BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c28292_g1_i1 len=990 path=[968:0-989]

Length=990
                                                                      Score     E

ref|XP_011070994.1|  PREDICTED: extracellular ribonuclease LE-lik...    273   4e-87   
ref|XP_011070992.1|  PREDICTED: extracellular ribonuclease LE-like      267   2e-84   
ref|XP_003517990.1|  PREDICTED: ribonuclease 3-like                     266   3e-84   
ref|XP_010683182.1|  PREDICTED: ribonuclease 1-like                     265   3e-84   
ref|XP_010939795.1|  PREDICTED: extracellular ribonuclease LE-like      264   1e-83   
ref|XP_008802596.1|  PREDICTED: extracellular ribonuclease LE-like      264   1e-83   
ref|NP_001235183.1|  uncharacterized protein LOC100306447 precursor     264   2e-83   
ref|XP_011070993.1|  PREDICTED: extracellular ribonuclease LE-lik...    263   4e-83   
ref|XP_010258336.1|  PREDICTED: intracellular ribonuclease LX-like      261   1e-82   
ref|XP_007157616.1|  hypothetical protein PHAVU_002G084500g             261   2e-82   
ref|XP_009117922.1|  PREDICTED: ribonuclease 3-like                     261   2e-82   
emb|CDY33761.1|  BnaA09g45670D                                          261   2e-82   
ref|XP_009626196.1|  PREDICTED: extracellular ribonuclease LE-like      261   3e-82   
ref|XP_004490068.1|  PREDICTED: ribonuclease 3-like                     261   3e-82   
gb|AAA21135.1|  RNase NE                                                260   4e-82   Nicotiana alata [flowering tobacco]
ref|XP_008783985.1|  PREDICTED: extracellular ribonuclease LE-like      259   9e-82   
ref|XP_006827258.1|  hypothetical protein AMTR_s00010p00262550          259   2e-81   
ref|XP_010937157.1|  PREDICTED: extracellular ribonuclease LE-like      258   2e-81   
ref|XP_008790973.1|  PREDICTED: extracellular ribonuclease LE-like      258   2e-81   
ref|XP_002522443.1|  ribonuclease t2, putative                          258   2e-81   Ricinus communis
ref|XP_008339896.1|  PREDICTED: extracellular ribonuclease LE-lik...    258   2e-81   
ref|XP_010937158.1|  PREDICTED: extracellular ribonuclease LE-like      258   3e-81   
ref|XP_008339895.1|  PREDICTED: extracellular ribonuclease LE-lik...    258   3e-81   
ref|XP_010907396.1|  PREDICTED: extracellular ribonuclease LE-like      258   3e-81   
gb|KDP41205.1|  hypothetical protein JCGZ_15612                         258   4e-81   
dbj|BAC77613.1|  ribonuclease NW                                        258   4e-81   Nicotiana glutinosa
ref|XP_007046080.1|  Ribonuclease 3                                     257   5e-81   
gb|AFK41755.1|  unknown                                                 257   8e-81   
emb|CDP00340.1|  unnamed protein product                                257   9e-81   
ref|XP_004297298.1|  PREDICTED: ribonuclease 3-like                     257   1e-80   
pdb|1IYB|A  Chain A, Crystal Structure Of The Nicotiana Glutinosa...    256   1e-80   
ref|XP_006483149.1|  PREDICTED: ribonuclease 3-like                     256   1e-80   
ref|XP_003613795.1|  LCR-like protein                                   256   1e-80   
ref|XP_009793100.1|  PREDICTED: extracellular ribonuclease LE-like      256   2e-80   
ref|XP_010552574.1|  PREDICTED: ribonuclease 3-like                     256   2e-80   
ref|XP_002311303.1|  S-like ribonuclease family protein                 256   2e-80   Populus trichocarpa [western balsam poplar]
ref|XP_010097616.1|  Extracellular ribonuclease LE                      256   2e-80   
emb|CDP00341.1|  unnamed protein product                                256   3e-80   
ref|XP_008389461.1|  PREDICTED: extracellular ribonuclease LE           255   4e-80   
ref|XP_009360333.1|  PREDICTED: extracellular ribonuclease LE-like      255   4e-80   
ref|XP_008221612.1|  PREDICTED: ribonuclease 3-like                     254   6e-80   
ref|XP_007223919.1|  hypothetical protein PRUPE_ppa011014mg             254   6e-80   
ref|XP_006438699.1|  hypothetical protein CICLE_v10032674mg             254   7e-80   
ref|XP_011016376.1|  PREDICTED: ribonuclease 3-like                     254   9e-80   
ref|XP_009110556.1|  PREDICTED: ribonuclease 3-like                     254   1e-79   
ref|XP_011017144.1|  PREDICTED: ribonuclease 3-like                     254   1e-79   
emb|CDX84041.1|  BnaC08g16040D                                          253   2e-79   
gb|AFK33515.1|  unknown                                                 254   2e-79   
gb|AAG09465.1|AF227522_1  S-like ribonuclease                           253   2e-79   Prunus dulcis [sweet almond]
ref|XP_007158650.1|  hypothetical protein PHAVU_002G170800g             253   5e-79   
ref|XP_008339897.1|  PREDICTED: extracellular ribonuclease LE-like      252   5e-79   
ref|XP_009103113.1|  PREDICTED: ribonuclease 3                          252   5e-79   
ref|XP_010527909.1|  PREDICTED: ribonuclease 1                          252   6e-79   
ref|XP_006415967.1|  hypothetical protein EUTSA_v10008717mg             251   8e-79   
ref|XP_004297299.1|  PREDICTED: extracellular ribonuclease LE-like      251   1e-78   
ref|NP_564264.1|  ribonuclease 3                                        251   2e-78   Arabidopsis thaliana [mouse-ear cress]
emb|CDY20583.1|  BnaC07g12500D                                          251   2e-78   
ref|XP_002275271.1|  PREDICTED: extracellular ribonuclease LE           251   2e-78   Vitis vinifera
ref|XP_010477807.1|  PREDICTED: ribonuclease 3                          250   3e-78   
ref|XP_009411173.1|  PREDICTED: extracellular ribonuclease LE-like      250   3e-78   
ref|XP_006305515.1|  hypothetical protein CARUB_v10009986mg             252   4e-78   
ref|XP_002316136.1|  hypothetical protein POPTR_0010s17580g             250   4e-78   Populus trichocarpa [western balsam poplar]
ref|XP_003613789.1|  Ribonuclease T2                                    249   6e-78   
ref|XP_003517989.1|  PREDICTED: ribonuclease 1-like                     249   6e-78   
ref|XP_009360332.1|  PREDICTED: ribonuclease 3-like                     249   7e-78   
gb|KHG28210.1|  Ribonuclease 3 -like protein                            248   2e-77   
ref|XP_011075505.1|  PREDICTED: extracellular ribonuclease LE-like      248   2e-77   
ref|XP_010495851.1|  PREDICTED: ribonuclease 3-like                     248   2e-77   
gb|AAC49326.1|  wounding-induced ribonuclease gene                      248   2e-77   Zinnia violacea [garden zinnia]
ref|XP_010498993.1|  PREDICTED: ribonuclease 3-like                     248   3e-77   
ref|NP_563941.1|  ribonuclease T2                                       248   4e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010258337.1|  PREDICTED: ribonuclease 1-like                     248   4e-77   
ref|NP_001238449.1|  uncharacterized protein LOC100305644 precursor     247   4e-77   
ref|XP_006355102.1|  PREDICTED: extracellular ribonuclease LE-like      247   5e-77   
ref|XP_002892796.1|  ribonuclease T2 family protein                     247   6e-77   
ref|XP_010458911.1|  PREDICTED: ribonuclease 3-like                     247   6e-77   
gb|EYU28760.1|  hypothetical protein MIMGU_mgv1a013386mg                247   6e-77   
ref|XP_008389464.1|  PREDICTED: ribonuclease 3-like                     247   6e-77   
ref|XP_010476468.1|  PREDICTED: ribonuclease 3-like                     247   7e-77   
ref|XP_002522442.1|  ribonuclease t2, putative                          246   9e-77   Ricinus communis
ref|XP_002890631.1|  hypothetical protein ARALYDRAFT_472718             246   9e-77   
ref|XP_006303725.1|  hypothetical protein CARUB_v10011861mg             246   1e-76   
ref|XP_009395130.1|  PREDICTED: extracellular ribonuclease LE-lik...    246   1e-76   
gb|AAC49325.1|  ribonuclease                                            246   2e-76   Zinnia violacea [garden zinnia]
ref|XP_010066906.1|  PREDICTED: ribonuclease 3-like                     246   2e-76   
ref|XP_002311302.1|  S2-RNase family protein                            245   2e-76   Populus trichocarpa [western balsam poplar]
gb|KFK44585.1|  hypothetical protein AALP_AA1G277900                    245   4e-76   
ref|XP_006344331.1|  PREDICTED: ribonuclease 1-like                     245   4e-76   
ref|XP_010476469.1|  PREDICTED: ribonuclease 3-like isoform X1          244   4e-76   
ref|XP_010066908.1|  PREDICTED: ribonuclease 1-like                     244   4e-76   
ref|XP_007046081.1|  Ribonuclease 1                                     244   7e-76   
ref|XP_011017135.1|  PREDICTED: ribonuclease 1-like                     244   1e-75   
ref|XP_009401398.1|  PREDICTED: extracellular ribonuclease LE-like      244   1e-75   
ref|NP_001266087.1|  ribonuclease 1-like precursor                      244   1e-75   
gb|KHG28209.1|  Ribonuclease 1 -like protein                            244   1e-75   
ref|NP_001234195.1|  extracellular ribonuclease LE precursor            243   2e-75   
ref|XP_010683181.1|  PREDICTED: extracellular ribonuclease LE-like      243   2e-75   
ref|XP_009117923.1|  PREDICTED: ribonuclease 3-like                     243   2e-75   
ref|XP_010425075.1|  PREDICTED: ribonuclease 1                          243   2e-75   
gb|KDP41204.1|  hypothetical protein JCGZ_15611                         243   2e-75   
pdb|1DIX|A  Chain A, Crystal Structure Of Rnase Le                      242   3e-75   
ref|XP_003613791.1|  Ribonuclease T2                                    243   3e-75   
ref|XP_006438697.1|  hypothetical protein CICLE_v10032651mg             242   5e-75   
dbj|BAF03592.1|  S-like RNase                                           242   5e-75   Fagopyrum esculentum
ref|XP_010495841.1|  PREDICTED: ribonuclease 3-like                     241   5e-75   
dbj|BAF03593.1|  S-like RNase                                           242   5e-75   Fagopyrum homotropicum
dbj|BAF03591.1|  S-like RNase                                           242   6e-75   Fagopyrum esculentum
ref|XP_006483150.1|  PREDICTED: extracellular ribonuclease LE-like      242   6e-75   
ref|XP_010514069.1|  PREDICTED: ribonuclease 1-like                     242   6e-75   
gb|KHN12205.1|  Ribonuclease 1                                          241   1e-74   
gb|KDO82931.1|  hypothetical protein CISIN_1g026944mg                   241   1e-74   
ref|XP_011013416.1|  PREDICTED: LOW QUALITY PROTEIN: ribonuclease 1     241   1e-74   
ref|XP_004973521.1|  PREDICTED: ribonuclease 1-like                     241   1e-74   
ref|XP_010066907.1|  PREDICTED: ribonuclease 1-like                     241   2e-74   
ref|XP_010502310.1|  PREDICTED: ribonuclease 1-like                     241   2e-74   
ref|XP_009129105.1|  PREDICTED: ribonuclease 1                          241   2e-74   
ref|XP_008446355.1|  PREDICTED: ribonuclease 1-like                     241   2e-74   
ref|XP_006291795.1|  hypothetical protein CARUB_v10017969mg             240   2e-74   
gb|ABK28493.1|  unknown                                                 240   2e-74   Arabidopsis thaliana [mouse-ear cress]
gb|KHG25338.1|  Extracellular ribonuclease LE                           240   2e-74   
ref|XP_011075506.1|  PREDICTED: intracellular ribonuclease LX-like      240   2e-74   
ref|NP_178399.1|  ribonuclease 1                                        240   3e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004237041.1|  PREDICTED: extracellular ribonuclease LE-like      241   3e-74   
emb|CDY09344.1|  BnaA02g26660D                                          240   4e-74   
gb|AAM63798.1|  ribonuclease, RNS1                                      240   4e-74   Arabidopsis thaliana [mouse-ear cress]
gb|KFK33495.1|  hypothetical protein AALP_AA5G020500                    240   4e-74   
emb|CDY62181.1|  BnaCnng39460D                                          239   4e-74   
ref|XP_006395743.1|  hypothetical protein EUTSA_v10004863mg             239   6e-74   
dbj|BAB19805.1|  ribonuclease                                           239   7e-74   Oryza sativa Japonica Group [Japonica rice]
dbj|BAO05320.1|  S-like ribonuclease                                    239   9e-74   
ref|XP_002875183.1|  ribonuclease, RNS1                                 239   9e-74   
emb|CDX81621.1|  BnaC08g39800D                                          251   1e-73   
ref|NP_001061877.1|  Os08g0434100                                       239   1e-73   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ07095.1|  hypothetical protein OsI_29344                          239   1e-73   Oryza sativa Indica Group [Indian rice]
ref|XP_003518732.1|  PREDICTED: ribonuclease 1-like                     238   1e-73   
ref|XP_006355103.1|  PREDICTED: intracellular ribonuclease LX-like      238   1e-73   
emb|CDY33762.1|  BnaA09g45680D                                          237   4e-73   
ref|XP_008446356.1|  PREDICTED: ribonuclease 3-like                     237   6e-73   
ref|NP_001234551.1|  intracellular ribonuclease LX precursor            237   7e-73   
emb|CAB40355.1|  ribonuclease T2                                        237   7e-73   Solanum lycopersicum
ref|XP_009783064.1|  PREDICTED: intracellular ribonuclease LX-lik...    237   8e-73   
ref|XP_004135175.1|  PREDICTED: ribonuclease 3-like                     236   8e-73   
ref|XP_008221730.1|  PREDICTED: ribonuclease 1                          236   1e-72   
gb|AAS01727.1|  S-like RNase                                            236   2e-72   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010527911.1|  PREDICTED: ribonuclease 3-like                     235   2e-72   
ref|XP_006344267.1|  PREDICTED: intracellular ribonuclease LX-like      236   3e-72   
emb|CDP00339.1|  unnamed protein product                                235   3e-72   
ref|XP_004135454.1|  PREDICTED: extracellular ribonuclease LE-like      235   3e-72   
ref|XP_004155386.1|  PREDICTED: LOW QUALITY PROTEIN: extracellula...    235   4e-72   
ref|XP_010265111.1|  PREDICTED: ribonuclease 1-like                     234   5e-72   
ref|NP_001131005.1|  uncharacterized protein LOC100192110 precursor     234   5e-72   Zea mays [maize]
ref|XP_010683180.1|  PREDICTED: ribonuclease 1-like                     234   8e-72   
ref|XP_007223921.1|  hypothetical protein PRUPE_ppa011026mg             234   8e-72   
ref|XP_010462695.1|  PREDICTED: ribonuclease 3-like                     233   1e-71   
ref|XP_006438698.1|  hypothetical protein CICLE_v10032651mg             233   2e-71   
gb|AAF82615.1|AF157011_1  S-like ribonuclease                           233   2e-71   Prunus dulcis [sweet almond]
ref|XP_007157617.1|  hypothetical protein PHAVU_002G084600g             232   3e-71   
ref|XP_009395131.1|  PREDICTED: extracellular ribonuclease LE-lik...    232   4e-71   
ref|XP_002445549.1|  hypothetical protein SORBIDRAFT_07g021330          232   4e-71   Sorghum bicolor [broomcorn]
ref|XP_009793099.1|  PREDICTED: intracellular ribonuclease LX-like      232   4e-71   
dbj|BAO05321.1|  S-like ribonuclease                                    232   4e-71   
ref|XP_003574555.2|  PREDICTED: ribonuclease 1-like                     236   7e-71   
ref|XP_009626195.1|  PREDICTED: intracellular ribonuclease LX-like      231   1e-70   
dbj|BAH22709.1|  S-like ribonuclease                                    231   1e-70   Dionaea muscipula
gb|AAS07016.1|  S-like RNase                                            229   3e-70   Triticum aestivum [Canadian hard winter wheat]
dbj|BAN14351.1|  S-like ribonuclease                                    229   3e-70   
emb|CDP00337.1|  unnamed protein product                                229   4e-70   
gb|EMS55779.1|  Ribonuclease 3                                          230   5e-70   
dbj|BAN14352.1|  S-like ribonuclease                                    229   6e-70   
ref|XP_006659433.1|  PREDICTED: extracellular ribonuclease LE-like      229   1e-69   
gb|KCW64954.1|  hypothetical protein EUGRSUZ_G02498                     227   1e-69   
pdb|1VCZ|A  Chain A, Crystal Structure Of The Rnase Nt In Complex...    227   3e-69   
gb|EYU28761.1|  hypothetical protein MIMGU_mgv1a012841mg                227   4e-69   
dbj|BAA84469.1|  RNase NGR3                                             227   4e-69   Nicotiana glutinosa
emb|CDY03023.1|  BnaC07g22040D                                          227   5e-69   
ref|XP_009152222.1|  PREDICTED: ribonuclease 1-like                     227   5e-69   
ref|XP_010108673.1|  Ribonuclease 3                                     225   7e-69   
dbj|BAE16663.1|  ribonuclease                                           225   2e-68   Drosera adelae
dbj|BAJ96489.1|  predicted protein                                      225   2e-68   
emb|CDP00338.1|  unnamed protein product                                224   4e-68   
dbj|BAO05319.1|  S-like ribonuclease                                    223   2e-67   
gb|AAB58719.1|  ribonuclease                                            221   4e-67   Hordeum vulgare [barley]
ref|NP_001237086.1|  uncharacterized protein LOC100527255               221   1e-66   
dbj|BAJ99985.1|  predicted protein                                      219   5e-66   
emb|CAB40354.1|  ribonuclease T2                                        217   1e-65   Solanum lycopersicum
ref|XP_010480471.1|  PREDICTED: ribonuclease 3-like                     215   4e-65   
gb|EMT12880.1|  Ribonuclease 1                                          214   2e-64   
ref|XP_004490067.1|  PREDICTED: ribonuclease 1-like                     214   3e-64   
ref|XP_002965999.1|  hypothetical protein SELMODRAFT_270532             211   7e-63   
gb|ACV83770.1|  RNase Phy1                                              208   1e-62   Petunia x hybrida [garden petunia]
emb|CAJ77498.1|  putative ribonuclease T2 precursor                     206   2e-61   Solanum tuberosum [potatoes]
ref|XP_003613797.1|  LCR-like protein                                   207   3e-61   
gb|KFK43663.1|  hypothetical protein AALP_AA1G156800                    206   1e-60   
emb|CDY33763.1|  BnaA09g45690D                                          202   2e-59   
ref|XP_009117927.1|  PREDICTED: ribonuclease 1                          202   4e-59   
ref|XP_011071277.1|  PREDICTED: ribonuclease 1-like                     201   5e-59   
ref|XP_010476460.1|  PREDICTED: ribonuclease 3-like isoform X1          201   7e-59   
ref|XP_001783305.1|  predicted protein                                  201   1e-58   
ref|XP_008350926.1|  PREDICTED: LOW QUALITY PROTEIN: ribonuclease...    199   1e-58   
ref|XP_010458907.1|  PREDICTED: ribonuclease 3-like                     199   5e-58   
ref|XP_003613800.1|  LCR-like protein                                   198   8e-58   
ref|NP_563940.1|  ribonuclease T2 family protein                        197   1e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006417041.1|  hypothetical protein EUTSA_v10008594mg             197   3e-57   
ref|XP_006304136.1|  hypothetical protein CARUB_v10010110mg             196   4e-57   
ref|XP_001763141.1|  predicted protein                                  196   6e-57   
gb|AAQ22605.1|  At1g14210                                               195   1e-56   Arabidopsis thaliana [mouse-ear cress]
gb|AAB58718.1|  aleurone ribonuclease                                   194   2e-56   Hordeum vulgare [barley]
gb|EMT26752.1|  Ribonuclease 1                                          192   1e-55   
gb|EMS61800.1|  Ribonuclease 1                                          194   1e-55   
ref|XP_002892795.1|  ribonuclease T2 family protein                     192   1e-55   
gb|ACV83767.1|  RNase Phy5                                              190   1e-55   Petunia x hybrida [garden petunia]
ref|XP_009783068.1|  PREDICTED: intracellular ribonuclease LX-lik...    190   4e-55   
ref|XP_010495828.1|  PREDICTED: ribonuclease 3-like                     191   7e-55   
ref|XP_002967396.1|  hypothetical protein SELMODRAFT_87215              188   2e-54   
ref|XP_002960316.1|  hypothetical protein SELMODRAFT_75785              188   2e-54   
gb|EMS60319.1|  Ribonuclease 1                                          189   2e-54   
ref|XP_010683178.1|  PREDICTED: ribonuclease 1-like                     188   5e-54   
ref|XP_010683174.1|  PREDICTED: ribonuclease 1-like                     186   2e-53   
ref|XP_010248021.1|  PREDICTED: extracellular ribonuclease LE-like      186   3e-53   
gb|EMS46663.1|  Ribonuclease 1                                          184   1e-52   
gb|AFK35821.1|  unknown                                                 183   3e-52   
gb|AAB46384.1|  storage protein                                         182   1e-51   Nelumbo nucifera [Indian lotus]
ref|XP_010683175.1|  PREDICTED: ribonuclease 3-like isoform X1          181   2e-51   
ref|XP_010683173.1|  PREDICTED: ribonuclease 1-like                     181   3e-51   
gb|EMT26753.1|  Ribonuclease 1                                          181   3e-51   
gb|AAD39309.1|AC007576_32  Very similar to ribonucleases                181   3e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006657993.1|  PREDICTED: ribonuclease 1-like                     181   3e-51   
ref|XP_009796409.1|  PREDICTED: extracellular ribonuclease LE-lik...    181   5e-51   
ref|NP_001060356.1|  Os07g0630400                                       179   4e-50   Oryza sativa Japonica Group [Japonica rice]
gb|EAY85177.1|  hypothetical protein OsI_06534                          178   4e-50   Oryza sativa Indica Group [Indian rice]
gb|KEH27820.1|  ribonuclease T2 family protein                          177   5e-50   
ref|XP_004958409.1|  PREDICTED: ribonuclease 1-like                     177   1e-49   
ref|XP_010683386.1|  PREDICTED: ribonuclease 1-like                     174   1e-48   
ref|XP_003562632.1|  PREDICTED: ribonuclease 1-like                     174   3e-48   
ref|XP_004958410.1|  PREDICTED: ribonuclease 1-like                     172   8e-48   
ref|XP_003613802.1|  S-like ribonuclease                                177   8e-47   
emb|CDP14821.1|  unnamed protein product                                168   2e-46   
ref|XP_002461070.1|  hypothetical protein SORBIDRAFT_02g040170          167   9e-46   Sorghum bicolor [broomcorn]
tpg|DAA63734.1|  TPA: ribonuclease 1                                    167   1e-45   
ref|NP_001151299.1|  ribonuclease 1 precursor                           162   7e-44   Zea mays [maize]
ref|XP_009796410.1|  PREDICTED: intracellular ribonuclease LX-lik...    158   2e-42   
gb|EEE68746.1|  hypothetical protein OsJ_27436                          158   2e-42   Oryza sativa Japonica Group [Japonica rice]
gb|EPS67237.1|  hypothetical protein M569_07540                         153   7e-42   
emb|CDX81620.1|  BnaC08g39810D                                          154   3e-41   
ref|XP_009395805.1|  PREDICTED: ribonuclease 3-like                     154   5e-41   
ref|XP_010656419.1|  PREDICTED: extracellular ribonuclease LE-like      150   2e-39   
ref|XP_008785941.1|  PREDICTED: extracellular ribonuclease LE-lik...    150   2e-39   
emb|CBI27451.3|  unnamed protein product                                146   4e-39   
ref|XP_004301762.1|  PREDICTED: uncharacterized protein LOC101311199    154   8e-39   
gb|AAF45043.1|AF182197_1  RNase S-like protein precursor                147   4e-38   Hordeum vulgare [barley]
gb|EMS67355.1|  Ribonuclease 1                                          146   8e-38   
ref|XP_010912919.1|  PREDICTED: ribonuclease 3-like                     144   3e-37   
ref|XP_009365767.1|  PREDICTED: ribonuclease 1-like                     142   1e-36   
ref|XP_006660899.1|  PREDICTED: ribonuclease 1-like                     143   1e-36   
gb|AAM80567.1|  RNase S-like protein                                    141   3e-36   Hordeum vulgare [barley]
gb|AAM18521.1|  S-like RNase                                            141   5e-36   Triticum aestivum [Canadian hard winter wheat]
gb|EMT30713.1|  Ribonuclease 1                                          141   8e-36   
ref|XP_008650765.1|  PREDICTED: knotted1 induced1 isoform X1            140   1e-35   
ref|XP_002316135.1|  S-like ribonuclease family protein                 137   1e-35   Populus trichocarpa [western balsam poplar]
dbj|BAD34237.1|  putative RNase S-like protein precursor                140   2e-35   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ09899.1|  hypothetical protein OsI_32193                          139   5e-35   Oryza sativa Indica Group [Indian rice]
ref|XP_006660898.1|  PREDICTED: ribonuclease 1-like                     138   6e-35   
ref|XP_006304137.1|  hypothetical protein CARUB_v10010110mg             136   8e-35   
gb|AGT17218.1|  Ribonuclease T2 family protein                          138   9e-35   
ref|XP_010925305.1|  PREDICTED: extracellular ribonuclease LE-like      137   1e-34   
gb|ACG27812.1|  extracellular ribonuclease LE precursor                 137   1e-34   Zea mays [maize]
ref|XP_002461071.1|  hypothetical protein SORBIDRAFT_02g040180          136   2e-34   Sorghum bicolor [broomcorn]
ref|XP_002462742.1|  hypothetical protein SORBIDRAFT_02g031170          136   5e-34   Sorghum bicolor [broomcorn]
tpg|DAA64356.1|  TPA: extracellular ribonuclease LE                     135   7e-34   
ref|XP_004957484.1|  PREDICTED: ribonuclease 3-like isoform X2          135   1e-33   
gb|AGT17217.1|  Ribonuclease T2 family protein                          134   2e-33   
ref|NP_001063794.2|  Os09g0538000                                       134   2e-33   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ09897.1|  hypothetical protein OsI_32190                          134   4e-33   Oryza sativa Indica Group [Indian rice]
gb|ABR25970.1|  ribonuclease 3 precursor                                133   4e-33   Oryza sativa Indica Group [Indian rice]
ref|NP_001063793.1|  Os09g0537700                                       134   4e-33   Oryza sativa Japonica Group [Japonica rice]
gb|AAL33776.1|  drought-induced S-like ribonuclease                     133   4e-33   Oryza sativa [red rice]
ref|XP_002462741.1|  hypothetical protein SORBIDRAFT_02g031160          133   5e-33   Sorghum bicolor [broomcorn]
ref|NP_001106070.1|  knotted1 induced1 precursor                        134   5e-33   Zea mays [maize]
ref|XP_010269492.1|  PREDICTED: extracellular ribonuclease LE-like      133   6e-33   
gb|ACG31122.1|  extracellular ribonuclease LE precursor                 132   1e-32   
ref|XP_008791750.1|  PREDICTED: ribonuclease 3-like                     131   5e-32   
gb|EMT31573.1|  Ribonuclease 1                                          130   3e-31   
tpg|DAA64357.1|  TPA: hypothetical protein ZEAMMB73_880167              127   3e-31   
ref|XP_002512930.1|  ribonuclease t2, putative                          128   3e-31   
ref|XP_005824584.1|  hypothetical protein GUITHDRAFT_116245             127   7e-31   
ref|XP_010259636.1|  PREDICTED: extracellular ribonuclease LE-like      126   2e-30   
dbj|BAA10891.1|  ribonuclease (RNase LC1)                               124   5e-30   
ref|XP_002946824.1|  S-like RNase                                       123   6e-30   
pdb|1UCG|A  Chain A, Crystal Structure Of Ribonuclease Mc1 N71t M...    123   6e-30   
ref|NP_001274161.1|  uncharacterized protein LOC101779804 precursor     125   7e-30   
gb|EAZ04800.1|  hypothetical protein OsI_26973                          125   8e-30   
ref|XP_010912810.1|  PREDICTED: extracellular ribonuclease LE-like      124   1e-29   
ref|XP_010320924.1|  PREDICTED: extracellular ribonuclease LE-lik...    120   1e-29   
ref|XP_010320923.1|  PREDICTED: extracellular ribonuclease LE-lik...    120   1e-29   
ref|XP_009416654.1|  PREDICTED: ribonuclease 3-like                     124   1e-29   
pdb|1J1F|A  Chain A, Crystal Structure Of The Rnase Mc1 Mutant N7...    121   3e-29   
ref|XP_008238073.1|  PREDICTED: ribonuclease 1-like                     120   3e-29   
pdb|1BK7|A  Chain A, Ribonuclease Mc1 From The Seeds Of Bitter Gourd    121   4e-29   
sp|P23540.1|RNMC_MOMCH  RecName: Full=Ribonuclease MC; Short=RNas...    121   4e-29   
pdb|1J1G|A  Chain A, Crystal Structure Of The Rnase Mc1 Mutant N7...    120   7e-29   
ref|XP_010251385.1|  PREDICTED: ribonuclease 2-like                     122   1e-28   
ref|XP_010271085.1|  PREDICTED: extracellular ribonuclease LE-like      120   1e-28   
ref|XP_009416010.1|  PREDICTED: extracellular ribonuclease LE-like      121   1e-28   
gb|ADA67882.1|  S-like RNase                                            121   2e-28   
ref|XP_008443402.1|  PREDICTED: ribonuclease MC-like                    120   2e-28   
dbj|BAA95359.1|  S-like RNase                                           120   2e-28   
dbj|BAC20680.1|  putative aleurone ribonuclease                         120   2e-28   
ref|XP_010542069.1|  PREDICTED: ribonuclease 2                          120   4e-28   
ref|XP_002947011.1|  S-like RNase                                       120   5e-28   
ref|XP_004298428.1|  PREDICTED: extracellular ribonuclease LE-like      116   8e-28   
gb|ACR19180.1|  S-like RNase                                            119   1e-27   
ref|XP_006469367.1|  PREDICTED: ribonuclease 2-like                     119   1e-27   
pdb|1V9H|A  Chain A, Crystal Structure Of The Rnase Mc1 Mutant Y1...    117   2e-27   
ref|XP_010069564.1|  PREDICTED: ribonuclease 2-like                     118   2e-27   
ref|XP_002879817.1|  hypothetical protein ARALYDRAFT_903231             117   3e-27   
gb|ACV95496.1|  ribonuclease                                            116   5e-27   
ref|XP_004147499.1|  PREDICTED: ribonuclease MC-like                    116   5e-27   
ref|XP_010912809.1|  PREDICTED: ribonuclease 1-like                     117   5e-27   
ref|XP_004957483.1|  PREDICTED: ribonuclease 3-like isoform X1          117   7e-27   
gb|ACY00699.1|  S-like RNase                                            117   9e-27   
gb|KCW57946.1|  hypothetical protein EUGRSUZ_H00686                     116   1e-26   
ref|XP_002512928.1|  ribonuclease t2, putative                          115   1e-26   
ref|XP_009139666.1|  PREDICTED: ribonuclease 2                          116   1e-26   
ref|XP_008447208.1|  PREDICTED: ribonuclease 2-like                     116   1e-26   
gb|ABR25508.1|  ribonuclease 3 precursor                                114   1e-26   
dbj|BAE06157.1|  RNase Bm2                                              115   1e-26   
ref|XP_011006741.1|  PREDICTED: ribonuclease 2                          116   1e-26   
ref|NP_030524.1|  ribonuclease 2                                        115   2e-26   
ref|XP_011089580.1|  PREDICTED: ribonuclease 2                          116   2e-26   
ref|XP_010908763.1|  PREDICTED: ribonuclease 2                          115   3e-26   
ref|XP_004333567.1|  ribonuclease, T2 family                            116   3e-26   
ref|XP_006294824.1|  hypothetical protein CARUB_v10023875mg             115   3e-26   
ref|XP_010517341.1|  PREDICTED: ribonuclease 2-like isoform X2          114   3e-26   
ref|XP_010517340.1|  PREDICTED: ribonuclease 2-like isoform X1          115   4e-26   
ref|XP_008788242.1|  PREDICTED: ribonuclease 2                          114   4e-26   
gb|ADA67883.1|  S-like RNase                                            115   4e-26   
ref|XP_010505665.1|  PREDICTED: ribonuclease 2                          114   5e-26   
ref|XP_002321228.1|  hypothetical protein POPTR_0014s17280g             114   6e-26   
ref|XP_010646091.1|  PREDICTED: ribonuclease 2-like                     114   6e-26   
ref|XP_001691379.1|  predicted protein                                  113   6e-26   
ref|XP_010647483.1|  PREDICTED: ribonuclease 2-like                     114   6e-26   
gb|KCW57950.1|  hypothetical protein EUGRSUZ_H00686                     113   1e-25   
ref|XP_010069562.1|  PREDICTED: ribonuclease 2-like                     113   1e-25   
gb|ACJ22520.1|  S7-2 RNase                                              112   1e-25   
ref|XP_004147497.1|  PREDICTED: ribonuclease MC-like                    112   1e-25   
dbj|BAC20676.1|  putative aleurone ribonuclease                         112   2e-25   
ref|XP_004159644.1|  PREDICTED: ribonuclease MC-like                    112   2e-25   
ref|XP_009600252.1|  PREDICTED: ribonuclease 2-like isoform X2          112   3e-25   
ref|XP_009600251.1|  PREDICTED: ribonuclease 2-like isoform X1          112   3e-25   
dbj|BAG87969.1|  unnamed protein product                                112   4e-25   
gb|ABK92675.1|  unknown                                                 112   5e-25   
ref|XP_010508972.1|  PREDICTED: ribonuclease 2-like                     111   5e-25   
ref|XP_007135209.1|  hypothetical protein PHAVU_010G110200g             111   6e-25   
ref|XP_009789347.1|  PREDICTED: ribonuclease 2-like isoform X3          111   8e-25   
gb|ADZ48268.1|  S-locus-associated ribonuclease                         110   9e-25   
ref|XP_640939.1|  ribonuclease T2                                       110   1e-24   
ref|XP_009417013.1|  PREDICTED: extracellular ribonuclease LE-like      110   1e-24   
dbj|BAA84468.1|  RNase NGR2                                             111   1e-24   
dbj|BAA36389.1|  S3-RNase                                               110   1e-24   
ref|XP_008785950.1|  PREDICTED: ribonuclease 3-like isoform X2          108   1e-24   
gb|AAP92437.1|  S-RNase                                                 109   1e-24   
ref|XP_004148942.1|  PREDICTED: ribonuclease 2-like                     110   1e-24   
ref|XP_009789346.1|  PREDICTED: ribonuclease 2-like isoform X2          110   1e-24   
ref|XP_004246242.1|  PREDICTED: ribonuclease 2                          110   1e-24   
ref|XP_009789345.1|  PREDICTED: ribonuclease 2-like isoform X1          110   2e-24   
ref|XP_003564836.1|  PREDICTED: ribonuclease 2-like                     110   2e-24   
gb|AAT69244.1|  S1-RNase protein                                        109   2e-24   
ref|XP_007201311.1|  hypothetical protein PRUPE_ppa009963mg             110   2e-24   
ref|XP_004161534.1|  PREDICTED: LOW QUALITY PROTEIN: ribonuclease...    110   3e-24   
ref|XP_006344344.1|  PREDICTED: ribonuclease 2-like                     110   3e-24   
ref|XP_008235857.1|  PREDICTED: ribonuclease 2                          110   3e-24   
gb|ABA26543.1|  S-RNase                                                 108   3e-24   
ref|XP_008372666.1|  PREDICTED: ribonuclease 2-like                     109   3e-24   
ref|XP_004290105.1|  PREDICTED: ribonuclease 2-like                     109   4e-24   
dbj|BAA10892.1|  ribonuclease (RNase LC2)                               107   5e-24   
ref|XP_003548554.1|  PREDICTED: ribonuclease 2-like                     108   6e-24   
gb|EYU40680.1|  hypothetical protein MIMGU_mgv1a011299mg                108   7e-24   
dbj|GAM22940.1|  hypothetical protein SAMD00019534_061150               107   7e-24   
dbj|BAC00933.1|  S25-RNase                                              107   7e-24   
emb|CAC50874.1|  S-like RNAse 28                                        108   7e-24   
gb|KFV73696.1|  Ribonuclease T2                                         107   8e-24   
gb|AFK42606.1|  unknown                                                 107   9e-24   
gb|ACU25553.1|  self-incompatibility associated ribonuclease S2         107   9e-24   
gb|AAB26702.1|  stylar protein                                          107   9e-24   
ref|XP_004510730.1|  PREDICTED: ribonuclease 2-like                     108   9e-24   
ref|XP_008356274.1|  PREDICTED: ribonuclease 2-like                     107   1e-23   
gb|ABG76213.1|  S-RNase                                                 106   1e-23   
gb|ABY82412.1|  self-incompatibility associated ribonuclease            107   1e-23   
emb|CAD29435.1|  S-ribonuclease                                         107   1e-23   
emb|CAA53666.1|  S-RNase S3                                             106   1e-23   
gb|ABA26546.1|  S-RNase                                                 106   2e-23   
gb|ADZ76512.1|  S-locus associated ribonuclease                         106   2e-23   
ref|NP_001045086.1|  Os01g0897200                                       107   2e-23   
gb|EYU46083.1|  hypothetical protein MIMGU_mgv1a011196mg                107   2e-23   
emb|CAD33235.1|  S-like RNase                                           107   2e-23   
gb|EYU46082.1|  hypothetical protein MIMGU_mgv1a011196mg                107   2e-23   
ref|XP_004506021.1|  PREDICTED: ribonuclease 3-like                     107   2e-23   
emb|CDY60490.1|  BnaC04g55920D                                          107   2e-23   
dbj|BAF56246.1|  S-RNase                                                104   2e-23   
gb|ABV02074.1|  S-locus S-RNase S15                                     105   2e-23   
ref|XP_009679140.1|  PREDICTED: ribonuclease T2 isoform X1              106   2e-23   
dbj|BAC20937.1|  Sd-RNase                                               105   3e-23   
dbj|BAF91848.1|  Se-RNase                                               106   3e-23   
ref|XP_004367303.1|  ribonuclease T2                                    106   3e-23   
dbj|BAJ41467.1|  S-ribonuclease 3                                       106   3e-23   
ref|XP_004137987.1|  PREDICTED: ribonuclease 1-like                     106   3e-23   
gb|AFK35006.1|  unknown                                                 107   3e-23   
ref|XP_010679023.1|  PREDICTED: ribonuclease 2                          107   3e-23   
dbj|BAG97613.1|  unnamed protein product                                107   3e-23   
ref|XP_008382535.1|  PREDICTED: ribonuclease 2-like                     106   3e-23   
gb|ABY82413.1|  self-incompatibility associated ribonuclease            105   3e-23   
ref|XP_010480470.1|  PREDICTED: ribonuclease 3-like                     102   4e-23   
gb|ABW08113.1|  S7-RNase                                                105   4e-23   
ref|XP_002524581.1|  ribonuclease t2, putative                          106   4e-23   
gb|AAF82612.2|AF157008_1  self-incompatibility associated ribonuc...    105   4e-23   
ref|XP_004148699.1|  PREDICTED: ribonuclease 1-like                     105   4e-23   
gb|ABW74348.1|  S35-RNase                                               105   5e-23   
emb|CDY39709.1|  BnaA04g07260D                                          106   5e-23   
emb|CBI27389.3|  unnamed protein product                                101   5e-23   
gb|ABW74347.1|  S34-RNase                                               105   5e-23   
gb|AAX38606.1|  ribonuclease S3                                         103   5e-23   
gb|ADZ74121.1|  self-incompatibility associated ribonuclease S1         105   6e-23   
gb|KFO53953.1|  Ribonuclease T2                                         104   6e-23   
gb|ABW08114.1|  S26-RNase                                               105   6e-23   
gb|AAT69245.1|  S2-RNase protein                                        105   7e-23   
ref|XP_006134572.1|  PREDICTED: ribonuclease T2 isoform X2              105   7e-23   
gb|ABV72003.1|  S15-RNase                                               104   7e-23   
ref|XP_009695114.1|  PREDICTED: ribonuclease T2                         105   7e-23   
ref|XP_008498179.1|  PREDICTED: ribonuclease T2                         105   8e-23   
gb|ADZ48267.1|  S-locus-associated ribonuclease                         104   8e-23   
ref|XP_003528806.1|  PREDICTED: ribonuclease 2-like                     105   9e-23   
gb|KHN27253.1|  Ribonuclease 2                                          105   9e-23   
ref|XP_005527009.1|  PREDICTED: LOW QUALITY PROTEIN: ribonuclease T2    105   9e-23   
gb|KFQ43003.1|  Ribonuclease T2                                         104   1e-22   
gb|ABA26545.1|  S-RNase                                                 104   1e-22   
gb|ABY65899.1|  S-RNase                                                 104   1e-22   
ref|XP_008459317.1|  PREDICTED: ribonuclease 1-like isoform X1          104   1e-22   
pdb|1JY5|A  Chain A, Rnase-Related Protein From Calystegia Sepium       103   1e-22   
gb|ADZ48271.1|  S-locus-associated ribonuclease                         103   1e-22   
gb|KFV71801.1|  Ribonuclease T2                                         103   1e-22   
gb|ABY82414.1|  self-incompatibility associated ribonuclease            103   2e-22   
ref|XP_006134571.1|  PREDICTED: ribonuclease T2 isoform X1              104   2e-22   
ref|XP_010128315.1|  PREDICTED: ribonuclease T2                         104   2e-22   
gb|AAA33730.1|  Sx-protein                                              103   2e-22   
gb|ABY65900.1|  S-RNase                                                 103   2e-22   
ref|XP_008641624.1|  PREDICTED: ribonuclease T2                         104   2e-22   
dbj|BAF56259.1|  S-RNase                                                102   2e-22   
ref|XP_009417014.1|  PREDICTED: ribonuclease 3-like                     104   2e-22   
dbj|BAA36387.1|  S2-RNase                                               103   2e-22   
gb|ABB40578.1|  ribonuclease S26-RNase                                  103   2e-22   
dbj|BAF42762.1|  Sk-RNase                                               103   2e-22   
gb|EMS54491.1|  Ribonuclease 1                                          103   2e-22   
gb|ABV71999.1|  S11-RNase                                               103   2e-22   
gb|ADZ74126.1|  self-incompatibility associated ribonuclease S8         103   2e-22   
emb|CAC27785.1|  RNase S2                                               103   2e-22   
gb|ACD31530.1|  S-RNase                                                 102   2e-22   
ref|XP_006577070.1|  PREDICTED: ribonuclease S-7-like                   103   2e-22   
dbj|BAC75458.1|  Sk-RNase                                               102   2e-22   
ref|XP_009679148.1|  PREDICTED: ribonuclease T2 isoform X2              102   2e-22   
ref|XP_010015859.1|  PREDICTED: ribonuclease T2                         103   2e-22   
gb|ABG76211.1|  S-RNase                                                 102   3e-22   
ref|XP_008173764.1|  PREDICTED: ribonuclease T2                         103   3e-22   
ref|XP_004176401.1|  PREDICTED: ribonuclease T2                         103   3e-22   
gb|EPS70004.1|  hypothetical protein M569_04758                         102   3e-22   
gb|ABF61823.1|  Sh-RNase                                                103   3e-22   
gb|KFQ26952.1|  Ribonuclease T2                                         102   3e-22   
gb|ABJ97522.1|  S-RNase                                                 103   3e-22   
ref|XP_010194620.1|  PREDICTED: ribonuclease T2                         103   3e-22   
dbj|GAA50115.1|  ribonuclease Oy                                        103   3e-22   
ref|XP_003567359.2|  PREDICTED: ribonuclease 2-like                     104   3e-22   
gb|EOB01602.1|  Ribonuclease T2                                         103   3e-22   
ref|XP_009358930.1|  PREDICTED: ribonuclease 2                          103   3e-22   
gb|ACG36234.1|  ribonuclease 2 precursor                                103   3e-22   
ref|XP_009904648.1|  PREDICTED: ribonuclease T2                         103   3e-22   
gb|KFQ15345.1|  Ribonuclease T2                                         102   4e-22   
gb|ABN09749.1|  Ribonuclease T2; Thioredoxin domain 2; Thioredoxi...    104   4e-22   
gb|KFV45796.1|  Ribonuclease T2                                         102   4e-22   
ref|XP_003792469.1|  PREDICTED: ribonuclease T2                         103   4e-22   
gb|EFA82171.1|  ribonuclease T2                                         102   4e-22   
gb|ADZ48270.1|  S-locus-associated ribonuclease                         102   4e-22   
gb|AAN76453.1|  self-incompatibility ribonuclease                       102   4e-22   
gb|ABV02075.1|  S-locus S-RNase S16                                     102   4e-22   
gb|KFP17849.1|  Ribonuclease T2                                         102   4e-22   
ref|XP_003594130.1|  Protein disulfide-isomerase A6                     104   4e-22   
ref|XP_003637821.1|  S7-RNase                                           102   4e-22   
gb|KFM04131.1|  Ribonuclease T2                                         102   4e-22   
gb|KFM24260.1|  Ribonuclease DdI                                        104   5e-22   
dbj|BAC20945.1|  Si-RNase                                               101   5e-22   
ref|XP_005019278.1|  PREDICTED: LOW QUALITY PROTEIN: ribonuclease T2    103   5e-22   
dbj|BAH22122.1|  S-RNase                                                102   5e-22   
gb|ABL86027.1|  S-RNase                                                 102   5e-22   
dbj|BAF56273.1|  S-RNase                                                100   5e-22   
gb|KHN18763.1|  Intracellular ribonuclease LX                           103   5e-22   
ref|XP_009639360.1|  PREDICTED: ribonuclease T2                         102   5e-22   
dbj|BAA24017.1|  ribonuclease                                           102   6e-22   
ref|XP_005416410.1|  PREDICTED: LOW QUALITY PROTEIN: ribonuclease T2    103   6e-22   
dbj|BAA83479.1|  S1-RNase                                               102   6e-22   
ref|XP_009417017.1|  PREDICTED: ribonuclease 1-like                     103   6e-22   
gb|KFQ33601.1|  Ribonuclease T2                                         102   6e-22   
gb|KFW70771.1|  Ribonuclease T2                                         102   6e-22   



