI +W  VP QC  YVGHYMLGHQYR D   +   A  YAK+  L  DGK
Sbjct  63   LSWRLAVEVGNIINWKTVPAQCGSYVGHYMLGHQYRKDSKLITDVAWLYAKSLNLKKDGK  122

Query  410  DIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSL  589
            ++WVFDI+ETTLSNLPY+AR    FG  A+N T F+ WV EG APA+P  ++LY+ L+ L
Sbjct  123  NVWVFDIDETTLSNLPYFARQ--GFGTKAFNITAFNEWVLEGRAPALPESLQLYKKLLKL  180

Query  590  GIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKG-ANDTRTAVEYKSKKRTELVKKG  766
            G+K VF++G ++  R V I NL+  GY  WEKL+LKG A   +T+ E+KS +R +L K G
Sbjct  181  GVKVVFITGREEDQRSVTITNLRNVGYRTWEKLVLKGSAYSGKTSYEFKSAERAKLEKSG  240

Query  767  YRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
            +RIIGN+GDQWSD+LG +AG RTFKLPDP+YY++
Sbjct  241  FRIIGNMGDQWSDILGASAGNRTFKLPDPLYYVS  274



>ref|XP_008358084.1| PREDICTED: acid phosphatase 1-like [Malus domestica]
Length=261

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/256 (54%), Positives = 179/256 (70%), Gaps = 3/256 (1%)
 Frame = +2

Query  104  LLVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMV  283
            LL  + +    T ++   I +QIH LRP +  GG  +PG++CLSWRL VE  NI +W  V
Sbjct  8    LLFFLAIFFSTTQAYEPLINHQIHLLRPKSGAGGSSVPGLSCLSWRLAVEVGNIINWKTV  67

Query  284  PQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYY  463
            P QC  YVGHYMLGHQYR D   +   A  YAK+  L  DGK++WVFDI+ETTLSNLPY+
Sbjct  68   PAQCGSYVGHYMLGHQYRKDSKLITDVAWLYAKSLNLKKDGKNVWVFDIDETTLSNLPYF  127

Query  464  ARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVR  643
            AR    FG  A+N T F+ WV EG APA+P  ++LY+ L+ LG+K VF++G ++  R V 
Sbjct  128  ARQ--GFGTKAFNITAFNEWVLEGRAPALPESLQLYKKLLKLGVKVVFITGREEDQRSVT  185

Query  644  IANLKKTGYSHWEKLILKG-ANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDN  820
            I NL+  GY  WEKL+LKG A   +T+ E+KS +R +L K G+RIIGN+GDQWSD+LG +
Sbjct  186  ITNLRNVGYRTWEKLVLKGSAYSGKTSYEFKSAERAKLEKSGFRIIGNMGDQWSDILGAS  245

Query  821  AGARTFKLPDPMYYIA  868
            AG RTFKLPDP+YY++
Sbjct  246  AGNRTFKLPDPLYYVS  261



>ref|XP_004305256.1| PREDICTED: acid phosphatase 1-like [Fragaria vesca subsp. vesca]
Length=263

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 137/264 (52%), Positives = 173/264 (66%), Gaps = 3/264 (1%)
 Frame = +2

Query  80   RKLTMRAFLLVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEAN  259
            + L +   L +  L+AT       D     IH L+P +  GG H+  ++CLSWRLGVE +
Sbjct  2    KALPVLQLLFLATLVATTQGSFELDLADKIIHLLQPKSGSGGSHVGNISCLSWRLGVETH  61

Query  260  NIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEET  439
            NI DW  +P  CE YVGHYMLG QYR D   V   A  YA+   L  DG  +WVFD++ET
Sbjct  62   NIIDWTTIPAACEGYVGHYMLGDQYRKDSAVVTHEAYVYAEGLNLTDDGNKLWVFDVDET  121

Query  440  TLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGT  619
            TLSNLPYYA+    FG   YN+T F+AWV EG APA+P  ++LY+ L++LGIK  F++G 
Sbjct  122  TLSNLPYYAKH--GFGVEVYNSTAFNAWVLEGIAPALPESLKLYKKLLALGIKVAFITGR  179

Query  620  KQQFRKVRIANLKKTGYSHWEKLILKGAN-DTRTAVEYKSKKRTELVKKGYRIIGNIGDQ  796
             +  R V   NLK  GY  WE LILKG++    T+V YKS +RT+L + GY IIGNIGDQ
Sbjct  180  GESQRNVTETNLKNAGYDTWETLILKGSSYSGNTSVVYKSAERTKLEESGYTIIGNIGDQ  239

Query  797  WSDLLGDNAGARTFKLPDPMYYIA  868
            WSDL+G + G RTFKLPDPMYYI+
Sbjct  240  WSDLIGTSVGNRTFKLPDPMYYIS  263



>ref|XP_003627057.1| Acid phosphatase [Medicago truncatula]
 gb|AET01533.1| stem 28 kDa glycoprotein [Medicago truncatula]
Length=264

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/266 (51%), Positives = 173/266 (65%), Gaps = 5/266 (2%)
 Frame = +2

Query  77   KRKLTMRAFLLVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEA  256
            K+ L      L+V     I          NQI  LR  +  GGH+I  V+C SWRLG+EA
Sbjct  2    KKILIFFFVTLLVTCHGNILNHDDDHGSNNQIFPLRVKSGSGGHYIEEVSCASWRLGIEA  61

Query  257  NNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEE  436
            +NI +W  +P++CE+Y+G+YMLG QYR D  AV      YAK   +   GKDIWVFDI+E
Sbjct  62   HNIINWKTIPKECEKYIGNYMLGDQYRADSKAVNREGYFYAKTLNIT-TGKDIWVFDIDE  120

Query  437  TTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSG  616
            T+LSNLPYYA+    FG   YN T F+ WV  GTAPA+P   +LY  L+SLGIK  FL+G
Sbjct  121  TSLSNLPYYAKH--GFGVEPYNDTLFNQWVDLGTAPALPESKKLYNKLLSLGIKIAFLTG  178

Query  617  TKQQFRKVRIANLKKTGYSHWEKLILKGAN--DTRTAVEYKSKKRTELVKKGYRIIGNIG  790
               + +++   NL++ G+  WEKLILK       +TAV YKS +R +L ++GYRI+GNIG
Sbjct  179  RPLKQKEITAKNLRRAGFKKWEKLILKNTTIYHGKTAVTYKSSERKKLEEEGYRIVGNIG  238

Query  791  DQWSDLLGDNAGARTFKLPDPMYYIA  868
            DQWSD+LG N G RTFKLPDP+YYIA
Sbjct  239  DQWSDILGTNTGERTFKLPDPLYYIA  264



>ref|XP_006654133.1| PREDICTED: acid phosphatase 1-like [Oryza brachyantha]
Length=272

 Score =   267 bits (682),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/247 (52%), Positives = 167/247 (68%), Gaps = 3/247 (1%)
 Frame = +2

Query  131  IPTFSHADSI-PNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYV  307
            +PT    D +    IH+LRP    G   + G+ C SWRLGVEA+NI DW  VP +CE YV
Sbjct  28   VPTERLEDEVVAPLIHALRPLLGSGAGQLAGLPCDSWRLGVEAHNIIDWETVPAKCEGYV  87

Query  308  GHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFG  487
            GHYMLG  YR D   V   AV YA+   LA +GK++W+FD++ETTLSNLPYYA  +  FG
Sbjct  88   GHYMLGGHYRRDSAVVVDEAVAYAETLQLAGNGKEVWIFDVDETTLSNLPYYA--NYGFG  145

Query  488  ATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTG  667
            A  +N T F  + +EGTAPA+P  +RLY+ L+ LGIKPV L+G ++  R     NL++ G
Sbjct  146  AKPFNHTSFINYAAEGTAPALPETLRLYQRLLELGIKPVILTGRREYLRDATEKNLRQQG  205

Query  668  YSHWEKLILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLP  847
            YS WEKL+LK  +  +    +KS +R +LV  GY I+GNIGDQWSD+LG   G+RTFKLP
Sbjct  206  YSMWEKLLLKPTSALQAGAAFKSGERQKLVDAGYAIVGNIGDQWSDILGAPEGSRTFKLP  265

Query  848  DPMYYIA  868
            DPMYY++
Sbjct  266  DPMYYVS  272



>gb|EMS46715.1| Stem 28 kDa glycoprotein [Triticum urartu]
Length=269

 Score =   266 bits (680),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 135/246 (55%), Positives = 165/246 (67%), Gaps = 4/246 (2%)
 Frame = +2

Query  131  IPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVG  310
            +PT      +   IH+LRP    G H   GV C SW LGVEA+N+RDW  VP  CE YVG
Sbjct  28   MPTSLDEAVVAPLIHALRPLLGSGKH--AGVACDSWVLGVEAHNVRDWKTVPASCEGYVG  85

Query  311  HYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGA  490
            HYMLG  +R D   V   A+ Y  N  LA +GK++WVFDI+ETTLSNLPYYA+    FGA
Sbjct  86   HYMLGKHFRRDSKIVIDQALAYVDNLKLAGNGKEVWVFDIDETTLSNLPYYAKH--GFGA  143

Query  491  TAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGY  670
            T +NAT F+A+V EG+APA+P   RLY  L+S+GIKPVFL+G  +  R V I NL++ G 
Sbjct  144  TPFNATSFNAYVLEGSAPALPETKRLYNKLLSVGIKPVFLTGRTEDQRAVTITNLRRQGI  203

Query  671  SHWEKLILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPD  850
            S W  L+LK      +AV YKS +R +L   G+ I+GNIGDQWSD+LG   GARTFKLPD
Sbjct  204  SGWMNLLLKQPGFKGSAVTYKSGERQKLQDAGFVIVGNIGDQWSDILGAPEGARTFKLPD  263

Query  851  PMYYIA  868
            PMYYI 
Sbjct  264  PMYYIG  269



>gb|AFK46217.1| unknown [Medicago truncatula]
Length=264

 Score =   266 bits (680),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 135/266 (51%), Positives = 172/266 (65%), Gaps = 5/266 (2%)
 Frame = +2

Query  77   KRKLTMRAFLLVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEA  256
            K+ L      L+V     I          NQI  LR  +  GGH+I  V+C SWRLG+EA
Sbjct  2    KKILIFFFVTLLVTCHGNILNHDDDHGSNNQIFPLRVKSGSGGHYIEEVSCASWRLGIEA  61

Query  257  NNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEE  436
            +NI +W  +P++CE+Y+G+YMLG QYR D  AV      YAK   +   GKDIWVFDI+E
Sbjct  62   HNIINWKTIPKECEKYIGNYMLGDQYRADSKAVNREGYFYAKTLNIT-TGKDIWVFDIDE  120

Query  437  TTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSG  616
            T+LSNLPYYA+    FG   YN T F+ WV  GTAPA+P   +LY  L+SLGIK  FL+G
Sbjct  121  TSLSNLPYYAKH--GFGVEPYNDTLFNQWVDLGTAPALPESKKLYNKLLSLGIKIAFLTG  178

Query  617  TKQQFRKVRIANLKKTGYSHWEKLILKGAN--DTRTAVEYKSKKRTELVKKGYRIIGNIG  790
               + +++   NL++ G+  WEKLILK       +TAV YKS +R +L + GYRI+GNIG
Sbjct  179  RPLKQKEITAKNLRRAGFKKWEKLILKNTTIYHGKTAVTYKSSERKKLEEGGYRIVGNIG  238

Query  791  DQWSDLLGDNAGARTFKLPDPMYYIA  868
            DQWSD+LG N G RTFKLPDP+YYIA
Sbjct  239  DQWSDILGTNTGERTFKLPDPLYYIA  264



>ref|XP_009381186.1| PREDICTED: acid phosphatase 1-like [Musa acuminata subsp. malaccensis]
Length=263

 Score =   266 bits (679),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 129/236 (55%), Positives = 160/236 (68%), Gaps = 2/236 (1%)
 Frame = +2

Query  161  PNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRD  340
            P  IH L+P    GG    GV C SWR GVE NN+R W  VP+ CE YVGHYMLG +YR 
Sbjct  30   PPAIHLLKPLFGSGGLPADGVTCASWRFGVETNNVRGWRTVPRSCEGYVGHYMLGDRYRQ  89

Query  341  DCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDA  520
            D   V  +A  Y +   +  DG D W+FDI+ET LSNLPYYA     FG   YNAT F+A
Sbjct  90   DSAVVTAAAAAYVEGLQIPGDGMDAWIFDIDETVLSNLPYYAHH--GFGVEPYNATSFNA  147

Query  521  WVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKG  700
            WV +G APA+P  ++LY  L+ LGIK VFL+G  ++ R V I NLK+ GY  WEKL+LKG
Sbjct  148  WVDKGIAPALPESLKLYHKLLPLGIKIVFLTGRSEERRNVTITNLKRAGYRTWEKLLLKG  207

Query  701  ANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
                 TA+ +K+ +R +L ++GYRI+GNIGDQWSD+LG   GARTFKLPDP+YYI+
Sbjct  208  EGVNGTAMAFKTAEREKLEEQGYRIVGNIGDQWSDILGKPEGARTFKLPDPLYYIS  263



>gb|AFK40440.1| unknown [Lotus japonicus]
Length=261

 Score =   264 bits (675),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/259 (51%), Positives = 169/259 (65%), Gaps = 7/259 (3%)
 Frame = +2

Query  107  LVVVLLATIPTFSHADS---IPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWA  277
            +++ L+ATI    H  S   +   +  LR  T  GGH+IP V+C SW LGVEA+NI +W 
Sbjct  5    ILLFLVATILATCHGSSDHGVSFNVFPLRMKTGSGGHYIPDVSCASWTLGVEAHNIINWK  64

Query  278  MVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLP  457
             +P++CE YVG+YM+G QYR D   V   A  YA++  L  DGK+IWVFDI+ET+LSNLP
Sbjct  65   TIPEECEGYVGNYMIGQQYRSDSKTVCKQAYFYARSLNLPRDGKNIWVFDIDETSLSNLP  124

Query  458  YYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRK  637
            YYA     FG   YN T F+ WV    AP +P  ++LY  L+SLGIK  FL+G     + 
Sbjct  125  YYAEH--GFGLELYNDTAFNLWVDRAAAPVLPESLKLYNKLLSLGIKIAFLTGRPLSQKD  182

Query  638  VRIANLKKTGYSHWEKLILKGAN--DTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLL  811
                NLK  G+  WEKLILK  +    +TAV YKS +R +L ++GYRIIGNIGDQWSD+L
Sbjct  183  NTAKNLKLAGFYTWEKLILKEPSTYSGKTAVTYKSAERKKLEEEGYRIIGNIGDQWSDIL  242

Query  812  GDNAGARTFKLPDPMYYIA  868
            G   G RTFKLPDPMYYI+
Sbjct  243  GTTTGNRTFKLPDPMYYIS  261



>ref|XP_009797387.1| PREDICTED: acid phosphatase 1-like [Nicotiana sylvestris]
Length=239

 Score =   263 bits (672),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 166/222 (75%), Gaps = 6/222 (3%)
 Frame = +2

Query  212  IPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNAT  391
            +P +NCLSWR+ VE NNIRDW  VP QC+ YV  YM   QYRDDC AV I+A+QYAK   
Sbjct  20   VPQINCLSWRMAVETNNIRDWKTVPVQCKSYVSEYMTSQQYRDDCNAVVIAAIQYAKTLN  79

Query  392  LAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLY  571
            ++ +GKD+WVF+I+ETTLSN+PYY+R +V FGAT  +  K+++W+ EG +PAVPG + LY
Sbjct  80   VSKEGKDLWVFNIDETTLSNVPYYSRPEVGFGATKSSGKKYESWIKEGKSPAVPGALLLY  139

Query  572  RTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDTRTAVE----YKSK  739
            +TL+ LGIKP+F++ TK++FR++RIANLKK GY  W K I KG ND+    E    +K++
Sbjct  140  KTLLDLGIKPIFITDTKEEFRQLRIANLKKAGYHSWFKFICKGKNDSELYSEHKGNWKTQ  199

Query  740  KRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            KR ELVK GYR++GN+G  W D++ D    RTFK+P+PMYY 
Sbjct  200  KRAELVKAGYRLVGNLGG-WDDIIVDFL-LRTFKMPNPMYYF  239



>ref|XP_003530059.1| PREDICTED: stem 28 kDa glycoprotein-like [Glycine max]
Length=264

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/236 (57%), Positives = 161/236 (68%), Gaps = 6/236 (3%)
 Frame = +2

Query  167  QIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDC  346
            QI  LR  T  GGH+IP V+C SWRLGVEA+N+ DW  +PQ CE Y+G+YMLGHQYR D 
Sbjct  33   QIFPLRMKTGPGGHYIPEVSCKSWRLGVEAHNVIDWRTIPQDCEGYIGNYMLGHQYRSDS  92

Query  347  IAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWV  526
              V   A  YAK  T+    K  WVFD++ETTLSNLPY+A  D  FG   YNAT F+ WV
Sbjct  93   KTVCREAYFYAK--TINITAKTTWVFDVDETTLSNLPYFA--DHGFGVELYNATAFNEWV  148

Query  527  SEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAN  706
              G APA+P  ++LY  L+SLGIK VF++G     + V   NLK  GY  WEKLI K  +
Sbjct  149  DLGEAPALPESLKLYNKLLSLGIKIVFITGRPLYQQAVTATNLKLAGYYKWEKLITKDTD  208

Query  707  --DTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
              + +TAV YKS +R +L + GY IIGNIGDQWSD+LG N G RTFKLPDPMYYI+
Sbjct  209  KYNGKTAVTYKSTERQKLEENGYNIIGNIGDQWSDILGTNTGLRTFKLPDPMYYIS  264



>dbj|BAJ94050.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89326.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=272

 Score =   263 bits (671),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 127/233 (55%), Positives = 160/233 (69%), Gaps = 4/233 (2%)
 Frame = +2

Query  170  IHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCI  349
            IH+LRP    G     GV C SWRLGVEA+N+RDW  VP  CE+YVGHYM+G  YR D  
Sbjct  44   IHALRPLLGSGKQ--AGVACDSWRLGVEAHNVRDWKTVPASCEDYVGHYMVGDHYRRDSK  101

Query  350  AVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVS  529
             V   A+ Y  +  LA +GK++WVFD++ETTLSNLPYYA+    FGAT +N+T F A+  
Sbjct  102  VVIDQAIAYVDSLKLAGNGKEVWVFDVDETTLSNLPYYAKH--GFGATPFNSTSFRAYAR  159

Query  530  EGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND  709
            EG+APA+P   RLY  L+S+GIKPV L+G ++  R     NL+  GYS W KL+LK  + 
Sbjct  160  EGSAPALPETKRLYNKLLSVGIKPVILTGRRENLRASTTTNLRSQGYSRWMKLLLKQQDF  219

Query  710  TRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
              ++V +KS +R +L   GY I+GNIGDQWSD+LG   GARTFKLPDPMYYI 
Sbjct  220  RGSSVTFKSGERQKLQNAGYIIVGNIGDQWSDILGAPEGARTFKLPDPMYYIG  272



>gb|EYU36713.1| hypothetical protein MIMGU_mgv1a012835mg [Erythranthe guttata]
Length=238

 Score =   261 bits (668),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 157/217 (72%), Gaps = 2/217 (1%)
 Frame = +2

Query  224  NCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHD  403
            NCLSWRL VE NN+R+W +VP +C  +V  YM   QYR DC  VA +AV++AK   LA D
Sbjct  22   NCLSWRLSVETNNLRNWKLVPNECATHVKVYMERGQYRQDCDIVADTAVEFAKTVKLAGD  81

Query  404  GKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLV  583
            GK+IWVFDI+ET LSNLP+YAR DVA+GA +YN T    W+ EG APA P  ++LY+ L+
Sbjct  82   GKEIWVFDIDETALSNLPFYARPDVAYGAKSYNWTGLGEWIKEGKAPANPSMLKLYKELI  141

Query  584  SLGIKPVFLSG-TKQQFRKVRIANLKKTGYSHWEKLILKGANDTRTAVE-YKSKKRTELV  757
            +L  K VFL+G  +++F K RI+NLK  GY+ WEKLI K   +  T  + +KSKKR EL 
Sbjct  142  ALKYKIVFLTGANEERFMKPRISNLKNAGYTTWEKLIFKPGAEKGTPTKIFKSKKRKELE  201

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
              GYRI+GN+GDQW DL+GD  G RTFKLP+PMYY+A
Sbjct  202  TAGYRIVGNVGDQWGDLVGDYVGMRTFKLPNPMYYVA  238



>ref|XP_003627058.1| Stem 28 kDa glycoprotein [Medicago truncatula]
 gb|AET01534.1| stem 28 kDa glycoprotein [Medicago truncatula]
 gb|AFK40192.1| unknown [Medicago truncatula]
Length=261

 Score =   262 bits (669),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 137/260 (53%), Positives = 169/260 (65%), Gaps = 7/260 (3%)
 Frame = +2

Query  101  FLLVVVLLATI--PTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDW  274
               +V LLAT      +H       I  LR  T  GG +IP V+C SWR+ VEA NI +W
Sbjct  5    LFFLVTLLATCHGNVQNHEHESNFNIFPLRMKTGPGGKYIPEVSCASWRVAVEARNIINW  64

Query  275  AMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNL  454
              VPQ+CEEYVG+YMLG QYR D   V      YA+   L  DG+D+WVFDI+ETTLSNL
Sbjct  65   KTVPQECEEYVGNYMLGDQYRADSKFVNREGFFYARTLNLK-DGRDLWVFDIDETTLSNL  123

Query  455  PYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFR  634
            PYYA     FG   YN T F+AWV EG APA+P   +LY  LV+LG+K  FL+G   + +
Sbjct  124  PYYATH--GFGVNPYNETLFNAWVDEGAAPALPETQKLYNKLVNLGVKIAFLTGRPLKQK  181

Query  635  KVRIANLKKTGYSHWEKLILKGAN--DTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDL  808
             +   NLK+ GY  +EKLILK       +TAV+YKS +R +L ++G+RIIGN GDQWSD+
Sbjct  182  DITAKNLKEAGYHTYEKLILKDTELYHGKTAVQYKSSERKKLEEEGWRIIGNSGDQWSDI  241

Query  809  LGDNAGARTFKLPDPMYYIA  868
            LG N G RTFKLPDP+YYIA
Sbjct  242  LGTNTGERTFKLPDPLYYIA  261



>dbj|BAJ94870.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=271

 Score =   262 bits (670),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/241 (55%), Positives = 160/241 (66%), Gaps = 4/241 (2%)
 Frame = +2

Query  152  DSIPNQIHSLRPHTAGGGH--HIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLG  325
            D++   IH+LRP    GG      GV C SWRLGVEA N+RDW  VP  CE YVGHYMLG
Sbjct  33   DAVAPLIHALRPLLGSGGQLGSRGGVPCDSWRLGVEAYNVRDWKTVPANCEGYVGHYMLG  92

Query  326  HQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNA  505
            + +R D   V   A+ Y     L  +GKD+WVFDI+ETTLSNLPYYA     FGA  YNA
Sbjct  93   NHFRRDFKVVIDQAIAYVDGLKLNGNGKDVWVFDIDETTLSNLPYYATH--GFGARPYNA  150

Query  506  TKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEK  685
            T FDA+V EG+APA+P   RLY  L+ +GIKPVF++G  +  R V + NL+  G+S W  
Sbjct  151  TSFDAYVLEGSAPALPETKRLYYKLLKVGIKPVFITGRTEDKRAVTVGNLRSQGFSGWMN  210

Query  686  LILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            L LK      +A+ YKS +R +L   GY I+GNIGDQWSD+LG   GARTFKLPDP+YYI
Sbjct  211  LTLKQHGFKGSAISYKSAERKKLQDAGYVIVGNIGDQWSDILGAPEGARTFKLPDPIYYI  270

Query  866  A  868
            A
Sbjct  271  A  271



>ref|XP_010088387.1| Stem 28 kDa glycoprotein [Morus notabilis]
 gb|EXB34861.1| Stem 28 kDa glycoprotein [Morus notabilis]
Length=259

 Score =   261 bits (668),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 134/257 (52%), Positives = 171/257 (67%), Gaps = 4/257 (2%)
 Frame = +2

Query  101  FLLVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAM  280
            FL   VL A      +   I N I+ LRP    GG    GV+CLSWR GVE NNI DW+ 
Sbjct  6    FLASTVLAAKAQADFNNPLINNLIYLLRPRYGSGGGGN-GVSCLSWRFGVETNNIIDWST  64

Query  281  VPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPY  460
            +P++CE YVG+YMLG QYR D   V   A  YA +  L+ DGKD+W+FDI+ET+LSNLPY
Sbjct  65   IPEKCELYVGNYMLGEQYRKDSEVVIKEAYLYATSLNLSKDGKDVWIFDIDETSLSNLPY  124

Query  461  YARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKV  640
            YAR    FG   +N T F  W+    APA+P  ++LY++L+SLG K VFLSG  ++ R  
Sbjct  125  YARH--GFGVEPFNLTSFTEWILTEDAPALPETLKLYKSLISLGFKIVFLSGRYEKTRSA  182

Query  641  RIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGD  817
               NL   GY  WEK++L+  +D + +++EYKS +R +LVK GY I+GNIGDQWSDLLG 
Sbjct  183  TERNLIYVGYKAWEKVLLRKDSDKSASSLEYKSAQRKQLVKDGYSIVGNIGDQWSDLLGT  242

Query  818  NAGARTFKLPDPMYYIA  868
            + G RTFKLPDPMYYI+
Sbjct  243  DPGNRTFKLPDPMYYIS  259



>emb|CAB71336.2| putative acid phosphatase [Hordeum vulgare subsp. vulgare]
 emb|CAF31501.1| putative acid phosphatase [Hordeum vulgare subsp. vulgare]
Length=272

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 130/233 (56%), Positives = 155/233 (67%), Gaps = 4/233 (2%)
 Frame = +2

Query  170  IHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCI  349
            IH+LRP    G     GV C SWRLGVEA N+RDW  VP  CE YVGHYMLG+ +R DC 
Sbjct  44   IHALRPLLGSGKQ--AGVACDSWRLGVEAYNVRDWKTVPANCEGYVGHYMLGNHFRRDCK  101

Query  350  AVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVS  529
             V   A+ Y     LA +GKD+WVFDI+ETTLSNLPYYA     FGA  YNAT FDA+V 
Sbjct  102  VVIDQAIAYVDGLKLAGNGKDVWVFDIDETTLSNLPYYATH--GFGARPYNATSFDAYVM  159

Query  530  EGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND  709
            EG+AP +P   RLY  L+ +GIKPVF++G  +  R V + NL+  G+S W  L LK    
Sbjct  160  EGSAPVLPETKRLYYKLLKVGIKPVFITGRTEDKRAVTVGNLRSQGFSGWMSLTLKQHGF  219

Query  710  TRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
              +A+ YKS +R +L   GY I+GNIGDQWSD+LG   GARTF  PDPMYYIA
Sbjct  220  KGSAISYKSAERKKLEDAGYVIVGNIGDQWSDILGAPEGARTFSRPDPMYYIA  272



>ref|XP_009625320.1| PREDICTED: acid phosphatase 1-like [Nicotiana tomentosiformis]
Length=237

 Score =   259 bits (663),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/219 (56%), Positives = 163/219 (74%), Gaps = 6/219 (3%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            +NCLSWR+ VE NNIRDW  VP QC+ YV  YM   QYRDDC AV I+A++YAK+  ++ 
Sbjct  21   INCLSWRIAVETNNIRDWKTVPTQCKSYVSEYMTSQQYRDDCNAVVIAAIEYAKSLNISK  80

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            +GKD+WVF+I+ETTLSN+PYY+R  V FGAT  +  KF++W+ EG +PAVPG + LY+ L
Sbjct  81   EGKDLWVFNIDETTLSNVPYYSRPQVGFGATKSSGKKFESWIKEGKSPAVPGVLLLYKIL  140

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDTRTAVE----YKSKKRT  748
            + LGIKP+F++ TK++FR++RIANLKK GY  W K I KG ND+    E    +K++KR 
Sbjct  141  LDLGIKPIFITDTKEEFRQLRIANLKKAGYHSWFKFICKGKNDSELYTEHKGNWKTQKRA  200

Query  749  ELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            ELVK GYR++GN+G  W D++ D    RTFK+P+PMYY 
Sbjct  201  ELVKAGYRLVGNLGG-WDDIIVDFL-LRTFKMPNPMYYF  237



>ref|XP_003568779.1| PREDICTED: stem 28 kDa glycoprotein [Brachypodium distachyon]
Length=287

 Score =   261 bits (667),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 129/235 (55%), Positives = 161/235 (69%), Gaps = 4/235 (2%)
 Frame = +2

Query  170  IHSLRPHTAGGGH--HIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDD  343
            IH+LRP    GG    + GV C SW LGVEA+N+R W  +P +CE YVGHYMLG ++R D
Sbjct  55   IHALRPLLGSGGEMGSLGGVACDSWLLGVEAHNVRGWKTIPAKCEGYVGHYMLGSRFRRD  114

Query  344  CIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAW  523
               V   A+ YA+   LA +GKD+WVFDI+ETTLSNLPYYA     FGA  +NAT F+A+
Sbjct  115  SKVVIDEAIAYAEGLKLAGNGKDVWVFDIDETTLSNLPYYATH--GFGAKPFNATSFNAY  172

Query  524  VSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGA  703
            V EG+APA+P   RLY  LVS+G+KPVFL+G  +  R +   NL++ G + W  L+LK  
Sbjct  173  VLEGSAPALPETKRLYNKLVSMGVKPVFLTGRTEDQRVITETNLRRQGITGWMNLLLKQP  232

Query  704  NDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
                +AV YKS +R +L   GY I+GNIGDQWSDLLG   G+RTFKLPDPMYYI 
Sbjct  233  GFKGSAVAYKSGERQKLQDAGYAIVGNIGDQWSDLLGAPEGSRTFKLPDPMYYIG  287



>dbj|BAJ90845.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=271

 Score =   260 bits (665),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 131/241 (54%), Positives = 159/241 (66%), Gaps = 4/241 (2%)
 Frame = +2

Query  152  DSIPNQIHSLRPHTAGGGH--HIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLG  325
            D++   IH+LRP    GG      GV C SWRLGVEA N+RDW  VP  CE YVGHYMLG
Sbjct  33   DAVAPLIHALRPLLGSGGQLGSRGGVPCDSWRLGVEAYNVRDWKTVPANCEGYVGHYMLG  92

Query  326  HQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNA  505
            + +R D   V    + Y     L  +GKD+WVFDI+ETTLSNLPYYA     FGA  YNA
Sbjct  93   NHFRRDFKVVIDQTIAYVDGLKLNGNGKDVWVFDIDETTLSNLPYYATH--GFGARPYNA  150

Query  506  TKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEK  685
            T FDA+V EG+APA+P   RLY  L+ +GIKPVF++G  +  R V + NL+  G+S W  
Sbjct  151  TSFDAYVLEGSAPALPETKRLYYKLLKVGIKPVFITGRTEDKRAVTVGNLRSQGFSGWMN  210

Query  686  LILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            L LK      +A+ YKS +R +L   GY I+GNIGDQWSD+LG   GARTFKLPDP+YYI
Sbjct  211  LTLKQHGFKGSAISYKSAERKKLQDAGYVIVGNIGDQWSDILGAPEGARTFKLPDPIYYI  270

Query  866  A  868
            A
Sbjct  271  A  271



>ref|XP_004960901.1| PREDICTED: stem 28 kDa glycoprotein-like [Setaria italica]
Length=268

 Score =   260 bits (664),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 157/235 (67%), Gaps = 4/235 (2%)
 Frame = +2

Query  170  IHSLRPHTAGGGH--HIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDD  343
            IH+LRP     G      GV C SWRL VEA N RDW  VP  CE YVGHYMLG  YR D
Sbjct  36   IHALRPMVGSAGDLGRRGGVPCDSWRLAVEAYNKRDWRTVPADCEGYVGHYMLGGHYRRD  95

Query  344  CIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAW  523
               V   AV YA+   L   GK++WVFDI+ET+LSNLPYYA     FG   YNAT F+A+
Sbjct  96   SRVVVNEAVAYAEGLKLGGKGKEVWVFDIDETSLSNLPYYATH--GFGTKPYNATSFNAY  153

Query  524  VSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGA  703
            V EG+AP +P   RLY  L++LGIKPVFL+G  +  R + +ANL++ GYS W KL+LK  
Sbjct  154  VLEGSAPVLPETQRLYNKLIALGIKPVFLTGRTEDQRAITVANLRRQGYSGWMKLLLKPV  213

Query  704  NDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
                +AV +KS +R +LV  GY I+GNIGDQWSD+LG   GARTFKLPDP+YYI 
Sbjct  214  GFKASAVGFKSGERKKLVDAGYVIVGNIGDQWSDILGAPEGARTFKLPDPIYYIG  268



>gb|EMT03894.1| Stem 28 kDa glycoprotein [Aegilops tauschii]
Length=273

 Score =   259 bits (662),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/233 (55%), Positives = 156/233 (67%), Gaps = 4/233 (2%)
 Frame = +2

Query  170  IHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCI  349
            IH+LRP    G H   GV C SWRLGVEA N+RDW  VP  CE+YVGHYM+G  YR D  
Sbjct  45   IHALRPLLGSGRH--AGVACDSWRLGVEAYNVRDWKAVPASCEDYVGHYMVGDHYRRDSK  102

Query  350  AVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVS  529
             V   A+ Y  +  LA  GK++WVFD++ETTLSNLPYYA+    FGAT +N T F+A+  
Sbjct  103  VVVDQAIAYVDSLKLAGKGKEVWVFDVDETTLSNLPYYAKH--GFGATPFNVTSFNAYAH  160

Query  530  EGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND  709
            EG+APA+P   RLY  L S+GIKPV L+G  +  R     NL++ GYS W  L+LK    
Sbjct  161  EGSAPALPETKRLYNKLFSVGIKPVILTGRAEYLRASTATNLRRQGYSRWMNLLLKAPGF  220

Query  710  TRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
              ++V +KS +R +L   GY I+GNIGDQWSD+LG   GARTFKLPDPMYYI 
Sbjct  221  KGSSVAFKSGERQKLQDAGYIIVGNIGDQWSDILGAPEGARTFKLPDPMYYIG  273



>gb|KHN39260.1| Stem 28 kDa glycoprotein [Glycine soja]
Length=226

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 157/228 (69%), Gaps = 6/228 (3%)
 Frame = +2

Query  191  TAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAV  370
            T  GGH+IP V+C SWRLGVEA+N+ DW  +PQ CE Y+G+YMLGHQYR D   V   A 
Sbjct  3    TGPGGHYIPEVSCKSWRLGVEAHNVIDWRTIPQDCEGYIGNYMLGHQYRSDSKTVCREAY  62

Query  371  QYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAV  550
             YAK  T+    K  WVFD++ETTLSNLPY+A  D  FG   YNAT F+ WV  G APA+
Sbjct  63   FYAK--TINITAKTTWVFDVDETTLSNLPYFA--DHGFGVELYNATAFNEWVDLGEAPAL  118

Query  551  PGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAN--DTRTAV  724
            P  ++LY  L+SLGIK VF++G     + V   NLK  GY  WEKLI K  +  + +TAV
Sbjct  119  PESLKLYNKLLSLGIKIVFITGRPLYQQAVTATNLKLAGYYKWEKLITKDTDKYNGKTAV  178

Query  725  EYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
             YKS +R +L + GY IIGNIGDQWSD+LG N G RTFKLPDPMYYI+
Sbjct  179  TYKSTERQKLEENGYNIIGNIGDQWSDILGTNTGHRTFKLPDPMYYIS  226



>ref|XP_002440748.1| hypothetical protein SORBIDRAFT_09g006010 [Sorghum bicolor]
 gb|EES19178.1| hypothetical protein SORBIDRAFT_09g006010 [Sorghum bicolor]
Length=285

 Score =   259 bits (663),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/234 (56%), Positives = 159/234 (68%), Gaps = 4/234 (2%)
 Frame = +2

Query  170  IHSLRP--HTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDD  343
            IH+L P   +AG      GV C SWRL VEA N RDW  VP  CE YVGHYMLG QYR D
Sbjct  53   IHALHPLVGSAGDLGRRAGVPCDSWRLAVEAYNKRDWKTVPANCEHYVGHYMLGRQYRLD  112

Query  344  CIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAW  523
               VA  A+ YA+   LA +GK++WVFDI+ET+LSNLPYYA+    FG   YNAT F+ +
Sbjct  113  SRVVADEAIAYAEGLKLAGNGKEVWVFDIDETSLSNLPYYAKH--GFGTKPYNATSFNEY  170

Query  524  VSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGA  703
            V EG+AP +P   RL++ L+SLGIKPVFL+G  +  R + + NL++ GYS W  L+LK  
Sbjct  171  VLEGSAPVLPETQRLFKKLISLGIKPVFLTGRTEDQRAITVTNLRRQGYSGWMHLLLKPI  230

Query  704  NDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
                TA+ YKS  R +L   GY I+GNIGDQWSD+LG   GARTFKLPDP+YYI
Sbjct  231  GFKGTAIGYKSGARQKLQNAGYVIVGNIGDQWSDILGAPEGARTFKLPDPLYYI  284



>ref|XP_007135625.1| hypothetical protein PHAVU_010G144600g [Phaseolus vulgaris]
 gb|ESW07619.1| hypothetical protein PHAVU_010G144600g [Phaseolus vulgaris]
Length=260

 Score =   258 bits (660),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 143/264 (54%), Positives = 174/264 (66%), Gaps = 9/264 (3%)
 Frame = +2

Query  92   MRAFLLVVVLLATIPTFSHADSI---PNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANN  262
            MR  + V VL  ++  +    S     NQI  LR  T  GGH+IP V+C SWR+GVEA+N
Sbjct  1    MRMKVFVFVLAVSVGAWQCEGSEHGHENQIFPLRMKTGSGGHYIPEVSCQSWRVGVEAHN  60

