BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c28313_g1_i1 len=615 path=[593:0-614]

Length=615
                                                                      Score     E

ref|XP_009599402.1|  PREDICTED: uncharacterized protein LOC104095056    116   1e-29   
ref|XP_009762912.1|  PREDICTED: uncharacterized protein LOC104214887    115   2e-29   
ref|XP_006354405.1|  PREDICTED: uncharacterized protein LOC102589244    117   3e-29   
emb|CDP15278.1|  unnamed protein product                                116   3e-29   
ref|XP_011077309.1|  PREDICTED: uncharacterized protein LOC105161353    109   4e-27   
ref|XP_010050728.1|  PREDICTED: uncharacterized protein LOC104439345    105   1e-25   
ref|XP_010267218.1|  PREDICTED: uncharacterized protein LOC104604536    104   1e-24   
gb|KHG25742.1|  Polypeptide N-acetylgalactosaminyltransferase 35A       103   1e-24   
gb|AFK36410.1|  unknown                                                 101   7e-24   
ref|XP_002517313.1|  conserved hypothetical protein                     101   7e-24   Ricinus communis
gb|EYU38568.1|  hypothetical protein MIMGU_mgv1a017238mg                100   1e-23   
ref|XP_003537301.1|  PREDICTED: uncharacterized protein LOC100804493    100   1e-23   
gb|ACG29441.1|  hypothetical protein                                    100   1e-23   Zea mays [maize]
ref|XP_008679144.1|  PREDICTED: uncharacterized protein pco097726a      100   1e-23   
ref|XP_007144348.1|  hypothetical protein PHAVU_007G148600g           99.8    2e-23   
ref|XP_004515910.1|  PREDICTED: uncharacterized protein LOC101492080  99.0    4e-23   
emb|CBI30152.3|  unnamed protein product                              99.4    9e-23   
gb|AFK37573.1|  unknown                                               97.1    2e-22   
ref|XP_004954454.1|  PREDICTED: uncharacterized protein LOC101769934  97.1    2e-22   
ref|XP_008809904.1|  PREDICTED: uncharacterized protein LOC103721457  96.7    3e-22   
ref|XP_003542520.1|  PREDICTED: uncharacterized protein LOC100527930  96.7    3e-22   
gb|KEH42166.1|  transmembrane protein, putative                       96.7    4e-22   
gb|KEH42167.1|  transmembrane protein, putative                       96.3    4e-22   
ref|XP_008776951.1|  PREDICTED: uncharacterized protein LOC103696982  96.3    5e-22   
ref|XP_009125505.1|  PREDICTED: uncharacterized protein LOC103850498  95.9    7e-22   
ref|XP_010675403.1|  PREDICTED: uncharacterized protein LOC104891412  95.9    8e-22   
ref|XP_009418283.1|  PREDICTED: uncharacterized protein LOC103998521  96.3    9e-22   
ref|XP_008387535.1|  PREDICTED: uncharacterized protein LOC103449996  95.5    9e-22   
ref|XP_010918607.1|  PREDICTED: uncharacterized protein LOC105042934  95.5    1e-21   
gb|KHN39070.1|  hypothetical protein glysoja_017364                   95.5    1e-21   
ref|XP_002454806.1|  hypothetical protein SORBIDRAFT_04g037830        94.7    2e-21   Sorghum bicolor [broomcorn]
ref|XP_002268987.1|  PREDICTED: uncharacterized protein LOC100247006  94.7    2e-21   Vitis vinifera
ref|XP_007027445.1|  Uncharacterized protein TCM_022279               94.7    2e-21   
ref|XP_009377042.1|  PREDICTED: uncharacterized protein LOC103965692  94.7    2e-21   
ref|XP_010908510.1|  PREDICTED: uncharacterized protein LOC105034891  94.4    3e-21   
ref|XP_010543441.1|  PREDICTED: uncharacterized protein LOC104816...  94.0    3e-21   
gb|KHN48285.1|  hypothetical protein glysoja_007954                   94.0    4e-21   
ref|XP_009386395.1|  PREDICTED: uncharacterized protein LOC103973531  94.0    4e-21   
gb|ABK93498.1|  unknown                                               93.2    6e-21   Populus trichocarpa [western balsam poplar]
ref|XP_011018785.1|  PREDICTED: uncharacterized protein LOC105121...  92.8    1e-20   
ref|XP_006381388.1|  hypothetical protein POPTR_0006s12450g           91.7    2e-20   
ref|XP_006648150.1|  PREDICTED: uncharacterized protein LOC102705136  91.7    2e-20   
gb|ABK96751.1|  unknown                                               91.3    5e-20   Populus trichocarpa x Populus deltoides
gb|EPS72357.1|  hypothetical protein M569_02403                       90.5    5e-20   
ref|XP_011018787.1|  PREDICTED: uncharacterized protein LOC105121...  90.9    5e-20   
ref|XP_010423707.1|  PREDICTED: uncharacterized protein LOC104708782  90.9    6e-20   
ref|NP_001048570.1|  Os02g0823600                                     90.5    7e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010543442.1|  PREDICTED: uncharacterized protein LOC104816...  90.1    9e-20   
ref|XP_003570430.2|  PREDICTED: uncharacterized protein LOC100842861  91.7    1e-19   
ref|XP_008241390.1|  PREDICTED: uncharacterized protein LOC103339816  89.4    2e-19   
ref|XP_009122696.1|  PREDICTED: uncharacterized protein LOC103847379  89.4    2e-19   
ref|XP_006381389.1|  hypothetical protein POPTR_0006s12450g           88.6    3e-19   
ref|XP_010452228.1|  PREDICTED: uncharacterized protein LOC104734368  89.4    3e-19   
ref|XP_006398798.1|  hypothetical protein EUTSA_v10015146mg           89.4    3e-19   
ref|XP_010098796.1|  hypothetical protein L484_022561                 89.4    4e-19   
gb|KHG22418.1|  Frizzled-6                                            88.6    5e-19   
gb|AAS20978.1|  F12E4.230-like protein                                88.2    5e-19   Hyacinthus orientalis [common hyacinth]
ref|XP_006851282.1|  hypothetical protein AMTR_s00050p00054970        87.4    5e-19   
dbj|BAJ87269.1|  predicted protein                                    88.6    6e-19   
ref|NP_568120.1|  uncharacterized protein                             87.8    8e-19   Arabidopsis thaliana [mouse-ear cress]
gb|KFK24800.1|  hypothetical protein AALP_AA8G026800                  87.4    1e-18   
ref|XP_008442719.1|  PREDICTED: uncharacterized protein LOC103486509  87.0    2e-18   
emb|CDY44369.1|  BnaC02g03080D                                        86.3    2e-18   
ref|XP_007202811.1|  hypothetical protein PRUPE_ppa014129mg           85.9    4e-18   
dbj|BAK05027.1|  predicted protein                                    83.6    2e-17   
emb|CDX70306.1|  BnaA10g26550D                                        82.4    7e-17   
ref|XP_002871035.1|  hypothetical protein ARALYDRAFT_487123           82.0    1e-16   
emb|CDY10378.1|  BnaCnng02790D                                        80.1    6e-16   
gb|ABR17890.1|  unknown                                               77.0    7e-15   Picea sitchensis
ref|XP_006491692.1|  PREDICTED: uncharacterized protein LOC102612124  76.3    1e-14   
ref|XP_006428352.1|  hypothetical protein CICLE_v10013275mg           73.6    1e-13   
ref|XP_002972785.1|  hypothetical protein SELMODRAFT_98349            72.0    2e-13   
ref|XP_003625700.1|  hypothetical protein MTR_7g102320                68.9    7e-12   
gb|KEH24035.1|  transmembrane protein, putative                       68.6    7e-12   
ref|XP_004494074.1|  PREDICTED: uncharacterized protein LOC101505...  68.6    7e-12   
gb|KEH24034.1|  transmembrane protein, putative                       68.2    8e-12   
ref|XP_004494075.1|  PREDICTED: uncharacterized protein LOC101505...  68.2    1e-11   