>ref|XP_011070994.1| PREDICTED: extracellular ribonuclease LE-like isoform X2 [Sesamum 
indicum]
Length=226

 Score =   273 bits (698),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 152/194 (78%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDTK+ CCYP+ GKPA NF+IHGLWP + N ++P NCN NS YD +K+
Sbjct  28   FFYFVQQWPGSYCDTKRSCCYPTAGKPAANFTIHGLWPNYNNATYPSNCNKNSPYDGTKV  87

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L  R++  W TL+CP+NNG+KFW HEWEKHGTC  S+ DQ +YFE+TLNIKD+VN L 
Sbjct  88   SDLFSRLEVSWATLACPTNNGTKFWSHEWEKHGTCSESVLDQHSYFEATLNIKDKVNLLH  147

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             LE AGI+PD NFY+VE IKEAIKAG G    +ECNSD S+  QL+Q+Y+CVD + KD+I
Sbjct  148  ILEAAGIRPDDNFYKVEDIKEAIKAGTGYDAAVECNSDPSRNGQLFQVYLCVDASAKDLI  207

Query  236  ECPTTVQRNCNTTV  195
            ECP   +R C +++
Sbjct  208  ECPVLPKRKCKSSI  221



>ref|XP_011070992.1| PREDICTED: extracellular ribonuclease LE-like [Sesamum indicum]
Length=245

 Score =   267 bits (682),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 152/188 (81%), Gaps = 2/188 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDT+K CCYP+TGKPA NF+IHGLWP + NGS+P NCNPNS Y+ +KI
Sbjct  47   FFYFVQQWPGSYCDTRKACCYPTTGKPAANFTIHGLWPNYNNGSYPSNCNPNSPYNATKI  106

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L+ +M+ +WPTL+CP+N G++FW HEWEKHGTC  S+ DQ +YFE+ LNIK++VN L+
Sbjct  107  SDLLGKMEVDWPTLACPTNGGTRFWTHEWEKHGTCSESVLDQHSYFEAALNIKNKVNLLK  166

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             LE+AGI+P+  FY    I+EAIKAG+G TP I CN+D+SK  Q+ +IY+CVD +GKD+I
Sbjct  167  VLEDAGIQPNDQFYREPQIREAIKAGIGYTPAITCNTDSSKNRQILEIYLCVDASGKDLI  226

Query  236  ECPTTVQR  213
            ECP    R
Sbjct  227  ECPKFPTR  234



>ref|XP_003517990.1| PREDICTED: ribonuclease 3-like [Glycine max]
 gb|KHN01231.1| Ribonuclease 3 [Glycine soja]
Length=226

 Score =   266 bits (679),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 152/194 (78%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPG+YCDTK+ CCYP TGKP+ +FSIHGLWP + +GSWP NC+P+S++D+S+I
Sbjct  28   FFYFVQQWPGAYCDTKQSCCYPKTGKPSADFSIHGLWPNYNDGSWPSNCDPDSVFDKSQI  87

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S LI  M+ +WP+LSCPS+NG +FW HEWEKHGTC  S  DQ  YFE+TL +K +VN L+
Sbjct  88   SDLISNMEKDWPSLSCPSSNGMRFWSHEWEKHGTCAESELDQREYFETTLKLKQKVNLLR  147

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L+NAGI+PD  FY +E+I EAIK G G TP IECN D+++ SQLYQ+Y+CVD +G ++I
Sbjct  148  ILKNAGIEPDDGFYTLESISEAIKEGTGFTPGIECNRDSARNSQLYQVYMCVDTSGSNLI  207

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C   +
Sbjct  208  ECPVLPRSKCGEQI  221



>ref|XP_010683182.1| PREDICTED: ribonuclease 1-like [Beta vulgaris subsp. vulgaris]
Length=221

 Score =   265 bits (678),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 152/192 (79%), Gaps = 0/192 (0%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDTKK CC+P+TGKP  +F IHGLWP + +GS+P NC+PN+ +D+S++
Sbjct  25   FFYFVQQWPGSYCDTKKSCCFPTTGKPDADFGIHGLWPNYNDGSYPSNCDPNTPFDQSEV  84

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCSIFDQCAYFESTLNIKDRVNFLQAL  411
            S L+ RM++EWPTL+CPSN+G  FW HEWEKHGTCS  DQ +YF+ +L++K++ N LQAL
Sbjct  85   SGLLRRMRTEWPTLACPSNDGLNFWSHEWEKHGTCSALDQHSYFQISLDLKNQANLLQAL  144

Query  410  ENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDIIEC  231
             +AGI+P+G  Y +E+IK+AIK GVG TP +ECN+D S  SQLYQIY+CVD +  ++IEC
Sbjct  145  TSAGIRPNGQTYSLESIKDAIKQGVGYTPFVECNTDTSSNSQLYQIYLCVDNSASNLIEC  204

Query  230  PTTVQRNCNTTV  195
            P      C + +
Sbjct  205  PVFPHGRCGSQI  216



>ref|XP_010939795.1| PREDICTED: extracellular ribonuclease LE-like [Elaeis guineensis]
Length=226

 Score =   264 bits (675),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 118/194 (61%), Positives = 150/194 (77%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDT K CCYP+TGKPA +F IHGLWP + +GS+P NC+P++ YDESKI
Sbjct  28   FFYFVQQWPGSYCDTAKSCCYPTTGKPAADFGIHGLWPNYNDGSYPSNCDPDNSYDESKI  87

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
              LI  MQ+EWPTL+CPS++GSKFW HEWEKHGTC  SI D+ +YFE+ L++K +V+ LQ
Sbjct  88   KDLITAMQAEWPTLACPSDDGSKFWSHEWEKHGTCSESILDEHSYFEAALDLKKQVDLLQ  147

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L++AGI PD   Y V +I  AIK   G TP IECN D S  +QLYQ+YICVD NGKD+I
Sbjct  148  ILKSAGINPDDGSYSVRSISRAIKDATGFTPGIECNVDESGNTQLYQVYICVDTNGKDLI  207

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C+++V
Sbjct  208  ECPVYPRSKCSSSV  221



>ref|XP_008802596.1| PREDICTED: extracellular ribonuclease LE-like [Phoenix dactylifera]
Length=226

 Score =   264 bits (675),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 151/194 (78%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDT K CCYP+TGKPA +F IHGLWP + +GS+P NC+P++ YDESKI
Sbjct  28   FFYFVQQWPGSYCDTAKSCCYPTTGKPAADFGIHGLWPNYNDGSYPSNCDPDNDYDESKI  87

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
              LI  M++EWPTL+CPS  GSKFW HEWEKHGTC  SI D+ +YFE+ L++K +V+ LQ
Sbjct  88   KDLITAMEAEWPTLACPSGGGSKFWSHEWEKHGTCSESILDEHSYFEAALSLKKQVDILQ  147

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            +L++AGI+PDG FY V +I  AIK   G TP IECN D S  +QLYQ+Y+CVD N KD+I
Sbjct  148  SLKSAGIEPDGGFYSVSSISRAIKDATGFTPGIECNVDESGNTQLYQVYVCVDANAKDLI  207

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C+++V
Sbjct  208  ECPVYPRSKCSSSV  221



>ref|NP_001235183.1| uncharacterized protein LOC100306447 precursor [Glycine max]
 gb|ACU14629.1| unknown [Glycine max]
 gb|KHN12204.1| Ribonuclease 3 [Glycine soja]
Length=226

 Score =   264 bits (674),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 150/194 (77%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPG+YCDTK+ CCYP TGKPA +FSIHGLWP + +GSWP NC+P+S++D+S+I
Sbjct  28   FFYFVQQWPGAYCDTKQSCCYPKTGKPAADFSIHGLWPNFKDGSWPSNCDPDSVFDKSQI  87

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S LI  M+ +WP+LSCPS+NG +FW HEWEKHGTC  S  DQ  YFE+TL +K +VN L+
Sbjct  88   SDLISNMEKDWPSLSCPSSNGMRFWSHEWEKHGTCAESELDQREYFETTLKLKQKVNLLR  147

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L+NAGI+PD   Y +E + EAIK G G TP IECN D+++ SQLYQ+Y+CVD +G ++I
Sbjct  148  ILKNAGIEPDDEIYTLERVTEAIKKGTGFTPGIECNRDSARNSQLYQVYMCVDTSGSNLI  207

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C   +
Sbjct  208  ECPVLPRSRCGEQI  221



>ref|XP_011070993.1| PREDICTED: extracellular ribonuclease LE-like isoform X1 [Sesamum 
indicum]
Length=244

 Score =   263 bits (673),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 152/212 (72%), Gaps = 20/212 (9%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDTK+ CCYP+ GKPA NF+IHGLWP + N ++P NCN NS YD +K+
Sbjct  28   FFYFVQQWPGSYCDTKRSCCYPTAGKPAANFTIHGLWPNYNNATYPSNCNKNSPYDGTKV  87

Query  590  ------------------SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCS--IFDQ  471
                              S L  R++  W TL+CP+NNG+KFW HEWEKHGTCS  + DQ
Sbjct  88   NDNQSTTLIKMDRTIVVVSDLFSRLEVSWATLACPTNNGTKFWSHEWEKHGTCSESVLDQ  147

Query  470  CAYFESTLNIKDRVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKV  291
             +YFE+TLNIKD+VN L  LE AGI+PD NFY+VE IKEAIKAG G    +ECNSD S+ 
Sbjct  148  HSYFEATLNIKDKVNLLHILEAAGIRPDDNFYKVEDIKEAIKAGTGYDAAVECNSDPSRN  207

Query  290  SQLYQIYICVDLNGKDIIECPTTVQRNCNTTV  195
             QL+Q+Y+CVD + KD+IECP   +R C +++
Sbjct  208  GQLFQVYLCVDASAKDLIECPVLPKRKCKSSI  239



>ref|XP_010258336.1| PREDICTED: intracellular ribonuclease LX-like [Nelumbo nucifera]
Length=226

 Score =   261 bits (668),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 150/194 (77%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDTK+ CCYP+TGKPA++FSIHGLWP + +GS+P NC+PNS  D S+I
Sbjct  28   FFYFVQQWPGSYCDTKQSCCYPATGKPASDFSIHGLWPNYNDGSYPSNCDPNSPLDSSEI  87

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L  RMQ  WP+LSCPS++G KFW HEW+KHGTC  S+ DQ  YF+STLN++++ N LQ
Sbjct  88   SDLTSRMQRSWPSLSCPSSDGLKFWSHEWQKHGTCSESVLDQHGYFQSTLNLQNKANLLQ  147

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L NAGI+P+G FY +++IK+A+  G+G TP IECN D S  SQLYQIY+CVD +  + I
Sbjct  148  ILRNAGIQPNGGFYSLDSIKDALTQGIGYTPGIECNVDKSGNSQLYQIYLCVDTSASNFI  207

Query  236  ECPTTVQRNCNTTV  195
            +CP      C++ +
Sbjct  208  QCPILPSSRCSSRI  221



>ref|XP_007157616.1| hypothetical protein PHAVU_002G084500g [Phaseolus vulgaris]
 gb|AGV54455.1| S-like ribonuclease [Phaseolus vulgaris]
 gb|ESW29610.1| hypothetical protein PHAVU_002G084500g [Phaseolus vulgaris]
Length=226

 Score =   261 bits (667),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 147/194 (76%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPG+YCDTK+ CCYP TGKP  +FSIHGLWP + +GSWP NC+P+S++D+S+I
Sbjct  28   FFYFVQQWPGAYCDTKQSCCYPKTGKPTADFSIHGLWPNYKDGSWPSNCDPDSVFDKSQI  87

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S+LI  M+  WP+LSCPS+NG +FW HEWEKHGTC  S  DQ  YFE+TL +K +VN LQ
Sbjct  88   SHLISSMEKNWPSLSCPSSNGMRFWSHEWEKHGTCAQSELDQSEYFEATLKLKQKVNLLQ  147

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L+NAGI+ D  FY + +I  AIK G G TP IECN D++  SQLYQ+Y+CVD +G D+I
Sbjct  148  ILKNAGIEADDEFYSLNSITNAIKEGTGFTPGIECNRDSAHNSQLYQVYLCVDTSGSDLI  207

Query  236  ECPTTVQRNCNTTV  195
            +CP   +  C   V
Sbjct  208  QCPLLPRSKCGEQV  221



>ref|XP_009117922.1| PREDICTED: ribonuclease 3-like [Brassica rapa]
Length=227

 Score =   261 bits (667),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 150/194 (77%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V QWPG+YCDTK+ CCYP+TGKPA +F IHGLWP + +GS+P NC+P+S +D ++I
Sbjct  29   FFYFVLQWPGAYCDTKRACCYPTTGKPAADFGIHGLWPNYNDGSYPSNCDPDSEFDPAEI  88

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L+  MQ++WPTLSCPSNNGSKFW+HEWEKHGTC  S+ DQ  YFE+TL ++DRVN LQ
Sbjct  89   SDLVSTMQTKWPTLSCPSNNGSKFWEHEWEKHGTCSESVMDQHKYFENTLALRDRVNLLQ  148

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L++AGI PD  FY+++ IK AIK G G TP+I CN D  K SQL++I+ CVD +G + I
Sbjct  149  ILQDAGINPDDEFYDLQDIKNAIKDGTGFTPVIHCNKDPDKNSQLHEIFFCVDTSGTEFI  208

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C + +
Sbjct  209  ECPIIPRDRCPSKL  222



>emb|CDY33761.1| BnaA09g45670D [Brassica napus]
Length=227

 Score =   261 bits (667),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 150/194 (77%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V QWPG+YCDTK+ CCYP+TGKPA +F IHGLWP + +GS+P NC+P+S +D ++I
Sbjct  29   FFYFVLQWPGAYCDTKRACCYPTTGKPAADFGIHGLWPNYNDGSYPSNCDPDSEFDPAEI  88

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L+  MQ++WPTLSCPSNNGSKFW+HEWEKHGTC  S+ DQ  YFE+TL ++DRVN LQ
Sbjct  89   SDLVSTMQTKWPTLSCPSNNGSKFWEHEWEKHGTCSESVMDQHKYFENTLALRDRVNLLQ  148

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L++AGI PD  FY+++ IK AIK G G TP+I CN D  K SQL++I+ CVD +G + I
Sbjct  149  ILQDAGINPDDEFYDLQDIKNAIKDGTGFTPVIHCNKDPEKNSQLHEIFFCVDTSGTEFI  208

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C + +
Sbjct  209  ECPIIPRDRCPSKL  222



>ref|XP_009626196.1| PREDICTED: extracellular ribonuclease LE-like [Nicotiana tomentosiformis]
 dbj|BAA95448.1| RNase [Nicotiana tabacum]
Length=229

 Score =   261 bits (666),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 148/194 (76%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDTK+ CCYP TGKPA++F IHGLWP   +GS+P NC+ NS YD+S++
Sbjct  31   FFYFVQQWPGSYCDTKQSCCYPKTGKPASDFGIHGLWPNNNDGSYPSNCDSNSPYDQSQV  90

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCS--IFDQCAYFESTLNIKDRVNFLQ  417
            S LI RMQ  WPTL+CPS+ GS FW HEWEKHGTC+  +FDQ  YF+  L++K+++N L+
Sbjct  91   SDLISRMQQNWPTLACPSDTGSAFWSHEWEKHGTCAENVFDQHGYFKKALDLKNQINLLE  150

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L+ AGI PDG FY +  IK AI++ VG TP IECN D S  SQLYQ+YICVD +G D+I
Sbjct  151  ILQGAGINPDGGFYSLNNIKNAIRSAVGYTPGIECNVDESGNSQLYQVYICVDGSGSDLI  210

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C +++
Sbjct  211  ECPVFPRGKCGSSI  224



>ref|XP_004490068.1| PREDICTED: ribonuclease 3-like [Cicer arietinum]
Length=230

 Score =   261 bits (666),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 148/194 (76%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPG+YCDTK+ CCYP TGKP+ +FSIHGLWP + +GSWP NCN +S++D+S+I
Sbjct  32   FFYFVQQWPGAYCDTKQSCCYPKTGKPSADFSIHGLWPNYNDGSWPSNCNLDSVFDKSQI  91

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S LI  M+  WP+LSCPS+NG +FW HEWEKHGTC  S  DQ  YF++ LN+K++ N LQ
Sbjct  92   SDLISNMEKNWPSLSCPSSNGFRFWSHEWEKHGTCAESELDQHDYFQTALNLKEKANLLQ  151

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L+NAGI+PD  FY +E   EAIK G G TP IECN D+++ SQLYQ+YICVD +G + I
Sbjct  152  ILKNAGIEPDDEFYSIENFSEAIKEGTGFTPGIECNKDSARNSQLYQVYICVDTSGSNFI  211

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C+  +
Sbjct  212  ECPVLPRSRCDDQI  225



>gb|AAA21135.1| RNase NE [Nicotiana alata]
Length=231

 Score =   260 bits (665),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 148/194 (76%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDTK+ CCYP TGKPA++F IHGLWP   +GS+P NC+ NS YD+S++
Sbjct  33   FFYFVQQWPGSYCDTKQSCCYPKTGKPASDFGIHGLWPNNNDGSYPSNCDSNSPYDQSQV  92

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S LI RMQ  WPTL+CPS  GS FW HEWEKHGTC  SIFDQ  YF+  L++K+++N L+
Sbjct  93   SDLISRMQQNWPTLACPSGTGSAFWSHEWEKHGTCSESIFDQHGYFKKALDLKNQINLLE  152

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L+ AGI PDG FY + +IK AI++ +G TP IECN D S  SQLYQ+YICVD +G ++I
Sbjct  153  ILQGAGINPDGGFYSLNSIKNAIRSAIGYTPGIECNVDDSGNSQLYQVYICVDGSGSNLI  212

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C +++
Sbjct  213  ECPVFPRGKCGSSI  226



>ref|XP_008783985.1| PREDICTED: extracellular ribonuclease LE-like [Phoenix dactylifera]
Length=226

 Score =   259 bits (662),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 145/194 (75%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDT++ CCYP TGKPA +F IHGLWP   +GS+P NC+P+S YD SKI
Sbjct  28   FFYFVQQWPGSYCDTRRSCCYPKTGKPAADFGIHGLWPNNKDGSYPSNCDPDSPYDRSKI  87

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
              LI  MQ++WPTL+CPS +GS FW+HEWEKHGTC  SI DQ +YF++ LN+K R + L 
Sbjct  88   RDLIPTMQAKWPTLACPSGDGSDFWEHEWEKHGTCSESILDQHSYFQAALNLKKRADLLG  147

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L  AGI+PDG FY V++I  AI+   G TP +ECN D S  SQLYQIY+CVD N +D+I
Sbjct  148  ILRGAGIEPDGGFYSVDSITGAIRDATGFTPGVECNVDESSNSQLYQIYLCVDTNARDLI  207

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C++ +
Sbjct  208  ECPVYPRSKCSSRI  221



>ref|XP_006827258.1| hypothetical protein AMTR_s00010p00262550 [Amborella trichopoda]
 gb|ERM94495.1| hypothetical protein AMTR_s00010p00262550 [Amborella trichopoda]
Length=228

 Score =   259 bits (661),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 147/194 (76%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDTK  CCYP+TGKPA NFSIHGLWP + +GS+P NC+P+S +  S++
Sbjct  25   FFYFVQQWPGSYCDTKASCCYPTTGKPAANFSIHGLWPNYNDGSYPSNCDPDSQFQPSEV  84

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S LI RM+ +WPTL+CPS NG KFW HEW KHGTC  S+ DQ  YFES L +K +VN +Q
Sbjct  85   SDLIGRMRKDWPTLACPSGNGVKFWTHEWVKHGTCSESVLDQHQYFESALKLKGKVNLVQ  144

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL++AGI PDG+ Y + +I EAI+A  G TP IECN D S+  QLYQIY+CVD +G  II
Sbjct  145  ALQDAGIYPDGSTYSLNSITEAIRAATGHTPGIECNRDESRNPQLYQIYMCVDTSGSSII  204

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C++ V
Sbjct  205  ECPKLPRGGCSSQV  218



>ref|XP_010937157.1| PREDICTED: extracellular ribonuclease LE-like [Elaeis guineensis]
Length=225

 Score =   258 bits (660),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 146/194 (75%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDTK+ CCYP TGKPA +F IHGLWP   +GS+P NC+P+S YD+SKI
Sbjct  27   FFYFVQQWPGSYCDTKRSCCYPKTGKPAADFGIHGLWPNNNDGSYPSNCDPDSPYDQSKI  86

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
              LI  MQ++WPTL+CPS +GS FWKHEWEKHGTC  SI +Q +YF +TLN+K +V+ L 
Sbjct  87   RDLIPTMQAKWPTLACPSGDGSAFWKHEWEKHGTCSESILNQHSYFNTTLNLKKQVDLLG  146

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L  AGI+PDG FY V++I  AI+   G TP IECN D S  SQLYQIYICVD N  D+I
Sbjct  147  ILRGAGIEPDGGFYSVDSITGAIRDATGFTPGIECNVDESSNSQLYQIYICVDTNAGDLI  206

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C++ +
Sbjct  207  ECPVYPRSKCSSRI  220



>ref|XP_008790973.1| PREDICTED: extracellular ribonuclease LE-like [Phoenix dactylifera]
Length=224

 Score =   258 bits (660),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/213 (54%), Positives = 156/213 (73%), Gaps = 3/213 (1%)
 Frame = -2

Query  827  PFVTAFAEDDAAADHNSDLFYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWL  648
            P +   +   AA   + D F+Y+V+QWPGSYCDTKK CCYPSTGKPA +F IHGLWP + 
Sbjct  8    PMMVLLSLAIAATAEDFD-FFYFVQQWPGSYCDTKKSCCYPSTGKPAADFGIHGLWPNYN  66

Query  647  NGSWPENCNPNSLYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFD  474
            +G++P +C+P + +D SKI  LI RM+++WPTL+CPS +GSKFW HEWEKHGTC  SI D
Sbjct  67   DGAYPSSCDPRNSFDSSKIKDLIGRMRADWPTLACPSGDGSKFWAHEWEKHGTCSESILD  126

Query  473  QCAYFESTLNIKDRVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASK  294
            Q +YFE+ LN+K + N LQ L++AGI PDG +Y++  I +AI+  +G TP IECN D S 
Sbjct  127  QHSYFEAALNLKKQANLLQILQDAGIVPDGGYYKLNNISKAIREAIGFTPGIECNVDESG  186

Query  293  VSQLYQIYICVDLNGKDIIECPTTVQRNCNTTV  195
              QLYQIY+CVD +G ++I+CP   +  C++ V
Sbjct  187  NRQLYQIYMCVDTSGTELIDCPVYPKSKCSSRV  219



>ref|XP_002522443.1| ribonuclease t2, putative [Ricinus communis]
 gb|EEF39935.1| ribonuclease t2, putative [Ricinus communis]
Length=226

 Score =   258 bits (660),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 115/194 (59%), Positives = 147/194 (76%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDT+  CCYP TGKPA +F IHGLWP + +G +P NCNP+S YD+S+I
Sbjct  28   FFYFVQQWPGSYCDTRHSCCYPKTGKPAADFGIHGLWPNYKDGGYPSNCNPDSEYDKSQI  87

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L   +Q +WPTLSCPS +G+KFW HEW KHGTC  S  DQ  YFE+ L +K++VN LQ
Sbjct  88   SDLTSSLQKDWPTLSCPSGDGNKFWSHEWIKHGTCSESELDQHDYFEAALKLKEKVNLLQ  147

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL++AGIKPD  FYE+ +I+EAIK   G TP IECN D S+ SQL+Q+Y+CVD +G +II
Sbjct  148  ALKDAGIKPDDEFYELSSIEEAIKEATGYTPGIECNVDGSRNSQLFQVYLCVDTSGSEII  207

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C + V
Sbjct  208  ECPVLPRGRCASRV  221



>ref|XP_008339896.1| PREDICTED: extracellular ribonuclease LE-like isoform X2 [Malus 
domestica]
Length=220

 Score =   258 bits (659),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 148/194 (76%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDT   CCYP+TGKPA  F IHGLWP + +GS+P NC+ ++ YDESKI
Sbjct  22   FFYFVQQWPGSYCDTDASCCYPTTGKPAQEFGIHGLWPNYNDGSYPSNCDSDNPYDESKI  81

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCS--IFDQCAYFESTLNIKDRVNFLQ  417
            S LI R+Q++WPTL+CPS NGSKFW HEW KHGTCS  + DQ  YFE++LN+K+ ++  Q
Sbjct  82   SDLISRLQADWPTLACPSXNGSKFWAHEWNKHGTCSEPVLDQHGYFEASLNLKENLDIFQ  141

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L+NAGI+ DGN Y + +IKEAIK+ +G TP I CN DAS  SQLY++YICVD +  +II
Sbjct  142  ILQNAGIRADGNIYSLSSIKEAIKSAIGYTPGITCNEDASGNSQLYEVYICVDTSSSNII  201

Query  236  ECPTTVQRNCNTTV  195
            ECP      C++ +
Sbjct  202  ECPVLPGTKCSSKI  215



>ref|XP_010937158.1| PREDICTED: extracellular ribonuclease LE-like [Elaeis guineensis]
Length=225

 Score =   258 bits (659),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 149/194 (77%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDTK+ CCYP TGKPA +F IHGLWP   +GS+P NC+P+S YD+SKI
Sbjct  27   FFYFVQQWPGSYCDTKRSCCYPKTGKPAADFGIHGLWPNNNDGSYPSNCDPDSPYDQSKI  86

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
              L+  MQ++WPTL+CPS++GS+FWKHEWEKHGTC  SI +Q +YF++ LN+K +V+ LQ
Sbjct  87   RDLMPTMQAKWPTLACPSSDGSEFWKHEWEKHGTCSESILNQHSYFQAALNLKKQVDLLQ  146

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L+ AGI+PDG  Y V+ I  AI+   G TP IECN D S  SQLYQIYICVD N KD+I
Sbjct  147  ILQGAGIEPDGGSYSVDNITRAIRDATGFTPGIECNVDESSNSQLYQIYICVDTNAKDLI  206

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C++ +
Sbjct  207  ECPLYPRSMCSSQI  220



>ref|XP_008339895.1| PREDICTED: extracellular ribonuclease LE-like isoform X1 [Malus 
domestica]
Length=228

 Score =   258 bits (659),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 148/194 (76%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDT   CCYP+TGKPA  F IHGLWP + +GS+P NC+ ++ YDESKI
Sbjct  30   FFYFVQQWPGSYCDTDASCCYPTTGKPAQEFGIHGLWPNYNDGSYPSNCDSDNPYDESKI  89

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCS--IFDQCAYFESTLNIKDRVNFLQ  417
            S LI R+Q++WPTL+CPS NGSKFW HEW KHGTCS  + DQ  YFE++LN+K+ ++  Q
Sbjct  90   SDLISRLQADWPTLACPSXNGSKFWAHEWNKHGTCSEPVLDQHGYFEASLNLKENLDIFQ  149

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L+NAGI+ DGN Y + +IKEAIK+ +G TP I CN DAS  SQLY++YICVD +  +II
Sbjct  150  ILQNAGIRADGNIYSLSSIKEAIKSAIGYTPGITCNEDASGNSQLYEVYICVDTSSSNII  209

Query  236  ECPTTVQRNCNTTV  195
            ECP      C++ +
Sbjct  210  ECPVLPGTKCSSKI  223



>ref|XP_010907396.1| PREDICTED: extracellular ribonuclease LE-like [Elaeis guineensis]
Length=224

 Score =   258 bits (659),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 148/194 (76%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y V+QWPGSYCDTK  CCYPSTGKPA +F IHGLWP + +G++P NC+P + YD SKI
Sbjct  26   FFYLVQQWPGSYCDTKNSCCYPSTGKPAADFGIHGLWPNYNDGTYPSNCDPENSYDSSKI  85

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
              LI RM+++WPTL+CPS +GS+FW HEWEKHGTC  SI DQ +YF++ LN+K +VN LQ
Sbjct  86   KDLIGRMRADWPTLACPSGDGSRFWAHEWEKHGTCSESILDQHSYFKAALNLKKQVNLLQ  145

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L++AGI PDG FY++  I +AI+  +G TP IECN D S   QLYQIY+CVD +G ++I
Sbjct  146  ILQDAGIVPDGGFYKLNNISKAIREAIGFTPGIECNVDESGNRQLYQIYLCVDTSGTELI  205

Query  236  ECPTTVQRNCNTTV  195
            +CP   +  C++ V
Sbjct  206  DCPVYPKSKCSSRV  219



>gb|KDP41205.1| hypothetical protein JCGZ_15612 [Jatropha curcas]
Length=226

 Score =   258 bits (658),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 114/200 (57%), Positives = 151/200 (76%), Gaps = 3/200 (2%)
 Frame = -2

Query  785  HNSDL-FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSL  609
            H+ D  F+Y+V+QWPGSYCDT+  CCYP TGKPA +F IHGLWP + +G +P NCNP+S+
Sbjct  22   HSQDFDFFYFVQQWPGSYCDTRHSCCYPKTGKPAADFGIHGLWPNYKDGGYPSNCNPDSV  81

Query  608  YDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKD  435
            +D+S+IS L+ R++  WPTLSCPS +G+KFW HEW KHGTC  S  DQ  YFE+ L +K+
Sbjct  82   FDKSQISDLVSRLERNWPTLSCPSGDGNKFWSHEWVKHGTCAESELDQHDYFEAALKLKE  141

Query  434  RVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDL  255
            +VN L+ L +AGIKPD  FYE+E I+EAIK  +G TP +ECN D SK +QL+QIY+CVD 
Sbjct  142  KVNLLKILTDAGIKPDDEFYELETIEEAIKDAIGYTPGLECNKDGSKNTQLFQIYLCVDT  201

Query  254  NGKDIIECPTTVQRNCNTTV  195
            +  +IIECP   + +C + V
Sbjct  202  SASEIIECPVLPRGSCASRV  221



>dbj|BAC77613.1| ribonuclease NW [Nicotiana glutinosa]
Length=229

 Score =   258 bits (658),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 147/194 (76%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDTK+ CCYP TGKPA++F IHGLWP   +GS+P NC+ NS YD+S++
Sbjct  31   FFYFVQQWPGSYCDTKQSCCYPKTGKPASDFGIHGLWPNNNDGSYPSNCDSNSPYDQSQV  90

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCS--IFDQCAYFESTLNIKDRVNFLQ  417
            S LI RMQ  WPTL+CPS  GS FW HEWEKHGTC+  +FDQ  YF+  L++K+++N L+
Sbjct  91   SDLISRMQQNWPTLACPSGTGSAFWSHEWEKHGTCAENVFDQHGYFKKALDLKNQINLLE  150

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L+ AGI PDG FY + +IK AI++ +G  P IECN D S  SQLYQIYICVD +G ++I
Sbjct  151  ILQGAGINPDGGFYSLNSIKNAIRSAIGYAPGIECNVDESGNSQLYQIYICVDGSGSNLI  210

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C +++
Sbjct  211  ECPIFPRGKCGSSI  224



>ref|XP_007046080.1| Ribonuclease 3 [Theobroma cacao]
 gb|EOY01912.1| Ribonuclease 3 [Theobroma cacao]
Length=228

 Score =   257 bits (657),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 149/195 (76%), Gaps = 3/195 (2%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKK-GCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESK  594
            F+Y+V+QWPG+YCDTK+  CCYP TGKPA +F IHGLWP + +G +P NC+PNS +D S+
Sbjct  29   FFYFVQQWPGAYCDTKQHSCCYPKTGKPAADFGIHGLWPNYRDGGYPSNCDPNSRFDRSE  88

Query  593  ISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFL  420
            IS LI  ++ EWPTLSCPSN+G+KFW HEW KHGTC  S  DQ  YF++ L +K + NFL
Sbjct  89   ISDLIGTLEKEWPTLSCPSNDGTKFWTHEWVKHGTCSESELDQREYFQAALKLKQKANFL  148

Query  419  QALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDI  240
            QAL NAGIKP+  FYE++ I++AIK  VG TP IECN+D+S+ SQLYQIY+CVD +G D 
Sbjct  149  QALTNAGIKPNDEFYELQDIEDAIKEAVGFTPGIECNTDSSRNSQLYQIYLCVDTSGSDF  208

Query  239  IECPTTVQRNCNTTV  195
            I+CP      C +++
Sbjct  209  IKCPLLPSSRCGSSI  223



>gb|AFK41755.1| unknown [Lotus japonicus]
Length=226

 Score =   257 bits (656),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 146/194 (75%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPG+YCD+K+ CCYP TGKP  +F IHGLWP + +GSWP NC+P+S +D+S+I
Sbjct  28   FFYFVQQWPGAYCDSKQSCCYPKTGKPTADFGIHGLWPNYNDGSWPSNCDPDSTFDKSEI  87

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S LI  M+  WP+LSCPS+NG +FW HEWEKHGTC  S   Q  YFE+ L +K++VN LQ
Sbjct  88   SELISSMEKSWPSLSCPSSNGIRFWSHEWEKHGTCAESELGQREYFEAALKLKEKVNLLQ  147

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L+NA I+PD  FY +E+IK+AIK G G TP IECN D+   SQLYQ+Y+CVD +G D I
Sbjct  148  ILKNAEIQPDDEFYSIESIKDAIKEGSGFTPGIECNRDSRGNSQLYQVYMCVDTSGSDFI  207

Query  236  ECPTTVQRNCNTTV  195
            ECP + +  C + +
Sbjct  208  ECPVSPRSKCGSDI  221



>emb|CDP00340.1| unnamed protein product [Coffea canephora]
Length=231

 Score =   257 bits (656),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 145/192 (76%), Gaps = 1/192 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y V+QWP SYC TK+ CCYP+TGKPA +FSIHGLWP   +GSWP NC+  S +DES++
Sbjct  29   FFYLVQQWPASYCGTKRSCCYPTTGKPAEDFSIHGLWPNRNDGSWPSNCDEGSSFDESEV  88

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCSIFDQCAYFESTLNIKDRVNFLQAL  411
            S L++RMQ EWP+L+CPS++G +FW HEWEKHGTCS+ ++  YF++ L++KD+ N LQ L
Sbjct  89   SDLVKRMQQEWPSLACPSSDGVRFWSHEWEKHGTCSLLNEHQYFQTALDLKDKSNLLQVL  148

Query  410  ENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDIIEC  231
            ++AGI+P G FY +E IKEAI+ GVG TP IECN D     QLYQ+Y+CVD +  D IEC
Sbjct  149  KDAGIRP-GKFYSLEKIKEAIQQGVGYTPFIECNVDQGGNRQLYQVYLCVDSSASDFIEC  207

Query  230  PTTVQRNCNTTV  195
            PT     C + +
Sbjct  208  PTFPHGRCGSEI  219



>ref|XP_004297298.1| PREDICTED: ribonuclease 3-like [Fragaria vesca subsp. vesca]
Length=229

 Score =   257 bits (656),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 150/194 (77%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPG+YCDTK  CCYP +GKPA +F IHGLWP + +GS+P NC+P+S++D+S+I
Sbjct  31   FFYFVQQWPGAYCDTKHSCCYPKSGKPAADFGIHGLWPNYNDGSYPSNCDPDSVFDKSEI  90

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L+  ++  WP++SCPS+NG +FW HEWEKHGTC  S  DQ  YF++ L +K++ N LQ
Sbjct  91   SELMSSLEKNWPSMSCPSSNGYRFWSHEWEKHGTCAESELDQKDYFQAGLKLKEKANLLQ  150

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL+ AGIKPD   Y +E+I +AIK GVG TP IECN D++  SQLYQ+Y+CVD +G+DII
Sbjct  151  ALKKAGIKPDDELYSLESIVQAIKEGVGHTPGIECNKDSAGNSQLYQVYLCVDTSGQDII  210

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C +TV
Sbjct  211  ECPILPRGRCASTV  224



>pdb|1IYB|A Chain A, Crystal Structure Of The Nicotiana Glutinosa Ribonuclease 
Nw
 pdb|1IYB|B Chain B, Crystal Structure Of The Nicotiana Glutinosa Ribonuclease 
Nw
Length=208

 Score =   256 bits (653),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 147/194 (76%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDTK+ CCYP TGKPA++F IHGLWP   +GS+P NC+ NS YD+S++
Sbjct  10   FFYFVQQWPGSYCDTKQSCCYPKTGKPASDFGIHGLWPNNNDGSYPSNCDSNSPYDQSQV  69

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCS--IFDQCAYFESTLNIKDRVNFLQ  417
            S LI RMQ  WPTL+CPS  GS FW HEWEKHGTC+  +FDQ  YF+  L++K+++N L+
Sbjct  70   SDLISRMQQNWPTLACPSGTGSAFWSHEWEKHGTCAENVFDQHGYFKKALDLKNQINLLE  129

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L+ AGI PDG FY + +IK AI++ +G  P IECN D S  SQLYQIYICVD +G ++I
Sbjct  130  ILQGAGIHPDGGFYSLNSIKNAIRSAIGYAPGIECNVDESGNSQLYQIYICVDGSGSNLI  189

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C +++
Sbjct  190  ECPIFPRGKCGSSI  203



>ref|XP_006483149.1| PREDICTED: ribonuclease 3-like [Citrus sinensis]
 gb|KDO82932.1| hypothetical protein CISIN_1g027258mg [Citrus sinensis]
Length=226

 Score =   256 bits (654),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 147/194 (76%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDTK+ CCYP +GKPA +F IHGLWP + +GS+P NC+P+S++++S+I
Sbjct  28   FFYFVQQWPGSYCDTKQSCCYPKSGKPAADFGIHGLWPEYKDGSYPSNCDPDSVFEKSQI  87

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S LI  ++  WPTLSCPSN+G+KFW HEW KHGTC  S  DQ  YFE+ L +K++ N LQ
Sbjct  88   SDLISDLRQNWPTLSCPSNDGTKFWTHEWVKHGTCAESELDQREYFEAALKLKEKANLLQ  147

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL+NAGIKPD  FYE+E+I  AIK   G TP IECN D    SQLYQIY+CVD +  + I
Sbjct  148  ALKNAGIKPDDGFYELESIIAAIKEATGFTPGIECNVDPEHNSQLYQIYMCVDTSASEFI  207

Query  236  ECPTTVQRNCNTTV  195
            +CP   ++ C +TV
Sbjct  208  QCPKQPRKKCASTV  221



>ref|XP_003613795.1| LCR-like protein [Medicago truncatula]
 gb|AES96753.1| ribonuclease T2 family protein [Medicago truncatula]
Length=227

 Score =   256 bits (654),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 146/194 (75%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPG+YCDTK+ CCYP TGKP  +F IHGLWP + +GSWP NC+P+S +D+S+I
Sbjct  29   FFYFVQQWPGAYCDTKQSCCYPKTGKPTADFGIHGLWPNYNDGSWPSNCDPDSTFDKSQI  88

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L++ M+  WP+LSCPS+NG +FW HEWEKHGTC  S  DQ  YFE+ L +K++ N LQ
Sbjct  89   SDLMKNMEKNWPSLSCPSSNGFRFWSHEWEKHGTCAESELDQHEYFETALKLKEKANLLQ  148

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            +L NAGI+P+  FY +E I EAIK G G TP IECN D+++ SQLYQ+Y+CVD +G + I
Sbjct  149  SLTNAGIEPNDEFYSIENISEAIKEGTGFTPGIECNRDSARNSQLYQVYMCVDTSGSNFI  208

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C   +
Sbjct  209  ECPLLPRSRCGEQI  222



>ref|XP_009793100.1| PREDICTED: extracellular ribonuclease LE-like [Nicotiana sylvestris]
Length=231

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 146/194 (75%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDTK+ CCYP TGKPA++F IHGLWP   +GS+P NC+ NS YD+S++
Sbjct  33   FFYFVQQWPGSYCDTKQSCCYPKTGKPASDFGIHGLWPNNNDGSYPSNCDSNSPYDQSQV  92

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S LI RMQ  WPTL+CPS  GS FW HEWEKHGTC  SIFDQ  YF+  L++K+++N L+
Sbjct  93   SDLISRMQQNWPTLACPSGTGSAFWSHEWEKHGTCSESIFDQHGYFKKALDLKNQINLLE  152

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L+ AGI PD  FY + +IK AI + +G TP IECN D S  SQLYQ+YICVD +G ++I
Sbjct  153  ILQGAGINPDDGFYSLNSIKNAINSAIGYTPGIECNVDESGNSQLYQVYICVDGSGSNLI  212

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C +++
Sbjct  213  ECPVFPRGKCGSSI  226



>ref|XP_010552574.1| PREDICTED: ribonuclease 3-like [Tarenaya hassleriana]
Length=229

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 144/194 (74%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPG+YCD+++ CCYP TGKPA +F IHGLWP + +G WP+NCNP+S +DES+I
Sbjct  31   FFYFVQQWPGAYCDSRQSCCYPKTGKPAADFGIHGLWPNYKSGGWPQNCNPDSEFDESQI  90

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L+  MQ+EWPTLSCPSN+G KFW HEW KHGTC  S  DQ  YF + L +K + N L 
Sbjct  91   SDLLSNMQTEWPTLSCPSNDGVKFWTHEWTKHGTCAESELDQHDYFHAALKLKQKANLLH  150

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL NAGIKP+  FY +  IK+AI+  +G TP IECN D+S  SQLYQIY+CVD +G + I
Sbjct  151  ALSNAGIKPNDEFYGLREIKKAIEEAIGFTPGIECNKDSSHNSQLYQIYLCVDTSGAEFI  210

Query  236  ECPTTVQRNCNTTV  195
            ECP      C++ +
Sbjct  211  ECPVLPHGRCDSRI  224



>ref|XP_002311303.1| S-like ribonuclease family protein [Populus trichocarpa]
 gb|EEE88670.1| S-like ribonuclease family protein [Populus trichocarpa]
Length=227

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 146/195 (75%), Gaps = 3/195 (2%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDTK  CCYP TGKP  +F IHGLWP   +GS+P+NCN ++  DE +I
Sbjct  28   FFYFVQQWPGSYCDTKHSCCYPRTGKPVADFGIHGLWPQNEDGSYPQNCNRDNALDEDQI  87

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCS---IFDQCAYFESTLNIKDRVNFL  420
            S L   +Q +WP+LSCPS+ G +FW HEWEKHGTC+     DQ  YFE+ L +K++ N L
Sbjct  88   SDLTSSLQKDWPSLSCPSSTGFRFWSHEWEKHGTCAESEEIDQHGYFEAALKLKEKANLL  147

Query  419  QALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDI  240
            QAL+NAGIKPD  FY++++IKEAIK   G TP IECN DASK SQLYQ+++CVD++G + 
Sbjct  148  QALDNAGIKPDDEFYDLDSIKEAIKDATGFTPGIECNIDASKNSQLYQVFMCVDISGSEF  207

Query  239  IECPTTVQRNCNTTV  195
            IECP   +R C + V
Sbjct  208  IECPVLPKRRCASKV  222



>ref|XP_010097616.1| Extracellular ribonuclease LE [Morus notabilis]
 gb|EXB69695.1| Extracellular ribonuclease LE [Morus notabilis]
Length=228

 Score =   256 bits (653),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 147/182 (81%), Gaps = 2/182 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y V+QWPGSYCDTK+ CCYP+TGKPA +F IHGLWP + +G++P NC+PN+ +D+S+I
Sbjct  29   FFYLVQQWPGSYCDTKQSCCYPTTGKPAADFGIHGLWPNYNDGTYPSNCDPNNPFDQSEI  88

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L   +Q  WPTL+CPS +G KFW+HEWEKHGTC  S+ DQ AYF++TLN+K +VN LQ
Sbjct  89   SDLTTTLQRNWPTLACPSGSGVKFWEHEWEKHGTCSESVLDQHAYFQTTLNLKRKVNLLQ  148

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L+ AGI+P+G FY +E IK+AI+ G+G TP IECN DAS  SQLYQ+Y+CVD +G ++I
Sbjct  149  VLKTAGIQPNGKFYTLENIKKAIQDGIGYTPWIECNVDASGNSQLYQVYLCVDTSGSNLI  208

Query  236  EC  231
            EC
Sbjct  209  EC  210



>emb|CDP00341.1| unnamed protein product [Coffea canephora]
Length=236

 Score =   256 bits (653),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 148/194 (76%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCD+K+GCCYP TGKPA++FSIHGLWP + +GS+P NC+P + ++ S+I
Sbjct  38   FFYFVQQWPGSYCDSKQGCCYPITGKPASDFSIHGLWPNYNDGSYPSNCDPQAQFNPSQI  97

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L  RMQ +WP+LSCPS++G  FW HEWEKHGTC  SI DQ  YF S L +K + N LQ
Sbjct  98   SDLTSRMQKDWPSLSCPSSDGLSFWSHEWEKHGTCSESILDQHDYFASALLLKRQSNLLQ  157

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L+NAGI+P+G +Y ++ IK AI+ G+G TP IECN D S  SQLYQIY+CVD +G ++I
Sbjct  158  ILKNAGIQPNGQYYSLDGIKAAIRGGIGHTPYIECNVDPSGNSQLYQIYVCVDTSGSNLI  217

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C + +
Sbjct  218  ECPVLPRGTCGSRI  231



>ref|XP_008389461.1| PREDICTED: extracellular ribonuclease LE [Malus domestica]
Length=226

 Score =   255 bits (651),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 143/194 (74%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDTKK CCYP+TGKPA +F IHGLWP   +GS+P NC+PN+ +D+S+I
Sbjct  28   FFYFVQQWPGSYCDTKKSCCYPTTGKPAADFGIHGLWPNNKDGSYPSNCDPNNPFDQSEI  87

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L   MQ EWPTL+CPS NG  FW HEWEKHGTC  S  DQ  YF + LN+K ++N LQ
Sbjct  88   SDLRSSMQKEWPTLACPSGNGITFWTHEWEKHGTCSESFIDQHGYFAAALNLKKKINLLQ  147

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            ALE+AGIKP+G+ Y ++ IK A+K   G TP IECN + S  SQLYQ+Y+CVD +G D+I
Sbjct  148  ALESAGIKPNGDSYTLQNIKGAVKDATGFTPFIECNVEESGNSQLYQVYLCVDTSGSDLI  207