Query  263  IRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETT  442
            + +W  VP  CE YVG+YMLG QYR D   V   A  YAK  TL    +DIWVFD++ETT
Sbjct  61   VVEWKTVPADCEGYVGNYMLGKQYRSDSKTVCHEAFSYAK--TLNITSRDIWVFDVDETT  118

Query  443  LSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTK  622
            LSNLPYYA     FG   YNAT  D WV  G APA+P  ++LY+ L+SLGIK VFL+G  
Sbjct  119  LSNLPYYAHH--GFGVEPYNATTSDEWVEVGEAPALPESLKLYKKLLSLGIKIVFLTGRP  176

Query  623  QQFRKVRIANLKKTGYSHWEKLILKGAN--DTRTAVEYKSKKRTELVKKGYRIIGNIGDQ  796
               + V + NLK  GY  WEKLILK  +    +TAV YKS +R ++ K+GY+IIGNIGDQ
Sbjct  177  LNQKAVTVTNLKIAGYHKWEKLILKDTSIYHGKTAVTYKSSERKKVEKEGYKIIGNIGDQ  236

Query  797  WSDLLGDNAGARTFKLPDPMYYIA  868
            WSD+LG N G RTFKLPDPMYYI+
Sbjct  237  WSDILGTNTGQRTFKLPDPMYYIS  260



>ref|XP_002439412.1| hypothetical protein SORBIDRAFT_09g005960 [Sorghum bicolor]
 gb|EES17842.1| hypothetical protein SORBIDRAFT_09g005960 [Sorghum bicolor]
Length=268

 Score =   258 bits (658),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 128/241 (53%), Positives = 163/241 (68%), Gaps = 5/241 (2%)
 Frame = +2

Query  152  DSIPNQIHSLRP--HTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLG  325
            D +P  IH LRP  H++G    + GV C SWR  VE + +RDW  VP +CE+YVG+YMLG
Sbjct  31   DGMP-LIHMLRPLLHSSGHLGRLGGVPCDSWRFAVETDTLRDWETVPARCEKYVGNYMLG  89

Query  326  HQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNA  505
             QYR D  AV   AV YA+   L+ DGK++WVFD++ETTLSNLPYYA     FG+  YN+
Sbjct  90   GQYRSDSQAVVDEAVAYAEGLKLSGDGKEVWVFDVDETTLSNLPYYAEH--GFGSEPYNS  147

Query  506  TKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEK  685
            T F A+     APA+P   RLY+ L  LGIKPV L+G ++  R+    NL   GY+ +EK
Sbjct  148  TAFGAYTKLANAPALPETQRLYKRLQELGIKPVILTGRREDKRESTAKNLADVGYTGYEK  207

Query  686  LILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            L+LK  +   TAVE+KS +R +LV  GY I+GNIGDQW+DLLG+  G RTFKLPDPMYY+
Sbjct  208  LLLKPQDARVTAVEFKSGERKKLVDAGYVIVGNIGDQWTDLLGEPEGDRTFKLPDPMYYV  267

Query  866  A  868
             
Sbjct  268  G  268



>gb|EMS66285.1| Stem 28 kDa glycoprotein [Triticum urartu]
Length=275

 Score =   258 bits (658),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 158/233 (68%), Gaps = 4/233 (2%)
 Frame = +2

Query  170  IHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCI  349
            IH+LRP    G H   G+ C SWRLGVEA N+RDW  VP  CE YVGHYM+G  YR D  
Sbjct  47   IHALRPLLGSGSH--AGMACDSWRLGVEAYNVRDWKTVPASCEGYVGHYMVGDHYRRDSK  104

Query  350  AVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVS  529
             V   A+ Y  +  LA +GK++WVFD++ETTLSNLPYYA+    FGAT +N T+F+A+  
Sbjct  105  VVVDQAIAYVDSLKLAGNGKEVWVFDVDETTLSNLPYYAKH--GFGATPFNVTRFNAYAQ  162

Query  530  EGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND  709
            EG+APA+P   RLY  L+S+GIKPV L+G  +  R     NL++ GYS W  L+LK    
Sbjct  163  EGSAPALPETKRLYNKLLSVGIKPVILTGRAEYLRASTATNLRRQGYSGWMNLLLKAPGF  222

Query  710  TRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
              ++V +KS ++ +L   GY I+GNIGDQWSD++G   GARTFKLPDPMYYI 
Sbjct  223  KGSSVAFKSGEKQKLQDAGYIIVGNIGDQWSDIIGAPDGARTFKLPDPMYYIG  275



>ref|XP_004963522.1| PREDICTED: stem 28 kDa glycoprotein-like [Setaria italica]
Length=276

 Score =   257 bits (657),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/243 (54%), Positives = 156/243 (64%), Gaps = 4/243 (2%)
 Frame = +2

Query  146  HADSIPNQIHSLRPHTAGGGH--HIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYM  319
             AD     IH+LRP     G      GV C SWRL VEA N RDW  VP  CE YVGHYM
Sbjct  36   EADVAAPVIHALRPMVGSAGDLGRRGGVPCDSWRLAVEAYNKRDWRTVPVDCEGYVGHYM  95

Query  320  LGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAY  499
            LG  YR D   V   AV YA+   L   GK++WVFD +ETTLSNLPYYA     FG   Y
Sbjct  96   LGGHYRQDSGDVVDEAVAYAEGLKLGGKGKEVWVFDTDETTLSNLPYYATD--GFGTKPY  153

Query  500  NATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHW  679
            NAT F+ +V EG+AP +P   RLY  L+SLGIKPVF++G  +  R + +ANL++ GYS W
Sbjct  154  NATSFNEYVMEGSAPVLPETQRLYNKLISLGIKPVFVTGRTEDQRAITVANLRREGYSGW  213

Query  680  EKLILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMY  859
             KL+LK      TA+ +KS +R +L   GY I+GNIGDQWSD+LG   GARTFKLPDP+Y
Sbjct  214  MKLMLKPVGYNGTAIGFKSGERQKLQDAGYVIVGNIGDQWSDILGAPEGARTFKLPDPLY  273

Query  860  YIA  868
            YI 
Sbjct  274  YIG  276



>ref|NP_001150932.1| LOC100284565 precursor [Zea mays]
 gb|ACG40988.1| stem 28 kDa glycoprotein precursor [Zea mays]
Length=293

 Score =   258 bits (658),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/235 (54%), Positives = 156/235 (66%), Gaps = 4/235 (2%)
 Frame = +2

Query  170  IHSLRP--HTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDD  343
            IH+LRP   +AG      GV C SWRL VE  N RDW  VP  CE YVGHYMLG  YR D
Sbjct  61   IHALRPLLGSAGDLGRRAGVPCDSWRLAVETYNKRDWTTVPASCERYVGHYMLGGHYRRD  120

Query  344  CIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAW  523
               V   A+ YA+   L  +GK++WVFDI+ET+LSNLPYYA     FG   YNAT F+ +
Sbjct  121  SRVVIDEAIAYAEGLKLGGNGKEVWVFDIDETSLSNLPYYATH--GFGTKLYNATSFNEY  178

Query  524  VSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGA  703
            V EG+AP +P   RL++ LVSLGIKPVFL+G  +  R + + NL++ GYS W  L+LK  
Sbjct  179  VLEGSAPVLPETQRLFKKLVSLGIKPVFLTGRTEDQRAITVTNLRRQGYSGWMTLLLKPV  238

Query  704  NDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
                TA+ YKS +R +L   GY I+GNIGDQWSD+LG   GARTFKLPDP+YYI 
Sbjct  239  GLKATAIAYKSGERQKLQDAGYVIVGNIGDQWSDILGAPEGARTFKLPDPLYYIG  293



>gb|EMS54507.1| Acid phosphatase 1 [Triticum urartu]
Length=280

 Score =   257 bits (656),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/235 (55%), Positives = 155/235 (66%), Gaps = 4/235 (2%)
 Frame = +2

Query  170  IHSLRPHTAGGGH--HIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDD  343
            IH+LRP     G      GV C SWRLGVEA N+RDW  VP  CE YVGHYMLG  +R D
Sbjct  48   IHALRPLLGSSGELGSRGGVPCDSWRLGVEAYNVRDWKTVPANCEGYVGHYMLGSHFRRD  107

Query  344  CIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAW  523
               V   A+ Y  +  L  +GK++WVFDI+ETTLSNLPYYA     FGA  YNAT FDA+
Sbjct  108  SKVVIDQAIAYVDSLKLDGNGKEVWVFDIDETTLSNLPYYATH--GFGARPYNATSFDAY  165

Query  524  VSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGA  703
            V EGTAPA+P   RLY  L+ +GIKPVF++G  +  R + +ANL+  G S W  L LK  
Sbjct  166  VLEGTAPALPESKRLYYKLLKVGIKPVFITGRTEDKRAITVANLRSQGISGWMNLTLKQP  225

Query  704  NDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
                +A+ YKS +R +L   GY I+GNIGDQWSDLLG   GARTFKLPDP+YYI 
Sbjct  226  GFHGSAISYKSAQRKKLQDAGYVIVGNIGDQWSDLLGAPEGARTFKLPDPLYYIG  280



>ref|XP_004960902.1| PREDICTED: acid phosphatase 1-like [Setaria italica]
Length=290

 Score =   256 bits (655),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 129/235 (55%), Positives = 160/235 (68%), Gaps = 4/235 (2%)
 Frame = +2

Query  170  IHSLRP--HTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDD  343
            IH+LRP   +AG      GV C SWRL VE NN RDW  VP +CE YVG+YMLG  YR D
Sbjct  58   IHALRPLVGSAGDLGWRGGVPCDSWRLAVETNNKRDWRTVPARCERYVGNYMLGGHYRRD  117

Query  344  CIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAW  523
               V   AV YA+   LA +GK++WVFDI+ET LSNLPYYA +   FG   Y+AT F+A+
Sbjct  118  SRVVIDEAVAYAEGLQLAGNGKEVWVFDIDETALSNLPYYASN--GFGTKPYDATSFNAY  175

Query  524  VSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGA  703
            V  G+AP +P   RLY  L+SLGI PVFL+G ++  R + +ANL++ GYS W KL+LK  
Sbjct  176  VFAGSAPVLPETQRLYNKLISLGITPVFLTGRRENQRAITVANLRREGYSGWMKLLLKPV  235

Query  704  NDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
                TA+ +KS +R +L   GY I+GNIGDQWSD+LG   GARTFKLPDP+YYI 
Sbjct  236  GYNGTAIGFKSDERRKLQDAGYVIVGNIGDQWSDILGAPEGARTFKLPDPLYYIG  290



>ref|XP_006654134.1| PREDICTED: stem 28 kDa glycoprotein-like [Oryza brachyantha]
Length=245

 Score =   254 bits (648),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 124/223 (56%), Positives = 157/223 (70%), Gaps = 8/223 (4%)
 Frame = +2

Query  218  GVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLA  397
            GV C SWRLGVEA+N+ +W  VP +CE YVGHY+LG  YR D   V   A+ YA+   LA
Sbjct  25   GVACDSWRLGVEAHNVINWKTVPAKCEGYVGHYLLGGHYRRDSAVVVDEAIAYAETLQLA  84

Query  398  HDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRT  577
             +GK++W+FDI+ET+LSNLPYYA+    FG T YN T F  +V+EG+APA+P   RLYR 
Sbjct  85   GNGKEVWIFDIDETSLSNLPYYAKH--GFGVTPYNDTSFREYVAEGSAPALPETRRLYRR  142

Query  578  LVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDTRT------AVEYKSK  739
            L+ +G+KPVFL+G  +  R V +ANL+K GYS WEKL+LK A           AV YKS 
Sbjct  143  LLEIGVKPVFLTGRTEDQRAVTVANLRKQGYSGWEKLLLKPAVHGAAGGLHAPAVAYKSG  202

Query  740  KRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
            +R +L   G+ I+GNIGDQWSD+LG+  GARTFKLPDP+YYI 
Sbjct  203  QRQKLKDSGFIIVGNIGDQWSDILGEPEGARTFKLPDPLYYIG  245



>ref|XP_006356133.1| PREDICTED: acid phosphatase 1-like [Solanum tuberosum]
Length=185

 Score =   251 bits (640),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 146/185 (79%), Gaps = 1/185 (1%)
 Frame = +2

Query  317  MLGH-QYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGAT  493
            MLG  QYR DC  VA  A++YAK   L  DGKD+WVFD+++TTLSNLPYYARSDV FG  
Sbjct  1    MLGKLQYRRDCEYVAKQAIEYAKGLKLNRDGKDVWVFDVDDTTLSNLPYYARSDVRFGTI  60

Query  494  AYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYS  673
            A N TKF  W++EG  P +P  + +Y+TL+SLGIKPV ++G  + FR+ RIANLKK GYS
Sbjct  61   ALNDTKFIEWLAEGKLPVIPSILGVYKTLLSLGIKPVIITGAPENFRQSRIANLKKAGYS  120

Query  674  HWEKLILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDP  853
            +W KL+L+G N++++AVEYKS KR ELVK GYRI+GNIGDQW+DL+G+  GARTFK+P+P
Sbjct  121  NWLKLVLRGGNNSKSAVEYKSSKRMELVKAGYRIVGNIGDQWTDLIGEIVGARTFKVPNP  180

Query  854  MYYIA  868
            MYY+ 
Sbjct  181  MYYVG  185



>ref|XP_004960903.1| PREDICTED: acid phosphatase 1-like [Setaria italica]
Length=280

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/235 (54%), Positives = 159/235 (68%), Gaps = 4/235 (2%)
 Frame = +2

Query  170  IHSLRP--HTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDD  343
            IH+LRP   +AG      GV C SWRL VEA N RDW  VP  CE YVGHYMLG  YR D
Sbjct  48   IHALRPLVGSAGDLGRRGGVPCDSWRLAVEAYNKRDWKTVPADCEGYVGHYMLGGHYRRD  107

Query  344  CIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAW  523
               V   A+ YA+   LA +G+++WVFDI+ET+LSNLPYYA+    FG   +NAT F+A+
Sbjct  108  SRVVVDEAIAYAEGLKLAGNGREVWVFDIDETSLSNLPYYAKH--GFGTEPFNATSFNAY  165

Query  524  VSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGA  703
            V EG+A A+P   RL+  L+SLGIKPVFL+G  +  R + + NL++ GY  W KL+LK  
Sbjct  166  VLEGSALALPETQRLFDKLISLGIKPVFLTGRTENQRAITVVNLRRQGYYGWMKLLLKPV  225

Query  704  NDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
                TA+ +KS +R +L   GY I+GNIGDQWSD+LG   GARTFKLPDPMYYI 
Sbjct  226  GFKGTAIGFKSGERRKLQDAGYVIVGNIGDQWSDILGAPEGARTFKLPDPMYYIG  280



>gb|EMT19717.1| Acid phosphatase 1 [Aegilops tauschii]
Length=278

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/235 (53%), Positives = 157/235 (67%), Gaps = 4/235 (2%)
 Frame = +2

Query  170  IHSLRPHTAGGGH--HIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDD  343
            IH+LRP    GG      GV C SWRLGVEA+N+RDW  VP  CE YVGHYMLG  YR D
Sbjct  46   IHALRPMLGSGGQLGSRAGVACDSWRLGVEAHNVRDWKTVPASCEGYVGHYMLGGHYRRD  105

Query  344  CIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAW  523
               V   A+ Y  +  LA +GK++WVFD++ETTLSNLPYYA     FGAT YN T F  +
Sbjct  106  SKLVIDQAISYVDSLKLAGNGKEVWVFDVDETTLSNLPYYATH--GFGATPYNWTSFQEY  163

Query  524  VSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGA  703
              + +APA+P   RL+  L+S+GIKPV L+G ++  R   + NL++ G+S W  ++LK A
Sbjct  164  ARQASAPALPETKRLFDKLLSVGIKPVILTGRREVQRTATVTNLRRQGFSGWMTVLLKPA  223

Query  704  NDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
                + V +KS +R +L+  GY I+GNIGDQWSD+LG   GARTFKLPDPMYYI 
Sbjct  224  EFKGSGVTFKSGERQKLLDAGYVIVGNIGDQWSDILGTPEGARTFKLPDPMYYIG  278



>gb|EMS67586.1| Acid phosphatase 1 [Triticum urartu]
Length=280

 Score =   253 bits (645),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 126/241 (52%), Positives = 161/241 (67%), Gaps = 4/241 (2%)
 Frame = +2

Query  152  DSIPNQIHSLRPHTAGGGH--HIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLG  325
            +++   IH+LRP    GG      GV C SWRLGVEA+N+RDW  VP  CE YVGHYMLG
Sbjct  42   EAVEPLIHALRPMLGSGGQLGSRAGVACDSWRLGVEAHNVRDWKTVPTSCEGYVGHYMLG  101

Query  326  HQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNA  505
              YR D   V   A+ Y  +  LA +GK++WVFD++ETTLSNLPYYA     FGAT YN 
Sbjct  102  GHYRRDSKLVIDEAIFYVDSLKLAGNGKEVWVFDVDETTLSNLPYYATH--GFGATPYNW  159

Query  506  TKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEK  685
            T F  + ++ +APA+P   RLY  L+S+GIKPV L+G ++  R   I NL++ G+S    
Sbjct  160  TSFHEYAAQASAPALPETKRLYNKLLSVGIKPVILTGRREAQRTATITNLRRQGFSGSMA  219

Query  686  LILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            ++LK A    +AV +KS +R +L+  GY I+GNIGDQWSD+LG   GARTFKLPDPMYYI
Sbjct  220  VLLKPAEFKGSAVTFKSGERQKLLDAGYVIVGNIGDQWSDILGTPEGARTFKLPDPMYYI  279

Query  866  A  868
             
Sbjct  280  G  280



>ref|XP_011072446.1| PREDICTED: acid phosphatase 1-like [Sesamum indicum]
Length=184

 Score =   249 bits (635),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 140/184 (76%), Gaps = 0/184 (0%)
 Frame = +2

Query  317  MLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATA  496
            MLG + R DC  VA +A++YAK+  L  DGKD+WVFDI+ETTLSNLPYYARSDV FGA  
Sbjct  1    MLGKRSRHDCEVVADAAIEYAKSLKLGGDGKDVWVFDIDETTLSNLPYYARSDVQFGALP  60

Query  497  YNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSH  676
            YN TKF+ WV+EG AP VP   RLY+TL+SLGIK VFL+G    FR++R ANL   GY  
Sbjct  61   YNGTKFNEWVTEGKAPPVPAVRRLYKTLLSLGIKAVFLTGGSDAFRRIRTANLYAAGYHS  120

Query  677  WEKLILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPM  856
            W KLI KG  +   A+ YKSKKR E+V +GYRI+GNIGDQWSDLLG +AG RTFK+PDPM
Sbjct  121  WLKLIFKGEAEEGAALVYKSKKRREVVDEGYRIVGNIGDQWSDLLGADAGNRTFKVPDPM  180

Query  857  YYIA  868
            YYI 
Sbjct  181  YYIG  184



>gb|KHN05326.1| Stem 28 kDa glycoprotein [Glycine soja]
Length=271

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 138/236 (58%), Positives = 162/236 (69%), Gaps = 6/236 (3%)
 Frame = +2

Query  167  QIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDC  346
            QI  LR  T  GGH+IP V+C SWRLGVEA+N+ DW  VPQ CE Y+G+YMLG QYR D 
Sbjct  40   QIFPLRMKTGHGGHYIPEVSCQSWRLGVEAHNVIDWKTVPQDCEGYIGNYMLGEQYRSDS  99

Query  347  IAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWV  526
              V   A  YAK  TL    K  WVFDI+ETTLSNLPYYA  D  FG   YN T F+ WV
Sbjct  100  KIVNQQAYFYAK--TLNITAKTAWVFDIDETTLSNLPYYA--DHGFGVELYNETSFNKWV  155

Query  527  SEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAN  706
              G APA+P  ++LY+ L+SLGIK VF++G     + V   NLK  GY  WEKLI K  +
Sbjct  156  DLGEAPALPESLKLYKKLLSLGIKIVFITGRPLDQKAVTATNLKLAGYHTWEKLITKNTS  215

Query  707  D--TRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
            +   +TAV YKS +R +L +KGY+IIGNIGDQWSDLLG N G RTFKLPDPMYYI+
Sbjct  216  EYHGKTAVTYKSTERKKLEEKGYKIIGNIGDQWSDLLGTNTGDRTFKLPDPMYYIS  271



>ref|NP_001148494.1| stem 28 kDa glycoprotein precursor [Zea mays]
 gb|ACG31723.1| stem 28 kDa glycoprotein precursor [Zea mays]
 gb|ACN31777.1| unknown [Zea mays]
Length=261

 Score =   247 bits (630),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 149/214 (70%), Gaps = 2/214 (1%)
 Frame = +2

Query  224  NCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHD  403
            +C SWRLGVE NNIRDW  +P +C  YV  YM G  +R DC  VA  A  YA+   L  D
Sbjct  49   SCASWRLGVETNNIRDWYSIPAECRGYVRDYMYGDLFRQDCAVVAREAAAYAEGLELGGD  108

Query  404  GKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLV  583
            GK++WVFD+++TTLSNLPYYA  D  FGA  YNAT FD +V+  TAP +P  ++LY TL+
Sbjct  109  GKEVWVFDVDDTTLSNLPYYA--DTGFGAEPYNATYFDEYVANATAPPLPEVLQLYETLL  166

Query  584  SLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDTRTAVEYKSKKRTELVKK  763
            SLGIK VF++G     ++  I NL+  GY  W+KL+LK ++   + V YKS +R +LV  
Sbjct  167  SLGIKVVFITGRHDYEKEPTIKNLRSAGYHTWDKLVLKPSSLGSSVVPYKSGERQKLVDA  226

Query  764  GYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            GYRI+GN+GDQWSDL+G   G RTFK+PDPMYY+
Sbjct  227  GYRIVGNMGDQWSDLIGAPEGDRTFKVPDPMYYV  260



>ref|NP_001236180.1| acid phosphatase precursor [Glycine max]
 emb|CAA11075.1| acid phosphatase [Glycine max]
Length=264

 Score =   246 bits (628),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 138/238 (58%), Positives = 162/238 (68%), Gaps = 8/238 (3%)
 Frame = +2

Query  167  QIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDC  346
            QI  LR  T  GGH+IP V+C SWRLGVEA+N+ DW  VPQ CE Y+G+YMLG QYR D 
Sbjct  31   QIFPLRMKTGHGGHYIPEVSCQSWRLGVEAHNVIDWKTVPQDCEGYIGNYMLGEQYRSDS  90

Query  347  IAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWV  526
              V   A  YAK  TL    K  WVFDI+ETTLSNLPYYA  D  FG   YN T F+ WV
Sbjct  91   KIVNQQAYFYAK--TLNITAKTAWVFDIDETTLSNLPYYA--DHGFGVELYNETSFNKWV  146

Query  527  SEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIA--NLKKTGYSHWEKLILKG  700
              G APA+P  ++LY+ L+SLGIK VF++G     + V     NLK  GY  WEKLI K 
Sbjct  147  DLGEAPALPESLKLYKKLLSLGIKIVFITGRPLDQKAVTATNLNLKLAGYHTWEKLITKN  206

Query  701  AND--TRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
             ++   +TAV YKS +R +L +KGY+IIGNIGDQWSDLLG N G RTFKLPDPMYYI+
Sbjct  207  TSEYHGKTAVTYKSTERKKLEEKGYKIIGNIGDQWSDLLGTNTGDRTFKLPDPMYYIS  264



>gb|EAY96842.1| hypothetical protein OsI_18762 [Oryza sativa Indica Group]
Length=280

 Score =   246 bits (627),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 132/240 (55%), Positives = 165/240 (69%), Gaps = 9/240 (4%)
 Frame = +2

Query  170  IHSLRPHTAGGGHHIP--GVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDD  343
            IH+LRP    GG      GV C SWRLGVEA+N+  W  VP +CE YVGHYMLG  YR D
Sbjct  43   IHALRPLLGSGGQLAARAGVACDSWRLGVEAHNVIGWRTVPARCEGYVGHYMLGGHYRRD  102

Query  344  CIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAW  523
               V   A+ YA++  LA +GK+IWVFDI+ET+LSNLPYYA     FGAT YN T F  +
Sbjct  103  SAVVVDEAIAYAESLQLAGNGKEIWVFDIDETSLSNLPYYANH--GFGATLYNDTSFREY  160

Query  524  VSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILK--  697
            V+EG+APA+P   RLYR L+ LG+KPVFL+G  +  R + + NL++ GYS W +L+LK  
Sbjct  161  VAEGSAPALPETRRLYRRLLQLGVKPVFLTGRTEDQRNITVTNLRRQGYSGWMELLLKPV  220

Query  698  --GANDTR-TAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
               A + + +AV YKS +R +L   G+ I+GNIGDQWSD+LG   GARTFKLPDPMYYI 
Sbjct  221  VHAAGELQGSAVAYKSGERQKLEDAGFTIVGNIGDQWSDILGTPEGARTFKLPDPMYYIG  280



>ref|XP_009607238.1| PREDICTED: acid phosphatase 1-like [Nicotiana tomentosiformis]
Length=169

 Score =   241 bits (615),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 135/163 (83%), Gaps = 0/163 (0%)
 Frame = +2

Query  380  KNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGG  559
            K++T+  DGKD+ VFDI+ETTL NLPYYARSDVAFGA  +N  KF+ WVSEG APA+P  
Sbjct  7    KDSTIGGDGKDVCVFDIDETTLFNLPYYARSDVAFGAIPFNNAKFNEWVSEGKAPAIPAT  66

Query  560  VRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDTRTAVEYKSK  739
            +RLY+ ++SLGIKPVF++GT +  RK RIANLKK GY+ W KL+LKG ND+  +V +KS 
Sbjct  67   LRLYKMVLSLGIKPVFITGTPRFTRKARIANLKKAGYTSWLKLVLKGKNDSPKSVVFKSS  126

Query  740  KRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
            KRTELVK GYRI+GNIGDQWSDL+GDN G+RTFK+PDPMYYI 
Sbjct  127  KRTELVKAGYRIVGNIGDQWSDLIGDNVGSRTFKVPDPMYYIG  169



>ref|XP_004960899.1| PREDICTED: stem 28 kDa glycoprotein-like isoform X1 [Setaria 
italica]
Length=274

 Score =   244 bits (624),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 124/241 (51%), Positives = 157/241 (65%), Gaps = 5/241 (2%)
 Frame = +2

Query  152  DSIPNQIHSLRPHTAGGGH--HIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLG  325
            D +P  IH LRP  + GGH      V C SWR  VE NN R W  +P +CE YVG+YM+G
Sbjct  37   DGMP-LIHMLRPLLSSGGHLGRRGRVPCDSWRFAVETNNKRGWKTIPARCERYVGNYMMG  95

Query  326  HQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNA  505
              YR D  AV   A+ YA+   L+  G ++WVFDI+ET LSNLPYYA+    FGA  YN 
Sbjct  96   GHYRSDSRAVVNEAIAYAEGLELSGKGNEVWVFDIDETALSNLPYYAKH--GFGAEPYNW  153

Query  506  TKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEK  685
            T F A+  +  APA+P  +RLY+ L +LGIKPV L+G ++  R+  + NL   GY+ + K
Sbjct  154  TAFGAYAKQANAPALPETLRLYKRLQALGIKPVILTGRREDKREATVRNLASAGYTGYLK  213

Query  686  LILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            L+LK  N    ++E+KS +R +LV  GY I+GNIGDQWSDLLG   G RTFKLPDPMYYI
Sbjct  214  LLLKPQNVRMHSLEFKSGERKKLVDAGYVIVGNIGDQWSDLLGAPEGDRTFKLPDPMYYI  273

Query  866  A  868
            A
Sbjct  274  A  274



>ref|NP_001148296.1| stem 28 kDa glycoprotein precursor [Zea mays]
 gb|ACG30436.1| stem 28 kDa glycoprotein precursor [Zea mays]
Length=272

 Score =   244 bits (623),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/241 (51%), Positives = 157/241 (65%), Gaps = 5/241 (2%)
 Frame = +2

Query  152  DSIPNQIHSLRP--HTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLG  325
            D +P  IH LRP  H+ G       V C SWR  VE N +RDW  VP +CE+YVG+YMLG
Sbjct  35   DGMP-LIHMLRPLLHSGGDLGRRGRVPCDSWRFAVETNTLRDWDTVPARCEKYVGNYMLG  93

Query  326  HQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNA  505
              YR D  AVA  A+ YA+   L   GK++WVFD++ETTLSNLPYYA+    FG   YN 
Sbjct  94   GHYRSDSRAVANEAIAYAEGLNLTGQGKEVWVFDVDETTLSNLPYYAKH--GFGVEPYNW  151

Query  506  TKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEK  685
            + F A+V E  AP +P   RLY+ L +LGIKPV L+G ++  R+    NL   GY+ + K
Sbjct  152  STFGAYVKEANAPVLPETQRLYKRLQALGIKPVILTGRREDKREATANNLAAAGYTGYLK  211

Query  686  LILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            L+LK  N   +++E+KS +R +L   GY I+GNIGDQW+DLLG+  G RTFKLPDPMYYI
Sbjct  212  LLLKPQNVKVSSIEFKSGERKKLQDAGYVIVGNIGDQWTDLLGEPEGGRTFKLPDPMYYI  271

Query  866  A  868
             
Sbjct  272  G  272



>gb|AFW77368.1| stem glycoprotein [Zea mays]
Length=272

 Score =   244 bits (623),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/241 (51%), Positives = 157/241 (65%), Gaps = 5/241 (2%)
 Frame = +2

Query  152  DSIPNQIHSLRP--HTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLG  325
            D +P  IH LRP  H+ G       V C SWR  VE N +RDW  VP +CE+YVG+YMLG
Sbjct  35   DGMP-LIHMLRPLLHSGGDLGRRGRVPCDSWRFAVETNTLRDWDTVPARCEKYVGNYMLG  93

Query  326  HQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNA  505
              YR D  AVA  A+ YA+   L   GK++WVFD++ETTLSNLPYYA+    FG   YN 
Sbjct  94   GHYRSDSRAVANEAIAYAEGLNLTGQGKEVWVFDVDETTLSNLPYYAKH--GFGVEPYNW  151

Query  506  TKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEK  685
            + F A+V E  AP +P   RLY+ L +LGIKPV L+G ++  R+    NL   GY+ + K
Sbjct  152  STFGAYVKEANAPVLPETQRLYKRLQALGIKPVILTGRREDKREATANNLAAAGYTGYLK  211

Query  686  LILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            L+LK  N   +++E+KS +R +L   GY I+GNIGDQW+DLLG+  G RTFKLPDPMYYI
Sbjct  212  LLLKPQNVKVSSIEFKSGERKKLQDAGYVIVGNIGDQWTDLLGEPEGGRTFKLPDPMYYI  271

Query  866  A  868
             
Sbjct  272  G  272



>ref|XP_004960898.1| PREDICTED: stem 31 kDa glycoprotein-like isoform X2 [Setaria 
italica]
Length=262

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 147/214 (69%), Gaps = 2/214 (1%)
 Frame = +2

Query  224  NCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHD  403
            +C SWRLGVE NNIR W  +P +C  YV  YM G  +R DC  V   A  YA+   LA D
Sbjct  50   SCPSWRLGVETNNIRGWYSIPAECRGYVRDYMFGDLFRQDCAVVVREAAAYAEGLELAGD  109

Query  404  GKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLV  583
            G+ +WVFDI++T LSNLPYYA  D  FGA  YNAT F+ +V++ TAPA+P  ++LY  L+
Sbjct  110  GEAVWVFDIDDTALSNLPYYA--DTGFGAQPYNATYFEEYVAKATAPALPEVLKLYEKLL  167

Query  584  SLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDTRTAVEYKSKKRTELVKK  763
            +LGIK  F++G  +  R+  + NL+  GY  WEKL+LK ++   + V YKS +R +LV  
Sbjct  168  ALGIKVAFITGRHEYEREPTVKNLRSAGYHTWEKLVLKPSSLGSSVVPYKSGERQKLVDA  227

Query  764  GYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            GYRI+GNIGDQWSDL+G   G RTFK+PDPMYY+
Sbjct  228  GYRIVGNIGDQWSDLVGAPEGDRTFKVPDPMYYV  261



>ref|XP_002440742.1| hypothetical protein SORBIDRAFT_09g005940 [Sorghum bicolor]
 gb|EES19172.1| hypothetical protein SORBIDRAFT_09g005940 [Sorghum bicolor]
Length=260

 Score =   239 bits (610),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 126/254 (50%), Positives = 162/254 (64%), Gaps = 7/254 (3%)
 Frame = +2

Query  104  LLVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMV  283
            LLVV + A   T +  D     +H L+  T+  G      +C SWRLGVE NNIRDW  +
Sbjct  13   LLVVAVHAAGATRAGGD-----MHHLQMVTSTAGTARAVASCASWRLGVETNNIRDWYSI  67

Query  284  PQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYY  463
            P +C  YV  YM G  +R DC  VA  A  YA+   LA DG+++WVFD+++TTL+NLPYY
Sbjct  68   PAECRSYVRDYMYGDLFRQDCAVVAGEAAAYAEGLELAGDGEEVWVFDVDDTTLTNLPYY  127

Query  464  ARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVR  643
            A  D  FGA  YNAT FD +V+  TAPA+P  + LY  L+SLGIK VF++G         
Sbjct  128  A--DTGFGAEPYNATYFDEYVANATAPALPEVLELYEKLLSLGIKVVFITGRHDDEEAAT  185

Query  644  IANLKKTGYSHWEKLILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNA  823
            + NL+  GY  WEKL+LK ++   + V YKS +R +LV  GYRI+GN+GDQWSDL G   
Sbjct  186  VKNLRSAGYHTWEKLVLKPSSLGSSVVPYKSGERQKLVDAGYRIVGNMGDQWSDLTGAPE  245

Query  824  GARTFKLPDPMYYI  865
            G RTFK+PDPMYY+
Sbjct  246  GDRTFKVPDPMYYV  259



>ref|XP_004960900.1| PREDICTED: stem 28 kDa glycoprotein-like isoform X2 [Setaria 
italica]
Length=279

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/246 (50%), Positives = 157/246 (64%), Gaps = 10/246 (4%)
 Frame = +2

Query  152  DSIPNQIHSLRPHTAGGGH--HIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLG  325
            D +P  IH LRP  + GGH      V C SWR  VE NN R W  +P +CE YVG+YM+G
Sbjct  37   DGMP-LIHMLRPLLSSGGHLGRRGRVPCDSWRFAVETNNKRGWKTIPARCERYVGNYMMG  95

Query  326  HQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNA  505
              YR D  AV   A+ YA+   L+  G ++WVFDI+ET LSNLPYYA+    FGA  YN 
Sbjct  96   GHYRSDSRAVVNEAIAYAEGLELSGKGNEVWVFDIDETALSNLPYYAKH--GFGAEPYNW  153

Query  506  TKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEK  685
            T F A+  +  APA+P  +RLY+ L +LGIKPV L+G ++  R+  + NL   GY+ + K
Sbjct  154  TAFGAYAKQANAPALPETLRLYKRLQALGIKPVILTGRREDKREATVRNLASAGYTGYLK  213

Query  686  LILK-----GANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPD  850
            L+LK       N    ++E+KS +R +LV  GY I+GNIGDQWSDLLG   G RTFKLPD
Sbjct  214  LLLKYSICLCTNVRMHSLEFKSGERKKLVDAGYVIVGNIGDQWSDLLGAPEGDRTFKLPD  273

Query  851  PMYYIA  868
            PMYYIA
Sbjct  274  PMYYIA  279



>gb|AFW77369.1| hypothetical protein ZEAMMB73_279889 [Zea mays]
Length=276

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 123/245 (50%), Positives = 157/245 (64%), Gaps = 9/245 (4%)
 Frame = +2

Query  152  DSIPNQIHSLRP--HTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLG  325
            D +P  IH LRP  H+ G       V C SWR  VE N +RDW  VP +CE+YVG+YMLG
Sbjct  35   DGMP-LIHMLRPLLHSGGDLGRRGRVPCDSWRFAVETNTLRDWDTVPARCEKYVGNYMLG  93

Query  326  HQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFG----AT  493
              YR D  AVA  A+ YA+   L   GK++WVFD++ETTLSNLPYYA+    FG      
Sbjct  94   GHYRSDSRAVANEAIAYAEGLNLTGQGKEVWVFDVDETTLSNLPYYAKH--GFGERRRVE  151

Query  494  AYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYS  673
             YN + F A+V E  AP +P   RLY+ L +LGIKPV L+G ++  R+    NL   GY+
Sbjct  152  PYNWSTFGAYVKEANAPVLPETQRLYKRLQALGIKPVILTGRREDKREATANNLAAAGYT  211

Query  674  HWEKLILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDP  853
             + KL+LK  N   +++E+KS +R +L   GY I+GNIGDQW+DLLG+  G RTFKLPDP
Sbjct  212  GYLKLLLKPQNVKVSSIEFKSGERKKLQDAGYVIVGNIGDQWTDLLGEPEGGRTFKLPDP  271

Query  854  MYYIA  868
            MYYI 
Sbjct  272  MYYIG  276



>ref|XP_011076425.1| PREDICTED: acid phosphatase 1-like [Sesamum indicum]
Length=269

 Score =   237 bits (604),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 121/269 (45%), Positives = 162/269 (60%), Gaps = 18/269 (7%)
 Frame = +2

Query  95   RAFLLVVVL--LATIPTFSHADSIPNQI---------HSLRPHTAGGGHHIPGVNCLSWR  241
            R FLL+ +L         SH D+ P  I           L+  T    H    + C SWR
Sbjct  6    RIFLLLSILPFACFSQEISHPDAFPGAIILQLPERNEAQLKKLTLEEAH----LQCTSWR  61

Query  242  LGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWV  421
            + VEANN+  W  +P+ C +YV  YM G+ Y  D   V   A  YA++  L  DGKD W+
Sbjct  62   VAVEANNLSPWKTIPEDCADYVKEYMTGNVYEFDLQRVYNEAGIYARSVNLNGDGKDAWI  121

Query  422  FDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKP  601
            FD++ET LSNLPYYA     +G   +N+TKFD WV  GTAPAV   ++LY  ++SLG K 
Sbjct  122  FDVDETLLSNLPYYAEH--GYGLEMFNSTKFDQWVETGTAPAVESSLKLYEEVLSLGFKV  179