>ref|XP_009599402.1| PREDICTED: uncharacterized protein LOC104095056 [Nicotiana tomentosiformis]
Length=85

 Score =   116 bits (290),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 68/86 (79%), Gaps = 1/86 (1%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVC+ACL+PLFLVPIVNLLP+LF   MAK+YR+FGKEYQ+P R PPACP+KPSATKPNNS
Sbjct  1    MVCVACLIPLFLVPIVNLLPVLFHILMAKIYRMFGKEYQRPERAPPACPFKPSATKPNNS  60

Query  330  VSEGPSPIDQDPHRQISAGGDDGKRE  253
            V+  PS     P  + + G DD K++
Sbjct  61   VTGEPSAGASHPIPK-AVGVDDSKQD  85



>ref|XP_009762912.1| PREDICTED: uncharacterized protein LOC104214887 [Nicotiana sylvestris]
Length=85

 Score =   115 bits (289),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 68/86 (79%), Gaps = 1/86 (1%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVC+ACL+PLFLVPIVNLLP+LF   MAK+YR+FGKEYQ+P R PPACP+KPSATKPNNS
Sbjct  1    MVCVACLIPLFLVPIVNLLPVLFHILMAKIYRMFGKEYQRPERAPPACPFKPSATKPNNS  60

Query  330  VSEGPSPIDQDPHRQISAGGDDGKRE  253
            V+  PS     P  + + G DD K++
Sbjct  61   VTGEPSSGASHPIPK-AVGVDDSKQD  85



>ref|XP_006354405.1| PREDICTED: uncharacterized protein LOC102589244 [Solanum tuberosum]
Length=150

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 78/112 (70%), Gaps = 3/112 (3%)
 Frame = -1

Query  585  SHIGESRRPRHPGKPRRIRILSEAKMVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFG  406
            SHI   R+     + ++ +  +  KMVC+ACL+PLFLVPIVNLLP+LF   MAKVYR+ G
Sbjct  41   SHILLHRKTNQKSRTQKKK-YNLKKMVCVACLIPLFLVPIVNLLPVLFHILMAKVYRMMG  99

Query  405  KEYQKPARVPPACPYKPSATKPNNSVSEGPSPIDQDPHRQISA-GGDDGKRE  253
            KEYQ+P R PPACP+KPSATKPNNSV+ G  P    PH    A G DD K++
Sbjct  100  KEYQRPERAPPACPFKPSATKPNNSVT-GEEPSSGAPHPVPKAVGVDDSKQD  150



>emb|CDP15278.1| unnamed protein product [Coffea canephora]
Length=125

 Score =   116 bits (290),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 71/89 (80%), Gaps = 3/89 (3%)
 Frame = -1

Query  516  AKMVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPN  337
            +KMVCLACLLPLFLVPIVNLLPLLFDF M K+YRLFG EY+KP R PPACPYKPSATKPN
Sbjct  39   SKMVCLACLLPLFLVPIVNLLPLLFDFIMGKIYRLFGWEYRKPERAPPACPYKPSATKPN  98

Query  336  -NSVSEGPSPIDQDPHRQISAGGDDGKRE  253
             NSV++  S +  D + Q  A  DD K++
Sbjct  99   SNSVAKADS-VAPD-NIQKPALIDDSKKD  125



>ref|XP_011077309.1| PREDICTED: uncharacterized protein LOC105161353 [Sesamum indicum]
Length=87

 Score =   109 bits (273),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 66/88 (75%), Gaps = 3/88 (3%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPN--  337
            MVCLACLLPLFLVPIVNLLPLLFD  MAKVYRLFG EYQKP R PPACP KPSA+K    
Sbjct  1    MVCLACLLPLFLVPIVNLLPLLFDIIMAKVYRLFGWEYQKPERAPPACPIKPSASKTGTI  60

Query  336  NSVSEGPSPIDQDPHRQISAGGDDGKRE  253
            +SV++  +    D  R+ S G DD K++
Sbjct  61   SSVTDKDNLAAPDQSRK-SVGVDDSKQD  87



>ref|XP_010050728.1| PREDICTED: uncharacterized protein LOC104439345 [Eucalyptus grandis]
Length=86

 Score =   105 bits (263),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVCLACLLPLFLVPIVNLLPLLFD  MAKVY LFG EY+KPAR PPACPYKP+A   +  
Sbjct  1    MVCLACLLPLFLVPIVNLLPLLFDIIMAKVYALFGWEYRKPARTPPACPYKPTAPIKDGK  60

Query  330  VSEGPSP  310
            V EG +P
Sbjct  61   VGEGDAP  67



>ref|XP_010267218.1| PREDICTED: uncharacterized protein LOC104604536 [Nelumbo nucifera]
Length=122

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 60/83 (72%), Gaps = 10/83 (12%)
 Frame = -1

Query  513  KMVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNN  334
            KMVCLACLLPLFLVPIVN+LPLLFDF MAK+YRLFG EY+KP RVPP+CPYKP  TK + 
Sbjct  40   KMVCLACLLPLFLVPIVNILPLLFDFIMAKIYRLFGWEYRKPERVPPSCPYKP-VTKKDA  98

Query  333  SVSEG---------PSPIDQDPH  292
             V E           + +D D H
Sbjct  99   KVEEQATVSHPVTPATVLDNDKH  121



>gb|KHG25742.1| Polypeptide N-acetylgalactosaminyltransferase 35A [Gossypium 
arboreum]
Length=123

 Score =   103 bits (258),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -1

Query  513  KMVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNN  334
            KMVC+ACLLPLFLVPIVN+LPLLFDF M K+YRL G EY+KP R PPACPYKP+A   NN
Sbjct  37   KMVCIACLLPLFLVPIVNILPLLFDFIMGKIYRLLGWEYRKPERAPPACPYKPAAKLENN  96

Query  333  S  331
            S
Sbjct  97   S  97



>gb|AFK36410.1| unknown [Lotus japonicus]
Length=83

 Score =   101 bits (251),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVC+ACLLPLFLVPI+NLLPLLFDF MAK+YR+FG EY+KP R PPACPYKPSA   +  
Sbjct  1    MVCVACLLPLFLVPIINLLPLLFDFLMAKIYRVFGWEYRKPERAPPACPYKPSANGVSKQ  60

Query  330  VSEGPSPIDQDPHR  289
                  P   +P +
Sbjct  61   AEANAEPATPEPVK  74



>ref|XP_002517313.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45106.1| conserved hypothetical protein [Ricinus communis]
Length=87