Query  236  ECPTTVQRNCNTTV  195
            ECP      C   +
Sbjct  208  ECPVFPHGKCGAQI  221



>ref|XP_009360333.1| PREDICTED: extracellular ribonuclease LE-like [Pyrus x bretschneideri]
Length=226

 Score =   255 bits (651),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 143/194 (74%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDTK+ CCYP+TGKPA +F IHGLWP   +GS+P NC+PN+ +D+S+I
Sbjct  28   FFYFVQQWPGSYCDTKQSCCYPTTGKPAADFGIHGLWPNKKDGSYPSNCDPNNPFDQSEI  87

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L   MQ EWPTL+CPS NG  FW HEWEKHGTC  S  DQ  YF + LN+K ++N LQ
Sbjct  88   SDLRSSMQKEWPTLACPSGNGIAFWTHEWEKHGTCSESFIDQHGYFAAALNLKKKINLLQ  147

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            ALE+AGI+P+G+ Y ++ IK A+K   G TP IECN D S  SQLYQ+Y+CVD +G D+I
Sbjct  148  ALESAGIQPNGDSYTLQNIKGAVKDATGFTPFIECNVDESGNSQLYQVYLCVDTSGSDLI  207

Query  236  ECPTTVQRNCNTTV  195
            ECP      C   +
Sbjct  208  ECPVFPHGKCGAQI  221



>ref|XP_008221612.1| PREDICTED: ribonuclease 3-like [Prunus mume]
Length=227

 Score =   254 bits (650),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 147/194 (76%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPG+YCDTK  CCYP +GKP+ +F IHGLWP + +GS+P NC+P+S++D+S+I
Sbjct  29   FFYFVQQWPGAYCDTKHTCCYPKSGKPSADFGIHGLWPNYKDGSYPSNCDPDSVFDKSEI  88

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L+  ++  WP+LSCPS+NG +FW HEWEKHGTC  S  DQ  YFE+ L +K +VN LQ
Sbjct  89   SELMSNLEKNWPSLSCPSSNGFRFWSHEWEKHGTCSESELDQKDYFEAALKLKQKVNLLQ  148

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L+ AGI PD   Y +E+IKEAIK G G TP IECN D++  SQLYQ+Y+CVD +G+DII
Sbjct  149  ILKTAGIVPDDGMYSLESIKEAIKEGAGYTPGIECNKDSAGNSQLYQVYLCVDTSGQDII  208

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C + V
Sbjct  209  ECPVLPKGRCASDV  222



>ref|XP_007223919.1| hypothetical protein PRUPE_ppa011014mg [Prunus persica]
 gb|EMJ25118.1| hypothetical protein PRUPE_ppa011014mg [Prunus persica]
Length=227

 Score =   254 bits (650),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 147/194 (76%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPG+YCDTK  CCYP +GKP+ +F IHGLWP + +GS+P NC+P+S++D+S+I
Sbjct  29   FFYFVQQWPGAYCDTKHTCCYPKSGKPSADFGIHGLWPNYKDGSYPSNCDPDSVFDKSEI  88

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L+  ++  WP+LSCPS+NG +FW HEWEKHGTC  S  DQ  YFE+ L +K +VN LQ
Sbjct  89   SELMSNLEKNWPSLSCPSSNGFRFWSHEWEKHGTCSESELDQKDYFEAALKLKQKVNLLQ  148

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L+ AGI PD   Y +E+IKEAIK G G TP IECN D++  SQLYQ+Y+CVD +G+DII
Sbjct  149  ILKTAGIVPDDGMYSLESIKEAIKEGAGYTPGIECNKDSAGNSQLYQVYLCVDTSGQDII  208

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C + V
Sbjct  209  ECPVLPKGRCASDV  222



>ref|XP_006438699.1| hypothetical protein CICLE_v10032674mg [Citrus clementina]
 gb|ESR51939.1| hypothetical protein CICLE_v10032674mg [Citrus clementina]
Length=226

 Score =   254 bits (650),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 146/194 (75%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDTK+ CCYP +GKPA +F IHGLWP + +GS+P NC+P+ ++++S+I
Sbjct  28   FFYFVQQWPGSYCDTKQSCCYPKSGKPAADFGIHGLWPEYKDGSYPSNCDPDGVFEKSQI  87

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S LI  ++  WPTLSCPSN+G+KFW HEW KHGTC  S  DQ  YFE+ L +K++ N LQ
Sbjct  88   SDLISDLRQNWPTLSCPSNDGTKFWTHEWVKHGTCAESELDQREYFEAALKLKEKANLLQ  147

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL+NAGIKPD  FYE+E+I  AIK   G TP IECN D    SQLYQIY+CVD +  + I
Sbjct  148  ALKNAGIKPDDGFYELESIIAAIKEATGFTPGIECNVDPEHNSQLYQIYMCVDTSASEFI  207

Query  236  ECPTTVQRNCNTTV  195
            +CP   ++ C +TV
Sbjct  208  QCPKQPRKKCASTV  221



>ref|XP_011016376.1| PREDICTED: ribonuclease 3-like [Populus euphratica]
Length=229

 Score =   254 bits (649),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 145/195 (74%), Gaps = 3/195 (2%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDTK  CCYP TGKP  +F IHGLWP   +GS+P+NCN ++  DE +I
Sbjct  30   FFYFVQQWPGSYCDTKHSCCYPRTGKPDADFGIHGLWPQNEDGSYPQNCNRDNALDEDQI  89

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCS---IFDQCAYFESTLNIKDRVNFL  420
            S L   +Q +WP+LSCPS+ G +FW HEWEKHGTC+     DQ  YFE+ L +K++ N L
Sbjct  90   SDLTSSLQKDWPSLSCPSSTGFRFWSHEWEKHGTCAESEEIDQHGYFEAALKLKEKANLL  149

Query  419  QALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDI  240
            QAL NAGIKPD  FY++++IKEAIK   G TP IECN DAS+ SQLYQ+++CVD++G + 
Sbjct  150  QALNNAGIKPDDEFYDLDSIKEAIKDATGFTPGIECNIDASRNSQLYQVFMCVDISGSEF  209

Query  239  IECPTTVQRNCNTTV  195
            IECP   +R C + V
Sbjct  210  IECPELPKRRCASKV  224



>ref|XP_009110556.1| PREDICTED: ribonuclease 3-like [Brassica rapa]
 emb|CDX96863.1| BnaA08g24060D [Brassica napus]
Length=228

 Score =   254 bits (649),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 147/194 (76%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y V QWPG+YCDTK+ CCYP++GKPA +F IHGLWP + +G++P NCNP+S +D+S+I
Sbjct  30   FFYLVLQWPGAYCDTKRSCCYPTSGKPAADFGIHGLWPNYKDGTYPSNCNPDSEFDKSQI  89

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            + L+  ++  WPTL+CPSN G KFWKHEWEKHGTC  S+ DQ  YFE++L ++DR N LQ
Sbjct  90   TDLVSSLKKTWPTLACPSNEGFKFWKHEWEKHGTCSESVMDQHEYFENSLKLRDRANLLQ  149

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL N+GIKPD  FY++E I++AIK  +G TP IECN D  +  QL+QIYICVD +G + I
Sbjct  150  ALTNSGIKPDDRFYDLEKIRKAIKDEIGFTPGIECNKDPERNDQLHQIYICVDTSGTEFI  209

Query  236  ECPTTVQRNCNTTV  195
            +CP   +  C + +
Sbjct  210  KCPILPRERCPSRL  223



>ref|XP_011017144.1| PREDICTED: ribonuclease 3-like [Populus euphratica]
Length=229

 Score =   254 bits (649),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 145/195 (74%), Gaps = 3/195 (2%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDTK  CCYP TGKP  +F IHGLWP   +GS+P+NCN ++  DE +I
Sbjct  30   FFYFVQQWPGSYCDTKHSCCYPRTGKPDADFGIHGLWPQNEDGSYPQNCNRDNALDEDQI  89

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCS---IFDQCAYFESTLNIKDRVNFL  420
            S L   +Q +WP+LSCPS+ G +FW HEWEKHGTC+     DQ  YFE+ L +K++ N L
Sbjct  90   SDLTSSLQKDWPSLSCPSSTGFRFWSHEWEKHGTCAESEEIDQHGYFEAALKLKEKANLL  149

Query  419  QALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDI  240
            QAL NAGIKPD  FY++++IKEAIK   G TP IECN DAS+ SQLYQ+++CVD++G + 
Sbjct  150  QALNNAGIKPDDEFYDLDSIKEAIKDATGFTPGIECNIDASRNSQLYQVFMCVDISGSEF  209

Query  239  IECPTTVQRNCNTTV  195
            IECP   +R C + V
Sbjct  210  IECPELPKRRCASKV  224



>emb|CDX84041.1| BnaC08g16040D [Brassica napus]
Length=228

 Score =   253 bits (647),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 146/194 (75%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y V QWPG+YCDTK+ CCYP++GKPA +F IHGLWP + +GS+P NCNP+S +D+S+I
Sbjct  30   FFYLVLQWPGAYCDTKRSCCYPTSGKPAADFGIHGLWPNYKDGSYPSNCNPDSEFDKSQI  89

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            + L+  ++  WPTL+CPSN G KFWKHEWEKHGTC  S+ DQ  YFE++L ++DR N  Q
Sbjct  90   TDLVSSLKKTWPTLACPSNEGFKFWKHEWEKHGTCSESVMDQHEYFENSLKLRDRANLFQ  149

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL N+GIKPD  FY++E I++AIK  +G TP IECN D  +  QL+QIYICVD +G + I
Sbjct  150  ALTNSGIKPDDRFYDLEKIRKAIKDEIGFTPGIECNKDPERNDQLHQIYICVDTSGTEFI  209

Query  236  ECPTTVQRNCNTTV  195
            +CP   +  C + +
Sbjct  210  KCPILPRERCPSRL  223



>gb|AFK33515.1| unknown [Medicago truncatula]
Length=238

 Score =   254 bits (648),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 144/194 (74%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPG+YCDTK+ CCYP TGKP  +F IHGLWP + +GSWP NC+P+S  D+S+I
Sbjct  29   FFYFVQQWPGAYCDTKQSCCYPKTGKPTADFGIHGLWPNYNDGSWPSNCDPDSTLDKSQI  88

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L++ M   WP+LSCPS+NG +FW HEWEKHGTC  S  DQ  YFE+ L +K++ N LQ
Sbjct  89   SDLMKNMGKNWPSLSCPSSNGFRFWSHEWEKHGTCAESELDQHEYFETALKLKEKANLLQ  148

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            +L NAGI+P+  FY +E I EAIK G G TP IECN D+++ SQLYQ+Y+CVD +G + I
Sbjct  149  SLTNAGIEPNDEFYSIENISEAIKEGTGFTPGIECNRDSARNSQLYQVYMCVDTSGSNFI  208

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C   +
Sbjct  209  ECPLLPRSRCGEQI  222



>gb|AAG09465.1|AF227522_1 S-like ribonuclease [Prunus dulcis]
Length=227

 Score =   253 bits (647),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 147/194 (76%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPG+YCDTK+ CCYP +GKP+ +F IHGLWP + +GS+P NC+P+S++D+S+I
Sbjct  29   FFYFVQQWPGAYCDTKQTCCYPKSGKPSADFGIHGLWPNYKDGSYPSNCDPDSVFDKSEI  88

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L   ++  WP+L+CPS+NG +FW HEWEKHGTC  S  DQ  YFE+ L +K +VN LQ
Sbjct  89   SELTSNLEKNWPSLTCPSSNGFRFWSHEWEKHGTCSESELDQKDYFEAALKLKQKVNLLQ  148

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L+ AGI PD   Y +E+IKEAIK G G TP IECN D++  SQLYQ+Y+CVD +G+DII
Sbjct  149  ILKTAGIVPDDGMYSLESIKEAIKEGAGYTPGIECNKDSAGNSQLYQVYLCVDTSGQDII  208

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C + V
Sbjct  209  ECPVLPKGRCASDV  222



>ref|XP_007158650.1| hypothetical protein PHAVU_002G170800g [Phaseolus vulgaris]
 gb|ESW30644.1| hypothetical protein PHAVU_002G170800g [Phaseolus vulgaris]
Length=251

 Score =   253 bits (646),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 142/194 (73%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            FYY+V+QWPGSYCDT+  CCYP+TGKPA +F IHGLWP + +GS+P NC+ N+ +  S+I
Sbjct  53   FYYFVQQWPGSYCDTQNSCCYPTTGKPAADFGIHGLWPNYKDGSYPSNCDSNNRFQPSQI  112

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L   +Q  WPTL+CPS NG +FW HEWEKHGTC  S+  Q  YFE+ L++K R N L+
Sbjct  113  SDLTSSLQRNWPTLACPSGNGVQFWTHEWEKHGTCSESLLKQHDYFEAALDLKQRANLLR  172

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL NAGI+PDG FY + +IK AIK  +G TP IECN DAS+ SQLYQ+Y+CVD +G   I
Sbjct  173  ALTNAGIQPDGGFYSLSSIKGAIKDAIGYTPYIECNVDASRNSQLYQVYLCVDTSGSGFI  232

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C + V
Sbjct  233  ECPVFPKGKCGSQV  246



>ref|XP_008339897.1| PREDICTED: extracellular ribonuclease LE-like [Malus domestica]
Length=226

 Score =   252 bits (644),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 111/191 (58%), Positives = 144/191 (75%), Gaps = 2/191 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDTK  CCYP+TGKPA +F IHGLWP + +GS+P NC+P++ +D+S+I
Sbjct  28   FFYFVQQWPGSYCDTKTSCCYPTTGKPAADFGIHGLWPNYNDGSYPSNCDPSNPFDQSEI  87

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L   MQ EWPTL+CPS++G  FW HEWEKHGTC  S+ DQ  YFE+ LN+K ++N LQ
Sbjct  88   SDLRSSMQKEWPTLACPSSSGIAFWTHEWEKHGTCSESVIDQHGYFEAALNLKKKINLLQ  147

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            ALE+AGI+P+G+ Y ++ I  A+K   G TP IECN D S  SQLYQ+Y+CVD +G D+I
Sbjct  148  ALESAGIQPNGDSYTLQNITGAVKDATGFTPFIECNVDESGNSQLYQVYLCVDTSGSDLI  207

Query  236  ECPTTVQRNCN  204
            ECP      C 
Sbjct  208  ECPVFPHGQCG  218



>ref|XP_009103113.1| PREDICTED: ribonuclease 3 [Brassica rapa]
 emb|CDY40267.1| BnaA07g09330D [Brassica napus]
Length=222

 Score =   252 bits (643),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 138/194 (71%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V QWPG+YCD++  CCYP TGKPA +F IHGLWP +  G WP+NCNP+S +DE ++
Sbjct  24   FFYFVVQWPGAYCDSRHSCCYPKTGKPAADFGIHGLWPNYKTGGWPQNCNPDSTFDELRV  83

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L+  +Q EWPTLSCPSN+G  FW HEWEKHGTC  S  DQ  YFE+ L +K + N L 
Sbjct  84   SDLMSNLQREWPTLSCPSNDGVHFWTHEWEKHGTCAESELDQHDYFEAGLKLKQKANLLH  143

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL NAGIKPD  FYE++ I+ AIK  +G  P IECN D+S  SQLYQIY+CVD +  + I
Sbjct  144  ALTNAGIKPDDKFYEIKDIERAIKEAIGFAPGIECNKDSSHNSQLYQIYLCVDTSASNFI  203

Query  236  ECPTTVQRNCNTTV  195
             CP      C++ V
Sbjct  204  NCPVMPHGRCDSRV  217



>ref|XP_010527909.1| PREDICTED: ribonuclease 1 [Tarenaya hassleriana]
 ref|XP_010527910.1| PREDICTED: ribonuclease 1 [Tarenaya hassleriana]
Length=233

 Score =   252 bits (644),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 150/204 (74%), Gaps = 6/204 (3%)
 Frame = -2

Query  797  AAADHNSDLFYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNP  618
            A+AD +   F+Y+V+QWPGSYCDTKK CCYP+TGKPA +F IHGLWP + +G++P NC+ 
Sbjct  28   ASADFD---FFYFVQQWPGSYCDTKKSCCYPTTGKPAADFGIHGLWPNYEDGTYPSNCDD  84

Query  617  NSLYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLN  444
            NS +D+S IS LI  M+  WPTL+CPS  G  FW+HEWEKHGTC  S+ DQ  YF++TL 
Sbjct  85   NSPFDKSTISDLISNMRKSWPTLACPSGTGEAFWEHEWEKHGTCSESVLDQHDYFKTTLG  144

Query  443  IKDRVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYIC  264
            +K + N LQAL+ AGI PDG  Y +E+IK+AIK G G  P IECN+D S  +QLYQ+Y+C
Sbjct  145  LKQQTNILQALKTAGINPDGGSYSLESIKDAIKEGTGFDPWIECNTDESGNTQLYQVYLC  204

Query  263  VDLNGKDIIECPTTVQ-RNCNTTV  195
            VD +G  +IECP   + R C + +
Sbjct  205  VDRSGSKLIECPVKPRGRKCGSEI  228



>ref|XP_006415967.1| hypothetical protein EUTSA_v10008717mg [Eutrema salsugineum]
 gb|ESQ34320.1| hypothetical protein EUTSA_v10008717mg [Eutrema salsugineum]
Length=222

 Score =   251 bits (642),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 139/194 (72%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V QWPG+YCD+++ CCYP TGKPA +F IHGLWP +  G WP+NCNP+S +DES++
Sbjct  24   FFYFVLQWPGAYCDSRQHCCYPKTGKPAADFGIHGLWPNYKTGGWPQNCNPDSEFDESRV  83

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L+  +Q EWPTLSCPSN+G KFW HEWEKHGTC  S  DQ  YFE+ L +K + N L 
Sbjct  84   SDLMSNLQKEWPTLSCPSNDGVKFWTHEWEKHGTCAESELDQHDYFEAGLKLKQKANLLH  143

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L NAGIKPD  FYE+  I++ IK  +G  P IECN D+S  SQLYQIY+CVD +  + I
Sbjct  144  VLTNAGIKPDDKFYEINDIEKTIKEAIGFAPGIECNKDSSHNSQLYQIYLCVDTSASNFI  203

Query  236  ECPTTVQRNCNTTV  195
             CP      C++ V
Sbjct  204  NCPVMPHGRCDSRV  217



>ref|XP_004297299.1| PREDICTED: extracellular ribonuclease LE-like [Fragaria vesca 
subsp. vesca]
Length=231

 Score =   251 bits (642),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 145/194 (75%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGS+CDTK  CCYP+TGKPA +F IHGLWP + +GS+P NC+PN+ +D+S+I
Sbjct  33   FFYFVQQWPGSFCDTKTSCCYPTTGKPAADFGIHGLWPNYKDGSYPSNCDPNNPFDQSQI  92

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCS--IFDQCAYFESTLNIKDRVNFLQ  417
            S LI  MQ EWPTL+CPS++G  FW HEWEKHGTCS    +Q +YF + L++K + N LQ
Sbjct  93   SDLISSMQEEWPTLACPSSSGIAFWTHEWEKHGTCSETAINQHSYFAAALDLKKKANLLQ  152

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL++ GIKP+G  Y +  IK A+K  +G TP IECN D S  SQLYQ+Y+CVD NG D+I
Sbjct  153  ALQSTGIKPNGESYTLADIKAALKNAIGYTPYIECNVDESGNSQLYQVYLCVDTNGSDLI  212

Query  236  ECPTTVQRNCNTTV  195
            ECP      C +++
Sbjct  213  ECPIFPHGKCGSSI  226



>ref|NP_564264.1| ribonuclease 3 [Arabidopsis thaliana]
 sp|P42815.1|RNS3_ARATH RecName: Full=Ribonuclease 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF87036.1|AC006535_14 T24P13.23 [Arabidopsis thaliana]
 gb|AAC48926.1| ribonuclease [Arabidopsis thaliana]
 gb|AAD14489.1| ribonuclease [Arabidopsis thaliana]
 gb|AAL36200.1| putative ribonuclease, RNS3 [Arabidopsis thaliana]
 gb|AAM51363.1| putative ribonuclease RNS3 [Arabidopsis thaliana]
 gb|AAM67130.1| ribonuclease, RNS3 [Arabidopsis thaliana]
 gb|AEE30746.1| ribonuclease 3 [Arabidopsis thaliana]
Length=222

 Score =   251 bits (640),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 148/219 (68%), Gaps = 10/219 (5%)
 Frame = -2

Query  845  VVEEEEPFVTAFAEDDAAADHNSDLFYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHG  666
            ++  ++ +V +FA+D          F+Y+V QWPG+YCD++  CCYP TGKPA +F IHG
Sbjct  7    ILALQQLYVQSFAQDFD--------FFYFVLQWPGAYCDSRHSCCYPQTGKPAADFGIHG  58

Query  665  LWPTWLNGSWPENCNPNSLYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC  486
            LWP +  G WP+NCNP+S +D+ ++S L+  +Q EWPTLSCPSN+G KFW HEWEKHGTC
Sbjct  59   LWPNYKTGGWPQNCNPDSRFDDLRVSDLMSDLQREWPTLSCPSNDGMKFWTHEWEKHGTC  118

Query  485  --SIFDQCAYFESTLNIKDRVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIEC  312
              S  DQ  YFE+ L +K + N L AL NAGIKPD  FYE++ I+  IK  VG  P IEC
Sbjct  119  AESELDQHDYFEAGLKLKQKANLLHALTNAGIKPDDKFYEMKDIENTIKQVVGFAPGIEC  178

Query  311  NSDASKVSQLYQIYICVDLNGKDIIECPTTVQRNCNTTV  195
            N D+S  SQLYQIY+CVD +    I CP      C++ V
Sbjct  179  NKDSSHNSQLYQIYLCVDTSASKFINCPVMPHGRCDSRV  217



>emb|CDY20583.1| BnaC07g12500D [Brassica napus]
Length=222

 Score =   251 bits (640),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 138/194 (71%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V QWPG+YCD++  CCYP TGKPA +F IHGLWP +  G WP+NCNP+S +DE ++
Sbjct  24   FFYFVVQWPGAYCDSRHSCCYPKTGKPAADFGIHGLWPNYKTGGWPQNCNPDSTFDELRV  83

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L+  ++ EWPTLSCPSN+G  FW HEWEKHGTC  S  DQ  YFE+ L +K + N L 
Sbjct  84   SDLMSNLRREWPTLSCPSNDGVHFWTHEWEKHGTCAESELDQHDYFEAGLKLKQKANLLH  143

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL NAGIKPD  FYE++ I+ AIK  +G  P IECN D+S  SQLYQIY+CVD +  + I
Sbjct  144  ALTNAGIKPDDKFYEIKDIERAIKEAIGFAPGIECNKDSSHNSQLYQIYLCVDTSASNFI  203

Query  236  ECPTTVQRNCNTTV  195
             CP      C++ V
Sbjct  204  NCPVMPHGRCDSRV  217



>ref|XP_002275271.1| PREDICTED: extracellular ribonuclease LE [Vitis vinifera]
 emb|CBI31950.3| unnamed protein product [Vitis vinifera]
Length=226

 Score =   251 bits (640),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 146/194 (75%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y V+QWPGSYCD+K+ CCYP+TGKP  +F IHGLWP + +GS+P NC+ N+ YDES+I
Sbjct  28   FFYLVQQWPGSYCDSKQSCCYPTTGKPDADFGIHGLWPNYRDGSYPSNCDSNNPYDESEI  87

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S LI  MQ EWPTL+CPS NGSKFW HEW+KHGTC  S+  Q  YFE+ L++K  V+ +Q
Sbjct  88   SDLIRSMQEEWPTLACPSGNGSKFWAHEWDKHGTCSESVLSQYQYFEAALDLKKDVDLVQ  147

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L+ AGI+ +G  Y +  IK+AIK  VGVTP IECN D+S  SQLYQ+Y+CVD +GK+II
Sbjct  148  ILKKAGIRANGESYPLYDIKDAIKDAVGVTPWIECNVDSSGNSQLYQVYLCVDTSGKNII  207

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C + +
Sbjct  208  ECPVMPRGKCGSRI  221



>ref|XP_010477807.1| PREDICTED: ribonuclease 3 [Camelina sativa]
Length=222

 Score =   250 bits (639),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 137/194 (71%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V QWPG+YCD++  CCYP TGKPA +F IHGLWP +  G WP+NCNP+S +D+ ++
Sbjct  24   FFYFVLQWPGAYCDSRHSCCYPKTGKPAADFGIHGLWPNYKTGGWPQNCNPDSQFDDLRV  83

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L+  +Q EWPTLSCPSN+G KFW HEWEKHGTC  S  DQ  YFE+ L +K + N L 
Sbjct  84   SDLMSELQREWPTLSCPSNDGMKFWTHEWEKHGTCAESELDQHDYFEAGLKLKQKANLLH  143

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL NAGIKPD  FYE++ I+ AIK   G  P IECN D+S  SQLYQ+Y+CVD +    I
Sbjct  144  ALTNAGIKPDDKFYEMKNIQNAIKEATGFAPDIECNKDSSHNSQLYQVYLCVDTSASKFI  203

Query  236  ECPTTVQRNCNTTV  195
             CP      C++ V
Sbjct  204  NCPVMPHGRCDSRV  217



>ref|XP_009411173.1| PREDICTED: extracellular ribonuclease LE-like [Musa acuminata 
subsp. malaccensis]
Length=222

 Score =   250 bits (639),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 145/194 (75%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDTK+ CCYPSTGKPA +F IHGLWP + +GS+P NC+P   Y+ S+I
Sbjct  24   FFYFVQQWPGSYCDTKQSCCYPSTGKPAADFGIHGLWPNYNDGSYPSNCDPKRPYNASEI  83

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            + L+ RM+S WPTL+CPS +GS+FW HEWEKHGTC  S+ DQ +YF++ L++K RVN L+
Sbjct  84   NDLMGRMRSSWPTLACPSGDGSRFWSHEWEKHGTCSASVLDQHSYFQTALDLKKRVNLLK  143

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L++AG++PDG FY +  I  AI   +G  P IECN+D     QLYQIY+CVD +GK++I
Sbjct  144  LLQDAGVRPDGGFYGLGDISSAIGDAIGYAPGIECNADEFGNRQLYQIYVCVDTSGKELI  203

Query  236  ECPTTVQRNCNTTV  195
             CP      C++ +
Sbjct  204  RCPVYPTTKCSSRI  217



>ref|XP_006305515.1| hypothetical protein CARUB_v10009986mg [Capsella rubella]
 gb|EOA38413.1| hypothetical protein CARUB_v10009986mg [Capsella rubella]
Length=275

 Score =   252 bits (643),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/248 (48%), Positives = 157/248 (63%), Gaps = 11/248 (4%)
 Frame = -2

Query  917  LVILQCTISIYAAHSQSFLYYAEQVVEEEEPFVTAFAEDD-----AAADHNSDLFYYYVE  753
            L IL      + +H + F +   + +EE + F+   A         A D +   F+Y+V 
Sbjct  27   LSILYWVFDYFDSHKR-FGFSTFKYLEEMKFFICILALQQLYVQSVAQDFD---FFYFVL  82

Query  752  QWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKISYLIER  573
            QWPG+YCD++  CCYP TGKPA +F IHGLWP +  G WP+NCNP+S +D+ ++S L+  
Sbjct  83   QWPGAYCDSRHSCCYPKTGKPAADFGIHGLWPNYKTGGWPQNCNPDSQFDDLRVSDLMSE  142

Query  572  MQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQALENAG  399
            +Q EWPTLSCPSN+G KFW HEWEKHGTC  S  DQ  YFE+ L +K + N L AL NAG
Sbjct  143  LQREWPTLSCPSNDGMKFWTHEWEKHGTCAESELDQHDYFEAGLKLKQKANLLHALTNAG  202

Query  398  IKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDIIECPTTV  219
            IKPD  FYE++ I++ IK   G  P IECN D+S  SQLYQIY+CVD +    I CP   
Sbjct  203  IKPDDKFYEIKEIEKTIKEATGFAPGIECNKDSSHNSQLYQIYLCVDTSASKFINCPVMP  262

Query  218  QRNCNTTV  195
               C++ V
Sbjct  263  HGRCDSRV  270



>ref|XP_002316136.1| hypothetical protein POPTR_0010s17580g [Populus trichocarpa]
 gb|EEF02307.1| hypothetical protein POPTR_0010s17580g [Populus trichocarpa]
Length=226

 Score =   250 bits (638),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 144/194 (74%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDT   CCYP+TGKPA +F IHGLWP + +G++P+NC+ +S YD  K+
Sbjct  28   FFYFVQQWPGSYCDTMTSCCYPTTGKPAADFGIHGLWPNYNDGTYPKNCDASSPYDPKKV  87

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            + L   MQ  WPTL+CPS  G  FW HEWEKHGTC  SI DQ  YF++ L++K +VN LQ
Sbjct  88   ADLRSGMQKNWPTLACPSGTGVAFWTHEWEKHGTCSESILDQHGYFQAALDLKKQVNLLQ  147

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL NAGI PDG  Y + +IK AI+  VG TP IECN+D S+ SQLYQIY+CVD +GK++I
Sbjct  148  ALTNAGINPDGGSYSLSSIKSAIQEAVGFTPWIECNTDTSRNSQLYQIYLCVDTSGKNVI  207

Query  236  ECPTTVQRNCNTTV  195
            +CP   +  C++ +
Sbjct  208  DCPVFPRGKCDSEI  221



>ref|XP_003613789.1| Ribonuclease T2 [Medicago truncatula]
 gb|AES96747.1| ribonuclease T2 family protein [Medicago truncatula]
Length=228

 Score =   249 bits (637),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 144/194 (74%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCD+KK CCYP+TGKPA +F IHGLWP + +G++P NC+PN+ +D S+I
Sbjct  30   FFYFVQQWPGSYCDSKKSCCYPTTGKPAADFGIHGLWPNYKDGTYPSNCDPNNAFDPSQI  89

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L   +Q  WPTL+CPS +G +FW HEWEKHGTC  S+  Q  YFE+TLN++ + N LQ
Sbjct  90   SDLKSNLQQNWPTLACPSGDGIQFWTHEWEKHGTCSESVLKQHDYFETTLNLRQKANLLQ  149

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL +AG++PDGN Y + +IK AI+  VG  P IECN D+S  SQLYQ+Y+CVD +G + I
Sbjct  150  ALTSAGVQPDGNSYSLSSIKGAIQNAVGFAPFIECNVDSSGNSQLYQVYLCVDTSGSNFI  209

Query  236  ECPTTVQRNCNTTV  195
            +CP      C + +
Sbjct  210  DCPVFPHGKCGSEI  223



>ref|XP_003517989.1| PREDICTED: ribonuclease 1-like [Glycine max]
 gb|KHN01230.1| Ribonuclease 1 [Glycine soja]
Length=227

 Score =   249 bits (637),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 111/203 (55%), Positives = 148/203 (73%), Gaps = 5/203 (2%)
 Frame = -2

Query  797  AAADHNSDLFYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNP  618
            A+ D N   F+Y+V+QWPGSYCDT+K CCYP+TGKPA +F IHGLWP + +G++P NC+P
Sbjct  23   ASPDFN---FFYFVQQWPGSYCDTQKSCCYPTTGKPAADFGIHGLWPNYNDGTYPSNCDP  79

Query  617  NSLYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLN  444
            N+ ++ S IS L   +QS WPTL+CPS++G  FW HEW+KHGTC  S+  Q  YFE+ LN
Sbjct  80   NNPFNPSGISDLTSSLQSNWPTLACPSSDGITFWTHEWDKHGTCSESVLKQHDYFEAALN  139

Query  443  IKDRVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYIC  264
            ++ + N LQAL NAGI+PDG  Y +  IKEAIK G+G  P IECN D+S  SQLYQ+Y+C
Sbjct  140  LRQKANLLQALTNAGIQPDGQSYSLSDIKEAIKNGIGYAPFIECNVDSSGNSQLYQVYLC  199

Query  263  VDLNGKDIIECPTTVQRNCNTTV  195
            V+ +G D +ECP   +  C + +
Sbjct  200  VNTSGSDFMECPVFPRSKCGSDI  222



>ref|XP_009360332.1| PREDICTED: ribonuclease 3-like [Pyrus x bretschneideri]
 dbj|BAA08475.1| ribonuclease [Pyrus pyrifolia]
Length=227

 Score =   249 bits (636),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 146/194 (75%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPG+YCDTK  CCYP +GKP  +F IHGLWP + +G +P NC+P+S++D+S+I
Sbjct  29   FFYFVQQWPGAYCDTKHTCCYPKSGKPTADFGIHGLWPNYKDGGYPSNCDPDSVFDKSQI  88

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L+  +   WP+LSCPS+NG +FW HEWEKHGTC  S  DQ  YFE+ L ++++VN LQ
Sbjct  89   SELLTSLNKNWPSLSCPSSNGYRFWSHEWEKHGTCSESELDQKEYFEAALKLREKVNLLQ  148

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L+NAGI P+   Y +E+I EAIK GVG TP IECN D++  SQLYQIY+CVD +G+DII
Sbjct  149  ILKNAGIVPNDELYNLESIVEAIKVGVGHTPGIECNKDSAGNSQLYQIYLCVDTSGQDII  208

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C + +
Sbjct  209  ECPLLPKGRCASKI  222



>gb|KHG28210.1| Ribonuclease 3 -like protein [Gossypium arboreum]
Length=228

 Score =   248 bits (634),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 144/194 (74%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V QWPGSYCDTK+ CCYP TGKP+ +F IHGLWP + +G +P NC+ NS +D+S+I
Sbjct  30   FFYFVLQWPGSYCDTKQRCCYPKTGKPSADFGIHGLWPNYNDGGYPSNCDTNSRFDKSEI  89

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S LI  ++ EWPTLSCPSN+G KFW HEW KHGTC  S   Q  YFE+ L +K + N LQ
Sbjct  90   SSLIGSLEKEWPTLSCPSNDGVKFWTHEWLKHGTCSESELGQREYFEAALQLKQKANLLQ  149

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL +AGIKP+  FYE+E I++AI+  VG TP IECN D+S+ SQLYQ+Y+CVD +G D I
Sbjct  150  ALTSAGIKPNDEFYELEEIEDAIRQAVGFTPGIECNVDSSRNSQLYQVYLCVDNSGSDFI  209

Query  236  ECPTTVQRNCNTTV  195
            +CP   +  C + +
Sbjct  210  KCPLLPRAKCGSRI  223



>ref|XP_011075505.1| PREDICTED: extracellular ribonuclease LE-like [Sesamum indicum]
Length=228

 Score =   248 bits (633),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 149/194 (77%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDTK+ CCYP+TGKP ++F IHGLWP + +GS+P NC+P++ YD+SKI
Sbjct  30   FFYFVQQWPGSYCDTKRSCCYPTTGKPPSDFGIHGLWPNYRDGSYPSNCDPSNPYDQSKI  89

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S LI RMQ  W TLSCPSN+GS FW HEWEKHGTC  S+ DQ  YF++ L++K +++ LQ
Sbjct  90   SDLISRMQENWATLSCPSNSGSTFWSHEWEKHGTCSESVLDQHGYFKAALDLKSKLDLLQ  149

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L++AGI PDG FY + +I+ AI+ G+G TP IECN D    SQLYQIY+CVD +G ++I
Sbjct  150  ILQSAGINPDGGFYSLSSIRSAIRKGIGYTPGIECNVDEEGNSQLYQIYVCVDTSGSELI  209

Query  236  ECPTTVQRNCNTTV  195
            ECP      C +T+
Sbjct  210  ECPVFPNGKCASTI  223



>ref|XP_010495851.1| PREDICTED: ribonuclease 3-like [Camelina sativa]
Length=226

 Score =   248 bits (633),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 139/194 (72%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y V QWPG+YCDTK+ CCYP++GKP  +F IHGLWP + +GSWP NC+P+S +  S+I
Sbjct  28   FFYLVVQWPGAYCDTKRSCCYPTSGKPEADFGIHGLWPNYKDGSWPSNCDPDSQFGRSQI  87

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
              L+ RM+  WPTLSCPSN G  FW+HEWEKHGTC  S+ DQ  YFE+ L +KD+ N LQ
Sbjct  88   EDLLSRMKKNWPTLSCPSNEGFNFWEHEWEKHGTCSESVMDQHEYFENALKLKDKANLLQ  147

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L N+GI PD  FY++  I  AIK G+G TP +ECN D  + +QLYQIYICVD +G + I
Sbjct  148  ILTNSGINPDDEFYDLNKITNAIKDGIGFTPGLECNKDPERNAQLYQIYICVDTSGTEFI  207

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C + +
Sbjct  208  ECPVLPRGRCPSKL  221



>gb|AAC49326.1| wounding-induced ribonuclease gene [Zinnia violacea]
Length=229

 Score =   248 bits (633),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 146/194 (75%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y V+QWPGSYCDTK+GCCYPSTGKPA++F IHGLWP   +GS+P NC+ ++ +D SKI
Sbjct  31   FFYLVQQWPGSYCDTKQGCCYPSTGKPASDFGIHGLWPNRNDGSYPSNCDSSNPFDASKI  90

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L   MQSEWPTL CPSNNG  FW HEW+KHGTC  S+ +Q  YF +TL++K+ +N LQ
Sbjct  91   SDLTSHMQSEWPTLLCPSNNGLAFWGHEWDKHGTCSESVLNQHDYFATTLSLKNEINLLQ  150

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL +AGI+P+G  Y + +IK AIK   G TP +ECN+D+S  SQLYQIY+CVD +    I
Sbjct  151  ALRSAGIQPNGQKYSLSSIKTAIKQASGYTPWVECNNDSSGNSQLYQIYLCVDSSASGFI  210

Query  236  ECPTTVQRNCNTTV  195
            ECP   + +C +++
Sbjct  211  ECPVFPKGSCGSSI  224



>ref|XP_010498993.1| PREDICTED: ribonuclease 3-like [Camelina sativa]
Length=222

 Score =   248 bits (632),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 137/194 (71%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V QWPG+YCD++  CCYP TGKPA +F IHGLWP +  G WP+NCNP+S +D+ ++
Sbjct  24   FFYFVLQWPGAYCDSRHSCCYPKTGKPAADFGIHGLWPNYKTGGWPQNCNPDSQFDDLRV  83

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L+  +Q EWPTLSCPSN+G KFW HEWEKHGTC  S  DQ  YFE+ L +K + N   
Sbjct  84   SDLMIDLQREWPTLSCPSNDGMKFWTHEWEKHGTCAESELDQHDYFEAGLKLKQKANLFH  143

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL NAGIKPD  FYE++ I+ AIK   G +P IECN D+S  SQLYQ+Y+CVD +    I
Sbjct  144  ALTNAGIKPDDKFYEMKNIQNAIKEATGFSPGIECNKDSSHNSQLYQVYLCVDTSASKFI  203

Query  236  ECPTTVQRNCNTTV  195
             CP      C++ V
Sbjct  204  NCPVMPHGRCDSRV  217



>ref|NP_563941.1| ribonuclease T2 [Arabidopsis thaliana]
 gb|AAD39308.1|AC007576_31 Very similar to ribonucleases [Arabidopsis thaliana]
 gb|AEE29124.1| ribonuclease T2 [Arabidopsis thaliana]
Length=228

 Score =   248 bits (632),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 141/194 (73%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V QWPG+YCDT + CCYP++GKPA +F IHGLWP +  GSWP NC+P+S +D S+I
Sbjct  30   FFYFVLQWPGAYCDTSRACCYPTSGKPAADFGIHGLWPNYNGGSWPSNCDPDSQFDRSQI  89

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L+  ++  WPTLSCPSN G  FW+HEWEKHGTC  S+ DQ  YFE+ L +K + N LQ
Sbjct  90   SDLVSSLKKNWPTLSCPSNEGFNFWEHEWEKHGTCSESVMDQHEYFENALKLKQKANLLQ  149

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L+N+GI PD  FY ++ I  AIK G+G TP IECN D  + +QL+QIYICVD +G + I
Sbjct  150  ILKNSGINPDDGFYNLDKITNAIKDGIGFTPGIECNKDPERNAQLHQIYICVDTSGTEFI  209

Query  236  ECPTTVQRNCNTTV  195
            ECP   + +C + +
Sbjct  210  ECPVLPRGSCPSQI  223



>ref|XP_010258337.1| PREDICTED: ribonuclease 1-like [Nelumbo nucifera]
Length=248

 Score =   248 bits (633),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 144/195 (74%), Gaps = 3/195 (2%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPN-SLYDESK  594
            F+Y+V+QWPGSYCDT++GCCYP TGKPA +FSIHGLWP + +GS+P NC+   + +D S+
Sbjct  28   FFYFVQQWPGSYCDTRRGCCYPKTGKPAADFSIHGLWPNYNDGSYPSNCDSQQNPFDPSE  87

Query  593  ISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCS--IFDQCAYFESTLNIKDRVNFL  420
            I+ L +RMQ  WP+L+CP+N+  KFW HEW KHGTCS  + DQ  YFE+ LN+K +V+ L
Sbjct  88   ITDLTDRMQRSWPSLACPNNDMLKFWSHEWNKHGTCSESVLDQHGYFETALNLKKKVDLL  147

Query  419  QALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDI  240
            Q L  AGI PDGNFY +  IK AI    G TP IECN D S  SQLYQ+Y+CVD +G D+
Sbjct  148  QILAEAGINPDGNFYNLRDIKVAISEATGYTPGIECNVDGSGNSQLYQVYLCVDKSGPDL  207

Query  239  IECPTTVQRNCNTTV  195
            I+CP   +  C++T+
Sbjct  208  IKCPVYPRSRCDSTI  222



>ref|NP_001238449.1| uncharacterized protein LOC100305644 precursor [Glycine max]
 gb|ACU13430.1| unknown [Glycine max]
 gb|KHN07840.1| Ribonuclease 1 [Glycine soja]
Length=227

 Score =   247 bits (631),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 142/195 (73%), Gaps = 3/195 (2%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDT-KKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESK  594
            FYY+V+QWPGSYCDT +  CCYP+TGKPA +F IHGLWP + +GS+P NC+ N+ +  S+
Sbjct  28   FYYFVQQWPGSYCDTTQNSCCYPTTGKPAADFGIHGLWPNYKDGSYPSNCDSNNRFQPSQ  87

Query  593  ISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFL  420
            IS L   +Q  WPTL+CPS NG +FW HEWEKHGTC  S+  Q  YFE+ L++K R N L
Sbjct  88   ISDLTSSLQRNWPTLACPSGNGVQFWTHEWEKHGTCSQSVLKQHDYFETALDLKQRANLL  147

Query  419  QALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDI  240
            QAL NAGI+PDG FY + +IK AIK  +G TP IECN D S+ +QLYQ+Y+CVD +G + 
Sbjct  148  QALTNAGIQPDGGFYSLSSIKGAIKNAIGYTPYIECNVDTSRNNQLYQVYLCVDTSGSNF  207

Query  239  IECPTTVQRNCNTTV  195
            IECP   +  C + V
Sbjct  208  IECPVFPRGKCGSQV  222



>ref|XP_006355102.1| PREDICTED: extracellular ribonuclease LE-like [Solanum tuberosum]
Length=230

 Score =   247 bits (631),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 114/205 (56%), Positives = 153/205 (75%), Gaps = 6/205 (3%)
 Frame = -2

Query  800  DAAADHNSDLFYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCN  621
            +AA D +   F+Y+V+QWPGSYCDTK+ CCYP+TGKPA +F IHGLWP   +G++P NC+
Sbjct  24   NAATDFD---FFYFVQQWPGSYCDTKQSCCYPTTGKPAADFGIHGLWPNNNDGTYPSNCD  80

Query  620  PNSLYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIF-DQCAYFEST  450
            PN+ YD+S++S LI RMQ  WPTL+CPS +GS FW HEWEKHGTC  S+F +Q AYF+ T
Sbjct  81   PNNPYDQSQVSDLISRMQQNWPTLACPSGSGSTFWSHEWEKHGTCAESVFTNQHAYFKKT  140

Query  449  LNIKDRVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIY  270
            L++K++V+ L  L+ A I PDG  Y++  I+ AIK+ +G TP I+CN D S  SQLYQ+Y
Sbjct  141  LDLKNQVDLLSILQGADIHPDGKSYDLVNIRNAIKSAIGYTPWIQCNVDQSGNSQLYQVY  200

Query  269  ICVDLNGKDIIECPTTVQRNCNTTV  195
            ICVD +G ++IECP      C T++
Sbjct  201  ICVDGSGSNLIECPIFPGGKCGTSI  225



>ref|XP_002892796.1| ribonuclease T2 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69055.1| ribonuclease T2 family protein [Arabidopsis lyrata subsp. lyrata]
Length=226

 Score =   247 bits (630),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 139/194 (72%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y V QWPG+YCDTK+ CCYP++GKPA +F IHGLWP +  GSWP NC+P+S +D S+I
Sbjct  28   FFYLVLQWPGAYCDTKRACCYPTSGKPAADFGIHGLWPNYNGGSWPSNCDPDSQFDRSQI  87

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L+  ++  WPTLSCPSN G KFW+HEWEKHGTC  S+ DQ  YFE+ L +K++ N LQ
Sbjct  88   SDLVSSLKKNWPTLSCPSNEGFKFWEHEWEKHGTCSESVMDQHDYFENALKLKEKANLLQ  147

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L N+GI PD  FY +  I  AIK G+G TP IECN D  +  QL+QIYICVD +G + I
Sbjct  148  ILTNSGINPDDGFYSLTKITNAIKNGIGFTPGIECNKDPERNDQLHQIYICVDTSGTEFI  207

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C + +
Sbjct  208  ECPVLPRGRCPSQL  221



>ref|XP_010458911.1| PREDICTED: ribonuclease 3-like [Camelina sativa]
Length=226

 Score =   247 bits (630),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 139/194 (72%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y V QWPG+YCDTK+ CCYP++GKP  +F IHGLWP + +GSWP NC+P+S +D S+I
Sbjct  28   FFYLVVQWPGAYCDTKRSCCYPTSGKPEADFGIHGLWPNYKDGSWPSNCDPDSQFDRSQI  87

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
              L+  M+  WPTLSCPSN G  FW+HEWEKHGTC  S+ DQ  YFE+ L +KD+ N LQ
Sbjct  88   EDLLSSMKKNWPTLSCPSNEGFNFWEHEWEKHGTCSESVMDQHEYFENALKLKDKANLLQ  147

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L N+GI PD  FY++  I  AIK G+G TP ++CN D  + +QLYQIYICVD +G + I
Sbjct  148  ILTNSGINPDDGFYDLNKITNAIKDGIGFTPGLQCNKDPERNAQLYQIYICVDTSGTEFI  207

