BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c28276_g1_i1 len=452 path=[15:0-451]

Length=452
                                                                      Score     E

gb|KCW76140.1|  hypothetical protein EUGRSUZ_D00517                     157   8e-44   
gb|KCW76139.1|  hypothetical protein EUGRSUZ_D00515                     157   1e-43   
emb|CDP18637.1|  unnamed protein product                                155   1e-43   
ref|XP_010054326.1|  PREDICTED: zingipain-2-like                        157   6e-43   
ref|XP_010054325.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    158   9e-43   
ref|XP_002523447.1|  cysteine protease, putative                        154   4e-42   Ricinus communis
ref|XP_002523448.1|  cysteine protease, putative                        154   4e-42   Ricinus communis
ref|XP_011005484.1|  PREDICTED: senescence-specific cysteine prot...    149   5e-42   
ref|XP_011008467.1|  PREDICTED: senescence-specific cysteine prot...    152   5e-42   
gb|KCW84689.1|  hypothetical protein EUGRSUZ_B01506                     152   5e-42   
ref|XP_006852525.1|  hypothetical protein AMTR_s00021p00178750          150   5e-42   
gb|KCW76128.1|  hypothetical protein EUGRSUZ_D00504                     152   7e-42   
ref|XP_010045987.1|  PREDICTED: ervatamin-B-like                        153   9e-42   
ref|XP_010052200.1|  PREDICTED: ervatamin-B-like                        152   1e-41   
ref|XP_010052203.1|  PREDICTED: ervatamin-B-like                        152   2e-41   
ref|XP_008805390.1|  PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-...    152   2e-41   
dbj|BAD29955.1|  cysteine protease                                      152   2e-41   Daucus carota [carrots]
ref|XP_011014387.1|  PREDICTED: senescence-specific cysteine prot...    148   2e-41   
gb|KDP45355.1|  hypothetical protein JCGZ_09604                         150   3e-41   
ref|XP_010045985.1|  PREDICTED: ervatamin-B-like                        151   4e-41   
ref|XP_008780645.1|  PREDICTED: vignain-like                            149   5e-41   
ref|XP_010054320.1|  PREDICTED: ervatamin-B-like                        151   5e-41   
ref|XP_010906196.1|  PREDICTED: senescence-specific cysteine prot...    150   5e-41   
ref|XP_010045986.1|  PREDICTED: ervatamin-B-like                        150   6e-41   
gb|KCW76123.1|  hypothetical protein EUGRSUZ_D00500                     150   7e-41   
ref|XP_006388352.1|  hypothetical protein POPTR_0213s00210g             146   8e-41   
ref|XP_009387347.1|  PREDICTED: vignain-like                            150   8e-41   
ref|XP_010052199.1|  PREDICTED: ervatamin-B-like                        150   8e-41   
gb|AAT34987.1|  putative cysteine protease                              150   8e-41   Gossypium hirsutum [American cotton]
ref|XP_009616844.1|  PREDICTED: zingipain-1-like                        150   9e-41   
ref|XP_011014388.1|  PREDICTED: senescence-specific cysteine prot...    150   1e-40   
ref|XP_010912725.1|  PREDICTED: zingipain-2-like                        150   1e-40   
ref|XP_010912736.1|  PREDICTED: senescence-specific cysteine prot...    149   1e-40   
ref|XP_006830175.1|  hypothetical protein AMTR_s00374p00012080          149   1e-40   
ref|XP_011086004.1|  PREDICTED: senescence-specific cysteine prot...    149   2e-40   
ref|XP_010054319.1|  PREDICTED: zingipain-2-like                        149   2e-40   
ref|XP_010277773.1|  PREDICTED: senescence-specific cysteine prot...    149   2e-40   
ref|XP_007025398.1|  Senescence-associated gene 12                      149   2e-40   
ref|XP_002305073.2|  hypothetical protein POPTR_0004s05540g             149   2e-40   Populus trichocarpa [western balsam poplar]