 Score =   101 bits (251),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 59/85 (69%), Gaps = 13/85 (15%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVC+ACLLPLFLVPIVN+LPLLFD+ M KVY LFG EY+KP R PPACPYKPSA++    
Sbjct  1    MVCIACLLPLFLVPIVNILPLLFDYIMGKVYALFGWEYRKPERAPPACPYKPSASR----  56

Query  330  VSEGPSPIDQDPHRQISAGGDDGKR  256
                     ++  +Q  A G+ G R
Sbjct  57   ---------EESAKQAGAEGETGAR  72



>gb|EYU38568.1| hypothetical protein MIMGU_mgv1a017238mg [Erythranthe guttata]
Length=87

 Score =   100 bits (250),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 63/88 (72%), Gaps = 3/88 (3%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPN--  337
            MVCLACLLPLFLVPIVNLLP+LFD  M KVYRLFG EY+KP R PPACP KPSA+K    
Sbjct  1    MVCLACLLPLFLVPIVNLLPVLFDIIMGKVYRLFGWEYRKPVRAPPACPMKPSASKTGTA  60

Query  336  NSVSEGPSPIDQDPHRQISAGGDDGKRE  253
            +SV+   +    DP  + S G DD K +
Sbjct  61   DSVAGIQNHGAPDPSLK-SVGEDDDKLD  87



>ref|XP_003537301.1| PREDICTED: uncharacterized protein LOC100804493 [Glycine max]
Length=82

 Score =   100 bits (249),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 61/86 (71%), Gaps = 4/86 (5%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVCLACLLPLFLVPIVN+LPLLF F M K+YR+FG EY+KP R PPACP+KP    P N 
Sbjct  1    MVCLACLLPLFLVPIVNILPLLFHFIMGKIYRVFGWEYRKPERAPPACPFKP----PANR  56

Query  330  VSEGPSPIDQDPHRQISAGGDDGKRE  253
            VSE  + ++  P   +  G  D K++
Sbjct  57   VSEAEADVEPVPADPVKPGNVDVKQD  82



>gb|ACG29441.1| hypothetical protein [Zea mays]
Length=84

 Score =   100 bits (249),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 61/86 (71%), Gaps = 2/86 (2%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVC+ACLLPLFL+P+VN LP L D  ++KVYRLFG EY++P RVPPACPYKP+A K +  
Sbjct  1    MVCVACLLPLFLIPVVNALPYLIDLIISKVYRLFGWEYRRPERVPPACPYKPAAQKNDEG  60

Query  330  VSEGPSPIDQDPHRQISAGGDDGKRE  253
             SE    +  +PH   +A  +D K E
Sbjct  61   ASESKPLV--EPHGAGAAAAEDKKVE  84



>ref|XP_008679144.1| PREDICTED: uncharacterized protein pco097726a [Zea mays]
 gb|ACF81331.1| unknown [Zea mays]
 gb|ACG44881.1| hypothetical protein [Zea mays]
 gb|AFW63930.1| hypothetical protein ZEAMMB73_897659 [Zea mays]
Length=84

 Score =   100 bits (249),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 62/86 (72%), Gaps = 2/86 (2%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVC+ACLLPLFL+P+VN LP L D  ++KVYRLFG EY++P RVPPACPYKP+A K +  
Sbjct  1    MVCVACLLPLFLIPVVNALPYLIDLIISKVYRLFGWEYRRPERVPPACPYKPAAQKNDEG  60

Query  330  VSEGPSPIDQDPHRQISAGGDDGKRE  253
             SE   P+  +PH   +A  +D K E
Sbjct  61   ASES-KPL-AEPHGAGAAAAEDKKVE  84



>ref|XP_007144348.1| hypothetical protein PHAVU_007G148600g [Phaseolus vulgaris]
 gb|ESW16342.1| hypothetical protein PHAVU_007G148600g [Phaseolus vulgaris]
Length=83

 Score = 99.8 bits (247),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 58/86 (67%), Gaps = 3/86 (3%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVCLACLLPLFLVPIVN+LP+LF   M K+YR+FG EY+KP RVPPACPYKP  T  +  
Sbjct  1    MVCLACLLPLFLVPIVNILPILFHIIMGKIYRVFGWEYRKPERVPPACPYKPPTTGVSKQ  60

Query  330  VSEGPSPIDQDPHRQISAGGDDGKRE  253
                  PI  DP   +  G  D K++
Sbjct  61   AEADVEPISADP---VKPGTVDVKKD  83



>ref|XP_004515910.1| PREDICTED: uncharacterized protein LOC101492080 [Cicer arietinum]
Length=83

 Score = 99.0 bits (245),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 58/86 (67%), Gaps = 3/86 (3%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVCLACLLPLFLVPIVN+LPLLFDF M K YR+FG EY+KP R PPACPYKPS    N  
Sbjct  1    MVCLACLLPLFLVPIVNVLPLLFDFIMGKFYRVFGWEYRKPERAPPACPYKPST---NTI  57

Query  330  VSEGPSPIDQDPHRQISAGGDDGKRE  253
             S+  +     P   +  G  D K++
Sbjct  58   SSKDEANAGTSPTEPVKPGSVDVKQD  83



>emb|CBI30152.3| unnamed protein product [Vitis vinifera]
Length=125

 Score = 99.4 bits (246),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 59/79 (75%), Gaps = 5/79 (6%)
 Frame = -1

Query  558  RHPGKPRRIRILSE---AKMVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKP  388
            RHP +   +R       +KMVCLACLLPLFLVPIVNLLPLLF+  MAKVY LFG EY+KP
Sbjct  23   RHPLESSLLRFTQSKRRSKMVCLACLLPLFLVPIVNLLPLLFNLIMAKVYGLFGWEYRKP  82

Query  387  ARVPPACPYKPSATKPNNS  331
             RVP ACPYKP+A   NNS
Sbjct  83   ERVPAACPYKPAAN--NNS  99



>gb|AFK37573.1| unknown [Lotus japonicus]
Length=83

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVC+ACLLPLFLVPI+NLLPLLFDF MAK+YR+FG EY+KP R PPA PYKPSA   +  
Sbjct  1    MVCVACLLPLFLVPIINLLPLLFDFLMAKIYRVFGWEYRKPERAPPARPYKPSANGASKQ  60

Query  330  VSEGPSPIDQDPHR  289
                  P   +P +
Sbjct  61   AEANAEPATPEPVK  74



>ref|XP_004954454.1| PREDICTED: uncharacterized protein LOC101769934 [Setaria italica]
Length=81

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 59/86 (69%), Gaps = 5/86 (6%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVC+ACLLPLFL+P+VN LP LFD  + KVYRLFG EY++P R PPACPYKP+A K +  
Sbjct  1    MVCVACLLPLFLIPVVNALPYLFDLILRKVYRLFGWEYRRPERAPPACPYKPAAQKNDEG  60

Query  330  VSEGPSPIDQDPHRQISAGGDDGKRE  253
             SE    +  +PH    A  +D K E
Sbjct  61   ASESKPLV--EPH---GAAAEDKKEE  81



>ref|XP_008809904.1| PREDICTED: uncharacterized protein LOC103721457 [Phoenix dactylifera]
Length=80