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C + +
Sbjct  208  ECPVLPRGRCPSQL  221



>gb|EYU28760.1| hypothetical protein MIMGU_mgv1a013386mg [Erythranthe guttata]
Length=222

 Score =   247 bits (630),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 145/194 (75%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDTK+ CCYP+TGKP ++F IHGLWP + +GS+P NC+P++ YD+SKI
Sbjct  24   FFYFVQQWPGSYCDTKQSCCYPTTGKPPSDFGIHGLWPNYKDGSYPSNCDPSNSYDQSKI  83

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S LI +MQ  W TL+CPSN+GS FW HEW+KHGTC  S+ DQ +YF + LN+K +++ LQ
Sbjct  84   SDLISKMQENWATLACPSNSGSTFWSHEWDKHGTCSESVLDQHSYFGTALNLKSKLDLLQ  143

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L++AGI PDG+ Y +  I+  I   +G TP I+CN D    SQLYQ+Y+CVD +G ++I
Sbjct  144  ILQSAGINPDGSLYSLSTIRSTISNAIGYTPWIQCNVDEQGNSQLYQVYVCVDNSGSNLI  203

Query  236  ECPTTVQRNCNTTV  195
            ECP      C +++
Sbjct  204  ECPVFPNGKCGSSI  217



>ref|XP_008389464.1| PREDICTED: ribonuclease 3-like [Malus domestica]
Length=227

 Score =   247 bits (630),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 145/194 (75%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPG+YCDTK  CCYP +GKP  +F IHGLWP + +G +P NC+P+S++D+S+I
Sbjct  29   FFYFVQQWPGAYCDTKHTCCYPKSGKPTADFGIHGLWPNYKDGGYPSNCDPDSVFDKSQI  88

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L+  +   WP+LSCPS+NG +FW HEWEKHGTC  S  DQ  YFE+ L ++++VN LQ
Sbjct  89   SELMTSLNKNWPSLSCPSSNGYRFWSHEWEKHGTCSESELDQKEYFEAALKLREKVNLLQ  148

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L+NAGI P+   Y +E+I EAIK GVG TP IECN D++  SQLYQ+Y+CVD +G+DII
Sbjct  149  ILKNAGIVPNDELYNLESIVEAIKEGVGHTPGIECNKDSAGNSQLYQVYLCVDTSGQDII  208

Query  236  ECPTTVQRNCNTTV  195
             CP   +  C + V
Sbjct  209  ACPLLPKGRCASKV  222



>ref|XP_010476468.1| PREDICTED: ribonuclease 3-like [Camelina sativa]
Length=229

 Score =   247 bits (630),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 136/184 (74%), Gaps = 2/184 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V QWPG+YCDTK  CCYP++GKPA +F IHGLWP + + SWP NC+P+S +D S+I
Sbjct  30   FFYFVVQWPGAYCDTKSSCCYPTSGKPAADFGIHGLWPNYNSSSWPSNCDPDSKFDRSQI  89

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
              L+  M+  WPTLSCPSN G KFWKHEWEKHGTC  S+ DQ  YFE+ L +KD+ N LQ
Sbjct  90   EDLLSSMKKNWPTLSCPSNEGFKFWKHEWEKHGTCAESVMDQHEYFEAALKLKDKANLLQ  149

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L NA I PD  FY+++ I +AIK G+G TP ++CN D  +  QLYQIYICVD +G + I
Sbjct  150  TLTNAEINPDDGFYDLKKITKAIKDGIGFTPGLQCNKDRERNDQLYQIYICVDTSGTEFI  209

Query  236  ECPT  225
            ECP 
Sbjct  210  ECPV  213



>ref|XP_002522442.1| ribonuclease t2, putative [Ricinus communis]
 gb|EEF39934.1| ribonuclease t2, putative [Ricinus communis]
Length=226

 Score =   246 bits (629),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 143/194 (74%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDTK+ CCYP+TGKPA +F IHGLWP + +GS+P NC+ N+ +++ KI
Sbjct  28   FFYFVQQWPGSYCDTKQSCCYPTTGKPAADFGIHGLWPNYDDGSYPSNCDSNNPFNQKKI  87

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L   MQ  WPTL+CPS NG  FW HEWEKHGTC  SI DQ  YF++ L++K +VN LQ
Sbjct  88   SDLTSSMQKNWPTLACPSGNGVTFWTHEWEKHGTCSESILDQHGYFKAALDLKKQVNLLQ  147

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L++A I P+G  Y + +IK AI+  +G TP IECNSDAS  SQLYQIY+CVD +G ++I
Sbjct  148  VLQSADIVPNGGTYSLSSIKSAIQESIGYTPWIECNSDASGNSQLYQIYLCVDTSGSNLI  207

Query  236  ECPTTVQRNCNTTV  195
            ECP      C + +
Sbjct  208  ECPVFPHGKCGSQI  221



>ref|XP_002890631.1| hypothetical protein ARALYDRAFT_472718 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66890.1| hypothetical protein ARALYDRAFT_472718 [Arabidopsis lyrata subsp. 
lyrata]
Length=222

 Score =   246 bits (629),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 136/194 (70%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V QWPG+YCD+   CCYP TGKPA +F IHGLWP +  G WP+NCNP+S +D+ ++
Sbjct  24   FFYFVLQWPGAYCDSIHSCCYPKTGKPAADFGIHGLWPNYKTGGWPQNCNPDSQFDDLRV  83

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L+  +Q EWPTLSCPSN+G KFW HEWEKHGTC  S  DQ  YFE+ L +K + N L 
Sbjct  84   SDLMNDLQREWPTLSCPSNDGMKFWTHEWEKHGTCAESELDQHDYFEAGLKLKQKANLLH  143

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL NAGIKPD  FYE++ I+  IK  VG  P IECN D+S  SQLYQIY+CVD +    I
Sbjct  144  ALTNAGIKPDDKFYEMKDIENTIKEVVGFAPGIECNKDSSHNSQLYQIYLCVDTSASKFI  203

Query  236  ECPTTVQRNCNTTV  195
             CP      C++ V
Sbjct  204  NCPVMPHGRCDSRV  217



>ref|XP_006303725.1| hypothetical protein CARUB_v10011861mg [Capsella rubella]
 gb|EOA36623.1| hypothetical protein CARUB_v10011861mg [Capsella rubella]
Length=226

 Score =   246 bits (628),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 138/190 (73%), Gaps = 2/190 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y V QWPG+YCDTK+ CCYP++GKP  +F IHGLWP + +GSWP NC+P+S +D ++I
Sbjct  28   FFYLVVQWPGAYCDTKRACCYPTSGKPDADFGIHGLWPNYKDGSWPSNCDPDSQFDRTQI  87

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
              L+  M+  WPTLSCPSN G +FW+HEWEKHGTC  S+ DQ  YFE+ L +KD+ N LQ
Sbjct  88   EDLVSSMKKNWPTLSCPSNEGFEFWEHEWEKHGTCSESVMDQHEYFENALKLKDKANLLQ  147

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L N+GI PD  FY +  I +AIK G+G TP I+CN D  + +QLYQIY+CVD +G + I
Sbjct  148  ILTNSGINPDDGFYGLSEITKAIKDGIGFTPGIQCNKDPERNAQLYQIYLCVDTSGTEFI  207

Query  236  ECPTTVQRNC  207
            ECP   +  C
Sbjct  208  ECPVLPRGRC  217



>ref|XP_009395130.1| PREDICTED: extracellular ribonuclease LE-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=225

 Score =   246 bits (627),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 149/203 (73%), Gaps = 3/203 (1%)
 Frame = -2

Query  797  AAADHNSDLFYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNP  618
            A+  H+ D F+Y+V+QWPGSYCDT++ CCYPSTGKPA++F IHGLWP + +GS+P NC+ 
Sbjct  19   ASTAHDFD-FFYFVQQWPGSYCDTRQSCCYPSTGKPASDFGIHGLWPNYNDGSYPSNCDS  77

Query  617  NSLYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLN  444
            +  YD S++S L+  MQ  WPTL+CPS +GS FW HEW KHGTC  S+ DQ +YF++ L 
Sbjct  78   DWPYDASEMSDLMGMMQMNWPTLACPSGDGSSFWSHEWRKHGTCSESLLDQRSYFQAALY  137

Query  443  IKDRVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYIC  264
            +K +V+ L+ L++AGI+PDG FY +  I  AI+  +G TP I+CN D S   QLYQIY+C
Sbjct  138  LKKQVDLLKVLQDAGIRPDGGFYSLRGIAGAIREAIGYTPGIQCNVDESGNRQLYQIYLC  197

Query  263  VDLNGKDIIECPTTVQRNCNTTV  195
            VD  GK++IECP   +  C++ V
Sbjct  198  VDTWGKELIECPVFPRSKCSSRV  220



>gb|AAC49325.1| ribonuclease [Zinnia violacea]
Length=239

 Score =   246 bits (628),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 146/196 (74%), Gaps = 4/196 (2%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCD+++GCCYP TGKPA +FSIHGLWP +++G++P NC+ ++ +D+SK+
Sbjct  30   FFYFVQQWPGSYCDSRRGCCYPKTGKPAEDFSIHGLWPNYVDGTYPSNCDSSNQFDDSKV  89

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L   +Q  WPTL+CPS +G KFW+HEWEKHGTC  SIFD+  YFE+ L++K + N L 
Sbjct  90   SNLESELQVHWPTLACPSGDGLKFWRHEWEKHGTCAESIFDERGYFEAALSLKKKANLLN  149

Query  416  ALENAGIKP-DGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDI  240
            ALENAGI+P DG F+ ++ IK+AI   VG  P IECN D+S   QLYQ+Y CVD +  + 
Sbjct  150  ALENAGIRPADGKFHTLDQIKDAITQAVGYEPYIECNVDSSGYHQLYQVYQCVDRSASNF  209

Query  239  IECPTTVQ-RNCNTTV  195
            I+CP  +  R C   V
Sbjct  210  IKCPVLLTGRACGNKV  225



>ref|XP_010066906.1| PREDICTED: ribonuclease 3-like [Eucalyptus grandis]
 gb|KCW64953.1| hypothetical protein EUGRSUZ_G02497 [Eucalyptus grandis]
Length=228

 Score =   246 bits (627),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 149/194 (77%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDTK+ CCYP TGKPA +FSIHGLWP + +G++P NCN ++ +++S+I
Sbjct  30   FFYFVQQWPGSYCDTKRKCCYPKTGKPAADFSIHGLWPNYNDGTYPSNCNNDNAFEKSEI  89

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S LI  ++  WP+L+CPS++ +KFW HEW+KHGTC  S  DQ  YFE+ L +K++VN LQ
Sbjct  90   SDLIGSLEKNWPSLTCPSSDDTKFWTHEWDKHGTCSESELDQHEYFEAALKLKEKVNLLQ  149

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L+NAGIKP+  FY ++++KEAIK  +G  P +ECN D+S  SQ+YQI++CVD +G ++I
Sbjct  150  NLKNAGIKPNNEFYSIDSVKEAIKEAIGFEPGLECNKDSSGNSQIYQIFVCVDTSGSELI  209

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C + V
Sbjct  210  ECPVLPRGRCASQV  223



>ref|XP_002311302.1| S2-RNase family protein [Populus trichocarpa]
 gb|EEE88669.1| S2-RNase family protein [Populus trichocarpa]
Length=227

 Score =   245 bits (626),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 142/194 (73%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDTK+ CCYP+TGKPA +F IHGLWP + +G++P+NC+  + ++  K+
Sbjct  29   FFYFVQQWPGSYCDTKQSCCYPTTGKPAADFGIHGLWPNYQDGNYPQNCDSKNPFNPDKV  88

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            + L   MQ  WPTL+CPS NG  FW HEWEKHGTC  S+ DQ  YF++ L+++ + N LQ
Sbjct  89   ADLRSSMQKNWPTLACPSGNGVSFWTHEWEKHGTCSESVLDQHGYFQAALSLQKQANLLQ  148

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL +AGI PDG  Y +  IK AI+  VG TP IECN+DAS  SQLYQIY+CVD  GK++I
Sbjct  149  ALASAGINPDGGSYSMSNIKRAIQEAVGFTPWIECNTDASGNSQLYQIYLCVDTTGKNLI  208

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C + +
Sbjct  209  ECPVFPKGKCGSDI  222



>gb|KFK44585.1| hypothetical protein AALP_AA1G277900 [Arabis alpina]
Length=222

 Score =   245 bits (625),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 136/194 (70%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V QWPG+YCD++  CCYP TGKPA +F IHGLWP +  G WP+NCNP+S + ES++
Sbjct  24   FFYFVLQWPGAYCDSRHSCCYPKTGKPAADFGIHGLWPNYKTGGWPQNCNPDSRFVESRV  83

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L+  +Q EWPTLSCPSN+G  FW HEWEKHGTC  S  DQ  YFE+ L +K + N L 
Sbjct  84   SDLMSNLQREWPTLSCPSNDGVNFWTHEWEKHGTCAESELDQHDYFEAGLKLKQKANLLH  143

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL NAGIKPD  FYE + I++ I+  +G  P IECN D+S  SQLYQIY+CVD +    I
Sbjct  144  ALINAGIKPDDKFYETKDIEKTIQEAIGFAPGIECNKDSSHNSQLYQIYLCVDTSASKFI  203

Query  236  ECPTTVQRNCNTTV  195
             CP      C++ V
Sbjct  204  NCPVMPHGRCDSRV  217



>ref|XP_006344331.1| PREDICTED: ribonuclease 1-like [Solanum tuberosum]
Length=236

 Score =   245 bits (625),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 143/194 (74%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QW  + CD K  CCYP+TGKPA +F IHGLWP + N ++P NCN NS +DE++I
Sbjct  27   FFYFVQQWLPALCDKKAACCYPTTGKPALDFGIHGLWPVYNNHTFPSNCNGNSPFDENQI  86

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCSI--FDQCAYFESTLNIKDRVNFLQ  417
              L+  MQ +WPTL+CP NNG KFW HEW KHGTCS+   D  +YF+ TL +K++VN LQ
Sbjct  87   LDLMSDMQKDWPTLACPKNNGKKFWAHEWNKHGTCSLSMLDMHSYFQVTLALKEKVNLLQ  146

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L+NAGI+PDG  Y ++AIKEAIK G+G   +IECN+D    +QL+Q+YICVD  G D+I
Sbjct  147  LLKNAGIRPDGGSYGMKAIKEAIKNGIGHDVVIECNNDVFGNNQLFQVYICVDKTGSDLI  206

Query  236  ECPTTVQRNCNTTV  195
            ECP  ++R C+  +
Sbjct  207  ECPMILKRKCDENI  220



>ref|XP_010476469.1| PREDICTED: ribonuclease 3-like isoform X1 [Camelina sativa]
 ref|XP_010476470.1| PREDICTED: ribonuclease 3-like isoform X2 [Camelina sativa]
Length=226

 Score =   244 bits (624),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 141/194 (73%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y V QWPG+YCDTK+ CCYP++GKP  +F IHGLWP + +GS+P NC+P+S +D S+I
Sbjct  28   FFYLVVQWPGAYCDTKRSCCYPTSGKPDADFGIHGLWPNYKDGSYPSNCDPDSQFDRSQI  87

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
              L+  M+  WPTLSCPSN G  FW+HEWEKHGTC  S+ DQ  YF++TL +KD+ N LQ
Sbjct  88   EDLLSGMKKNWPTLSCPSNEGFNFWEHEWEKHGTCSESVMDQHDYFKNTLKLKDKANLLQ  147

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L N+GI PD  FY++  I +AIK G+G TP ++CN D  + SQLYQIY+CVD +G + I
Sbjct  148  ILTNSGINPDDGFYDLNKITKAIKDGIGFTPGLQCNKDPERNSQLYQIYLCVDTSGSEFI  207

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C + +
Sbjct  208  ECPVLPRGRCPSKL  221



>ref|XP_010066908.1| PREDICTED: ribonuclease 1-like [Eucalyptus grandis]
 gb|KCW64955.1| hypothetical protein EUGRSUZ_G02499 [Eucalyptus grandis]
Length=225

 Score =   244 bits (624),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 146/194 (75%), Gaps = 3/194 (2%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDT++ CCYP+TGKPA +F IHGLWP   +GS+P NC+PNS ++ S++
Sbjct  28   FFYFVQQWPGSYCDTERSCCYPTTGKPAADFGIHGLWPNHDDGSYPSNCDPNSPFNPSEV  87

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L   MQ  WPTL+CPS +G KFW HEWEKHGTC  S+ DQ AYFE  L++K + N LQ
Sbjct  88   SDLKSSMQKNWPTLACPSGDGQKFWSHEWEKHGTCSESVLDQHAYFELALSLKQKANLLQ  147

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL+++GI P G+ Y +E+IK+AI   VG TP IECN D+S  SQLYQIY+CVD +G D+I
Sbjct  148  ALKSSGITP-GSSYSLESIKDAITEAVGYTPWIECNKDSSGNSQLYQIYLCVDPSGSDLI  206

Query  236  ECPTTVQRNCNTTV  195
            +CP   +  C+  +
Sbjct  207  KCPVFPKGPCSKEI  220



>ref|XP_007046081.1| Ribonuclease 1 [Theobroma cacao]
 gb|EOY01913.1| Ribonuclease 1 [Theobroma cacao]
Length=227

 Score =   244 bits (623),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 147/195 (75%), Gaps = 3/195 (2%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDT-KKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESK  594
            F+Y+V+QWPGS+CD+ K  CCYP+TGKPA +F IHGLWP + +GS+P+NC+ N+ ++ES+
Sbjct  28   FFYFVQQWPGSFCDSDKSSCCYPTTGKPAADFGIHGLWPNYNDGSYPQNCDSNNPFNESE  87

Query  593  ISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFL  420
            IS LI  M+  WP+LSCPS+NG  FW HEWEKHGTC  S+ DQ  YFE+TL +K +   L
Sbjct  88   ISDLISSMRKNWPSLSCPSSNGESFWTHEWEKHGTCSESVLDQHDYFETTLGLKQQTKLL  147

Query  419  QALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDI  240
            Q+L++AGI P+G FY +  I++AIK G G TP IECN D+S  SQLYQ+Y+CVD +G ++
Sbjct  148  QSLQSAGINPNGKFYSLADIRDAIKEGTGYTPWIECNKDSSGNSQLYQVYLCVDKSGSNL  207

Query  239  IECPTTVQRNCNTTV  195
            IECP   +  C + +
Sbjct  208  IECPVFPKGKCGSQI  222



>ref|XP_011017135.1| PREDICTED: ribonuclease 1-like [Populus euphratica]
Length=227

 Score =   244 bits (622),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 141/194 (73%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V QWPGSYCDTK+ CCYP+TGKPA +F IHGLWP + +G++P+NC+  + ++  K+
Sbjct  29   FFYFVHQWPGSYCDTKQSCCYPTTGKPAADFGIHGLWPNYQDGNYPQNCDSQNPFNPDKV  88

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            + L   MQ  WPTL+CPS NG  FW HEWEKHGTC  S+ DQ  YF++ L+++ + N LQ
Sbjct  89   ADLRSSMQKNWPTLACPSGNGVSFWTHEWEKHGTCSESVLDQHGYFQAALSLQRQANLLQ  148

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL +AGI PDG  Y +  IK AI+  +G TP IECN+DAS  SQLYQIY+CVD  GK++I
Sbjct  149  ALASAGINPDGGSYSMSNIKSAIQEAIGFTPWIECNTDASGNSQLYQIYLCVDTTGKNLI  208

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C + +
Sbjct  209  ECPVFPKGKCGSEI  222



>ref|XP_009401398.1| PREDICTED: extracellular ribonuclease LE-like [Musa acuminata 
subsp. malaccensis]
Length=227

 Score =   244 bits (622),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 145/194 (75%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V QWPGSYCDT K CCYP++GKPA +F IHGLWP + +GS+P NC+PN+ YD SK+
Sbjct  29   FFYFVLQWPGSYCDTAKSCCYPTSGKPAADFGIHGLWPNYNDGSYPSNCDPNNPYDASKV  88

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
              L+  M+ +WPTL+CPS++G++FW HEWEKHGTC  S+FDQ  YF++ L +K +V+ L+
Sbjct  89   RDLLSTMRQKWPTLACPSSDGTQFWTHEWEKHGTCSESVFDQHGYFQAALKLKKQVDVLR  148

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L++AGI+PDG  Y ++++  AI   +G TP IECN+D    SQLYQ+Y+CVD +   +I
Sbjct  149  ILQDAGIQPDGGDYSLKSVVSAISDAIGYTPWIECNNDEGGNSQLYQVYLCVDTSAAKLI  208

Query  236  ECPTTVQRNCNTTV  195
            ECP   ++ C + +
Sbjct  209  ECPVLPRKRCGSEI  222



>ref|NP_001266087.1| ribonuclease 1-like precursor [Cicer arietinum]
 ref|XP_004490066.1| PREDICTED: ribonuclease 1-like [Cicer arietinum]
 emb|CAA10130.1| ribonuclease T2 [Cicer arietinum]
Length=229

 Score =   244 bits (622),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 139/194 (72%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCD+KK CCYP+TGKP  +F IHGLWP + +G++P NC+P+  +DES+I
Sbjct  31   FFYFVQQWPGSYCDSKKACCYPTTGKPDADFGIHGLWPNYKDGTYPSNCDPSKPFDESQI  90

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L   +Q  WPTL+CPS +G  FW HEWEKHGTC  S+ +Q  YFE+TLN+K + N L+
Sbjct  91   SGLTSSLQKNWPTLACPSGDGITFWTHEWEKHGTCSESVLNQHDYFETTLNLKQKANLLK  150

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL +AGI  DG  Y +  IK AI+ GVG  P IECN D+S  SQLYQ+Y+CVD +G D I
Sbjct  151  ALTSAGINADGGSYSLSNIKTAIQDGVGFAPFIECNRDSSGNSQLYQVYLCVDNSGSDFI  210

Query  236  ECPTTVQRNCNTTV  195
            +CP      C   +
Sbjct  211  DCPVFPHGKCGPEI  224



>gb|KHG28209.1| Ribonuclease 1 -like protein [Gossypium arboreum]
Length=228

 Score =   244 bits (622),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 145/185 (78%), Gaps = 3/185 (2%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDT-KKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESK  594
            F+Y+V+QWPG+YCD+ K  CCYP+TGKPA +FSIHGLWP + +GS+ +NC+ N+ +D SK
Sbjct  28   FFYFVQQWPGAYCDSDKNSCCYPTTGKPAADFSIHGLWPNYNDGSYHQNCDSNNPFDASK  87

Query  593  ISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFL  420
            IS LI  M+  WP+LSCPSN+G  FW HEWEKHGTC  S+FDQ  YFE+TL +K + N L
Sbjct  88   ISDLISNMRKNWPSLSCPSNDGESFWSHEWEKHGTCSESVFDQHPYFETTLGLKQQTNLL  147

Query  419  QALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDI  240
            +AL+ AGI+PDG+ Y +E IK+AIK G G TP IECN D+S  SQLYQ+Y+C+D +G ++
Sbjct  148  KALKAAGIEPDGSSYSLENIKDAIKEGSGYTPWIECNEDSSGNSQLYQVYLCLDKSGSNL  207

Query  239  IECPT  225
            IECP 
Sbjct  208  IECPV  212



>ref|NP_001234195.1| extracellular ribonuclease LE precursor [Solanum lycopersicum]
 sp|P80022.2|RNLE_SOLLC RecName: Full=Extracellular ribonuclease LE; Short=RNase LE; 
Flags: Precursor [Solanum lycopersicum]
 emb|CAA55895.1| ribonuclease [Solanum lycopersicum]
 emb|CAB40353.1| ribonuclease T2 [Solanum lycopersicum]
 emb|CAD60451.1| ribonuclease T2 [Solanum lycopersicum]
Length=230

 Score =   243 bits (621),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/205 (54%), Positives = 149/205 (73%), Gaps = 6/205 (3%)
 Frame = -2

Query  800  DAAADHNSDLFYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCN  621
            +AA D +   F+Y+V+QWPGSYCDTK+ CCYP+TGKPA +F IHGLWP   +G++P NC+
Sbjct  24   NAAKDFD---FFYFVQQWPGSYCDTKQSCCYPTTGKPAADFGIHGLWPNNNDGTYPSNCD  80

Query  620  PNSLYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCS---IFDQCAYFEST  450
            PNS YD+S+IS LI  MQ  WPTL+CPS +GS FW HEWEKHGTC+   + +Q AYF+  
Sbjct  81   PNSPYDQSQISDLISSMQQNWPTLACPSGSGSTFWSHEWEKHGTCAESVLTNQHAYFKKA  140

Query  449  LNIKDRVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIY  270
            L++K++++ L  L+ A I PDG  Y++  I+ AIK+ +G TP I+CN D S  SQLYQ+Y
Sbjct  141  LDLKNQIDLLSILQGADIHPDGESYDLVNIRNAIKSAIGYTPWIQCNVDQSGNSQLYQVY  200

Query  269  ICVDLNGKDIIECPTTVQRNCNTTV  195
            ICVD +G  +IECP      C T++
Sbjct  201  ICVDGSGSSLIECPIFPGGKCGTSI  225



>ref|XP_010683181.1| PREDICTED: extracellular ribonuclease LE-like [Beta vulgaris 
subsp. vulgaris]
Length=226

 Score =   243 bits (620),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 144/194 (74%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V++WPGSYCDTKKGCCYP TGKP  NF IHGLWP + +GS+P NC+P+S +D S++
Sbjct  28   FFYFVQEWPGSYCDTKKGCCYPLTGKPNANFGIHGLWPNYDDGSYPSNCDPDSPFDLSEV  87

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
              L   +Q EWPTL+CPS +G+KFW HEWEKHGTC  S+ +Q +YF++ L++K+++N LQ
Sbjct  88   EDLRSILQEEWPTLACPSGDGTKFWSHEWEKHGTCSESVLNQRSYFQTNLDLKEKINLLQ  147

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L+NAGI+P+G  Y +  IK AI+ GVG TP I CN D +  +QLY+I  CVD    ++I
Sbjct  148  VLKNAGIEPNGTLYSLGYIKNAIEGGVGFTPAIGCNVDPAGTTQLYRISFCVDNTASNLI  207

Query  236  ECPTTVQRNCNTTV  195
            ECP   + NC + V
Sbjct  208  ECPRFPRSNCPSRV  221



>ref|XP_009117923.1| PREDICTED: ribonuclease 3-like [Brassica rapa]
Length=227

 Score =   243 bits (620),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 141/188 (75%), Gaps = 2/188 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y   QWPG+YCDTK+ CCYP+TGKPA +F IHGLWP + NGS+P NC+P++ +D S+I
Sbjct  29   FFYLALQWPGAYCDTKRACCYPTTGKPAADFGIHGLWPNYNNGSYPSNCDPSNEFDPSEI  88

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L+  +Q++WPTLSCPSN G KFW+HEWEKHGTC  S+ DQ  YFE TL ++DR+N LQ
Sbjct  89   SDLVSTLQTKWPTLSCPSNEGYKFWEHEWEKHGTCSESVMDQHGYFEKTLALRDRINLLQ  148

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L +AGIKP+  FY+++ IK+AI+   G TP+I CN D  K  QL++I +CVD +G + +
Sbjct  149  ILTDAGIKPNDEFYKLKDIKKAIEKATGFTPVINCNRDPEKNRQLHEILLCVDKSGTEFM  208

Query  236  ECPTTVQR  213
            +CP    R
Sbjct  209  DCPMPTDR  216



>ref|XP_010425075.1| PREDICTED: ribonuclease 1 [Camelina sativa]
Length=230

 Score =   243 bits (620),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 147/210 (70%), Gaps = 5/210 (2%)
 Frame = -2

Query  818  TAFAEDDAAADHNSDLFYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGS  639
            + FA   ++ D +   F+Y+V+QWPGSYCDT+K CC+P++GKPA +F IHGLWP + +G+
Sbjct  19   SVFAASSSSEDFD---FFYFVQQWPGSYCDTQKKCCFPTSGKPAADFGIHGLWPNYKDGT  75

Query  638  WPENCNPNSLYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCA  465
            +P NC+    +D+S IS LI  M+  WPTL+CPS +G  FW+HEWEKHGTC  S+ DQ  
Sbjct  76   YPSNCDDTKPFDKSTISDLITSMKRSWPTLACPSGSGDAFWEHEWEKHGTCSESVIDQHE  135

Query  464  YFESTLNIKDRVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQ  285
            YF++ LN+K + + L AL  AGI PDGN Y +E+I+++IK  +G TP IECN D S  SQ
Sbjct  136  YFQTALNLKQKTDLLGALTKAGINPDGNSYSLESIRDSIKESIGFTPWIECNRDESGNSQ  195

Query  284  LYQIYICVDLNGKDIIECPTTVQRNCNTTV  195
            LYQ+Y+CVD +G  +IECP      C   +
Sbjct  196  LYQVYLCVDRSGSGLIECPVFPHGKCGAEI  225



>gb|KDP41204.1| hypothetical protein JCGZ_15611 [Jatropha curcas]
Length=221

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 141/194 (73%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDTKK CCYP+TGKPA +F IHGLWP + +G++P NC+ ++ ++++KI
Sbjct  23   FFYFVQQWPGSYCDTKKSCCYPTTGKPAADFGIHGLWPNYKDGTYPSNCDSSNPFNQNKI  82

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L   MQ  WPTL+CPS NG  FW HEWEKHGTC  S+ DQ  YF++ LN+K +VN LQ
Sbjct  83   SDLTSSMQKNWPTLACPSGNGVTFWSHEWEKHGTCSESVLDQHGYFQAALNLKKKVNLLQ  142

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L NAGI  +G  Y + +IK AI+  +G  P IECN+D S  SQLYQ+Y+CVD +G ++I
Sbjct  143  VLNNAGISANGESYSLSSIKSAIQEAIGYNPWIECNNDESGNSQLYQVYLCVDTSGSNLI  202

Query  236  ECPTTVQRNCNTTV  195
            ECP      C + +
Sbjct  203  ECPVFPNGKCASNI  216



>pdb|1DIX|A Chain A, Crystal Structure Of Rnase Le
Length=208

 Score =   242 bits (618),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 144/195 (74%), Gaps = 3/195 (2%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDTK+ CCYP+TGKPA +F IHGLWP   +G++P NC+PNS YD+S+I
Sbjct  9    FFYFVQQWPGSYCDTKQSCCYPTTGKPAADFGIHGLWPNNNDGTYPSNCDPNSPYDQSQI  68

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCS---IFDQCAYFESTLNIKDRVNFL  420
            S LI  MQ  WPTL+CPS +GS FW HEWEKHGTC+   + +Q AYF+  L++K++++ L
Sbjct  69   SDLISSMQQNWPTLACPSGSGSTFWSHEWEKHGTCAESVLTNQHAYFKKALDLKNQIDLL  128

Query  419  QALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDI  240
              L+ A I PDG  Y++  I+ AIK+ +G TP I+CN D S  SQLYQ+YICVD +G  +
Sbjct  129  SILQGADIHPDGESYDLVNIRNAIKSAIGYTPWIQCNVDQSGNSQLYQVYICVDGSGSSL  188

Query  239  IECPTTVQRNCNTTV  195
            IECP      C T++
Sbjct  189  IECPIFPGGKCGTSI  203



>ref|XP_003613791.1| Ribonuclease T2 [Medicago truncatula]
 gb|AES96749.1| ribonuclease T2 family protein [Medicago truncatula]
 gb|AFK48654.1| unknown [Medicago truncatula]
Length=230

 Score =   243 bits (620),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 145/193 (75%), Gaps = 4/193 (2%)
 Frame = -2

Query  797  AAADHNSDLFYYYVEQWPGSYCDTKKG-CCYPSTGKPATNFSIHGLWPTWLNGSWPENCN  621
            A+  H+ D F+Y+V+QWPGSYCD++K  CCYP+TGKPA +F IHGLWP + +G++P NC+
Sbjct  22   ASQSHDFD-FFYFVQQWPGSYCDSQKSSCCYPTTGKPAADFGIHGLWPNYKDGTYPSNCD  80

Query  620  PNSLYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTL  447
            P++ +  S+IS L   +Q  WPTL+CPS NG  FW HEWEKHGTC  S+  Q  YFE+TL
Sbjct  81   PSNAFKPSQISDLTSNLQKNWPTLACPSGNGITFWTHEWEKHGTCSESVLSQHDYFETTL  140

Query  446  NIKDRVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYI  267
            N++ + N LQAL +AGI+PDG  Y + +IK AI+  +G TP IECN D+SK SQLYQ+Y+
Sbjct  141  NLRQKANLLQALTSAGIQPDGGSYTLSSIKGAIQNAIGYTPYIECNVDSSKNSQLYQVYL  200

Query  266  CVDLNGKDIIECP  228
            CVD +G D I+CP
Sbjct  201  CVDTSGSDFIDCP  213



>ref|XP_006438697.1| hypothetical protein CICLE_v10032651mg [Citrus clementina]
 gb|ESR51937.1| hypothetical protein CICLE_v10032651mg [Citrus clementina]
Length=230

 Score =   242 bits (618),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 138/184 (75%), Gaps = 2/184 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V QWPGSYCDT K CCYP+TGKPA +F IHGLWP + +GS+P NC+PN+ +D+S+I
Sbjct  31   FFYFVLQWPGSYCDTAKSCCYPTTGKPAADFGIHGLWPNYNDGSYPSNCDPNAPFDQSQI  90

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L   MQ  WPTL+CPS NG  FW HEWEKHGTC  S+ +Q  YF++ LN+K++++ LQ
Sbjct  91   SDLRSSMQKNWPTLACPSGNGITFWSHEWEKHGTCSESVLNQHQYFQTALNLKNQIHLLQ  150

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL  AGI PDG+ Y +E+IK+AIK   G +P IECN D S  SQLYQIY+CVD +  + I
Sbjct  151  ALRTAGIVPDGSSYSLESIKDAIKEASGFSPWIECNVDESGNSQLYQIYLCVDTSASNFI  210

Query  236  ECPT  225
             CP 
Sbjct  211  NCPV  214



>dbj|BAF03592.1| S-like RNase [Fagopyrum esculentum]
Length=225

 Score =   242 bits (617),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 144/194 (74%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V QWPG+YCD +K CC+P+TGKP  +F IHGLWP + +G++P NC+ ++ ++ SKI
Sbjct  27   FFYFVLQWPGAYCDARKACCFPTTGKPDADFGIHGLWPNYNDGTYPSNCDSSNPFERSKI  86

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L+ RMQSEWPTL+CPS +G+ FW HEWEKHGTC  S+ DQ AYF+S+L++KD++N L+
Sbjct  87   SDLVTRMQSEWPTLACPSGDGTAFWTHEWEKHGTCSESVLDQHAYFKSSLDLKDQINALE  146

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL  AGI+P+   Y +E IK+A+K G G TP +ECN D S  SQLYQ+Y CVD +   +I
Sbjct  147  ALTKAGIEPNDETYTLENIKDALKEGTGFTPFVECNRDQSGNSQLYQLYFCVDSSSVSLI  206

Query  236  ECPTTVQRNCNTTV  195
            +CP   +  C   +
Sbjct  207  DCPIYPRGKCGPQI  220



>ref|XP_010495841.1| PREDICTED: ribonuclease 3-like [Camelina sativa]
Length=214

 Score =   241 bits (616),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 138/194 (71%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V QWPG+YCDT + CCYP++GKPA +F IHGLWP + + SWP NC+P+S +D S+I
Sbjct  16   FFYFVVQWPGAYCDTNRSCCYPTSGKPAADFGIHGLWPNYNSSSWPSNCDPDSKFDRSQI  75

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
              L+  M++ WPTLSCPSN G KFW+HEWEKHGTC  S  DQ  YFE  L +KD+ N LQ
Sbjct  76   EDLLSSMKNNWPTLSCPSNEGFKFWEHEWEKHGTCAESEMDQHEYFEIALKLKDKANLLQ  135

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L N+GI PD  FY+++ I  AIK G+G  P ++CN D    +QLYQIYICVD +G + I
Sbjct  136  ILANSGINPDDGFYDLKKITNAIKDGIGFAPGLQCNKDRKHNAQLYQIYICVDTSGTEFI  195

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C + +
Sbjct  196  ECPVLPKGRCPSKL  209



>dbj|BAF03593.1| S-like RNase [Fagopyrum homotropicum]
Length=225

 Score =   242 bits (617),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 144/194 (74%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V QWPG+YCD +K CC+P+TGKP  +F IHGLWP + +G++P NC+ ++ ++ SKI
Sbjct  27   FFYFVLQWPGAYCDARKACCFPTTGKPDADFGIHGLWPNYNDGTYPSNCDSSNPFERSKI  86

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L+ RMQSEWPTL+CPS +G+ FW HEWEKHGTC  S+ DQ AYF+S+L++KD++N L+
Sbjct  87   SDLVTRMQSEWPTLACPSGDGTAFWTHEWEKHGTCSESVLDQHAYFKSSLDLKDQINALE  146

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL  AGI+P+   Y +E IK+A+K G G TP +ECN D S  SQLYQ+Y CVD +   +I
Sbjct  147  ALTKAGIEPNDESYTLENIKDALKEGTGFTPFVECNRDQSGNSQLYQLYFCVDSSSVSLI  206

Query  236  ECPTTVQRNCNTTV  195
            +CP   +  C   +
Sbjct  207  DCPIYPRGKCGPQI  220



>dbj|BAF03591.1| S-like RNase [Fagopyrum esculentum]
Length=225

 Score =   242 bits (617),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 144/194 (74%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V QWPG+YCD +K CC+P+TGKP  +F IHGLWP + +G++P NC+ ++ ++ SKI
Sbjct  27   FFYFVLQWPGAYCDARKACCFPTTGKPDADFGIHGLWPNYNDGTYPSNCDSSNPFESSKI  86

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L+ RMQSEWPTL+CPS +G+ FW HEWEKHGTC  S+ DQ AYF+S+L++KD++N L+
Sbjct  87   SDLVTRMQSEWPTLACPSGDGTAFWTHEWEKHGTCSESVLDQHAYFKSSLDLKDQINALE  146

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL  AGI+P+   Y +E IK+A+K G G TP +ECN D S  SQLYQ+Y CVD +   +I
Sbjct  147  ALTKAGIEPNDETYTLENIKDALKEGTGFTPFVECNRDQSGNSQLYQLYFCVDSSSVSLI  206

Query  236  ECPTTVQRNCNTTV  195
            +CP   +  C   +
Sbjct  207  DCPIYPRGKCGPQI  220



>ref|XP_006483150.1| PREDICTED: extracellular ribonuclease LE-like [Citrus sinensis]
Length=230

 Score =   242 bits (617),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 111/191 (58%), Positives = 140/191 (73%), Gaps = 3/191 (2%)
 Frame = -2

Query  791  ADHNSDLFYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNS  612
            A  N D F+Y+V QWPGSYCDT K CCYP+TGKPA +F IHGLWP + +GS+P NC+P +
Sbjct  25   AARNFD-FFYFVLQWPGSYCDTAKSCCYPTTGKPAADFGIHGLWPNYNDGSYPSNCDPTA  83

Query  611  LYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIK  438
             +D+S+IS L   MQ  WPTL+CPS NG  FW HEWEKHGTC  S+ +Q  YF++ LN+K
Sbjct  84   PFDQSQISDLRSSMQKNWPTLACPSGNGITFWSHEWEKHGTCSESVLNQHQYFQTALNLK  143

Query  437  DRVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVD  258
            +++N LQAL  AGI PDG+ Y +E+IK+AIK   G +P IECN D S  SQLYQIY+CVD
Sbjct  144  NQINLLQALRTAGIVPDGSSYSLESIKDAIKEASGFSPWIECNVDESGNSQLYQIYLCVD  203

Query  257  LNGKDIIECPT  225
             +  + I CP 
Sbjct  204  TSASNFINCPV  214



>ref|XP_010514069.1| PREDICTED: ribonuclease 1-like [Camelina sativa]
Length=230

 Score =   242 bits (617),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 146/210 (70%), Gaps = 5/210 (2%)
 Frame = -2

Query  818  TAFAEDDAAADHNSDLFYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGS  639
            + FA   ++ D +   F+Y+V+QWPGSYCDT+K CCYP++GKPA +F IHGLWP + +G+
Sbjct  19   SVFAASSSSEDFD---FFYFVQQWPGSYCDTQKTCCYPTSGKPAADFGIHGLWPNYKDGT  75

Query  638  WPENCNPNSLYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCA  465
            +P NC+    +D+S IS LI  M   WPTL+CPS +G  FW+HEWEKHGTC  S+ DQ  
Sbjct  76   YPSNCDDTKPFDKSTISDLITSMTKSWPTLACPSGSGDAFWEHEWEKHGTCSESVIDQHE  135

Query  464  YFESTLNIKDRVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQ  285
            YF++ L++K + + L AL  AGI PDG  Y +E+I+++IK  +G TP IECN D S  SQ
Sbjct  136  YFQTALDLKQKTDLLGALTKAGINPDGKSYSLESIRDSIKESIGFTPWIECNRDESGNSQ  195

Query  284  LYQIYICVDLNGKDIIECPTTVQRNCNTTV  195
            LYQ+Y+CVD +G  +IECP      C T +
Sbjct  196  LYQVYLCVDRSGSGLIECPVFPHGKCGTEI  225



>gb|KHN12205.1| Ribonuclease 1 [Glycine soja]
Length=227

 Score =   241 bits (615),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 140/194 (72%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDT+K CCYP+ GKPA +F IHGLWP + +G +P NC+PN+ +D S I
Sbjct  29   FFYFVQQWPGSYCDTQKSCCYPTKGKPAADFGIHGLWPNYNDGKYPSNCDPNNPFDPSGI  88

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L   ++S WPTL+CPS +G +FW HEW+KHGTC  S+  Q  YFE+ LN+K + N LQ
Sbjct  89   SDLTSSLESNWPTLACPSGDGIEFWTHEWDKHGTCSESVLKQHDYFEAALNLKQKANLLQ  148

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL +AGI+ DG  Y +  IK AI+  +G TP IECN D+S  SQLYQ+Y+CV+ +G D I
Sbjct  149  ALTSAGIQADGQSYSLSEIKGAIEGAIGFTPFIECNVDSSGNSQLYQVYLCVNTSGSDFI  208

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C + +
Sbjct  209  ECPVFPRGKCGSDI  222



>gb|KDO82931.1| hypothetical protein CISIN_1g026944mg [Citrus sinensis]
Length=230

 Score =   241 bits (615),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/191 (58%), Positives = 140/191 (73%), Gaps = 3/191 (2%)
 Frame = -2

Query  791  ADHNSDLFYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNS  612
            A  N D F+Y+V QWPGSYCDT K CCYP+TGKPA +F IHGLWP + +GS+P NC+PN+
Sbjct  25   AARNFD-FFYFVLQWPGSYCDTAKSCCYPTTGKPAADFGIHGLWPNYNDGSYPSNCDPNA  83

Query  611  LYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIK  438
             +D+S+IS L   M   WPTL+CPS NG  FW HEWEKHGTC  S+ +Q  YF++ LN+K
Sbjct  84   PFDQSQISDLRSSMLKNWPTLACPSGNGITFWSHEWEKHGTCSESVLNQHQYFQTALNLK  143

Query  437  DRVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVD  258
            +++N LQAL  AGI PDG+ Y +E+IK+AIK   G +P IECN D S  SQLYQIY+CVD
Sbjct  144  NQINLLQALRTAGIVPDGSSYSLESIKDAIKEASGFSPWIECNVDESGNSQLYQIYLCVD  203

Query  257  LNGKDIIECPT  225
             +  + I CP 
Sbjct  204  TSASNFINCPV  214



>ref|XP_011013416.1| PREDICTED: LOW QUALITY PROTEIN: ribonuclease 1 [Populus euphratica]
Length=226

 Score =   241 bits (615),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 141/194 (73%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDT   CCYP+TGKPA +F IHGLWP + +G++P+NC+ ++ YD  K+
Sbjct  28   FFYFVQQWPGSYCDTMTSCCYPTTGKPAADFGIHGLWPNYNDGTYPKNCDASNPYDPKKV  87

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            + L   +Q  WP L+CPS  G  FW HEWEKHGTC  S  DQ  YF++ L++K +VN LQ
Sbjct  88   ADLRSGLQKNWPPLACPSGTGVVFWTHEWEKHGTCSESTLDQHGYFQAALDLKKQVNLLQ  147

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL NAGI PDG  Y   +IK AI+  VG TP IECN+D S+ SQLYQIY+CVD +GK++I
Sbjct  148  ALTNAGINPDGGSYSFSSIKSAIQEAVGCTPWIECNTDTSRNSQLYQIYLCVDTSGKNLI  207

Query  236  ECPTTVQRNCNTTV  195
            +CP   +  C++ +
Sbjct  208  DCPVFPRGKCDSEI  221



>ref|XP_004973521.1| PREDICTED: ribonuclease 1-like [Setaria italica]
Length=231

 Score =   241 bits (615),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 143/195 (73%), Gaps = 3/195 (2%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y V QWPGSYCDT++ CCYP +GKPA +F IHGLWP   +GS+P+NCNP+S +D SK+
Sbjct  32   FFYLVLQWPGSYCDTRQSCCYPKSGKPAADFGIHGLWPNRDDGSYPQNCNPDSEFDPSKV  91

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCS--IFDQCAYFESTLNIKDRVNFLQ  417
            S L+  ++++WPTL+CP+N+G +FW HEWEKHGTC+  +FD+  YF++ L ++DR+  L+
Sbjct  92   SDLLSSLRAKWPTLACPTNDGLRFWGHEWEKHGTCASNVFDEHGYFQAALRLRDRLGVLR  151

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL   G++PDG +Y ++ IK AI+ G G  P +ECN D S  SQLYQ+Y CV+  G  ++
Sbjct  152  ALAAGGVRPDGGYYTLDQIKGAIRDGTGFEPYVECNRDESGNSQLYQLYFCVNAAGDSLV  211

Query  236  ECPTTVQ-RNCNTTV  195
            ECP   + R C + +
Sbjct  212  ECPILPRGRPCGSRI  226



>ref|XP_010066907.1| PREDICTED: ribonuclease 1-like [Eucalyptus grandis]
Length=226

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/248 (48%), Positives = 162/248 (65%), Gaps = 35/248 (14%)
 Frame = -2