Query  602  VFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELVKKGYRII  778
            + L+G  ++ R + + NL + G+  W+KLIL+ + D  +TA  YKS KR ELV++GYRI+
Sbjct  180  ILLTGRSERHRGITVENLLRAGFREWDKLILRSSEDHGKTATVYKSDKRNELVEEGYRIL  239

Query  779  GNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            GN GDQWSDLLG +   R+FKLP+PMYYI
Sbjct  240  GNSGDQWSDLLGSSMSKRSFKLPNPMYYI  268



>gb|EMT02057.1| Stem 28 kDa glycoprotein [Aegilops tauschii]
Length=261

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/233 (52%), Positives = 151/233 (65%), Gaps = 13/233 (6%)
 Frame = +2

Query  170  IHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCI  349
            IH+LRP    G H   GV C SW LGVEA+N+RDW  VP  CE           +R D  
Sbjct  42   IHALRPLLGSGKHA--GVACDSWVLGVEAHNVRDWKTVPASCE---------GPFRRDSK  90

Query  350  AVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVS  529
             V   A+ Y  +  L  +GK++WVFDI+ETTLSNLPYYA+    FGAT +NAT F+A+V 
Sbjct  91   VVVDQALAYVDSLKLTGNGKEVWVFDIDETTLSNLPYYAKH--GFGATPFNATSFNAYVR  148

Query  530  EGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND  709
            EG+APA+P   RLY  L S+GIKPVFL+G  +  R + + NL++ G S W  L+LK    
Sbjct  149  EGSAPALPETKRLYNKLRSVGIKPVFLTGRTEDQRAITVTNLRRQGISGWMNLLLKQPGF  208

Query  710  TRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
              +AV YKS +R +L   GY I+GNIGDQWSD+LG   GARTFKLPDPMYYI 
Sbjct  209  KGSAVTYKSGERQKLQDAGYVIVGNIGDQWSDILGAPEGARTFKLPDPMYYIG  261



>gb|KCW53447.1| hypothetical protein EUGRSUZ_J02693 [Eucalyptus grandis]
Length=240

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 139/203 (68%), Gaps = 0/203 (0%)
 Frame = +2

Query  98   AFLLVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWA  277
            + LL+ + +A   + + A  +P++IH LRP    GGHHIPGV+C SWRL VE +NI+DW 
Sbjct  5    SLLLLFLAIAVSASLTLAGDVPDKIHPLRPQVGSGGHHIPGVSCQSWRLAVETDNIKDWD  64

Query  278  MVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLP  457
            +VP  CE YVG+YMLGHQYR DC A   +A  YAK  TL  DGKD+W+FDI+ET LSNLP
Sbjct  65   VVPMVCENYVGNYMLGHQYRKDCNAAGWAAYDYAKGLTLKKDGKDVWIFDIDETALSNLP  124

Query  458  YYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRK  637
            YYAR D AFGA  YN T F  W  EG APAVP  + LY+ L+ LG K VF+SG  +  R 
Sbjct  125  YYARPDNAFGAKEYNETTFKEWELEGKAPAVPAILYLYKRLLKLGFKIVFISGKSESLRS  184

Query  638  VRIANLKKTGYSHWEKLILKGAN  706
            + + N+KK GY  WEKLILK  N
Sbjct  185  ITVYNMKKVGYHTWEKLILKRRN  207



>ref|XP_007215832.1| hypothetical protein PRUPE_ppa010152mg [Prunus persica]
 gb|EMJ17031.1| hypothetical protein PRUPE_ppa010152mg [Prunus persica]
Length=228

 Score =   234 bits (596),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 149/221 (67%), Gaps = 5/221 (2%)
 Frame = +2

Query  110  VVVLLATI--PTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMV  283
            +V  LATI   T  +   + + IH L P T G    +PG++CLSWRL VE NNI +W  V
Sbjct  8    LVFFLATIVSTTQGYEPVLTHHIHLLTPKTGGARGSVPGLSCLSWRLAVETNNIINWKTV  67

Query  284  PQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYY  463
            P +CE YVGHYMLGHQYR D   V   A  YAK+  L  DGK++WVFDI+ETTLSNLPYY
Sbjct  68   PAECEGYVGHYMLGHQYRKDSKVVTNGAWLYAKSLNLTKDGKNVWVFDIDETTLSNLPYY  127

Query  464  ARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVR  643
            A +   FG   YNAT FD WV +GTAPA+P  ++LY+ L++LG+K VFL+G  +  R V 
Sbjct  128  AVN--GFGTELYNATSFDEWVLKGTAPALPESLKLYQKLLTLGVKVVFLTGRGEDKRNVT  185

Query  644  IANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKK  763
              NLK  GY  WEKLILKG+  T +T+  YKS +RT+LVKK
Sbjct  186  TTNLKNVGYHTWEKLILKGSAYTGKTSYVYKSAERTKLVKK  226



>emb|CBI25273.3| unnamed protein product [Vitis vinifera]
Length=182

 Score =   232 bits (591),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 136/184 (74%), Gaps = 2/184 (1%)
 Frame = +2

Query  317  MLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATA  496
            MLGHQYR D   V   A+ YA++  L  DGKD+WVFDI+ETTLSNLPYYA +   FGA  
Sbjct  1    MLGHQYRQDSRVVVYEAIAYAESLKLGGDGKDVWVFDIDETTLSNLPYYAEN--GFGAEV  58

Query  497  YNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSH  676
            +N T F+ WV +G APA+P  ++LY  LVSLGIK VFL+G  +  R V +ANLKK GY  
Sbjct  59   FNETSFNEWVMKGEAPALPESLKLYNKLVSLGIKVVFLTGKGEDERNVTVANLKKVGYHT  118

Query  677  WEKLILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPM  856
            WEKLIL+ ++D  TA+ YKS +R ++ + GY+I+GN+GDQWSD+LG N G RTFKLPDPM
Sbjct  119  WEKLILRKSSDGSTALVYKSNQRKKVEESGYKIVGNMGDQWSDILGTNTGNRTFKLPDPM  178

Query  857  YYIA  868
            YYIA
Sbjct  179  YYIA  182



>emb|CDO98049.1| unnamed protein product [Coffea canephora]
Length=303

 Score =   236 bits (602),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 123/269 (46%), Positives = 164/269 (61%), Gaps = 5/269 (2%)
 Frame = +2

Query  71   IKKRKLTMRAFLLVVVLLATIPTFSH-ADSIPNQIHSLRPH-TAGGGHHIPGVNCLSWRL  244
            ++K  + + A L ++V  AT     H A   P  I+ LR    A  G  +   NCLSWRL
Sbjct  32   LQKMAVALVACLCLLVFGATTSQAGHPAHPDPKLINPLRIMPEASSGDSVSVNNCLSWRL  91

Query  245  GVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVF  424
             VE NN R+W  VP+ C  YV HYM G QY  DC AV   A++Y K+  +  DG+ IW+F
Sbjct  92   TVETNNKRNWNGVPEICGNYVAHYMTGKQYGYDCDAVVDIAIEYVKSLPIPRDGRSIWIF  151

Query  425  DIEETTLSNLPYYARSDVAFGATAYNA---TKFDAWVSEGTAPAVPGGVRLYRTLVSLGI  595
            DI++T LSNLP+++R DV FG    NA    +F  +V     P +   +RLY+ +V  GI
Sbjct  152  DIDDTALSNLPFFSRPDVFFGVKTDNAELEAEFYEFVLTAEVPVLEATLRLYQAVVEAGI  211

Query  596  KPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDTRTAVEYKSKKRTELVKKGYRI  775
            K VFL+G+ ++    R  NLK  GY  WEKLILK  + T +   +KS+ R +LV +GYRI
Sbjct  212  KAVFLTGSSERSADARDKNLKAVGYHTWEKLILKPDSVTTSVQAFKSEVRDQLVAEGYRI  271

Query  776  IGNIGDQWSDLLGDNAGARTFKLPDPMYY  862
             GNIGDQW+D++G N G RTFKLP+PMYY
Sbjct  272  EGNIGDQWADIVGSNVGRRTFKLPNPMYY  300



>emb|CDP05370.1| unnamed protein product [Coffea canephora]
Length=268

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 109/216 (50%), Positives = 143/216 (66%), Gaps = 3/216 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            + C SWR  VEANN+  W  +P +C  YV  YM G  Y  D   V+ +A  +AK+  LA 
Sbjct  54   LQCTSWRFAVEANNLSPWKTIPPECAAYVEDYMTGRAYSYDLQRVSRAAGAFAKSVELAE  113

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DGKD+W+FD++ET LSNLPYYA+    +G   +N TKFD WV EG APA+   + LYR +
Sbjct  114  DGKDVWIFDVDETLLSNLPYYAQH--GYGLEIFNHTKFDKWVEEGLAPAIHSSLELYRDV  171

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELV  757
             SLG K  FL+G  ++   +   NL K G+ HW+KLIL+   D  + A  YKS+KR E++
Sbjct  172  TSLGFKVFFLTGRSERHGNITADNLIKVGFQHWDKLILRSPEDHPKQATMYKSEKRDEMI  231

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            K+GYRI+GN GDQWSDLLG +   R+FKLP+PMYYI
Sbjct  232  KEGYRIVGNSGDQWSDLLGSSPANRSFKLPNPMYYI  267



>ref|XP_010098159.1| Acid phosphatase 1 [Morus notabilis]
 gb|EXB74596.1| Acid phosphatase 1 [Morus notabilis]
Length=262

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/265 (45%), Positives = 165/265 (62%), Gaps = 7/265 (3%)
 Frame = +2

Query  86   LTMRAFLLVVVLLATIPTFSHADSIPNQ----IHSLRPHTAGGGHHIPGVNCLSWRLGVE  253
            + +  FL  VVL AT       D+  N+    +H LR   + GG+   G  C SW+ GVE
Sbjct  1    MLLYYFLATVVLAATSTAQPDLDNPLNKNFNKLHLLRRQGSFGGNS-NGAWCSSWQYGVE  59

Query  254  ANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIE  433
             NNI  W  VP++CE YV  YMLG +Y +D   V   A  YA++ TL+ DGKD+W+FD++
Sbjct  60   TNNIIGWKTVPEKCELYVARYMLGERYGEDSKVVTKEAYLYAQSHTLSDDGKDVWLFDVD  119

Query  434  ETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLS  613
            +T +SNLPYYA +   FG   Y+   F  W+    APA+P  ++LY+ L +LG K +FL+
Sbjct  120  DTAVSNLPYYATN--GFGVKPYDPESFHQWILSEAAPALPKSLKLYKNLKTLGFKIIFLT  177

Query  614  GTKQQFRKVRIANLKKTGYSHWEKLILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIGD  793
            G ++  R    +NLK  GY  WE ++LK  + + T  ++K+++R  L   GYRI+GNIGD
Sbjct  178  GRRENERSAIESNLKVAGYHTWELVLLKDDDYSGTTADFKAEQRKNLEDAGYRIVGNIGD  237

Query  794  QWSDLLGDNAGARTFKLPDPMYYIA  868
            QW+DLLG NAG RTFKLP+P+YY A
Sbjct  238  QWTDLLGTNAGHRTFKLPNPLYYAA  262



>ref|XP_006853740.1| hypothetical protein AMTR_s00056p00177520 [Amborella trichopoda]
 gb|ERN15207.1| hypothetical protein AMTR_s00056p00177520 [Amborella trichopoda]
Length=287

 Score =   233 bits (593),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 114/233 (49%), Positives = 150/233 (64%), Gaps = 6/233 (3%)
 Frame = +2

Query  182  RPHTAGGGHHI---PGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIA  352
            R +   GG       G  C SWR  VE NN+R+W  VP +C+EYVG YM G +Y  D   
Sbjct  57   RQYDIPGGRETGKDTGFVCDSWRFAVETNNLREWKKVPDKCQEYVGVYMTGDRYESDSEI  116

Query  353  VAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSE  532
            V+  A  +A+N ++  DGKD+WVFDI+ET LSNLPYYA +   FG+  +N   F+ WV +
Sbjct  117  VSGEAENFARNISILGDGKDVWVFDIDETLLSNLPYYAEN--GFGSKDFNEDSFNEWVVK  174

Query  533  GTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT  712
              APA+P  ++LY  L  LG + + L+G ++  R V   NL   GY  WE+LIL+GA D+
Sbjct  175  AEAPALPYSLKLYNELKKLGFRVILLTGREESQRTVTAENLIAAGYDSWERLILRGAKDS  234

Query  713  -RTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
             + AV YKS+KR E+  +GYRI GN GDQWSDLLG   G R+FKLP+PMYYI+
Sbjct  235  GKPAVVYKSEKRMEIEGEGYRIHGNSGDQWSDLLGFAIGNRSFKLPNPMYYIS  287



>ref|XP_010662272.1| PREDICTED: acid phosphatase 1 [Vitis vinifera]
Length=259

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/263 (44%), Positives = 157/263 (60%), Gaps = 11/263 (4%)
 Frame = +2

Query  89   TMRAFLLVVVL---LATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEAN  259
            ++R FLL  +    L+  P  SH   +P  +    P  +     +    C SWR GVEAN
Sbjct  3    SLRIFLLFALFSISLSHEPFNSHL--LPRPLILEYPQESSEEIQL---ECTSWRFGVEAN  57

Query  260  NIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEET  439
            N+  W  +P  C EYV  YM G  Y  D   VA  A  YA+   L+ DG D+WVFD++ET
Sbjct  58   NLGPWKTIPVACAEYVKDYMTGRAYEIDLERVANEAAIYARTVELSADGNDVWVFDVDET  117

Query  440  TLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGT  619
             LSNLPYYA     +G   ++  +F  WV + TAPA+   ++LY  + SLG K   L+G 
Sbjct  118  LLSNLPYYAEH--GYGLEVFDEMEFAKWVEKATAPAIGSSLKLYEVVQSLGFKTFLLTGR  175

Query  620  KQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELVKKGYRIIGNIGDQ  796
             +  R V + NL   G+ +W+KLIL+G+ND  + A  YKS+KR+E+VK+GYRI+GN GDQ
Sbjct  176  SENQRSVTVENLINAGFQNWDKLILRGSNDHGKQATVYKSEKRSEMVKEGYRIVGNSGDQ  235

Query  797  WSDLLGDNAGARTFKLPDPMYYI  865
            WSDLLG     R+FKLP+PMYYI
Sbjct  236  WSDLLGSEMSLRSFKLPNPMYYI  258



>ref|XP_006357920.1| PREDICTED: acid phosphatase 1-like [Solanum tuberosum]
Length=251

 Score =   229 bits (584),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 150/216 (69%), Gaps = 3/216 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            + C SWR  VE NN+  W  +PQ+C +YV  Y++G  Y+ D   V+  A +YAK+  L  
Sbjct  37   LKCTSWRFAVETNNLSPWKTIPQECADYVREYIVGPGYKMDIDRVSNEAGEYAKSVDLGD  96

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DG+D+WVFD++ET LSNLPYY  SD  +G   +++ +FD WV +GTAPA+   ++LY+ +
Sbjct  97   DGRDVWVFDVDETLLSNLPYY--SDHGYGLEVFDSVEFDKWVEKGTAPALGSSLKLYQEV  154

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELV  757
            +SLG K   L+G  ++ R V + NL   G+  W KLIL+G++D  +TA  +KS++R E+V
Sbjct  155  LSLGFKVFLLTGRSERHRSVTVENLMNAGFHDWHKLILRGSDDHGKTATTFKSERRNEIV  214

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            ++G+RI+GN GDQWSDLLG +   R+FKLP+P+YYI
Sbjct  215  EEGFRIVGNSGDQWSDLLGSSMSNRSFKLPNPIYYI  250



>ref|XP_006656617.1| PREDICTED: acid phosphatase 1-like, partial [Oryza brachyantha]
Length=226

 Score =   228 bits (582),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 112/226 (50%), Positives = 149/226 (66%), Gaps = 4/226 (2%)
 Frame = +2

Query  194  AGGGHHIP-GVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAV  370
             G G  +P  V C SWRL  EANN+  W+ VP++C  YV  Y+ G  YR D   VA  A 
Sbjct  2    GGEGEEVPVEVRCASWRLAGEANNLAPWSAVPEECAAYVRGYVTGVAYRSDLEEVAREAS  61

Query  371  QYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAV  550
             YA+ A +A DG+D WVFD++ET LSNLPYYA  +  +G   ++  +FD WV  G APA+
Sbjct  62   TYARAARVAGDGRDAWVFDVDETLLSNLPYYA--EHGYGLELFDHREFDKWVERGEAPAI  119

Query  551  PGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKG-ANDTRTAVE  727
            P  ++LY+ +  LG K   L+G  +  + V + NLKK GY  W+KLIL+  A+  +TA  
Sbjct  120  PSSLKLYKEVRDLGFKTFLLTGRSEGHQGVTVDNLKKQGYHEWDKLILRAPADRKKTATI  179

Query  728  YKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            YKS+KR E+ ++GYRI+GN GDQWSDLLG +  AR+FKLP+PMYYI
Sbjct  180  YKSEKRKEMEEEGYRILGNSGDQWSDLLGYSTSARSFKLPNPMYYI  225



>ref|XP_011101105.1| PREDICTED: acid phosphatase 1-like [Sesamum indicum]
Length=267

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/217 (47%), Positives = 147/217 (68%), Gaps = 3/217 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            + C SWR+ VEANN+  W  +P++C +YV  YM+G  Y  D   V+  A  +A++  L+ 
Sbjct  53   LQCTSWRVAVEANNLSPWEKIPEECADYVKEYMIGKGYELDLQRVSNEAKAFARSVYLSG  112

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DGK  W+FD++ET LSNLPYYA  D  FG   +++TKF  WV  G APA+   + LY  +
Sbjct  113  DGKSAWIFDVDETLLSNLPYYA--DHGFGLEVFDSTKFGQWVEMGIAPAIESSLELYEEV  170

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELV  757
            +SLG K + L+G  ++ R + + NL + G+  W+KL+L+ + D  +TA  YKS+KR ELV
Sbjct  171  LSLGFKVILLTGRSERHRSITVENLFQAGFREWDKLLLRSSEDHEKTATIYKSEKRNELV  230

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
            ++GY+I+GN GDQWSDLLG +   R+FKLP+PMYYI+
Sbjct  231  EQGYQILGNSGDQWSDLLGSSMSIRSFKLPNPMYYIS  267



>ref|XP_007135620.1| hypothetical protein PHAVU_010G144200g [Phaseolus vulgaris]
 gb|ESW07614.1| hypothetical protein PHAVU_010G144200g [Phaseolus vulgaris]
Length=270

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 122/267 (46%), Positives = 163/267 (61%), Gaps = 12/267 (4%)
 Frame = +2

Query  74   KKRKLTMRAF--LLVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLG  247
            KK ++ M+ F  L+V V L  +P   H      Q+  L+  T     +   V+C SWRLG
Sbjct  11   KKSEVNMKFFSVLIVAVFLVALP--CHGSEY--QVFPLQMKTGSNEQYSTQVSCTSWRLG  66

Query  248  VEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFD  427
            VEANN+  W  VP  C+EYV  Y+LG QYR D   V   A  YAK   +    KD++VFD
Sbjct  67   VEANNLIKWKTVPAACQEYVADYLLGDQYRSDSKTVCREAYFYAKRLNIT--AKDVFVFD  124

Query  428  IEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVF  607
            I++TTLSNL Y+A     FG  A+NAT F  WVS G A A+P  + LY  LVSLGIK VF
Sbjct  125  IDDTTLSNLQYFANH--GFGVEAHNATAFKIWVSFGEAFALPETLVLYNKLVSLGIKVVF  182

Query  608  LSGTKQQFRKVRIANLKKTGYSHWEKLILK--GANDTRTAVEYKSKKRTELVKKGYRIIG  781
            ++      + V I+NLK+ G+  WEKLI +       + +  +K+ +R +LV +GYRI+G
Sbjct  183  ITERPVDLKDVTISNLKEVGFHTWEKLIARDPAIYSGKLSNAFKTSERKKLVAEGYRIVG  242

Query  782  NIGDQWSDLLGDNAGARTFKLPDPMYY  862
            NIGDQWSD++G+  G RTFKLP+P+YY
Sbjct  243  NIGDQWSDIVGEKKGFRTFKLPNPLYY  269



>ref|XP_009588519.1| PREDICTED: acid phosphatase 1-like [Nicotiana tomentosiformis]
Length=258

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 147/216 (68%), Gaps = 3/216 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            + C SWR  VE NN+  W  +P++C +YV  Y+ G  Y+ D   V+  A  YA++  L  
Sbjct  44   LECTSWRFAVETNNLSPWKTIPEECADYVRQYINGGAYKLDIDRVSSEAGTYAESMKLGG  103

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DGKD+WVFD++ET LSNLPYY++    +G   +++ KFD WV +G APA+   ++LY+ +
Sbjct  104  DGKDVWVFDVDETLLSNLPYYSQH--GYGLEVFDSVKFDEWVEKGVAPAIGSSLKLYQDV  161

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELV  757
            + LG K   L+G  ++ R V + NL   G+  W+KLIL+G+ D  ++A  YKS+KR E+V
Sbjct  162  MRLGFKVFLLTGRSERHRIVTVENLMNAGFQDWDKLILRGSEDHGKSATMYKSEKRDEMV  221

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            K+G+RI+GN GDQWSDLLG +A  R+FKLP+PMYYI
Sbjct  222  KEGFRIVGNSGDQWSDLLGSSASIRSFKLPNPMYYI  257



>ref|NP_001056747.1| Os06g0139800 [Oryza sativa Japonica Group]
 dbj|BAD68673.1| putative acid phosphatase [Oryza sativa Japonica Group]
 dbj|BAF18661.1| Os06g0139800 [Oryza sativa Japonica Group]
 gb|EAY99585.1| hypothetical protein OsI_21563 [Oryza sativa Indica Group]
 dbj|BAG86750.1| unnamed protein product [Oryza sativa Japonica Group]
Length=293

 Score =   228 bits (582),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/241 (47%), Positives = 150/241 (62%), Gaps = 6/241 (2%)
 Frame = +2

Query  155  SIPNQIHSLRPHTA--GGGHHIPG-VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLG  325
             +P    S  P  A  G G  +P  V C SWRL  EANN+  W  +P++C  YV  Y+ G
Sbjct  54   ELPTTTSSSSPALAEEGEGEAVPAEVRCASWRLAGEANNLAPWKSLPEECAAYVREYLTG  113

Query  326  HQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNA  505
              YR D   VA  A  YA+ A +  DG+D WVFD++ET LSNLPYYA  D  +G   ++ 
Sbjct  114  VAYRSDLEVVAREASAYARTARVGDDGRDAWVFDVDETLLSNLPYYA--DHGYGLELFDH  171

Query  506  TKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEK  685
             +FD WV  G APA+P  ++LY  +  LG K   L+G  +    V + NLKK G+  W+K
Sbjct  172  REFDKWVERGEAPAIPSSLKLYNEVRDLGFKTFLLTGRSEGHHGVTVDNLKKQGFHDWDK  231

Query  686  LILKG-ANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYY  862
            LIL+  A+  +TA  YKS+KR E+ ++GYRI+GN GDQWSDLLG +  AR+FKLP+PMYY
Sbjct  232  LILRAPADRKKTATIYKSEKRKEMEEEGYRILGNSGDQWSDLLGFSTSARSFKLPNPMYY  291

Query  863  I  865
            I
Sbjct  292  I  292



>gb|EAZ35770.1| hypothetical protein OsJ_20061 [Oryza sativa Japonica Group]
Length=293

 Score =   228 bits (580),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 114/241 (47%), Positives = 150/241 (62%), Gaps = 6/241 (2%)
 Frame = +2

Query  155  SIPNQIHSLRPHTA--GGGHHIPG-VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLG  325
             +P    S  P  A  G G  +P  V C SWRL  EANN+  W  +P++C  YV  Y+ G
Sbjct  54   ELPTTTSSSSPALAEEGEGEAVPAEVRCASWRLAGEANNLAPWKSLPEECAAYVREYLTG  113

Query  326  HQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNA  505
              YR D   VA  A  YA+ A +  DG+D WVFD++ET LSNLPYYA  D  +G   ++ 
Sbjct  114  VAYRSDLEVVAREASAYARTARVGDDGRDAWVFDVDETLLSNLPYYA--DHGYGLELFDH  171

Query  506  TKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEK  685
             +FD WV  G APA+P  ++LY  +  LG K   L+G  +    V + NLKK G+  W+K
Sbjct  172  REFDKWVERGEAPAIPSSLKLYNEVRDLGFKTFLLTGRSEGHHGVTVDNLKKQGFHDWDK  231

Query  686  LILKG-ANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYY  862
            LIL+  A+  +TA  YKS+KR E+ ++GYRI+GN GDQWSDLLG +  AR+FKLP+PMYY
Sbjct  232  LILRAPADRKKTATIYKSEKRKEMEEEGYRILGNSGDQWSDLLGFSTSARSFKLPNPMYY  291

Query  863  I  865
            I
Sbjct  292  I  292



>ref|XP_010941067.1| PREDICTED: acid phosphatase 1-like [Elaeis guineensis]
Length=271

 Score =   227 bits (578),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 140/216 (65%), Gaps = 3/216 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            + C SWR   EANN+  W  VP  C  YV  YM G  YR D   VA  A  YA++ +L  
Sbjct  57   LRCASWRFAGEANNLAPWKTVPADCGAYVKDYMTGKAYRFDLEMVADEAAAYARSISLVG  116

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DG D WVFD++ET LSNLPYYA  D  +G   +N+ +FD WV +  APA+   ++LY  +
Sbjct  117  DGMDAWVFDVDETLLSNLPYYA--DHGYGLEVFNSHEFDKWVDKAMAPAIQSSLKLYEEI  174

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELV  757
            + LG K   L+G  +  + V + NLKK G+  WEKLIL+G ND  + A  YKS+KR+E+ 
Sbjct  175  LRLGFKIFLLTGRSEGQKIVTVENLKKVGFQDWEKLILRGVNDHGKLATTYKSEKRSEIT  234

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
             +GYRI+GN GDQWSDLLG + G R+FKLP+PMYYI
Sbjct  235  AEGYRILGNSGDQWSDLLGSSTGNRSFKLPNPMYYI  270



>gb|EYU20188.1| hypothetical protein MIMGU_mgv1a011800mg [Erythranthe guttata]
Length=270

 Score =   226 bits (577),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 116/275 (42%), Positives = 162/275 (59%), Gaps = 21/275 (8%)
 Frame = +2

Query  86   LTMRAFLLVVVLLATIP--TFSHADSIPNQIHSLRPHTAGGGHHIPG------------V  223
            +  R    ++VLL+ +P   FS  D +       RP   G    I G            +
Sbjct  1    MMSRLLEKILVLLSVLPFACFSQEDGL---FPITRP-VIGQFSEIDGAQLKEWPQREDEL  56

Query  224  NCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHD  403
             C SWR+  EANN+  W  +P++C +YV  Y+ G  Y  D + V+  A  +A    L++D
Sbjct  57   QCTSWRVAGEANNLNPWRTIPEECIDYVKEYIKGKGYEFDLVRVSKIAGAFATTVNLSND  116

Query  404  GKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLV  583
            G+D W+FDI+ET LSNLPYYA     +G   +++ KFD WV  G APA+   + LYR ++
Sbjct  117  GRDAWIFDIDETLLSNLPYYAAH--GYGLEIFDSAKFDKWVETGNAPAIESSLNLYREVL  174

Query  584  SLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELVK  760
             LG K + L+G  ++ R + + NL K G+  WEKLIL+   D  +TA EYKS+KR ELV+
Sbjct  175  RLGFKAILLTGRSERHRSITVENLSKAGFCDWEKLILRSTEDHGKTAKEYKSEKRNELVE  234

Query  761  KGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            +GYRI+GN GDQWSDLLG +   R+FKL +PMYYI
Sbjct  235  EGYRILGNSGDQWSDLLGSSVSERSFKLSNPMYYI  269



>ref|XP_008376378.1| PREDICTED: acid phosphatase 1 [Malus domestica]
Length=266

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/217 (48%), Positives = 144/217 (66%), Gaps = 3/217 (1%)
 Frame = +2

Query  218  GVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLA  397
            G++C SWR  VEANN+  W  +P++C EYV  Y+ G  Y  D   V+  A  YAK+  L 
Sbjct  51   GLHCASWRFSVEANNVNPWETIPEECAEYVKDYLTGRAYGFDLERVSKEAGVYAKSVELN  110

Query  398  HDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRT  577
             DGKD+W+FDI++T LSNLPYY  +D  +G   ++  +FD WV +  APA+   ++LY  
Sbjct  111  GDGKDVWIFDIDDTLLSNLPYY--TDHGYGLEVFDNVEFDKWVEKAMAPAIKSSLKLYEE  168

Query  578  LVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTEL  754
            ++SLG K   L+G  +  RKV + NL   G+  W KLIL+ A+D  + A  YKS+KR+E+
Sbjct  169  VLSLGFKVFLLTGRTEGKRKVTVENLNNAGFRDWHKLILRSADDREKLATIYKSEKRSEM  228

Query  755  VKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
             K+GYRI+GN GDQWSDLLG +   R+FKLP+PMYYI
Sbjct  229  EKEGYRILGNSGDQWSDLLGTSVSLRSFKLPNPMYYI  265



>ref|XP_009800382.1| PREDICTED: acid phosphatase 1-like [Nicotiana sylvestris]
Length=257

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/216 (46%), Positives = 147/216 (68%), Gaps = 3/216 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            + C SWR  VEANN+  W  +P++C +YV  Y+ G  Y+ D   V+  A  YA++  L  
Sbjct  43   LECTSWRFAVEANNLSPWKTIPKECADYVRQYINGGAYKLDIDRVSSEAGAYAESMKLGA  102

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DGKD+W+FD++ET LSNLPYY++    +G   +++ KFD WV +G APA+   ++LY+ +
Sbjct  103  DGKDVWIFDVDETLLSNLPYYSQH--GYGLEVFDSVKFDEWVEKGVAPAIGSSLKLYQDV  160

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELV  757
            + LG K   L+G  ++ R V + NL   G+  W+KLIL+G+ D  ++A  YKS+KR E+V
Sbjct  161  MRLGFKVFLLTGRSERHRIVTVENLMNAGFQDWDKLILRGSEDHGKSATIYKSEKRDEMV  220

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            ++G+RI+GN GDQWSDLLG +   R+FKLP+PMYYI
Sbjct  221  EEGFRIVGNSGDQWSDLLGSSTSIRSFKLPNPMYYI  256



>ref|XP_010098160.1| Acid phosphatase 1 [Morus notabilis]
 gb|EXB74597.1| Acid phosphatase 1 [Morus notabilis]
Length=214

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 119/261 (46%), Positives = 149/261 (57%), Gaps = 49/261 (19%)
 Frame = +2

Query  92   MRAFLLVVVLLATIPTFSHADS--IPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNI  265
            M  F  + ++LA     +  D   I NQI+ LRP    GG +  GV CLSWR GVE NNI
Sbjct  1    MMLFFFLAIVLAAKTAQADFDGPVIVNQIYLLRPQYGSGGRN--GVTCLSWRFGVETNNI  58

Query  266  RDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTL  445
             DW  VP++C  YVG+YMLG QYR D  AV   A +YAK+  LA DGKD+W+FDI+ETTL
Sbjct  59   IDWETVPEECALYVGNYMLGQQYRQDSKAVVKEAYRYAKSLILADDGKDVWIFDIDETTL  118

Query  446  SNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQ  625
            SNLP+YAR    FG   ++A  F+ WV   +APA+P  ++L                   
Sbjct  119  SNLPFYAR--YGFGVKPHDAELFNEWVLTESAPALPESLKL-------------------  157

Query  626  QFRKVRIANLKKTGYSHWEKLILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSD  805
                                     +N + TAVEYKS +R +L   GY+I+GNIGDQWSD
Sbjct  158  ------------------------DSNYSITAVEYKSAERKKLEDAGYKIVGNIGDQWSD  193

Query  806  LLGDNAGARTFKLPDPMYYIA  868
            LLG N G RTFKLPDPMYY++
Sbjct  194  LLGTNTGCRTFKLPDPMYYVS  214



>ref|XP_009370433.1| PREDICTED: acid phosphatase 1-like [Pyrus x bretschneideri]
Length=266

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/216 (49%), Positives = 143/216 (66%), Gaps = 3/216 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            ++C SWR  VEANN+  W  +P++C EYV  Y+ G  Y  D   V+  A  YAK+  L  
Sbjct  52   LHCASWRFSVEANNVNPWKTIPEECAEYVKDYLKGRAYGFDLERVSKEAGVYAKSVELNG  111

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DGKD+W+FDI++T LSNLPYYA  D  +G   ++  +FD WV +  APA+   ++LY  +
Sbjct  112  DGKDVWIFDIDDTLLSNLPYYA--DHGYGLEVFDNVEFDKWVEKAMAPAIKSSLKLYEEV  169

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELV  757
            +SLG K   L+G  +  RKV + NL   G+  W KLIL+ A+D  + A  YKS+KR+E+ 
Sbjct  170  LSLGFKVFLLTGRTEGKRKVTVENLNNAGFRDWHKLILRSADDLEKMATIYKSEKRSEME  229

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            K+GYRI+GN GDQWSDLLG +   R+FKLP+PMYYI
Sbjct  230  KEGYRILGNSGDQWSDLLGTSVSPRSFKLPNPMYYI  265



>ref|NP_001242215.1| uncharacterized protein LOC100795218 precursor [Glycine max]
 gb|ACU20782.1| unknown [Glycine max]
 gb|ACU22719.1| unknown [Glycine max]
 gb|KHN05324.1| Stem 28 kDa glycoprotein [Glycine soja]
Length=255

 Score =   224 bits (571),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 117/254 (46%), Positives = 157/254 (62%), Gaps = 6/254 (2%)
 Frame = +2

Query  107  LVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVP  286
            ++V+ +AT+           Q   L+  T  GG +   V C SWRLGVEANN+  W  VP
Sbjct  5    VLVLFVATVLVAYECHGSDYQKFPLQMKTGFGGQYSNEVACASWRLGVEANNVVKWQTVP  64

Query  287  QQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYA  466
              C EY+  Y+LG QYR D   V   A  YAK+  L +  KD++V D+++TTLSNL Y+A
Sbjct  65   AACGEYIADYVLGDQYRSDSKTVNQQAYFYAKSLKLTN--KDVFVLDVDDTTLSNLQYFA  122

Query  467  RSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRI  646
                 FG   +N T F  WV +G A A+P  +++Y  L++LGIK VFLS        V  
Sbjct  123  NH--GFGVEPHNTTAFKNWVLDGEAFALPETLKMYNKLLALGIKIVFLSERPLSLGDVTA  180

Query  647  ANLKKTGYSHWEKLILKGANDT--RTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDN  820
             NLK+ G++ WEKLIL+  ++   + + EYKS +R +L K+GYRIIGN+GDQWSDLLG N
Sbjct  181  KNLKEVGFNTWEKLILRDPSEYSGKLSFEYKSAEREKLEKEGYRIIGNVGDQWSDLLGSN  240

Query  821  AGARTFKLPDPMYY  862
             G RTFKLP+P+YY
Sbjct  241  KGTRTFKLPNPLYY  254



>ref|NP_001234071.1| acid phosphatase 1 precursor [Solanum lycopersicum]
 sp|P27061.1|PPA1_SOLLC RecName: Full=Acid phosphatase 1; AltName: Full=Apase-1(1); Flags: 
Precursor [Solanum lycopersicum]
 gb|AAA34134.1| acid phosphatase type 1 precursor [Solanum lycopersicum]
 gb|AAA34135.1| acid phosphatase type 5 [Solanum lycopersicum]
 emb|CAA39370.1| acid phosphatase [Solanum lycopersicum]
 prf||1908427A acid phosphatase 1
Length=255

 Score =   224 bits (571),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/260 (42%), Positives = 162/260 (62%), Gaps = 8/260 (3%)
 Frame = +2

Query  92   MRAFLLVVVLLATIPTFS-HADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIR  268
            MR F+ +V+L   I T + ++   P  +    P           + C +WR  VE NN+ 
Sbjct  1    MRIFVFLVLLTVAIGTENLNSHVFPRPLIIEYPEKQLRDE----LKCTTWRFVVETNNLS  56

Query  269  DWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLS  448
             W  +P++C +YV  YM+G  Y+ +   V+  A +YAK+  L  DG+D+W+FD++ET LS
Sbjct  57   PWKTIPEECADYVKEYMVGPGYKMEIDRVSDEAGEYAKSVDLGDDGRDVWIFDVDETLLS  116

Query  449  NLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQ  628
            NLPYY  SD  +G   ++  +FD WV  GTAPA+   ++LY+ ++ LG K   L+G  ++
Sbjct  117  NLPYY--SDHRYGLEVFDDVEFDKWVENGTAPALGSSLKLYQEVLKLGFKVFLLTGRSER  174

Query  629  FRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELVKKGYRIIGNIGDQWSD  805
             R V + NL   G+  W KLIL+G++D  +TA  YKS++R  +V++G+RI+GN GDQWSD
Sbjct  175  HRSVTVENLMNAGFHDWHKLILRGSDDHGKTATTYKSERRNAMVEEGFRIVGNSGDQWSD  234

Query  806  LLGDNAGARTFKLPDPMYYI  865
            LLG +   R+FKLP+PMYYI
Sbjct  235  LLGSSMSYRSFKLPNPMYYI  254



>ref|XP_008367296.1| PREDICTED: acid phosphatase 1-like [Malus domestica]
Length=266

 Score =   224 bits (572),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 115/265 (43%), Positives = 162/265 (61%), Gaps = 12/265 (5%)
 Frame = +2

Query  101  FLLVVVLLATIPT-FSHA--DS--IPNQIHSLRPHTA----GGGHHIPGVNCLSWRLGVE  253
            FL + +L + +P  FSH   DS  +P  +    P  A        +   ++C SWR  VE
Sbjct  3    FLKIFLLFSLLPVAFSHETFDSRLLPRPLILEYPDIAETHFNDLENELRLHCDSWRFSVE  62