 Score = 96.7 bits (239),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 56/81 (69%), Gaps = 4/81 (5%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVC+ACLLPLFL+P+VN LPLL DF + KVYRLFG EY+KP RVPPACPYKP     N  
Sbjct  1    MVCVACLLPLFLIPVVNALPLLVDFILGKVYRLFGWEYRKPERVPPACPYKPV----NKK  56

Query  330  VSEGPSPIDQDPHRQISAGGD  268
             ++G S    +P  Q  A  D
Sbjct  57   DAQGGSEEHTNPESQKVAEND  77



>ref|XP_003542520.1| PREDICTED: uncharacterized protein LOC100527930 [Glycine max]
 gb|ACU17160.1| unknown [Glycine max]
Length=82

 Score = 96.7 bits (239),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 60/86 (70%), Gaps = 4/86 (5%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVCLACLLPLFLVPIVN+LPLL+ F M K+YR+FG EY+KP R PP CPYKP    P N 
Sbjct  1    MVCLACLLPLFLVPIVNILPLLYYFIMGKIYRVFGWEYRKPERAPPVCPYKP----PTNR  56

Query  330  VSEGPSPIDQDPHRQISAGGDDGKRE  253
            VS+  + ++  P   +  G  D K++
Sbjct  57   VSKVEADVEPVPADPVKPGSVDVKQD  82



>gb|KEH42166.1| transmembrane protein, putative [Medicago truncatula]
Length=82

 Score = 96.7 bits (239),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 53/70 (76%), Gaps = 1/70 (1%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPN-N  334
            MVCL CL+PLFLVPIVN LPLLFDF M K+Y  FG EY+KP RVPPACP KPS    N +
Sbjct  1    MVCLVCLVPLFLVPIVNFLPLLFDFLMGKIYAAFGWEYRKPERVPPACPIKPSNKTINKD  60

Query  333  SVSEGPSPID  304
             VS GPSP +
Sbjct  61   EVSVGPSPTE  70



>gb|KEH42167.1| transmembrane protein, putative [Medicago truncatula]
Length=83

 Score = 96.3 bits (238),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 53/71 (75%), Gaps = 2/71 (3%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPN--  337
            MVCL CL+PLFLVPIVN LPLLFDF M K+Y  FG EY+KP RVPPACP KPS    N  
Sbjct  1    MVCLVCLVPLFLVPIVNFLPLLFDFLMGKIYAAFGWEYRKPERVPPACPIKPSNKTINKQ  60

Query  336  NSVSEGPSPID  304
            + VS GPSP +
Sbjct  61   DEVSVGPSPTE  71



>ref|XP_008776951.1| PREDICTED: uncharacterized protein LOC103696982 [Phoenix dactylifera]
Length=80

 Score = 96.3 bits (238),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 55/81 (68%), Gaps = 4/81 (5%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVCLACLLPLFL+P+VN LPLL  F ++KVYRLFG EY+KP RVPPACPY P     N  
Sbjct  1    MVCLACLLPLFLIPVVNALPLLVHFILSKVYRLFGWEYRKPERVPPACPYNPG----NKK  56

Query  330  VSEGPSPIDQDPHRQISAGGD  268
             ++G +     P  Q  AG D
Sbjct  57   DTQGGNETRTQPENQKVAGDD  77



>ref|XP_009125505.1| PREDICTED: uncharacterized protein LOC103850498 [Brassica rapa]
Length=82

 Score = 95.9 bits (237),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATK-PNN  334
            MVC+ CL+PLFL+P+VNLLP +FD  MAKVY  FG EY+KPARVPPACP+KP+ TK    
Sbjct  1    MVCIMCLVPLFLIPLVNLLPRIFDLLMAKVYGWFGWEYRKPARVPPACPFKPTVTKVAAE  60

Query  333  SVSEGPSPI  307
            ++SEG   I
Sbjct  61   TISEGTETI  69



>ref|XP_010675403.1| PREDICTED: uncharacterized protein LOC104891412 [Beta vulgaris 
subsp. vulgaris]
Length=87

 Score = 95.9 bits (237),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVCLACLLPLFL+P+VN LPLLF   MA+VYRL G EY+KP RVPPACPYKP     +NS
Sbjct  1    MVCLACLLPLFLIPVVNALPLLFHILMARVYRLLGWEYRKPERVPPACPYKPGMVTKSNS  60

Query  330  VSEG  319
             SEG
Sbjct  61   -SEG  63



>ref|XP_009418283.1| PREDICTED: uncharacterized protein LOC103998521, partial [Musa 
acuminata subsp. malaccensis]
Length=100

 Score = 96.3 bits (238),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 55/70 (79%), Gaps = 1/70 (1%)
 Frame = -1

Query  513  KMVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNN  334
            K VCLACLLPLFL+P+VN LPLLFD  + K+Y LFG EY+KP RVPPACPYKP A+K N 
Sbjct  19   KTVCLACLLPLFLIPVVNALPLLFDVIVGKIYHLFGWEYRKPERVPPACPYKP-ASKKNG  77

Query  333  SVSEGPSPID  304
             ++E  + ++
Sbjct  78   DLNETENQVE  87



>ref|XP_008387535.1| PREDICTED: uncharacterized protein LOC103449996 [Malus domestica]
Length=84

 Score = 95.5 bits (236),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVC+ACLLPLFLVPIVNLLPLLFD  M K+Y+LFG EY+KP R PPACP KP A K +  
Sbjct  1    MVCVACLLPLFLVPIVNLLPLLFDLIMGKIYQLFGWEYRKPERAPPACPIKPVAKK-DTK  59

Query  330  VSEGPSPIDQD  298
            VSE   P   D
Sbjct  60   VSEKAEPGQPD  70



>ref|XP_010918607.1| PREDICTED: uncharacterized protein LOC105042934 [Elaeis guineensis]
Length=80

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 55/81 (68%), Gaps = 4/81 (5%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVCLACLLPLFL+P+VN LPLL DF + KVYRLFG EY+KP RVPPACPYKP     N  
Sbjct  1    MVCLACLLPLFLIPVVNALPLLVDFILGKVYRLFGWEYRKPERVPPACPYKPV----NKK  56

Query  330  VSEGPSPIDQDPHRQISAGGD  268
             ++G +     P  Q  A  D
Sbjct  57   DTQGGNETLTQPESQKVAVDD  77



>gb|KHN39070.1| hypothetical protein glysoja_017364 [Glycine soja]
Length=79

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 59/86 (69%), Gaps = 7/86 (8%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVCLACLLPLFLVPIVN+LPLLF F M K+YR+FG EY+KP R PPACP+KP A +    
Sbjct  1    MVCLACLLPLFLVPIVNILPLLFHFIMGKIYRVFGWEYRKPERAPPACPFKPPANRAEAD  60

Query  330  VSEGPSPIDQDPHRQISAGGDDGKRE  253
            V     P+  DP   +  G  D K++
Sbjct  61   V----EPVPADP---VKPGNVDVKQD  79



>ref|XP_002454806.1| hypothetical protein SORBIDRAFT_04g037830 [Sorghum bicolor]
 gb|EES07782.1| hypothetical protein SORBIDRAFT_04g037830 [Sorghum bicolor]
Length=81

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 59/86 (69%), Gaps = 5/86 (6%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVC+ACLLPLFL+P+VN LP L D  ++KVYRLFG EY++P R PPACPYKP+A K +  
Sbjct  1    MVCVACLLPLFLIPLVNALPYLVDLIISKVYRLFGWEYRRPERAPPACPYKPAAQKNDEG  60