Query  932  SILIGLVILQCTISIYAAHSQSFLYYAEQVVEEEEPFVTAFAEDDAAADHNSDLFYYYVE  753
            SI I LV+LQC   + A  SQSF                               F+Y+V+
Sbjct  7    SIAISLVLLQCLAVLVA--SQSFD------------------------------FFYFVQ  34

Query  752  QWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKISYLIER  573
            QWPGSYCDT++ CCYP+TGKPA +F IHGLWP + +GS+P NC+ +S ++ S++S L   
Sbjct  35   QWPGSYCDTQQSCCYPTTGKPAADFGIHGLWPNYNDGSYPSNCDSSSPFNPSEVSDLKSS  94

Query  572  MQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQALENAG  399
            MQ+ WPTL+CPS +G +FW HEWEKHGTC  SI DQ AYFES L++K + N LQAL++AG
Sbjct  95   MQNSWPTLACPSGDGEQFWSHEWEKHGTCSESILDQHAYFESALSLKQKANLLQALKSAG  154

Query  398  IKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDIIECPTTV  219
            I P G+ Y +++IK+AI    G TP IECN D+S   Q+YQIY+CVD +G ++IECP   
Sbjct  155  ITPGGS-YSLKSIKDAITEAAGYTPWIECNKDSSGNYQIYQIYLCVDTSGSNLIECPVFP  213

Query  218  QRNCNTTV  195
            +  C++ +
Sbjct  214  KGACSSEI  221



>ref|XP_010502310.1| PREDICTED: ribonuclease 1-like [Camelina sativa]
Length=230

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 139/194 (72%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDT+K CCYP++GKPA +F IHGLWP + +G++P NC+    +D+S I
Sbjct  32   FFYFVQQWPGSYCDTQKKCCYPTSGKPAADFGIHGLWPNYKDGTYPSNCDDTKPFDKSTI  91

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S LI  M+  WPTL+CPS +G  FW+HEWEKHGTC  S+ DQ  YF++ LN+K + + L 
Sbjct  92   SDLITSMKKSWPTLACPSGSGDAFWEHEWEKHGTCSESVIDQHEYFQTALNLKQKTDLLG  151

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL  AGI PDGN Y +E+I+++IK   G TP +ECN D S  SQLYQ+Y+CVD +G  +I
Sbjct  152  ALTKAGINPDGNSYSLESIRDSIKESTGFTPWVECNRDESGNSQLYQVYLCVDRSGSGLI  211

Query  236  ECPTTVQRNCNTTV  195
            ECP      C   +
Sbjct  212  ECPVFPHGKCGDEI  225



>ref|XP_009129105.1| PREDICTED: ribonuclease 1 [Brassica rapa]
Length=229

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 107/203 (53%), Positives = 141/203 (69%), Gaps = 3/203 (1%)
 Frame = -2

Query  794  AADHNSDL-FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNP  618
            AA  + D  F+Y+V+QWPGSYCDT+K CCYP++GKPA +F IHGLWP + +G++P NC+ 
Sbjct  22   AASSSEDFDFFYFVQQWPGSYCDTQKSCCYPTSGKPAADFGIHGLWPNYKDGTYPSNCDA  81

Query  617  NSLYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLN  444
               +D S IS LI  M+  WPTL+CPS +G  FW+HEWEKHGTC  S+ +Q  YF+++L 
Sbjct  82   TKPFDSSTISDLISSMKRNWPTLACPSGSGEAFWEHEWEKHGTCSQSVINQHEYFQTSLG  141

Query  443  IKDRVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYIC  264
            +K + N L AL  AGI PDGN Y +E+I+ +IKA  G TP IECN D S  SQLYQ+Y+C
Sbjct  142  LKQKTNLLGALTKAGINPDGNSYSLESIRGSIKASTGFTPWIECNRDGSGNSQLYQVYLC  201

Query  263  VDLNGKDIIECPTTVQRNCNTTV  195
            VD +   +IECP      C   +
Sbjct  202  VDRSASGLIECPVFPHGKCGAQI  224



>ref|XP_008446355.1| PREDICTED: ribonuclease 1-like [Cucumis melo]
Length=230

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 144/194 (74%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+ WPGSYCDT++ CCYP TGKP+ +F IHGLWP + +G++P NC+P+S +D ++I
Sbjct  32   FFYFVQNWPGSYCDTERSCCYPRTGKPSADFKIHGLWPNYNDGTYPSNCDPSSPFDRTQI  91

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L+  M+  WP+L+CPS++ +KFW HEW KHGTC  S+ DQ  YFE+TLN+K + N LQ
Sbjct  92   SDLVSSMEKNWPSLACPSSDNTKFWSHEWNKHGTCSESVLDQYEYFETTLNLKAQANILQ  151

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL+ AGI PDG+ Y ++ IK AI+ G+ +TP I CN D S  SQLY+IY+CVD +  + I
Sbjct  152  ALQTAGINPDGSHYSLDKIKSAIEEGIKLTPGISCNVDGSGNSQLYEIYLCVDSSASNFI  211

Query  236  ECPTTVQRNCNTTV  195
            +CP     NC ++V
Sbjct  212  DCPVFPNSNCASSV  225



>ref|XP_006291795.1| hypothetical protein CARUB_v10017969mg [Capsella rubella]
 gb|EOA24693.1| hypothetical protein CARUB_v10017969mg [Capsella rubella]
Length=230

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 139/194 (72%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDT+K CCYP+TGKPA +F IHGLWP + +G++P NC+    +D S I
Sbjct  32   FFYFVQQWPGSYCDTQKKCCYPTTGKPAADFGIHGLWPNYKDGTYPSNCDDTKPFDSSTI  91

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L+  M+  WPTL+CPS +G  FW+HEWEKHGTC  S+ DQ  YF++ L++K + + L 
Sbjct  92   SDLLTSMKKSWPTLACPSGSGEAFWEHEWEKHGTCSESVIDQHEYFQTALSLKQKTDLLG  151

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL  AGI PDG  Y +E+I+++IK  VG TP +ECN D S  SQLYQ+Y+CVD +G  +I
Sbjct  152  ALTKAGINPDGKSYSLESIRDSIKESVGFTPWVECNRDESGNSQLYQVYLCVDRSGSGLI  211

Query  236  ECPTTVQRNCNTTV  195
            ECP      C T +
Sbjct  212  ECPVFPHGKCGTEI  225



>gb|ABK28493.1| unknown [Arabidopsis thaliana]
Length=231

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 139/194 (72%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDT+K CCYP++GKPA +F IHGLWP + +G++P NC+ +  +D S I
Sbjct  32   FFYFVQQWPGSYCDTQKKCCYPNSGKPAADFGIHGLWPNYKDGTYPSNCDASKPFDSSTI  91

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L+  M+  WPTL+CPS +G  FW+HEWEKHGTC  S+ DQ  YF++ LN+K + N L 
Sbjct  92   SDLLTSMKKSWPTLACPSGSGEAFWEHEWEKHGTCSESVIDQHEYFQTALNLKQKTNLLG  151

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL  AGI PDG  Y +E+I+++IK  +G TP +ECN D S  SQLYQ+Y+CVD +G  +I
Sbjct  152  ALTKAGINPDGKSYSLESIRDSIKESIGFTPWVECNRDGSGNSQLYQVYLCVDRSGSGLI  211

Query  236  ECPTTVQRNCNTTV  195
            ECP      C   +
Sbjct  212  ECPVFPHGKCGAEI  225



>gb|KHG25338.1| Extracellular ribonuclease LE [Gossypium arboreum]
Length=231

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 145/191 (76%), Gaps = 3/191 (2%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKK-GCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESK  594
            F+Y+VEQWPGSYCD+ K  CCYP+TGKPA +FSIHGLWP + NGS+P+NC+PN+ ++ES+
Sbjct  32   FFYFVEQWPGSYCDSDKFSCCYPTTGKPAADFSIHGLWPNYRNGSYPQNCDPNNPFNESE  91

Query  593  ISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFL  420
            I+ LI  M+  WP+L+CPS++G  FW HEWEKHGTC  S+ DQ +YF++ L ++ + N L
Sbjct  92   IADLISSMRRNWPSLACPSSSGESFWSHEWEKHGTCSESLLDQHSYFQTALTLRQQTNIL  151

Query  419  QALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDI  240
            Q+L++ GI PDG  Y +  IK+AIK   G TP IECN D+S  SQLYQ+Y+CVD +G ++
Sbjct  152  QSLKSVGIIPDGGSYSLANIKDAIKNRTGYTPWIECNEDSSGNSQLYQVYLCVDSSGSNL  211

Query  239  IECPTTVQRNC  207
            IECP   +  C
Sbjct  212  IECPVFSKGKC  222



>ref|XP_011075506.1| PREDICTED: intracellular ribonuclease LX-like [Sesamum indicum]
Length=235

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 139/193 (72%), Gaps = 2/193 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWP SYCDT++ CCYP+TGKP  +FSIHGLWP + +G +P+NC+  S  DESKI
Sbjct  29   FFYFVQQWPASYCDTRRSCCYPTTGKPDEDFSIHGLWPNYNSGKYPQNCDRESSLDESKI  88

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCSIFDQCAYFESTLNIKDRVNFLQAL  411
            S L+ RMQ +WPTL+CPS +G KFW HEWEKHGTC+  DQ +YF++ L +K + N LQ L
Sbjct  89   SDLVSRMQKDWPTLACPSGDGMKFWGHEWEKHGTCTSLDQHSYFQAALELKSKANLLQLL  148

Query  410  ENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDIIEC  231
             +AGI+P GNFY +E+IK+AI+ G+G    IECN D     QLYQ+Y+CVD +    I+C
Sbjct  149  GDAGIRP-GNFYSLESIKQAIEEGLGYGAYIECNVDPEGNHQLYQVYLCVDTSASSFIQC  207

Query  230  PTTVQ-RNCNTTV  195
            P     R C   +
Sbjct  208  PVLPHGRGCGNNI  220



>ref|NP_178399.1| ribonuclease 1 [Arabidopsis thaliana]
 sp|P42813.1|RNS1_ARATH RecName: Full=Ribonuclease 1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC48925.1| ribonuclease [Arabidopsis thaliana]
 gb|AAC32917.1| ribonuclease, RNS1 [Arabidopsis thaliana]
 gb|AAL62405.1| ribonuclease, RNS1 [Arabidopsis thaliana]
 gb|AAM48029.1| ribonuclease RNS1 [Arabidopsis thaliana]
 gb|ABE65814.1| ribonuclease 1 [Arabidopsis thaliana]
 gb|AEC05652.1| ribonuclease 1 [Arabidopsis thaliana]
Length=230

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 139/194 (72%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDT+K CCYP++GKPA +F IHGLWP + +G++P NC+ +  +D S I
Sbjct  32   FFYFVQQWPGSYCDTQKKCCYPNSGKPAADFGIHGLWPNYKDGTYPSNCDASKPFDSSTI  91

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L+  M+  WPTL+CPS +G  FW+HEWEKHGTC  S+ DQ  YF++ LN+K + N L 
Sbjct  92   SDLLTSMKKSWPTLACPSGSGEAFWEHEWEKHGTCSESVIDQHEYFQTALNLKQKTNLLG  151

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL  AGI PDG  Y +E+I+++IK  +G TP +ECN D S  SQLYQ+Y+CVD +G  +I
Sbjct  152  ALTKAGINPDGKSYSLESIRDSIKESIGFTPWVECNRDGSGNSQLYQVYLCVDRSGSGLI  211

Query  236  ECPTTVQRNCNTTV  195
            ECP      C   +
Sbjct  212  ECPVFPHGKCGAEI  225



>ref|XP_004237041.1| PREDICTED: extracellular ribonuclease LE-like [Solanum lycopersicum]
Length=240

 Score =   241 bits (614),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 149/201 (74%), Gaps = 4/201 (2%)
 Frame = -2

Query  785  HNSDL-FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSL  609
            H  D  F+Y+ +QW  + CD+K  CCYP+ GKPA +F IHGLWP + NGS+P++CN N  
Sbjct  21   HAQDFDFFYFAQQWNPASCDSKIKCCYPTNGKPAEDFGIHGLWPNYFNGSFPKSCNKNVR  80

Query  608  YDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCSI--FDQCAYFESTLNIKD  435
            YDE++IS LI  MQ  WPTLSCPSNNG++FW HEW+KHGTCS+   D  +YF++ L +K+
Sbjct  81   YDETQISDLISSMQKNWPTLSCPSNNGTRFWSHEWKKHGTCSLSMLDIHSYFQAALALKE  140

Query  434  RVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDL  255
            +VN LQ L+NAGI+P+G FY +EAIK+AI+ G+G T  +ECN D +  SQLY++Y+CVD 
Sbjct  141  KVNLLQILKNAGIQPNGGFYNLEAIKKAIEKGIGHTIGVECNIDLNGNSQLYEVYVCVDK  200

Query  254  NGKDIIECPTTVQ-RNCNTTV  195
            +G +II+CP   + + CN  V
Sbjct  201  SGSNIIDCPIIPETKRCNEIV  221



>emb|CDY09344.1| BnaA02g26660D [Brassica napus]
Length=232

 Score =   240 bits (612),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 106/203 (52%), Positives = 141/203 (69%), Gaps = 3/203 (1%)
 Frame = -2

Query  794  AADHNSDL-FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNP  618
            AA  + D  F+Y+V+QWPGSYCDT+K CCYP++GKPA +F IHGLWP + +G++P NC+ 
Sbjct  25   AASSSEDFDFFYFVQQWPGSYCDTQKSCCYPTSGKPAADFGIHGLWPNYKDGTYPSNCDA  84

Query  617  NSLYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLN  444
               +D S IS L+  M+  WPTL+CPS +G  FW+HEWEKHGTC  S+ +Q  YF+++L 
Sbjct  85   TKPFDSSTISDLVSSMKRNWPTLACPSGSGEAFWEHEWEKHGTCSQSVINQHEYFQTSLG  144

Query  443  IKDRVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYIC  264
            +K + N L AL  AGI PDGN Y +E+I+ +IKA  G TP IECN D S  SQLYQ+Y+C
Sbjct  145  LKQKTNLLGALTKAGINPDGNSYSLESIRGSIKASTGFTPWIECNRDGSGNSQLYQVYLC  204

Query  263  VDLNGKDIIECPTTVQRNCNTTV  195
            VD +   +IECP      C   +
Sbjct  205  VDRSASGLIECPVFPHGKCGAQI  227



>gb|AAM63798.1| ribonuclease, RNS1 [Arabidopsis thaliana]
Length=230

 Score =   240 bits (612),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 139/194 (72%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDT+K CCYP++GKPA +F IHGLWP + +G++P NC+ +  +D S I
Sbjct  32   FFYFVQQWPGSYCDTQKKCCYPNSGKPAADFGIHGLWPNYKDGTYPSNCDDSKPFDSSTI  91

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L+  M+  WPTL+CPS +G  FW+HEWEKHGTC  S+ DQ  YF++ LN+K + N L 
Sbjct  92   SDLLTSMKKSWPTLACPSGSGEAFWEHEWEKHGTCSESVIDQHEYFQTALNLKQKTNLLG  151

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL  AGI PDG  Y +E+I+++IK  +G TP +ECN D S  SQLYQ+Y+CVD +G  +I
Sbjct  152  ALTKAGINPDGKSYSLESIRDSIKESIGFTPWVECNRDGSGNSQLYQVYLCVDRSGSGLI  211

Query  236  ECPTTVQRNCNTTV  195
            ECP      C   +
Sbjct  212  ECPVFPHGKCGAEI  225



>gb|KFK33495.1| hypothetical protein AALP_AA5G020500 [Arabis alpina]
Length=230

 Score =   240 bits (612),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 106/204 (52%), Positives = 142/204 (70%), Gaps = 3/204 (1%)
 Frame = -2

Query  797  AAADHNSDL-FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCN  621
            AA+  + D  F+Y+V+QWPGSYCDT+K CCYP+TGKPA +F IHGLWP + +G++P NC+
Sbjct  22   AASSSSEDFDFFYFVQQWPGSYCDTQKSCCYPTTGKPAADFGIHGLWPNYKDGTYPSNCD  81

Query  620  PNSLYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTL  447
                +D+S I+ LI  M+  WPTL+CPS +G  FW+HEWEKHGTC  S+ DQ  YF++ L
Sbjct  82   ETKPFDKSTITDLISSMKKSWPTLACPSGSGEAFWEHEWEKHGTCSESVIDQHQYFQTAL  141

Query  446  NIKDRVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYI  267
             +K + N L AL  AGI P+G  Y +E+I+++IK   G TP IECN D S  SQLYQ+Y+
Sbjct  142  GLKQKTNLLGALTKAGINPNGQSYSLESIRDSIKESTGFTPWIECNRDGSGNSQLYQVYL  201

Query  266  CVDLNGKDIIECPTTVQRNCNTTV  195
            CVD +   +IECP      C T +
Sbjct  202  CVDRSASGLIECPVFPHGKCGTEI  225



>emb|CDY62181.1| BnaCnng39460D [Brassica napus]
Length=229

 Score =   239 bits (611),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 106/203 (52%), Positives = 141/203 (69%), Gaps = 3/203 (1%)
 Frame = -2

Query  794  AADHNSDL-FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNP  618
            AA  + D  F+Y+V+QWPGSYCDT+K CCYP++GKPA +F IHGLWP + +G++P NC+ 
Sbjct  22   AASSSEDFDFFYFVQQWPGSYCDTQKSCCYPTSGKPAADFGIHGLWPNYKDGTYPSNCDD  81

Query  617  NSLYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLN  444
               +D S IS L+  M+  WPTL+CPS +G  FW+HEWEKHGTC  S+ +Q  YF+++L 
Sbjct  82   TKPFDSSTISDLVSSMKRNWPTLACPSGSGEAFWEHEWEKHGTCSQSVINQHEYFQTSLG  141

Query  443  IKDRVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYIC  264
            +K + N L AL  AGI PDGN Y +E+I+ +IKA  G TP IECN D S  SQLYQ+Y+C
Sbjct  142  LKQKTNLLGALTKAGINPDGNSYSLESIRGSIKASTGFTPWIECNRDGSGNSQLYQVYLC  201

Query  263  VDLNGKDIIECPTTVQRNCNTTV  195
            VD +   +IECP      C   +
Sbjct  202  VDRSASGLIECPVFPHGKCGAQI  224



>ref|XP_006395743.1| hypothetical protein EUTSA_v10004863mg [Eutrema salsugineum]
 gb|ESQ33029.1| hypothetical protein EUTSA_v10004863mg [Eutrema salsugineum]
Length=230

 Score =   239 bits (611),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 106/204 (52%), Positives = 142/204 (70%), Gaps = 3/204 (1%)
 Frame = -2

Query  797  AAADHNSDL-FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCN  621
            AA+  + D  F+Y+V+QWPGSYCDT+K CCYP+TGKPA +F IHGLWP + +G++P NC+
Sbjct  22   AASSSSEDFDFFYFVQQWPGSYCDTQKKCCYPTTGKPAADFGIHGLWPNYKDGTYPSNCD  81

Query  620  PNSLYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTL  447
                +D+S IS LI  M+  WPTL+CPS +G  FW+HEWEKHGTC  S+ DQ  YF++ L
Sbjct  82   QTKPFDQSTISDLINSMKKSWPTLACPSGSGETFWEHEWEKHGTCSESVIDQHEYFQTAL  141

Query  446  NIKDRVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYI  267
            N++ + N L AL  AGI PDG  Y +E+I+++IK   G TP I+CN D S  SQLYQ+Y+
Sbjct  142  NLRQKTNLLGALTKAGINPDGKSYSLESIRDSIKESTGFTPWIQCNRDESGNSQLYQVYL  201

Query  266  CVDLNGKDIIECPTTVQRNCNTTV  195
            CVD +   +IECP      C   +
Sbjct  202  CVDRSASGLIECPVFPHGKCGDEI  225



>dbj|BAB19805.1| ribonuclease [Oryza sativa Japonica Group]
Length=218

 Score =   239 bits (609),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 136/186 (73%), Gaps = 3/186 (2%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F++ V QWPGSYCDTK+ CCYP +GKPA +F IHGLWP   +GS+P+NC+P+S +D SK+
Sbjct  29   FFFLVLQWPGSYCDTKQSCCYPRSGKPAADFGIHGLWPNRDDGSYPQNCDPDSEFDPSKV  88

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC---SIFDQCAYFESTLNIKDRVNFL  420
            S L+  M+SEWPTL+CPSN+G +FW HEWEKHGTC   ++ D+  YFE+ L ++ R+  L
Sbjct  89   SDLLGSMRSEWPTLACPSNDGIRFWAHEWEKHGTCAAAALGDEHGYFEAALRLRSRLPVL  148

Query  419  QALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDI  240
             AL + G+ PDG +Y +  IK AI+ GVG  P +ECN D S  SQLYQ+Y CVD  G+  
Sbjct  149  AALRDGGVSPDGGYYTLSQIKGAIQRGVGAEPFVECNRDESGNSQLYQLYFCVDAAGERF  208

Query  239  IECPTT  222
            ++CP +
Sbjct  209  VDCPAS  214



>dbj|BAO05320.1| S-like ribonuclease [Sarracenia leucophylla]
Length=226

 Score =   239 bits (609),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 148/194 (76%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V QWPGSYCDTK+ CCYP+TGKPAT+F IHGLWP + +GS+P NC+ N+ Y++S+I
Sbjct  28   FFYFVLQWPGSYCDTKQSCCYPTTGKPATDFGIHGLWPNYNDGSYPSNCDTNNPYNQSEI  87

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L+ R+Q  WPTL+CPS+NG+ FW HEW KHGTC  S+ D+  YF S L++KD++  LQ
Sbjct  88   SDLVSRLQKSWPTLACPSSNGNSFWSHEWTKHGTCSESVLDEHGYFRSALDLKDKLGLLQ  147

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             LE+AGI PDG  Y V++I EAI+  +G  P I+CN+DAS  +QLYQ+YICVD +GK+ I
Sbjct  148  ILEDAGINPDGQSYSVDSISEAIEGSIGHAPGIQCNNDASNENQLYQVYICVDTSGKNFI  207

Query  236  ECPTTVQRNCNTTV  195
            ECP      C +++
Sbjct  208  ECPVLPSEKCASSI  221



>ref|XP_002875183.1| ribonuclease, RNS1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51442.1| ribonuclease, RNS1 [Arabidopsis lyrata subsp. lyrata]
Length=230

 Score =   239 bits (609),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 137/194 (71%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDT+K CCYP+TGKPA +F IHGLWP + +G++P NC+    +D S I
Sbjct  32   FFYFVQQWPGSYCDTQKKCCYPTTGKPAADFGIHGLWPNYKDGTYPSNCDETKPFDRSTI  91

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L+  M+  WPTL+CPS +G  FW+HEWEKHGTC  S+ DQ  YF++ L +K + N L 
Sbjct  92   SDLLTSMKKSWPTLACPSGSGEAFWEHEWEKHGTCSESVIDQHEYFQTALKLKQKTNLLG  151

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL  AGI PDG  Y +E+I+++IK  +G TP +ECN D S  SQLYQ+Y+CVD +G  +I
Sbjct  152  ALTKAGINPDGKSYSLESIRDSIKESIGFTPWVECNRDGSGNSQLYQVYLCVDRSGSGLI  211

Query  236  ECPTTVQRNCNTTV  195
            +CP      C   +
Sbjct  212  QCPVFPHGKCGAEI  225



>emb|CDX81621.1| BnaC08g39800D [Brassica napus]
Length=640

 Score =   251 bits (640),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/203 (55%), Positives = 149/203 (73%), Gaps = 6/203 (3%)
 Frame = -2

Query  797  AAADHNSDLF----YYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPE  630
              AD   D+F    +Y+V QWPG+YCDTK+ CCYP++GKPA +F IHGLWP + +GS+P 
Sbjct  429  VGADVIRDVFSLHLFYFVLQWPGAYCDTKRACCYPTSGKPAADFGIHGLWPNYKDGSYPS  488

Query  629  NCNPNSLYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFE  456
            NC+P++ +D S+IS L+  +Q++WPTLSCPSN G KFW+HEWEKHGTC  S+ DQ  YFE
Sbjct  489  NCDPDNEFDPSEISDLVSTLQTKWPTLSCPSNEGFKFWEHEWEKHGTCSESVMDQHKYFE  548

Query  455  STLNIKDRVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQ  276
            +TL ++DRVN LQ L  AGI+P+  FY+++ IK+AIK   G TP+I CN D  K SQL++
Sbjct  549  NTLALRDRVNLLQILTGAGIEPNDEFYKLKDIKKAIKEATGFTPVINCNKDPEKNSQLHE  608

Query  275  IYICVDLNGKDIIECPTTVQRNC  207
            I+ CVD +G + IECP   +  C
Sbjct  609  IFFCVDTSGTEFIECPIIPRDRC  631



>ref|NP_001061877.1| Os08g0434100 [Oryza sativa Japonica Group]
 dbj|BAB19803.1| ribonuclease [Oryza sativa (japonica cultivar-group)]
 dbj|BAB19804.1| ribonuclease [Oryza sativa Japonica Group]
 dbj|BAD10616.1| ribonuclease [Oryza sativa Japonica Group]
 dbj|BAD09840.1| ribonuclease [Oryza sativa Japonica Group]
 dbj|BAF23791.1| Os08g0434100 [Oryza sativa Japonica Group]
 dbj|BAG87136.1| unnamed protein product [Oryza sativa Japonica Group]
Length=229

 Score =   239 bits (609),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 139/196 (71%), Gaps = 4/196 (2%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F++ V QWPGSYCDTK+ CCYP +GKPA +F IHGLWP   +GS+P+NC+P+S +D SK+
Sbjct  29   FFFLVLQWPGSYCDTKQSCCYPRSGKPAADFGIHGLWPNRDDGSYPQNCDPDSEFDPSKV  88

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC---SIFDQCAYFESTLNIKDRVNFL  420
            S L+  M+SEWPTL+CPSN+G +FW HEWEKHGTC   ++ D+  YFE+ L ++ R+  L
Sbjct  89   SDLLGSMRSEWPTLACPSNDGIRFWAHEWEKHGTCAAAALGDEHGYFEAALRLRSRLPVL  148

Query  419  QALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDI  240
             AL + G+ PDG +Y +  IK AI+ GVG  P +ECN D S  SQLYQ+Y CVD  G+  
Sbjct  149  AALRDGGVSPDGGYYTLSQIKGAIQRGVGAEPFVECNRDESGNSQLYQLYFCVDAAGERF  208

Query  239  IECPTTV-QRNCNTTV  195
            ++CP +   R C   +
Sbjct  209  VDCPASPGGRPCGNRI  224



>gb|EAZ07095.1| hypothetical protein OsI_29344 [Oryza sativa Indica Group]
Length=229

 Score =   239 bits (609),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 139/196 (71%), Gaps = 4/196 (2%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F++ V QWPGSYCDTK+ CCYP +GKPA +F IHGLWP   +GS+P+NC+P+S +D SK+
Sbjct  29   FFFLVLQWPGSYCDTKQSCCYPRSGKPAADFGIHGLWPNRDDGSYPQNCDPDSEFDPSKV  88

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC---SIFDQCAYFESTLNIKDRVNFL  420
            S L+  M+SEWPTL+CPSN+G +FW HEWEKHGTC   ++ D+  YFE+ L ++ R+  L
Sbjct  89   SDLLGSMRSEWPTLACPSNDGIRFWAHEWEKHGTCAAAALGDEHGYFEAALRLRSRLPVL  148

Query  419  QALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDI  240
             AL + G+ PDG +Y +  IK AI+ GVG  P +ECN D S  SQLYQ+Y CVD  G+  
Sbjct  149  AALRDGGVSPDGGYYTLSQIKGAIQRGVGAEPFVECNRDESGNSQLYQLYFCVDAAGERF  208

Query  239  IECPTTV-QRNCNTTV  195
            ++CP +   R C   +
Sbjct  209  VDCPVSPGGRPCGNRI  224



>ref|XP_003518732.1| PREDICTED: ribonuclease 1-like [Glycine max]
Length=227

 Score =   238 bits (608),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 139/194 (72%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDT+K CCYP+ GKPA +F IHGLWP + +G +P NC+PN+ +D S I
Sbjct  29   FFYFVQQWPGSYCDTQKSCCYPTKGKPAADFGIHGLWPNYNDGKYPSNCDPNNPFDPSGI  88

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L   ++S WPTL+CPS +G +FW HEW+ HGTC  S+  Q  YFE+ LN+K + N LQ
Sbjct  89   SDLTSSLESNWPTLACPSGDGIEFWTHEWDIHGTCSESVLKQHDYFEAALNLKQKANLLQ  148

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL +AGI+ DG  Y +  IK AI+  +G TP IECN D+S  SQLYQ+Y+CV+ +G D I
Sbjct  149  ALTSAGIQADGQSYSLSEIKGAIEGAIGFTPFIECNVDSSGNSQLYQVYLCVNTSGSDFI  208

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C + +
Sbjct  209  ECPVFPRGKCGSDI  222



>ref|XP_006355103.1| PREDICTED: intracellular ribonuclease LX-like [Solanum tuberosum]
Length=237

 Score =   238 bits (608),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/252 (46%), Positives = 157/252 (62%), Gaps = 33/252 (13%)
 Frame = -2

Query  944  ENMKSILIGLVILQCTISIYAAHSQSFLYYAEQVVEEEEPFVTAFAEDDAAADHNSDLFY  765
            ++ KS+LI ++++QC + +  A                            A D +   F+
Sbjct  3    KSQKSLLIKIIVVQCLLVLCVA----------------------------AQDFD---FF  31

Query  764  YYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKISY  585
            Y+V+QWP SYCDT++ CCYP+TGKP  +FSIHGLWP + NG WP+NC+  S  DES+ S 
Sbjct  32   YFVQQWPASYCDTRRSCCYPTTGKPDEDFSIHGLWPNYENGKWPQNCDKESSLDESEFSD  91

Query  584  LIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCSIFDQCAYFESTLNIKDRVNFLQALEN  405
            LI  M+  WP+L+CPS++G KFW HEW KHGTCS  +Q AYF++ L+ K + N LQ L N
Sbjct  92   LISTMEKNWPSLACPSSDGLKFWSHEWLKHGTCSALNQHAYFQTALDFKTKSNLLQNLNN  151

Query  404  AGIKP-DGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDIIECP  228
            AGIKP +G  Y VE+IK AI+ GVG TP IECN D+    QLYQ+Y+CVD +    I+CP
Sbjct  152  AGIKPRNGEHYSVESIKNAIEEGVGHTPFIECNVDSQGNHQLYQVYLCVDSSASKFIDCP  211

Query  227  TTVQ-RNCNTTV  195
                 R C + +
Sbjct  212  IFPHGRKCGSKI  223



>emb|CDY33762.1| BnaA09g45680D [Brassica napus]
Length=217

 Score =   237 bits (604),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 144/195 (74%), Gaps = 2/195 (1%)
 Frame = -2

Query  791  ADHNSDLFYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNS  612
            +++ ++L      QWPG+YCDTK+ CCYP+TGKPA +F IHGLWP + NGS+P NC+P++
Sbjct  12   SEYPNNLIQNICMQWPGAYCDTKRACCYPTTGKPAADFGIHGLWPNYNNGSYPSNCDPSN  71

Query  611  LYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIK  438
             +D S+IS L+  +Q++WPTLSCPSN G KFW+HEWEKHGTC  S+ DQ  YFE TL ++
Sbjct  72   EFDPSEISDLVSTLQTKWPTLSCPSNEGYKFWEHEWEKHGTCSESVMDQHGYFEKTLALR  131

Query  437  DRVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVD  258
            DR+N LQ L +AGI+P+  FY+++ IK+AI+   G TP+I CN D  K  QL++I +CVD
Sbjct  132  DRINLLQILTDAGIEPNDEFYKLKDIKKAIEKATGFTPVINCNRDPEKNRQLHEILLCVD  191

Query  257  LNGKDIIECPTTVQR  213
             +G + ++CP    R
Sbjct  192  KSGTEFMDCPMPTDR  206



>ref|XP_008446356.1| PREDICTED: ribonuclease 3-like [Cucumis melo]
Length=228

 Score =   237 bits (604),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 144/195 (74%), Gaps = 3/195 (2%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKG-CCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESK  594
            F+Y+V+QWPG+YCDTKK  CCYP TG+P  +F IHGLWP + +G++P +CNP+S++D ++
Sbjct  29   FFYFVQQWPGAYCDTKKQHCCYPKTGRPVADFGIHGLWPNYKDGTYPSDCNPDSVFDRTQ  88

Query  593  ISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFL  420
            IS ++  M+  WP+LSCPS+NG +FW HEWEKHGTC  S  DQ  YFE+ + +K++ N L
Sbjct  89   ISEVLSSMEKHWPSLSCPSSNGLRFWSHEWEKHGTCSESELDQKEYFEAAIKLKEKANLL  148

Query  419  QALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDI  240
              L NAGI+ +   Y +E++K AI+ G+G TP IECN D++  SQLYQIY+CVD +G + 
Sbjct  149  NVLNNAGIEANDEMYSLESVKNAIEEGIGFTPGIECNKDSAGNSQLYQIYLCVDTSGSEF  208

Query  239  IECPTTVQRNCNTTV  195
            I+CP   +  C +T+
Sbjct  209  IKCPILPRPKCASTI  223



>ref|NP_001234551.1| intracellular ribonuclease LX precursor [Solanum lycopersicum]
 sp|P80196.2|RNLX_SOLLC RecName: Full=Intracellular ribonuclease LX; Short=RNase LX; 
Flags: Precursor [Solanum lycopersicum]
 emb|CAA55896.1| ribonuclease [Solanum lycopersicum]
Length=237

 Score =   237 bits (604),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 137/182 (75%), Gaps = 1/182 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWP SYCDT++ CCYP+TGKP  +FSIHGLWP + +G WP+NC+  S  DES+ 
Sbjct  30   FFYFVQQWPASYCDTRRSCCYPTTGKPDEDFSIHGLWPNYKDGKWPQNCDRESSLDESEF  89

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCSIFDQCAYFESTLNIKDRVNFLQAL  411
            S LI  M+  WP+L+CPS++G KFW HEW KHGTCS  +Q AYF++ L+ K + N LQ L
Sbjct  90   SDLISTMEKNWPSLACPSSDGLKFWSHEWLKHGTCSALNQHAYFQTALDFKTKSNLLQNL  149

Query  410  ENAGIKP-DGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDIIE  234
             NAGIKP +G++Y VE+IK+AI+ GVG TP IECN D+    QLYQ+Y+CVD +    I+
Sbjct  150  NNAGIKPRNGDYYGVESIKKAIEKGVGHTPFIECNVDSQGNHQLYQVYLCVDSSASKFID  209

Query  233  CP  228
            CP
Sbjct  210  CP  211



>emb|CAB40355.1| ribonuclease T2 [Solanum lycopersicum]
Length=233

 Score =   237 bits (604),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 137/182 (75%), Gaps = 1/182 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWP SYCDT++ CCYP+TGKP  +FSIHGLWP + +G WP+NC+  S  DES+ 
Sbjct  30   FFYFVQQWPASYCDTRRSCCYPTTGKPDEDFSIHGLWPNYKDGKWPQNCDRESSLDESEF  89

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCSIFDQCAYFESTLNIKDRVNFLQAL  411
            S LI  M+  WP+L+CPS++G KFW HEW KHGTCS  +Q AYF++ L+ K + N LQ L
Sbjct  90   SDLISTMEKNWPSLACPSSDGLKFWSHEWLKHGTCSALNQHAYFQTALDFKTKSNLLQNL  149

Query  410  ENAGIKP-DGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDIIE  234
             NAGIKP +G++Y VE+IK+AI+ GVG TP IECN D+    QLYQ+Y+CVD +    I+
Sbjct  150  NNAGIKPRNGDYYGVESIKKAIEKGVGHTPFIECNVDSQGNHQLYQVYLCVDSSASKFID  209

Query  233  CP  228
            CP
Sbjct  210  CP  211



>ref|XP_009783064.1| PREDICTED: intracellular ribonuclease LX-like isoform X1 [Nicotiana 
sylvestris]
Length=240

 Score =   237 bits (604),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 115/253 (45%), Positives = 159/253 (63%), Gaps = 36/253 (14%)
 Frame = -2

Query  944  ENMKSILIGLVILQCTISIYAAHSQSFLYYAEQVVEEEEPFVTAFAEDDAAADHNSDLFY  765
             +++ +L+ LVI QC   I   H+Q F                               F+
Sbjct  2    RSIQLVLVKLVIFQC---IMLLHAQDFD------------------------------FF  28

Query  764  YYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKISY  585
            Y+ +QW  + CD+K  CCYP+ GKPA +F IHGLWP + NGS+P++CN N+ YDE++IS 
Sbjct  29   YFAQQWNPASCDSKIKCCYPTNGKPAQDFGIHGLWPNYNNGSFPKSCNKNARYDETQISD  88

Query  584  LIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCSI--FDQCAYFESTLNIKDRVNFLQAL  411
            LI  MQ  WPTLSCPSNNG++FW HEW+KHGTCS+   D  +YF++ L +K++VN LQ L
Sbjct  89   LISSMQKNWPTLSCPSNNGTRFWSHEWKKHGTCSLSMLDMHSYFQAALALKEKVNLLQFL  148

Query  410  ENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDIIEC  231
             NAGIKPDG FY  EA+KEAI+ G+G T  +ECN D     QL+++Y+CVD  G +II+C
Sbjct  149  NNAGIKPDGGFYSYEAMKEAIEKGIGHTVGVECNIDLFGNRQLFEVYVCVDKCGSEIIDC  208

Query  230  PTTVQ-RNCNTTV  195
            P   + + C  ++
Sbjct  209  PIVPESKRCKESI  221



>ref|XP_004135175.1| PREDICTED: ribonuclease 3-like [Cucumis sativus]
 ref|XP_004155309.1| PREDICTED: ribonuclease 3-like [Cucumis sativus]
 gb|KGN51921.1| S-like ribonuclease [Cucumis sativus]
Length=228

 Score =   236 bits (603),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 145/195 (74%), Gaps = 3/195 (2%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKG-CCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESK  594
            F+Y+V+QWPG+YCDTK+  CCYP TG+PA +F IHGLWP + +GS+P NC+P+S++D ++
Sbjct  29   FFYFVQQWPGAYCDTKRQHCCYPETGRPAADFGIHGLWPNYKDGSYPSNCDPDSVFDRTQ  88

Query  593  ISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFL  420
            IS ++  M   WP+LSCPS+NG +FW HEWEKHGTC  S  DQ  YFE+ + +K++ N L
Sbjct  89   ISEVLSSMDKHWPSLSCPSSNGLRFWSHEWEKHGTCSESELDQKEYFEAAIKLKEKANLL  148

Query  419  QALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDI  240
            + L +AGI+ +   Y +E++K AI+ G+G TP IECN D++  +QLYQ+Y+CVD +G + 
Sbjct  149  KVLNSAGIEANDEMYSLESVKNAIEEGIGFTPGIECNRDSAGNAQLYQVYLCVDTSGSEF  208

Query  239  IECPTTVQRNCNTTV  195
            I+CP   +  C +T+
Sbjct  209  IKCPILPRTKCASTI  223



>ref|XP_008221730.1| PREDICTED: ribonuclease 1, partial [Prunus mume]
Length=240

 Score =   236 bits (602),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 148/194 (76%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDTKK CCYP+TGKPA +F IHGLWP + +GS+P NC+P++ +D+S+I
Sbjct  42   FFYFVQQWPGSYCDTKKSCCYPTTGKPAADFGIHGLWPNYKDGSYPSNCDPSNPFDQSEI  101

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L   MQ EWPTL+CPS +G +FW HEWEKHGTC  S+ DQ  YF + L++K ++N LQ
Sbjct  102  SDLRSSMQKEWPTLACPSGSGIEFWTHEWEKHGTCSESVIDQHGYFAAALSLKKKLNLLQ  161

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            ALE+AGI+P+G+ Y +  IK+A+K+G G TP IECN D S  SQLYQ+Y CVD +G D+I
Sbjct  162  ALESAGIQPNGDSYSLGNIKDAVKSGTGFTPFIECNVDESGNSQLYQVYFCVDTSGSDLI  221

Query  236  ECPTTVQRNCNTTV  195
            ECP      C + +
Sbjct  222  ECPVFPHGKCGSQI  235



>gb|AAS01727.1| S-like RNase [Triticum aestivum]
Length=228

 Score =   236 bits (601),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 139/195 (71%), Gaps = 3/195 (2%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y V QWPGSYCDTK+ CCYP +GKPA +F IHGLWP   +GS+P+NCNP + +D SK+
Sbjct  29   FFYLVLQWPGSYCDTKQSCCYPRSGKPAADFGIHGLWPNRDDGSYPQNCNPANAFDPSKV  88

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCS--IFDQCAYFESTLNIKDRVNFLQ  417
            S L+  ++ EWPTL+CP+++G +FW HEWEKHGTC+  +F++  YF++ L+++D++  L 
Sbjct  89   SDLLSSLRREWPTLACPTSDGLQFWAHEWEKHGTCAQNLFNEHGYFQTALHLRDQLRVLD  148

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL +AG+ PDG +Y + AIK AI+ G G  P +ECN D S  SQLYQ+Y CVD N    +
Sbjct  149  ALTSAGVSPDGGYYTLSAIKGAIQQGTGFEPFVECNRDESGNSQLYQLYFCVDANASGFV  208

Query  236  ECPTTV-QRNCNTTV  195
            ECP     R C   V
Sbjct  209  ECPVQPGGRPCGNRV  223



>ref|XP_010527911.1| PREDICTED: ribonuclease 3-like [Tarenaya hassleriana]
Length=224

 Score =   235 bits (600),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 142/194 (73%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V QWPG+YCD+++ CCYP TGKP+++FSIHGLWP + +GS+P NC+P+S + +S++
Sbjct  26   FFYFVLQWPGAYCDSRQSCCYPKTGKPSSDFSIHGLWPNYNDGSYPSNCDPDSQFHKSEV  85

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
              L+ +M  +WP+L+CPS++G +FW+HEW KHGTC  S  DQ  YF++ L +KD+ N LQ
Sbjct  86   EDLLNKMAEKWPSLACPSSDGVRFWEHEWVKHGTCSESELDQHDYFDAALKLKDKANLLQ  145

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L++AGI PD  FY ++ IK AI+ G G +P IECN D S+ SQLYQIY+CVD +    I
Sbjct  146  FLKSAGINPDDGFYSLKEIKNAIEEGTGFSPGIECNKDPSRNSQLYQIYLCVDTSATTFI  205

Query  236  ECPTTVQRNCNTTV  195
            ECP   Q  C   +
Sbjct  206  ECPILPQGRCAPEI  219



>ref|XP_006344267.1| PREDICTED: intracellular ribonuclease LX-like [Solanum tuberosum]
Length=240

 Score =   236 bits (601),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 145/195 (74%), Gaps = 3/195 (2%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+ +QW  + CD+K  CCYP+ GKP  +F IHGLWP + NGS+P++CN N  YDE++I
Sbjct  27   FFYFTQQWNPASCDSKIKCCYPTNGKPEEDFGIHGLWPNYFNGSYPKSCNKNVRYDETQI  86

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCSI--FDQCAYFESTLNIKDRVNFLQ  417
            S LI  MQ  WPTLSCPSNNG++FW HEW+KHGTCS+   D  +YF++ L +K++VN LQ
Sbjct  87   SDLISSMQKNWPTLSCPSNNGTRFWSHEWKKHGTCSLSMLDMHSYFQAALALKEKVNLLQ  146

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L+NAGI+P+G FY +EAIK+AI+ G+  T  +ECN D +  SQL+++YICVD +G +II
Sbjct  147  ILKNAGIQPNGGFYNLEAIKKAIEKGIEHTIGVECNIDLNGNSQLFEVYICVDKSGSNII  206

Query  236  ECPTTVQ-RNCNTTV  195
            +CP   + + CN  V
Sbjct  207  DCPIIPETKRCNEIV  221



>emb|CDP00339.1| unnamed protein product [Coffea canephora]
Length=228

 Score =   235 bits (599),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 149/194 (77%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDT +GCCYPS GKPA++F IHGLWPT  +GS+P NC+ ++ +D SKI
Sbjct  30   FFYFVQQWPGSYCDTDQGCCYPSNGKPASDFGIHGLWPTNNDGSYPSNCDSSNPFDISKI  89

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L+ RM+ +WP+L+CPS++G+ FW HEWEKHGTC  SI DQ  YF+S L++KD ++ LQ
Sbjct  90   SDLVSRMEQDWPSLACPSSSGTTFWSHEWEKHGTCSESILDQHGYFKSALDLKDNLDLLQ  149

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L++AGI+  G  Y + +IK AI++ +G TP IECN+D S  SQLYQIYICVD +  +II
Sbjct  150  ILQSAGIQAGGGSYSLSSIKNAIESAIGSTPWIECNTDGSGNSQLYQIYICVDASASNII  209

Query  236  ECPTTVQRNCNTTV  195
            ECP      C+++V
Sbjct  210  ECPVMQTGRCSSSV  223



>ref|XP_004135454.1| PREDICTED: extracellular ribonuclease LE-like [Cucumis sativus]
 gb|KGN51920.1| hypothetical protein Csa_5G605140 [Cucumis sativus]
Length=240

 Score =   235 bits (600),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 144/194 (74%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+ WPGSYCDT + CCYP TGKP+ +F IHGLWP + +G++P NC+ ++ +D ++I
Sbjct  42   FFYFVQSWPGSYCDTGRSCCYPKTGKPSGDFKIHGLWPNYNDGTYPSNCDSSNPFDRTQI  101

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L+  M+  WP+L+CPS++ +KFW HEW KHGTC  S+ DQ +YFE+TLN+K + N LQ
Sbjct  102  SDLVSSMEKNWPSLACPSSDNTKFWSHEWNKHGTCSESVLDQHSYFETTLNLKQQANILQ  161

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL+ AGI PDG++Y ++ IK AI+ G+ ++P I CN D S  SQLY+IY+CVD +  + I
Sbjct  162  ALQTAGINPDGSYYSLDKIKSAIEEGIKLSPGISCNVDESGNSQLYEIYLCVDSSASNFI  221

Query  236  ECPTTVQRNCNTTV  195
            +CP     NC +++
Sbjct  222  DCPIFPNSNCASSL  235



>ref|XP_004155386.1| PREDICTED: LOW QUALITY PROTEIN: extracellular ribonuclease LE-like 
[Cucumis sativus]
Length=240