Query  254  ANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIE  433
            ANN+  W  +P++C  YV  Y+ G  Y  D   V+  A  YAK+  L  DGKD+W+FDI+
Sbjct  63   ANNVNXWKTIPEECAGYVKDYLTGRAYAXDLERVSKEAGVYAKSVELNGDGKDVWIFDID  122

Query  434  ETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLS  613
            +T LSNLPYYA  D  +G   ++  +FD WV +  APA+   ++LY  ++SLG K   L+
Sbjct  123  DTLLSNLPYYA--DHGYGLEVFDTVEFDKWVEKAMAPAIKSSLKLYEEVLSLGFKVFLLT  180

Query  614  GTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELVKKGYRIIGNIG  790
            G  +  RKV + NL   G+  W KLIL+ A+D  + A+ YKS+KR+E+ K+GYR++GN G
Sbjct  181  GRTEGKRKVTVENLNNAGFXEWHKLILRSADDHEKLAIIYKSEKRSEMEKEGYRLLGNSG  240

Query  791  DQWSDLLGDNAGARTFKLPDPMYYI  865
            DQWSDLLG +   R+FKLP+PMYYI
Sbjct  241  DQWSDLLGTSLALRSFKLPNPMYYI  265



>ref|XP_006358226.1| PREDICTED: acid phosphatase 1-like [Solanum tuberosum]
Length=263

 Score =   224 bits (571),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 99/216 (46%), Positives = 148/216 (69%), Gaps = 3/216 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            + C SWR  VEANN+  W ++PQ+C +YV  Y+ G  Y+ +   V+  A  +A++  L  
Sbjct  49   LECTSWRFAVEANNLSPWKIIPQECTDYVRQYITGGAYKMEIDRVSSEAGAFAESMKLGE  108

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DGKD+W+FD++ET LSNLPYY++    +G+  +++ +FD WV +G APA+   ++LY+ +
Sbjct  109  DGKDVWIFDVDETLLSNLPYYSQH--GYGSEVFDSVEFDKWVEKGVAPAIGSSLKLYQDV  166

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELV  757
            + LG K   L+G  ++ R V + NL   G+  W+KLIL+G+ D  ++A  YKS+KR E+V
Sbjct  167  MRLGFKVFLLTGRSERHRIVTVENLMNAGFQDWDKLILRGSEDHGKSATIYKSEKRNEMV  226

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            ++G RI GN GDQWSDLLG +A  R+FKLP+PMYYI
Sbjct  227  EEGLRIAGNSGDQWSDLLGSSASIRSFKLPNPMYYI  262



>gb|KHG01291.1| Acid phosphatase 1 [Gossypium arboreum]
Length=266

 Score =   224 bits (571),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/216 (48%), Positives = 144/216 (67%), Gaps = 3/216 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            ++C SWR  VEANN+  W  +P++C  YV  YM G  Y+ D   V+  A  YAKN  L+ 
Sbjct  52   LHCTSWRFSVEANNLSPWKTIPEECLGYVKEYMTGRGYKLDLERVSSEAGVYAKNLELSG  111

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DGKD+W+FDI+ET LSNLPYY      +G   ++  +FD WV +G APA+   ++LY  +
Sbjct  112  DGKDVWIFDIDETLLSNLPYYIEH--GYGLEIFDPIEFDKWVQKGMAPAIEPSLKLYEKI  169

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELV  757
            + LG K   L+G  ++ R + I NL K G+  W+KLIL+ +    + AV +KS+KR+E+V
Sbjct  170  LDLGFKVFLLTGRNEKHRSITIENLTKAGFQRWDKLILRDSEQHGKLAVVFKSEKRSEMV  229

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            ++GYRI+GN GDQWSDLLG +   R+FKLP+PMYYI
Sbjct  230  EEGYRIVGNSGDQWSDLLGADPSRRSFKLPNPMYYI  265



>ref|XP_009372837.1| PREDICTED: acid phosphatase 1-like [Pyrus x bretschneideri]
Length=266

 Score =   224 bits (571),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 142/216 (66%), Gaps = 3/216 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            ++C SWR  VEANN+  W  +P++C EYV  Y+ G  Y  D   V+  A  YAK+  L  
Sbjct  52   LHCASWRFSVEANNVNPWKTIPEECAEYVKDYLTGRAYGFDLERVSKEAGLYAKSVELNG  111

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DGKD+W+FDI++T LSNLPYYA  D  +G   ++  +FD WV +  APAV   ++LY  +
Sbjct  112  DGKDVWIFDIDDTLLSNLPYYA--DHGYGLEVFDNVEFDKWVEKAMAPAVKSSLKLYEEV  169

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELV  757
            +SLG K   L+G  +  RKV + NL   G+  W KLIL+ A+D  + A  YKS+KR E+ 
Sbjct  170  LSLGFKVFLLTGRTEGKRKVTVENLNNAGFRDWHKLILRSADDREKLATIYKSEKRGEME  229

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            K+GYRI+GN GDQWSDLLG +   R+FKLP+PMYYI
Sbjct  230  KEGYRILGNSGDQWSDLLGTSVSLRSFKLPNPMYYI  265



>ref|XP_006280976.1| hypothetical protein CARUB_v10026976mg [Capsella rubella]
 gb|EOA13874.1| hypothetical protein CARUB_v10026976mg [Capsella rubella]
Length=258

 Score =   224 bits (570),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 111/262 (42%), Positives = 161/262 (61%), Gaps = 9/262 (3%)
 Frame = +2

Query  92   MRAFLLVVVLLATIPTFSHADSI---PNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANN  262
            MR +L+V+VL++   +    DSI   P++I ++    A        ++C +WR   E NN
Sbjct  1    MRIYLIVLVLVSVFSSAFAEDSILKYPSEIENMHKRAADED---VDLHCTTWRFAAEMNN  57

Query  263  IRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETT  442
            +  W  +P +C +YV +Y++G  Y  D   V+  A  +A +   + DGKDIWVFDI+ET 
Sbjct  58   LAPWKTIPVECADYVKNYVMGKGYATDLERVSEEAFIFASSVEFSGDGKDIWVFDIDETL  117

Query  443  LSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTK  622
            LSNLPYY   D  FG   ++ ++FD WV  G APA+   ++LY+ ++ LG K   L+G K
Sbjct  118  LSNLPYYI--DHGFGLELFDHSEFDKWVERGVAPAIAPSLKLYQRVIDLGYKVFLLTGRK  175

Query  623  QQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKKGYRIIGNIGDQW  799
            +  R V + NL   G+ +W+KLIL+   +  + A  YKS+KR E+VK+GYRI GN GDQW
Sbjct  176  ESHRLVTVENLINAGFQNWDKLILRSPEEQHKMATLYKSEKRDEMVKEGYRIRGNSGDQW  235

Query  800  SDLLGDNAGARTFKLPDPMYYI  865
            SDLLG +   R+FKL +PMYYI
Sbjct  236  SDLLGTSMSQRSFKLANPMYYI  257



>ref|XP_008801792.1| PREDICTED: acid phosphatase 1-like [Phoenix dactylifera]
Length=270

 Score =   224 bits (571),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 110/236 (47%), Positives = 146/236 (62%), Gaps = 3/236 (1%)
 Frame = +2

Query  161  PNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRD  340
            P      +  T+  G     + C SWR   EANN+  W  VP  C  YV  YM G  YR 
Sbjct  36   PGDDQIFQTSTSDVGKEEVQLRCASWRFAGEANNLAPWKTVPADCGAYVKDYMTGKAYRF  95

Query  341  DCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDA  520
            D   VA  A  YA++ +LA D  D WVFD++ET LSNLPYYA  D  +G   +++ +FD 
Sbjct  96   DLEMVADEAAAYARSVSLAGDCMDAWVFDVDETLLSNLPYYA--DHGYGLEVFSSHEFDK  153

Query  521  WVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKG  700
            WV +  APA+   ++LY  ++ LG K   L+G  +  + V + NLKK G+  W++LIL+G
Sbjct  154  WVDKAMAPAIQSSLKLYEEILRLGFKIFLLTGRTEGQKIVTMENLKKVGFRDWKQLILRG  213

Query  701  AND-TRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
             ND  RTA  YKS+KR+E+V  GYRI+GN GDQWSDLLG + G R+FKLP+PM+YI
Sbjct  214  VNDHGRTATMYKSEKRSEIVANGYRILGNSGDQWSDLLGSSMGNRSFKLPNPMFYI  269



>ref|XP_009797620.1| PREDICTED: acid phosphatase 1-like [Nicotiana sylvestris]
Length=263

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/264 (42%), Positives = 162/264 (61%), Gaps = 5/264 (2%)
 Frame = +2

Query  80   RKLTMRAFLLVVVLLATIPTF-SHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEA  256
            R L +  FL++  L+       SH    P  I    PH       +  + C SWR  VE 
Sbjct  2    RILRVVTFLVLFTLVTGHENLNSHMFPRPLIIEYPEPHHHQLKDEVQ-LQCTSWRFAVET  60

Query  257  NNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEE  436
            NN+  W  +P++C  YV  Y+ G  Y+ D   V+  A  YAK+  L  DGKD+WVFD++E
Sbjct  61   NNLGPWKTIPEECGNYVRQYIEGGAYKMDIDRVSDEAGAYAKSRDLGADGKDVWVFDVDE  120

Query  437  TTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSG  616
            T LSNLPYY  SD   G   +++ +F+ WV +G APA+   ++LY+ ++SLG K   L+G
Sbjct  121  TLLSNLPYY--SDHGHGLEVFDSVEFEKWVEKGMAPAIGSSLKLYQDVLSLGFKVFLLTG  178

Query  617  TKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELVKKGYRIIGNIGD  793
              ++ R + + NL   G+  W KLIL+G++D  +TA  +KS++R E+V++G+RI+GN GD
Sbjct  179  RGERHRGITVENLMNAGFRDWHKLILRGSDDHGKTATTFKSERRNEMVEEGFRILGNSGD  238

Query  794  QWSDLLGDNAGARTFKLPDPMYYI  865
            QWSDLLG +A  R+FKLP+PMYYI
Sbjct  239  QWSDLLGSSASNRSFKLPNPMYYI  262



>ref|XP_010693738.1| PREDICTED: acid phosphatase 1 [Beta vulgaris subsp. vulgaris]
Length=263

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/216 (47%), Positives = 144/216 (67%), Gaps = 3/216 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            + C SWR GVEANN+  W  +PQ+C +YV +YM+G  Y+ D   V+  +  +AK+  L  
Sbjct  49   LQCTSWRFGVEANNLNPWKTIPQECGDYVKNYMMGKGYQLDLERVSYESSVFAKSVHLGD  108

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            D  D+WVFD++ET LSNLPYY +    +G   +++ +FD WV +G APA+   +RLY  +
Sbjct  109  DSNDVWVFDVDETLLSNLPYYVQH--GYGLEVFDSVEFDKWVDKGMAPAIEPSLRLYEEV  166

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELV  757
            +SLG K   L+G  ++ R V   NL   G+ +W+KLIL+   D  + A+ +KS+KR E+V
Sbjct  167  LSLGFKIFLLTGRSEKRRDVTAQNLMNAGFKNWDKLILRDTEDHGKLAMIFKSEKRIEMV  226

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            K+G+RI+GN GDQWSDLLG     R+FKLP+PMYYI
Sbjct  227  KEGFRILGNSGDQWSDLLGSAMSTRSFKLPNPMYYI  262



>ref|XP_004235180.1| PREDICTED: acid phosphatase 1 [Solanum lycopersicum]
Length=263

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/216 (46%), Positives = 146/216 (68%), Gaps = 3/216 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            + C SWR  VEANN+  W ++PQ+C +YV  Y+ G  Y+ +   V+  A  +A++  L  
Sbjct  49   LECTSWRFAVEANNLSPWKIIPQECADYVRQYITGGAYKMEIDRVSTEAGAFAESMKLGE  108

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DGKD+W+FD++ET LSNLPYY++    +G   +++ +FD WV +G APA+   ++LY+ +
Sbjct  109  DGKDVWIFDVDETLLSNLPYYSQH--GYGLEVFDSVEFDKWVEKGEAPAIGSSLKLYQDV  166

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELV  757
            + LG K   L+G  ++ R V + NL   G+  W+KLIL+G+ D  ++A  YKS+KR E+V
Sbjct  167  MRLGFKVFLLTGRSERHRIVTVENLMNAGFQDWDKLILRGSEDHGKSATIYKSEKRNEMV  226

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            + G RI GN GDQWSDLLG +A  R+FKLP+PMYYI
Sbjct  227  EDGLRIAGNSGDQWSDLLGSSASIRSFKLPNPMYYI  262



>ref|XP_002510996.1| Acid phosphatase 1 precursor, putative [Ricinus communis]
 gb|EEF51598.1| Acid phosphatase 1 precursor, putative [Ricinus communis]
Length=272

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/216 (50%), Positives = 142/216 (66%), Gaps = 3/216 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            + C SWR  VEANN+  W  +PQ+C  YV  Y++G  Y+ D   V+  A  YAK+  L+ 
Sbjct  58   LQCTSWRFAVEANNLNPWKTIPQECAGYVRDYVMGRGYQVDLERVSNEAGVYAKSVQLSE  117

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DGKD WVFD++ET LSNLPYYA  D  +G   ++  KFD WV E TAPA+   ++LY+ +
Sbjct  118  DGKDAWVFDVDETLLSNLPYYA--DHGYGLEVFDPMKFDKWVEEATAPAIESSLKLYKEV  175

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELV  757
              LG K   L+G  +  R V   NL K G+  W+KLIL+ + D  + A  YKS+KR+E+V
Sbjct  176  RGLGFKVFLLTGRSEYQRGVTEENLIKAGFQSWDKLILRASGDHGKLASIYKSEKRSEMV  235

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
             +GYRI+GN GDQWSDLLG +   R+FKLP+PMYYI
Sbjct  236  SEGYRILGNSGDQWSDLLGISMSTRSFKLPNPMYYI  271



>gb|ABK95709.1| unknown [Populus trichocarpa]
Length=183

 Score =   219 bits (559),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 134/185 (72%), Gaps = 3/185 (2%)
 Frame = +2

Query  317  MLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATA  496
            MLG QYR+D   +   A  +AK   LA DGKDIWVFD++ETTLSNLPYYA+    FGA  
Sbjct  1    MLGSQYREDSAVITDEAFAHAKTFKLAGDGKDIWVFDVDETTLSNLPYYAKH--GFGAEP  58

Query  497  YNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSH  676
            YN+T F+ WV  G A A+P  ++LYR L+S+GIK VFL+G  +  R V   NLK  GY  
Sbjct  59   YNSTAFNQWVFTGKALALPESLKLYRNLLSIGIKVVFLTGRTEDQRAVTSNNLKNAGYHI  118

Query  677  WEKLILKGANDT-RTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDP  853
            WEKLILK ++ + +TAV YKS +R +L KKGYRIIGNIGDQWSDLLG + G RTFKLPDP
Sbjct  119  WEKLILKSSSYSGKTAVFYKSSERAKLEKKGYRIIGNIGDQWSDLLGTSVGNRTFKLPDP  178

Query  854  MYYIA  868
            MYYI+
Sbjct  179  MYYIS  183



>prf||1908418A acid phosphatase 1
Length=255

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/260 (41%), Positives = 161/260 (62%), Gaps = 8/260 (3%)
 Frame = +2

Query  92   MRAFLLVVVLLATIPTFS-HADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIR  268
            MR F+ +V+L   I T + ++   P  +    P           + C +WR  VE NN+ 
Sbjct  1    MRIFVFLVLLTVAIGTENLNSHVFPRPLIIEYPEKQLRDE----LKCTTWRFVVETNNLS  56

Query  269  DWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLS  448
             W  +P++C +YV  YM+G  Y+ +   V+  A +YAK+  L  DG+D+W+FD++ET LS
Sbjct  57   PWKTIPEECADYVKEYMVGPGYKMEIDRVSDEAGEYAKSVDLGDDGRDVWIFDVDETLLS  116

Query  449  NLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQ  628
            NLPYY  SD  +G   ++  +FD WV  G APA+   ++LY+ ++ LG K   L+G  ++
Sbjct  117  NLPYY--SDHRYGLEVFDDVEFDKWVENGIAPALGSSLKLYQEVLKLGFKVFLLTGRSER  174

Query  629  FRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELVKKGYRIIGNIGDQWSD  805
             R V + NL   G+  W KLIL+G++D  +TA  YKS++R  +V++G+RI+GN GDQWSD
Sbjct  175  HRSVTVENLMNAGFHDWHKLILRGSDDHGKTATTYKSERRNAMVEEGFRIVGNSGDQWSD  234

Query  806  LLGDNAGARTFKLPDPMYYI  865
            LLG +   R+FKLP+PMYYI
Sbjct  235  LLGSSMSYRSFKLPNPMYYI  254



>ref|XP_009362705.1| PREDICTED: acid phosphatase 1 [Pyrus x bretschneideri]
Length=266

 Score =   222 bits (566),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 142/216 (66%), Gaps = 3/216 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            ++C SWR  VEANN+  W  +P+ C EYV  Y+ G  Y  D   V+  A  YAK   L  
Sbjct  52   LHCDSWRFSVEANNVNPWKTIPEDCAEYVKDYLTGRAYEFDLERVSKEAGVYAKRVELNG  111

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DGKD+W+FDI++T LSNLPYYA  D  +G   ++  +F+ WV +  APA+   ++LY  +
Sbjct  112  DGKDVWIFDIDDTLLSNLPYYA--DHGYGLEVFDTVEFNKWVEKAMAPAIKSSLKLYEEV  169

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELV  757
            +SLG K   L+G  +  RKV + NL   G+  W KLIL+ A+D  + A+ YKS+KR+E+ 
Sbjct  170  LSLGFKVFLLTGRTEGKRKVTVENLNNAGFREWHKLILRSADDHEKLAIIYKSEKRSEME  229

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            ++GYR++GN GDQWSDLLG +   R+FKLP+PMYYI
Sbjct  230  REGYRLLGNSGDQWSDLLGTSVALRSFKLPNPMYYI  265



>ref|XP_003620757.1| Acid phosphatase-like protein [Medicago truncatula]
 gb|AES76975.1| plant acid phosphatase [Medicago truncatula]
Length=252

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/215 (48%), Positives = 137/215 (64%), Gaps = 3/215 (1%)
 Frame = +2

Query  227  CLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDG  406
            C SWRL VE NN+  W  +P +C E V  YM+G +Y  DC  V   + ++ K  T+  DG
Sbjct  40   CDSWRLAVETNNVGQWKQIPARCVESVAEYMIGEKYESDCEVVGKFSAEFVKGVTVGGDG  99

Query  407  KDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVS  586
            +D WVFDI+ET LSN+PYY   DV FG+  +N T F+ WV+   APA+P  +  YR L  
Sbjct  100  RDAWVFDIDETLLSNVPYY--QDVGFGSKIFNETSFNDWVNLADAPALPASLSFYRKLQE  157

Query  587  LGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKK  763
            LG     L+G  +  R V  ANL   GY +WE+LIL+GA+D  ++A  YKS+KR EL+ +
Sbjct  158  LGFTIFLLTGRSEHQRNVTEANLLFAGYRNWERLILRGASDQGKSATSYKSEKRQELMSE  217

Query  764  GYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
            GYRI G+ GDQWSDL G     R+FKLP+PMY+I 
Sbjct  218  GYRIHGSSGDQWSDLWGYAVSTRSFKLPNPMYFIG  252



>gb|KDP22459.1| hypothetical protein JCGZ_26290 [Jatropha curcas]
Length=268

 Score =   222 bits (566),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/217 (48%), Positives = 141/217 (65%), Gaps = 3/217 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            + C SWR  VEANN+  W  +PQ C EYV +YM+G  Y+ D   V+  A  YAK+  L  
Sbjct  54   LQCTSWRFAVEANNLNPWKTIPQDCAEYVRNYMMGRGYQVDLERVSNEAGVYAKSVQLNE  113

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DGKD WVFD++ET LSNLPYY      +G   ++  +FD WV +  APA+   ++LY+ +
Sbjct  114  DGKDAWVFDVDETLLSNLPYYTGH--GYGLEIFDPLEFDKWVEKAMAPAIEPSLKLYKEI  171

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELV  757
            + LG K   L+G  ++ R V   NL   G+ +W+KLIL+ ++D  + A  YKS+KR E+V
Sbjct  172  LGLGFKVFLLTGRNEKQRSVTEENLINAGFQNWDKLILRASDDHGKLATTYKSEKRNEMV  231

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
             +GYRI GN GDQWSDLLG +   R+FKLP+PMYYIA
Sbjct  232  NEGYRIQGNSGDQWSDLLGSSMSTRSFKLPNPMYYIA  268



>ref|XP_004511128.1| PREDICTED: acid phosphatase 1-like [Cicer arietinum]
Length=264

 Score =   222 bits (565),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 105/217 (48%), Positives = 143/217 (66%), Gaps = 3/217 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            + C SWR   EANN+  W  VP++C EYV  YM G  Y  D   V+  A +YAK+  L  
Sbjct  50   LRCSSWRFAGEANNLSPWKTVPKECAEYVKEYMTGKGYVYDLEIVSKEAEEYAKSVQLNE  109

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DG D W+FDI+ET LSNLPYYA     FG   ++  KFD WV +G APA+   ++LY  +
Sbjct  110  DGLDAWIFDIDETLLSNLPYYAAH--GFGLQVFDHAKFDDWVVKGVAPAIEPSLKLYEDV  167

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELV  757
            ++LG K + L+G  +Q R V + NL   G+  W +LIL+G++D  + AV YKS+KR+E+ 
Sbjct  168  LNLGYKVILLTGRSEQHRAVTVDNLINAGFRDWHQLILRGSDDKGKRAVIYKSEKRSEME  227

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
            K GYRI+GN GDQWSDL+G +   ++FKLP+PMYYI+
Sbjct  228  KDGYRILGNSGDQWSDLIGSSLSVKSFKLPNPMYYIS  264



>ref|XP_011028463.1| PREDICTED: acid phosphatase 1 [Populus euphratica]
Length=261

 Score =   221 bits (563),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 107/216 (50%), Positives = 143/216 (66%), Gaps = 3/216 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            + C SWR GVEANN+  W  VP +C EYV  YMLG  Y  D   V+  A  YAK+  L+ 
Sbjct  47   LQCTSWRFGVEANNLNPWKTVPLECGEYVKDYMLGRAYSLDLERVSNEAGVYAKSLKLSG  106

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DGKDIWVFD++ET LS+LPYYA  D  +G   ++  +F+ WV +  APA+   ++LY+ +
Sbjct  107  DGKDIWVFDVDETLLSHLPYYA--DHGYGLERFDPAEFNKWVDKAIAPALEPSLKLYKEV  164

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELV  757
            + LG K   L+G  +  R V   NL   G+ +W+KLIL+G+ D  + A  +KS KR+E+V
Sbjct  165  MGLGFKVFLLTGRSEMQRSVTEENLINAGFQNWDKLILRGSEDHGKLATIFKSDKRSEMV  224

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            K+GYRI+GN GDQWSDLLG     R+FKLP+PMYYI
Sbjct  225  KEGYRILGNSGDQWSDLLGSFMSNRSFKLPNPMYYI  260



>gb|ACU24349.1| unknown [Glycine max]
Length=255

 Score =   221 bits (562),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 115/254 (45%), Positives = 155/254 (61%), Gaps = 6/254 (2%)
 Frame = +2

Query  107  LVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVP  286
            ++V+ +AT+           Q   L+  T  GG +   V C SWRLGVEANN+  W  VP
Sbjct  5    VLVLFVATVLVAYECRGSDYQKFPLQMKTGFGGQYSNEVACASWRLGVEANNVVKWQTVP  64

Query  287  QQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYA  466
              C EY+  Y+LG QYR D   V   A  YAK+  L +  KD++V D+++TTLSNL Y+A
Sbjct  65   AACGEYIADYVLGDQYRSDFKTVNQQAYFYAKSLKLTN--KDVFVLDVDDTTLSNLQYFA  122

Query  467  RSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRI  646
                 FG   +N T F  WV +G A A+P  +++Y  L++ GIK VFLS        V  
Sbjct  123  NH--GFGVEPHNTTAFKNWVLDGEAFALPEILKMYNKLLAFGIKIVFLSERPLSLGDVTA  180

Query  647  ANLKKTGYSHWEKLILKGANDT--RTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDN  820
             NLK+ G++ WEKLI +  ++   + + EYKS +R +L K+GYRIIGN+GDQWSDLLG N
Sbjct  181  KNLKEVGFNTWEKLIFRDPSEYSGKLSFEYKSAEREKLEKEGYRIIGNVGDQWSDLLGSN  240

Query  821  AGARTFKLPDPMYY  862
             G RTFKLP+P+YY
Sbjct  241  KGTRTFKLPNPLYY  254



>gb|AFK34288.1| unknown [Medicago truncatula]
Length=252

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 137/215 (64%), Gaps = 3/215 (1%)
 Frame = +2

Query  227  CLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDG  406
            C SWRL VE N++  W  +P +C E V  YM+G +Y  DC  V   + ++ K  T+  DG
Sbjct  40   CDSWRLAVETNSVGQWKQIPARCVESVAEYMIGEKYESDCEVVGKFSAEFVKGVTVGGDG  99

Query  407  KDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVS  586
            +D WVFDI+ET LSN+PYY   DV FG+  +N T F+ WV+   APA+P  +  YR L  
Sbjct  100  RDAWVFDIDETLLSNVPYY--QDVGFGSKIFNETSFNDWVNLADAPALPASLSFYRKLQE  157

Query  587  LGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKK  763
            LG     L+G  +  R V  ANL   GY +WE+LIL+GA+D  ++A  YKS+KR EL+ +
Sbjct  158  LGFTIFLLTGRSEHQRNVTEANLLFAGYRNWERLILRGASDQGKSATSYKSEKRQELMSE  217

Query  764  GYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
            GYRI G+ GDQWSDL G     R+FKLP+PMY+I 
Sbjct  218  GYRIHGSSGDQWSDLWGYAVSTRSFKLPNPMYFIG  252



>gb|AHC69831.1| acid phosphatase [Nicotiana tabacum]
Length=263

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/264 (42%), Positives = 160/264 (61%), Gaps = 5/264 (2%)
 Frame = +2

Query  80   RKLTMRAFLLVVVLLATIPTF-SHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEA  256
            R L +  FL++  L+       SH    P  I    PH       +  + C SWR  VE 
Sbjct  2    RILRVVTFLVLFTLVTGHENLNSHMFPRPLIIEYPEPHHHQLKDEVQ-LQCTSWRFAVET  60

Query  257  NNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEE  436
            NN+  W  +P++C  YV  Y+ G  Y+ D   V+  A  YAK+  L  DGKD+WVFD++E
Sbjct  61   NNLGPWKTIPEECGNYVRQYIEGGAYKMDIDRVSDEAGAYAKSRDLGADGKDVWVFDVDE  120

Query  437  TTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSG  616
            T LSNLPYY  SD   G   +++ +F+ WV +G APA+   ++LY+ ++ LG K   L+G
Sbjct  121  TLLSNLPYY--SDHGHGLEVFDSVEFEKWVEKGMAPAIGSSLKLYQDVMRLGFKVFLLTG  178

Query  617  TKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELVKKGYRIIGNIGD  793
              ++ R V + NL   G+  W+KLIL+G+ D  ++A  YKS+KR E+V++G+R++GN GD
Sbjct  179  RSERHRIVTVENLMNAGFQDWDKLILRGSEDHGKSATIYKSEKRDEMVEEGFRLVGNSGD  238

Query  794  QWSDLLGDNAGARTFKLPDPMYYI  865
            QWSDLLG +   R+FKLP+PMYYI
Sbjct  239  QWSDLLGSSTSIRSFKLPNPMYYI  262



>gb|AGV54493.1| acid phosphatase [Phaseolus vulgaris]
Length=256

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/263 (45%), Positives = 158/263 (60%), Gaps = 12/263 (5%)
 Frame = +2

Query  86   LTMRAF--LLVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEAN  259
            + M+ F  L+V   L  +P   H      Q+  L+  T     +   V+C SWRLGVEAN
Sbjct  1    MNMKFFSVLIVAAFLVALP--CHGSEY--QVFPLQMKTGSNEQYSTQVSCTSWRLGVEAN  56

Query  260  NIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEET  439
            N+  W  VP  C+EYV  Y+LG QYR D   V   A  YAK  TL    +D++VFDI++T
Sbjct  57   NLIKWKTVPAACQEYVADYLLGDQYRSDSKTVCREAYFYAK--TLNITARDVFVFDIDDT  114

Query  440  TLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGT  619
            TLSNL Y+A     FG  A+NAT F  WVS G A A+P  + LY  LV LGIK VF++  
Sbjct  115  TLSNLQYFANH--GFGVEAHNATAFKIWVSFGEAFALPETLVLYNKLVGLGIKVVFITER  172

Query  620  KQQFRKVRIANLKKTGYSHWEKLILK--GANDTRTAVEYKSKKRTELVKKGYRIIGNIGD  793
                + V I+NLK+ G+  WEK I +       + +  +K+ +R +LV +GYRI+GNIGD
Sbjct  173  PVDLKDVTISNLKEVGFHTWEKFIARDPAIYSGKLSNAFKTSERKKLVAEGYRIVGNIGD  232

Query  794  QWSDLLGDNAGARTFKLPDPMYY  862
            QWSD++G+  G RTFKLP+P+YY
Sbjct  233  QWSDIVGEKKGFRTFKLPNPLYY  255



>ref|NP_001240054.1| uncharacterized protein LOC100802126 precursor [Glycine max]
 gb|ACU19722.1| unknown [Glycine max]
Length=271

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/217 (47%), Positives = 145/217 (67%), Gaps = 3/217 (1%)
 Frame = +2

Query  218  GVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLA  397
            G+ C +WR+  EANN+  W  +P++C EYV  YM G  Y  D   V+  A ++A++  L 
Sbjct  56   GLRCGAWRVAGEANNLGAWRTIPEECTEYVKEYMTGKGYAVDLEMVSKEAEEFARSVPLG  115

Query  398  HDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRT  577
             DGKD W+FDI+ET LSNLPYYA     +G   ++  KF+ WV +G APA+   ++LY  
Sbjct  116  SDGKDAWIFDIDETLLSNLPYYAAH--GYGLEVFDHEKFNNWVEKGVAPAIEPSLKLYED  173

Query  578  LVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTEL  754
            +++LG K + L+G  ++ R V + NL   G+  W++LIL+ ++D  + AV YKS+KR+E+
Sbjct  174  VLNLGFKVILLTGRSERHRSVTVDNLINAGFKEWDQLILRNSDDQGKRAVLYKSEKRSEM  233

Query  755  VKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
             K GYRI+GN GDQWSDLLG +   R+FKLP+PMYYI
Sbjct  234  EKDGYRILGNSGDQWSDLLGSSVSVRSFKLPNPMYYI  270



>gb|KCW90870.1| hypothetical protein EUGRSUZ_A02919 [Eucalyptus grandis]
Length=263

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 142/216 (66%), Gaps = 3/216 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            + C SWR  VEANN+  W  +PQ+C +YV  YM+G  Y  D   V+  A  YA +  L+ 
Sbjct  49   LQCDSWRFAVEANNVNPWKTIPQECADYVRDYMMGKGYGFDIDRVSKEAAVYAGSVELSG  108

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DGKD+W+FDI+ET LSNLPYYA     FG   ++  +FD WV +  A  +   ++LY  +
Sbjct  109  DGKDVWIFDIDETLLSNLPYYAEH--GFGLEVFDPVEFDKWVDKAEALGIQPSLKLYELV  166

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELV  757
            + LG K   L+G  ++ R V I NL   G+ +W+KLI++ + D ++ AV YKS+KR E+V
Sbjct  167  LGLGFKVFLLTGRSEEQRSVTIENLINAGFQNWDKLIVRASEDHSKLAVVYKSEKRDEMV  226

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            ++GYRI+GN GDQWSDLLG +   R+FKLP+PMYYI
Sbjct  227  REGYRILGNSGDQWSDLLGSSMSIRSFKLPNPMYYI  262



>ref|XP_004307784.1| PREDICTED: acid phosphatase 1-like [Fragaria vesca subsp. vesca]
Length=267

 Score =   219 bits (559),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/216 (47%), Positives = 142/216 (66%), Gaps = 3/216 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            + C SWR  VEANN+  W  +P++C EYV  Y+ G  Y  D   V+  A  Y K+  L  
Sbjct  53   LRCTSWRFAVEANNVNPWKTIPEECVEYVKDYVTGRGYSVDLERVSNEAGIYVKSVVLGG  112

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DGKD+W+FD+++T LSN+PYYA  D  +G+  ++  +FD WV +G +PA+   ++LY  +
Sbjct  113  DGKDVWIFDVDDTLLSNVPYYA--DHGYGSEVFDQVEFDKWVDKGMSPAIKSSLKLYEEV  170

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELV  757
            + LG K   L+G  +  R V   NLK  G+  W KLIL+ A+D  ++A  YKS+KR+E+ 
Sbjct  171  LGLGFKVFLLTGRSEGKRGVTAENLKNVGFQDWHKLILRAADDHGKSATIYKSEKRSEME  230

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            K+GYRI+GN GDQWSDLLG +   R+FKLP+PMYYI
Sbjct  231  KEGYRILGNSGDQWSDLLGSSMSIRSFKLPNPMYYI  266



>ref|XP_002867623.1| hypothetical protein ARALYDRAFT_329150 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43882.1| hypothetical protein ARALYDRAFT_329150 [Arabidopsis lyrata subsp. 
lyrata]
Length=260

 Score =   219 bits (558),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 102/217 (47%), Positives = 140/217 (65%), Gaps = 3/217 (1%)
 Frame = +2

Query  218  GVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLA  397
             ++C SWR   E NN+  W  +P +C +YV HY++G  Y  D   V+  A  YA +    
Sbjct  45   NLHCTSWRFAAETNNLAPWKTIPAECADYVYHYLMGEGYVVDVERVSEEAKLYASSFQSN  104

Query  398  HDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRT  577
             DGKDIW+FDI+ET LSNLPYY       G   ++ +KFD WV +G APA+    +LY+ 
Sbjct  105  ADGKDIWIFDIDETLLSNLPYYMEH--GCGLEVFDHSKFDKWVEKGIAPAIAPSFKLYQK  162

Query  578  LVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTEL  754
            +V LG K + L+G ++  R + + NL+  G+ +W+KLIL+  +D  +TA  YKS+KR E+
Sbjct  163  VVDLGYKVILLTGRRENHRVITVENLRNAGFHNWDKLILRSLDDRNKTATMYKSEKREEM  222

Query  755  VKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            VK+GYRI GN GDQWSDLLG     R+FKLP+PMYYI
Sbjct  223  VKEGYRIRGNSGDQWSDLLGSAMSERSFKLPNPMYYI  259



>ref|XP_006385121.1| acid phosphatase family protein [Populus trichocarpa]
 gb|ERP62918.1| acid phosphatase family protein [Populus trichocarpa]
Length=261

 Score =   219 bits (558),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/216 (49%), Positives = 143/216 (66%), Gaps = 3/216 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            + C SWR GVEANN+  W  VP +C EYV  YMLG  Y  D   V+  +  YAK+  L+ 
Sbjct  47   LQCTSWRFGVEANNLNPWKTVPLECGEYVKDYMLGRAYSLDLERVSNESGVYAKSLKLSG  106

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DGKDIWVFD++ET LS+LPYYA  D  +G   ++  +F+ WV +  APA+   ++LY+ +
Sbjct  107  DGKDIWVFDVDETLLSHLPYYA--DHGYGLEIFDPAEFNKWVDKAIAPALEPSLKLYKEV  164

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELV  757
            + LG K   L+G  +  R V   NL   G+ +W+KLIL+G+ D  + A  +KS KR+E+V
Sbjct  165  MDLGFKVFLLTGRSETQRSVTEENLINAGFQNWDKLILRGSEDHGKLATIFKSDKRSEMV  224

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            K+G+RI+GN GDQWSDLLG     R+FKLP+PMYYI
Sbjct  225  KEGFRILGNSGDQWSDLLGSFMSNRSFKLPNPMYYI  260



>ref|NP_199939.1| HAD superfamily, subfamily IIIB acid phosphatase [Arabidopsis 
thaliana]
 dbj|BAA97389.1| acid phosphatase [Arabidopsis thaliana]
 dbj|BAD95053.1| acid phosphatase [Arabidopsis thaliana]
 gb|ABD19661.1| At5g51260 [Arabidopsis thaliana]
 gb|AED96059.1| HAD superfamily, subfamily IIIB acid phosphatase [Arabidopsis 
thaliana]
Length=257

 Score =   219 bits (557),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 110/262 (42%), Positives = 163/262 (62%), Gaps = 10/262 (4%)
 Frame = +2

Query  92   MRAFLLVVVLLATIPTFSHADSI---PNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANN  262
            MR +L+ +V+++   T + +DSI   P++I S   H       +  ++C +WR   E NN
Sbjct  1    MRIYLIFLVVVSLF-TSAFSDSILEYPSEIES--RHKKAAEEDV-NLHCTTWRFAAEMNN  56

Query  263  IRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETT  442
            +  W  +P +C +YV  Y++G  Y  D   V+  A+ +A++   + DGKDIW+FDI+ET 
Sbjct  57   LAPWKTIPVECADYVKDYVMGKGYLTDLERVSEEALIFARSIEFSGDGKDIWIFDIDETL  116

Query  443  LSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTK  622
            LSNLPYY   D  FG   ++ ++FD WV  G APA+   ++LY+ ++ LG K   L+G K
Sbjct  117  LSNLPYYI--DHGFGLELFDHSEFDKWVERGVAPAIAPSLKLYQRVLDLGYKVFLLTGRK  174

Query  623  QQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKKGYRIIGNIGDQW  799
            +  R V + NL   G+ +W+KLIL+   +  + A  YKS+KR E+VK+GYRI GN GDQW
Sbjct  175  ESHRLVTVENLINAGFQNWDKLILRSPEEQHKMATLYKSEKRDEMVKEGYRIRGNSGDQW  234