ref|XP_010045988.1|  PREDICTED: ervatamin-B-like                        149   2e-40   
ref|XP_002305072.2|  hypothetical protein POPTR_0004s05520g             149   3e-40   Populus trichocarpa [western balsam poplar]
ref|XP_010099379.1|  KDEL-tailed cysteine endopeptidase CEP1            149   3e-40   
ref|XP_009352795.1|  PREDICTED: ervatamin-B-like                        149   3e-40   
ref|XP_008800073.1|  PREDICTED: ervatamin-B-like                        149   3e-40   
ref|XP_008800071.1|  PREDICTED: ervatamin-B-like                        148   4e-40   
ref|XP_011086005.1|  PREDICTED: senescence-specific cysteine prot...    148   4e-40   
emb|CDP18641.1|  unnamed protein product                                148   5e-40   
ref|XP_006849385.1|  hypothetical protein AMTR_s01332p00008900          148   8e-40   
ref|XP_004303175.1|  PREDICTED: vignain-like                            147   8e-40   
ref|XP_007048792.1|  Senescence-associated gene 12                      147   1e-39   
ref|XP_004505522.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    147   1e-39   
ref|XP_002522559.1|  cysteine protease, putative                        147   1e-39   Ricinus communis
gb|AFR11773.1|  cysteine protease                                       147   1e-39   
gb|KFK31512.1|  hypothetical protein AALP_AA6G122300                    147   1e-39   
ref|XP_008779806.1|  PREDICTED: ervatamin-B-like                        147   1e-39   
gb|KHN38752.1|  Vignain                                                 146   2e-39   
ref|XP_006857797.1|  hypothetical protein AMTR_s00061p00215400          147   2e-39   
gb|KCW76137.1|  hypothetical protein EUGRSUZ_D00513                     146   2e-39   
ref|XP_006384060.1|  hypothetical protein POPTR_0004s05510g             147   2e-39   
ref|XP_010058990.1|  PREDICTED: ervatamin-B-like                        145   2e-39   
gb|EYU25679.1|  hypothetical protein MIMGU_mgv1a023356mg                147   2e-39   
ref|XP_010052206.1|  PREDICTED: ervatamin-B-like                        146   2e-39   
ref|XP_009344439.1|  PREDICTED: ervatamin-B-like                        146   2e-39   
ref|XP_008225221.1|  PREDICTED: vignain-like                            142   2e-39   
ref|XP_006417940.1|  hypothetical protein EUTSA_v10008102mg             146   2e-39   
dbj|BAF56430.1|  cysteine proteinase                                    146   2e-39   Lotus japonicus
ref|XP_009352793.1|  PREDICTED: zingipain-2-like                        146   2e-39   
ref|XP_006857795.1|  hypothetical protein AMTR_s00061p00215070          146   2e-39   
ref|XP_008383642.1|  PREDICTED: zingipain-1-like                        146   3e-39   
ref|XP_007048796.1|  Senescence-associated gene 12                      146   3e-39   
ref|XP_004290089.1|  PREDICTED: vignain-like                            146   3e-39   
ref|XP_011078044.1|  PREDICTED: senescence-specific cysteine prot...    146   3e-39   
ref|XP_008246197.1|  PREDICTED: vignain-like                            145   3e-39   
gb|KCW74062.1|  hypothetical protein EUGRSUZ_E02690                     145   4e-39   
dbj|BAF56428.1|  cysteine proteinase                                    146   4e-39   Lotus japonicus
gb|KHN05669.1|  Vignain                                                 145   4e-39   
ref|XP_006281607.1|  hypothetical protein CARUB_v10027725mg             145   4e-39   
gb|KDP38773.1|  hypothetical protein JCGZ_05109                         142   4e-39   
ref|XP_008244498.1|  PREDICTED: ervatamin-B-like                        145   5e-39   
ref|XP_010054327.1|  PREDICTED: vignain-like                            143   5e-39   
ref|XP_007213386.1|  hypothetical protein PRUPE_ppa026372mg             145   5e-39   