 Score =   235 bits (599),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 143/194 (74%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+ WPGSYCDT + CCYP TGKP+ +F IHGLWP + +G++P NC+ ++ +D ++I
Sbjct  42   FFYFVQSWPGSYCDTGRSCCYPKTGKPSGDFKIHGLWPNYNDGTYPSNCDSSNPFDRTQI  101

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L+  M+  WP+L+CPS++ +KFW HEW KHGTC  S+ DQ  YFE+TLN+K + N LQ
Sbjct  102  SDLVSSMEKNWPSLACPSSDNTKFWSHEWNKHGTCSESVLDQXQYFETTLNLKQQANILQ  161

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL+ AGI PDG++Y ++ IK AI+ G+ ++P I CN D S  SQLY+IY+CVD +  + I
Sbjct  162  ALQTAGINPDGSYYSLDKIKSAIEEGIKLSPGISCNVDESGNSQLYEIYLCVDSSASNFI  221

Query  236  ECPTTVQRNCNTTV  195
            +CP     NC +++
Sbjct  222  DCPIFPNSNCASSL  235



>ref|XP_010265111.1| PREDICTED: ribonuclease 1-like [Nelumbo nucifera]
Length=232

 Score =   234 bits (598),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 138/194 (71%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGS+CDT+ GCCYP TGKPA++FSIHGLWP + NGS+P NC+  + ++   I
Sbjct  28   FFYFVQQWPGSFCDTRTGCCYPQTGKPASDFSIHGLWPNYNNGSYPSNCDYRNPFNPRMI  87

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L  R++  WP+L+CP +   +FW HEW KHGTC  SI +Q AYF + LN++++VN LQ
Sbjct  88   SDLRIRLEKTWPSLACPRSEMLRFWSHEWIKHGTCSESILNQRAYFITALNLRNKVNLLQ  147

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L NAGIKPDG  Y +  IKEAI    G TP I CN D S  SQLYQI++CVD +G   I
Sbjct  148  ILVNAGIKPDGRLYSLGVIKEAITKATGYTPGIVCNLDRSGSSQLYQIFLCVDTSGSKFI  207

Query  236  ECPTTVQRNCNTTV  195
            ECP   ++ C +++
Sbjct  208  ECPVFPRQMCGSSI  221



>ref|NP_001131005.1| uncharacterized protein LOC100192110 precursor [Zea mays]
 gb|ACF79429.1| unknown [Zea mays]
 gb|ACG37896.1| ribonuclease 3 precursor [Zea mays]
 tpg|DAA48973.1| TPA: hypothetical protein ZEAMMB73_030161 [Zea mays]
Length=229

 Score =   234 bits (597),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 145/204 (71%), Gaps = 6/204 (3%)
 Frame = -2

Query  797  AAADHNSDLFYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNP  618
            AA D++   F+Y V QWPG+YCDTK+ CCYP +GKPA +F IHGLWP   +G++P+NC+P
Sbjct  24   AAQDYD---FFYLVLQWPGAYCDTKQSCCYPKSGKPAADFGIHGLWPNRDDGTYPQNCSP  80

Query  617  NSLYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCS--IFDQCAYFESTLN  444
            ++ ++ SK+S L+  ++++WPTL+CPSN+G +FW HEWEKHGTC+  +FD+  YF++ L 
Sbjct  81   DNAFNPSKVSDLLSSLRAKWPTLACPSNDGLRFWGHEWEKHGTCAADVFDEHGYFQAALR  140

Query  443  IKDRVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYIC  264
            ++D++  L AL +AG+KPDG +Y +  IK AI+ G G  P +ECN D +  SQLYQ+Y C
Sbjct  141  LRDQLGVLGALTSAGVKPDGGYYTLSQIKGAIRQGTGFEPYVECNRDEAGNSQLYQLYFC  200

Query  263  VDLNGKDIIECPTTVQ-RNCNTTV  195
            VD  G   ++CP     R C   +
Sbjct  201  VDAAGDSFVDCPVLPSGRPCGNRI  224



>ref|XP_010683180.1| PREDICTED: ribonuclease 1-like [Beta vulgaris subsp. vulgaris]
Length=234

 Score =   234 bits (597),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 144/194 (74%), Gaps = 3/194 (2%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTK-KGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESK  594
            F+Y+V+QWPG+YCD K + CC+P  GKP+T+FSIHGLWP + +G +P NC+ +  +DES+
Sbjct  37   FFYFVQQWPGAYCDAKGRSCCFPDNGKPSTDFSIHGLWPNYNDGGYPSNCDSSKPFDESQ  96

Query  593  ISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCSIF-DQCAYFESTLNIKDRVNFLQ  417
            +  L  R+++EWP+L+CPS  G KFW HEW KHGTCS F +Q  YF++ L++KD+ N LQ
Sbjct  97   LDELESRLKTEWPSLACPSI-GPKFWAHEWNKHGTCSFFSNQQDYFQAGLDLKDKTNLLQ  155

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL++  I+P+  FY VE +KEAIK  +G  P IECN D+   SQLYQ+YICVD NGKD+I
Sbjct  156  ALKDEEIEPNDEFYNVEDMKEAIKKKIGFYPWIECNHDSDDNSQLYQVYICVDTNGKDLI  215

Query  236  ECPTTVQRNCNTTV  195
            +CP   + NC + V
Sbjct  216  KCPVLPRGNCASRV  229



>ref|XP_007223921.1| hypothetical protein PRUPE_ppa011026mg [Prunus persica]
 gb|EMJ25120.1| hypothetical protein PRUPE_ppa011026mg [Prunus persica]
Length=226

 Score =   234 bits (596),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 147/194 (76%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDTKK CCYP+TGKPA +F IHGLWP + +GS+P NC+P++ +D+S+I
Sbjct  28   FFYFVQQWPGSYCDTKKSCCYPTTGKPAADFGIHGLWPNYKDGSYPSNCDPSNPFDQSEI  87

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L   MQ EWPTL+CPS +G +FW HEWEKHGTC  S+ DQ  YF + LN+K +++ LQ
Sbjct  88   SDLRSSMQKEWPTLACPSGSGIEFWTHEWEKHGTCSESVIDQHGYFAAALNLKKKLSLLQ  147

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            ALE+AGI+P+G+ Y +  IK+A+K+  G TP IECN D S  SQLYQ+Y CVD +G D+I
Sbjct  148  ALESAGIQPNGDSYSLGNIKDAVKSATGFTPFIECNVDESGNSQLYQVYFCVDTSGSDLI  207

Query  236  ECPTTVQRNCNTTV  195
            ECP      C + +
Sbjct  208  ECPVFPHGKCGSQI  221



>ref|XP_010462695.1| PREDICTED: ribonuclease 3-like [Camelina sativa]
Length=201

 Score =   233 bits (593),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 133/187 (71%), Gaps = 2/187 (1%)
 Frame = -2

Query  749  WPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKISYLIERM  570
            WPG+YCDTK  CCYP++GKPA +F IHGLWP + + SWP NC+P+S +D S+I  L+  M
Sbjct  10   WPGAYCDTKSSCCYPTSGKPAADFGIHGLWPNYNSSSWPSNCDPDSKFDRSQIEDLLSSM  69

Query  569  QSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQALENAGI  396
            +  WPTLSCPSN G KFWKHEWEKHGTC  S+ DQ  YFE+ L +K++ N LQ L N+GI
Sbjct  70   KKNWPTLSCPSNEGFKFWKHEWEKHGTCAESVMDQHEYFENALKLKEKANLLQILTNSGI  129

Query  395  KPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDIIECPTTVQ  216
             PD  FY+++ I   IK G+G TP ++CN D  +  QLYQIYICVD +G + IECP   +
Sbjct  130  NPDDGFYDLKNITNTIKDGIGYTPGLQCNKDRERNFQLYQIYICVDTSGTEFIECPVLPK  189

Query  215  RNCNTTV  195
              C + +
Sbjct  190  GTCPSKL  196



>ref|XP_006438698.1| hypothetical protein CICLE_v10032651mg [Citrus clementina]
 gb|ESR51938.1| hypothetical protein CICLE_v10032651mg [Citrus clementina]
Length=228

 Score =   233 bits (594),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 136/184 (74%), Gaps = 4/184 (2%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V QWPGSYCDT K CCYP+TGKPA +F IHGLWP + +GS+P NC+PN+ +D+S+I
Sbjct  31   FFYFVLQWPGSYCDTAKSCCYPTTGKPAADFGIHGLWPNYNDGSYPSNCDPNAPFDQSQI  90

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L   MQ  WPTL+CPS NG  FW HEWEKHGTC  S+ +Q  YF++ LN+K++++ LQ
Sbjct  91   SDLRSSMQKNWPTLACPSGNGITFWSHEWEKHGTCSESVLNQHQYFQTALNLKNQIHLLQ  150

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL  A   PDG+ Y +E+IK+AIK   G +P IECN D S  SQLYQIY+CVD +  + I
Sbjct  151  ALRTA--VPDGSSYSLESIKDAIKEASGFSPWIECNVDESGNSQLYQIYLCVDTSASNFI  208

Query  236  ECPT  225
             CP 
Sbjct  209  NCPV  212



>gb|AAF82615.1|AF157011_1 S-like ribonuclease [Prunus dulcis]
 gb|AAG31930.1|AF202030_1 RNase PD2 [Prunus dulcis]
Length=226

 Score =   233 bits (593),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 147/194 (76%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDTKK CCYP+TGKPA +F IHGLWP + +GS+P NC+P++ +D+S+I
Sbjct  28   FFYFVQQWPGSYCDTKKSCCYPTTGKPAADFGIHGLWPNYKDGSYPSNCDPSNPFDQSEI  87

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S +   MQ EWPTL+CPS +G +FW HEWEKHGTC  S+ DQ  YF + LN+K +++ LQ
Sbjct  88   SDIRSSMQKEWPTLACPSGSGIEFWTHEWEKHGTCSESVIDQHGYFAAALNLKKKLSLLQ  147

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            ALE+AGI+P+G+ Y +  IK+A+K+  G TP IECN D S  SQLYQ+Y CVD +G D+I
Sbjct  148  ALESAGIQPNGDSYSLGNIKDAVKSATGFTPFIECNVDESGNSQLYQVYFCVDTSGSDLI  207

Query  236  ECPTTVQRNCNTTV  195
            ECP      C + +
Sbjct  208  ECPVFPHGKCGSQI  221



>ref|XP_007157617.1| hypothetical protein PHAVU_002G084600g [Phaseolus vulgaris]
 gb|ESW29611.1| hypothetical protein PHAVU_002G084600g [Phaseolus vulgaris]
Length=227

 Score =   232 bits (592),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 100/194 (52%), Positives = 139/194 (72%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGS+CDT+K CCYP++GKP  +F IHGLWP   +GS+P NC+PN+ ++ S+I
Sbjct  29   FFYFVQQWPGSFCDTEKSCCYPTSGKPNADFGIHGLWPNSNDGSFPSNCDPNNPFNPSQI  88

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L   ++S WPTL+CPS +G  FW HEW KHGTC  S+  Q  YFE+ L+++ + N LQ
Sbjct  89   SDLTSSLESNWPTLACPSGDGMTFWSHEWTKHGTCSESVLKQHDYFEAALSLRQKANLLQ  148

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL  AGI+P+G  Y + +IK AIK  +G TP IECN D+S  SQLYQ+Y+CV+ +G D I
Sbjct  149  ALTTAGIQPNGGSYSLSSIKGAIKDAIGFTPFIECNVDSSGNSQLYQVYLCVNTSGSDFI  208

Query  236  ECPTTVQRNCNTTV  195
            +C    +  C + +
Sbjct  209  DCSVFPRGKCGSNI  222



>ref|XP_009395131.1| PREDICTED: extracellular ribonuclease LE-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=216

 Score =   232 bits (591),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 145/203 (71%), Gaps = 12/203 (6%)
 Frame = -2

Query  797  AAADHNSDLFYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNP  618
            A+  H+ D F+Y+V+QWPGSYCDT++ CCYPSTGKPA++F IHGLWP + +GS+P NC+ 
Sbjct  19   ASTAHDFD-FFYFVQQWPGSYCDTRQSCCYPSTGKPASDFGIHGLWPNYNDGSYPSNCDS  77

Query  617  NSLYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCS--IFDQCAYFESTLN  444
            +  YD S+++         WPTL+CPS +GS FW HEW KHGTCS  + DQ +YF++ L 
Sbjct  78   DWPYDASEMN---------WPTLACPSGDGSSFWSHEWRKHGTCSESLLDQRSYFQAALY  128

Query  443  IKDRVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYIC  264
            +K +V+ L+ L++AGI+PDG FY +  I  AI+  +G TP I+CN D S   QLYQIY+C
Sbjct  129  LKKQVDLLKVLQDAGIRPDGGFYSLRGIAGAIREAIGYTPGIQCNVDESGNRQLYQIYLC  188

Query  263  VDLNGKDIIECPTTVQRNCNTTV  195
            VD  GK++IECP   +  C++ V
Sbjct  189  VDTWGKELIECPVFPRSKCSSRV  211



>ref|XP_002445549.1| hypothetical protein SORBIDRAFT_07g021330 [Sorghum bicolor]
 gb|EES15044.1| hypothetical protein SORBIDRAFT_07g021330 [Sorghum bicolor]
Length=225

 Score =   232 bits (591),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 139/195 (71%), Gaps = 3/195 (2%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y V QWPGSYCDTK+ CCYP +GKPA +F IHGLWP   +G++P+NC+P++ ++ SK+
Sbjct  26   FFYLVLQWPGSYCDTKQSCCYPKSGKPAADFGIHGLWPNRDDGTYPQNCSPDNAFNPSKV  85

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCS--IFDQCAYFESTLNIKDRVNFLQ  417
            S L+  ++++WPTL+CPSN+G +FW HEWEKHGTC+  +FD+  YF++ + ++D++  L 
Sbjct  86   SDLLSSLRAKWPTLACPSNDGLRFWGHEWEKHGTCAANVFDEHGYFQAAMRLRDQLGVLA  145

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL +AG+ PDG +Y +  IK AI  G G  P +ECN D +  SQLYQ+Y CVD  G   +
Sbjct  146  ALSSAGVNPDGGYYSLSQIKGAISQGTGFEPYVECNRDEAGNSQLYQLYFCVDAAGDSFV  205

Query  236  ECPTTVQ-RNCNTTV  195
            ECP   + R C   +
Sbjct  206  ECPVLPRGRPCGNRI  220



>ref|XP_009793099.1| PREDICTED: intracellular ribonuclease LX-like [Nicotiana sylvestris]
Length=234

 Score =   232 bits (592),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 138/194 (71%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWP SYCDT++ CCYP+TGKP  +FSIHGLWP + NG WP+NC+  S  DESKI
Sbjct  29   FFYFVQQWPASYCDTRRSCCYPTTGKPDEDFSIHGLWPNYENGKWPQNCDRESSLDESKI  88

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCSIFDQCAYFESTLNIKDRVNFLQAL  411
            S LI  M+  WP+L+CPS++G +FW HEW KHGTCS   + AYF++ L+ + + N L+ L
Sbjct  89   SDLISTMEKNWPSLACPSSDGVRFWSHEWLKHGTCSALGERAYFQAALDFRKKSNLLENL  148

Query  410  ENAGIKP-DGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDIIE  234
            +NAGI P +G  Y +E+IK+AI+ GVG +P IECN D     Q+YQ+Y+CVD    D I+
Sbjct  149  KNAGITPRNGEHYTLESIKKAIEEGVGHSPYIECNVDTQGNHQIYQVYLCVDKTATDFID  208

Query  233  CPTTVQ-RNCNTTV  195
            CP     R C + +
Sbjct  209  CPVFPHGRGCGSKI  222



>dbj|BAO05321.1| S-like ribonuclease [Nepenthes bicalcarata]
Length=231

 Score =   232 bits (591),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 142/198 (72%), Gaps = 6/198 (3%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDT +GCCYP+TGKPA++F IHGLWP   +GS+P NC+PN+ +D S+I
Sbjct  29   FFYFVQQWPGSYCDTSEGCCYPTTGKPASDFGIHGLWPNNDDGSYPSNCDPNNPFDPSQI  88

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
              L+  +Q+EWP+LSCPS+NG  FW HEW+KHGTC  S+ D+  YF + L +K + N LQ
Sbjct  89   QDLLSSLQAEWPSLSCPSSNGISFWTHEWDKHGTCSESVLDEHDYFAAALALKSQANLLQ  148

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVT--PLIECNSDASKVSQLYQIYICVDLNGKD  243
            ALENAGI P+G+FY +  I  AI    G T    + CN+D     QLYQ+YICVD +G++
Sbjct  149  ALENAGINPNGSFYALSDIDHAIAQATGNTNYGYVSCNTDDYGNGQLYQVYICVDHSGQN  208

Query  242  IIECPT--TVQRNCNTTV  195
             I CPT     +NC ++V
Sbjct  209  FINCPTNGVTDQNCPSSV  226



>ref|XP_003574555.2| PREDICTED: ribonuclease 1-like [Brachypodium distachyon]
Length=356

 Score =   236 bits (601),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 133/185 (72%), Gaps = 2/185 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F++ V QWPGSYCDTKK CCYP +GKPA +F IHGLWP   +G++P++CNP++ +D SK+
Sbjct  157  FFFLVLQWPGSYCDTKKSCCYPKSGKPAADFGIHGLWPNRDDGTYPQDCNPDNAFDPSKV  216

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCS--IFDQCAYFESTLNIKDRVNFLQ  417
            S L+  M+  WPTL+CP+N+G +FW HEWEKHGTC+  +FD+  YF + L ++D++  L 
Sbjct  217  SDLLGSMRKNWPTLACPTNDGVRFWGHEWEKHGTCAENLFDEHGYFSTALRLRDQLRVLD  276

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL + GI PDG +Y + AIK AI+ G G  P +ECN D S  SQLYQ+Y CVD      +
Sbjct  277  ALRSGGISPDGGYYTLSAIKGAIQQGTGFEPFVECNRDESGNSQLYQLYFCVDAGATKFV  336

Query  236  ECPTT  222
            ECP +
Sbjct  337  ECPVS  341



>ref|XP_009626195.1| PREDICTED: intracellular ribonuclease LX-like [Nicotiana tomentosiformis]
Length=234

 Score =   231 bits (589),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 139/194 (72%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWP SYCDT++ CCYP+TGKP  +FSIHGLWP + NG WP+NC+  S  DES+I
Sbjct  29   FFYFVQQWPASYCDTRRSCCYPTTGKPDEDFSIHGLWPNYENGKWPQNCDRESSLDESEI  88

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCSIFDQCAYFESTLNIKDRVNFLQAL  411
            S LI  M+  WP+L+CPS++G +FW HEW KHGTCS   + AYF++ L+ + + N L+ L
Sbjct  89   SDLISTMEKNWPSLACPSSDGVRFWSHEWLKHGTCSALGERAYFQAALDFRKKSNLLENL  148

Query  410  ENAGIKP-DGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDIIE  234
            +NAGI P +G  Y +E+IK+AI+ GVG +P IECN D     Q+YQ+Y+CVD    D I+
Sbjct  149  KNAGINPRNGEHYTLESIKKAIEEGVGHSPYIECNVDTQGNHQIYQVYLCVDKTATDFID  208

Query  233  CPTTVQ-RNCNTTV  195
            CP   + R C + +
Sbjct  209  CPVFPRGRGCGSKI  222



>dbj|BAH22709.1| S-like ribonuclease [Dionaea muscipula]
Length=225

 Score =   231 bits (588),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 145/195 (74%), Gaps = 3/195 (2%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDT + CCYP+TGKPA++F IHGLWP + +GS+P NC+ ++ +D S+I
Sbjct  26   FFYFVQQWPGSYCDTSQSCCYPTTGKPASDFGIHGLWPNYNSGSYPSNCDSSNPFDPSQI  85

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
              L+ +MQ+EWP+LSCPS++G+ FW HEW KHGTC  S+ ++ AYF++ L++K+  N LQ
Sbjct  86   QDLLSQMQTEWPSLSCPSSDGTSFWTHEWNKHGTCSESVLNEHAYFQAALSLKNSSNLLQ  145

Query  416  ALENAGIKPDGNFYEVEAIKEAIK-AGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDI  240
             L NAGI P+GN Y +  +  A+K A  G    I+CN+D +  SQLYQ+Y+CV+ +G+  
Sbjct  146  TLANAGITPNGNSYNLSDVLAAMKQATGGYDAYIQCNTDQNGNSQLYQVYMCVNTSGQSF  205

Query  239  IECPTTVQRNCNTTV  195
            IECP    +NCN ++
Sbjct  206  IECPVAPSQNCNPSI  220



>gb|AAS07016.1| S-like RNase [Triticum aestivum]
Length=229

 Score =   229 bits (585),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 133/184 (72%), Gaps = 2/184 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y V QWPGSYCDTK+ CCYP +GKPA +F IHGLWP   +GS+P+NCNP+S +D SK+
Sbjct  30   FFYLVLQWPGSYCDTKQSCCYPRSGKPAADFGIHGLWPNRDDGSYPQNCNPDSAFDPSKV  89

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCS--IFDQCAYFESTLNIKDRVNFLQ  417
            S ++  ++S WPTL+CP+N+G +FW HEWEKHGTC+  +F++  YF++ L ++ ++  L 
Sbjct  90   SDILSSLRSSWPTLACPTNDGLRFWAHEWEKHGTCAQNLFNEHGYFQAALRLRGQLRVLD  149

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL  AGI PDG +Y + AIK AI+ G G  P ++CN D S  SQL+Q+Y CV  +    +
Sbjct  150  ALATAGISPDGGYYTMGAIKGAIQEGTGFAPHVDCNRDESGNSQLFQLYFCVHADASRFV  209

Query  236  ECPT  225
            ECP 
Sbjct  210  ECPV  213



>dbj|BAN14351.1| S-like ribonuclease [Cephalotus follicularis]
Length=227

 Score =   229 bits (585),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 138/182 (76%), Gaps = 2/182 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDT +GCCYP TGKPA++F IHGLWP   +GS+P NC+PN+ +++S++
Sbjct  28   FFYFVQQWPGSYCDTSQGCCYPPTGKPASDFGIHGLWPNNNDGSYPSNCDPNNPFNQSEV  87

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L+  +++ WP+L+CPS++G  FW HEW+KHGTC  S+ D+  YF++ LN+K++ N LQ
Sbjct  88   SDLMSSLETNWPSLACPSSDGISFWTHEWDKHGTCSESVLDEHDYFQAALNLKNKTNLLQ  147

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL +AGI P+G  Y +  I  AI    G TP IECN D S  +QLYQ+Y+CVD +G ++I
Sbjct  148  ALASAGINPNGESYNLSDIINAINQSDGFTPSIECNDDESGNNQLYQVYMCVDTSGSNLI  207

Query  236  EC  231
            EC
Sbjct  208  EC  209



>emb|CDP00337.1| unnamed protein product [Coffea canephora]
Length=225

 Score =   229 bits (585),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 143/191 (75%), Gaps = 5/191 (3%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKK-GCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESK  594
            F++ V+ WPGSYCDTK+  CCY + GKP T+F+IHGLWP + N S P++CN  + ++++K
Sbjct  28   FFFVVQMWPGSYCDTKRVSCCYRAAGKP-TDFTIHGLWPHFNNNSIPQDCNRKNPFNKAK  86

Query  593  ISYLIERMQSEWPTLSCPSNNGS-KFWKHEWEKHGTCS--IFDQCAYFESTLNIKDRVNF  423
            +S L  +++  WPT  C   + S KFW HEW KHGTCS  + DQ AYF++ LNIKD+VN 
Sbjct  87   VSDLTTKLEKTWPTFKCGRKSSSAKFWSHEWTKHGTCSEDVLDQHAYFKAALNIKDKVNL  146

Query  422  LQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKD  243
            L+ L+NAGI+PDG FY+++ IKEAIKAG G  P+IECN+DAS   QLYQ+Y+CVD  G  
Sbjct  147  LEILKNAGIQPDGKFYKLDDIKEAIKAGTGYNPVIECNTDASGNIQLYQVYLCVDSAGSS  206

Query  242  IIECPTTVQRN  210
            +IECP T++R+
Sbjct  207  LIECPVTLKRD  217



>gb|EMS55779.1| Ribonuclease 3 [Triticum urartu]
Length=254

 Score =   230 bits (586),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 133/183 (73%), Gaps = 2/183 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y V QWPGSYCDTK+ CCYP +GKPA +F IHGLWP   +GS+P+NCNP+S +D SK+
Sbjct  55   FFYLVLQWPGSYCDTKQSCCYPRSGKPAADFGIHGLWPNRDDGSYPQNCNPDSTFDPSKV  114

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCS--IFDQCAYFESTLNIKDRVNFLQ  417
            S ++  ++S WPTL+CP+N+G +FW HEWEKHGTC+  +F++  YF++ L ++ ++  L 
Sbjct  115  SDILSSLRSSWPTLACPTNDGLRFWAHEWEKHGTCAQNLFNEHGYFQAALRLRGQLRVLD  174

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL  AGI PDG +Y + AIK AI+ G G  P ++CN D S  SQL+Q+Y CV  +    +
Sbjct  175  ALATAGISPDGGYYTMGAIKGAIQEGTGFAPHVDCNRDESGNSQLFQLYFCVHADASRFV  234

Query  236  ECP  228
            ECP
Sbjct  235  ECP  237



>dbj|BAN14352.1| S-like ribonuclease [Cephalotus follicularis]
Length=227

 Score =   229 bits (583),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 137/182 (75%), Gaps = 2/182 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDT +GCCYP TGKPA++F IHGLWP   +GS+P NC+PN+ +++S++
Sbjct  28   FFYFVQQWPGSYCDTSQGCCYPPTGKPASDFGIHGLWPNNNDGSYPSNCDPNNPFNQSEV  87

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S L+  +++ WP+L+CPS++G  FW HEW+KHGTC  S+ D+  YF++ LN+K + N LQ
Sbjct  88   SDLMSSLETNWPSLACPSSDGISFWTHEWDKHGTCSESVLDEHDYFQAALNLKSKTNLLQ  147

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL +AGI P+G  Y +  I  AI    G TP IECN D S  +QLYQ+Y+CVD +G ++I
Sbjct  148  ALASAGINPNGESYNLSDIINAINQSDGFTPSIECNDDESGNNQLYQVYMCVDTSGSNLI  207

Query  236  EC  231
            EC
Sbjct  208  EC  209



>ref|XP_006659433.1| PREDICTED: extracellular ribonuclease LE-like [Oryza brachyantha]
Length=239

 Score =   229 bits (583),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 134/186 (72%), Gaps = 3/186 (2%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F++ V QWPGSYCDT++ CCYP +GKP  +F IHGLWP   +GS+P+NC+P+S +D SK+
Sbjct  38   FFFLVLQWPGSYCDTRQSCCYPRSGKPPADFGIHGLWPNRDDGSYPQNCDPDSEFDPSKV  97

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC---SIFDQCAYFESTLNIKDRVNFL  420
            S L+  ++SEWPTL+CPSN+G +FW HEWEKHGTC   ++ D+  YF++ L ++ ++  L
Sbjct  98   SDLMGSLRSEWPTLACPSNDGVRFWSHEWEKHGTCAESALGDERGYFQAALRLRSQLPVL  157

Query  419  QALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDI  240
             AL + G+ PDG +Y +  IK AI+ G G+ P +ECN D S  +QLYQ+Y CVD  G   
Sbjct  158  AALRDGGVSPDGGYYTLAQIKGAIQRGTGLQPFVECNRDESGNTQLYQLYFCVDAAGDRF  217

Query  239  IECPTT  222
            I+CP +
Sbjct  218  IDCPVS  223



>gb|KCW64954.1| hypothetical protein EUGRSUZ_G02498, partial [Eucalyptus grandis]
Length=191

 Score =   227 bits (578),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 140/187 (75%), Gaps = 3/187 (2%)
 Frame = -2

Query  749  WPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKISYLIERM  570
            WPGSYCDT++ CCYP+TGKPA +F IHGLWP + +GS+P NC+ +S ++ S++S L   M
Sbjct  1    WPGSYCDTQQSCCYPTTGKPAADFGIHGLWPNYNDGSYPSNCDSSSPFNPSEVSDLKSSM  60

Query  569  QSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQALENAGI  396
            Q+ WPTL+CPS +G +FW HEWEKHGTC  SI DQ AYFES L++K + N LQAL++AGI
Sbjct  61   QNSWPTLACPSGDGEQFWSHEWEKHGTCSESILDQHAYFESALSLKQKANLLQALKSAGI  120

Query  395  KPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDIIECPTTVQ  216
             P G+ Y +++IK+AI    G TP IECN D+S   Q+YQIY+CVD +G ++IECP   +
Sbjct  121  TPGGS-YSLKSIKDAITEAAGYTPWIECNKDSSGNYQIYQIYLCVDTSGSNLIECPVFPK  179

Query  215  RNCNTTV  195
              C++ +
Sbjct  180  GACSSEI  186



>pdb|1VCZ|A Chain A, Crystal Structure Of The Rnase Nt In Complex With 5'-Gmp
 pdb|1VD1|A Chain A, Crystal Structure Of Rnase Nt In Complex With 5'-Amp
 pdb|1VD3|A Chain A, Ribonuclease Nt In Complex With 2'-ump
Length=217

 Score =   227 bits (578),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 100/194 (52%), Positives = 137/194 (71%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWP SYCDT++ CCYP+TGKP  +FSIHGLWP + NG WP+NC+  S  DES+I
Sbjct  10   FFYFVQQWPASYCDTRRSCCYPTTGKPDEDFSIHGLWPNYENGKWPQNCDRESSLDESEI  69

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCSIFDQCAYFESTLNIKDRVNFLQAL  411
            S LI  M+  WP+L+CPS++G +FW HEW KHGTCS   + AYF++ L+ + + N L+ L
Sbjct  70   SDLISTMEKNWPSLACPSSDGVRFWSHEWLKHGTCSALGERAYFQAALDFRKKSNLLENL  129

Query  410  ENAGIKP-DGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDIIE  234
            +NA I P +G  Y +E+IK+AI+ GVG +P IECN D     Q+YQ+Y+CVD    D I+
Sbjct  130  KNAEITPRNGEHYTLESIKKAIEEGVGHSPYIECNVDTQGNHQIYQVYLCVDKTATDFID  189

Query  233  CPTTVQ-RNCNTTV  195
            CP     R C + +
Sbjct  190  CPIFPHGRGCGSKI  203



>gb|EYU28761.1| hypothetical protein MIMGU_mgv1a012841mg [Erythranthe guttata]
Length=238

 Score =   227 bits (579),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 134/189 (71%), Gaps = 2/189 (1%)
 Frame = -2

Query  758  VEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKISYLI  579
            V+QWPGSYCDT++ CCYP+TGKP  +FSIHGLWP +  G WP+NC   S  D S+IS L+
Sbjct  35   VQQWPGSYCDTRQSCCYPTTGKPDEDFSIHGLWPNYNTGKWPQNCGSQSSLDRSEISDLM  94

Query  578  ERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCSIFDQCAYFESTLNIKDRVNFLQALENAG  399
             RM  +WPTL+CP+ +G KFW HEW+KHGTC+ FDQ  YF+  L++K++ N LQ L  +G
Sbjct  95   SRMHKDWPTLACPTADGMKFWGHEWDKHGTCTSFDQHTYFQFALDLKNKANLLQVLAKSG  154

Query  398  IKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDIIECPTTV  219
            I+P GNFY +E+IK+AI+ GVG  P I+CN D+    Q++Q+Y+CVD +    I CP   
Sbjct  155  IRP-GNFYGLESIKQAIQEGVGYEPYIDCNVDSEGNHQVFQVYLCVDKSATKFIRCPILP  213

Query  218  Q-RNCNTTV  195
              R C + +
Sbjct  214  HGRACGSRI  222



>dbj|BAA84469.1| RNase NGR3 [Nicotiana glutinosa]
 dbj|BAC77611.1| ribonuclease NGR3 [Nicotiana glutinosa]
Length=236

 Score =   227 bits (579),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 100/194 (52%), Positives = 137/194 (71%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWP SYCDT++ CCYP+TGKP  +FSIHGLWP + NG WP+NC+  S  DES+I
Sbjct  29   FFYFVQQWPASYCDTRRSCCYPTTGKPDEDFSIHGLWPNYENGKWPQNCDRESSLDESEI  88

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCSIFDQCAYFESTLNIKDRVNFLQAL  411
            S LI  M+  WP+L+CPS++G +FW HEW KHGTCS   + AYF++ L+ + + N L+ L
Sbjct  89   SDLISTMEKNWPSLACPSSDGVRFWSHEWLKHGTCSALGERAYFQAALDFRKKSNLLENL  148

Query  410  ENAGIKP-DGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDIIE  234
            +NA I P +G  Y +E+IK+AI+ GVG +P IECN D     Q+YQ+Y+CVD    D I+
Sbjct  149  KNAEITPRNGEHYTLESIKKAIEEGVGHSPYIECNVDTQGNHQIYQVYLCVDKTATDFID  208

Query  233  CPTTVQ-RNCNTTV  195
            CP     R C + +
Sbjct  209  CPIFPHGRGCGSKI  222



>emb|CDY03023.1| BnaC07g22040D [Brassica napus]
Length=229

 Score =   227 bits (578),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 142/203 (70%), Gaps = 3/203 (1%)
 Frame = -2

Query  794  AADHNSDL-FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNP  618
            AA  + D  F+Y+V+QWPGSYCDT++ CC+P++GKPA +F IHGLWP + +G++P NC+ 
Sbjct  22   AASSSEDFDFFYFVQQWPGSYCDTQRSCCFPTSGKPAADFGIHGLWPNYKDGTYPSNCDN  81

Query  617  NSLYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCS--IFDQCAYFESTLN  444
               +D S IS LI  MQ  WPTL+CPS +G  FW+HEWEKHGTCS  + DQ  YF++ LN
Sbjct  82   TKPFDSSSISDLISSMQKSWPTLACPSGSGETFWEHEWEKHGTCSEAVIDQHEYFQTALN  141

Query  443  IKDRVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYIC  264
            +K + + L AL  AGI PDG  Y +E+I+++IK   G TP I+CN+D S  SQLYQ+Y+C
Sbjct  142  LKQKTDLLGALTKAGINPDGKSYSLESIRDSIKESTGFTPWIQCNTDGSGNSQLYQVYLC  201

Query  263  VDLNGKDIIECPTTVQRNCNTTV  195
            VD +G  +IECP      C   +
Sbjct  202  VDRSGSGLIECPVFPHGKCGVEI  224



>ref|XP_009152222.1| PREDICTED: ribonuclease 1-like [Brassica rapa]
 emb|CDY45186.1| BnaA06g33900D [Brassica napus]
Length=229

 Score =   227 bits (578),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 143/203 (70%), Gaps = 3/203 (1%)
 Frame = -2

Query  794  AADHNSDL-FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNP  618
            AA  + D  F+Y+V+QWPGSYCDT++ CC+P++GKPA +F IHGLWP + +G++P NC+ 
Sbjct  22   AASSSEDFDFFYFVQQWPGSYCDTQRSCCFPTSGKPAADFGIHGLWPNYKDGTYPSNCDN  81

Query  617  NSLYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLN  444
               +D S IS LI  MQ  WPTL+CPS +G  FW+HEWEKHGTC  S+ DQ  YF++ LN
Sbjct  82   TKPFDSSSISDLISSMQKSWPTLACPSGSGETFWEHEWEKHGTCSESVIDQHEYFQTALN  141

Query  443  IKDRVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYIC  264
            +K + + L AL  AGI PDG  Y +E+I+++IK   G TP I+CN+D S  SQLYQ+Y+C
Sbjct  142  LKQKADLLGALTKAGINPDGKSYSIESIRDSIKESTGFTPWIQCNTDESGNSQLYQVYLC  201

Query  263  VDLNGKDIIECPTTVQRNCNTTV  195
            VD +G  +IECP   +  C   +
Sbjct  202  VDRSGSGLIECPVFPRGKCGDEI  224



>ref|XP_010108673.1| Ribonuclease 3 [Morus notabilis]
 gb|EXC19984.1| Ribonuclease 3 [Morus notabilis]
Length=206

 Score =   225 bits (574),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 139/195 (71%), Gaps = 3/195 (2%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKK-GCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESK  594
            + +   QWPG+YCDTK   CCYP TGKP   FSIHGLWP   +GSWP NCNP+S++D  +
Sbjct  7    YMHAYTQWPGAYCDTKHHSCCYPKTGKPTAEFSIHGLWPNHKDGSWPSNCNPDSVFDRLE  66

Query  593  ISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFL  420
            IS L+  +Q  WP+LSCPS+NG +FW HEWEKHGTC  S  +Q  YF + L +K++VN L
Sbjct  67   ISDLMGSLQKNWPSLSCPSSNGFRFWSHEWEKHGTCSESELNQHDYFATALKLKEKVNLL  126

Query  419  QALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDI  240
            + L+NA I+PD  FY +++I +AI+A     P +ECN D++  SQLYQ+Y+CVD +G +I
Sbjct  127  KILKNAEIEPDDGFYSLDSIVKAIEAVTSHAPGMECNKDSAGNSQLYQVYLCVDTSGSEI  186

Query  239  IECPTTVQRNCNTTV  195
            IECP   +  C+++V
Sbjct  187  IECPILPRGRCDSSV  201



>dbj|BAE16663.1| ribonuclease [Drosera adelae]
 dbj|BAE44977.1| ribonuclease [Drosera adelae]
Length=227

 Score =   225 bits (573),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 140/194 (72%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPG+YCDT +GCC P++GKP ++F IHGLWP + +G +P NC+ ++ +D S+I
Sbjct  29   FFYFVQQWPGAYCDTSRGCCNPTSGKPPSDFGIHGLWPNYNSGGYPSNCDSSNPFDPSQI  88

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
              L+ ++Q++WP+L+CPS++G+ FW HEW KHGTC  S+  + AYF + LN+K + N L 
Sbjct  89   QDLLSQLQTQWPSLTCPSSDGTSFWTHEWNKHGTCSESVLTEHAYFAAALNLKSQANTLA  148

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            +L NAGI P+ +FY +  +  AIK G G    ++CN+D +  SQLYQIYICVD  G + I
Sbjct  149  SLTNAGITPNNSFYNLSDVLAAIKQGTGHDAYVQCNTDENGNSQLYQIYICVDTTGANFI  208

Query  236  ECPTTVQRNCNTTV  195
            ECP    +NC +++
Sbjct  209  ECPVAPNQNCPSSI  222



>dbj|BAJ96489.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=230

 Score =   225 bits (573),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 134/184 (73%), Gaps = 2/184 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y V QWPGSYCDTK+ CCYP +GKPA +F IHGLWP   +GS+P+NCNP+S +D SK+
Sbjct  31   FFYLVLQWPGSYCDTKQSCCYPRSGKPAADFGIHGLWPNREDGSYPQNCNPDSAFDPSKV  90

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCS--IFDQCAYFESTLNIKDRVNFLQ  417
            S L+  ++S WPTL+CP+N+G +FW HEWEKHGTC+  +FD+  YF++ L ++D++  L 
Sbjct  91   SDLLSSLRSSWPTLACPTNDGLRFWAHEWEKHGTCAQNLFDEHGYFQTALRLRDQLRVLD  150

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL  AGI PDG +Y + AIK AI+ G G  P ++CN D S  SQL+Q+Y CV  +    +
Sbjct  151  ALATAGISPDGGYYTLGAIKGAIQEGTGFAPHVDCNRDESGNSQLFQLYFCVHADASRFV  210

Query  236  ECPT  225
            +CP 
Sbjct  211  DCPV  214



>emb|CDP00338.1| unnamed protein product [Coffea canephora]
Length=210

 Score =   224 bits (570),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 138/194 (71%), Gaps = 21/194 (11%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F ++V+ WPG+YCDTK+ CCYP+ GKP T+F+IH LWP + N ++PE+CNPNS Y+E+K 
Sbjct  28   FLFFVQMWPGAYCDTKRTCCYPAAGKP-TDFTIHRLWPVFNNVTFPEDCNPNSHYNETKK  86

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCS--IFDQCAYFESTLNIKDRVNFLQ  417
            S                    +KFW HEW KHGTC+  + DQ  YF + L+IKD+VN LQ
Sbjct  87   S------------------TTTKFWTHEWTKHGTCALPVLDQHGYFAAALSIKDKVNILQ  128

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L+NAGI+PDG  Y+++ IKEAIKAG G  P+IECN++AS   QLYQ+Y+CVD  G D+I
Sbjct  129  VLKNAGIQPDGTLYKLDDIKEAIKAGTGYIPVIECNTNASGNIQLYQVYLCVDAAGSDLI  188

Query  236  ECPTTVQRNCNTTV  195
            ECP T++R CNT+V
Sbjct  189  ECPVTLKRACNTSV  202



>dbj|BAO05319.1| S-like ribonuclease [Aldrovanda vesiculosa]
Length=228

 Score =   223 bits (567),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 95/194 (49%), Positives = 139/194 (72%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QW GSYCDT   CCYP+ G+P  +F IHGLWP + +GS+P NC+ ++ +D S+I
Sbjct  27   FFYFVQQWSGSYCDTSSSCCYPTYGQPPADFGIHGLWPNYNSGSYPSNCDSSNPFDPSQI  86

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
              L+ +MQ+EWP+LSCPS++G+ FW HEW+KHGTC  S+ ++ +YF + L++K+  N LQ
Sbjct  87   QDLLSQMQTEWPSLSCPSSDGTSFWSHEWDKHGTCSESVLNEHSYFAAALSLKNSTNLLQ  146

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L NAGI P+GN Y +  I  AIK G+     I+CN+D +  SQ++Q+YICVD  G++II
Sbjct  147  TLANAGITPNGNSYNLSDILAAIKQGIRYDAAIQCNTDQNGNSQIFQVYICVDTTGQNII  206

Query  236  ECPTTVQRNCNTTV  195
            ECP      C +++
Sbjct  207  ECPVYPTNKCPSSI  220



>gb|AAB58719.1| ribonuclease [Hordeum vulgare subsp. vulgare]
Length=227

 Score =   221 bits (564),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 132/195 (68%), Gaps = 4/195 (2%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y V QWPGSYCDTKK CCYP TGKPA +F IHGLWP   +GS+P+NCNP + +D SK+
Sbjct  29   FFYLVLQWPGSYCDTKKSCCYPRTGKPAADFGIHGLWPNRDDGSYPQNCNPANAFDPSKV  88

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCS--IFDQCAYFESTLNIKDRVNFLQ  417
            S L+  +++EWPTL+CP+++G +FW HEWEKHGTC+  +F +  YF++    +     L 
Sbjct  89   SDLLSSLRAEWPTLACPASDGLQFWAHEWEKHGTCAQNLFHEHGYFQTAAPPRP-APLLD  147

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL +AG+ PDG +Y + A+K AI+ G G  P +ECN D S  SQLYQ+Y CVD      +
Sbjct  148  ALASAGVAPDGGYYTLSAVKGAIQQGTGFEPFVECNRDESGNSQLYQLYFCVDARASGFV  207

Query  236  ECPTTV-QRNCNTTV  195
            ECP     R C   +
Sbjct  208  ECPVQPGGRPCGDRI  222



>ref|NP_001237086.1| uncharacterized protein LOC100527255 [Glycine max]
 gb|ACU16312.1| unknown [Glycine max]
 gb|KHN07841.1| Extracellular ribonuclease LE [Glycine soja]
Length=238

 Score =   221 bits (562),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 136/199 (68%), Gaps = 13/199 (7%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCN-PNSLYDESK  594
            F+Y+V+QWPGS+CDTKK CC+P TGKP +NFSIHGLWP + NGS+P NCN   + +++SK
Sbjct  28   FFYFVQQWPGSFCDTKKSCCFPLTGKPVSNFSIHGLWPNFSNGSFPSNCNIAENPFNQSK  87

Query  593  ISYLIERMQSEWPTLSCP----------SNNGSKFWKHEWEKHGTCS--IFDQCAYFEST  450
            I+ LI R +  W +LSC           S++ ++FWKHEW+KHGTCS  I DQ AYFE+T
Sbjct  88   ITDLIPRAEKGWASLSCAGSKKTENNKTSSDNTRFWKHEWDKHGTCSDLILDQHAYFEAT  147

Query  449  LNIKDRVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIY  270
            LN+KDRV+ LQ L+  GIKPDGN Y +  I +AI   +G+ P I CN+D S   QL +IY
Sbjct  148  LNLKDRVDLLQILQYNGIKPDGNLYSIVNITKAITQAIGLEPGITCNTDPSGNRQLNEIY  207

Query  269  ICVDLNGKDIIECPTTVQR  213
            +C D      IECP    R
Sbjct  208  LCADKYASSFIECPILPSR  226



>dbj|BAJ99985.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=250

 Score =   219 bits (559),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 128/168 (76%), Gaps = 2/168 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y V QWPGSYCDTKK CCYP TGKPA +F IHGLWP   +GS+P+NCNP + +D SK+
Sbjct  30   FFYLVLQWPGSYCDTKKSCCYPRTGKPAADFGIHGLWPNRDDGSYPQNCNPANAFDPSKV  89

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCS--IFDQCAYFESTLNIKDRVNFLQ  417
            S L+  +++EWPTL+CP+++G +FW HEWEKHGTC+  +F++  YF++ L+++D++  L 
Sbjct  90   SDLLSSLRAEWPTLACPASDGLQFWAHEWEKHGTCAQNLFNEHGYFQTALHLRDQLRVLD  149

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQI  273
            AL +AG+ PDG +Y + AIK AI+ G G  P +ECN D S  SQLYQ+
Sbjct  150  ALASAGVAPDGGYYTLSAIKGAIQQGTGFEPFVECNRDESGNSQLYQL  197



>emb|CAB40354.1| ribonuclease T2 [Solanum lycopersicum]
Length=198

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 127/168 (76%), Gaps = 3/168 (2%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDTK+ CCYP+TGKPA +F IHGLWP   +G++P NC+PNS YD+S+I
Sbjct  31   FFYFVQQWPGSYCDTKQSCCYPTTGKPAADFGIHGLWPNNNDGTYPSNCDPNSPYDQSQI  90

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCS---IFDQCAYFESTLNIKDRVNFL  420
            S LI  MQ  WPTL+CPS +GS FW HEWEKHGTC+   + +Q AYF+  L++K++++ L
Sbjct  91   SDLISSMQQNWPTLACPSGSGSTFWSHEWEKHGTCAESVLTNQHAYFKKALDLKNQIDLL  150