Query  800  SDLLGDNAGARTFKLPDPMYYI  865
            SDLLG +   R+FKL +PMYYI
Sbjct  235  SDLLGTSMSQRSFKLANPMYYI  256



>gb|EYU31308.1| hypothetical protein MIMGU_mgv1a011623mg [Erythranthe guttata]
Length=276

 Score =   219 bits (559),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 116/276 (42%), Positives = 165/276 (60%), Gaps = 18/276 (7%)
 Frame = +2

Query  77   KRKLTMRA--FLLVVVLLA----TIPTFSHADSIP-----NQIHSLRPHTAGGGHHIPGV  223
            +R +T+ A  FLL V+ LA    T  +  H    P     N+ H L+   A     +   
Sbjct  5    RRPITISALIFLLTVLPLAFPKETSSSTDHQFPRPLILEINESHHLKKSPAAEESEL---  61

Query  224  NCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLA-H  400
             C SWR+  EANN+  W  +P +C +YV  YM    Y  D   V+  +V YA+   L+  
Sbjct  62   QCTSWRVAAEANNLSPWKKIPDECADYVKEYMEYKGYEIDLQRVSNESVLYARTLNLSGS  121

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DGK  WVFD++ET LSNLPYY   D  +G   ++  KFD WV +G APA+   +++Y  +
Sbjct  122  DGKFSWVFDVDETLLSNLPYYV--DHGYGLEIFDGEKFDEWVEKGEAPALKSSLKVYEEV  179

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELV  757
            ++LG K   L+G  ++FR +   NL + G+ +W+KLIL+   D  +TA++YKS KR ELV
Sbjct  180  LALGFKVFLLTGRSERFRNITARNLVRAGFRNWDKLILRSTEDNGKTAIKYKSGKRNELV  239

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            ++GY+I+GN GDQWSDLLG +   R+FKLP+PMYYI
Sbjct  240  QEGYKILGNSGDQWSDLLGTSISERSFKLPNPMYYI  275



>ref|XP_010532228.1| PREDICTED: acid phosphatase 1-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010532229.1| PREDICTED: acid phosphatase 1-like isoform X2 [Tarenaya hassleriana]
Length=266

 Score =   219 bits (557),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 103/217 (47%), Positives = 140/217 (65%), Gaps = 3/217 (1%)
 Frame = +2

Query  218  GVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLA  397
             + C SWR   E NN+  W  VP +C +YV  Y++G  Y  D   V+  A  YA +  L+
Sbjct  51   NLRCTSWRFAAETNNLAPWKTVPAECADYVKDYVMGRAYVIDLERVSDEAGFYASSVDLS  110

Query  398  HDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRT  577
             DGKDIWVFDI+ET LSNLPYY      +G   ++  +FD WV +G APA+   ++LY+ 
Sbjct  111  GDGKDIWVFDIDETLLSNLPYYIEH--GYGMEVFDHLEFDKWVEKGVAPAIAPSLKLYQK  168

Query  578  LVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTEL  754
            ++ LG K   L+G  +  R V + NL   G+ +W+KLIL+ + +  +TA EYKS+KR E+
Sbjct  169  VIDLGYKVFLLTGRSESHRLVTVENLINAGFQNWDKLILRSSEEKGKTATEYKSEKREEM  228

Query  755  VKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            VK+GYRI GN GDQWSDLLG +   R+FKLP+PMYYI
Sbjct  229  VKEGYRIRGNSGDQWSDLLGSSMSQRSFKLPNPMYYI  265



>ref|XP_007038298.1| HAD superfamily, subfamily IIIB acid phosphatase [Theobroma cacao]
 gb|EOY22799.1| HAD superfamily, subfamily IIIB acid phosphatase [Theobroma cacao]
Length=266

 Score =   219 bits (557),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 103/216 (48%), Positives = 141/216 (65%), Gaps = 3/216 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            + C SWR  VE NN+  W  +P++C  YV  YM G  Y  D   VA  A  YAK+  L+ 
Sbjct  52   LQCTSWRFTVETNNLSPWKTIPEKCGGYVKDYMTGRGYTMDLERVANEAGVYAKSVELSG  111

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DGKD+WVFDI+ET LSNLPYYA     +G   +   +FD WV  G APA+   ++LY  +
Sbjct  112  DGKDVWVFDIDETLLSNLPYYAEH--GYGLEIFYPVEFDKWVQRGMAPAIDPSLKLYEMV  169

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELV  757
            + LG K   L+G  ++ R V I NL K G+  W+KLIL+ + D  + A  +KS+KR+++V
Sbjct  170  LDLGFKVFLLTGRSEEQRSVTIENLTKAGFQSWDKLILRDSEDHGKLATVFKSEKRSKMV  229

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            ++G+RI+GN GDQWSDLLG +  +R+FKLP+PMYYI
Sbjct  230  EEGFRILGNSGDQWSDLLGSSPSSRSFKLPNPMYYI  265



>gb|KFK26738.1| acid phosphatase [Arabis alpina]
Length=264

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 110/260 (42%), Positives = 155/260 (60%), Gaps = 10/260 (4%)
 Frame = +2

Query  104  LLVVVLLATIPTFSHADSIPNQIHSLRP-----HTAGGGHHIPGVNCLSWRLGVEANNIR  268
            LLVV L ++   FS +  +P  +    P             +  ++C SWR   E NN+ 
Sbjct  8    LLVVSLFSS--AFSDSYLLPRPLVLQYPSEIVTRPKKSDEDVINLHCTSWRFAAETNNLS  65

Query  269  DWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLS  448
             W  +P++C +YV  Y+LG  Y  D   V+  A  +A +   A DGKDIW+FDI+ET LS
Sbjct  66   PWKTIPEECADYVKDYVLGKGYVTDLERVSEEASMFASSVEFAGDGKDIWIFDIDETLLS  125

Query  449  NLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQ  628
            NLPYY   D  FG   ++ ++FD WV  G APA+   ++LY+ +V LG K   L+G K+ 
Sbjct  126  NLPYYI--DHGFGLEVFHHSEFDKWVERGVAPAIAPSLKLYQRVVDLGYKVFLLTGRKES  183

Query  629  FRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKKGYRIIGNIGDQWSD  805
             R + + NL   G+ +W+KLIL+  ++  + A  YKS+KR E+VK+GYRI GN GDQWSD
Sbjct  184  HRLITVENLINAGFQNWDKLILRSPDEQHKMATLYKSEKRDEMVKEGYRIRGNSGDQWSD  243

Query  806  LLGDNAGARTFKLPDPMYYI  865
            LLG +   R+FKL +PMYYI
Sbjct  244  LLGSSMSQRSFKLANPMYYI  263



>ref|XP_010062554.1| PREDICTED: acid phosphatase 1 [Eucalyptus grandis]
Length=365

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 142/216 (66%), Gaps = 3/216 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            + C SWR  VEANN+  W  +PQ+C +YV  YM+G  Y  D   V+  A  YA +  L+ 
Sbjct  151  LQCDSWRFAVEANNVNPWKTIPQECADYVRDYMMGKGYGFDIDRVSKEAAVYAGSVELSG  210

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DGKD+W+FDI+ET LSNLPYYA     FG   ++  +FD WV +  A  +   ++LY  +
Sbjct  211  DGKDVWIFDIDETLLSNLPYYAEH--GFGLEVFDPVEFDKWVDKAEALGIQPSLKLYELV  268

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELV  757
            + LG K   L+G  ++ R V I NL   G+ +W+KLI++ + D ++ AV YKS+KR E+V
Sbjct  269  LGLGFKVFLLTGRSEEQRSVTIENLINAGFQNWDKLIVRASEDHSKLAVVYKSEKRDEMV  328

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            ++GYRI+GN GDQWSDLLG +   R+FKLP+PMYYI
Sbjct  329  REGYRILGNSGDQWSDLLGSSMSIRSFKLPNPMYYI  364



>ref|XP_010433112.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=259

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/259 (44%), Positives = 153/259 (59%), Gaps = 13/259 (5%)
 Frame = +2

Query  101  FLLVVVLLATI--PTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDW  274
            F  +V LLA +  P  S   S      S   HT    H     NC SWRL  E NN   W
Sbjct  11   FFFIVSLLAVLINPAISSRAS-----SSFTKHTQ---HSSIASNCESWRLASETNNAGSW  62

Query  275  AMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNL  454
             +VP +C   V +Y+ G Q+ +D   VA  A+ YAK   L  DGKD WVFDI+ET LSNL
Sbjct  63   KVVPSRCVNSVKNYITGGQFENDYNIVARYAIAYAKRVKLGGDGKDAWVFDIDETLLSNL  122

Query  455  PYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFR  634
             YY    + +G+  Y+ TKF+ W  +G APA    ++LY+ L  LG   + L+G  +  R
Sbjct  123  EYY--KALGYGSEPYDDTKFNEWAVQGKAPAFDASLKLYKALKRLGFTIILLTGRDESQR  180

Query  635  KVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLL  811
             V   NL+  GY  W +L+L+G ND  +TA +YKS++R+++VK+GY+I G+ GDQWSDL 
Sbjct  181  SVTAKNLRDAGYFGWNRLLLRGKNDQGKTATQYKSEQRSKVVKEGYKIHGSTGDQWSDLQ  240

Query  812  GDNAGARTFKLPDPMYYIA  868
            G    AR+FK+P+PMYYIA
Sbjct  241  GFAVAARSFKVPNPMYYIA  259



>ref|XP_002436441.1| hypothetical protein SORBIDRAFT_10g002690 [Sorghum bicolor]
 gb|EER87808.1| hypothetical protein SORBIDRAFT_10g002690 [Sorghum bicolor]
Length=303

 Score =   218 bits (556),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/217 (50%), Positives = 139/217 (64%), Gaps = 4/217 (2%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNA-TLA  397
            V C SW L  EANN+  W  VP +C  +V  Y+ G  YR D   VA  +  YA+ A  L 
Sbjct  88   VRCASWWLAAEANNLAPWKAVPPECVPHVRDYVTGAAYRSDLELVARESAAYARAALPLG  147

Query  398  HDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRT  577
             DG+D WVFD++ET LSNLPYYA  D  +GA  ++  +FD WV  G A A+P  ++LY  
Sbjct  148  DDGRDAWVFDVDETLLSNLPYYA--DHGYGAELFDHHRFDEWVERGEAAAIPSSLKLYNE  205

Query  578  LVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTEL  754
            +  LG K   L+G  +  R V + NL K G+  WEKLIL+ A D  +TA  YKS+KR E+
Sbjct  206  VRELGFKTFLLTGRSEGHRGVTVENLNKQGFHDWEKLILRAAGDRKKTATVYKSEKRKEM  265

Query  755  VKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
             ++GYRI+GN GDQWSDLLG +  AR+FKLP+PMYYI
Sbjct  266  EEEGYRILGNSGDQWSDLLGSSMSARSFKLPNPMYYI  302



>ref|XP_010258799.1| PREDICTED: acid phosphatase 1 [Nelumbo nucifera]
Length=282

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/216 (45%), Positives = 138/216 (64%), Gaps = 3/216 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            + C SWR   E NN+  W  +P +C  YV  Y+ G  Y  D   V+  A+ YA++  L  
Sbjct  68   LQCTSWRFAAETNNLNPWKTIPSECAGYVKDYVTGRGYLVDLERVSKEAIAYARSVQLVG  127

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DGKD W+FDI+ET LSNLPYYA  D  +G   ++  +FD WV +  AP +   ++LY  +
Sbjct  128  DGKDAWIFDIDETLLSNLPYYA--DHGYGLEVFDGREFDKWVEKAMAPVIESSLKLYEEV  185

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELV  757
            + LG K   L+G  ++ R V I NL+  G+ +W+KLIL+   D  ++A  YKS++R+E+V
Sbjct  186  LELGFKVFLLTGRSERHRSVTIENLRDAGFQNWDKLILRNLGDNGKSATLYKSERRSEMV  245

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
             +GYRI+GN GDQWSDLLG +   R+FKLP+PMYYI
Sbjct  246  NEGYRILGNSGDQWSDLLGSSTSNRSFKLPNPMYYI  281



>ref|XP_010688366.1| PREDICTED: acid phosphatase 1-like [Beta vulgaris subsp. vulgaris]
Length=257

 Score =   217 bits (552),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/215 (48%), Positives = 140/215 (65%), Gaps = 3/215 (1%)
 Frame = +2

Query  227  CLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDG  406
            C SWR  VE N+   W  VP +C  +V +YM+G +Y  D   VA +++++AK+  ++ DG
Sbjct  45   CESWRFSVETNDAGLWYSVPSRCHNFVKNYMIGDRYLSDSNVVAGNSLEFAKSVKVSGDG  104

Query  407  KDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVS  586
            KD WVFD++ET L NLPYY   D  FG+  +N   FD ++    +P +P  + LY+ L  
Sbjct  105  KDAWVFDVDETLLFNLPYYEAHD--FGSEVFNEDSFDQYMLLAESPVLPASLSLYKELQR  162

Query  587  LGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELVKK  763
            LG     L+G  + FR    ANL+  GYS+WE+LIL+G +D ++ AVEYKS+KR EL   
Sbjct  163  LGFTIFILTGRSEPFRNATEANLQSAGYSNWERLILRGPSDKSKKAVEYKSEKRKELEDA  222

Query  764  GYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
            GYRI GN GDQWSDLLG   G R+FKLP+PMYYIA
Sbjct  223  GYRIRGNSGDQWSDLLGYAIGQRSFKLPNPMYYIA  257



>gb|EMT02056.1| Stem 31 kDa glycoprotein [Aegilops tauschii]
Length=250

 Score =   216 bits (551),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 117/245 (48%), Positives = 149/245 (61%), Gaps = 23/245 (9%)
 Frame = +2

Query  134  PTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGH  313
            PT      +   IH+LRP    G H    V C SW LGVEA+N+R               
Sbjct  29   PTSLDEAVVAPLIHALRPLLGSGKHA--RVACDSWVLGVEAHNVR---------------  71

Query  314  YMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGAT  493
                  +R D   V   A+ Y  +  L+ +GK++WVFDI+ETTLSNLPYYA+    FGAT
Sbjct  72   ----ADFRRDSKVVVDQALAYVDSLKLSGNGKEVWVFDIDETTLSNLPYYAKH--GFGAT  125

Query  494  AYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYS  673
             +NAT FDA+V EG+AP++P   RLY  L+S+G+KPVFL+G  +  R + + NL++ G S
Sbjct  126  PFNATSFDAYVLEGSAPSLPETKRLYNKLLSVGVKPVFLTGRTEDKRAITVTNLRRQGIS  185

Query  674  HWEKLILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDP  853
             W  L+LK      +AV YKS +R +L   GY IIGNIGDQWSD+LG   GARTFKLPDP
Sbjct  186  GWMNLLLKQPGFKGSAVTYKSGERQKLQDAGYIIIGNIGDQWSDILGAPEGARTFKLPDP  245

Query  854  MYYIA  868
            MYYI 
Sbjct  246  MYYIG  250



>ref|XP_002865848.1| hypothetical protein ARALYDRAFT_495196 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42107.1| hypothetical protein ARALYDRAFT_495196 [Arabidopsis lyrata subsp. 
lyrata]
Length=257

 Score =   216 bits (551),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 108/262 (41%), Positives = 162/262 (62%), Gaps = 10/262 (4%)
 Frame = +2

Query  92   MRAFLLVVVLLATIPTFSHADSI---PNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANN  262
            MR +++ +V+++   + + +DSI   P++I S   H       +  ++C +WR   E NN
Sbjct  1    MRIYVIFLVVISLFAS-AFSDSILEYPSEIES--RHKKATDEDV-NLHCTTWRFAAEMNN  56

Query  263  IRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETT  442
            +  W  +P +C +YV  Y++G  Y  D   V+  A+ +A +   + DGKDIW+FDI+ET 
Sbjct  57   LAPWKTIPVECADYVKDYVMGKGYVTDLERVSEEALIFASSVEFSGDGKDIWIFDIDETL  116

Query  443  LSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTK  622
            LSNLPYY   D  FG   ++ ++FD WV +G APA+   ++LY+ ++ LG K   L+G K
Sbjct  117  LSNLPYYI--DHGFGLELFDHSEFDKWVEKGVAPAIAPSLKLYQRVIDLGYKVFLLTGRK  174

Query  623  QQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKKGYRIIGNIGDQW  799
            +  R V + NL   G+ +W+KLIL+   +  + A  YKS+KR E+VK GYRI GN GDQW
Sbjct  175  ESHRLVTVENLINAGFQNWDKLILRSPEEQHKMATLYKSEKRDEMVKDGYRIRGNSGDQW  234

Query  800  SDLLGDNAGARTFKLPDPMYYI  865
            SDLLG +   R+FKL +PMYYI
Sbjct  235  SDLLGTSMSQRSFKLANPMYYI  256



>ref|NP_194245.1| HAD superfamily, subfamily IIIB acid phosphatase [Arabidopsis 
thaliana]
 emb|CAB36757.1| acid phosphatase-like protein [Arabidopsis thaliana]
 emb|CAB79424.1| acid phosphatase-like protein [Arabidopsis thaliana]
 gb|AAL67073.1| putative acid phosphatase [Arabidopsis thaliana]
 gb|AAM14241.1| putative acid phosphatase [Arabidopsis thaliana]
 gb|AEE85017.1| HAD superfamily, subfamily IIIB acid phosphatase [Arabidopsis 
thaliana]
Length=260

 Score =   216 bits (550),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/217 (46%), Positives = 140/217 (65%), Gaps = 3/217 (1%)
 Frame = +2

Query  218  GVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLA  397
             ++C SWR   E NN+  W  +P +C +YV  Y++G  Y  D   V+  A  YA +    
Sbjct  45   NLHCTSWRFAAETNNLAPWKTIPAECADYVKDYLMGEGYVVDVERVSEEAKVYASSFESN  104

Query  398  HDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRT  577
             DGKDIW+FDI+ET LSNLPYY       G   ++ +KFD WV +G APA+   ++LY+ 
Sbjct  105  GDGKDIWIFDIDETLLSNLPYYMEH--GCGLEVFDHSKFDMWVEKGIAPAIAPSLKLYQK  162

Query  578  LVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTEL  754
            ++ LG K + L+G ++  R + + NL+  G+ +W+KLIL+  +D  +TA  YKS+KR E+
Sbjct  163  VIHLGYKVILLTGRRENHRVITVENLRNAGFHNWDKLILRSLDDRNKTATMYKSEKREEM  222

Query  755  VKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            VK+GYRI GN GDQWSDLLG     R+FKLP+PMYYI
Sbjct  223  VKEGYRIRGNSGDQWSDLLGSAMSERSFKLPNPMYYI  259



>gb|KDO45271.1| hypothetical protein CISIN_1g023192mg [Citrus sinensis]
Length=286

 Score =   217 bits (552),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 100/216 (46%), Positives = 141/216 (65%), Gaps = 3/216 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            + C +WR  VEANN+  W  +P++C EYV  YM+G  Y  D   V+  A  YAK+  L  
Sbjct  72   LQCTTWRFAVEANNLNPWKTIPRECLEYVRDYMMGRGYGLDLERVSNEAGVYAKSVELRG  131

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DGKD W+FDI+ET LSNLPYY      +G   +N  +FD WV +  +PA+   ++LY  +
Sbjct  132  DGKDAWIFDIDETLLSNLPYYQEH--GYGLEIFNPVEFDKWVEKAMSPAIEASLKLYEEV  189

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELV  757
            + LG K   L+G  ++ R + + NL   G  +W+KLIL+ ++D  + A+ YKS+KR E+V
Sbjct  190  LGLGFKIFLLTGRSEKQRSITVDNLINAGVRYWDKLILRSSDDHGKLAIIYKSEKRNEMV  249

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            ++GYRI+GN GDQWSDLLG    +R+FKLP+PMYYI
Sbjct  250  QEGYRILGNSGDQWSDLLGSPMPSRSFKLPNPMYYI  285



>ref|XP_010482458.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=260

 Score =   216 bits (549),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 108/264 (41%), Positives = 161/264 (61%), Gaps = 11/264 (4%)
 Frame = +2

Query  92   MRAFLLVVVLLATIPTFSHAD-----SIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEA  256
            MR +L++++++ ++ + S          P++I S+  H       +  ++C +WR   E 
Sbjct  1    MRIYLIILLVVVSLFSSSAFSDDSILEYPSEIESM--HKKAAEEDV-DLHCTTWRFAAEM  57

Query  257  NNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEE  436
            NN+  W  +P +C +YV +Y++G  Y  D   V+  A  +A +   + DGKDIWVFDI+E
Sbjct  58   NNLAPWKTIPVECADYVKNYVMGKGYATDLERVSEEAFIFANSVEFSGDGKDIWVFDIDE  117

Query  437  TTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSG  616
            T LSNLPYY   D  FG   ++ ++FD WV  G APA+   ++LY+ +V LG K   L+G
Sbjct  118  TLLSNLPYYI--DHGFGLELFDHSEFDKWVERGVAPAIAPSLKLYQRVVDLGYKVFLLTG  175

Query  617  TKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKKGYRIIGNIGD  793
             K+  R V + NL   G+ +W+KLIL+   +  + A  YKS+KR E+VK+GYRI GN GD
Sbjct  176  RKESHRLVTVENLINAGFQNWDKLILRSPEEQHKMATLYKSEKRDEMVKEGYRIRGNSGD  235

Query  794  QWSDLLGDNAGARTFKLPDPMYYI  865
            QWSDLLG +   R+FKL +PMYYI
Sbjct  236  QWSDLLGTSMSQRSFKLANPMYYI  259



>ref|XP_004513069.1| PREDICTED: acid phosphatase 1-like [Cicer arietinum]
Length=250

 Score =   215 bits (547),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/222 (46%), Positives = 138/222 (62%), Gaps = 3/222 (1%)
 Frame = +2

Query  206  HHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKN  385
              I G  C SWRL VE NN+  W  +P  C + V  YM+G QY+ DC  V   + ++AK 
Sbjct  31   KKISGEYCDSWRLAVETNNVGAWKQIPASCVDSVAEYMIGEQYKRDCDVVGEYSYEFAKR  90

Query  386  ATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVR  565
                 DG+D WVFDI+ET LSN+PYY    V FG+  +N T F+ WV    APA+P  + 
Sbjct  91   VAFGGDGRDAWVFDIDETLLSNVPYY--KTVGFGSEFFNETSFNDWVKLADAPALPSSLS  148

Query  566  LYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKK  742
            LY+ L+ LG +   L+G  +  R     NL  +GY +W++LIL+G  D  + A+ +KS+K
Sbjct  149  LYKKLLELGFRIFLLTGRSEYQRNATETNLLFSGYRNWDRLILRGPYDQGKPAIRFKSEK  208

Query  743  RTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
            R ELV +GYRI G+ GDQWSDL G    +R+FKLP+PMY+IA
Sbjct  209  REELVSEGYRIHGSSGDQWSDLWGFAVASRSFKLPNPMYFIA  250



>ref|XP_007218818.1| hypothetical protein PRUPE_ppa010063mg [Prunus persica]
 gb|EMJ20017.1| hypothetical protein PRUPE_ppa010063mg [Prunus persica]
Length=266

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/216 (48%), Positives = 139/216 (64%), Gaps = 3/216 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            ++C SWR  VEANNI  W  +PQ+C +YV  Y+ G  Y  D   V+  A  YAK   L+ 
Sbjct  52   LHCTSWRFSVEANNINPWKTIPQECAKYVKDYVTGRAYGFDLERVSKEAGVYAKAVELSG  111

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DGKD+W+FDI++T LSNLPYYA  D  +G   ++  +FD WV +  APA+   ++LY  +
Sbjct  112  DGKDVWIFDIDDTLLSNLPYYA--DHGYGLEVFDHLEFDRWVDKAMAPAIKSSLKLYEEV  169

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELV  757
            + LGIK   L+G     RK  I NL   G+  W KLIL+  ++  + A  YKS+KR E+ 
Sbjct  170  LGLGIKVFLLTGRSDGKRKATIENLINAGFRDWHKLILRAPDEQGKLATVYKSEKRNEME  229

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            K+GYRI+GN GDQWSD+LG +   R+FKLP+PMYYI
Sbjct  230  KEGYRILGNSGDQWSDILGTSMSIRSFKLPNPMYYI  265



>ref|XP_009795729.1| PREDICTED: acid phosphatase 1-like [Nicotiana sylvestris]
Length=267

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 116/269 (43%), Positives = 158/269 (59%), Gaps = 15/269 (6%)
 Frame = +2

Query  92   MRAFLLVVVLLATIPTFSHADSI----PNQIHSLRPHTAGGGHHIPGVN-----CLSWRL  244
            ++ FL+ V +  T  + S + SI    P  +  L   T      IP  N     C SWR 
Sbjct  4    VQNFLVAVFISFTFVSTSFSQSILGITPEILELL---TINRHRKIPKDNNNALYCESWRF  60

Query  245  GVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVF  424
             VE N+   WA++P++C  +V  YM G +Y  DC AVA  ++ +A    +++DGKD WVF
Sbjct  61   TVETNDAGLWALIPERCASFVQDYMNGDRYSSDCGAVADLSLAFANTVKVSNDGKDAWVF  120

Query  425  DIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPV  604
            DI+ET LSNLPYY      FG+  ++   FD WV+E  APA+P  ++LY+ L   G K  
Sbjct  121  DIDETLLSNLPYYVTH--GFGSEIFDEIAFDKWVNEAEAPAIPASLKLYKELQQRGFKIF  178

Query  605  FLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKKGYRIIG  781
             L+G  +  R     NL   GYS+WE+LIL+G +D  + A +YKS+KR EL  +GYRI G
Sbjct  179  LLTGRSEFQRNYTEKNLVYAGYSNWERLILRGPSDKGKLATQYKSEKRKELEDEGYRIHG  238

Query  782  NIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
            + GDQWSDL G     R+FKLP+PMYYIA
Sbjct  239  SSGDQWSDLNGFAVATRSFKLPNPMYYIA  267



>gb|AGV54632.1| stem 28 kDa glycoprotein [Phaseolus vulgaris]
Length=255

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/261 (44%), Positives = 157/261 (60%), Gaps = 9/261 (3%)
 Frame = +2

Query  86   LTMRAFLLVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNI  265
            + M+A L++   L+ +    H    P  +  ++  T   GH+   V+C S   GVEANN+
Sbjct  1    MKMKA-LVICAGLSLVAFACHGSEYPRFLSQMK--TGLNGHYSTQVSCTSLGFGVEANNL  57

Query  266  RDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTL  445
              W  VP  C+EYV  Y+LG QYR D   V   A  YAK  TL    +D++VFDI++TTL
Sbjct  58   SKWKTVPAACQEYVADYLLGDQYRSDSKTVCREAYFYAK--TLKFTARDVFVFDIDDTTL  115

Query  446  SNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQ  625
            SNL Y+A     FG  A+NAT F  WVS G A A+P  + LY  LV LGIK VF++    
Sbjct  116  SNLQYFANH--GFGVEAHNATAFKIWVSFGEAFALPETLVLYNKLVGLGIKVVFITERPV  173

Query  626  QFRKVRIANLKKTGYSHWEKLILK--GANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQW  799
              + V I+NLK+ G+  WEK I +       + +  +K+ +R +LV +GYRI+GNIGDQW
Sbjct  174  DLKDVTISNLKEVGFHTWEKFIARDPAIYSGKLSNAFKTSERKKLVAEGYRIVGNIGDQW  233

Query  800  SDLLGDNAGARTFKLPDPMYY  862
            SD++G+  G RTFKLP+P+YY
Sbjct  234  SDIVGEKKGFRTFKLPNPLYY  254



>ref|XP_007152955.1| hypothetical protein PHAVU_004G174200g [Phaseolus vulgaris]
 gb|ESW24949.1| hypothetical protein PHAVU_004G174200g [Phaseolus vulgaris]
Length=251

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/259 (44%), Positives = 152/259 (59%), Gaps = 10/259 (4%)
 Frame = +2

Query  92   MRAFLLVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRD  271
            M + + ++ LL  + T SH  S P  I  L    A    +     C SWRL VE NN   
Sbjct  1    MDSGVCLLSLLVALSTLSHVLSEP--ILRLPSEKAISSDY-----CDSWRLAVETNNAGP  53

Query  272  WAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSN  451
            W  VP  C ++V  Y+ G +YR DC  V   ++ +A++  L  DG+D WVFDI+ET LSN
Sbjct  54   WERVPANCVDFVAEYISGERYRRDCEVVGNLSLAFARSVRLVGDGRDAWVFDIDETLLSN  113

Query  452  LPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQF  631
            +PYY   D+ FG   +N T FDAWV+   APA+   + LY  L  LG +   L+G  +  
Sbjct  114  VPYY--EDIGFGFEIFNETSFDAWVNSAAAPALVPNLILYNELKELGFRIFLLTGRSEYQ  171

Query  632  RKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKKGYRIIGNIGDQWSDL  808
            R    ANL  +GY +WE+LIL+ + D  + A+ YKS+KR EL  +GYRI G+ GDQWSDL
Sbjct  172  RNATEANLMLSGYRNWERLILRESYDKGKPAISYKSEKREELENEGYRIHGSSGDQWSDL  231

Query  809  LGDNAGARTFKLPDPMYYI  865
             G    AR+FKLP+PMYYI
Sbjct  232  WGYAVAARSFKLPNPMYYI  250



>ref|XP_008234437.1| PREDICTED: acid phosphatase 1 [Prunus mume]
Length=266

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/216 (48%), Positives = 140/216 (65%), Gaps = 3/216 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            ++C+SWR  VEANNI  W  +PQ+C EYV  Y+ G  Y  D   V+  A  YAK   L+ 
Sbjct  52   LHCISWRFSVEANNINPWKTIPQECAEYVKDYVTGRAYGFDLERVSKEAGVYAKAIELSG  111

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DGKD W+FDI++T LSNLPYYA  D  +G   ++  +F+ WV +  APA+   ++LY  +
Sbjct  112  DGKDAWIFDIDDTLLSNLPYYA--DHGYGLEVFDHLEFERWVEKAMAPAIKSSLKLYEEV  169

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELV  757
            + LGIK   L+G  +  RK  I NL   G+  W KLIL+  ++  + A  YKS+KR E+ 
Sbjct  170  LGLGIKVFLLTGRGEGKRKATIENLVNAGFRDWHKLILRAPDEQGKLATVYKSEKRNEME  229

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            K+GYRI+GN GDQWSD+LG +   R+FKLP+PMYYI
Sbjct  230  KEGYRILGNSGDQWSDILGTSMSIRSFKLPNPMYYI  265



>ref|XP_006401998.1| hypothetical protein EUTSA_v10014448mg [Eutrema salsugineum]
 gb|ESQ43451.1| hypothetical protein EUTSA_v10014448mg [Eutrema salsugineum]
Length=258

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/260 (42%), Positives = 157/260 (60%), Gaps = 5/260 (2%)
 Frame = +2

Query  92   MRAFLLVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRD  271
            M+ +++ +V+      FS   SI     +   +   GG  +  ++C SWR   E NN+  
Sbjct  1    MKIYVIFLVVSLFSSAFSDEPSILEYPSTRHKNPDDGGDEV-DLHCTSWRFAAETNNLAP  59

Query  272  WAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH-DGKDIWVFDIEETTLS  448
            W  +P +C +Y+  Y+LG  Y  D   V+  A  +A +   +  DGKDIW+FDI+ET LS
Sbjct  60   WQTIPVECADYIKDYVLGKGYVTDLERVSEEASNFASSVVESSGDGKDIWIFDIDETLLS  119

Query  449  NLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQ  628
            NLPYY   D  FG   ++ ++FD WV  G APA+   ++LY+ ++ LG K   L+G K+ 
Sbjct  120  NLPYYI--DHGFGLELFDHSEFDKWVERGVAPAIAPSLKLYQRVLDLGYKVFLLTGRKES  177

Query  629  FRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKKGYRIIGNIGDQWSD  805
             R V + NL   G+ +W+KLIL+  ++  +TA  YKS+KR E+VK+GYRI GN GDQWSD
Sbjct  178  HRLVTVENLISAGFQNWDKLILRSPDEQHKTATLYKSEKRDEMVKEGYRIRGNSGDQWSD  237

Query  806  LLGDNAGARTFKLPDPMYYI  865
            LLG +   R+FKL +PMYYI
Sbjct  238  LLGSSMSQRSFKLANPMYYI  257



>ref|XP_007133483.1| hypothetical protein PHAVU_011G182400g [Phaseolus vulgaris]
 gb|ESW05477.1| hypothetical protein PHAVU_011G182400g [Phaseolus vulgaris]
Length=269

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/217 (46%), Positives = 144/217 (66%), Gaps = 3/217 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            + C +WR+  EANN+  W  VP++C +YV  YM G  Y  D   V+  A ++AK+  L+ 
Sbjct  55   LRCGAWRVAGEANNLGAWRTVPEECADYVKEYMTGKGYLVDLEMVSKEAEEFAKSVKLSD  114

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DGKD W+FDI+ET LSNLPYYA     +G   ++  KF+ WV EG AP++   ++LY  +
Sbjct  115  DGKDAWIFDIDETLLSNLPYYAAH--GYGLEIFDHEKFNDWVEEGVAPSLQPSLKLYEDV  172

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELV  757
            + LG K + L+G  ++ R V + NL   G+  W+ LIL+ ++D  + AV +KS+KR+E+ 
Sbjct  173  LKLGFKVILLTGRSERHRSVTVDNLINAGFKEWDHLILRSSDDQGKRAVVFKSEKRSEME  232

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
            K GYRI+GN GDQWSDL+G +   R+FKLP+PMYYI+
Sbjct  233  KDGYRILGNSGDQWSDLIGSSLSVRSFKLPNPMYYIS  269



>ref|XP_003531798.1| PREDICTED: acid phosphatase 1-like [Glycine max]
 gb|KHN38151.1| Acid phosphatase 1 [Glycine soja]
Length=261

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/242 (44%), Positives = 151/242 (62%), Gaps = 3/242 (1%)
 Frame = +2

Query  143  SHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYML  322
            SH+DS        RP           + C +WR+  EANN+  WA++P++C EYV  YM 
Sbjct  21   SHSDSDSGHPVLPRPLIVEYPEFDAVLRCGAWRVAGEANNLGAWAIIPEECAEYVKDYMS  80

Query  323  GHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYN  502
            G  Y  D   V+  A +YA+   L +DGKD WVFDI+ET LSNLPYYA     +G   ++
Sbjct  81   GKGYALDLEMVSKEAEEYARTVPLGYDGKDAWVFDIDETLLSNLPYYAAH--GYGLEVFD  138

Query  503  ATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWE  682
              KF+ WV +G A A+   ++LY  +++LG K + L+G  ++ R V + NL   G+  W+
Sbjct  139  HEKFNDWVEKGVATAIEPSLKLYEDVLNLGFKVILLTGRNERHRSVTVDNLINAGFKDWD  198

Query  683  KLILKGANDT-RTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMY  859
            +LIL+ ++D  + AV YKS+KR E+ K GYRI+GN GDQWSDLLG +   R+FKLP+P+Y
Sbjct  199  QLILRTSDDQGKPAVLYKSEKRGEMEKDGYRILGNSGDQWSDLLGSSISVRSFKLPNPVY  258

Query  860  YI  865
            YI
Sbjct  259  YI  260



>ref|XP_010442941.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=260

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/236 (44%), Positives = 148/236 (63%), Gaps = 6/236 (3%)
 Frame = +2

Query  161  PNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRD  340
            P++I S+  H       +  ++C +WR   E NN+  W  +P +C +YV +Y++G  Y  
Sbjct  29   PSEIESM--HKKAAEEDV-DLHCTTWRFAAEMNNLAPWKSIPAECADYVKNYVMGKGYAT  85

Query  341  DCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDA  520
            D   V+  A+ +A +   + DGKDIWVFDI+ET LSNLPYY   D  FG   ++ ++FD 
Sbjct  86   DLERVSEEALIFANSVEFSGDGKDIWVFDIDETLLSNLPYYI--DHGFGLELFDHSEFDK  143

Query  521  WVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKG  700
            WV  G APA+   ++LY+ +V LG K   L+G K+  R V + NL   G+ +W+KLIL+ 
Sbjct  144  WVERGVAPAIAPSLKLYQRVVDLGYKVFLLTGRKESHRLVTVENLINAGFQNWDKLILRS  203

Query  701  ANDT-RTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
              +  + A  YKS+KR E+VK+GYRI GN GDQWSDLLG +   R+FKL +PMYYI
Sbjct  204  PEEQHKMATLYKSEKRDEMVKEGYRIRGNSGDQWSDLLGTSMSQRSFKLANPMYYI  259



>ref|XP_006490172.1| PREDICTED: acid phosphatase 1-like [Citrus sinensis]
Length=286

 Score =   215 bits (548),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/216 (46%), Positives = 141/216 (65%), Gaps = 3/216 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            + C +WR  VEANN+  W  +P++C EYV  YM+G  Y  D   V+  A  YAK+  L  
Sbjct  72   LQCTTWRFAVEANNLNPWKTIPRECLEYVRDYMMGRGYGLDLERVSNEAGVYAKSVELRG  131

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DGKD W+FDI+ET LSNLPYY      +G   ++  +FD WV +  +PA+   ++LY  +
Sbjct  132  DGKDAWIFDIDETLLSNLPYYQEH--GYGLEIFDPVEFDKWVEKAMSPAIEASLKLYEEV  189

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELV  757
            + LG K   L+G  ++ R + + NL   G  +W+KLIL+ ++D  + A+ YKS+KR E+V
Sbjct  190  LGLGFKIFLLTGRSEKQRSITVDNLINAGVRYWDKLILRSSDDHGKLAIIYKSEKRNEMV  249

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            ++GYRI+GN GDQWSDLLG    +R+FKLP+PMYYI
Sbjct  250  QEGYRILGNSGDQWSDLLGSPMPSRSFKLPNPMYYI  285



>ref|XP_006426851.1| hypothetical protein CICLE_v10026223mg [Citrus clementina]
 gb|ESR40091.1| hypothetical protein CICLE_v10026223mg [Citrus clementina]
Length=234