ref|XP_010052201.1|  PREDICTED: ervatamin-B-like                        145   5e-39   
ref|XP_009797968.1|  PREDICTED: vignain-like                            145   5e-39   
gb|KDP38776.1|  hypothetical protein JCGZ_05112                         142   5e-39   
ref|XP_006294508.1|  hypothetical protein CARUB_v10023540mg             145   5e-39   
ref|XP_007212667.1|  hypothetical protein PRUPE_ppa018342mg             145   6e-39   
ref|XP_010474538.1|  PREDICTED: senescence-specific cysteine prot...    145   6e-39   
gb|KDP21078.1|  hypothetical protein JCGZ_21549                         145   7e-39   
ref|XP_004289205.1|  PREDICTED: cysteine proteinase RD21a-like          146   7e-39   
ref|XP_008225270.1|  PREDICTED: zingipain-2-like                        145   7e-39   
ref|XP_004506025.1|  PREDICTED: vignain-like                            145   7e-39   
ref|XP_006449486.1|  hypothetical protein CICLE_v10018236mg             144   7e-39   
ref|XP_006857796.1|  hypothetical protein AMTR_s00061p00215230          145   8e-39   
ref|XP_009357173.1|  PREDICTED: ervatamin-B-like                        145   9e-39   
ref|XP_008228922.1|  PREDICTED: vignain-like                            144   1e-38   
ref|XP_006469012.1|  PREDICTED: vignain-like                            144   1e-38   
ref|XP_011045912.1|  PREDICTED: senescence-specific cysteine prot...    145   1e-38   
ref|XP_010052197.1|  PREDICTED: ervatamin-B-like                        145   1e-38   
ref|XP_010417893.1|  PREDICTED: ervatamin-B-like                        144   1e-38   
ref|XP_010510777.1|  PREDICTED: ervatamin-B-like                        144   1e-38   
ref|XP_004297571.1|  PREDICTED: vignain-like                            144   1e-38   
gb|KCW76141.1|  hypothetical protein EUGRSUZ_D00518                     143   1e-38   
ref|XP_007216164.1|  hypothetical protein PRUPE_ppa015341mg             140   1e-38   
ref|XP_009357171.1|  PREDICTED: ervatamin-B-like                        144   2e-38   
sp|P60994.1|ERVB_TABDI  RecName: Full=Ervatamin-B; Short=ERV-B          141   2e-38   Tabernaemontana divaricata [crepe jasmine]
ref|XP_011005485.1|  PREDICTED: senescence-specific cysteine prot...    144   2e-38   
ref|XP_010054322.1|  PREDICTED: ervatamin-B-like                        144   2e-38   
ref|XP_008810168.1|  PREDICTED: ervatamin-B-like isoform X2             144   2e-38   
ref|XP_007212585.1|  hypothetical protein PRUPE_ppa015944mg             144   2e-38   
ref|XP_011086001.1|  PREDICTED: senescence-specific cysteine prot...    144   2e-38   
ref|XP_006446792.1|  hypothetical protein CICLE_v10018253mg             144   2e-38   
gb|KDP38777.1|  hypothetical protein JCGZ_05113                         141   2e-38   
gb|EYU19040.1|  hypothetical protein MIMGU_mgv1a026538mg                144   2e-38   
ref|XP_003538185.1|  PREDICTED: vignain-like                            144   2e-38   
gb|KDO63329.1|  hypothetical protein CISIN_1g047793mg                   144   2e-38   
ref|XP_008382007.1|  PREDICTED: ervatamin-B-like                        144   2e-38   
ref|XP_009629965.1|  PREDICTED: ervatamin-B-like                        144   2e-38   
ref|XP_009357172.1|  PREDICTED: ervatamin-B-like                        144   2e-38   
ref|XP_010426443.1|  PREDICTED: ervatamin-B                             144   2e-38   
ref|XP_008810167.1|  PREDICTED: ervatamin-B-like isoform X1             144   2e-38   
ref|XP_004233054.1|  PREDICTED: senescence-specific cysteine prot...    144   2e-38   
ref|XP_011078542.1|  PREDICTED: senescence-specific cysteine prot...    144   2e-38   
ref|XP_008244476.1|  PREDICTED: ervatamin-B-like                        144   3e-38   
ref|XP_009775915.1|  PREDICTED: ervatamin-B-like                        144   3e-38   