Query  330  VSEGPSPIDQDPHRQISAGGDDGKRE  253
             SE    +  +PH    A  +D K E
Sbjct  61   ASESKPLV--NPH---GAAAEDKKEE  81



>ref|XP_002268987.1| PREDICTED: uncharacterized protein LOC100247006 [Vitis vinifera]
 ref|XP_010653988.1| PREDICTED: uncharacterized protein LOC100247006 [Vitis vinifera]
 ref|XP_010653989.1| PREDICTED: uncharacterized protein LOC100247006 [Vitis vinifera]
Length=84

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 51/60 (85%), Gaps = 2/60 (3%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVCLACLLPLFLVPIVNLLPLLF+  MAKVY LFG EY+KP RVP ACPYKP+A   NNS
Sbjct  1    MVCLACLLPLFLVPIVNLLPLLFNLIMAKVYGLFGWEYRKPERVPAACPYKPAAN--NNS  58



>ref|XP_007027445.1| Uncharacterized protein TCM_022279 [Theobroma cacao]
 gb|EOY07947.1| Uncharacterized protein TCM_022279 [Theobroma cacao]
Length=87

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVC+ACLLPLFLVPIVN+LPLLF + M K+Y+LFG EY+KP R PPACPYKP+A K  N 
Sbjct  1    MVCIACLLPLFLVPIVNILPLLFHYIMGKIYKLFGWEYRKPERAPPACPYKPAA-KTENV  59

Query  330  VSEGPSPI  307
               GP  +
Sbjct  60   KKVGPETV  67



>ref|XP_009377042.1| PREDICTED: uncharacterized protein LOC103965692 [Pyrus x bretschneideri]
Length=84

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 51/63 (81%), Gaps = 1/63 (2%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVC+ACLLPLFLVPIVNLLPLLFD  M K+Y+LFG EY+KP R PPACP KP A K +  
Sbjct  1    MVCVACLLPLFLVPIVNLLPLLFDLIMGKIYQLFGWEYRKPERAPPACPIKPVAKK-DTK  59

Query  330  VSE  322
            VSE
Sbjct  60   VSE  62



>ref|XP_010908510.1| PREDICTED: uncharacterized protein LOC105034891 [Elaeis guineensis]
Length=80

 Score = 94.4 bits (233),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVCLACLLPLFL+P+VN LPLL  F + KVYRLFG EY+KP RVPPACPYKP   K    
Sbjct  1    MVCLACLLPLFLIPVVNALPLLVHFILGKVYRLFGWEYRKPERVPPACPYKPVKEKDTQG  60

Query  330  VSE  322
             SE
Sbjct  61   GSE  63



>ref|XP_010543441.1| PREDICTED: uncharacterized protein LOC104816357 isoform X1 [Tarenaya 
hassleriana]
Length=80

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 53/81 (65%), Gaps = 1/81 (1%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVCL CL+PLFLVPIVNLLP + D+FMAKVY L G EY+KP R PP CPYKPS T+  N+
Sbjct  1    MVCLMCLVPLFLVPIVNLLPRILDYFMAKVYALLGWEYRKPERAPPVCPYKPS-TRNGNA  59

Query  330  VSEGPSPIDQDPHRQISAGGD  268
              E P  +     R      D
Sbjct  60   TKEAPENVQNPVARDAEVKQD  80



>gb|KHN48285.1| hypothetical protein glysoja_007954 [Glycine soja]
Length=79

 Score = 94.0 bits (232),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 57/86 (66%), Gaps = 7/86 (8%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVCLACLLPLFLVPIVN+LPLL+ F M K+YR+FG EY+KP R PP CPYKP    P N 
Sbjct  1    MVCLACLLPLFLVPIVNILPLLYYFIMGKIYRVFGWEYRKPERAPPVCPYKP----PTNR  56

Query  330  VSEGPSPIDQDPHRQISAGGDDGKRE  253
                  P+  DP   +  G  D K++
Sbjct  57   AEADVEPVPADP---VKPGSVDVKQD  79



>ref|XP_009386395.1| PREDICTED: uncharacterized protein LOC103973531 [Musa acuminata 
subsp. malaccensis]
Length=81

 Score = 94.0 bits (232),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 57/82 (70%), Gaps = 2/82 (2%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVCLACLLPLF +P+VN LPLLF F + K+Y LFG EY+KP RVPP+CPYKP+  K  + 
Sbjct  1    MVCLACLLPLFFIPVVNALPLLFYFIVGKIYWLFGWEYRKPERVPPSCPYKPAVKKIVDG  60

Query  330  VSEGPSPIDQDPHRQISAGGDD  265
             SE  S +  +P R  + G  +
Sbjct  61   SSETVSSV--EPQRSGTEGDKN  80



>gb|ABK93498.1| unknown [Populus trichocarpa]
Length=83

 Score = 93.2 bits (230),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 61/86 (71%), Gaps = 3/86 (3%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVC+ACLLPLFLVPIVNLLPL+F F   K+Y LFG EY+KP R PPACPYKP A+  N +
Sbjct  1    MVCVACLLPLFLVPIVNLLPLIFYFLKGKIYALFGWEYRKPERAPPACPYKPPASSINTT  60

Query  330  VSEGPSPIDQDPHRQISAGGDDGKRE  253
              +  +  + +P  +  A G DGK+E
Sbjct  61   NKQMEA--EGEPVAKPVAVG-DGKQE  83



>ref|XP_011018785.1| PREDICTED: uncharacterized protein LOC105121725 isoform X1 [Populus 
euphratica]
 ref|XP_011018789.1| PREDICTED: uncharacterized protein LOC105121727 isoform X1 [Populus 
euphratica]
Length=83

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 61/86 (71%), Gaps = 3/86 (3%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVC+ACLLPLFLVPIVNLLPL+F F   K+Y LFG EY+KP R PPACPYKP A+  N +
Sbjct  1    MVCVACLLPLFLVPIVNLLPLIFYFLKGKIYALFGWEYRKPERAPPACPYKPPASSINTT  60

Query  330  VSEGPSPIDQDPHRQISAGGDDGKRE  253
              +  +  + +P  +  A G DGK++
Sbjct  61   TKQVEA--EGEPVAKPVAVG-DGKQD  83



>ref|XP_006381388.1| hypothetical protein POPTR_0006s12450g [Populus trichocarpa]
 gb|ERP59185.1| hypothetical protein POPTR_0006s12450g [Populus trichocarpa]
Length=82

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 59/86 (69%), Gaps = 4/86 (5%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVC+ACLLPLFLVPIVNLLPL+F F   K+Y LFG EY+KP R PPACPYKP A+  N +
Sbjct  1    MVCVACLLPLFLVPIVNLLPLIFYFLKGKIYALFGWEYRKPERAPPACPYKPPASSINTT  60

Query  330  VSEGPSPIDQDPHRQISAGGDDGKRE  253
                    + +P  +  A G DGK+E
Sbjct  61   ---NKMEAEGEPVAKPVAVG-DGKQE  82



>ref|XP_006648150.1| PREDICTED: uncharacterized protein LOC102705136 [Oryza brachyantha]
Length=83