 Score =   213 bits (543),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 146/219 (67%), Gaps = 6/219 (3%)
 Frame = +2

Query  53   PLTSYIIKKRKLTMRAFLLVV--VLLATIPTFSHADS--IPNQIHSLRPHTAGGGHHIPG  220
            PL  + +     T   F + +  + LATIP  SH  S  IP+QIH LRP      + +PG
Sbjct  9    PLLFFFLATISATSHGFSMDIRHLFLATIPATSHGFSMDIPHQIHLLRPKAGSRNNDVPG  68

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            ++CLSWRLGVE NN+  WA VP++C +YVGHYMLG QYR D   VA  A+ +A++ TLA 
Sbjct  69   LSCLSWRLGVETNNVIGWATVPEKCADYVGHYMLGQQYRLDSEVVANEAILHAQSLTLAG  128

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DGKDIWVFDI+ET+L NLPYYA++   FG   YN T F+ WV+ G AP +P  ++LY+ L
Sbjct  129  DGKDIWVFDIDETSLCNLPYYAKN--GFGVKPYNPTMFNEWVNTGKAPPLPESLKLYKKL  186

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILK  697
            + LGIK VFL+G  +  R V  ANLK  G++ WEKLILK
Sbjct  187  LLLGIKIVFLTGRPEDQRNVTEANLKHAGFNTWEKLILK  225



>ref|NP_001150931.1| acid phosphatase 1 precursor [Zea mays]
 gb|ACG40987.1| acid phosphatase 1 precursor [Zea mays]
Length=299

 Score =   215 bits (548),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 138/219 (63%), Gaps = 4/219 (2%)
 Frame = +2

Query  215  PGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDC-IAVAISAVQYAKNAT  391
            P V C SWRL  EANN+  W  VP +C  +V  Y+ G  YR D  +    SA      A 
Sbjct  82   PDVRCASWRLAAEANNLAPWRAVPPECAPHVRDYVTGVAYRSDLDLVARESAAYARAAAP  141

Query  392  LAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLY  571
            L  DG+D WVFD++ET LSNLPYYA     +GA  ++  KFD WV  G A A+P  ++LY
Sbjct  142  LGADGRDAWVFDVDETLLSNLPYYAEH--GYGAELFDHHKFDEWVERGEAAAIPSSLKLY  199

Query  572  RTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRT  748
              +  LG K   L+G  +  R V + NL K G+  WEKL+L+ A D  +TA  YKS+KR 
Sbjct  200  NEVRELGFKTFLLTGRSEGHRGVTVDNLNKQGFHDWEKLVLRAAGDRKKTATVYKSEKRK  259

Query  749  ELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            E+ ++GYRI+GN GDQWSDLLG + GAR+FKLP+PMYYI
Sbjct  260  EMEQEGYRILGNSGDQWSDLLGSSMGARSFKLPNPMYYI  298



>ref|XP_010536549.1| PREDICTED: acid phosphatase 1-like [Tarenaya hassleriana]
Length=258

 Score =   214 bits (544),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 102/217 (47%), Positives = 137/217 (63%), Gaps = 3/217 (1%)
 Frame = +2

Query  218  GVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLA  397
             ++C SWR   E NN+  W  VP +C +YV  YM+   Y  D   V+  A  YA +  L+
Sbjct  43   NLHCTSWRFAAETNNLAPWKAVPAECADYVKDYMVERAYVIDLEKVSDEAEVYASSVELS  102

Query  398  HDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRT  577
             DGKDIWVFDI+ET LSNLPYY      +GA  ++  +FD WV +G APA+   ++LY+ 
Sbjct  103  GDGKDIWVFDIDETLLSNLPYYIEH--GYGAEVFDHLEFDKWVEKGRAPAIEASLKLYQK  160

Query  578  LVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTEL  754
            +  LG K   L+G  +  R V + NL   G+ +W+KLIL+ + D  +TA EYKS+KR  +
Sbjct  161  VRDLGYKVFLLTGRSESHRLVTVENLINAGFQNWDKLILRSSEDKWKTATEYKSEKREGM  220

Query  755  VKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            V  GY+I GN GDQWSDLLG +   R+FKLP+PMYYI
Sbjct  221  VDDGYKIRGNSGDQWSDLLGSSMSERSFKLPNPMYYI  257



>gb|AFW75455.1| hypothetical protein ZEAMMB73_076415 [Zea mays]
Length=299

 Score =   215 bits (547),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 138/219 (63%), Gaps = 4/219 (2%)
 Frame = +2

Query  215  PGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDC-IAVAISAVQYAKNAT  391
            P V C SWRL  EANN+  W  VP +C  +V  Y+ G  YR D  +    SA      A 
Sbjct  82   PDVRCASWRLAAEANNLAPWRAVPPECAPHVRDYVTGVAYRSDLDLVARESAAYARAAAP  141

Query  392  LAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLY  571
            L  DG+D WVFD++ET LSNLPYYA     +GA  ++  KFD WV  G A A+P  ++LY
Sbjct  142  LGADGRDAWVFDVDETLLSNLPYYAEH--GYGAELFDHHKFDEWVERGEAAAIPSSLKLY  199

Query  572  RTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRT  748
              +  LG K   L+G  +  R V + NL K G+  WEKL+L+ A D  +TA  YKS+KR 
Sbjct  200  NEVRELGFKTFLLTGRSEGHRGVTVDNLNKQGFHDWEKLVLRAAGDRKKTATVYKSEKRK  259

Query  749  ELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            E+ ++GYRI+GN GDQWSDLLG + GAR+FKLP+PMYYI
Sbjct  260  EMEQEGYRILGNSGDQWSDLLGSSMGARSFKLPNPMYYI  298



>ref|XP_003557220.2| PREDICTED: acid phosphatase 1-like [Brachypodium distachyon]
Length=270

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 115/269 (43%), Positives = 161/269 (60%), Gaps = 9/269 (3%)
 Frame = +2

Query  80   RKLTMRAFLLVVVLLATIPTFSHADSIPN----QIHSLRPHTAGGGHHIPGVNCLSWRLG  247
            R  ++ A +L+ V+LA      HA  +P     Q+ S                C SWR+ 
Sbjct  3    RHGSLLALVLMGVMLAVAGAEEHAAELPRPLVIQLPSSTTEKTAADEAEAEARCASWRVA  62

Query  248  VEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKN--ATLAHDGKDIWV  421
            VEANN+  W+ VP +C  +V  Y+ G  YR D   VA  A  YA++  A+ +    D WV
Sbjct  63   VEANNVLPWSAVPAECAAHVRRYVTGPAYRSDLELVAREASAYARSLAASASDRAADAWV  122

Query  422  FDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKP  601
            FD++ET LSNLPYYA  D  +G   ++  +FD WV +G APA+P  ++LY+ +  LG K 
Sbjct  123  FDVDETLLSNLPYYA--DHGYGLELFDHREFDRWVEKGEAPAIPSSLKLYKEVRDLGFKT  180

Query  602  VFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELVKKGYRII  778
              L+G  +  + V + NLKK G+  W++LIL+ A D T+TA  YKS+KR E+  +GY+I+
Sbjct  181  FLLTGRSEGHQGVTVDNLKKQGFHDWDRLILRAAADRTKTATAYKSEKRKEMEAEGYKIL  240

Query  779  GNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            GN GDQWSDLLG +  AR+FKLP+PMYYI
Sbjct  241  GNSGDQWSDLLGYSMSARSFKLPNPMYYI  269



>ref|XP_010098162.1| Stem 28 kDa glycoprotein [Morus notabilis]
 gb|EXB74599.1| Stem 28 kDa glycoprotein [Morus notabilis]
Length=261

 Score =   213 bits (543),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 113/262 (43%), Positives = 156/262 (60%), Gaps = 10/262 (4%)
 Frame = +2

Query  92   MRAFLLVVVLLATIPT--FSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNI  265
            + +F L  VL AT     + +   I N+I  LR  +  G   +    CLSWR G+E NN+
Sbjct  5    LLSFFLATVLAATSAQAGYEYPHDITNKISLLRTKSGAGVSFVDEEWCLSWRFGIETNNL  64

Query  266  RDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGK-DIWVFDIEETT  442
             DWAM P++CE Y+  YMLG QY  D   V   A +YAKN  L +DGK  +WVFDI+ET 
Sbjct  65   VDWAMYPEECEGYIWRYMLGCQYEKDSKVVTEEAYEYAKNLNLPYDGKIHVWVFDIDETA  124

Query  443  LSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTK  622
            L+NL ++          + N    +       +PA+P  + LY+ L +LGIK VFLS   
Sbjct  125  LTNLNHFIPKHGFRAKPSNNEHALEE------SPALPATLELYKKLGTLGIKVVFLSLRT  178

Query  623  QQFRKVRIANLKKTGYSHWEKLILK-GANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQW  799
            +  R     NL+  GY  WEK+IL+  +N   T++E+KS +R +L +  YRI+GNIGDQW
Sbjct  179  EDLRTDTENNLRNVGYETWEKVILRPDSNYAGTSLEFKSGQRKKLEESKYRIVGNIGDQW  238

Query  800  SDLLGDNAGARTFKLPDPMYYI  865
            SDLLG N+G RTFKLP+P+Y++
Sbjct  239  SDLLGTNSGLRTFKLPNPIYHV  260



>gb|ABK23358.1| unknown [Picea sitchensis]
Length=275

 Score =   214 bits (544),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 112/244 (46%), Positives = 144/244 (59%), Gaps = 3/244 (1%)
 Frame = +2

Query  140  FSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYM  319
            F H+D I  +  +L           P +NC SWR GVE N +R W++VPQ+C EYV  YM
Sbjct  34   FDHSDWISEESTALDKWELKQPPQDPQLNCESWRFGVETNTVRFWSVVPQECVEYVKDYM  93

Query  320  LGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAY  499
             G QY  D   VA  ++ YA +  L+ DGKD+WVFD++ET LSNLP YA  +  +G    
Sbjct  94   DGSQYLLDSNVVANVSIAYANSLNLSGDGKDVWVFDVDETLLSNLPLYAAYN--YGGADM  151

Query  500  NATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHW  679
            +   F  W     APA+P   RLY  L+ LG K   L+G     R     NL + GY  W
Sbjct  152  DDGAFIKWADLAEAPALPASQRLYAHLLQLGFKIFLLTGRYDYERNATEKNLVQAGYHSW  211

Query  680  EKLILKGANDTR-TAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPM  856
            E L+L+G +D   TAV YKS +R ++ K G+RI GN GDQWSDL G + G RTFKLP+PM
Sbjct  212  EALLLRGPDDYETTAVVYKSGRRLKIEKDGFRIRGNSGDQWSDLSGYSCGDRTFKLPNPM  271

Query  857  YYIA  868
            Y+IA
Sbjct  272  YFIA  275



>ref|XP_006837335.1| hypothetical protein AMTR_s00111p00084650 [Amborella trichopoda]
 gb|ERN00189.1| hypothetical protein AMTR_s00111p00084650 [Amborella trichopoda]
Length=298

 Score =   214 bits (546),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 137/214 (64%), Gaps = 3/214 (1%)
 Frame = +2

Query  227  CLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDG  406
            C SWR  VE NN++ W +VP +C  +V  YM    YR D   VA  A  +A+N  L  DG
Sbjct  86   CESWRFAVETNNLQSWKVVPIECGGFVKKYMSERGYRSDLEMVAEVAGAFARNVELGQDG  145

Query  407  KDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVS  586
             D W+FDI+ET LSNL YY  +   FG   +N  KFD WV    APA+   ++LY  ++ 
Sbjct  146  MDAWIFDIDETLLSNLVYYEEN--GFGLELFNGNKFDEWVDLAEAPAISPFLKLYEEVLE  203

Query  587  LGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKK  763
            +G K   L+G  +  R   I NL+ +G+ +W++LI++GA D  ++AV YKS+KR E+ K+
Sbjct  204  MGFKVFLLTGRSESQRSTTIHNLQNSGFQNWDRLIMRGAADQGKSAVFYKSEKRMEMEKE  263

Query  764  GYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            G+RI+GN GDQWSDLLG +   R+FKLP+PMYYI
Sbjct  264  GFRILGNSGDQWSDLLGSSMAIRSFKLPNPMYYI  297



>ref|XP_006284361.1| hypothetical protein CARUB_v10005533mg [Capsella rubella]
 gb|EOA17259.1| hypothetical protein CARUB_v10005533mg [Capsella rubella]
Length=260

 Score =   213 bits (542),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 99/217 (46%), Positives = 138/217 (64%), Gaps = 3/217 (1%)
 Frame = +2

Query  218  GVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLA  397
             ++C SWR   E NN+  W  +P +C +YV  Y++G  Y  D   V+  A  YA      
Sbjct  45   NLHCTSWRFAAETNNLAPWKTIPAECADYVKDYLMGKGYVFDVERVSEEAKVYASTFESN  104

Query  398  HDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRT  577
             DGKD+W+FDI+ET LSNLPYY       G   ++ +KFD WV  G APA+   ++LY+ 
Sbjct  105  GDGKDVWIFDIDETLLSNLPYYLEH--GCGLEVFDHSKFDKWVERGIAPAIAPSLKLYQM  162

Query  578  LVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTEL  754
            +  +G K + L+G ++  R V + NL+  G+ +W+KLIL+ ++D  +TA  YKS+KR E+
Sbjct  163  VKEMGYKVILLTGRRENHRVVTVENLRNAGFHNWDKLILRSSDDDHKTATTYKSEKRDEM  222

Query  755  VKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            VK+GYRI GN GDQWSDLLG     R+FKLP+PMYYI
Sbjct  223  VKEGYRIRGNSGDQWSDLLGSAMSERSFKLPNPMYYI  259



>gb|AFK42878.1| unknown [Medicago truncatula]
 gb|AET02725.2| plant acid phosphatase [Medicago truncatula]
Length=259

 Score =   213 bits (542),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 101/217 (47%), Positives = 140/217 (65%), Gaps = 3/217 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            + C SWR   EANN+  W  VP++C E+V  YM G  Y  D       A ++AK+  L  
Sbjct  45   LRCRSWRFAGEANNLSPWKTVPKECAEHVKEYMNGKGYVYDLEIANKEAGEFAKSVKLKE  104

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DG D WVFDI+ET LSNLPYYA     +G   ++  KFD WV +G APA+   ++LY  +
Sbjct  105  DGLDAWVFDIDETLLSNLPYYAAH--GYGFEVFDHAKFDDWVEKGVAPAIEASLKLYEDI  162

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELV  757
            ++LG K + L+G  +  R V + NL   G+  W +LIL+ ++D  + AV YKS+KR+E+ 
Sbjct  163  LNLGYKVILLTGRSESHRAVTVDNLINAGFRDWHQLILRSSDDKGKLAVIYKSEKRSEME  222

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
            K+G+RI+GN GDQWSDLLG +   R+FKLP+PMY+IA
Sbjct  223  KEGFRILGNSGDQWSDLLGSSVSVRSFKLPNPMYFIA  259



>ref|XP_006421584.1| hypothetical protein CICLE_v10005566mg [Citrus clementina]
 gb|ESR34824.1| hypothetical protein CICLE_v10005566mg [Citrus clementina]
Length=286

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/214 (46%), Positives = 140/214 (65%), Gaps = 3/214 (1%)
 Frame = +2

Query  227  CLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDG  406
            C +WR  VEANN+  W  +P++C EYV  YM+G  Y  D   V+  A  +AK+  L  DG
Sbjct  74   CTTWRFAVEANNLNPWKTIPRECLEYVRDYMMGRGYGLDLERVSNEAGVFAKSVELRGDG  133

Query  407  KDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVS  586
            KD W+FDI+ET LSNLPYY      +G   ++  +FD WV +  +PA+   ++LY  ++ 
Sbjct  134  KDAWIFDIDETLLSNLPYYQEH--GYGLEIFDPVEFDKWVEKAMSPAIEASLKLYEEVLG  191

Query  587  LGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELVKK  763
            LG K   L+G  ++ R + + NL   G  +W+KLIL+ ++D  + A+ YKS+KR E+V++
Sbjct  192  LGFKIFLLTGRSEKQRSITVDNLINAGVRYWDKLILRSSDDHGKLAIIYKSEKRNEMVQE  251

Query  764  GYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            GYRI+GN GDQWSDLLG    +R+FKLP+PMYYI
Sbjct  252  GYRILGNSGDQWSDLLGSPMPSRSFKLPNPMYYI  285



>ref|XP_010267101.1| PREDICTED: acid phosphatase 1-like [Nelumbo nucifera]
Length=266

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/264 (43%), Positives = 152/264 (58%), Gaps = 8/264 (3%)
 Frame = +2

Query  95   RAFLLVVVLLATIPTFSHA--DSIPNQIHSLRPHTAGGGHHI---PGVNCLSWRLGVEAN  259
            R  LL+V        FS      +P    S R     G   I    G+ C SWR  VE N
Sbjct  5    RFVLLLVFSSLIFGVFSQPVLKILPEIRKSARVDPIAGDRKIRVDDGMFCDSWRFSVETN  64

Query  260  NIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEET  439
            +   W  +P++C  +V  Y+ G +Y  D + VA  ++ +AK   ++  GKD+WVFDI+ET
Sbjct  65   DAGLWKQIPERCVNFVKEYVTGDRYASDSVVVAEDSLSFAKTVKVSGHGKDVWVFDIDET  124

Query  440  TLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGT  619
             LSNLPYY      FG+  ++   FD WV    APA+P  +RLY+ L  LG   V L+G 
Sbjct  125  LLSNLPYYELH--GFGSEEFDEKSFDEWVELAEAPALPASLRLYKQLQQLGFTVVLLTGR  182

Query  620  KQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKKGYRIIGNIGDQ  796
             +  R V   NL   GYS+WE+LIL+G +D  + A+ YKS+KR +L ++GYRI G+ GDQ
Sbjct  183  TEAQRNVTEKNLLFAGYSNWERLILRGPSDEGKIALVYKSEKRMQLEEEGYRIHGSSGDQ  242

Query  797  WSDLLGDNAGARTFKLPDPMYYIA  868
            WSDLLG     R+FKLP+PMYYIA
Sbjct  243  WSDLLGFAMAKRSFKLPNPMYYIA  266



>ref|XP_004287494.1| PREDICTED: acid phosphatase 1-like [Fragaria vesca subsp. vesca]
Length=253

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/261 (44%), Positives = 150/261 (57%), Gaps = 15/261 (6%)
 Frame = +2

Query  98   AFLLVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHI---PGVNCLSWRLGVEANNIR  268
            AFLL   LL TIP      ++ + I    PH +     +     + C SWR  VE N+  
Sbjct  4    AFLL---LLITIPA-----ALSHSILQF-PHVSDYDRKLRADDNIYCDSWRFSVETNDAG  54

Query  269  DWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLS  448
             W  +P +C  +V  YM G +Y  D   V+  ++ + +   L  DGKD WVFDI+ET LS
Sbjct  55   SWDSIPSRCVAFVQDYMTGDRYASDSAIVSNFSLAFGQGVKLGGDGKDSWVFDIDETLLS  114

Query  449  NLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQ  628
            NLPYY      FGA  ++   FD WV    APA+P  + LY+ L  LG K   L+G  + 
Sbjct  115  NLPYYQEH--GFGAVTFDEVSFDKWVDLAEAPAIPASLSLYKGLQRLGFKIFLLTGRSEF  172

Query  629  FRKVRIANLKKTGYSHWEKLILKGANDTRT-AVEYKSKKRTELVKKGYRIIGNIGDQWSD  805
             R   + NL  +GYS WE+L+L+G +D  T A EYKSKKR EL+ +G+RI G+ GDQWSD
Sbjct  173  QRNATVNNLVYSGYSDWERLLLRGPSDKGTLATEYKSKKRAELINEGFRIHGSSGDQWSD  232

Query  806  LLGDNAGARTFKLPDPMYYIA  868
            LLG     R+FKLP+PMYYIA
Sbjct  233  LLGFAVARRSFKLPNPMYYIA  253



>ref|XP_004245159.1| PREDICTED: acid phosphatase 1-like [Solanum lycopersicum]
Length=269

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 134/215 (62%), Gaps = 3/215 (1%)
 Frame = +2

Query  227  CLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDG  406
            C SWR  VE NN   W+M+PQ+C  +V  Y  G +Y  D  AVA  ++ +A    +++DG
Sbjct  57   CDSWRFTVETNNAGLWSMIPQRCISFVQDYTTGDRYSSDSAAVADLSLAFANTVNVSNDG  116

Query  407  KDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVS  586
             D WVFDI+ET LSNLPYY      FG+  ++   FD WV+E  APA+P  ++LY+ L  
Sbjct  117  MDAWVFDIDETLLSNLPYYVEH--GFGSQIFDEITFDKWVNEANAPAIPASLKLYKELQQ  174

Query  587  LGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKK  763
             G     L+G  +  R     N+   GYS+WE+LIL+G +D  + A EYKS+KR EL  +
Sbjct  175  RGFTIFLLTGRIENQRNKTERNMVHAGYSNWERLILRGPSDKGKLATEYKSEKRKELEDE  234

Query  764  GYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
            GYRI GN GDQWSDL G     R+FKLP+PMYYIA
Sbjct  235  GYRIRGNSGDQWSDLTGFAVAERSFKLPNPMYYIA  269



>gb|ACJ84626.1| unknown [Medicago truncatula]
Length=259

 Score =   211 bits (538),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/217 (46%), Positives = 139/217 (64%), Gaps = 3/217 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            + C SWR   EANN+  W  VP++C E+V  YM G  Y  D       A ++AK+  L  
Sbjct  45   LRCRSWRFAGEANNLSPWKTVPKECAEHVKEYMNGKGYVYDLEIANKEAGEFAKSVKLKE  104

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DG D WVFDI+ET LSNLPYYA     +G   ++  KFD WV +G  PA+   ++LY  +
Sbjct  105  DGLDAWVFDIDETLLSNLPYYAAH--GYGFEVFDHAKFDDWVEKGVTPAIEASLKLYEDI  162

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELV  757
            ++LG K + L+G  +  R V + NL   G+  W +LIL+ ++D  + AV YKS+KR+E+ 
Sbjct  163  LNLGYKVILLTGRSESHRAVTVDNLINAGFRDWHQLILRSSDDKGKLAVIYKSEKRSEME  222

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
            K+G+RI+GN GDQWSDLLG +   R+FKLP+PMY+IA
Sbjct  223  KEGFRILGNSGDQWSDLLGSSVSVRSFKLPNPMYFIA  259



>ref|XP_008437018.1| PREDICTED: acid phosphatase 1 [Cucumis melo]
Length=266

 Score =   211 bits (538),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 97/217 (45%), Positives = 141/217 (65%), Gaps = 3/217 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            + C SWR  VEANN+  W  +P+ C EYV  Y+ G  Y+ +    +  A  +AK   L  
Sbjct  52   LRCDSWRFNVEANNLNPWKTIPKNCSEYVKQYVTGRAYQLELEIASNEAEIFAKTVKLVG  111

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DGKD+W+FDI+ET LSNLPYY  +D  +G+ ++   +FD WV + TAP +   + LY+ L
Sbjct  112  DGKDVWIFDIDETLLSNLPYY--TDHGYGSESFKPDEFDNWVEKATAPPLQPSLELYKEL  169

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELV  757
            + LG K V L+G  ++ R+    NL   G+  W++L+L+  +D  ++A+ YKS+KR+E+ 
Sbjct  170  LDLGFKLVLLTGRSEKQRESTTRNLINAGFYDWDRLVLRRDDDQGKSAILYKSEKRSEME  229

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
             +G RIIGN GDQWSDLLG +   R+FKLP+PMYYI+
Sbjct  230  NEGLRIIGNSGDQWSDLLGTSVSVRSFKLPNPMYYIS  266



>gb|EMS60884.1| Acid phosphatase 1 [Triticum urartu]
Length=395

 Score =   215 bits (548),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 112/238 (47%), Positives = 149/238 (63%), Gaps = 12/238 (5%)
 Frame = +2

Query  152  DSIPNQIHSLRPHTAGGGH--HIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLG  325
            +++   IH+LRP    GG      GV C SWRLGVEA+N+RD   VP  CE YVGH MLG
Sbjct  3    EAVAPLIHALRPMLGSGGQLGSRAGVACDSWRLGVEAHNVRDRKRVPASCEGYVGHCMLG  62

Query  326  HQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNA  505
              Y  D   V   A+ Y  +  L+ +GK++ VFDI+ETTLSNLPYYA     FG      
Sbjct  63   GHYHRDSKLVIDQAISYIDSIKLSGNGKEVLVFDIDETTLSNLPYYATQ--GFG------  114

Query  506  TKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEK  685
              F  +  + +APA+P   RLY  L+S+GIK V L+G ++  R   + NL++ G+S W  
Sbjct  115  --FQEYARQASAPALPETKRLYNKLLSVGIKLVILTGRREVQRTATVTNLRRQGFSGWMT  172

Query  686  LILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMY  859
            ++LK A+   + V +KS +R +L+  GY I+GNIGDQWSD+LG   GARTFKLPDP+Y
Sbjct  173  VLLKPADFKGSTVTFKSSERQKLLDAGYIIVGNIGDQWSDILGTPEGARTFKLPDPIY  230


 Score =   178 bits (452),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 116/189 (61%), Gaps = 23/189 (12%)
 Frame = +2

Query  302  YVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVA  481
            YVGHYMLG  YR D   V   A+ Y  +  LA +GK++WVFD++ETTLSNLPYYA     
Sbjct  230  YVGHYMLGGHYRRDSKLVIDEAISYIDSLKLAGNGKEVWVFDVDETTLSNLPYYATH--G  287

Query  482  FGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKK  661
            FGAT YN T F  +  + +APA+P   RL+  L+S+GIKPV L+G ++  R   + NL++
Sbjct  288  FGATPYNWTSFQEYARQASAPALPETKRLFDKLLSVGIKPVILTGRREVQRTATVTNLRR  347

Query  662  TGYSHWEKLILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFK  841
             G+S W                      T+L+  GY I+GNIGDQWSD+L    GARTFK
Sbjct  348  QGFSGW---------------------MTKLLDAGYIIVGNIGDQWSDILSTPEGARTFK  386

Query  842  LPDPMYYIA  868
            LPDPMYYI 
Sbjct  387  LPDPMYYIG  395



>gb|ABK21277.1| unknown [Picea sitchensis]
 gb|ABR17651.1| unknown [Picea sitchensis]
Length=254

 Score =   211 bits (537),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 103/216 (48%), Positives = 142/216 (66%), Gaps = 4/216 (2%)
 Frame = +2

Query  227  CLSWRLGVEANNIRDWAMVPQQCEEYVGHYM-LGHQYRDDCIAVAISAVQYAKNATLAHD  403
            CL+WRL VE +N+++W++VP +C  YV  YM    QY +D     ++ + YAK   L  D
Sbjct  41   CLAWRLSVETSNLKNWSVVPSKCVGYVEKYMRTPGQYWEDSKVAVLTILGYAKTVKLVGD  100

Query  404  GKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLV  583
            GKD W+FDI+ET LSNLPYY + +  +G  AYN+T F+AWVSE  A  +P  + LY  L+
Sbjct  101  GKDAWIFDIDETLLSNLPYYQQHE--YGGEAYNSTTFEAWVSETKALVLPSSLLLYNVLL  158

Query  584  SLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDTRTAVE-YKSKKRTELVK  760
            + G K   L+G  +  R +   NL + GY  W+ LIL+G N+  +A   YK +KR ELVK
Sbjct  159  ARGFKIFLLTGRDEYQRNITTHNLFRAGYKGWDGLILRGVNEQGSAAGVYKPEKRGELVK  218

Query  761  KGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
            KGYR+ G++GDQWSDL G    +R+FKLP+PMYYI+
Sbjct  219  KGYRLWGSVGDQWSDLSGPYEASRSFKLPNPMYYIS  254



>gb|ACN40876.1| unknown [Picea sitchensis]
Length=254

 Score =   211 bits (536),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 103/216 (48%), Positives = 142/216 (66%), Gaps = 4/216 (2%)
 Frame = +2

Query  227  CLSWRLGVEANNIRDWAMVPQQCEEYVGHYM-LGHQYRDDCIAVAISAVQYAKNATLAHD  403
            CL+WRL VE +N+++W++VP +C  YV  YM    QY +D     ++ + YAK   L  D
Sbjct  41   CLAWRLSVETSNLKNWSVVPSKCVGYVEKYMRTPGQYWEDSKVAVLTNLGYAKTVKLVGD  100

Query  404  GKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLV  583
            GKD W+FDI+ET LSNLPYY + +  +G  AYN+T F+AWVSE  A  +P  + LY  L+
Sbjct  101  GKDAWIFDIDETLLSNLPYYQQHE--YGGEAYNSTTFEAWVSETKALVLPSSLLLYNVLL  158

Query  584  SLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDTRTAVE-YKSKKRTELVK  760
            + G K   L+G  +  R +   NL + GY  W+ LIL+G N+  +A   YK +KR ELVK
Sbjct  159  ARGFKIFLLTGRDEYQRNITTHNLFRAGYKGWDGLILRGVNEQGSAAGVYKPEKRGELVK  218

Query  761  KGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
            KGYR+ G++GDQWSDL G    +R+FKLP+PMYYI+
Sbjct  219  KGYRLWGSVGDQWSDLSGPYEASRSFKLPNPMYYIS  254



>ref|XP_002283385.2| PREDICTED: acid phosphatase 1-like [Vitis vinifera]
Length=307

 Score =   213 bits (541),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 139/214 (65%), Gaps = 3/214 (1%)
 Frame = +2

Query  227  CLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDG  406
            C SWR  VE N+   W  VP +C ++V  YM G +YR D    A  ++ +AK   +A DG
Sbjct  95   CDSWRFTVETNDAGVWVSVPDRCVQWVKDYMTGDRYRSDSEFAADDSLSFAKTVQIAGDG  154

Query  407  KDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVS  586
            KD+WVFDI+ET LSNLPYYA     FG+ A++ + FD WV+   APA+   +RLYR +  
Sbjct  155  KDVWVFDIDETLLSNLPYYAAH--GFGSEAFDDSTFDEWVNLAEAPALQASLRLYREVEQ  212

Query  587  LGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKK  763
            LG K V ++G  +  R V   NL   GYS+WE+L L+G  D+ +TA+ YKS+KR EL  +
Sbjct  213  LGFKIVLITGRIEPQRNVTEKNLVYAGYSNWERLFLRGRADSGKTALVYKSEKRRELEDE  272

Query  764  GYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            GYRI G+ GDQWSDLLG     R+FKLP+PMYYI
Sbjct  273  GYRIHGSSGDQWSDLLGFAIARRSFKLPNPMYYI  306



>ref|XP_010915367.1| PREDICTED: acid phosphatase 1-like isoform X1 [Elaeis guineensis]
Length=255

 Score =   211 bits (536),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 134/214 (63%), Gaps = 3/214 (1%)
 Frame = +2

Query  227  CLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDG  406
            C SWRL  E NN   W  +P  C ++V  YM G ++  D   VA  ++ +A+   +  DG
Sbjct  43   CDSWRLSAETNNAGYWKTIPAGCLQFVAEYMNGDRFLSDSAVVAAESLAFAQAVQVVGDG  102

Query  407  KDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVS  586
            KDIW+FD++ET LSNLPYY  +   +G+  +N T FD WV+   APA+P  +RLY  L+ 
Sbjct  103  KDIWIFDVDETLLSNLPYYVVN--GYGSEDFNETAFDEWVNLAKAPALPASLRLYEELLG  160

Query  587  LGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKK  763
            LG + VFL+G  +  R   + NL   GY  W +LIL+ A+D  + A  YKS++R EL  +
Sbjct  161  LGFQVVFLTGRVEAQRNATVENLSFAGYHSWNRLILREASDIGKKAAAYKSERRAELEAQ  220

Query  764  GYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            GYRI GN GDQWSDLLG     R+FKLP+PMYYI
Sbjct  221  GYRIHGNSGDQWSDLLGSPMAMRSFKLPNPMYYI  254



>ref|NP_001151681.1| acid phosphatase 1 precursor [Zea mays]
 ref|XP_008658711.1| PREDICTED: acid phosphatase 1 isoform X1 [Zea mays]
 gb|ACG43863.1| acid phosphatase 1 precursor [Zea mays]
Length=295

 Score =   212 bits (539),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 107/216 (50%), Positives = 138/216 (64%), Gaps = 5/216 (2%)
 Frame = +2

Query  227  CLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDC--IAVAISAVQYAKNATLAH  400
            C SWRL  EANN+  WA VP +C  +V  Y+ G  YR D   +A   +A   A     A 
Sbjct  81   CASWRLAAEANNLAPWAAVPPECAPHVRDYVTGSAYRSDLDLVARESAAYARAAAPAGAA  140

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DG+D WVFD++ET LSNLPYYA  +  +GA  ++  KFD WV  G A A+P  ++LY  +
Sbjct  141  DGRDAWVFDVDETLLSNLPYYA--EHGYGAELFDHHKFDEWVERGEAAAIPSSLKLYNEV  198

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELV  757
              LG K   L+G  +  R V + NL K G+  WEKLIL+ A D  +TA  YKS+KR E+ 
Sbjct  199  RGLGFKTFLLTGRSEAHRGVTVENLNKQGFHDWEKLILRAAGDREKTATVYKSEKRDEME  258

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            ++GYRI+GN GDQWSDLLG +  AR+FKLP+PMYYI
Sbjct  259  QEGYRILGNSGDQWSDLLGSSMSARSFKLPNPMYYI  294



>gb|ABK21327.1| unknown [Picea sitchensis]
 gb|ABR18337.1| unknown [Picea sitchensis]
Length=254

 Score =   211 bits (536),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 103/216 (48%), Positives = 141/216 (65%), Gaps = 4/216 (2%)
 Frame = +2

Query  227  CLSWRLGVEANNIRDWAMVPQQCEEYVGHYM-LGHQYRDDCIAVAISAVQYAKNATLAHD  403
            CL+WRL VE  N+++W++VP +C  YV  YM    QY +D     ++ + YAK   L  D
Sbjct  41   CLAWRLSVETGNLKNWSVVPSKCVGYVEKYMRTPGQYWEDSKVAVLTILGYAKTVKLVGD  100

Query  404  GKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLV  583
            GKD W+FDI+ET LSNLPYY + +  +G  AYN+T F+AWVSE  A  +P  + LY  L+
Sbjct  101  GKDAWIFDIDETLLSNLPYYQQHE--YGGEAYNSTTFEAWVSETKALVLPSSLLLYNVLL  158

Query  584  SLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDTRTAVE-YKSKKRTELVK  760
            + G K   L+G  +  R +   NL + GY  W+ LIL+G N+  +A   YK +KR ELVK
Sbjct  159  ARGFKIFLLTGRDEYQRNITTHNLFRAGYKGWDGLILRGVNEQGSAAGVYKPEKRGELVK  218

Query  761  KGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
            KGYR+ G++GDQWSDL G    +R+FKLP+PMYYI+
Sbjct  219  KGYRLWGSVGDQWSDLSGPYEASRSFKLPNPMYYIS  254



>gb|AFW85941.1| acid phosphatase 1 [Zea mays]
Length=312

 Score =   212 bits (540),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 107/216 (50%), Positives = 138/216 (64%), Gaps = 5/216 (2%)
 Frame = +2

Query  227  CLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDC--IAVAISAVQYAKNATLAH  400
            C SWRL  EANN+  WA VP +C  +V  Y+ G  YR D   +A   +A   A     A 
Sbjct  98   CASWRLAAEANNLAPWAAVPPECAPHVRDYVTGSAYRSDLDLVARESAAYARAAAPAGAA  157

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DG+D WVFD++ET LSNLPYYA  +  +GA  ++  KFD WV  G A A+P  ++LY  +
Sbjct  158  DGRDAWVFDVDETLLSNLPYYA--EHGYGAELFDHHKFDEWVERGEAAAIPSSLKLYNEV  215

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELV  757
              LG K   L+G  +  R V + NL K G+  WEKLIL+ A D  +TA  YKS+KR E+ 
Sbjct  216  RGLGFKTFLLTGRSEAHRGVTVENLNKQGFHDWEKLILRAAGDREKTATVYKSEKRDEME  275

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            ++GYRI+GN GDQWSDLLG +  AR+FKLP+PMYYI
Sbjct  276  QEGYRILGNSGDQWSDLLGSSMSARSFKLPNPMYYI  311



>ref|XP_004143740.1| PREDICTED: acid phosphatase 1-like [Cucumis sativus]
 gb|KGN50316.1| hypothetical protein Csa_5G167080 [Cucumis sativus]
Length=266

 Score =   211 bits (536),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 98/217 (45%), Positives = 139/217 (64%), Gaps = 3/217 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            + C SWR  VEANN+  W  +P+ C EYV  Y+ G  Y+ +    +  A  +AK   L  
Sbjct  52   LRCDSWRFNVEANNLNPWKRIPESCSEYVKQYVTGRAYQLELEIASNEAQVFAKTVKLVG  111

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DGKD+WVFDI+ET LSNLPYY  +D  +G+  +   +FD WV + TAP +   +  Y+ L
Sbjct  112  DGKDVWVFDIDETLLSNLPYY--TDHGYGSENFKPDEFDNWVEKATAPPLQPSLEFYKEL  169

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELV  757
            + LG K V L+G  ++ R+    NL   G+  W++LIL+  +D  ++A+ YKS+KR+E+ 
Sbjct  170  LDLGFKLVLLTGRSEKQRECTTRNLINAGFYDWDRLILRRDDDQGKSAILYKSEKRSEME  229

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
             +G RIIGN GDQWSDLLG +   R+FKLP+PMYYI+
Sbjct  230  NEGLRIIGNSGDQWSDLLGTSVSVRSFKLPNPMYYIS  266



>ref|XP_006359744.1| PREDICTED: acid phosphatase 1-like [Solanum tuberosum]
Length=268

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/264 (41%), Positives = 152/264 (58%), Gaps = 10/264 (4%)
 Frame = +2