ref|XP_002865220.1|  senescence-associated gene 12                      144   3e-38   
ref|NP_563764.1|  Cysteine proteinases superfamily protein              144   3e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008244499.1|  PREDICTED: ervatamin-B-like                        144   3e-38   
ref|XP_004252652.2|  PREDICTED: senescence-specific cysteine prot...    143   3e-38   
ref|XP_006663343.1|  PREDICTED: vignain-like                            143   3e-38   
ref|XP_008779585.1|  PREDICTED: zingipain-2-like                        143   3e-38   
ref|XP_006348972.1|  PREDICTED: oryzain alpha chain-like                142   3e-38   
ref|XP_003607546.1|  Cysteine proteinase                                144   3e-38   
ref|XP_009365508.1|  PREDICTED: vignain-like                            146   4e-38   
ref|XP_006362426.1|  PREDICTED: vignain-like                            143   4e-38   
ref|XP_006292980.1|  hypothetical protein CARUB_v10019256mg             143   4e-38   
ref|XP_003580686.1|  PREDICTED: oryzain alpha chain-like isoform X1     144   4e-38   
ref|XP_006469011.1|  PREDICTED: vignain-like                            143   4e-38   
ref|XP_007214432.1|  hypothetical protein PRUPE_ppa025658mg             143   4e-38   
gb|AAC49135.1|  SAG12 protein                                           143   4e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010518799.1|  PREDICTED: senescence-specific cysteine prot...    143   4e-38   
ref|XP_006469128.1|  PREDICTED: vignain-like                            143   4e-38   
ref|XP_009623244.1|  PREDICTED: ervatamin-B-like                        143   4e-38   
ref|XP_009761201.1|  PREDICTED: ervatamin-B-like                        143   4e-38   
ref|XP_004297572.1|  PREDICTED: vignain-like                            143   4e-38   
ref|XP_004306851.1|  PREDICTED: vignain-like                            143   4e-38   
ref|XP_010240524.1|  PREDICTED: oryzain alpha chain-like isoform X2     143   4e-38   
ref|XP_010091034.1|  KDEL-tailed cysteine endopeptidase CEP1            143   5e-38   
ref|XP_010939512.1|  PREDICTED: senescence-specific cysteine prot...    143   5e-38   
ref|XP_006360708.1|  PREDICTED: vignain-like                            143   5e-38   
ref|XP_006470293.1|  PREDICTED: xylem cysteine proteinase 1-like ...    143   5e-38   
gb|KDP45578.1|  hypothetical protein JCGZ_17185                         143   5e-38   
ref|XP_006470294.1|  PREDICTED: xylem cysteine proteinase 1-like ...    143   5e-38   
ref|XP_010481519.1|  PREDICTED: senescence-specific cysteine prot...    143   5e-38   
ref|XP_007025397.1|  Senescence-associated gene 12, putative            142   6e-38   
ref|XP_009372437.1|  PREDICTED: cysteine proteinase COT44-like          143   6e-38   
ref|XP_008338342.1|  PREDICTED: cysteine proteinase COT44-like          143   6e-38   
ref|XP_009119072.1|  PREDICTED: ervatamin-B                             143   6e-38   
ref|XP_002889596.1|  hypothetical protein ARALYDRAFT_887827             142   6e-38   
gb|KDP23983.1|  hypothetical protein JCGZ_25371                         142   7e-38   
ref|XP_009609383.1|  PREDICTED: ervatamin-B                             142   7e-38   
ref|XP_002316833.2|  hypothetical protein POPTR_0011s07520g             143   8e-38   Populus trichocarpa [western balsam poplar]
ref|XP_002524912.1|  cysteine protease, putative                        143   8e-38   Ricinus communis
ref|XP_006446793.1|  hypothetical protein CICLE_v10018274mg             142   9e-38   
gb|KFK31525.1|  hypothetical protein AALP_AA6G123900                    142   9e-38   
ref|XP_006362420.1|  PREDICTED: vignain-like                            142   9e-38   