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 52/66 (79%), Gaps = 3/66 (5%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVCLACLLPLFL+P+VN LPLL D  ++K+YRLFG EY++P R PPACP+KP+A K    
Sbjct  1    MVCLACLLPLFLIPVVNALPLLVDLIISKIYRLFGWEYRRPERAPPACPFKPAAAK---K  57

Query  330  VSEGPS  313
            + EG S
Sbjct  58   IDEGAS  63



>gb|ABK96751.1| unknown [Populus trichocarpa x Populus deltoides]
Length=83

 Score = 91.3 bits (225),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 60/86 (70%), Gaps = 3/86 (3%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVC+ACLLPLFLVPIVNLLPL+F F   K+Y LFG EY+KP R PPACPY P A+  N +
Sbjct  1    MVCVACLLPLFLVPIVNLLPLIFYFLKGKIYALFGWEYRKPERAPPACPYTPPASSINTT  60

Query  330  VSEGPSPIDQDPHRQISAGGDDGKRE  253
              +  +  + +P  +  A G DGK++
Sbjct  61   TKQVEA--EGEPVAKPVAVG-DGKQD  83



>gb|EPS72357.1| hypothetical protein M569_02403, partial [Genlisea aurea]
Length=64

 Score = 90.5 bits (223),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -1

Query  507  VCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATK  343
            VCL C LPLFLVPIVNLLP LFDF MAKVYRL GKEYQ+P R PP CP KPS+++
Sbjct  2    VCLVCFLPLFLVPIVNLLPRLFDFVMAKVYRLLGKEYQRPERAPPVCPVKPSSSR  56



>ref|XP_011018787.1| PREDICTED: uncharacterized protein LOC105121725 isoform X2 [Populus 
euphratica]
 ref|XP_011018790.1| PREDICTED: uncharacterized protein LOC105121727 isoform X2 [Populus 
euphratica]
Length=82

 Score = 90.9 bits (224),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 59/86 (69%), Gaps = 4/86 (5%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVC+ACLLPLFLVPIVNLLPL+F F   K+Y LFG EY+KP R PPACPYKP A+  N +
Sbjct  1    MVCVACLLPLFLVPIVNLLPLIFYFLKGKIYALFGWEYRKPERAPPACPYKPPASSINTT  60

Query  330  VSEGPSPIDQDPHRQISAGGDDGKRE  253
                    + +P  +  A G DGK++
Sbjct  61   TK---VEAEGEPVAKPVAVG-DGKQD  82



>ref|XP_010423707.1| PREDICTED: uncharacterized protein LOC104708782 [Camelina sativa]
Length=90

 Score = 90.9 bits (224),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVC+ CL+PLFLVP+VNL+P + DFFMAK+Y   G EY+KPARVPPACP+KP A   +N+
Sbjct  1    MVCVMCLVPLFLVPLVNLMPRIIDFFMAKLYAWLGWEYRKPARVPPACPFKPVANNNDNA  60



>ref|NP_001048570.1| Os02g0823600 [Oryza sativa Japonica Group]
 dbj|BAD22924.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD22856.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF10484.1| Os02g0823600 [Oryza sativa Japonica Group]
Length=85

 Score = 90.5 bits (223),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVCLACLLPLFL+P+VN LPLLF   ++K+YRLFG EY++P R PPACP+KP+A K N  
Sbjct  1    MVCLACLLPLFLIPVVNALPLLFHLILSKIYRLFGWEYRRPERAPPACPFKPAA-KNNEG  59

Query  330  VSEGPSPIDQDPHRQISAGGDDGKRE  253
             SE    ++       +   +D K +
Sbjct  60   ASESKPLVEPQSASTTTTTAEDKKED  85



>ref|XP_010543442.1| PREDICTED: uncharacterized protein LOC104816357 isoform X2 [Tarenaya 
hassleriana]
Length=79

 Score = 90.1 bits (222),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 52/81 (64%), Gaps = 2/81 (2%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVCL CL+PLFLVPIVNLLP + D+FMAKVY L G EY+KP R PP CPYKPS    N +
Sbjct  1    MVCLMCLVPLFLVPIVNLLPRILDYFMAKVYALLGWEYRKPERAPPVCPYKPSTR--NGN  58

Query  330  VSEGPSPIDQDPHRQISAGGD  268
             ++ P  +     R      D
Sbjct  59   ATKAPENVQNPVARDAEVKQD  79



>ref|XP_003570430.2| PREDICTED: uncharacterized protein LOC100842861 [Brachypodium 
distachyon]
Length=138

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 52/68 (76%), Gaps = 1/68 (1%)
 Frame = -1

Query  525  LSEAKMVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSAT  346
            L EA MVC+ACL+P+FL+P VN LP LFD  ++K+YR+FG EY++P R PPACP+KP+A 
Sbjct  42   LKEA-MVCVACLIPIFLIPFVNALPFLFDLLLSKIYRMFGWEYRRPERAPPACPFKPAAN  100

Query  345  KPNNSVSE  322
            K   +  E
Sbjct  101  KTEGATGE  108



>ref|XP_008241390.1| PREDICTED: uncharacterized protein LOC103339816 [Prunus mume]
Length=84

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 58/86 (67%), Gaps = 2/86 (2%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVC+ACLLPLFLVPIVN LPLLF + + K+YRL G EY+KP   PPACPYKP A K ++ 
Sbjct  1    MVCVACLLPLFLVPIVNFLPLLFYYIVGKIYRLLGWEYRKPEIAPPACPYKPVA-KQDSK  59

Query  330  VSEGPSPIDQDPHRQISAGGDDGKRE  253
            VSE   P   D   +  AG    K+E
Sbjct  60   VSEKAEPAQPDSVPEF-AGAVGLKQE  84



>ref|XP_009122696.1| PREDICTED: uncharacterized protein LOC103847379 [Brassica rapa]
Length=88

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVC+ CL+PLFLVP++NLLP + DF MAKVY   G EY+KPARVPPACP+KP+       
Sbjct  1    MVCIMCLVPLFLVPLINLLPRIIDFLMAKVYGWLGWEYRKPARVPPACPFKPNDNNSTKV  60

Query  330  VSEGPSPIDQDPHRQISAGGDDG  262
             +E  S   ++   +    G+ G
Sbjct  61   TAEAGSEGREETIAKPVLAGESG  83



>ref|XP_006381389.1| hypothetical protein POPTR_0006s12450g [Populus trichocarpa]
 gb|ERP59186.1| hypothetical protein POPTR_0006s12450g [Populus trichocarpa]
Length=68

 Score = 88.6 bits (218),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVC+ACLLPLFLVPIVNLLPL+F F   K+Y LFG EY+KP R PPACPYKP A+  N +
Sbjct  1    MVCVACLLPLFLVPIVNLLPLIFYFLKGKIYALFGWEYRKPERAPPACPYKPPASSINTT  60

Query  330  VSEGP  316
                P
Sbjct  61   NKVSP  65



>ref|XP_010452228.1| PREDICTED: uncharacterized protein LOC104734368 [Camelina sativa]
Length=89

 Score = 89.4 bits (220),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 56/77 (73%), Gaps = 2/77 (3%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVC+ CL+PLFLVP+VNL+P + DFFMAK+Y   G EY+KPARVPPACP+KP A   N+S
Sbjct  1    MVCVMCLVPLFLVPLVNLMPRIIDFFMAKLYAWLGWEYRKPARVPPACPFKPVAK--NDS  58