Query  101  FLLVVVLLATIPTFSHADSI----PNQIHSLRPHTAGGGHHIPGVN---CLSWRLGVEAN  259
            F+ V+ +  T  + S + SI    P  +     +       IP  N   C SWR  VE N
Sbjct  7    FIAVLFISFTFVSTSFSQSILGISPQLLDLFAINRVFRHRKIPKDNALYCDSWRFTVETN  66

Query  260  NIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEET  439
            N   W+++P++C  +V  Y  G +Y  D  AVA  ++ +A    +++DG D WVFDI+ET
Sbjct  67   NAGLWSIIPERCISFVQEYTTGDRYSSDSAAVADLSLAFANTVKVSNDGMDAWVFDIDET  126

Query  440  TLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGT  619
             LSNLPYY      FG+  ++   FD WV+E  APA+P  ++LY+ L   G     L+G 
Sbjct  127  LLSNLPYYVEH--GFGSQIFDENAFDKWVNEANAPAIPASLKLYKELQQRGFTIFLLTGR  184

Query  620  KQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKKGYRIIGNIGDQ  796
             +  R     N+   GYS+WE+LIL+G +D  + A +YKS+KR EL  +GYRI GN GDQ
Sbjct  185  SEYQRNNTEKNMVHAGYSNWERLILRGPSDKGKLATQYKSEKRKELEDEGYRIRGNSGDQ  244

Query  797  WSDLLGDNAGARTFKLPDPMYYIA  868
            WSDL+G     R+FKLP+PMYYIA
Sbjct  245  WSDLMGFAVAQRSFKLPNPMYYIA  268



>ref|XP_008794092.1| PREDICTED: acid phosphatase 1-like [Phoenix dactylifera]
Length=258

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/217 (46%), Positives = 138/217 (64%), Gaps = 3/217 (1%)
 Frame = +2

Query  218  GVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLA  397
            G+ C SWRL  E NN   W  +P +C ++V  YM G +Y  D   VA  ++ +A+   +A
Sbjct  43   GLYCDSWRLSEETNNAGYWGTIPARCLQFVAEYMNGDRYALDSDVVAAESLAFAQTVQVA  102

Query  398  HDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRT  577
             DG D+W+FD++ET LSNLPYYA +   +G+  +N T FD W++   APA+P  +RLY  
Sbjct  103  GDGNDVWIFDVDETLLSNLPYYAVN--GYGSEEFNETTFDEWLNLAKAPALPASLRLYEE  160

Query  578  LVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTEL  754
            L+ LG + + L+G  +  R     NL   GY  W +LIL+ A+D  +TAV YKS+KR +L
Sbjct  161  LLGLGFQIILLTGRVEAERNATEKNLSFAGYHSWTRLILREASDIGKTAVAYKSEKRAQL  220

Query  755  VKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
              +G+RI GN GDQWSDLLG     R+FKLP+PMYYI
Sbjct  221  EAQGHRIHGNSGDQWSDLLGSPMATRSFKLPNPMYYI  257



>ref|XP_006451342.1| hypothetical protein CICLE_v10009222mg [Citrus clementina]
 ref|XP_006475349.1| PREDICTED: acid phosphatase 1-like [Citrus sinensis]
 gb|ESR64582.1| hypothetical protein CICLE_v10009222mg [Citrus clementina]
Length=262

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/260 (45%), Positives = 154/260 (59%), Gaps = 7/260 (3%)
 Frame = +2

Query  101  FLLVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPG--VNCLSWRLGVEANNIRDW  274
            FLLV+ L + + + + + S+  QI   R   AG      G  + C SWR  VE N+  +W
Sbjct  6    FLLVISLHSFLISHAFSQSVI-QIFPGRIEFAGDRKIRAGDELYCDSWRFSVETNDAGEW  64

Query  275  AMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATL-AHDGKDIWVFDIEETTLSN  451
              VP +C E+V  YM G  Y  D   V+  ++++AK+A + A DGKD WVFDI+ET LSN
Sbjct  65   DSVPSRCVEFVQKYMTGEHYLSDSEIVSGYSLKHAKSANVSAGDGKDAWVFDIDETLLSN  124

Query  452  LPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQF  631
            LPYYA     FG+  +N   FD WV    APA+P  +  Y+ L  LG K   L+G  +  
Sbjct  125  LPYYAAH--GFGSEIFNEDAFDEWVDLAKAPALPASLNFYKELKQLGFKIFLLTGRNEFQ  182

Query  632  RKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKKGYRIIGNIGDQWSDL  808
            R     NL   GYS W+KL L+G +D  + A  YKS+KR ELV +GYRI G+ GDQWSDL
Sbjct  183  RNTTEKNLLFAGYSDWKKLFLRGPSDQGKPATVYKSEKRLELVNEGYRIHGSSGDQWSDL  242

Query  809  LGDNAGARTFKLPDPMYYIA  868
            LG     R+FKLP+PMYYIA
Sbjct  243  LGFAKAERSFKLPNPMYYIA  262



>ref|XP_010110867.1| Acid phosphatase 1 [Morus notabilis]
 gb|EXC28686.1| Acid phosphatase 1 [Morus notabilis]
Length=259

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/259 (42%), Positives = 151/259 (58%), Gaps = 15/259 (6%)
 Frame = +2

Query  104  LLVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVN---CLSWRLGVEANNIRDW  274
            +L +  L  IP     +++P  I  + P      H +   +   C SWR  VE N+   W
Sbjct  12   ILFLFFLGQIP-----NALPQSIIQISPRN----HRVSDQDLLYCDSWRFSVETNDAGFW  62

Query  275  AMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNL  454
              +P++CE YV +Y+ G +YR D   VA  ++ + ++  +  DGKD W+FDI+ET LSNL
Sbjct  63   PTIPKRCENYVENYVTGDRYRSDSEFVAGDSLAFVRSLQMNDDGKDAWIFDIDETLLSNL  122

Query  455  PYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFR  634
            PYY      FGA  ++ T FD WV    APA+   + LY  L  LG K   L+G  +  R
Sbjct  123  PYYEAH--GFGAEVFDETPFDDWVDLAEAPALAASLSLYNELEQLGFKIFLLTGRSEYQR  180

Query  635  KVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLL  811
                 NL  +GY +WE+LIL+G +D  + A+ YKS+KR+ELV +GY I G+ GDQWSDL+
Sbjct  181  NATEKNLLYSGYKNWERLILRGPSDQHKPAIVYKSEKRSELVNEGYTIHGSSGDQWSDLM  240

Query  812  GDNAGARTFKLPDPMYYIA  868
            G     R+FKLP+PMYYIA
Sbjct  241  GFAVAQRSFKLPNPMYYIA  259



>gb|KDO55859.1| hypothetical protein CISIN_1g024820mg [Citrus sinensis]
Length=262

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/260 (45%), Positives = 154/260 (59%), Gaps = 7/260 (3%)
 Frame = +2

Query  101  FLLVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPG--VNCLSWRLGVEANNIRDW  274
            FLLV+ L + + + + + S+  QI   R   AG      G  + C SWR  VE N+  +W
Sbjct  6    FLLVISLHSFLISHAFSQSVI-QIFPGRIEFAGDRKIRAGDELYCDSWRFSVETNDAGEW  64

Query  275  AMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATL-AHDGKDIWVFDIEETTLSN  451
              VP +C E+V  YM G  Y  D   V+  ++++AK+A + A DGKD WVFDI+ET LSN
Sbjct  65   DSVPSRCVEFVQKYMTGEHYLSDSEIVSGYSLKHAKSANVSAGDGKDAWVFDIDETLLSN  124

Query  452  LPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQF  631
            LPYYA     FG+  +N   FD WV    APA+P  +  Y+ L  LG K   L+G  +  
Sbjct  125  LPYYAAH--GFGSEIFNEDAFDEWVDLAKAPALPASLTFYKELKQLGFKIFLLTGRNEFQ  182

Query  632  RKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKKGYRIIGNIGDQWSDL  808
            R     NL   GYS W+KL L+G +D  + A  YKS+KR ELV +GYRI G+ GDQWSDL
Sbjct  183  RNTTEKNLLFAGYSDWKKLFLRGPSDQGKPATVYKSEKRLELVNEGYRIHGSSGDQWSDL  242

Query  809  LGDNAGARTFKLPDPMYYIA  868
            LG     R+FKLP+PMYYIA
Sbjct  243  LGFAKAERSFKLPNPMYYIA  262



>ref|XP_010438922.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=267

 Score =   209 bits (532),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/216 (45%), Positives = 138/216 (64%), Gaps = 3/216 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            ++C SWR   E NN+  W  +P +C +YV  Y++G  Y  D   V+  A  YA +     
Sbjct  53   LHCTSWRFAAETNNLAPWKTIPVECADYVKDYLMGKGYVFDVERVSEEAKIYASSFESNG  112

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DGKD+W+FDI+ET LSNLPYY       G   +N +KFD WV +G APA+   ++LY+ +
Sbjct  113  DGKDVWIFDIDETLLSNLPYYLEH--GCGLEVFNHSKFDKWVEKGIAPAIAPSLKLYKLV  170

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELV  757
              +G K + L+G ++  R V + NL+  G+ +W+KLIL+  +D  +TA  +KS+KR E+V
Sbjct  171  QDMGYKVILLTGRRENHRVVTVENLRNAGFHNWDKLILRSMDDDHKTATIFKSEKRDEMV  230

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
             +GYRI GN GDQWSDLLG     R+FKLP+PMYYI
Sbjct  231  NEGYRIRGNSGDQWSDLLGFAMSERSFKLPNPMYYI  266



>ref|XP_010433681.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=267

 Score =   209 bits (532),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/216 (45%), Positives = 138/216 (64%), Gaps = 3/216 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            ++C SWR   E NN+  W  +P +C +YV  Y++G  Y  D   V+  A  YA +     
Sbjct  53   LHCTSWRFAAETNNLAPWKTIPVECADYVKDYLMGKGYVFDVERVSEEAKIYASSFESNG  112

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DGKD+W+FDI+ET LSNLPYY       G   +N +KFD WV +G APA+   ++LY+ +
Sbjct  113  DGKDVWIFDIDETLLSNLPYYLEH--GCGLEVFNHSKFDKWVEKGIAPAIAPSLKLYQMV  170

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELV  757
              +G K + L+G ++  R V + NL+  G+ +W+KLIL+  +D  +TA  YKS+KR E+V
Sbjct  171  QDMGYKVILLTGRRENHRVVTVENLRNAGFHNWDKLILRSMDDDHKTATIYKSEKRDEMV  230

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
             +GYRI GN GDQWSDLLG     R+FKLP+PMY+I
Sbjct  231  NEGYRIRGNSGDQWSDLLGFAMSERSFKLPNPMYFI  266



>gb|EEE62606.1| hypothetical protein OsJ_17409 [Oryza sativa Japonica Group]
Length=252

 Score =   209 bits (531),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 117/241 (49%), Positives = 142/241 (59%), Gaps = 44/241 (18%)
 Frame = +2

Query  170  IHSLRPHTAGGGHHIP---GVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRD  340
            IH+LRP   G G  +    GV C SWRLGVEA+N+ DW  VP +CE Y+GHYMLG  YR 
Sbjct  48   IHALRP-LLGSGRQLAARAGVACDSWRLGVEAHNVIDWRTVPAECEGYIGHYMLGEHYRR  106

Query  341  DCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDA  520
            D   V   AV YA+   LA +GK+IWVFDI+ET+LSNLPYYA+    FGAT YNAT F  
Sbjct  107  DFAVVVDEAVAYAETLKLAGNGKEIWVFDIDETSLSNLPYYAKH--GFGATPYNATSFRR  164

Query  521  WVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKG  700
                                            T+ Q R + + NL + G+S WEKL+LK 
Sbjct  165  --------------------------------TEDQ-RTITVTNLHRQGFSGWEKLLLKP  191

Query  701  ANDTR-----TAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            A         +AVEYKS +R +L   G+ I+GNIGDQWSD+LG   GARTFKLPDP+YYI
Sbjct  192  AVHATGELQGSAVEYKSGERQKLQDAGFIIVGNIGDQWSDILGAPEGARTFKLPDPLYYI  251

Query  866  A  868
             
Sbjct  252  G  252



>gb|KDP40845.1| hypothetical protein JCGZ_24844 [Jatropha curcas]
Length=255

 Score =   209 bits (531),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 119/267 (45%), Positives = 158/267 (59%), Gaps = 23/267 (9%)
 Frame = +2

Query  98   AFLLVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWA  277
            A LL+VVL+A    F+ +  I  +   LR H           NCLSWR+  EANN   W 
Sbjct  2    AMLLLVVLVAR---FATSQGIITEAIILRRHCRP--------NCLSWRVANEANNTIGWT  50

Query  278  MVPQQCEEYVGHYMLGH--QYRDDCIAVAISAVQYAKNATLAHDG-KDIWVFDIEETTLS  448
              P  C +YV  Y++G+  QYRDD   V   A+ Y KN +L  DG  DIWVFDI++T LS
Sbjct  51   KFPTGCIDYVKDYLVGNHSQYRDDSQLVIDQAIDYLKNLSLPKDGTNDIWVFDIDDTVLS  110

Query  449  NLPYYARSDVAFGATAYNATKFDAWV------SEGTAPAVPGGVRLYRTLVSLGIKPVFL  610
            N+ Y+   D+  G+ ++N+     WV      ++  APA+P   RLY  ++ LG+K VFL
Sbjct  111  NVQYFI--DIISGSESWNSILPANWVFTVPELAQDLAPALPESKRLYDEVLRLGVKVVFL  168

Query  611  SGTKQQFRKVRIANLKKTGYSHWEKLILKGAN-DTRTAVEYKSKKRTELVKKGYRIIGNI  787
            +G  ++ R V + NL   G+  WEKLILK       T +EYKS  RT L ++GY I+GNI
Sbjct  169  TGRSEENRNVTVVNLVADGFGTWEKLILKSDEFQNSTTLEYKSTMRTRLEEQGYIIVGNI  228

Query  788  GDQWSDLLGDNAGARTFKLPDPMYYIA  868
            GDQWSD+ G + G RTFKLP+PMYYIA
Sbjct  229  GDQWSDITGPSPGRRTFKLPNPMYYIA  255



>ref|XP_004964488.1| PREDICTED: acid phosphatase 1-like isoform X1 [Setaria italica]
Length=369

 Score =   212 bits (540),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 105/216 (49%), Positives = 135/216 (63%), Gaps = 3/216 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            V C SWRL  EANN+  W  VP  C  +V  Y+ G  YR D   +A  +  YA+ A L  
Sbjct  155  VRCASWRLAAEANNLAPWKAVPAGCAAHVRDYIAGAAYRSDLDLIARESTTYARAAPLRG  214

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DG+D WVFDI+ET LSNLPYYA     +G   ++  KFD WV  G A A+P  ++LY  +
Sbjct  215  DGRDAWVFDIDETLLSNLPYYAEH--GYGLELFDHQKFDRWVERGEALAIPSSLKLYNEV  272

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELV  757
              LG K   L+G  +    +   NLKK G+  W+KLIL+ A D  +TA  YKS+KR  + 
Sbjct  273  RELGFKTFLLTGRSEGHLDITAENLKKQGFHDWDKLILREACDRKKTATVYKSEKRKAME  332

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            ++GYRI+GN GDQWSDLLG +  AR+FKLP+PMYYI
Sbjct  333  EEGYRILGNSGDQWSDLLGWSMSARSFKLPNPMYYI  368



>ref|XP_009127318.1| PREDICTED: acid phosphatase 1 [Brassica rapa]
Length=261

 Score =   209 bits (531),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 111/258 (43%), Positives = 152/258 (59%), Gaps = 9/258 (3%)
 Frame = +2

Query  104  LLVVVLLATIPTFSHADSIPNQIHSLRPHTAG--GGHHIPGVNCLSWRLGVEANNIRDWA  277
             LVV L A+   FS   S P+ I            G  +  ++C SWR   E NN+  W+
Sbjct  8    FLVVSLFAS--AFSDELSDPSSILKYPSEETKRVDGDEV-NLHCTSWRFAAETNNLAPWS  64

Query  278  MVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATL-AHDGKDIWVFDIEETTLSNL  454
             +P +C +YV  Y+LG  Y  D   V+  A  +A      A DGKD WVFDI+ET LSNL
Sbjct  65   TIPAECADYVKDYVLGKGYVADLERVSEEASVFASTVDFSAGDGKDAWVFDIDETLLSNL  124

Query  455  PYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFR  634
            PYY   D  FG   ++ ++FD WV  G APA+   ++LY+ ++ LG +   L+G K+  R
Sbjct  125  PYYI--DHGFGLEVFDHSEFDKWVERGVAPAIAPSLKLYQRVIDLGYRVFLLTGRKESHR  182

Query  635  KVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLL  811
             V + NL   G+ +W+KLIL+  ++  + A  YKS+KR E+VK+GYRI GN GDQWSDLL
Sbjct  183  LVTVENLINAGFQNWDKLILRSPDEQHKMATLYKSEKRDEMVKEGYRIRGNSGDQWSDLL  242

Query  812  GDNAGARTFKLPDPMYYI  865
            G +   R+FKL +PMYYI
Sbjct  243  GSSMSQRSFKLANPMYYI  260



>ref|XP_008798586.1| PREDICTED: acid phosphatase 1-like [Phoenix dactylifera]
Length=255

 Score =   208 bits (530),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 134/214 (63%), Gaps = 3/214 (1%)
 Frame = +2

Query  227  CLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDG  406
            C SWRL  E NN   W  +P +C ++V  YM G ++  D   VA  ++ +A+   +  DG
Sbjct  43   CDSWRLSEETNNAGYWKTIPARCLQFVAEYMNGDRFASDSAVVAAESLAFAQTVQVVGDG  102

Query  407  KDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVS  586
            KD+W+FD++ET LSNLPYYA +   +G+  +N T FD WV+   APA+P  +RLY  L+ 
Sbjct  103  KDVWIFDVDETLLSNLPYYAVN--GYGSEDFNETTFDEWVNLAKAPALPASLRLYEELLG  160

Query  587  LGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKK  763
            LG + V L+G  +  R V   NL   GY  W +LIL+  +D  + AV YKS +R EL  +
Sbjct  161  LGFQVVLLTGRVEAQRNVTAENLSFAGYHSWNRLILREDSDIGKKAVRYKSGRRAELEAQ  220

Query  764  GYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            GYRI GN GDQWSDLLG     R+FKLP+PMYYI
Sbjct  221  GYRIHGNSGDQWSDLLGSPMAMRSFKLPNPMYYI  254



>emb|CDP03233.1| unnamed protein product [Coffea canephora]
Length=267

 Score =   209 bits (531),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 112/261 (43%), Positives = 155/261 (59%), Gaps = 13/261 (5%)
 Frame = +2

Query  113  VVLLATIPTFSHADSIPNQIHSLRPHTAGGGHH-----IP---GVNCLSWRLGVEANNIR  268
            +VLL+   + S A   P+ I  + P  +G   H     IP    + C SWR  VEAN++ 
Sbjct  11   IVLLSLHVSLSTA--FPDSILQILPENSGSSPHHRHRKIPRDDNLYCDSWRFVVEANDVG  68

Query  269  DWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLS  448
             WA +P +C  +V  Y+   +YR D  AVA +++++AK   ++ DGKD WVFDI+ET LS
Sbjct  69   PWARIPSRCVAFVQDYVTNDRYRADSEAVADASLEFAKTVKVSGDGKDAWVFDIDETLLS  128

Query  449  NLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQ  628
            N+PYYA     FG+  ++   FD WV    APA+P  +RL + L  LG K   L+G  + 
Sbjct  129  NVPYYAVH--GFGSETFDENSFDEWVDLAEAPALPASLRLCKELEQLGFKIFLLTGRTEF  186

Query  629  FRKVRIANLKKTGYSHWEKLILKG-ANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSD  805
             R     NL   GYS WE+LIL+G ++D + A  YKS++R EL  +GY I G+ GDQWSD
Sbjct  187  QRSATSKNLDYAGYSDWERLILRGPSDDGKPATVYKSERRKELEDEGYVIHGSSGDQWSD  246

Query  806  LLGDNAGARTFKLPDPMYYIA  868
            L G     R+FKLP+P+YYIA
Sbjct  247  LNGFAVAERSFKLPNPLYYIA  267



>ref|XP_008387412.1| PREDICTED: acid phosphatase 1-like [Malus domestica]
Length=257

 Score =   208 bits (530),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 134/215 (62%), Gaps = 3/215 (1%)
 Frame = +2

Query  227  CLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDG  406
            C SWR  +E N+   W+ +P +C  +V  YM G +YR D  +VA  ++ +AK  T   DG
Sbjct  45   CDSWRFSIETNDAGTWSNIPSRCXRFVQDYMTGDRYRSDLASVANYSLSFAKGVTXGGDG  104

Query  407  KDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVS  586
            KD WVFDI+ET LSNL YY      FG+  +N   FD WV    APA+P  + LY+ L  
Sbjct  105  KDAWVFDIDETLLSNLAYYQAH--GFGSETFNEAFFDEWVDLAEAPALPASLNLYKELEX  162

Query  587  LGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDTRT-AVEYKSKKRTELVKK  763
            LG K   L+G  +  R     NL   GY++WE+L+L+G +D  T A  YKS+KR++L+ +
Sbjct  163  LGFKMFLLTGRSEHQRNATARNLLYAGYNNWERLLLRGPSDQGTPATVYKSQKRSDLINE  222

Query  764  GYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
            GYRI G+ GDQWSDL+G     R+FKLP+PMYYIA
Sbjct  223  GYRIHGSSGDQWSDLIGFAIAQRSFKLPNPMYYIA  257



>ref|XP_006284235.1| hypothetical protein CARUB_v10005397mg, partial [Capsella rubella]
 gb|EOA17133.1| hypothetical protein CARUB_v10005397mg, partial [Capsella rubella]
Length=290

 Score =   209 bits (532),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 101/216 (47%), Positives = 137/216 (63%), Gaps = 3/216 (1%)
 Frame = +2

Query  224  NCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHD  403
            NC SWRL  E NN   W +VP +C   V +Y+ G Q+ +D   VA  A+ YAK   L  D
Sbjct  77   NCESWRLASETNNAGSWNVVPSRCVNSVKNYINGGQFENDYNIVARYAIAYAKRINLGRD  136

Query  404  GKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLV  583
            GKD WVFDI+ET LSNL YY      +G+  Y+  KF+ W  +G A +  G +RLY+ L 
Sbjct  137  GKDAWVFDIDETLLSNLDYYKVH--GYGSEPYDNAKFNEWAVQGKASSFDGSLRLYKALK  194

Query  584  SLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVK  760
             LG   + L+G  +  R +   NL+  GY  W +LIL+G ND  +TA++YKS++R+++VK
Sbjct  195  KLGFTIILLTGRDENQRSITEKNLRNAGYFGWNRLILRGKNDQGKTAIQYKSEQRSKVVK  254

Query  761  KGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
            +GY+I GN GDQWSDL G     R+FK+P+PMYYIA
Sbjct  255  EGYKIHGNTGDQWSDLQGFAVATRSFKVPNPMYYIA  290



>ref|XP_009137842.1| PREDICTED: acid phosphatase 1 [Brassica rapa]
 emb|CDY30222.1| BnaA03g49480D [Brassica napus]
Length=261

 Score =   208 bits (529),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 107/261 (41%), Positives = 151/261 (58%), Gaps = 14/261 (5%)
 Frame = +2

Query  104  LLVVVLLATIPTFSHADSIPNQIHSLR------PHTAGGGHHIPGVNCLSWRLGVEANNI  265
            L +  ++ T+ TF     +PN   SLR      P + G         C SWRL  E NN 
Sbjct  7    LPISFIVLTLFTF-----LPNHATSLRTSFIKLPGSDGSRSSAADTYCESWRLAAETNNA  61

Query  266  RDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTL  445
              W ++P  C + V  Y+ G QY  D   +A  A+ +AK   ++ DGKD+W+FDI+ET L
Sbjct  62   GTWDVIPSVCVDSVAGYLNGDQYASDYGVIADYALAFAKTVQVSGDGKDVWIFDIDETLL  121

Query  446  SNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQ  625
            +NL YY      +G+  + +  F+ WV EGTAPA    +RLY  L  LG   V L+G  +
Sbjct  122  TNLDYYKAH--GYGSEPFESNSFNEWVVEGTAPAFEASLRLYNALKKLGFTIVLLTGRDE  179

Query  626  QFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKKGYRIIGNIGDQWS  802
              R V   NL+  GYS WE+L+L+G  D  ++A  YKS++R++L+ +G++I GN GDQWS
Sbjct  180  HQRSVTETNLRDAGYSGWERLLLRGPEDQGKSATNYKSEQRSKLIGEGFKIRGNTGDQWS  239

Query  803  DLLGDNAGARTFKLPDPMYYI  865
            DLLG     R+FK+P+PMYYI
Sbjct  240  DLLGFAVADRSFKVPNPMYYI  260



>ref|XP_010438316.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=259

 Score =   208 bits (529),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 109/266 (41%), Positives = 151/266 (57%), Gaps = 13/266 (5%)
 Frame = +2

Query  80   RKLTMRAFLLVVVLLATI--PTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVE  253
            R  +   F  +V  LA +  P  S   S  +   +  P      H     NC SWRL  E
Sbjct  4    RSSSSITFFFIVSFLAVLVNPAIS---SRASSFFTKHPQ-----HSSIASNCESWRLASE  55

Query  254  ANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIE  433
             NN   W +VP +C   V +Y+ G Q+ +D   VA   + YAK   L  DGKD WVFDI+
Sbjct  56   TNNAGSWKVVPSRCVNSVKNYITGGQFDNDYNIVARYVIAYAKRVKLGGDGKDAWVFDID  115

Query  434  ETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLS  613
            ET LSNL YY      +G+  Y+ TKF+ W  +G APA    ++LY+ L  LG   + L+
Sbjct  116  ETLLSNLEYYKAH--GYGSEPYDDTKFNEWAVQGKAPAFDASLKLYKALKRLGFTIILLT  173

Query  614  GTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKKGYRIIGNIG  790
            G  +  R +   NL+  GY  W + +L+G ND  +TA +YKS++R+++VK+GY+I G+ G
Sbjct  174  GRDESQRSITAKNLRDAGYFGWNRFLLRGKNDQGKTATQYKSEQRSKVVKEGYKIHGSTG  233

Query  791  DQWSDLLGDNAGARTFKLPDPMYYIA  868
            DQWSDL G    AR+FK+P+PMYYIA
Sbjct  234  DQWSDLQGFAVAARSFKVPNPMYYIA  259



>emb|CDY47773.1| BnaC07g41870D [Brassica napus]
Length=261

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/255 (42%), Positives = 149/255 (58%), Gaps = 6/255 (2%)
 Frame = +2

Query  104  LLVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMV  283
             +V+ L   +P  +HA S+      L P + G         C SWRL  E NN   W ++
Sbjct  11   FIVLALFTFLP--NHAISLRTSFIKL-PGSDGSRSSAADTYCESWRLAAETNNAGTWDVI  67

Query  284  PQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYY  463
            P  C + V  Y+ G QY  D   +A  A+ +AK   ++ DGKD+W+FDI+ET L+NL YY
Sbjct  68   PSVCVDSVAGYLNGDQYGSDYGVIADYALAFAKTVQVSGDGKDVWIFDIDETLLTNLDYY  127

Query  464  ARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVR  643
                  +G+  + A  F+ WV EGTAPA    +RLY  L  LG   V L+G  +  R V 
Sbjct  128  RAH--GYGSEPFEANSFNEWVVEGTAPAFEASLRLYNALKKLGFTIVLLTGRDEHQRSVT  185

Query  644  IANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDN  820
              NL+  GYS WE+L+L+G  D  ++A  YKS++R++L+ +G++I GN GDQWSDLLG  
Sbjct  186  ETNLRDAGYSGWERLLLRGPEDQGKSATNYKSEQRSKLIGEGFKIRGNTGDQWSDLLGFA  245

Query  821  AGARTFKLPDPMYYI  865
               R+FK+P+PMYYI
Sbjct  246  VADRSFKVPNPMYYI  260



>ref|XP_010541530.1| PREDICTED: vegetative storage protein 2-like [Tarenaya hassleriana]
Length=262

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/246 (42%), Positives = 144/246 (59%), Gaps = 10/246 (4%)
 Frame = +2

Query  128  TIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYV  307
            T+P      + P+    LR         I   NC SW LGVE NNI ++  VP  CEEYV
Sbjct  24   TVPELIEQVTDPDMAEQLR-------LSISYPNCRSWHLGVETNNIINFKTVPANCEEYV  76

Query  308  GHYM-LGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAF  484
              Y+    QYR D   +   A  YAK   L +D  ++W+FD++ET LSN+P+Y  +   F
Sbjct  77   EDYLTFSDQYRADSKTICKEAYYYAKGLALKNDTVNVWIFDLDETLLSNIPFYQAN--GF  134

Query  485  GATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKT  664
            G  + ++  F+ W+S G AP +   + LY  L   GIKPV ++   ++ R++ ++NL+K 
Sbjct  135  GTESVDSEAFNKWISLGEAPVLGETLHLYNNLQKKGIKPVLITERYEELREITLSNLEKA  194

Query  665  GYSHWEKLILKGANDTRTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKL  844
            GY+ WEK I K        V YKSK+R +L + GY IIGNIGDQWSDL  ++AG RTFKL
Sbjct  195  GYTFWEKAIFKPTGSNAKIVNYKSKERKKLERGGYTIIGNIGDQWSDLQKESAGRRTFKL  254

Query  845  PDPMYY  862
            P+P+YY
Sbjct  255  PNPLYY  260



>ref|NP_001238459.1| stem 28 kDa glycoprotein precursor [Glycine max]
 sp|P15490.1|VSPA_SOYBN RecName: Full=Stem 28 kDa glycoprotein; AltName: Full=Vegetative 
storage protein A; Flags: Precursor [Glycine max]
 gb|AAA33937.1| 28 kDa protein [Glycine max]
 gb|AAA33967.1| vegetative storage protein [Glycine max]
 gb|ACU21079.1| unknown [Glycine max]
 prf||1609232B 28kD glycoprotein
 prf||1906374A vegetative storage protein
Length=254

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 121/265 (46%), Positives = 160/265 (60%), Gaps = 17/265 (6%)
 Frame = +2

Query  83   KLTMRAFLLVVVLLATIPTFSHA-DSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEAN  259
            K+ +  F +  +L+A      HA D  P     LR +T G G   P V C SWRL VEA+
Sbjct  2    KMKVLVFFVATILVAWQ---CHAYDMFP-----LRMNT-GYGARTPEVKCASWRLAVEAH  52

Query  260  NIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEET  439
            NI  +  +P++C E    Y+ G QYR D   V   A  YA++  L    KD +VF I+ T
Sbjct  53   NIFGFETIPEECVEATKEYIHGEQYRSDSKTVNQQAYFYARD--LEVHPKDTFVFSIDGT  110

Query  440  TLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGT  619
             LSN+PYY +    +G   +N+T +D WV++G APA+P  ++ Y  LVSLG K +FLSG 
Sbjct  111  VLSNIPYYKKH--GYGVEKFNSTLYDEWVNKGNAPALPETLKNYNKLVSLGFKIIFLSGR  168

Query  620  KQQFRKVRIANLKKTGYSHWEKLILKGANDTRT--AVEYKSKKRTELVKKGYRIIGNIGD  793
                + V  ANLKK GY  WEKLILK   D  T  AV YK+  R +L+++GY I+G IGD
Sbjct  169  TLDKQAVTEANLKKAGYHTWEKLILKDPQDPSTPNAVSYKTAAREKLIRQGYNIVGIIGD  228

Query  794  QWSDLLGDNAG-ARTFKLPDPMYYI  865
            QWSDLLG + G +RTFKLP+P+YYI
Sbjct  229  QWSDLLGGHRGESRTFKLPNPLYYI  253



>emb|CDY03376.1| BnaC01g17060D [Brassica napus]
Length=264

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/218 (46%), Positives = 137/218 (63%), Gaps = 4/218 (2%)
 Frame = +2

Query  218  GVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLA  397
             VNC SWR   E NN+  W  +P +C  YV  Y++G  Y  D   V+  A  YA +   +
Sbjct  48   NVNCTSWRFAAETNNLAPWKTIPAECAGYVKDYLMGRGYVVDLERVSEEANVYASSFGFS  107

Query  398  -HDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYR  574
              DGKD W+FDI+ET LSNLPYY       G   ++ TKFD WV +G APA+   ++LY 
Sbjct  108  GDDGKDTWIFDIDETLLSNLPYYLEH--GCGLEVFDHTKFDKWVEKGAAPAIAPSLKLYE  165

Query  575  TLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTE  751
             +  LG K + L+G ++  R + I NL   G+++W++LIL+  +D  +TA  +KS+KR E
Sbjct  166  KVKDLGYKVILLTGRRENHRVITIENLINAGFNNWDELILRSLDDDHKTATIFKSEKRDE  225

Query  752  LVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            +VK+GYRI GN GDQWSDLLG     R+FKLP+PMYYI
Sbjct  226  MVKEGYRIRGNSGDQWSDLLGSAMSQRSFKLPNPMYYI  263



>ref|XP_004964489.1| PREDICTED: acid phosphatase 1-like isoform X2 [Setaria italica]
Length=367

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/216 (49%), Positives = 134/216 (62%), Gaps = 5/216 (2%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            V C SWRL  EANN+  W  VP  C  +V  Y+ G  YR D   +A  +  YA+ A L  
Sbjct  155  VRCASWRLAAEANNLAPWKAVPAGCAAHVRDYIAGAAYRSDLDLIARESTTYARAAPLRG  214

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DG+D WVFDI+ET LSNLPYYA      G   ++  KFD WV  G A A+P  ++LY  +
Sbjct  215  DGRDAWVFDIDETLLSNLPYYAE----HGLELFDHQKFDRWVERGEALAIPSSLKLYNEV  270

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTELV  757
              LG K   L+G  +    +   NLKK G+  W+KLIL+ A D  +TA  YKS+KR  + 
Sbjct  271  RELGFKTFLLTGRSEGHLDITAENLKKQGFHDWDKLILREACDRKKTATVYKSEKRKAME  330

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            ++GYRI+GN GDQWSDLLG +  AR+FKLP+PMYYI
Sbjct  331  EEGYRILGNSGDQWSDLLGWSMSARSFKLPNPMYYI  366



>emb|CDY34346.1| BnaA01g14490D [Brassica napus]
Length=265

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/218 (46%), Positives = 137/218 (63%), Gaps = 4/218 (2%)
 Frame = +2

Query  218  GVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLA  397
             VNC SWR   E NN+  W  +P +C  YV  Y++G  Y  D   V+  A  YA +   +
Sbjct  49   NVNCTSWRFAAETNNLAPWKTIPAECAGYVKDYLMGRGYVVDLERVSEEANVYASSFGFS  108

Query  398  -HDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYR  574
              DGKD W+FDI+ET LSNLPYY       G   ++ TKFD WV +G APA+   ++LY 
Sbjct  109  GDDGKDTWIFDIDETLLSNLPYYLEH--GCGLEVFDHTKFDKWVEKGAAPAIAPSLKLYE  166

Query  575  TLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTE  751
             +  LG K + L+G ++  R + I NL   G+++W++LIL+  +D  +TA  +KS+KR E
Sbjct  167  KVKDLGYKVILLTGRRENHRVITIENLINAGFNNWDELILRSLDDDHKTATIFKSEKRDE  226

Query  752  LVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            +VK+GYRI GN GDQWSDLLG     R+FKLP+PMYYI
Sbjct  227  MVKEGYRIRGNSGDQWSDLLGSAMSQRSFKLPNPMYYI  264



>ref|XP_009138920.1| PREDICTED: acid phosphatase 1 [Brassica rapa]
Length=264

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/218 (46%), Positives = 137/218 (63%), Gaps = 4/218 (2%)
 Frame = +2

Query  218  GVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLA  397
             VNC SWR   E NN+  W  +P +C  YV  Y++G  Y  D   V+  A  YA +   +
Sbjct  48   NVNCTSWRFAAETNNLAPWKTIPAECAGYVKDYLMGRGYVVDLERVSEEANVYASSFGFS  107

Query  398  -HDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYR  574
              DGKD W+FDI+ET LSNLPYY       G   ++ TKFD WV +G APA+   ++LY 
Sbjct  108  GDDGKDTWIFDIDETLLSNLPYYLEH--GCGLEVFDHTKFDKWVEKGAAPAIAPSLKLYE  165

Query  575  TLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTE  751
             +  LG K + L+G ++  R + I NL   G+++W++LIL+  +D  +TA  +KS+KR E
Sbjct  166  KVKDLGYKVILLTGRRENHRVITIENLINAGFNNWDELILRSLDDDHKTATIFKSEKRDE  225

Query  752  LVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            +VK+GYRI GN GDQWSDLLG     R+FKLP+PMYYI
Sbjct  226  MVKEGYRIRGNSGDQWSDLLGSAMSQRSFKLPNPMYYI  263



>ref|NP_194656.1| HAD superfamily, subfamily IIIB acid phosphatase [Arabidopsis 
thaliana]
 emb|CAB79685.1| acid phosphatase-like protein [Arabidopsis thaliana]
 gb|AAM61010.1| acid phosphatase-like protein [Arabidopsis thaliana]
 gb|AAO44078.1| At4g29270 [Arabidopsis thaliana]
 dbj|BAE99747.1| acid phosphatase-like protein [Arabidopsis thaliana]
 gb|AEE85609.1| HAD superfamily, subfamily IIIB acid phosphatase [Arabidopsis 
thaliana]
Length=256

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/215 (45%), Positives = 138/215 (64%), Gaps = 3/215 (1%)
 Frame = +2

Query  227  CLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDG  406
            C SWRL  E NN+  W ++P QCE Y+ +Y+ G Q+  D   VA  A+ YAK   +  DG
Sbjct  44   CESWRLAAETNNVGPWKVIPSQCENYIKNYINGGQFDKDYDVVASYAIDYAKTVKVGGDG  103