emb|CDX86529.1|  BnaC08g01740D                                          143   9e-38   
ref|XP_004306597.1|  PREDICTED: vignain-like                            142   1e-37   
ref|XP_010103045.1|  KDEL-tailed cysteine endopeptidase CEP1            142   1e-37   
ref|XP_009361500.1|  PREDICTED: vignain-like                            142   1e-37   
ref|XP_010462580.1|  PREDICTED: ervatamin-B-like                        141   1e-37   
ref|XP_010070600.1|  PREDICTED: cysteine proteinase COT44-like          143   1e-37   
ref|XP_007213554.1|  hypothetical protein PRUPE_ppa018048mg             142   1e-37   
ref|XP_009359967.1|  PREDICTED: vignain-like                            142   1e-37   
ref|XP_007132275.1|  hypothetical protein PHAVU_011G081100g             142   1e-37   
dbj|BAM66994.1|  germination-specific cysteine protease 1               139   1e-37   
ref|XP_008811650.1|  PREDICTED: vignain-like                            141   1e-37   
ref|XP_006857794.1|  hypothetical protein AMTR_s00061p00214890          142   1e-37   
ref|XP_008228868.1|  PREDICTED: LOW QUALITY PROTEIN: zingipain-2-...    142   1e-37   
gb|EYU19037.1|  hypothetical protein MIMGU_mgv1a018631mg                141   1e-37   
ref|XP_009150151.1|  PREDICTED: macrodontain-1-like                     142   1e-37   
ref|XP_008340724.1|  PREDICTED: vignain-like                            142   1e-37   
ref|XP_003609015.1|  Cysteine proteinase                                142   1e-37   
ref|XP_010475355.1|  PREDICTED: ervatamin-B-like                        141   1e-37   
ref|XP_009110997.1|  PREDICTED: ervatamin-B-like                        142   1e-37   
gb|KDO55227.1|  hypothetical protein CISIN_1g019112mg                   142   2e-37   
ref|XP_009601308.1|  PREDICTED: ervatamin-B-like isoform X3             141   2e-37   
ref|XP_006446541.1|  hypothetical protein CICLE_v10015814mg             142   2e-37   
gb|EYU43350.1|  hypothetical protein MIMGU_mgv1a021555mg                141   2e-37   
ref|XP_010431170.1|  PREDICTED: senescence-specific cysteine prot...    141   2e-37   
ref|XP_007226492.1|  hypothetical protein PRUPE_ppa026538mg             141   2e-37   
ref|XP_009601307.1|  PREDICTED: ervatamin-B-like isoform X2             141   2e-37   
ref|XP_006470292.1|  PREDICTED: xylem cysteine proteinase 1-like ...    142   2e-37   
ref|XP_007211535.1|  hypothetical protein PRUPE_ppa008267mg             141   2e-37   
ref|XP_004252606.1|  PREDICTED: senescence-specific cysteine prot...    141   2e-37   
gb|AAB23155.1|  COT44=cysteine proteinase homolog                       141   2e-37   
sp|P25251.1|CYSP4_BRANA  RecName: Full=Cysteine proteinase COT44;...    141   2e-37   Brassica napus [oilseed rape]
ref|XP_011021998.1|  PREDICTED: senescence-specific cysteine prot...    141   2e-37   
ref|XP_007227669.1|  hypothetical protein PRUPE_ppa025602mg             141   2e-37   
ref|XP_010906195.1|  PREDICTED: senescence-specific cysteine prot...    139   2e-37   
ref|XP_010052198.1|  PREDICTED: ervatamin-B-like                        141   2e-37   
ref|XP_006470291.1|  PREDICTED: xylem cysteine proteinase 1-like ...    141   2e-37   
ref|XP_006467666.1|  PREDICTED: vignain-like                            141   2e-37   
gb|EYU25672.1|  hypothetical protein MIMGU_mgv1a018700mg                141   2e-37   
ref|XP_011022002.1|  PREDICTED: senescence-specific cysteine prot...    142   2e-37   
ref|XP_004487576.1|  PREDICTED: vignain-like                            141   2e-37   
ref|XP_008340386.1|  PREDICTED: cysteine proteinase COT44-like          142   2e-37   
gb|KDP23984.1|  hypothetical protein JCGZ_25372                         141   2e-37   