Query  330  VSEGPSPIDQDPHRQIS  280
             ++  +    +  + I+
Sbjct  59   ATKVAAETGTEGTKTIA  75



>ref|XP_006398798.1| hypothetical protein EUTSA_v10015146mg [Eutrema salsugineum]
 gb|ESQ40251.1| hypothetical protein EUTSA_v10015146mg [Eutrema salsugineum]
Length=90

 Score = 89.4 bits (220),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVCL CL+PLFLVPIVNLLP + DF MAKVY   G EY+KPAR PPAC +KP A   +N+
Sbjct  1    MVCLMCLVPLFLVPIVNLLPRIIDFLMAKVYSWLGWEYRKPARAPPACTFKPIAKNDDNA  60



>ref|XP_010098796.1| hypothetical protein L484_022561 [Morus notabilis]
 gb|EXB75884.1| hypothetical protein L484_022561 [Morus notabilis]
Length=106

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 56/90 (62%), Gaps = 8/90 (9%)
 Frame = -1

Query  507  VCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATK-----  343
            VCL CL+PLFL+P+VN LPLLF + M K+Y L G EY+KP R PPACPY PSA K     
Sbjct  20   VCLMCLVPLFLIPVVNALPLLFYYIMGKIYGLLGWEYRKPERAPPACPYNPSANKNTKVS  79

Query  342  PNNSVSEGPSPIDQDPHRQISAGGDDGKRE  253
             ++ V EG      DP   +S   D GK E
Sbjct  80   DSDQVGEGAESSPADP---VSKPVDHGKEE  106



>gb|KHG22418.1| Frizzled-6 [Gossypium arboreum]
Length=86

 Score = 88.6 bits (218),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 48/66 (73%), Gaps = 1/66 (2%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVC+ACLLPLFLVPIVN+LPLLF F M K+Y L G EY+KP R P  CPYKP A K  NS
Sbjct  1    MVCIACLLPLFLVPIVNILPLLFYFIMGKIYWLLGWEYRKPERAPATCPYKPPA-KTENS  59

Query  330  VSEGPS  313
               GP 
Sbjct  60   SKVGPE  65



>gb|AAS20978.1| F12E4.230-like protein [Hyacinthus orientalis]
Length=86

 Score = 88.2 bits (217),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 56/85 (66%), Gaps = 9/85 (11%)
 Frame = -1

Query  501  LACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPS-------ATK  343
            LACLLPLFL+P++N LP+L DF + KVY LFG EY+KPARVPPACPYK +        +K
Sbjct  1    LACLLPLFLIPVINALPVLMDFILGKVYALFGWEYRKPARVPPACPYKSTGIMNAEVGSK  60

Query  342  PNNSVSEGPSPIDQDPHRQISAGGD  268
                  +G S   Q+P   ++A G+
Sbjct  61   STGGKDDGLS--QQEPQEVVAAAGN  83



>ref|XP_006851282.1| hypothetical protein AMTR_s00050p00054970, partial [Amborella 
trichopoda]
 gb|ERN12863.1| hypothetical protein AMTR_s00050p00054970, partial [Amborella 
trichopoda]
Length=59

 Score = 87.4 bits (215),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNN  334
            MVCLACLLPLFLVPIVN+LPLLF F + K+Y L G EY+KP R PPACPYKP   K + 
Sbjct  1    MVCLACLLPLFLVPIVNVLPLLFYFILGKIYGLLGWEYRKPERAPPACPYKPQTQKDDQ  59



>dbj|BAJ87269.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=93

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVC+ACL+PLFL+P VN LP LFD  ++KVYR+ G EY++P RVP ACP+KP+A+K   +
Sbjct  1    MVCVACLIPLFLIPFVNALPYLFDLLLSKVYRMLGWEYRRPERVPAACPFKPAASKTEGA  60

Query  330  VSE  322
              E
Sbjct  61   AGE  63



>ref|NP_568120.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB83306.1| putative protein [Arabidopsis thaliana]
 gb|AAK76663.1| unknown protein [Arabidopsis thaliana]
 gb|AAM61493.1| unknown [Arabidopsis thaliana]
 gb|AAM91740.1| unknown protein [Arabidopsis thaliana]
 gb|AED90608.1| uncharacterized protein AT5G03460 [Arabidopsis thaliana]
Length=89

 Score = 87.8 bits (216),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVC+ CL+PLFLVP++NL+P + D+FMAK+Y   G EY+KPARVPPACP+KP A   N +
Sbjct  1    MVCVMCLVPLFLVPLINLMPRIIDYFMAKLYAWLGWEYRKPARVPPACPFKPVAKNDNAT  60



>gb|KFK24800.1| hypothetical protein AALP_AA8G026800 [Arabis alpina]
Length=89

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVC+ CL+PLFLVP++NLLP + DF MAKVY   G EY+KPAR PPACP+KP A   N +
Sbjct  1    MVCVMCLVPLFLVPLINLLPRIIDFLMAKVYAWLGWEYRKPARTPPACPFKPIAKNDNAT  60



>ref|XP_008442719.1| PREDICTED: uncharacterized protein LOC103486509 [Cucumis melo]
 gb|KGN58993.1| hypothetical protein Csa_3G741830 [Cucumis sativus]
Length=84

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 57/84 (68%), Gaps = 1/84 (1%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVCLACLLPLFL+P+VN LP+LF   M K+Y LFG EY+KP  VPPACPY+P+A K N++
Sbjct  1    MVCLACLLPLFLIPVVNALPVLFYLIMGKIYGLFGWEYRKPQVVPPACPYRPAA-KQNSN  59

Query  330  VSEGPSPIDQDPHRQISAGGDDGK  259
            V   P    Q P  +     DD +
Sbjct  60   VELEPLAGQQHPPPKPVDAMDDKQ  83



>emb|CDY44369.1| BnaC02g03080D [Brassica napus]
 emb|CDY04884.1| BnaAnng00660D [Brassica napus]
Length=78

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = -1

Query  495  CLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATK-PNNSVSEG  319
            CL+PLFL+P+VNLLP +FD  MAKVY   G EY+KPARVPPACP+KP+ TK    ++SEG
Sbjct  2    CLVPLFLIPLVNLLPRIFDLLMAKVYGWLGWEYRKPARVPPACPFKPTVTKVAAETISEG  61

Query  318  PSPI  307
               I
Sbjct  62   TETI  65



>ref|XP_007202811.1| hypothetical protein PRUPE_ppa014129mg [Prunus persica]
 gb|EMJ04010.1| hypothetical protein PRUPE_ppa014129mg [Prunus persica]
Length=84

 Score = 85.9 bits (211),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 50/63 (79%), Gaps = 1/63 (2%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVC+ACLLPLFLVPIVN LPLLF + + K+YRL G EY+KP   PPACPYKP A K ++ 
Sbjct  1    MVCVACLLPLFLVPIVNFLPLLFYYIVGKIYRLLGWEYRKPEIAPPACPYKPVA-KQDSK  59