Query  407  KDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVS  586
            KD WVFDI+ET LSN+ YY  +   +G+  Y++ K++  V +G  P     +RLY+ L  
Sbjct  104  KDAWVFDIDETLLSNIEYYKAN--GYGSEPYDSIKYNEVVEKGKDPGYDASLRLYKALKK  161

Query  587  LGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKK  763
            LG   + L+G  +  R V   NL+  GY  W +L+L+G ND  +TA +YKS++R+++VK+
Sbjct  162  LGFTIILLTGRDEGHRSVTEKNLRDAGYFGWNRLLLRGQNDQGKTATQYKSEQRSQVVKE  221

Query  764  GYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
            GY I GN GDQWSDLLG    +R+FK+P+PMYY+A
Sbjct  222  GYTIHGNTGDQWSDLLGFAVASRSFKVPNPMYYVA  256



>ref|XP_010249468.1| PREDICTED: acid phosphatase 1-like [Nelumbo nucifera]
Length=266

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/218 (47%), Positives = 133/218 (61%), Gaps = 3/218 (1%)
 Frame = +2

Query  218  GVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLA  397
            G+ C SWRL VE NN+  W  +PQ+C  ++  Y+ G  Y  D   VA S++ +A+   L+
Sbjct  51   GLFCDSWRLSVETNNVGFWKKIPQRCASFMKEYISGDHYASDSDVVAQSSLAFAETVELS  110

Query  398  HDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRT  577
             DGKD W+FDI+ET LSN PYY   D  FG   ++   F+ WV    AP +P   RLY+ 
Sbjct  111  GDGKDAWIFDIDETLLSNFPYYELHD--FGLQEFDERTFNVWVDMAEAPPLPPSQRLYKQ  168

Query  578  LVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTEL  754
            L  LG   + L+G  +  R     NL   GY  WEKLIL+G +D  + A+ YKS+KR EL
Sbjct  169  LQQLGFTLILLTGRSEAQRDATEKNLLVAGYHSWEKLILRGPSDQGKPAIIYKSEKRMEL  228

Query  755  VKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
              +GYRI G+ GDQWSDLLG     R+FKLP+PMYYIA
Sbjct  229  EAEGYRIHGSSGDQWSDLLGFAMAKRSFKLPNPMYYIA  266



>ref|XP_009352576.1| PREDICTED: acid phosphatase 1 [Pyrus x bretschneideri]
Length=258

 Score =   206 bits (524),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 134/215 (62%), Gaps = 3/215 (1%)
 Frame = +2

Query  227  CLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDG  406
            C SWR  VE N+   W+ +P +C  +V +YM G +Y  D  AVA  ++ +AK  T+  DG
Sbjct  46   CDSWRFSVETNDAGTWSNIPSRCVGFVQNYMTGDRYLSDSAAVANFSLSFAKGVTIGGDG  105

Query  407  KDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVS  586
            KD WVFDI+ET LSNLPYY      FG+  ++   FD WV    APA+P  + LY  L  
Sbjct  106  KDAWVFDIDETLLSNLPYYQAH--GFGSETFDEASFDEWVELAEAPALPASLNLYSQLER  163

Query  587  LGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDTRT-AVEYKSKKRTELVKK  763
            LG K   L+G  +  R     NL   GY++WE+L+L+G +D  T A  +KS+KR+ L+ +
Sbjct  164  LGFKIFLLTGRSEYQRNATAKNLLVAGYNNWERLLLRGPSDQGTLATVFKSQKRSNLINE  223

Query  764  GYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
            GYRI G+ GDQWSDL+G     R+FKLP+PMYYIA
Sbjct  224  GYRIHGSSGDQWSDLVGFAIAQRSFKLPNPMYYIA  258



>gb|ADE76411.1| unknown [Picea sitchensis]
Length=254

 Score =   206 bits (524),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/216 (46%), Positives = 138/216 (64%), Gaps = 4/216 (2%)
 Frame = +2

Query  227  CLSWRLGVEANNIRDWAMVPQQCEEYVGHYML-GHQYRDDCIAVAISAVQYAKNATLAHD  403
            C  WRL VE+ N+RDW +VP +C  YV  YM+   QY +D      + ++Y K   L  D
Sbjct  41   CEGWRLSVESGNLRDWDVVPSKCVGYVQKYMMTAGQYWEDSKVAVFTILEYVKTLKLVGD  100

Query  404  GKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLV  583
            GKD WVFDI+ET LSN+PYY + +  +G  A+++  F+AWV E  +PA+P  + LY  L+
Sbjct  101  GKDAWVFDIDETLLSNIPYYQQHE--YGGKAFDSKTFEAWVLEMKSPALPSSLLLYNRLL  158

Query  584  SLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDTRT-AVEYKSKKRTELVK  760
            + G K   L+G  +  R   + NL + GY  W  LIL+G N+  + A  YK +KR ELVK
Sbjct  159  ARGFKIFLLTGRDESQRNGTVHNLFQAGYKGWAGLILRGVNEQGSQASAYKPEKRAELVK  218

Query  761  KGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
            KGYR+ G++GDQWSDL G    +R+FKLP+PMYYI+
Sbjct  219  KGYRLWGSVGDQWSDLSGPYEASRSFKLPNPMYYIS  254



>ref|XP_002867418.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43677.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=256

 Score =   206 bits (523),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 101/214 (47%), Positives = 133/214 (62%), Gaps = 3/214 (1%)
 Frame = +2

Query  227  CLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDG  406
            C SWRL  E NN   W +VP QCE YV +Y+   Q+  D   VA  A+ YAK   L  DG
Sbjct  44   CESWRLAAETNNAGTWKVVPSQCENYVKNYISEGQFDKDYDLVASYAIAYAKTVKLGRDG  103

Query  407  KDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVS  586
            KD WVFDI+ET LSN+ YY      +G+  Y+ T F+ WV +GTAP     +RLY+ L  
Sbjct  104  KDAWVFDIDETLLSNIEYYKAH--GYGSQPYDNTLFNEWVVKGTAPGFDASLRLYKALKK  161

Query  587  LGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKK  763
            LG   + L+G  +  R +   NL+  GY  W +L+L+G ND  + A  YKS++R+++VK+
Sbjct  162  LGFTIILLTGRDESQRSITEKNLRDAGYFGWNRLLLRGKNDQGKAATLYKSEQRSKVVKE  221

Query  764  GYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            GY I GN GDQWSDL G    AR+FK+P+PMYYI
Sbjct  222  GYTIHGNTGDQWSDLQGFAVAARSFKVPNPMYYI  255



>ref|XP_006413336.1| hypothetical protein EUTSA_v10026026mg [Eutrema salsugineum]
 gb|ESQ54789.1| hypothetical protein EUTSA_v10026026mg [Eutrema salsugineum]
Length=258

 Score =   206 bits (523),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 98/217 (45%), Positives = 134/217 (62%), Gaps = 3/217 (1%)
 Frame = +2

Query  218  GVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLA  397
             V+C SWR   E NN+  W  +P +C +YV  Y++G  Y  D   V+  A  YA      
Sbjct  43   NVHCTSWRFAAETNNLAPWKTIPPECADYVKDYLMGKGYVADLERVSEEAWVYASTFEFP  102

Query  398  HDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRT  577
             DGKD WVFDI+ET LSNLPYY       G   +N  +FD WV +G APA+   ++LY+ 
Sbjct  103  GDGKDTWVFDIDETLLSNLPYYLEH--GCGLEVFNHVEFDKWVEKGVAPAIAPSLKLYQK  160

Query  578  LVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAN-DTRTAVEYKSKKRTEL  754
            +  LG K + L+G +++ + V + NL   G+  W++LIL+  +   +TA  YKS++R E+
Sbjct  161  VKDLGYKVILLTGRREKHKVVTVENLLNAGFHSWDELILRSLDGQNKTATIYKSEQRDEM  220

Query  755  VKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            VK+GYRI GN GDQWSDLLG     R+FKLP+PMYYI
Sbjct  221  VKEGYRIRGNSGDQWSDLLGSAMSERSFKLPNPMYYI  257



>ref|XP_008367917.1| PREDICTED: acid phosphatase 1-like [Malus domestica]
Length=259

 Score =   206 bits (523),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 135/215 (63%), Gaps = 3/215 (1%)
 Frame = +2

Query  227  CLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDG  406
            C SWR  VE N+   W+ +P +C  +V +YM G +Y  D  AVA  ++ +AK  T+  DG
Sbjct  47   CDSWRFSVETNDAGTWSNIPSRCVGFVQNYMTGARYPSDSAAVANFSLSFAKGVTIGGDG  106

Query  407  KDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVS  586
            KD WVFDI+ET LSNLPYY      FG+  ++   FD WV    APA+P  + LY  L  
Sbjct  107  KDAWVFDIDETLLSNLPYYQAH--GFGSETFDEASFDEWVELAEAPALPASLNLYSQLER  164

Query  587  LGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDTRT-AVEYKSKKRTELVKK  763
            LG K   L+G  +  R     NL   GY++WE+L+L+G +D  T A  +KS+KR++L+ +
Sbjct  165  LGFKIFLLTGRSEYQRNATAKNLLFAGYNNWERLLLRGPSDQGTLATVFKSQKRSDLINE  224

Query  764  GYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
            GYRI G+ GDQWSDL+G     R+FKLP+PMYYIA
Sbjct  225  GYRIHGSSGDQWSDLVGFAIAQRSFKLPNPMYYIA  259



>ref|XP_010258707.1| PREDICTED: acid phosphatase 1-like [Nelumbo nucifera]
Length=294

 Score =   207 bits (526),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 123/169 (73%), Gaps = 3/169 (2%)
 Frame = +2

Query  365  AVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAP  544
            A+ YA+N  L  DGKD+W+FDI+ET LSNLPYYAR    FG   +N+T F+ WV+ G AP
Sbjct  128  AILYAENLKLTRDGKDVWIFDIDETILSNLPYYARH--GFGVEPFNSTLFNEWVNTGEAP  185

Query  545  AVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILK-GANDTRTA  721
             +P  +RLYR L+SLG+K VFL+G  +  RK    NLKK G+  WEKLILK  +N   TA
Sbjct  186  PLPESLRLYRKLLSLGLKIVFLTGRSEDQRKATSTNLKKAGFHTWEKLILKKSSNQGTTA  245

Query  722  VEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
            V YKS +R  L + GYRI+GNIGDQWSD+LG+N G RTFKLPDPMYY++
Sbjct  246  VVYKSGERKTLEESGYRIVGNIGDQWSDILGNNTGNRTFKLPDPMYYLS  294



>dbj|BAJ97988.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK01226.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=279

 Score =   206 bits (524),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 106/223 (48%), Positives = 141/223 (63%), Gaps = 3/223 (1%)
 Frame = +2

Query  200  GGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYA  379
            GG     + C SWR   EANN+  WA VP  C  +V  Y+ G  YR D   VA  A  YA
Sbjct  58   GGDEAVELRCASWRTAGEANNLSPWAAVPPDCVPHVRAYLTGPAYRSDLDLVAREASAYA  117

Query  380  KNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGG  559
            ++A  +      WVFD++ET LSNLPYYA+    +G   ++  +FD WV  G APA+P  
Sbjct  118  RSAAASTGDAAAWVFDVDETLLSNLPYYAQH--GYGLELFDHREFDRWVETGEAPAIPSS  175

Query  560  VRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKS  736
            +RLYR +  LG K   L+G  +  + V + NL+K G+  W+KLIL+ A D T+TA +YKS
Sbjct  176  LRLYREVRDLGFKTFLLTGRSEAHQGVTVDNLRKQGFHDWDKLILRAAADRTKTATDYKS  235

Query  737  KKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            +KR E+  +GY+I+GN GDQWSDLLG +  AR+FKLP+PMYYI
Sbjct  236  EKRKEMEAEGYKILGNSGDQWSDLLGYSMSARSFKLPNPMYYI  278



>ref|XP_007202474.1| hypothetical protein PRUPE_ppa010268mg [Prunus persica]
 gb|EMJ03673.1| hypothetical protein PRUPE_ppa010268mg [Prunus persica]
Length=256

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/224 (45%), Positives = 135/224 (60%), Gaps = 5/224 (2%)
 Frame = +2

Query  206  HHIPGVN--CLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYA  379
            H I   N  C SWR  VE N+   W  +P +C  +V  YM G +Y  D  AVA  ++ +A
Sbjct  35   HRITDDNLYCDSWRFSVETNDAGTWTSIPSRCVAFVQDYMTGDRYLSDSAAVANYSLSFA  94

Query  380  KNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGG  559
            +   +  DGKD WVFDI+ET LSN PYY      FG+  ++   FD WV    APA+P  
Sbjct  95   RGVQIGGDGKDAWVFDIDETLLSNFPYYQAH--GFGSETFDEASFDEWVDLAKAPALPAS  152

Query  560  VRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKS  736
            ++LY+ L  LG K   L+G  +  R     NL    Y++WE+L+L+G +D   TA  YKS
Sbjct  153  LKLYKELQELGFKIFLLTGRSEHQRNATAKNLLYARYNNWERLLLRGPSDQGTTATVYKS  212

Query  737  KKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
            +KR++L+ +GYRI G+ GDQWSDLLG     R+FKLP+PMYYIA
Sbjct  213  EKRSDLINEGYRIHGSSGDQWSDLLGFAVAQRSFKLPNPMYYIA  256



>ref|XP_010448471.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=270

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/216 (44%), Positives = 137/216 (63%), Gaps = 3/216 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            ++C SWR   E NN+  W  +P +C +YV  Y++   Y  D   V+  A  YA +     
Sbjct  56   LHCTSWRFAAETNNLAPWKTIPVECADYVKDYLMDKGYVFDMERVSEEAEVYASSFESNG  115

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DGKD+W+FDI+ET LSNLPYY       G   +N +KFD WV +G APA+   ++LY+ +
Sbjct  116  DGKDVWIFDIDETLLSNLPYYLEH--GCGLEVFNHSKFDKWVEKGIAPAIAPSLKLYQMV  173

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELV  757
              +G K + L+G ++  R V + NL+  G+ +W+KLIL+  +D  +TA  +KS+KR E++
Sbjct  174  QDMGYKIILLTGRRENHRVVTVENLRNAGFHNWDKLILRSMDDDHKTATIFKSEKRDEMM  233

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
             +GYRI GN GDQWSDLLG     R+FKLP+PMYYI
Sbjct  234  DEGYRIRGNSGDQWSDLLGYAMSERSFKLPNPMYYI  269



>ref|XP_009109048.1| PREDICTED: acid phosphatase 1-like isoform X2 [Brassica rapa]
Length=262

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/240 (42%), Positives = 144/240 (60%), Gaps = 4/240 (2%)
 Frame = +2

Query  149  ADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGH  328
            A SI   I  L P + G         C SWRL VE NN   W ++P  C + V  Y+ G 
Sbjct  25   ATSIRTSIIKL-PRSDGSRSTAADTYCESWRLAVETNNAGTWGVLPSSCVDSVARYLNGD  83

Query  329  QYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNAT  508
            QY  D   +   A+ +AK   ++ DGKD+W+FDI+ET L+N+ YY      +G+  +++ 
Sbjct  84   QYGSDYDVIVDYALAFAKTVKISGDGKDVWIFDIDETLLTNIGYYKNH--GYGSEPFDSK  141

Query  509  KFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKL  688
             F+ WV +GTAPA    +R+Y  L  LG   V L+G  +  R V   NL+  GYS WE+L
Sbjct  142  SFNEWVVQGTAPAFAASLRMYNALKKLGFTIVLLTGRDEDQRNVTEKNLRDVGYSGWERL  201

Query  689  ILKGANDT-RTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            IL+G +D  ++A  YKS++R++L+ +G++I GN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  202  ILRGPDDQGKSATNYKSEQRSKLIDQGFKIHGNTGDQWSDLLGFAVADRSFKVPNPMYYI  261



>ref|XP_010925513.1| PREDICTED: acid phosphatase 1-like isoform X1 [Elaeis guineensis]
Length=256

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/215 (46%), Positives = 135/215 (63%), Gaps = 5/215 (2%)
 Frame = +2

Query  227  CLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDG  406
            C SWRL VE NN   W  +P +C ++V  YM G +Y  D   VA  ++ +A+   +A DG
Sbjct  44   CDSWRLSVETNNAGYWETIPARCLQFVAEYMNGERYASDSDVVAAESLAFAQTVQVAGDG  103

Query  407  KDIWVFDIEETTLSNLPYYARSDV-AFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLV  583
            KD+W+FD++ET LSN+PYY   DV  +G   +N T FD WV+   APA+   +RLY  L+
Sbjct  104  KDVWIFDVDETLLSNVPYY---DVHGYGWEEFNETAFDEWVNLAKAPALQASLRLYEELL  160

Query  584  SLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVK  760
             LG + + L+G  +  R     NL   GY  W++ IL+ A+D  + AV YKS++R +L  
Sbjct  161  GLGFQMILLTGRAEAQRNATEKNLSFVGYHSWKRFILREASDIGKKAVTYKSERRAQLEA  220

Query  761  KGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            +GYRI GN GDQWSDLLG     R+FKLP+PMYYI
Sbjct  221  QGYRIHGNSGDQWSDLLGSPMAMRSFKLPNPMYYI  255



>ref|XP_008242463.1| PREDICTED: acid phosphatase 1 [Prunus mume]
Length=256

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/224 (45%), Positives = 136/224 (61%), Gaps = 5/224 (2%)
 Frame = +2

Query  206  HHIPGVN--CLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYA  379
            H I   N  C SWR  +E N+   W  +P +C  +V  YM G +Y  D  AV+  ++ +A
Sbjct  35   HRITDDNLYCDSWRFSIETNDAGTWTSIPSRCVAFVQDYMTGDRYLSDSAAVSNYSLSFA  94

Query  380  KNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGG  559
            +   +  DGKD WVFDI+ET LSNLPYY      FG+  ++   FD WV    APA+P  
Sbjct  95   RGVQIGGDGKDAWVFDIDETLLSNLPYYEAH--GFGSETFDEASFDEWVDLAKAPALPAS  152

Query  560  VRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKS  736
            ++LY+ L  LG K   L+G  +  R     NL    Y++WE+L+L+G +D   TA  YKS
Sbjct  153  LKLYKELQQLGFKIFLLTGRSEHQRNATAKNLLYARYNNWERLLLRGPSDQGTTATVYKS  212

Query  737  KKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
            +KR++L+ +GYRI G+ GDQWSDLLG     R+FKLP+PMYYIA
Sbjct  213  EKRSDLINEGYRIHGSSGDQWSDLLGFAVAQRSFKLPNPMYYIA  256



>gb|ACU23829.1| unknown [Glycine max]
Length=254

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 119/265 (45%), Positives = 158/265 (60%), Gaps = 17/265 (6%)
 Frame = +2

Query  83   KLTMRAFLLVVVLLATIPTFSHA-DSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEAN  259
            K+ +  F +  +L+A      HA D  P     LR +T G G   P V C SWRL VEA+
Sbjct  2    KMKVLVFFVATILVAWQ---CHAYDMFP-----LRMNT-GYGARTPEVKCASWRLAVEAH  52

Query  260  NIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEET  439
            NI  +  +P++C E    Y+ G QYR D   V   A  YA++  L    KD +VF I+ T
Sbjct  53   NIFGFETIPEECVEATKEYIHGEQYRSDSKTVNQQAYFYARD--LEVHPKDTFVFSIDGT  110

Query  440  TLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGT  619
             LSN+PYY +    +G   +N+T +D WV++G APA+P  ++ Y  LVSLG K +FLSG 
Sbjct  111  VLSNIPYYKKH--GYGVEKFNSTLYDEWVNKGNAPALPETLKNYNKLVSLGFKIIFLSGR  168

Query  620  KQQFRKVRIANLKKTGYSHWEKLILKGANDTRT--AVEYKSKKRTELVKKGYRIIGNIGD  793
                + V  ANLKK GY  WEKLI K   D  T  AV YK+  R +L+++GY I+G IGD
Sbjct  169  TLDKQAVTEANLKKAGYHTWEKLIFKDPQDPSTPNAVSYKTAGREKLIRQGYNIVGIIGD  228

Query  794  QWSDLLGDNAG-ARTFKLPDPMYYI  865
            QWSD LG + G +RTFKLP+P+YYI
Sbjct  229  QWSDFLGGHRGESRTFKLPNPLYYI  253



>ref|XP_007012979.1| HAD superfamily isoform 2 [Theobroma cacao]
 gb|EOY30598.1| HAD superfamily isoform 2 [Theobroma cacao]
Length=258

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 132/215 (61%), Gaps = 3/215 (1%)
 Frame = +2

Query  227  CLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDG  406
            C SW L VE NN   W  +P +CE +V  YM G +Y  D   VA  ++ YA +  +  DG
Sbjct  46   CASWHLSVETNNAGSWKQIPIRCESFVQDYMTGPRYMSDSEIVANYSLAYASSVEIGRDG  105

Query  407  KDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVS  586
            KD WVFDI+ET L+NLPYY      FG+  ++   +D WV    APA+P  ++LY  L  
Sbjct  106  KDAWVFDIDETLLTNLPYYQAH--GFGSEPFDENSWDVWVDLAEAPAIPASLKLYNELKQ  163

Query  587  LGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDTRT-AVEYKSKKRTELVKK  763
            +G K   L+G  +  R     NL   GY+ WE+LIL+G +D  T A  YKS+KR++LV +
Sbjct  164  MGFKIFVLTGRSENQRNATGKNLLFAGYTDWERLILRGPSDDGTLATVYKSEKRSDLVNE  223

Query  764  GYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
            GYRI G+ GDQWSDLLG     R+FKLP+PMYYI+
Sbjct  224  GYRIHGSSGDQWSDLLGFAVAKRSFKLPNPMYYIS  258



>gb|ABL85037.1| acid phosphatase [Brachypodium sylvaticum]
Length=248

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/218 (48%), Positives = 140/218 (64%), Gaps = 5/218 (2%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDC--IAVAISAVQYAKNATL  394
              C SWR+  EANN+  W+ VP +C  +V  Y+ G  YR D   +A   SA   A  A+ 
Sbjct  32   ARCASWRVAGEANNLAPWSAVPAECAAHVRRYVTGPAYRSDLELVAREASAYARALAASG  91

Query  395  AHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYR  574
            A    D WVFD++ET LSNLPYYA  D  +G   ++  +FD WV +G APA+P  +RLY+
Sbjct  92   ADRAADAWVFDVDETLLSNLPYYA--DHGYGLELFDHREFDRWVEKGEAPAIPSSLRLYK  149

Query  575  TLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND-TRTAVEYKSKKRTE  751
             +  LG K   L+G  +  + V + NLKK G+  W++LIL+ A D T+TA  YKS+KR E
Sbjct  150  EVRDLGFKTFLLTGRSEGHQGVTVDNLKKQGFHDWDRLILRAAADRTKTATAYKSEKRKE  209

Query  752  LVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            +  +GY+I+GN GDQWSDLLG +  AR+FKLP+PMYYI
Sbjct  210  MEAEGYKILGNSGDQWSDLLGYSMSARSFKLPNPMYYI  247



>ref|XP_006412859.1| hypothetical protein EUTSA_v10026000mg [Eutrema salsugineum]
 gb|ESQ54312.1| hypothetical protein EUTSA_v10026000mg [Eutrema salsugineum]
Length=263

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/257 (39%), Positives = 151/257 (59%), Gaps = 6/257 (2%)
 Frame = +2

Query  104  LLVVVLLATIPTF--SHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEANNIRDWA  277
            L +   + ++ TF  + A+S+   +  L P + G         C SWRL  E NN   W 
Sbjct  9    LSITFFVLSLFTFLINSANSLRTSVIKL-PESDGSRSAAADTYCESWRLAAETNNAGTWD  67

Query  278  MVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLP  457
            ++P  C + V  Y+ G QY  D   +A  A+ +AK   ++ DG D+W+FDI+ET L+N+ 
Sbjct  68   VIPSMCIDSVSEYVNGDQYGSDYGVIADYALAFAKTVQISGDGNDVWIFDIDETLLTNID  127

Query  458  YYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRK  637
            YY      +G+  + ++ F+ W  +GTAPA    +RLY  L  LG   + L+G  +  R 
Sbjct  128  YYRAH--GYGSEPFESSSFNEWAVQGTAPAFDASLRLYNALKKLGFTIILLTGRDEDQRS  185

Query  638  VRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLG  814
            V   NL+  GYS WE+L+L+G  D  ++A  YKS++R++L++KG+RI GN GDQWSDLLG
Sbjct  186  VTETNLRDAGYSGWERLLLRGPGDQGKSATNYKSEQRSKLIEKGFRIHGNTGDQWSDLLG  245

Query  815  DNAGARTFKLPDPMYYI  865
                 R+FK+P+PMYYI
Sbjct  246  FAVADRSFKVPNPMYYI  262



>ref|XP_004158153.1| PREDICTED: acid phosphatase 1-like [Cucumis sativus]
Length=264

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/217 (45%), Positives = 137/217 (63%), Gaps = 5/217 (2%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            + C SWR  VEANN+  W  +P+ C EYV  Y+ G  Y+ +    +  A  +AK   L  
Sbjct  52   LRCDSWRFNVEANNLNPWKRIPESCSEYVKQYVTGRAYQLELEIASNEAQVFAKTVKLVG  111

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DGKD+WVFDI+ET LSNLPYY  +D  +G       +FD WV + TAP +   +  Y+ L
Sbjct  112  DGKDVWVFDIDETLLSNLPYY--TDHGYGGLG--PDEFDNWVEKATAPPLQPSLEFYKEL  167

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELV  757
            + LG K V L+G  ++ R+    NL   G+  W++LIL+  +D  ++A+ YKS+KR+E+ 
Sbjct  168  LDLGFKLVLLTGRSEKQRECTTRNLINAGFYDWDRLILRRDDDQGKSAILYKSEKRSEME  227

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
             +G RIIGN GDQWSDLLG +   R+FKLP+PMYYI+
Sbjct  228  NEGLRIIGNSGDQWSDLLGTSVSVRSFKLPNPMYYIS  264



>gb|EMT19714.1| Acid phosphatase 1 [Aegilops tauschii]
Length=332

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 120/295 (41%), Positives = 157/295 (53%), Gaps = 59/295 (20%)
 Frame = +2

Query  152  DSIPNQIHSLRPHTAGGGHHIPGVN--CLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLG  325
            +++   IH+LRP    GG         C SWRLGVEA+N+RDW  VP  CE +VGHYMLG
Sbjct  39   EAVAPLIHALRPLLGSGGQLGSLGGLACDSWRLGVEAHNVRDWKTVPASCEGHVGHYMLG  98

Query  326  HQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNA  505
              YR D   V   A+ Y  +  LA +GK++WVFD++ETTLSNLPYYA     FGAT YN 
Sbjct  99   GHYRRDSKLVIDQAISYVDSLKLAGNGKEVWVFDVDETTLSNLPYYATH--GFGATPYNW  156

Query  506  TKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGTKQQFRKV--RIANLKKTGYSHW  679
            T F  +  + +APA+P   RLY  L+S+GIKPV L+G ++  R V  R      T +  +
Sbjct  157  TSFQEYARQASAPALPETKRLYNKLLSVGIKPVILTGRRELTRMVDNRATPYNWTSFQEY  216

Query  680  EK------------------------LILKGANDTR------------------------  715
             +                        +IL G  + +                        
Sbjct  217  ARQASAPALPETKRLYNKLLSVGIKPVILTGRREAQRTPATITTLRRQGFSGSMAVLLKP  276

Query  716  -----TAVEYKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
                 ++V +KS +R +L+  GY I+GNIGDQWSD+LG   GARTFKLPDPMYYI
Sbjct  277  AEFKGSSVTFKSGERQKLLDAGYVIVGNIGDQWSDILGTPEGARTFKLPDPMYYI  331



>ref|XP_010925515.1| PREDICTED: acid phosphatase 1-like isoform X2 [Elaeis guineensis]
Length=254

 Score =   203 bits (517),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 134/214 (63%), Gaps = 5/214 (2%)
 Frame = +2

Query  227  CLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDG  406
            C SWRL VE NN   W  +P +C ++V  YM G +Y  D   VA  ++ +A+   +A DG
Sbjct  44   CDSWRLSVETNNAGYWETIPARCLQFVAEYMNGERYASDSDVVAAESLAFAQTVQVAGDG  103

Query  407  KDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVS  586
            KD+W+FD++ET LSN+PYY   DV  G   +N T FD WV+   APA+   +RLY  L+ 
Sbjct  104  KDVWIFDVDETLLSNVPYY---DV-HGWEEFNETAFDEWVNLAKAPALQASLRLYEELLG  159

Query  587  LGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKK  763
            LG + + L+G  +  R     NL   GY  W++ IL+ A+D  + AV YKS++R +L  +
Sbjct  160  LGFQMILLTGRAEAQRNATEKNLSFVGYHSWKRFILREASDIGKKAVTYKSERRAQLEAQ  219

Query  764  GYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            GYRI GN GDQWSDLLG     R+FKLP+PMYYI
Sbjct  220  GYRIHGNSGDQWSDLLGSPMAMRSFKLPNPMYYI  253



>prf||1609232A 31kD glycoprotein
Length=257

 Score =   203 bits (516),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 108/227 (48%), Positives = 143/227 (63%), Gaps = 7/227 (3%)
 Frame = +2

Query  194  AGGGHHIPGVNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQ  373
             G G     V C S+RL VEA+NIR +  +P++C E    Y+ G Q+R D   V   A  
Sbjct  34   TGYGERSSEVKCASFRLAVEAHNIRAFKTIPEECVEPTKDYINGEQFRSDSKTVNQQAFF  93

Query  374  YAKNATLAHDGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVP  553
            YA    + H+  DI++F I+ T LSN+PYY +    +G   +N T +D WV++G APA+P
Sbjct  94   YASEREVHHN--DIFIFGIDNTVLSNIPYYEKH--GYGVEEFNETLYDEWVNKGDAPALP  149

Query  554  GGVRLYRTLVSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGAND--TRTAVE  727
              ++ Y  L+SLG K VFLSG       V  ANLKK G+  WE+LILK  +D  T  A+ 
Sbjct  150  ETLKNYNKLLSLGFKIVFLSGRYLDKMAVTEANLKKAGFHTWEQLILKDPHDLITPNALS  209

Query  728  YKSKKRTELVKKGYRIIGNIGDQWSDLLGDNAG-ARTFKLPDPMYYI  865
            YKS  R  L+++GYRI+G IGDQWSDLLGD+ G +RTFKLP+PMYYI
Sbjct  210  YKSAMRENLLRQGYRIVGIIGDQWSDLLGDHRGESRTFKLPNPMYYI  256



>ref|XP_007012978.1| HAD superfamily isoform 1 [Theobroma cacao]
 gb|EOY30597.1| HAD superfamily isoform 1 [Theobroma cacao]
Length=323

 Score =   205 bits (521),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 132/215 (61%), Gaps = 3/215 (1%)
 Frame = +2

Query  227  CLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDG  406
            C SW L VE NN   W  +P +CE +V  YM G +Y  D   VA  ++ YA +  +  DG
Sbjct  111  CASWHLSVETNNAGSWKQIPIRCESFVQDYMTGPRYMSDSEIVANYSLAYASSVEIGRDG  170

Query  407  KDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVS  586
            KD WVFDI+ET L+NLPYY      FG+  ++   +D WV    APA+P  ++LY  L  
Sbjct  171  KDAWVFDIDETLLTNLPYYQAH--GFGSEPFDENSWDVWVDLAEAPAIPASLKLYNELKQ  228

Query  587  LGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDTRT-AVEYKSKKRTELVKK  763
            +G K   L+G  +  R     NL   GY+ WE+LIL+G +D  T A  YKS+KR++LV +
Sbjct  229  MGFKIFVLTGRSENQRNATGKNLLFAGYTDWERLILRGPSDDGTLATVYKSEKRSDLVNE  288

Query  764  GYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYIA  868
            GYRI G+ GDQWSDLLG     R+FKLP+PMYYI+
Sbjct  289  GYRIHGSSGDQWSDLLGFAVAKRSFKLPNPMYYIS  323



>ref|XP_002867419.1| acid phosphatase class B family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43678.1| acid phosphatase class B family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=253

 Score =   202 bits (515),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 135/214 (63%), Gaps = 3/214 (1%)
 Frame = +2

Query  227  CLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDG  406
            C SWRL  E NN   W ++P  C + V  Y+ G Q+R D   +A  A+ +AK+  ++ DG
Sbjct  41   CDSWRLAAETNNAGTWDVIPSICVDSVAEYLNGDQFRSDYDVIADYALAFAKSVEISGDG  100

Query  407  KDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVS  586
            KD+W+FDI+ET L+N+ YY      +G+  Y+   F  WV +GTAPA    +RLY  L  
Sbjct  101  KDVWIFDIDETLLTNIDYYKAH--GYGSEPYDNNSFSEWVEQGTAPAFDASLRLYNALKK  158

Query  587  LGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKK  763
             G   + L+G  +  R     NL+  GYS WE+L+L+G ND  ++A  YKS++R++L+++
Sbjct  159  FGFTIILLTGRDEDQRSSTETNLRDAGYSGWERLLLRGPNDQGKSATNYKSEQRSKLIQE  218

Query  764  GYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
            G++I GN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  219  GFKIRGNSGDQWSDLLGFAVADRSFKVPNPMYYI  252



>gb|KFK29483.1| hypothetical protein AALP_AA7G140100 [Arabis alpina]
Length=257

 Score =   202 bits (515),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 103/263 (39%), Positives = 151/263 (57%), Gaps = 13/263 (5%)
 Frame = +2

Query  80   RKLTMRAFLLVVVLLATIPTFSHADSIPNQIHSLRPHTAGGGHHIPGVNCLSWRLGVEAN  259
            R L++  F+L++     IP  S   S         P + G         C SWRL  E N
Sbjct  6    RSLSISFFVLLI-----IPIISARTSFIKL-----PGSDGSRSAATNTYCESWRLAAETN  55

Query  260  NIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAHDGKDIWVFDIEET  439
            N+  W ++P  C + V  Y+ G QY  D   +A  A+ +AK   ++ DGKD+W+FDI+ET
Sbjct  56   NVGTWDVIPSICVDSVSEYLNGDQYGSDYGVIADYALAFAKTVQISGDGKDVWIFDIDET  115

Query  440  TLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTLVSLGIKPVFLSGT  619
             L+N+ YY      +G+  Y++  ++ WV +GTAPA    +RLY  L  LG   V L+G 
Sbjct  116  LLTNIDYYKAH--GYGSIPYDSNSYNEWVVQGTAPAFDASLRLYNALKKLGFTIVLLTGR  173

Query  620  KQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELVKKGYRIIGNIGDQ  796
             +  R V   NL+  GY  WE+L+L+G  D  ++A  YKS++R++L+ +G++I GN GDQ
Sbjct  174  DEDQRSVTEKNLRDAGYLDWERLLLRGREDQGKSATNYKSEQRSKLIVEGFKIHGNTGDQ  233

Query  797  WSDLLGDNAGARTFKLPDPMYYI  865
            WSDLLG     R+FK+P+PMYYI
Sbjct  234  WSDLLGFAVAVRSFKVPNPMYYI  256



>gb|ABK92831.1| unknown [Populus trichocarpa]
Length=247

 Score =   202 bits (514),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 101/216 (47%), Positives = 129/216 (60%), Gaps = 3/216 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            V C  WR  VE N++  W  VP +C  YV  YM G  YR D    A  A+ +AK   +A 
Sbjct  33   VYCNGWRFSVETNDVGYWDHVPSRCVSYVQDYMTGDGYRSDSEVAASYALGFAKTVEIAG  92

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DGKD WVFD++ET LSNLPYYA     FG+  ++   FD WV    APA+   + LY+ L
Sbjct  93   DGKDAWVFDVDETLLSNLPYYAVH--GFGSEPFDELSFDEWVDLAEAPALQASLNLYKEL  150

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELV  757
              LG     L+G  +  R     NL+  GYS WE+LIL+ ++D  + A  YKS++R ELV
Sbjct  151  KQLGFTVFMLTGRSEHQRNATAKNLQLEGYSDWERLILRESSDQGKPATFYKSQRRLELV  210

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
             +GYRI GN GDQWSDL G     R+FKLP+P+YYI
Sbjct  211  NEGYRIHGNSGDQWSDLFGFAVSERSFKLPNPLYYI  246



>ref|XP_002309231.2| hypothetical protein POPTR_0006s15760g [Populus trichocarpa]
 gb|EEE92754.2| hypothetical protein POPTR_0006s15760g [Populus trichocarpa]
Length=247

 Score =   202 bits (514),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 101/216 (47%), Positives = 129/216 (60%), Gaps = 3/216 (1%)
 Frame = +2

Query  221  VNCLSWRLGVEANNIRDWAMVPQQCEEYVGHYMLGHQYRDDCIAVAISAVQYAKNATLAH  400
            V C  WR  VE N++  W  VP +C  YV  YM G  YR D    A  A+ +AK   +A 
Sbjct  33   VYCNGWRFSVETNDVGYWDHVPSRCVSYVQDYMTGDGYRSDSEVAASYALGFAKTVEIAG  92

Query  401  DGKDIWVFDIEETTLSNLPYYARSDVAFGATAYNATKFDAWVSEGTAPAVPGGVRLYRTL  580
            DGKD WVFD++ET LSNLPYYA     FG+  ++   FD WV    APA+   + LY+ L
Sbjct  93   DGKDAWVFDVDETLLSNLPYYAVH--GFGSEPFDELSFDEWVDLAKAPALQASLNLYKEL  150

Query  581  VSLGIKPVFLSGTKQQFRKVRIANLKKTGYSHWEKLILKGANDT-RTAVEYKSKKRTELV  757
              LG     L+G  +  R     NL+  GYS WE+LIL+ ++D  + A  YKS++R ELV
Sbjct  151  KQLGFTVFMLTGRSEHQRNATAKNLQLEGYSDWERLILRESSDQGKPATFYKSQRRLELV  210

Query  758  KKGYRIIGNIGDQWSDLLGDNAGARTFKLPDPMYYI  865
             +GYRI GN GDQWSDL G     R+FKLP+P+YYI
Sbjct  211  NEGYRIHGNSGDQWSDLFGFAVSERSFKLPNPLYYI  246



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2716226751040