ref|NP_568651.1|  cysteine protease SAG12                               141   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006285150.1|  hypothetical protein CARUB_v10006494mg             141   2e-37   
ref|XP_008348586.1|  PREDICTED: ervatamin-B-like                        141   2e-37   
ref|XP_008223852.1|  PREDICTED: ervatamin-B-like                        141   2e-37   
ref|XP_008803660.1|  PREDICTED: ervatamin-B-like                        141   2e-37   
ref|XP_009407029.1|  PREDICTED: ervatamin-B-like                        141   2e-37   
emb|CDY10188.1|  BnaC05g04310D                                          141   2e-37   
ref|XP_009359957.1|  PREDICTED: ervatamin-B-like                        141   2e-37   
ref|XP_004957245.1|  PREDICTED: vignain-like                            141   3e-37   
ref|XP_011078435.1|  PREDICTED: senescence-specific cysteine prot...    141   3e-37   
ref|XP_009367558.1|  PREDICTED: cysteine proteinase COT44-like          141   3e-37   
ref|XP_010054324.1|  PREDICTED: ervatamin-B-like                        140   3e-37   
gb|AEK97329.1|  chromoplast senescence-associated protein 12            139   3e-37   
ref|XP_004308524.1|  PREDICTED: vignain-like                            141   3e-37   
emb|CDY15571.1|  BnaA08g28550D                                          141   3e-37   
gb|EYU25680.1|  hypothetical protein MIMGU_mgv1a019612mg                140   3e-37   
gb|AAC35211.1|  cysteine proteinase                                     141   3e-37   Hemerocallis hybrid cultivar
ref|XP_009128825.1|  PREDICTED: ervatamin-B                             141   3e-37   
gb|AGT97048.1|  senescence-specific cysteine protease                   141   3e-37   
emb|CDX69285.1|  BnaC01g01680D                                          141   3e-37   
ref|XP_009397226.1|  PREDICTED: zingipain-2-like                        141   3e-37   
ref|XP_009392372.1|  PREDICTED: ervatamin-B-like                        139   3e-37   
ref|XP_009601306.1|  PREDICTED: ervatamin-B-like isoform X1             140   3e-37   
ref|XP_008225268.1|  PREDICTED: zingipain-2-like                        140   4e-37   
ref|XP_004304987.1|  PREDICTED: vignain-like                            141   4e-37   
ref|XP_006398274.1|  hypothetical protein EUTSA_v10000948mg             140   4e-37   
ref|XP_004306836.1|  PREDICTED: vignain-like                            140   4e-37   
emb|CDY44047.1|  BnaA08g15590D                                          141   4e-37   
ref|XP_009109364.1|  PREDICTED: cysteine proteinase COT44-like          141   4e-37   
emb|CDY22445.1|  BnaC03g61580D                                          141   4e-37   
gb|KFK23231.1|  hypothetical protein AALP_AAs59427U000100               138   4e-37   
ref|XP_009354269.1|  PREDICTED: ervatamin-B-like                        140   4e-37   
emb|CDX87758.1|  BnaC02g31910D                                          140   4e-37   
ref|XP_008780330.1|  PREDICTED: vignain-like                            136   4e-37   
ref|XP_008223851.1|  PREDICTED: ervatamin-B-like                        140   5e-37   
ref|XP_009359979.1|  PREDICTED: ervatamin-B-like                        140   5e-37   
ref|XP_002307151.2|  hypothetical protein POPTR_0005s09140g             139   5e-37   Populus trichocarpa [western balsam poplar]
ref|XP_008797119.1|  PREDICTED: vignain-like                            139   5e-37   
ref|XP_008349211.1|  PREDICTED: zingipain-2-like                        140   5e-37   
gb|AIA26572.1|  cysteine protease                                       140   5e-37   
ref|XP_004294729.1|  PREDICTED: vignain-like                            140   5e-37   
ref|XP_011009172.1|  PREDICTED: senescence-specific cysteine prot...    140   5e-37   
ref|XP_009137836.1|  PREDICTED: cysteine proteinase COT44               140   5e-37   