Query  419  QALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQ  276
              L+ A I PDG  Y++  I+ AIK+ +G TP I+CN D S  SQLYQ
Sbjct  151  SILQGADIHPDGESYDLVNIRNAIKSAIGYTPWIQCNVDQSGNSQLYQ  198



>ref|XP_010480471.1| PREDICTED: ribonuclease 3-like [Camelina sativa]
Length=198

 Score =   215 bits (548),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 119/161 (74%), Gaps = 2/161 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V QWPG+YCDTK  CCYP++GKPA +F IHGLWP + + SWP NC+P+S +D S+I
Sbjct  30   FFYFVVQWPGAYCDTKSSCCYPTSGKPAADFGIHGLWPNYNSSSWPSNCDPDSKFDRSQI  89

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
              L+  M+  WPTLSCPSN G KFWKHEWEKHGTC  S+ DQ  YFE+ L +KD+ N LQ
Sbjct  90   EDLLSSMKKNWPTLSCPSNEGFKFWKHEWEKHGTCAESVMDQHEYFEAALKLKDKANLLQ  149

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASK  294
             L NA I PD  FY+++ I +AIK G+G TP ++CN D  +
Sbjct  150  TLTNAEINPDDGFYDLKKITKAIKDGIGFTPGLQCNKDRER  190



>gb|EMT12880.1| Ribonuclease 1 [Aegilops tauschii]
Length=231

 Score =   214 bits (546),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 130/198 (66%), Gaps = 6/198 (3%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y V QWPGSYCDTK+ CCYP +GKPA +F IHGLWP   +GS+P+NCNP + +D SK+
Sbjct  29   FFYLVLQWPGSYCDTKQSCCYPRSGKPAADFGIHGLWPNRDDGSYPQNCNPANAFDPSKV  88

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCS--IFDQCAYFESTLNIKDRVNFLQ  417
            S L+  ++ EWPTL+CP+++G +FW HEWEKHGTC+  +F++  YF++ L+++D++  L 
Sbjct  89   SDLLSSLRREWPTLACPTSDGLQFWAHEWEKHGTCAQNLFNEHGYFQTALHLRDQLRVLD  148

Query  416  ALENAGIKPDGNFYEVE---AIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGK  246
            AL +AG+ P       E       A   G G  P +ECN D S  SQLYQ+Y CVD N  
Sbjct  149  ALTSAGVSPGRRLLHAERHQGRHPAGDRGTGFEPFVECNRDESGNSQLYQLYFCVDANAS  208

Query  245  DIIECPTTV-QRNCNTTV  195
              +ECP     R C   V
Sbjct  209  GFVECPVQPGGRPCGNRV  226



>ref|XP_004490067.1| PREDICTED: ribonuclease 1-like [Cicer arietinum]
Length=229

 Score =   214 bits (546),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 129/190 (68%), Gaps = 2/190 (1%)
 Frame = -2

Query  758  VEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKISYLI  579
            V+QWPGS+C  KKGCCYP+TGKP  +F IHGLWP + +GS P NC+P+  +D+S+IS L 
Sbjct  35   VQQWPGSFCGFKKGCCYPTTGKPDADFGIHGLWPKYNDGSSPSNCDPSKQFDQSQISGLT  94

Query  578  ERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQALEN  405
              +Q  WPTL+CPS +G   W HEWEKHGTC  S+ +Q  YFE+TL +K + N L+AL +
Sbjct  95   SSLQKNWPTLACPSGDGITLWTHEWEKHGTCSQSVLNQHDYFETTLKLKQKANLLKALTS  154

Query  404  AGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDIIECPT  225
            AGI  DG  Y +  I  AI+  VG  P I+C+  +S  SQLYQ+ +CVD +G D I+CP 
Sbjct  155  AGINADGGSYHLSNITTAIQDEVGFAPFIQCSVGSSGNSQLYQVLLCVDKSGSDFIDCPI  214

Query  224  TVQRNCNTTV  195
                 C++ +
Sbjct  215  FPYGRCDSKI  224



>ref|XP_002965999.1| hypothetical protein SELMODRAFT_270532 [Selaginella moellendorffii]
 ref|XP_002989227.1| hypothetical protein SELMODRAFT_184437 [Selaginella moellendorffii]
 gb|EFJ09665.1| hypothetical protein SELMODRAFT_184437 [Selaginella moellendorffii]
 gb|EFJ33419.1| hypothetical protein SELMODRAFT_270532 [Selaginella moellendorffii]
Length=238

 Score =   211 bits (537),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 136/193 (70%), Gaps = 1/193 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDT-KKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESK  594
            F+Y+V QWPG+YCD  +  CCYP+TGKPA +FSIHGLWP   +G+WP+ C+P++ ++ S+
Sbjct  26   FFYFVLQWPGAYCDRGQAACCYPTTGKPAEDFSIHGLWPNKDDGTWPQFCDPSNPFELSQ  85

Query  593  ISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCSIFDQCAYFESTLNIKDRVNFLQA  414
            IS L   M  EW +L CPS+N  +FW+HEWEKHGTC+  D+  YFE +L ++++V+ L  
Sbjct  86   ISDLRRAMNREWGSLDCPSSNSVEFWEHEWEKHGTCAFRDEHQYFERSLALREQVDPLGY  145

Query  413  LENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDIIE  234
            L +AGI+P+   Y +++I+ A++ G+G T  IECN D+S+ +QLYQ+Y CV  +   II+
Sbjct  146  LASAGIRPNNRLYSLQSIQLALEDGLGHTIGIECNRDSSRTAQLYQLYFCVASDASTIID  205

Query  233  CPTTVQRNCNTTV  195
            CP      C T V
Sbjct  206  CPVFPNSKCTTQV  218



>gb|ACV83770.1| RNase Phy1, partial [Petunia x hybrida]
Length=165

 Score =   208 bits (529),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 119/153 (78%), Gaps = 2/153 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDTK+ CCYP+TGKP+++F IHGLWP   +GS+P NC+P+S YD+S++
Sbjct  13   FFYFVQQWPGSYCDTKQSCCYPTTGKPSSDFGIHGLWPNNNDGSYPSNCDPSSPYDQSQV  72

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S LI RMQ  WPTL+CPS +GS FW HEW KHGTC  SIF+Q  YF+  L++K++++ L 
Sbjct  73   SDLISRMQQNWPTLACPSGSGSTFWSHEWNKHGTCAESIFNQHGYFKKALDLKNQIDLLG  132

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLI  318
             L+ AGI PDG FY + +IK AI++  G TP I
Sbjct  133  ILQGAGINPDGGFYSLSSIKSAIRSATGFTPGI  165



>emb|CAJ77498.1| putative ribonuclease T2 precursor [Solanum tuberosum]
Length=182

 Score =   206 bits (523),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/211 (47%), Positives = 134/211 (64%), Gaps = 32/211 (15%)
 Frame = -2

Query  944  ENMKSILIGLVILQCTISIYAAHSQSFLYYAEQVVEEEEPFVTAFAEDDAAADHNSDLFY  765
            ++ KS+LI ++++QC + +  A                            A D +   F+
Sbjct  3    KSQKSLLIKIIVVQCLLVLCVA----------------------------AQDFD---FF  31

Query  764  YYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKISY  585
            Y+V+QWP SYCDT++ CCYP+TGKP  +FSIHGLWP + NG WP+NC+  S  DES+ S 
Sbjct  32   YFVQQWPASYCDTRRSCCYPTTGKPDEDFSIHGLWPNYENGKWPQNCDKESSLDESEFSD  91

Query  584  LIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCSIFDQCAYFESTLNIKDRVNFLQALEN  405
            LI  M+  WP+L+CPS++G KFW HEW KHGTCS  +Q AYF++ L+ K + N LQ L N
Sbjct  92   LISTMEKNWPSLACPSSDGLKFWSHEWLKHGTCSALNQHAYFQTALDFKTKSNLLQNLNN  151

Query  404  AGIKP-DGNFYEVEAIKEAIKAGVGVTPLIE  315
            AGIKP +G  Y VE+IK AI+ GVG TP IE
Sbjct  152  AGIKPRNGEHYSVESIKNAIEEGVGHTPFIE  182



>ref|XP_003613797.1| LCR-like protein [Medicago truncatula]
 gb|AES96755.1| ribonuclease T2 family protein [Medicago truncatula]
Length=228

 Score =   207 bits (526),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/194 (49%), Positives = 135/194 (70%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+++QWPG+ CD+K+ CC+P TGKP  +F+I GL P + +GS P NCN  S++D+SKI
Sbjct  30   FFYFIQQWPGAICDSKQSCCFPKTGKPTADFTIAGLRPNFNDGSSPSNCNIKSVFDKSKI  89

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S LI+ +++ WP+LSCPS NG + W HEW KHGTC  S   Q  YF++ L +K + N LQ
Sbjct  90   SDLIKGLENNWPSLSCPSGNGIRLWSHEWMKHGTCSESKLTQHDYFQTALKLKKKSNLLQ  149

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L+NAGI+PD  FY    I +AI+   G +P IECN D+++ SQLYQ+Y+C D++G   I
Sbjct  150  ILKNAGIEPDNKFYNTGNILDAIQQATGYSPGIECNRDSARNSQLYQVYMCADISGSKFI  209

Query  236  ECPTTVQRNCNTTV  195
            ECP     +C+  V
Sbjct  210  ECPGLPMGSCDANV  223



>gb|KFK43663.1| hypothetical protein AALP_AA1G156800 [Arabis alpina]
Length=245

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/206 (46%), Positives = 137/206 (67%), Gaps = 9/206 (4%)
 Frame = -2

Query  797  AAADHNSDLFYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNP  618
            A  D N   F+Y+V  WPG+ CD++KGCC P+     ++F IHGLWP ++NG+WP  C+ 
Sbjct  23   AGPDFN---FFYWVTYWPGAICDSQKGCCPPTKCNTESDFMIHGLWPQFINGTWPAFCDQ  79

Query  617  NSLYDESKISYLIERMQ---SEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFES  453
            ++L+D SK+S L+ +M+   +EW   +CPSN  +K W+HEW+KHGTC  S+FDQ +YF++
Sbjct  80   SNLFDISKVSDLVSKMEKKWTEWGVYTCPSNE-TKLWEHEWDKHGTCVQSVFDQHSYFQT  138

Query  452  TLNIKDRVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQI  273
            +L  + R N L  L   GIKP+G FY ++ IK AIK  +G  P IECN D     QL+QI
Sbjct  139  SLKFRQRFNLLDILRQKGIKPNGEFYGLDEIKNAIKCVIGFAPGIECNEDVEGKKQLFQI  198

Query  272  YICVDLNGKDIIECPTTVQRNCNTTV  195
            YIC+D + K+ +ECP    ++C + +
Sbjct  199  YICLDNHAKEFVECPYVPDKSCASKI  224



>emb|CDY33763.1| BnaA09g45690D [Brassica napus]
Length=244

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 128/193 (66%), Gaps = 6/193 (3%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V  WPG+ CD++KGCC P  G  A++F IHGLWP + NG+WP  C+  +L+D SK+
Sbjct  28   FFYWVTYWPGAICDSQKGCCPPPKGNTASDFMIHGLWPQFNNGTWPAFCDQTNLFDISKV  87

Query  590  SYLIERMQ---SEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVN  426
            S L+ +M+   +EW   +CPSN  +K W+HEW KHGTC  S+FDQ +YF + L  + ++N
Sbjct  88   SDLVNKMEKKWTEWGVWACPSNE-TKLWEHEWNKHGTCVQSVFDQHSYFLTNLRFRQKLN  146

Query  425  FLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGK  246
             L  L+  GIKPDG  Y ++ IK AIK  +G  P IECN D     QL+QIYIC+D   K
Sbjct  147  LLNILKQKGIKPDGGLYGLDEIKNAIKCAIGYAPGIECNEDVKGTKQLFQIYICLDNYAK  206

Query  245  DIIECPTTVQRNC  207
            + +ECP    ++C
Sbjct  207  EFVECPYVPDKSC  219



>ref|XP_009117927.1| PREDICTED: ribonuclease 1 [Brassica rapa]
Length=244

 Score =   202 bits (513),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 128/193 (66%), Gaps = 6/193 (3%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V  WPG+ CD++KGCC P  G  A++F IHGLWP + NG+WP  C+  +L+D SK+
Sbjct  28   FFYWVTYWPGAICDSQKGCCPPPKGNTASDFMIHGLWPQFNNGTWPAFCDQTNLFDISKV  87

Query  590  SYLIERMQ---SEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVN  426
            S L+ +M+   +EW   +CPSN  +K W+HEW KHGTC  S+FDQ +YF + L  + ++N
Sbjct  88   SDLVNKMEKKWTEWGVWACPSNE-TKLWEHEWNKHGTCVQSVFDQHSYFLTNLRFRQKLN  146

Query  425  FLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGK  246
             L  L+  GIKPDG  Y ++ IK AIK  +G  P IECN D     QL+QIYIC+D   K
Sbjct  147  LLNILKQKGIKPDGGLYGLDEIKNAIKCAIGYAPGIECNEDVKGTKQLFQIYICLDNYAK  206

Query  245  DIIECPTTVQRNC  207
            + +ECP    ++C
Sbjct  207  EFVECPYVPDKSC  219



>ref|XP_011071277.1| PREDICTED: ribonuclease 1-like [Sesamum indicum]
Length=222

 Score =   201 bits (510),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 136/188 (72%), Gaps = 3/188 (2%)
 Frame = -2

Query  749  WPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKISYLIERM  570
            WPGSYCD+K+ CCYP TGKPA++FSIHGLWP + +GS+P NC+P + +D SKIS L  RM
Sbjct  30   WPGSYCDSKQSCCYPKTGKPASDFSIHGLWPNYNDGSYPSNCDPENQFDPSKISDLSRRM  89

Query  569  QSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQALENAGI  396
            Q++WP+L+CPS++   FW HEW+KHGTC  S+  Q  YF + LN+K ++N LQ L +AGI
Sbjct  90   QTDWPSLACPSSDSLSFWAHEWDKHGTCSQSVLGQHDYFATALNLKQQLNLLQILGDAGI  149

Query  395  KPDGNFYEVEAIKEAIKAGVGVTPLIECNSD-ASKVSQLYQIYICVDLNGKDIIECPTTV  219
            +P+G  Y + +IK+AIK G G    IECN D  S   QLYQ+Y+C+D +  +II+CP   
Sbjct  150  EPNGGVYSLSSIKDAIKGGSGYEAWIECNMDIQSGNRQLYQVYMCLDASASNIIDCPVLP  209

Query  218  QRNCNTTV  195
               C++T+
Sbjct  210  HGKCSSTI  217



>ref|XP_010476460.1| PREDICTED: ribonuclease 3-like isoform X1 [Camelina sativa]
 ref|XP_010476461.1| PREDICTED: ribonuclease 3-like isoform X2 [Camelina sativa]
Length=250

 Score =   201 bits (511),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 97/207 (47%), Positives = 134/207 (65%), Gaps = 10/207 (5%)
 Frame = -2

Query  797  AAADHNSDLFYYYVEQWPGSYCDTKKGCCYPST-GKPATNFSIHGLWPTWLNGSWPENCN  621
            AA D N   F+Y+V  WPG+ CD++KGCC P T G  + +F IHGLWP ++NG+WP  C+
Sbjct  24   AAPDFN---FFYWVNYWPGAICDSQKGCCPPPTKGNKSPDFMIHGLWPQFINGTWPAFCD  80

Query  620  PNSLYDESKISYLIERMQ---SEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFE  456
              +L+D SKIS L+ +M+   +EW    CPSN  +  W+HEW KHGTC  S+FDQ +YF 
Sbjct  81   QTNLFDISKISDLVSKMERKWTEWGVWVCPSNE-TNLWEHEWNKHGTCVQSVFDQHSYFH  139

Query  455  STLNIKDRVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQ  276
            + L  + ++NFL  L+  GIKP+  FY +  IK AIK  +G  P IECN D     QL+Q
Sbjct  140  TNLKFRQKINFLSILKQKGIKPNDGFYGLNEIKNAIKCAIGFAPGIECNEDVEGNKQLFQ  199

Query  275  IYICVDLNGKDIIECPTTVQRNCNTTV  195
            IYIC+D   K+ +ECP    ++C +T+
Sbjct  200  IYICLDNYTKEFVECPYVPDKSCTSTI  226



>ref|XP_001783305.1| predicted protein [Physcomitrella patens]
 gb|EDQ51915.1| predicted protein [Physcomitrella patens]
Length=268

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/221 (43%), Positives = 140/221 (63%), Gaps = 7/221 (3%)
 Frame = -2

Query  854  AEQVVEEEEPFVTAFAEDDAAADHNSDLFYYYVEQWPGSYCDTKKGCCYPSTGKPATNFS  675
            AEQV    E F  A  + D + D     F ++V+QWPGSYCD+++GCC+P TG+P   F 
Sbjct  23   AEQVPAPSEAFEGARRQKDNSFD-----FLFFVQQWPGSYCDSRQGCCFPVTGEPGPYFG  77

Query  674  IHGLWPTWLNGSWPENCNPNSLYDESKISYLIERMQSEWPTLSCPSNNGSK-FWKHEWEK  498
            IHGLWP   +G++P  C+ N  +D S ++ +I+ +   W TL+C S  G++ FW+HEW K
Sbjct  78   IHGLWPNRDDGTYPATCS-NEAFDPSLLADVIDNLNKNWGTLACNSKRGNEDFWEHEWSK  136

Query  497  HGTCSIFDQCAYFESTLNIKDRVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLI  318
            HGTCS F Q  YF++++++ +  +   AL +AGI PD  FY +  I +A    +G  P I
Sbjct  137  HGTCSGFTQREYFQNSVDLYNDYDITGALRDAGIVPDDRFYSIAEISKAFANLLGFAPEI  196

Query  317  ECNSDASKVSQLYQIYICVDLNGKDIIECPTTVQRNCNTTV  195
            ECN+D     QLYQ+YICV  +GK ++ECP ++++ C  +V
Sbjct  197  ECNTDPKGNRQLYQVYICVAKDGKTLVECPASIRKPCQGSV  237



>ref|XP_008350926.1| PREDICTED: LOW QUALITY PROTEIN: ribonuclease 3-like [Malus domestica]
Length=224

 Score =   199 bits (507),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 131/190 (69%), Gaps = 5/190 (3%)
 Frame = -2

Query  749  WPGSYCD-TKKGCCYPSTGKPATNFSIHGLWPTWLNGSWP--ENCNPNSLYDESKISYLI  579
            WPG+YCD T   CCYP +GKP  +F IHG WP + +G +P   NC+P+S++D+S+IS L+
Sbjct  15   WPGAYCDATNFTCCYPKSGKPTADFGIHGPWPNYKDGGYPXVSNCDPDSVFDKSEISELL  74

Query  578  ERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCSI--FDQCAYFESTLNIKDRVNFLQALEN  405
              +   WP+L CPSN+G  FW HEWEKHGTCS    DQ  YFE+ L +K + N LQ L+ 
Sbjct  75   SSLDKNWPSLKCPSNDGYGFWSHEWEKHGTCSESELDQKEYFEAALKLKKKXNLLQILKK  134

Query  404  AGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDIIECPT  225
            AGI P+  FY +E+I EA+K G G TP IECN+D++  SQLYQ+Y+CV  +G DIIECP 
Sbjct  135  AGIVPNDEFYSIESIVEAMKEGAGYTPGIECNNDSAGNSQLYQVYLCVHTSGXDIIECPL  194

Query  224  TVQRNCNTTV  195
              +  C + V
Sbjct  195  LPKEGCASKV  204



>ref|XP_010458907.1| PREDICTED: ribonuclease 3-like [Camelina sativa]
Length=249

 Score =   199 bits (506),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 96/207 (46%), Positives = 133/207 (64%), Gaps = 10/207 (5%)
 Frame = -2

Query  797  AAADHNSDLFYYYVEQWPGSYCDTKKGCCYPST-GKPATNFSIHGLWPTWLNGSWPENCN  621
            A  D N   F+Y+V  WPG+ CD++KGCC P T G  + +F IHGLWP ++NG+WP  C+
Sbjct  23   APPDFN---FFYWVNYWPGAICDSQKGCCPPPTRGNKSPDFMIHGLWPQFINGTWPAFCD  79

Query  620  PNSLYDESKISYLIERMQ---SEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFE  456
              +L+D SKIS L+ +M+   +EW    CPSN  +  W+HEW KHGTC  S+FDQ +YF 
Sbjct  80   QTNLFDISKISDLVSKMEKKWTEWGVWVCPSNE-TNLWEHEWNKHGTCVQSVFDQHSYFN  138

Query  455  STLNIKDRVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQ  276
            + L  + ++NFL  L+  GIKP+  FY +  IK AIK  +G  P IECN D     QL+Q
Sbjct  139  TNLKFRQKINFLSILKQKGIKPNDGFYGLNEIKNAIKCAIGFAPGIECNEDVEGNKQLFQ  198

Query  275  IYICVDLNGKDIIECPTTVQRNCNTTV  195
            IYIC+D   K+ +ECP    ++C +T+
Sbjct  199  IYICLDNYTKEFVECPYVPDKSCTSTI  225



>ref|XP_003613800.1| LCR-like protein [Medicago truncatula]
 gb|AES96758.1| ribonuclease T2 family protein [Medicago truncatula]
Length=235

 Score =   198 bits (503),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 91/194 (47%), Positives = 126/194 (65%), Gaps = 2/194 (1%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+++QWPG+YCD+ + CCYP T      F+I+GL PT  +GS P NC+ +S++D+SKI
Sbjct  31   FFYFIQQWPGAYCDSNQSCCYPITPILPAEFNIYGLRPTKNDGSTPLNCDIHSVFDKSKI  90

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
            S LIE ++  WP+L CP     K W HEW KHGTC  S   Q  YF++ L +K ++N +Q
Sbjct  91   SDLIENLELNWPSLRCPQLKSIKLWSHEWMKHGTCSESKLTQHDYFQTALKLKKKLNIIQ  150

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             LENAGI+PD  FY+  +I +AI+   G  P I CN D    SQL ++Y+CVD +G + I
Sbjct  151  ILENAGIEPDDKFYDTSSILDAIQQATGFLPGIVCNRDPGLKSQLLKVYMCVDTSGSNFI  210

Query  236  ECPTTVQRNCNTTV  195
            ECP     +C  TV
Sbjct  211  ECPGVPMGSCGDTV  224



>ref|NP_563940.1| ribonuclease T2 family protein [Arabidopsis thaliana]
 gb|AEE29123.1| ribonuclease T2 family protein [Arabidopsis thaliana]
Length=247

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 129/197 (65%), Gaps = 6/197 (3%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V  WPG+ CD++KGCC P+ G  A++F IHGLWP + NG+WP  C+  +L+D SKI
Sbjct  28   FFYWVNYWPGAICDSQKGCCPPTKGNTASDFIIHGLWPQFNNGTWPAFCDQTNLFDISKI  87

Query  590  SYLIERMQ---SEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVN  426
            S L+ +M+   +EW   +CPSN  +  W+HEW KHGTC  SIFDQ +YF + L  K +V+
Sbjct  88   SDLVCQMEKKWTEWGVWACPSNE-TNLWEHEWNKHGTCVQSIFDQHSYFRTNLKFKHKVH  146

Query  425  FLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGK  246
             L  L   GIKP+  FY ++ IK AIK  +G  P IECN D     QL+QIYIC+D   K
Sbjct  147  LLNILIQKGIKPNDGFYSLDEIKNAIKCAIGFAPGIECNEDVKGNKQLFQIYICLDNYAK  206

Query  245  DIIECPTTVQRNCNTTV  195
            + +ECP    ++C + +
Sbjct  207  EFVECPYVPDKSCASKI  223



>ref|XP_006417041.1| hypothetical protein EUTSA_v10008594mg [Eutrema salsugineum]
 gb|ESQ35394.1| hypothetical protein EUTSA_v10008594mg [Eutrema salsugineum]
Length=247

 Score =   197 bits (500),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/230 (43%), Positives = 141/230 (61%), Gaps = 19/230 (8%)
 Frame = -2

Query  869  SFLYYAEQVVEEEEPFVTAFAEDDAAADHNSDLFYYYVEQWPGSYCDTKKGCCYPSTGKP  690
            SFL     VV   +P          A + N   F+Y+V  WPG+ CD++KGCC P   K 
Sbjct  8    SFLVLQSLVVSSSQP----------APNFN---FFYWVTYWPGAICDSQKGCCPPPNSKA  54

Query  689  ATNFSIHGLWPTWLNGSWPENCNPNSLYDESKISYLIERMQS---EWPTLSCPSNNGSKF  519
             ++F IHGLWP + NG+WP  C+  +L++ SK+S LI RM++   EW   +CPSN  +K 
Sbjct  55   TSDFMIHGLWPQFNNGTWPAFCDQTNLFNISKVSDLICRMETKWAEWGVWTCPSNE-TKL  113

Query  518  WKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQALENAGIKPDGNFYEVEAIKEAIK  345
            W+HEW+KHGTC  SIF+Q +YF++ L  + +++ L  L+  GIKP+  FY ++ IK AIK
Sbjct  114  WEHEWDKHGTCVQSIFNQHSYFQTNLKYRQKLDLLNILKQKGIKPNDGFYGLDEIKNAIK  173

Query  344  AGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDIIECPTTVQRNCNTTV  195
              +G  P IECN D     QL+QIYIC+D   K+ +ECP    R+C + +
Sbjct  174  CVIGFAPGIECNEDVKGKKQLFQIYICLDNYAKEFVECPYVPDRSCASKI  223



>ref|XP_006304136.1| hypothetical protein CARUB_v10010110mg [Capsella rubella]
 gb|EOA37034.1| hypothetical protein CARUB_v10010110mg [Capsella rubella]
Length=248

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 128/197 (65%), Gaps = 6/197 (3%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V  WPG+ C+++KGCC P  G  + +F IHGLWP + NG+WP  C+  +L+D SKI
Sbjct  29   FFYWVNYWPGAICESQKGCCSPPKGNKSPDFMIHGLWPQFNNGTWPAFCDQTNLFDISKI  88

Query  590  SYLIERMQ---SEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVN  426
            S L+ +M+   +EW    CPSN  +  W+HEW KHGTC  S+FDQ +YF + L  + R+N
Sbjct  89   SDLVSKMERKWTEWGVWVCPSNE-TNLWEHEWNKHGTCVQSVFDQHSYFNTNLKFRQRIN  147

Query  425  FLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGK  246
            FL  L++ GI+P+  FY +  IK AIK  +G  P IECN D     QL+QIYIC+D   K
Sbjct  148  FLSILKHKGIQPNDGFYSLNEIKNAIKCVIGFAPGIECNEDVKGNKQLFQIYICLDNYAK  207

Query  245  DIIECPTTVQRNCNTTV  195
            + +ECP    ++C + +
Sbjct  208  EFVECPYVPDKSCASKI  224



>ref|XP_001763141.1| predicted protein [Physcomitrella patens]
 gb|EDQ72018.1| predicted protein [Physcomitrella patens]
Length=233

 Score =   196 bits (497),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 127/200 (64%), Gaps = 2/200 (1%)
 Frame = -2

Query  791  ADHNSDLFYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNS  612
            A  + D FY+  +QWPGSYCDT++GCC+P +  P   F IHGLWP + +GSWP+ C    
Sbjct  9    AQDDFDFFYFVQQQWPGSYCDTRRGCCFPLSSNPKAVFGIHGLWPNYDDGSWPDFCTKEP  68

Query  611  LYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCSIFDQCAYFESTLNIKDR  432
             ++  +++ ++++M  +W +L+CP+++   FW HEW KHGTCS   Q  YF+S +++  +
Sbjct  69   -FNPKELADVVDQMDDDWGSLACPASDSHSFWTHEWTKHGTCSGLGQHGYFQSAIDLYGK  127

Query  431  VNFLQALENAGIKPDGNFYEVEAIKEAIKAGV-GVTPLIECNSDASKVSQLYQIYICVDL  255
             +   AL  AGI PDG  Y+V+AI+ AI   + G  P I+CN D     QLYQ+YICV  
Sbjct  128  HDITGALAKAGILPDGKHYQVDAIRHAISTVLDGHLPGIDCNKDGHGNRQLYQVYICVGK  187

Query  254  NGKDIIECPTTVQRNCNTTV  195
            +GK +IECP   +  C  +V
Sbjct  188  DGKTLIECPIFPRNECKGSV  207



>gb|AAQ22605.1| At1g14210 [Arabidopsis thaliana]
Length=247

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 128/197 (65%), Gaps = 6/197 (3%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V  WPG+ CD++KGCC P+ G  A++F IHGLWP + NG+WP  C+  +L+D SKI
Sbjct  28   FFYWVNYWPGAICDSQKGCCPPTKGNTASDFIIHGLWPQFNNGTWPAFCDQTNLFDISKI  87

Query  590  SYLIERMQ---SEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVN  426
            S L+ +M+   +EW   +CP N  +  W+HEW KHGTC  SIFDQ +YF + L  K +V+
Sbjct  88   SDLVCQMEKKWTEWGVWACPINE-TNLWEHEWNKHGTCVQSIFDQHSYFRTNLKFKHKVH  146

Query  425  FLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGK  246
             L  L   GIKP+  FY ++ IK AIK  +G  P IECN D     QL+QIYIC+D   K
Sbjct  147  LLNILIQKGIKPNDGFYSLDEIKNAIKCAIGFAPGIECNEDVKGNKQLFQIYICLDNYAK  206

Query  245  DIIECPTTVQRNCNTTV  195
            + +ECP    ++C + +
Sbjct  207  EFVECPYVPDKSCASKI  223



>gb|AAB58718.1| aleurone ribonuclease [Hordeum vulgare subsp. vulgare]
Length=240

 Score =   194 bits (493),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/212 (44%), Positives = 127/212 (60%), Gaps = 21/212 (10%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTW--------LNGS--------  639
            F+Y V+QWPGS+CDTKKGCC+P TGKPAT+F IHGLWP +        L+G+        
Sbjct  25   FFYLVQQWPGSFCDTKKGCCFPDTGKPATDFGIHGLWPNYAECKTRGELDGALEMVTRRR  84

Query  638  ---WPENCNPNSLYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCSIFDQC  468
               WPE+CN   L    +I  L+  + + WPTL+C      +FW HEWEKHGTCS  DQ 
Sbjct  85   KKCWPESCNSERL-KLWEIRDLVTELDANWPTLACKGGKSFEFWTHEWEKHGTCSNLDQH  143

Query  467  AYFESTLNIKDRVNFLQALENAGIKP-DGNFYEVEAIKEAIKAGVGVTPLIECNSDASKV  291
             Y  + L  K R N    L +AGI P D   Y + +I++AI+ G G T  +ECN      
Sbjct  144  GYLATALGFKARHNLTSILADAGIVPSDTETYFLSSIRDAIREGTGFTANLECNRGVDGE  203

Query  290  SQLYQIYICVDLNGKDIIECPTTVQRNCNTTV  195
            +QL+Q+Y C+D +G+++I+CP  +Q NC   V
Sbjct  204  TQLFQVYQCIDRDGENLIDCPLPMQGNCKDRV  235



>gb|EMT26752.1| Ribonuclease 1 [Aegilops tauschii]
Length=241

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/214 (45%), Positives = 126/214 (59%), Gaps = 25/214 (12%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTW--------LNG---------  642
            F+Y V+QWPGS+CDTK GCC+P TGKPAT+FSIHG+WP +        L+G         
Sbjct  26   FFYLVQQWPGSFCDTKTGCCFPDTGKPATDFSIHGMWPNYAKCKTQGELDGVIEMVTKGK  85

Query  641  --SWPENCN--PNSLYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCSIFD  474
               WPE CN  P  L++   I  L++ + + WPTL+C      +FW HEWEKHGTCS   
Sbjct  86   KKCWPEFCNSEPLQLWE---IKDLVKELDANWPTLACKGGKSIEFWSHEWEKHGTCSDLG  142

Query  473  QCAYFESTLNIKDRVNFLQALENAGIKP-DGNFYEVEAIKEAIKAGVGVTPLIECNSDAS  297
            Q  YF + L +K R N    L + GI P D   Y + +I +AIK G G    +ECN   +
Sbjct  143  QHGYFAAALGLKARHNLTAVLADTGIVPSDSETYSLSSINDAIKEGTGFAAKLECNRGVA  202

Query  296  KVSQLYQIYICVDLNGKDIIECPTTVQRNCNTTV  195
               QLYQ+Y CVD +G+++I+CP  VQ NC   V
Sbjct  203  GEVQLYQVYQCVDRSGENLIDCPVPVQGNCKNRV  236



>gb|EMS61800.1| Ribonuclease 1 [Triticum urartu]
Length=301

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 118/177 (67%), Gaps = 21/177 (12%)
 Frame = -2

Query  749  WPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKISYLIERM  570
            WPGSYCDTK+ CCYP +GKPA +F IHGLWP   +GS+P+NCNP + +D SK+S L+  +
Sbjct  128  WPGSYCDTKQSCCYPRSGKPAADFGIHGLWPNRDDGSYPQNCNPANAFDPSKVSDLLSSL  187

Query  569  QSEWPTLSCPSNNGSKFWKHEWEKHGTCS--IFDQCAYFESTLNIKDRVNFLQALENAGI  396
            ++EWPTL+CP+++G +FW HEWEKHGTC+  +F++  YF++ L+++D++  L AL  AG 
Sbjct  188  RTEWPTLACPTSDGLQFWAHEWEKHGTCAQNLFNEHGYFQTALHLRDQLRVLDALTAAG-  246

Query  395  KPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDIIECPT  225
                              G G  P +ECN D S  SQLYQ+Y CVD N    +ECP 
Sbjct  247  ------------------GTGFEPFVECNRDESGNSQLYQLYFCVDANASGFVECPV  285



>ref|XP_002892795.1| ribonuclease T2 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69054.1| ribonuclease T2 family protein [Arabidopsis lyrata subsp. lyrata]
Length=247

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/206 (46%), Positives = 130/206 (63%), Gaps = 9/206 (4%)
 Frame = -2

Query  797  AAADHNSDLFYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNP  618
             A D N   F+Y+V  WPG+ CD+++GCC P+ G  A +F IHGLWP + NG+WP  C+ 
Sbjct  22   TAPDFN---FFYWVNYWPGAICDSQRGCCPPTKGNTAPDFIIHGLWPQFNNGTWPAFCDQ  78

Query  617  NSLYDESKISYLI---ERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFES  453
             +L+D SKIS L+   E+  +EW   +CPSN  +  W+HEW KHGTC  SIFDQ +YF +
Sbjct  79   TNLFDISKISDLVCQVEKKWTEWGVWACPSNE-TNLWEHEWNKHGTCVQSIFDQHSYFLT  137

Query  452  TLNIKDRVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQI  273
             L  + + N L  L+  GIKP+  FY ++ IK AIK  +G  P IECN D     QL+QI
Sbjct  138  NLKFRYKFNLLNILKQKGIKPNDGFYSLDEIKNAIKCVIGFAPGIECNEDVKGNKQLFQI  197

Query  272  YICVDLNGKDIIECPTTVQRNCNTTV  195
            YIC+D   K+ +ECP    ++C + +
Sbjct  198  YICLDNYAKEFVECPYVPDKSCASKI  223



>gb|ACV83767.1| RNase Phy5, partial [Petunia x hybrida]
Length=168

 Score =   190 bits (482),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 110/151 (73%), Gaps = 1/151 (1%)
 Frame = -2

Query  674  IHGLWPTWLNGSWPENCNPNSLYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKH  495
            IHGLWP + NG WP+NC+  S  DES+IS LI  M+  WP+L+CPS++G +FW HEW KH
Sbjct  1    IHGLWPNYENGKWPQNCDKESSLDESEISDLISTMEKNWPSLACPSSDGLRFWSHEWLKH  60

Query  494  GTCSIFDQCAYFESTLNIKDRVNFLQALENAGIKP-DGNFYEVEAIKEAIKAGVGVTPLI  318
            GTCS  DQ AYF++ LN K + N LQ LENAGIKP +G +Y +E+IK+AI+ GVG TP I
Sbjct  61   GTCSALDQHAYFQTALNFKKKSNLLQNLENAGIKPRNGEYYSMESIKKAIEEGVGHTPFI  120

Query  317  ECNSDASKVSQLYQIYICVDLNGKDIIECPT  225
            ECN D     Q+YQ+Y+CVD +  D I+CP 
Sbjct  121  ECNVDTEGNHQIYQVYLCVDSSASDFIDCPV  151



>ref|XP_009783068.1| PREDICTED: intracellular ribonuclease LX-like isoform X2 [Nicotiana 
sylvestris]
Length=207

 Score =   190 bits (482),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 99/251 (39%), Positives = 136/251 (54%), Gaps = 65/251 (26%)
 Frame = -2

Query  944  ENMKSILIGLVILQCTISIYAAHSQSFLYYAEQVVEEEEPFVTAFAEDDAAADHNSDLFY  765
             +++ +L+ LVI QC   I   H+Q F                               F+
Sbjct  2    RSIQLVLVKLVIFQC---IMLLHAQDFD------------------------------FF  28

Query  764  YYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKISY  585
            Y+ +QW  + CD+K  CCYP+ GKPA +F IHGLWP + NGS+P++CN N+ YDE++IS 
Sbjct  29   YFAQQWNPASCDSKIKCCYPTNGKPAQDFGIHGLWPNYNNGSFPKSCNKNARYDETQISD  88

Query  584  LIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCSIFDQCAYFESTLNIKDRVNFLQALEN  405
            LI  MQ  WPTLSCPSNNG++FW HEW+KH                              
Sbjct  89   LISSMQKNWPTLSCPSNNGTRFWSHEWKKH------------------------------  118

Query  404  AGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDIIECPT  225
             GIKPDG FY  EA+KEAI+ G+G T  +ECN D     QL+++Y+CVD  G +II+CP 
Sbjct  119  -GIKPDGGFYSYEAMKEAIEKGIGHTVGVECNIDLFGNRQLFEVYVCVDKCGSEIIDCPI  177

Query  224  TVQ-RNCNTTV  195
              + + C  ++
Sbjct  178  VPESKRCKESI  188



>ref|XP_010495828.1| PREDICTED: ribonuclease 3-like [Camelina sativa]
Length=257

 Score =   191 bits (485),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 93/215 (43%), Positives = 132/215 (61%), Gaps = 10/215 (5%)
 Frame = -2

Query  821  VTAFAEDDAAADHNSDLFYYYVEQWPGSYCDTKKGCCYPST-GKPATNFSIHGLWPTWLN  645
            + A +   A  D N   F+Y+V  WPG+ CD++KGCC P T G  +  F IHGLWP ++N
Sbjct  23   LVASSSQTAPPDFN---FFYWVNYWPGAICDSQKGCCPPPTKGNKSPEFMIHGLWPQFIN  79

Query  644  GSWPENCNPNSLYDESKISYLIERMQ---SEWPTLSCPSNNGSKFWKHEWEKHGTC--SI  480
            G+WP  C+  +L+D SKIS L+ +M+   +EW    CPSN  +  W+HEW KHGTC  ++
Sbjct  80   GTWPAFCDQTNLFDISKISDLVSKMEKKWTEWGVWVCPSNE-TNLWEHEWNKHGTCVQTV  138

Query  479  FDQCAYFESTLNIKDRVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDA  300
            FDQ +YF + L  + ++N L  L+   IKP+  FY +  IK AIK  +G  P IECN D 
Sbjct  139  FDQHSYFHTNLKFRQKINLLSILKQKEIKPNDGFYGLNEIKNAIKCVIGFAPGIECNEDV  198

Query  299  SKVSQLYQIYICVDLNGKDIIECPTTVQRNCNTTV  195
                QL+QIYIC+D   K+ +ECP    ++C + +
Sbjct  199  EGNKQLFQIYICLDNYAKEFVECPYVPDKSCTSKI  233



>ref|XP_002967396.1| hypothetical protein SELMODRAFT_87215 [Selaginella moellendorffii]
 gb|EFJ31995.1| hypothetical protein SELMODRAFT_87215 [Selaginella moellendorffii]
Length=210

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 129/197 (65%), Gaps = 6/197 (3%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y V +WPGSYCD    CCYP +GKPA++FSIHGLWP  L+GS+PENC+P+  ++ S+I
Sbjct  10   FFYLVLEWPGSYCDAATSCCYPQSGKPASDFSIHGLWPNNLDGSYPENCDPSRPFNASQI  69

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCS---IFDQCAYFESTLNIKDRVNFL  420
              L   M + W +LSCPS+N  KFW HEWEKHGTCS   +  Q  YF + L ++  V+ L
Sbjct  70   GGLRGDMDALWSSLSCPSSNSEKFWAHEWEKHGTCSEKILRSQRDYFAAALRLRKSVDLL  129

Query  419  QALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNS--DASKVSQLYQIYICVDLNGK  246
             ALE AGI PDG  Y +  IK A++ G G  P I CN+  D S  SQLYQIY+CV     
Sbjct  130  GALEQAGISPDGKSYALSLIKNALQDG-GYAPGITCNADDDDSGSSQLYQIYLCVSKENL  188

Query  245  DIIECPTTVQRNCNTTV  195
            +I  CP   + +C++ V
Sbjct  189  EITPCPVLPRSSCHSRV  205



>ref|XP_002960316.1| hypothetical protein SELMODRAFT_75785 [Selaginella moellendorffii]
 gb|EFJ37855.1| hypothetical protein SELMODRAFT_75785 [Selaginella moellendorffii]
Length=210

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 129/197 (65%), Gaps = 6/197 (3%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y V +WPGSYCD    CCYP +GKPA++FSIHGLWP  L+GS+PENC+P+  ++ S+I
Sbjct  10   FFYLVLEWPGSYCDAATSCCYPQSGKPASDFSIHGLWPNNLDGSYPENCDPSRPFNASQI  69

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCS---IFDQCAYFESTLNIKDRVNFL  420
              L   M + W +LSCPS+N  KFW HEWEKHGTCS   +  Q  YF + L ++  V+ L
Sbjct  70   GGLRGDMDALWSSLSCPSSNSEKFWAHEWEKHGTCSEKILRSQRDYFAAALRLRKSVDLL  129

Query  419  QALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNS--DASKVSQLYQIYICVDLNGK  246
             ALE AGI PDG  Y +  IK A++ G G  P I CN+  D S  SQLYQIY+CV     
Sbjct  130  GALEQAGISPDGKSYPLALIKNALQDG-GYAPGITCNADDDDSGSSQLYQIYLCVSKENL  188

Query  245  DIIECPTTVQRNCNTTV  195
            +I  CP   + +C++ V
Sbjct  189  EITPCPVLPRSSCHSRV  205



>gb|EMS60319.1| Ribonuclease 1 [Triticum urartu]
Length=252

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/207 (45%), Positives = 123/207 (59%), Gaps = 21/207 (10%)
 Frame = -2

Query  755  EQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTW--------LNGS-----------WP  633
             +WPGS+CDTKKGCC+P TGKPAT+F IHGLWP +        L+G+           WP
Sbjct  42   RKWPGSFCDTKKGCCFPDTGKPATDFGIHGLWPNYAKCKTRGELDGALEMVTKRKKKCWP  101

Query  632  ENCNPNSLYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCSIFDQCAYFES  453
            ENCN   L    +I  L+  + + WPTL+C      +FW HEWEKHGTCS  DQ  YF +
Sbjct  102  ENCNSERL-KLWEIKDLVTELDANWPTLACKGGKSIEFWTHEWEKHGTCSNLDQHGYFAT  160

Query  452  TLNIKDRVNFLQALENAGIKP-DGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQ  276
             L  K R N    L +AGI P D   Y + +I++AIK G G T  +ECN   +  +QL+Q
Sbjct  161  ALGFKARHNLTGILADAGIVPSDSETYFLSSIRDAIKEGTGFTANLECNRGVAGETQLFQ  220

Query  275  IYICVDLNGKDIIECPTTVQRNCNTTV  195
            +Y C+D  G+++I+CP  +Q NC   V
Sbjct  221  VYQCIDSAGENLIDCPLPMQGNCKDRV  247



>ref|XP_010683178.1| PREDICTED: ribonuclease 1-like [Beta vulgaris subsp. vulgaris]
Length=231

 Score =   188 bits (477),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 128/193 (66%), Gaps = 5/193 (3%)
 Frame = -2

Query  797  AAADHNSDLFYYYVEQWPGSYCDTK-KGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCN  621
            A A+      +Y+V+QW GSYCD   + CCYP +GKP  +FSI GLWP + +GS+P NC 
Sbjct  22   ALANSGDFHLFYFVQQWLGSYCDQHAEKCCYPPSGKPPADFSIEGLWPYFNDGSFPYNCG  81

Query  620  PNSLYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCS--IFDQCAYFESTL  447
              + ++E+ +  + + ++ EWP+ +CP   G KFW HEW KHGTCS  +  + AYF++ L
Sbjct  82   GGN-FNEALLKPMQDSLRREWPSFTCPQI-GRKFWVHEWNKHGTCSKTVLGEVAYFQAAL  139

Query  446  NIKDRVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYI  267
            N+K++V  LQAL NAGI+P+   Y ++A+KEAI  G G  P + CN ++  +SQ++Q+ +
Sbjct  140  NLKNKVRLLQALGNAGIRPNNQLYSLKAVKEAIARGTGFHPWVVCNKNSQGISQIWQVAM  199

Query  266  CVDLNGKDIIECP  228
            CVD  G  +I CP
Sbjct  200  CVDRTGTRLINCP  212



>ref|XP_010683174.1| PREDICTED: ribonuclease 1-like [Beta vulgaris subsp. vulgaris]
Length=232

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/194 (46%), Positives = 126/194 (65%), Gaps = 6/194 (3%)
 Frame = -2

Query  797  AAADHNSDLF-YYYVEQWPGSYCDTK-KGCCYPSTGKPATNFSIHGLWPTWLNGSWPENC  624
            A  + NS L  +Y V+QW GSYCD +   CCYP TGKP  +F+I+G WP + +GS+P NC
Sbjct  22   ALGNTNSGLRAFYLVQQWLGSYCDQRGTRCCYPPTGKPRPDFTIYGFWPYYNDGSFPYNC  81