Query  330  VSE  322
            V+E
Sbjct  60   VNE  62



>dbj|BAK05027.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=69

 Score = 83.6 bits (205),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATK  343
            MVC+ACL+PLFL+P VN LP LFD  ++KVYR+ G EY++P RVP ACP+KP+A+K
Sbjct  1    MVCVACLIPLFLIPFVNALPYLFDLLLSKVYRMLGWEYRRPERVPAACPFKPAASK  56



>emb|CDX70306.1| BnaA10g26550D [Brassica napus]
Length=84

 Score = 82.4 bits (202),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = -1

Query  495  CLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNSVSEGP  316
            CL+PLFLVP++NLLP + DF MAKVY   G EY+KPARVPPACP+KP+        +E  
Sbjct  2    CLVPLFLVPLINLLPRIIDFLMAKVYGWLGWEYRKPARVPPACPFKPNDNNSTKVTAEAG  61

Query  315  SPIDQDPHRQISAGGDDG  262
            S   ++   +    G+ G
Sbjct  62   SEAREETIAKPVLAGESG  79



>ref|XP_002871035.1| hypothetical protein ARALYDRAFT_487123 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47294.1| hypothetical protein ARALYDRAFT_487123 [Arabidopsis lyrata subsp. 
lyrata]
Length=88

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  507  VCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSA  349
            VC+ CL+PLFLVP++NL+P + D+FMAK+Y   G EY+KPAR PPACP+KP A
Sbjct  1    VCVMCLVPLFLVPLINLMPRIIDYFMAKLYAWLGWEYRKPARAPPACPFKPVA  53



>emb|CDY10378.1| BnaCnng02790D [Brassica napus]
Length=81

 Score = 80.1 bits (196),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = -1

Query  495  CLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPN-NSVSEG  319
            CL+PLFLVP++NLLP + DF MAKVY   G EY+KPARVPP+CP+KP+  K    + SEG
Sbjct  2    CLVPLFLVPLINLLPRIIDFLMAKVYGWLGWEYRKPARVPPSCPFKPNDNKVTAEAGSEG  61

Query  318  PSPIDQDPHRQISAGG  271
                   P     +GG
Sbjct  62   REETIAKPVVAGESGG  77



>gb|ABR17890.1| unknown [Picea sitchensis]
Length=85

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 54/65 (83%), Gaps = 2/65 (3%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATK--PN  337
            MVC+ACLLP+FL+PIVNLLPLLFD  M K+Y LFGKEY++P RVP ACPYKP++ K  P 
Sbjct  1    MVCIACLLPIFLIPIVNLLPLLFDLLMGKIYALFGKEYRRPERVPAACPYKPASKKVEPA  60

Query  336  NSVSE  322
             +V+E
Sbjct  61   PTVTE  65



>ref|XP_006491692.1| PREDICTED: uncharacterized protein LOC102612124 [Citrus sinensis]
Length=87

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 57/77 (74%), Gaps = 1/77 (1%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVCLACLLP+FLVPIVNLLPLLFD+ + K+Y LFG EY+KP R PPACPYKP+  +  N+
Sbjct  1    MVCLACLLPIFLVPIVNLLPLLFDYLLGKIYPLFGWEYRKPERAPPACPYKPAQKQNGNT  60

Query  330  VSEGPSPIDQDPHRQIS  280
             + G S +D      IS
Sbjct  61   NTVG-SEVDPGAPESIS  76



>ref|XP_006428352.1| hypothetical protein CICLE_v10013275mg [Citrus clementina]
 gb|ESR41592.1| hypothetical protein CICLE_v10013275mg [Citrus clementina]
Length=70

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = -1

Query  510  MVCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            MVCLACLLP+FLVPIVNLLPLLFD+ + K+Y LFG EY+KP R PPACPYKP+  +  N+
Sbjct  1    MVCLACLLPIFLVPIVNLLPLLFDYLLGKIYPLFGWEYRKPERAPPACPYKPAQKQNGNT  60

Query  330  VSEGP  316
             +  P
Sbjct  61   NTVSP  65



>ref|XP_002972785.1| hypothetical protein SELMODRAFT_98349, partial [Selaginella moellendorffii]
 gb|EFJ26006.1| hypothetical protein SELMODRAFT_98349, partial [Selaginella moellendorffii]
Length=56

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -1

Query  507  VCLACLLPLFLVPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACP  364
            VC+ACLLP+FL+P+VN+LP LFDFFMAK YR+F ++Y+ PAR P  CP
Sbjct  2    VCIACLLPIFLLPLVNILPRLFDFFMAKFYRVFRQDYKPPARAPAQCP  49



>ref|XP_003625700.1| hypothetical protein MTR_7g102320 [Medicago truncatula]
 gb|AES81918.1| transmembrane protein, putative [Medicago truncatula]
 gb|AFK37871.1| unknown [Medicago truncatula]
Length=82

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -1

Query  474  VPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATK  343
            VPIVN+LP+LF + M KVYRLFG EY+KP   PPACPYKP+A K
Sbjct  13   VPIVNVLPILFYYLMGKVYRLFGWEYRKPEIAPPACPYKPAAQK  56



>gb|KEH24035.1| transmembrane protein, putative [Medicago truncatula]
Length=71

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 41/51 (80%), Gaps = 1/51 (2%)
 Frame = -1

Query  474  VPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNSVSE  322
            VPIVN+LP+LF + M KVYRLFG EY+KP   PPACPYKP+A K ++ VS+
Sbjct  13   VPIVNVLPILFYYLMGKVYRLFGWEYRKPEIAPPACPYKPAAQK-DSKVSQ  62



>ref|XP_004494074.1| PREDICTED: uncharacterized protein LOC101505001 isoform X1 [Cicer 
arietinum]
Length=83

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 47/74 (64%), Gaps = 3/74 (4%)
 Frame = -1

Query  474  VPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNSVSEGPSPIDQDP  295
            VPIVN+LP+LF +   KVY LFG EY+KP RVPPACPYKP+A + +  V        + P
Sbjct  13   VPIVNILPILFYYVKGKVYGLFGWEYKKPERVPPACPYKPAAKRDSEQVEVEAV---RAP  69

Query  294  HRQISAGGDDGKRE  253
               + AG  D K++
Sbjct  70   VEPVKAGDVDVKQD  83



>gb|KEH24034.1| transmembrane protein, putative [Medicago truncatula]
Length=61

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -1

Query  474  VPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNS  331
            VPIVN+LP+LF + M KVYRLFG EY+KP   PPACPYKP+A K +  
Sbjct  13   VPIVNVLPILFYYLMGKVYRLFGWEYRKPEIAPPACPYKPAAQKDSKD  60



>ref|XP_004494075.1| PREDICTED: uncharacterized protein LOC101505001 isoform X2 [Cicer 
arietinum]
Length=82

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 47/74 (64%), Gaps = 4/74 (5%)
 Frame = -1

Query  474  VPIVNLLPLLFDFFMAKVYRLFGKEYQKPARVPPACPYKPSATKPNNSVSEGPSPIDQDP  295
            VPIVN+LP+LF +   KVY LFG EY+KP RVPPACPYKP+A + +    E      + P
Sbjct  13   VPIVNILPILFYYVKGKVYGLFGWEYKKPERVPPACPYKPAAKRDSEVEVEAV----RAP  68

Query  294  HRQISAGGDDGKRE  253
               + AG  D K++
Sbjct  69   VEPVKAGDVDVKQD  82



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 789084978192