Query  623  NPNSLYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCSI--FDQCAYFEST  450
              ++ YD +++  L  R++  WP+ +CP   G KFW HEW KHGTCS     +  YF++ 
Sbjct  82   GDDN-YDVARLKPLESRLRQAWPSFTCP-QIGRKFWVHEWNKHGTCSKSSLGEIPYFQAA  139

Query  449  LNIKDRVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIY  270
            LN+K R N L AL +AGI+P+  FY +++IK AI   +G  P IECN ++   SQL+Q+ 
Sbjct  140  LNLKSRANVLHALASAGIRPNNQFYSLKSIKRAITRSIGFHPWIECNHNSQGKSQLWQVT  199

Query  269  ICVDLNGKDIIECP  228
            +C D NG+ +I CP
Sbjct  200  LCADRNGRKLINCP  213



>ref|XP_010248021.1| PREDICTED: extracellular ribonuclease LE-like [Nelumbo nucifera]
Length=241

 Score =   186 bits (473),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 125/195 (64%), Gaps = 3/195 (2%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+ + + W GS+C ++KGCC+P+TGK +  F++HGL+P    G+   NC+  +  D S+I
Sbjct  30   FFLHAQVWAGSFCGSEKGCCFPNTGKVSQEFTVHGLFPCSSXGTXLMNCDRGNSLDLSQI  89

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFD-QCAYFESTLNIKDRVNFL  420
            + L+  MQ +WP+ SCPS++ + FW HEW KHGTC  S+FD Q  YF++ L++KD+VN L
Sbjct  90   TGLLHTMQRKWPSYSCPSSDSTPFWAHEWSKHGTCSLSVFDGQYDYFKAGLDLKDKVNIL  149

Query  419  QALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDI  240
            Q L+  GI PDG +Y  E I   ++   GVTP ++C  D     QLYQ+  CVD +G + 
Sbjct  150  QILKKEGINPDGQYYSSERITRVLQIATGVTPALDCTVDKFGKYQLYQVMFCVDKSGSEF  209

Query  239  IECPTTVQRNCNTTV  195
            ++CP   +  C + +
Sbjct  210  MDCPVYPEPTCPSII  224



>gb|EMS46663.1| Ribonuclease 1 [Triticum urartu]
Length=233

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/204 (45%), Positives = 117/204 (57%), Gaps = 12/204 (6%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWL----------NGSWPENCN  621
            F+Y+V+QWPGS+CDT  GCC+P   KPA +F IHGLWP +              WP+ CN
Sbjct  25   FFYHVQQWPGSFCDTTGGCCFPGNVKPAADFGIHGLWPNYAACRPAGDTNRTRCWPDFCN  84

Query  620  PNSLYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCSIFDQCAYFESTLNI  441
                ++ S IS L   M   W TLSC SN+ + FW HEW +HGTCS  DQ AYF + L  
Sbjct  85   AGDTFNPSLISDLRSDMDRNWGTLSCRSNDSTAFWSHEWSRHGTCSNMDQHAYFLAALRY  144

Query  440  KDRVNFLQALENAGIKP-DGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYIC  264
            K R N  + L +AGI P +   Y V +I++AI    G  P IECN +A   +QLYQ+Y C
Sbjct  145  KARFNLTRILLDAGIAPSEERTYCVGSIRDAIGEATGSAPGIECNRNARNETQLYQVYQC  204

Query  263  VDLNGKDIIECPTT-VQRNCNTTV  195
            VDL G   + CP   +Q  C   V
Sbjct  205  VDLAGTGPVPCPAVPMQSRCTDQV  228



>gb|AFK35821.1| unknown [Medicago truncatula]
Length=228

 Score =   183 bits (464),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/195 (45%), Positives = 132/195 (68%), Gaps = 4/195 (2%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTW-LNGSWPENCNPNSLYDESK  594
            F+ ++ QWPGSYCD+K GCCYP TGKPA +F+I+GL P++ +NG+ P NC+  S++++SK
Sbjct  30   FFTFILQWPGSYCDSKLGCCYPKTGKPAADFTIYGLRPSFNINGTSPTNCDIQSVFNKSK  89

Query  593  ISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCS--IFDQCAYFESTLNIKDRVNFL  420
            IS LIE ++  WP+L CP  N  + W HEW KHGTCS     Q  YF++ L +K ++N L
Sbjct  90   ISDLIEDLEINWPSLRCPRLNNIRIWSHEWMKHGTCSESKLSQHDYFQTALKLKKKLNLL  149

Query  419  QALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDI  240
            Q L +AG +P+  FY++      I+   G+ P +ECN D++   Q+ ++Y+CVD++G + 
Sbjct  150  QMLRDAGFEPNDQFYDIGNPLSIIEDATGLLPGMECNRDSAGNDQVLKVYMCVDISGSNF  209

Query  239  IECPTTVQRNCNTTV  195
            I+CP+ V  NC   V
Sbjct  210  IQCPSLVD-NCGAKV  223



>gb|AAB46384.1| storage protein [Nelumbo nucifera]
Length=241

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 125/195 (64%), Gaps = 3/195 (2%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+++ + W GS+C ++KG C+P+TG  +  F++HGL+P   +G+   NC+  +  D S+I
Sbjct  30   FFHHAQVWAGSFCASEKGSCFPNTGMVSQEFTVHGLFPCSSSGTRLMNCDRGNSLDLSQI  89

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFD-QCAYFESTLNIKDRVNFL  420
            + L+  MQ +WP+ SCPS++ + FW HEW KHGTC  S+FD Q  YF++ L++KD+VN L
Sbjct  90   TGLLHTMQRKWPSYSCPSSDSTPFWAHEWSKHGTCSLSVFDGQYDYFKAGLDLKDKVNIL  149

Query  419  QALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDI  240
            Q L+  GI PDG +Y  E I   ++   GVTP ++C  D     QLYQ+  CVD +G + 
Sbjct  150  QILKKEGINPDGQYYSSERITRVLQIATGVTPALDCTVDKFGKYQLYQVMFCVDKSGSEF  209

Query  239  IECPTTVQRNCNTTV  195
            ++CP   +  C + +
Sbjct  210  MDCPVYPEPTCPSII  224



>ref|XP_010683175.1| PREDICTED: ribonuclease 3-like isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=232

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/196 (46%), Positives = 124/196 (63%), Gaps = 7/196 (4%)
 Frame = -2

Query  767  YYYVEQWPGSYCDTK-KGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            +Y+++QW  SYC+ K   CCYP TGKPATNFSI+GLWP   +GS  +NC P S +D S I
Sbjct  34   FYFIQQWLPSYCNQKGTNCCYPPTGKPATNFSIYGLWPYQDDGSCLQNC-PGSTFDVSLI  92

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCS--IFDQCAYFESTLNIKDRVNFLQ  417
              +   +Q EWP+ +CP   G KFW HEW KHGTCS  + D+ AYF + LN+K+++N  Q
Sbjct  93   KPIESMLQQEWPSFTCPEI-GRKFWLHEWNKHGTCSKSVLDEMAYFHAALNLKNKINIFQ  151

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL    I+P+  FY ++ I   I    G  P I CN DA   SQ++Q+ +CVD +G +++
Sbjct  152  ALAETMIQPNDQFYPLDNITTMISLATGFRPSIFCNHDAQGNSQIWQVLLCVDKSGTELV  211

Query  236  EC--PTTVQRNCNTTV  195
             C  P   Q NC +T+
Sbjct  212  NCSNPYKQQGNCASTI  227



>ref|XP_010683173.1| PREDICTED: ribonuclease 1-like [Beta vulgaris subsp. vulgaris]
Length=232

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 120/183 (66%), Gaps = 5/183 (3%)
 Frame = -2

Query  767  YYYVEQWPGSYCDTKKG-CCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            +Y+V+QW GSYC+ +   CCYP TGKP  +F+I+GLWP + +GS+P NC  ++ YD  +I
Sbjct  33   FYFVQQWLGSYCNQRNTPCCYPPTGKPTPDFTIYGLWPYYNDGSFPYNCGDDN-YDVGRI  91

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
             Y+ +R++  WPT +CP   G KFW H W KHGTC  S+  +  Y E  L++K +VN  Q
Sbjct  92   KYMQDRLRKSWPTFTCPQI-GRKFWVHLWNKHGTCTKSMLGEIDYLEGALHLKSKVNVFQ  150

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            AL  AGI+PD  FY +++IK+AI    G  P I CN++A    Q++Q+ +C D   K +I
Sbjct  151  ALLRAGIRPDNRFYSLKSIKKAIARATGFHPWIVCNTNAQGHKQIWQVTLCADKTAKKLI  210

Query  236  ECP  228
            +CP
Sbjct  211  KCP  213



>gb|EMT26753.1| Ribonuclease 1 [Aegilops tauschii]
Length=233

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 117/204 (57%), Gaps = 12/204 (6%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWL----------NGSWPENCN  621
            F+Y+V++WPGS+CDT  GCC+P   KPA +F IHGLWP +              WP+ CN
Sbjct  25   FFYHVQKWPGSFCDTTGGCCFPGNVKPAADFGIHGLWPNYAACRPAGETNRTRCWPDFCN  84

Query  620  PNSLYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCSIFDQCAYFESTLNI  441
              + +  S IS L   M   W TLSC SN+ + FW HEW +HGTCS  DQ AYF + L  
Sbjct  85   ATNTFAPSLISDLKSDMDRNWGTLSCRSNDSTAFWSHEWSRHGTCSNMDQHAYFLAALRY  144

Query  440  KDRVNFLQALENAGIKP-DGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYIC  264
            K R N  + L ++GI P +   Y V +I++AI    G  P IECN +A   +QLYQ+Y C
Sbjct  145  KARFNLTRILLDSGIVPSEERTYCVGSIRDAIGEATGSAPGIECNRNARNETQLYQVYQC  204

Query  263  VDLNGKDIIECPTT-VQRNCNTTV  195
            VDL G   I CP   +Q  C   V
Sbjct  205  VDLAGTGPIPCPAVPMQGRCTDQV  228



>gb|AAD39309.1|AC007576_32 Very similar to ribonucleases [Arabidopsis thaliana]
Length=248

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 101/252 (40%), Positives = 141/252 (56%), Gaps = 39/252 (15%)
 Frame = -2

Query  929  ILIGLVILQCTISIYAAHSQS-----FLYYAEQVVEEEEPFVTAFAEDDAAADHNSDLFY  765
            I++ L+ILQ   S+  + SQ+     F Y+   V+     F T              L Y
Sbjct  5    IIVSLLILQ---SLVVSSSQTEPDFNFFYWVNYVM-----FPTT-------------LTY  43

Query  764  YYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKISY  585
             Y   WPG+ CD++KGCC P+ G  A++F IHGLWP + NG+WP  C+  +L+D      
Sbjct  44   IY---WPGAICDSQKGCCPPTKGNTASDFIIHGLWPQFNNGTWPAFCDQTNLFD------  94

Query  584  LIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQAL  411
             I +  +EW   +CPSN  +  W+HEW KHGTC  SIFDQ +YF + L  K +V+ L  L
Sbjct  95   -ISKKWTEWGVWACPSNE-TNLWEHEWNKHGTCVQSIFDQHSYFRTNLKFKHKVHLLNIL  152

Query  410  ENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDIIEC  231
               GIKP+  FY ++ IK AIK  +G  P IECN D     QL+QIYIC+D   K+ +EC
Sbjct  153  IQKGIKPNDGFYSLDEIKNAIKCAIGFAPGIECNEDVKGNKQLFQIYICLDNYAKEFVEC  212

Query  230  PTTVQRNCNTTV  195
            P    ++C + +
Sbjct  213  PYVPDKSCASKI  224



>ref|XP_006657993.1| PREDICTED: ribonuclease 1-like [Oryza brachyantha]
Length=250

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/242 (38%), Positives = 128/242 (53%), Gaps = 40/242 (17%)
 Frame = -2

Query  827  PFVTAFAEDDAAADHNSDLFYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTW-  651
            P V   A+ D         F+Y V+QWPGS+CDT+ GCC+P TGKPA  F IHGLWP + 
Sbjct  13   PLVAGVADFD---------FFYLVQQWPGSFCDTQTGCCFPDTGKPAPEFGIHGLWPNYA  63

Query  650  ----------------LNGS-------------WPENCNPNSLYDESKISYLIERMQSEW  558
                            ++G+             WPENC+  +     +I  L+  + + W
Sbjct  64   KCRAAGPELVEDVAMVVDGTTAAVDAVERRQKCWPENCDDRNPLKPWEIKDLVAELDANW  123

Query  557  PTLSCPSNNGSKFWKHEWEKHGTCSIFDQCAYFESTLNIKDRVNFLQALENAGIKP-DGN  381
            PTLSC S    +FW +EW+KHGTCS   Q  YF + L +K R +    L +AG+ P D  
Sbjct  124  PTLSCKSGRSMEFWSYEWKKHGTCSGMGQHEYFAAALELKKRHSLAAILADAGVVPSDNE  183

Query  380  FYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDIIECPTTVQRNCNT  201
             Y + +I++AI    G  P +ECN DAS  +QL+Q+Y CVD + K +++C   +Q  C  
Sbjct  184  SYFLSSIRDAIAGATGAVPNLECNRDASGETQLFQVYQCVDRSAKKLVDCQLPMQGKCRD  243

Query  200  TV  195
             V
Sbjct  244  RV  245



>ref|XP_009796409.1| PREDICTED: extracellular ribonuclease LE-like isoform X1 [Nicotiana 
sylvestris]
Length=247

 Score =   181 bits (458),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 85/199 (43%), Positives = 123/199 (62%), Gaps = 3/199 (2%)
 Frame = -2

Query  785  HNSDL-FYYYVEQWPGSYCDTK--KGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPN  615
            H  DL FY    QW  + C  +    CC  +TG+PA +F I GLWP++ N ++PENCN  
Sbjct  22   HAKDLDFYRLTLQWNPAACYNRIIGKCCNTTTGRPAEDFGIAGLWPSYNNLTYPENCNKA  81

Query  614  SLYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCSIFDQCAYFESTLNIKD  435
              YDE++IS L+  MQ  WP +SCPSNNG+  W  EW++ GTCS  +  +YFE+ L++K+
Sbjct  82   GPYDETQISDLLSSMQKNWPKISCPSNNGTSLWAKEWKERGTCSRLNMHSYFETALDLKE  141

Query  434  RVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDL  255
            ++N +Q ++  G++P+G FY    I  AIK  +G    IECN   +  SQ Y+++ICVD 
Sbjct  142  KLNLIQDVKRYGLEPNGQFYHWRHINAAIKLAIGHVIAIECNLGLTADSQFYRVHICVDK  201

Query  254  NGKDIIECPTTVQRNCNTT  198
            +G D I+CP  +     TT
Sbjct  202  SGSDFIDCPINLTEISETT  220



>ref|NP_001060356.1| Os07g0630400 [Oryza sativa Japonica Group]
 dbj|BAC20682.1| putative aleurone ribonuclease [Oryza sativa Japonica Group]
 dbj|BAF22270.1| Os07g0630400 [Oryza sativa Japonica Group]
 gb|EAZ40755.1| hypothetical protein OsJ_25228 [Oryza sativa Japonica Group]
 dbj|BAG96743.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87404.1| unnamed protein product [Oryza sativa Japonica Group]
Length=256

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/227 (38%), Positives = 121/227 (53%), Gaps = 35/227 (15%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTW--------------------  651
            F+Y V+QWPGS+CDT+ GCC+P TGKPA  F IHGLWP +                    
Sbjct  25   FFYLVQQWPGSFCDTQAGCCFPDTGKPAAEFGIHGLWPNYAKCRPAAGAVADDDDGVVEM  84

Query  650  -LNGS-------------WPENCNPNSLYDESKISYLIERMQSEWPTLSCPSNNGSKFWK  513
             ++G              WPE C+  +     +I  L+  + + WPTLSC      +FW 
Sbjct  85   VVDGGAAVERHHRRRQKCWPEYCDDGNKLRPWEIKDLVAELDANWPTLSCKGGKSFEFWS  144

Query  512  HEWEKHGTCSIFDQCAYFESTLNIKDRVNFLQALENAGIKP-DGNFYEVEAIKEAIKAGV  336
            +EW+KHGTCS   Q  YF + L +K R +    L  AGI P D   Y + +I++AI A  
Sbjct  145  YEWKKHGTCSGMGQHGYFAAALELKKRHDLAAVLAGAGIVPSDDESYSLGSIRDAIAAAT  204

Query  335  GVTPLIECNSDASKVSQLYQIYICVDLNGKDIIECPTTVQRNCNTTV  195
            G  P +ECN DA+  +QL+Q+Y CVD +GK +++C   +Q  C   V
Sbjct  205  GAVPNLECNRDAAGETQLFQVYQCVDRSGKKLVDCQLPMQGKCRDKV  251



>gb|EAY85177.1| hypothetical protein OsI_06534 [Oryza sativa Indica Group]
Length=256

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/227 (38%), Positives = 121/227 (53%), Gaps = 35/227 (15%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTW--------------------  651
            F+Y V+QWPGS+CDT+ GCC+P TGKPA  F IHGLWP +                    
Sbjct  25   FFYLVQQWPGSFCDTQAGCCFPDTGKPAVEFGIHGLWPNYAKCRPAAGAVADDDDGVVEM  84

Query  650  -LNGS-------------WPENCNPNSLYDESKISYLIERMQSEWPTLSCPSNNGSKFWK  513
             ++G              WPE C+  +     +I  L+  + + WPTLSC      +FW 
Sbjct  85   VVDGGAAVERHHRRRQKCWPEYCDDGNKLRPWEIKDLVAELDANWPTLSCKGGKSFEFWS  144

Query  512  HEWEKHGTCSIFDQCAYFESTLNIKDRVNFLQALENAGIKP-DGNFYEVEAIKEAIKAGV  336
            +EW+KHGTCS   Q  YF + L +K R +    L  AGI P D   Y + +I++AI A  
Sbjct  145  YEWKKHGTCSGMGQHGYFAAALELKKRHDLAAVLAGAGIVPSDDESYSLGSIRDAIAAAT  204

Query  335  GVTPLIECNSDASKVSQLYQIYICVDLNGKDIIECPTTVQRNCNTTV  195
            G  P +ECN DA+  +QL+Q+Y CVD +GK +++C   +Q  C   V
Sbjct  205  GAVPNLECNRDAAGETQLFQVYQCVDRSGKKLVDCQLPMQGKCRDKV  251



>gb|KEH27820.1| ribonuclease T2 family protein [Medicago truncatula]
Length=228

 Score =   177 bits (450),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 89/195 (46%), Positives = 132/195 (68%), Gaps = 4/195 (2%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTW-LNGSWPENCNPNSLYDESK  594
            F+ ++ QWPGSYCD+K GCCYP TGKPA +F+I+GL P++ +NG+ P NC+  S++++SK
Sbjct  30   FFTFILQWPGSYCDSKLGCCYPKTGKPAADFTIYGLRPSFNINGTSPTNCDIQSVFNKSK  89

Query  593  ISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFL  420
            IS LIE ++  WP+L CP  N  K W HEW KHGTC  S   Q  YF++ L +K ++N L
Sbjct  90   ISDLIEDLEINWPSLRCPRLNNIKIWSHEWMKHGTCSESKLSQHDYFQTALKLKKKLNLL  149

Query  419  QALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDI  240
            Q L++AG +P+  FY++      I+   G  P +ECN D++   Q+ ++Y+CVD++G + 
Sbjct  150  QMLKDAGFEPNDQFYDIGNPLSIIEDATGFLPGMECNRDSAGNDQVLKVYMCVDISGSNF  209

Query  239  IECPTTVQRNCNTTV  195
            I+CP+ V  NC   V
Sbjct  210  IQCPSLVD-NCGAKV  223



>ref|XP_004958409.1| PREDICTED: ribonuclease 1-like [Setaria italica]
Length=251

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/222 (39%), Positives = 119/222 (54%), Gaps = 30/222 (14%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTW-------LNG----------  642
            F+Y V+QWPGS+CDT++GCC+P  GKPA +F IHGLWP +       L G          
Sbjct  25   FFYLVQQWPGSFCDTRQGCCFPDAGKPAADFGIHGLWPNYAKCRGSQLQGLARAVLGEDA  84

Query  641  ------------SWPENCNPNSLYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEK  498
                         WPE C+  +     +I  L+  +   WPTLSC S    +FW +EW+K
Sbjct  85   AALFSAVGRRGRCWPEYCDDGNTLSPWEIRDLVASLDRNWPTLSCKSGRSFEFWSYEWKK  144

Query  497  HGTCSIFDQCAYFESTLNIKDRVNFLQALENAGIKP-DGNFYEVEAIKEAIKAGVGVTPL  321
            HGTCS  +Q  YF   L +K   N    L  AGI P +   Y + ++ +AI  G G T  
Sbjct  145  HGTCSNLEQHEYFARALELKAAHNLTAILAGAGIVPSNTETYSLSSVGDAIAQGTGFTAN  204

Query  320  IECNSDASKVSQLYQIYICVDLNGKDIIECPTTVQRNCNTTV  195
            +ECN DA   +QL+Q+Y+CVD   K +I+CP +++  C   V
Sbjct  205  LECNRDADGEAQLFQVYLCVDREVKQLIDCPLSMRSKCTDRV  246



>ref|XP_010683386.1| PREDICTED: ribonuclease 1-like [Beta vulgaris subsp. vulgaris]
Length=228

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 88/196 (45%), Positives = 123/196 (63%), Gaps = 7/196 (4%)
 Frame = -2

Query  767  YYYVEQWPGSYCDTK-KGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            +Y++++W  SYC+ K   CCYP TGKPA NFSI+GLWP   +GS  ENC+  S ++ S +
Sbjct  30   FYFIQEWLPSYCNQKGTSCCYPPTGKPAANFSIYGLWPYQKDGSSLENCS-GSTFNVSML  88

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCS--IFDQCAYFESTLNIKDRVNFLQ  417
              +   ++ EWP+ +CP   G KFW HEW K GTCS  I D+ AYF + LN+K+++N LQ
Sbjct  89   KPIESILRKEWPSFTCP-QIGRKFWLHEWNKRGTCSKSILDEMAYFHAALNVKNKINILQ  147

Query  416  ALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
             L    I P+  FY +++I   I   VG  P I CN DA   SQL+Q+ +CVD NG ++I
Sbjct  148  ILAKDMILPNNQFYSLDSITTTISQAVGFRPSIFCNHDAQGDSQLWQVLLCVDKNGMELI  207

Query  236  ECPTTVQ--RNCNTTV  195
             C T  Q   +C +T+
Sbjct  208  NCSTPPQGLGDCASTI  223



>ref|XP_003562632.1| PREDICTED: ribonuclease 1-like [Brachypodium distachyon]
Length=253

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/219 (39%), Positives = 120/219 (55%), Gaps = 27/219 (12%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYP-STGKPATNFSIHGLWPTWL------------------  648
            F+Y V+QWPGS+CDT++GCC+P  TG+PAT F IHGLWP +                   
Sbjct  30   FFYLVQQWPGSFCDTRQGCCFPDDTGRPATGFGIHGLWPNYAKCKTAFNDEPNAAPGLES  89

Query  647  -------NGSWPENCNPNSLYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGT  489
                      WPE CN        +I+ L+  + + W TLSC +     FW +EW+KHGT
Sbjct  90   AINKRRKKKCWPEYCNNGEPLKLGQIADLLATLNANWGTLSCKNKKSFTFWAYEWKKHGT  149

Query  488  CSIFDQCAYFESTLNIKDRVNFLQALENAGIKP-DGNFYEVEAIKEAIKAGVGVTPLIEC  312
            CS   Q  YF++ L +K + N    L  AGI P D   Y + +I++AIK G G    +EC
Sbjct  150  CSGLAQHDYFQAALRLKAQHNLTGILAQAGIVPSDDKTYFLSSIRDAIKEGTGFKANLEC  209

Query  311  NSDASKVSQLYQIYICVDLNGKDIIECPTTVQRNCNTTV  195
            N      +QL+Q+Y CVD++G+ +I+CP  +Q NC   V
Sbjct  210  NRGVGGETQLFQVYQCVDVSGEKLIDCPLPMQGNCQDRV  248



>ref|XP_004958410.1| PREDICTED: ribonuclease 1-like [Setaria italica]
Length=250

 Score =   172 bits (436),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 87/223 (39%), Positives = 119/223 (53%), Gaps = 33/223 (15%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWL-------------------  648
            F+Y+V+QWPGSYCDT +GCC+P +GKPA +F IHGLWP +                    
Sbjct  25   FFYFVQQWPGSYCDTWRGCCFPDSGKPAADFGIHGLWPNYAQCHGRYGLARAVLGDDAFF  84

Query  647  ------NGSWPENCNPNSLYDES-----KISYLIERMQSEWPTLSCPSNNGSKFWKHEWE  501
                     WP+ C  +  YD++     +I  LI  ++  WPTLSC S    +FW +EW+
Sbjct  85   SIVGRRGRCWPQYCGGD--YDDNALRPWEIRDLIASLERSWPTLSCKSGRSFEFWSYEWK  142

Query  500  KHGTCSIFDQCAYFESTLNIKDRVNFLQALENAGIKPDGN-FYEVEAIKEAIKAGVGVTP  324
            KHGTCS  +   YF   L +K   N    L  AGI P     Y V ++ +AI  G G T 
Sbjct  143  KHGTCSNLEPHDYFARALALKAAHNLTAILAGAGIVPSATETYSVSSVSDAITQGTGFTA  202

Query  323  LIECNSDASKVSQLYQIYICVDLNGKDIIECPTTVQRNCNTTV  195
             ++CN DA   SQLYQ+++CVD   K +I+CP   +  C+  V
Sbjct  203  NLDCNRDADGESQLYQVFMCVDREAKRLIDCPLHKRSKCSDQV  245



>ref|XP_003613802.1| S-like ribonuclease [Medicago truncatula]
Length=552

 Score =   177 bits (448),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 88/195 (45%), Positives = 132/195 (68%), Gaps = 4/195 (2%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTW-LNGSWPENCNPNSLYDESK  594
            F+ ++ QWPGSYCD+K GCCYP TGKPA +F+I+GL P++ +NG+ P NC+  S++++SK
Sbjct  30   FFTFILQWPGSYCDSKLGCCYPKTGKPAADFTIYGLRPSFNINGTSPTNCDIQSVFNKSK  89

Query  593  ISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFL  420
            IS LIE ++  WP+L CP  N  K W HEW KHGTC  S   Q  YF++ L +K ++N L
Sbjct  90   ISDLIEDLEINWPSLRCPRLNNIKIWSHEWMKHGTCSESKLSQHDYFQTALKLKKKLNLL  149

Query  419  QALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDI  240
            Q L++AG +P+  FY++      I+   G  P +ECN D++   Q+ ++Y+CVD++G + 
Sbjct  150  QMLKDAGFEPNDQFYDIGNPLSIIEDATGFLPGMECNRDSAGNDQVLKVYMCVDISGSNF  209

Query  239  IECPTTVQRNCNTTV  195
            I+CP+ V  NC   +
Sbjct  210  IQCPSLVD-NCGAKL  223



>emb|CDP14821.1| unnamed protein product [Coffea canephora]
Length=232

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/193 (43%), Positives = 117/193 (61%), Gaps = 4/193 (2%)
 Frame = -2

Query  797  AAADHNSDLFYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNP  618
            ++AD+  D FY Y+ +WPGS C TK+GCC   T KPA +F I G  P + NG+WPENC+P
Sbjct  26   SSADNPPDFFYVYL-KWPGSQCATKEGCCLTKTPKPARDFIITGFQPYYFNGTWPENCDP  84

Query  617  NSLYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCS---IFDQCAYFESTL  447
             S  D SKIS+L  R++  WP+L+CP +N  K W   W+K+GTCS   + +Q  YF   L
Sbjct  85   ASHLDVSKISHLRTRLEVHWPSLTCPGSNPEKLWSDAWKKYGTCSKPTLKNQQEYFRQAL  144

Query  446  NIKDRVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYI  267
             ++   N L+ L +AGI+PDG+ Y  + I + I  G    P + C++D    SQL Q+ +
Sbjct  145  AVRKSANLLKILGDAGIRPDGSSYPRDTISDTIIGGGLHLPGLGCSTDKDGNSQLDQVIL  204

Query  266  CVDLNGKDIIECP  228
            C   + K   ECP
Sbjct  205  CTGSDAKTFTECP  217



>ref|XP_002461070.1| hypothetical protein SORBIDRAFT_02g040170 [Sorghum bicolor]
 gb|EER97591.1| hypothetical protein SORBIDRAFT_02g040170 [Sorghum bicolor]
Length=251

 Score =   167 bits (423),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 80/223 (36%), Positives = 114/223 (51%), Gaps = 31/223 (14%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWL-------------------  648
            F+Y V+QWPGS+CDT++GCC+P   KPA  F IHG+WP +                    
Sbjct  24   FFYLVQQWPGSFCDTRQGCCFPDDTKPAAAFGIHGMWPNYAKCRGRQGLARAMLGDAAGA  83

Query  647  -----------NGSWPENCNPNSLYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWE  501
                          WPE C+  +     +I  L+  +   WPTLSC +    +FW +EW+
Sbjct  84   DDAFLSTVGRRGKCWPEYCDDGNELSPWEIRDLVASLDRSWPTLSCKNRRSFQFWSYEWK  143

Query  500  KHGTCSIFDQCAYFESTLNIKDRVNFLQALENAGIKP-DGNFYEVEAIKEAIKAGVGVTP  324
            KHGTCS  +   YF   L +K + +    L +AGI P D   Y V ++++AI  G G   
Sbjct  144  KHGTCSNLEPHDYFARALALKAKHDLAAILADAGIVPSDTETYTVSSVRDAIAQGTGFVA  203

Query  323  LIECNSDASKVSQLYQIYICVDLNGKDIIECPTTVQRNCNTTV  195
             +ECN DA   +QL+Q+Y CVD + K +I+CP  +   C   V
Sbjct  204  NLECNRDADGEAQLFQVYQCVDRDAKKLIDCPLAMPTKCTDRV  246



>tpg|DAA63734.1| TPA: ribonuclease 1 [Zea mays]
Length=259

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/246 (35%), Positives = 122/246 (50%), Gaps = 38/246 (15%)
 Frame = -2

Query  824  FVTAFAEDDAAADHNSDLFYYYVEQWPGSYCDTKKGCCYP-STGKPATNFSIHGLWPTWL  648
             +++F  D + A+     F+Y V+QWPGS+CDT++GCC+P   GKPA  F IHGLWP + 
Sbjct  11   LLSSFLADSSTAEEFD--FFYLVQQWPGSFCDTRQGCCFPDGAGKPAAAFGIHGLWPNYA  68

Query  647  -------------------------------NGSWPENCNPNSLYDESK---ISYLIERM  570
                                              WPE C       +     I  L+  +
Sbjct  69   KCRGRHHREGGGLARAVLGAGDAFLAAVGRRGKCWPEYCGGGGGGHQLSPWDIRDLVASL  128

Query  569  QSEWPTLSCPSNNGSKFWKHEWEKHGTCSIFDQCAYFESTLNIKDRVNFLQALENAGIKP  390
               WPTLSC +    +FW +EW+KHGTCS  D   YF   L ++ R +    L +AGI P
Sbjct  129  GRSWPTLSCKNRRSFEFWSYEWKKHGTCSNLDPHDYFARALQLRARHDLAAVLADAGIVP  188

Query  389  -DGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDIIECPTTVQR  213
             D + Y V+ +++AI  G G    +ECN DA   +QL+Q+Y CVD   KD+I+CP  +  
Sbjct  189  SDTDTYPVDRVRDAIAQGTGFAANLECNRDADGEAQLFQVYQCVDREAKDLIDCPLPMPT  248

Query  212  NCNTTV  195
             C   V
Sbjct  249  KCTDRV  254



>ref|NP_001151299.1| ribonuclease 1 precursor [Zea mays]
 gb|ACG42296.1| ribonuclease 1 precursor [Zea mays]
Length=261

 Score =   162 bits (410),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 83/231 (36%), Positives = 114/231 (49%), Gaps = 39/231 (17%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYP-STGKPATNFSIHGLWPTWL------------------  648
            F+Y V+QWPGS+CDT++GCC+P   GKP   F IHGLWP +                   
Sbjct  26   FFYLVQQWPGSFCDTRQGCCFPDGAGKPEAAFGIHGLWPNYAKCRGRHHREGGGLARAVL  85

Query  647  -------------NGSWPENCNPNSLYDESK------ISYLIERMQSEWPTLSCPSNNGS  525
                            WPE C      D         +  L+  +   WPTLSC +    
Sbjct  86   GADDAFLAAVGRRGKCWPEYCGGGGDGDGGHQLSPWDVRDLVASLGRSWPTLSCKNRRSF  145

Query  524  KFWKHEWEKHGTCSIFDQCAYFESTLNIKDRVNFLQALENAGIKP-DGNFYEVEAIKEAI  348
            +FW +EW+KHGTCS  D   YF   L +++R +    L +AGI P D + Y V+ +++AI
Sbjct  146  EFWSYEWKKHGTCSNLDPHDYFARALQLRERHDLAAVLADAGIVPSDTDTYPVDRVRDAI  205

Query  347  KAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDIIECPTTVQRNCNTTV  195
              G G    +ECN DA   +QL+Q+Y CVD   KD+I+CP  +   C   V
Sbjct  206  AQGTGFVANLECNRDADGEAQLFQVYQCVDREAKDLIDCPLPMPTKCTDRV  256



>ref|XP_009796410.1| PREDICTED: intracellular ribonuclease LX-like isoform X2 [Nicotiana 
sylvestris]
Length=231

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/199 (40%), Positives = 115/199 (58%), Gaps = 19/199 (10%)
 Frame = -2

Query  785  HNSDL-FYYYVEQWPGSYCDTK--KGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPN  615
            H  DL FY    QW  + C  +    CC  +TG+PA +F I GLWP++ N ++PENCN  
Sbjct  22   HAKDLDFYRLTLQWNPAACYNRIIGKCCNTTTGRPAEDFGIAGLWPSYNNLTYPENCNKA  81

Query  614  SLYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCSIFDQCAYFESTLNIKD  435
              YDE++IS L+  MQ  WP +SCPSNNG+  W  EW++ GTCS  +  +YFE+ L++K+
Sbjct  82   GPYDETQISDLLSSMQKNWPKISCPSNNGTSLWAKEWKERGTCSRLNMHSYFETALDLKE  141

Query  434  RVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDL  255
            ++N +Q ++                + AIK  +G    IECN   +  SQ Y+++ICVD 
Sbjct  142  KLNLIQDVK----------------RYAIKLAIGHVIAIECNLGLTADSQFYRVHICVDK  185

Query  254  NGKDIIECPTTVQRNCNTT  198
            +G D I+CP  +     TT
Sbjct  186  SGSDFIDCPINLTEISETT  204



>gb|EEE68746.1| hypothetical protein OsJ_27436 [Oryza sativa Japonica Group]
Length=250

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/195 (41%), Positives = 109/195 (56%), Gaps = 27/195 (14%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESK-  594
            F++ V QWPGSYCDTK+ CCYP +GKPA +F IHGLWP   +GS+P+NC+P+S +D SK 
Sbjct  29   FFFLVLQWPGSYCDTKQSCCYPRSGKPAADFGIHGLWPNRDDGSYPQNCDPDSEFDPSKN  88

Query  593  --------ISYLIE------------RMQSEWPTLSCPSNNGSKFWKHEWEKHGTC---S  483
                    IS + E            R+   W      +   S   +      GTC   +
Sbjct  89   FFPSVYQPISPIKEVNFAATCWGACARIGRRW---RARATTASGSGRTSGRSTGTCAAAA  145

Query  482  IFDQCAYFESTLNIKDRVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSD  303
            + D+  YFE+   ++ R+    AL + G+ PDG +Y +  IK AI+ GVG  P +ECN D
Sbjct  146  LGDEHGYFEAGFRLRSRLPVFAALRDGGVSPDGGYYTLSQIKGAIQRGVGAEPFVECNRD  205

Query  302  ASKVSQLYQIYICVD  258
             S  SQLYQ+Y CV+
Sbjct  206  ESGNSQLYQLYFCVE  220



>gb|EPS67237.1| hypothetical protein M569_07540, partial [Genlisea aurea]
Length=146

 Score =   153 bits (387),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 93/126 (74%), Gaps = 2/126 (2%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V+QWPGSYCDT++ CC+P+ GKP  +F IHGLWP + +G++P NC+P++ +  S+I
Sbjct  21   FFYFVQQWPGSYCDTQRSCCFPTAGKPPPDFGIHGLWPNYNDGTYPSNCDPSNPFHLSQI  80

Query  590  SYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTC--SIFDQCAYFESTLNIKDRVNFLQ  417
              L+  M+  W +L+CPS NG+ FW HEW KHGTC  S+ +Q +YF + L +K +++ LQ
Sbjct  81   WDLVPEMEQNWASLACPSGNGTTFWSHEWNKHGTCSESVLNQHSYFSAALELKRKIDLLQ  140

Query  416  ALENAG  399
             L NAG
Sbjct  141  ILRNAG  146



>emb|CDX81620.1| BnaC08g39810D [Brassica napus]
Length=218

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/191 (41%), Positives = 109/191 (57%), Gaps = 28/191 (15%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            F+Y+V  WPG+ CD++KGCC P  G  A++F IHGLWP + N +WP  C+  +L+D SK+
Sbjct  28   FFYWVTYWPGAICDSQKGCCPPPKGNMASDFMIHGLWPQFNNDTWPAFCDQTNLFDISKV  87

Query  590  SYLIERMQ---SEWPTLSCPSNNGSKFWKHEWEKHGTCSIFDQCAYFESTLNIKDRVNFL  420
            S L+ RM+   +EW   +CPSN  +K W+HEW KHGT        Y + + ++K +    
Sbjct  88   SDLVSRMEKKWTEWGVWTCPSNE-TKLWEHEWNKHGT-------QYIKDSTSLKQK----  135

Query  419  QALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDI  240
                         FY    IK AIK  +G  P IECN D     QL+QIYIC+D   K+ 
Sbjct  136  -------------FYNHYEIKNAIKCAIGYAPGIECNEDVKGTKQLFQIYICLDNYAKEF  182

Query  239  IECPTTVQRNC  207
            +ECP    ++C
Sbjct  183  VECPYVPDKSC  193



>ref|XP_009395805.1| PREDICTED: ribonuclease 3-like [Musa acuminata subsp. malaccensis]
Length=241

 Score =   154 bits (389),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 113/194 (58%), Gaps = 4/194 (2%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWP-TWLNGSWPENCNPNSLYDESK  594
            FYY V  WPG+YC  +  CC P+TG P  +F + GLWP     G     CN +  +D  +
Sbjct  27   FYYLVLMWPGAYC-VQSACCRPTTGLPKNDFFVRGLWPFDSTTGKPVTKCNSDP-FDIDQ  84

Query  593  ISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCSIFDQCAYFESTLNIKDRVNFLQA  414
            +S L + + S W  L CPSNNG  +WK  W+ +G CS  ++  YF++ L+++ +V+ L  
Sbjct  85   LSSLNDDLNSYWANLKCPSNNGVVYWKKSWKTYGVCSPMNETEYFQAALDLRAKVDVLSL  144

Query  413  LENAGIKPDGNF-YEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDII  237
            L+  GIKP   + +    I++AI  G+G TP+I C+     + QLY+IYICV  +GK II
Sbjct  145  LDKKGIKPSLLYIHGASDIEKAIAEGIGATPVIRCSKGLLGLFQLYEIYICVAKDGKTII  204

Query  236  ECPTTVQRNCNTTV  195
            ECP   +  C+  +
Sbjct  205  ECPEKPRFTCSEEI  218



>ref|XP_010656419.1| PREDICTED: extracellular ribonuclease LE-like [Vitis vinifera]
Length=239

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 92/135 (68%), Gaps = 2/135 (1%)
 Frame = -2

Query  593  ISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCS--IFDQCAYFESTLNIKDRVNFL  420
            IS LI  MQ+ WPTL+CPS NG+KFW HEW KHGTCS  +  Q  YF++ L +K  V+ L
Sbjct  100  ISDLIILMQNNWPTLACPSGNGTKFWAHEWNKHGTCSESVLSQHQYFKAALGLKKDVDLL  159

Query  419  QALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDI  240
            Q LE AGIKP+G  Y ++  K+AIK  VG TP I+CN   S   QLYQ+Y+CVD +GK+ 
Sbjct  160  QILEKAGIKPNGESYCLKKTKKAIKDAVGFTPWIQCNVAPSGNRQLYQVYVCVDTSGKNF  219

Query  239  IECPTTVQRNCNTTV  195
            I+CP   +  C +++
Sbjct  220  IQCPVMPKGKCGSSI  234



>ref|XP_008785941.1| PREDICTED: extracellular ribonuclease LE-like isoform X1 [Phoenix 
dactylifera]
Length=247

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/195 (39%), Positives = 113/195 (58%), Gaps = 7/195 (4%)
 Frame = -2

Query  770  FYYYVEQWPGSYCDTKKGCCYPSTGKPATNFSIHGLWPTWLNGSWPEN---CNPNSLYDE  600
            F+Y V  WPG+YC  + GCC P+TG PA +F + GLW    N +  E+   C  NS +  
Sbjct  29   FFYLVFMWPGAYC-AQSGCCVPTTGLPADDFFLRGLWT--YNATTMESVTKCKKNSPFYI  85

Query  599  SKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCSIFDQCAYFESTLNIKDRVNFL  420
            +++S L E + S W  + CPS +G   WK  W+ +G CS  ++  YF+  L ++ +V+ L
Sbjct  86   NQLSGLREELNSYWTNIKCPSTDGKSTWKSTWKSYGVCSGMNETDYFQFALKLRAKVDLL  145

Query  419  QALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDI  240
              L+  GI PD N Y V  I+ AI  G+GVTP I C+       QLY++YICVD +G   
Sbjct  146  SLLKKQGIYPDYNLYNVTDIQSAIVEGIGVTPEIRCSKGPFNKFQLYEVYICVDKDGA-F  204

Query  239  IECPTTVQRNCNTTV  195
            +ECP +    C++++
Sbjct  205  MECPGSQGFTCSSSI  219



>emb|CBI27451.3| unnamed protein product [Vitis vinifera]
Length=133

 Score =   146 bits (368),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 88/128 (69%), Gaps = 2/128 (2%)
 Frame = -2

Query  572  MQSEWPTLSCPSNNGSKFWKHEWEKHGTCS--IFDQCAYFESTLNIKDRVNFLQALENAG  399
            MQ+ WPTL+CPS NG+KFW HEW KHGTCS  +  Q  YF++ L +K  V+ LQ LE AG
Sbjct  1    MQNNWPTLACPSGNGTKFWAHEWNKHGTCSESVLSQHQYFKAALGLKKDVDLLQILEKAG  60

Query  398  IKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLNGKDIIECPTTV  219
            IKP+G  Y ++  K+AIK  VG TP I+CN   S   QLYQ+Y+CVD +GK+ I+CP   
Sbjct  61   IKPNGESYCLKKTKKAIKDAVGFTPWIQCNVAPSGNRQLYQVYVCVDTSGKNFIQCPVMP  120

Query  218  QRNCNTTV  195
            +  C +++
Sbjct  121  KGKCGSSI  128



>ref|XP_004301762.1| PREDICTED: uncharacterized protein LOC101311199 [Fragaria vesca 
subsp. vesca]
Length=595

 Score =   154 bits (390),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 104/187 (56%), Gaps = 8/187 (4%)
 Frame = -2

Query  767  YYYVEQWPGSYCDT-KKGCCYPSTGKPATNFSIHGLWPTWLNGSWPENCNPNSLYDESKI  591
            +Y   QWPGSYC   K+GCCYP + +   +F+I G+W    +G  P  C   + +  SKI
Sbjct  32   FYIAYQWPGSYCAAAKQGCCYPRSIRKHPSFTIGGIWAYTFSGDMPTYCKSKTPFSLSKI  91

Query  590  SYLIERMQSEWPTLSCPSNNGS----KFWKHEWEKHGTC--SIFD-QCAYFESTLNIKDR  432
            S L   ++  WP+LSCPS+  S    K W  EWEK+ TC  S+F  Q  YF + LN++ R
Sbjct  92   SNLTRNLERNWPSLSCPSHTSSTSSVKLWLQEWEKYETCAESLFGGQYQYFHAALNLRKR  151

Query  431  VNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQIYICVDLN  252
            V  LQ L NA I P+G+FY V A   AI+      P   CN D S   QLYQI +C D  
Sbjct  152  VGMLQMLSNADIHPNGSFYNVTAFSSAIQKATIYLPGFTCNKDKSGNKQLYQIILCGDTA  211

Query  251  GKDIIEC  231
            G  I +C
Sbjct  212  GTKITDC  218



>gb|AAF45043.1|AF182197_1 RNase S-like protein precursor [Hordeum vulgare subsp. vulgare]
Length=252

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 80/207 (39%), Positives = 115/207 (56%), Gaps = 7/207 (3%)
 Frame = -2

Query  803  DDAAADHNSDLFYYYVEQWPGSYC-DTKKGCCYP-STGKPATNFSIHGLWPTWLNGS--W  636
              A A  +S ++Y     WPG+YC  T  GCC P S   PA +F + G   T LN +   
Sbjct  17   SSAIAVSDSGIYYQIGLMWPGAYCVQTTGGCCMPKSPIVPAADFYVSGF--TVLNATTDA  74

Query  635  PENCNPNSLYDESKISYLIERMQSEWPTLSCPSNNGSKFWKHEWEKHGTCSIFDQCAYFE  456
            PE    ++ ++  +I   I  ++  W  + CPSNNG K WK  W+  G CS  D  AYF+
Sbjct  75   PETSCSSTPFNSDEI-LGISGLRQYWSNIKCPSNNGQKSWKSAWKTSGVCSGLDDKAYFQ  133

Query  455  STLNIKDRVNFLQALENAGIKPDGNFYEVEAIKEAIKAGVGVTPLIECNSDASKVSQLYQ  276
            + + ++ ++N L  L + GIKPD   Y +E IK+AI+AG GV PLI+C+       QLYQ
Sbjct  134  AAIALRSKINPLSRLVSKGIKPDFGLYSLEKIKKAIQAGTGVAPLIQCSKGPFDKFQLYQ  193

Query  275  IYICVDLNGKDIIECPTTVQRNCNTTV  195
            I+ICV  + K +IECP   +  C+  +
Sbjct  194  IFICVAEDAKTLIECPKPQKFTCSDEI  220



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2193756387154