gb|AAD53011.1|AF089848_1  senescence-specific cysteine protease         140   5e-37   Brassica napus [oilseed rape]
ref|XP_006343212.1|  PREDICTED: cysteine proteinase RD21a-like          140   5e-37   
ref|XP_008225269.1|  PREDICTED: uncharacterized protein LOC103324934    144   6e-37   
ref|XP_004513101.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    140   6e-37   
emb|CDX75633.1|  BnaA01g00690D                                          140   6e-37   
ref|XP_010501342.1|  PREDICTED: ervatamin-B-like                        139   6e-37   
gb|AHA62780.1|  RCR3-like cysteine protease                             140   6e-37   
ref|XP_010494742.1|  PREDICTED: senescence-specific cysteine prot...    140   6e-37   
gb|KHN08873.1|  Vignain                                                 140   6e-37   
ref|XP_008362418.1|  PREDICTED: vignain-like                            136   7e-37   
ref|XP_006582264.1|  PREDICTED: vignain-like                            140   7e-37   
gb|AAP32194.1|  cysteine protease 1                                     139   7e-37   Trifolium repens [creeping white clover]
ref|XP_006582263.1|  PREDICTED: vignain-like                            140   7e-37   
dbj|BAD29959.1|  cysteine protease                                      140   7e-37   Daucus carota [carrots]
gb|AHA62783.1|  RCR3-like cysteine protease                             140   7e-37   
ref|XP_010441658.1|  PREDICTED: senescence-specific cysteine prot...    140   8e-37   
ref|XP_006362436.1|  PREDICTED: vignain-like                            140   8e-37   
ref|XP_009354268.1|  PREDICTED: ervatamin-B-like                        140   8e-37   
ref|XP_006360707.1|  PREDICTED: vignain-like                            139   8e-37   
ref|XP_010928804.1|  PREDICTED: xylem cysteine proteinase 1-like        140   8e-37   
ref|XP_008353750.1|  PREDICTED: ervatamin-B-like                        139   9e-37   
ref|XP_009354321.1|  PREDICTED: ervatamin-B-like                        140   9e-37   
ref|XP_009617815.1|  PREDICTED: ervatamin-B-like                        139   1e-36   
ref|XP_008342777.1|  PREDICTED: ervatamin-B-like                        139   1e-36   
tpg|DAA42119.1|  TPA: hypothetical protein ZEAMMB73_388689              137   1e-36   
ref|XP_006367781.1|  PREDICTED: LOW QUALITY PROTEIN: KDEL-tailed ...    139   1e-36   
ref|XP_006446763.1|  hypothetical protein CICLE_v10017432mg             139   1e-36   
ref|XP_010040207.1|  PREDICTED: ervatamin-B-like                        139   1e-36   
ref|XP_010317330.1|  PREDICTED: uncharacterized protein LOC101251741    144   1e-36   
ref|XP_006470296.1|  PREDICTED: xylem cysteine proteinase 1-like        139   1e-36   
ref|XP_010906194.1|  PREDICTED: senescence-specific cysteine prot...    139   1e-36   
ref|XP_010445171.1|  PREDICTED: zingipain-2-like                        139   1e-36   
gb|EAY80530.1|  hypothetical protein OsI_35710                          140   1e-36   
ref|XP_008799976.1|  PREDICTED: vignain-like                            136   1e-36   
ref|XP_004252607.1|  PREDICTED: senescence-specific cysteine prot...    139   1e-36   
ref|XP_004232961.1|  PREDICTED: zingipain-2-like                        139   1e-36   
ref|XP_002306369.1|  hypothetical protein POPTR_0005s09080g             139   1e-36   
sp|P84347.1|MEX2_JACME  RecName: Full=Chymomexicain                     136   2e-36   
ref|XP_009352952.1|  PREDICTED: fruit bromelain-like                    138   2e-36   
ref|XP_003539770.1|  PREDICTED: vignain-like                            139   2e-36   
ref|XP_002877667.1|  hypothetical protein ARALYDRAFT_348033             139   2e-36   
ref|XP_008342782.1|  PREDICTED: ervatamin-B-like                        139   2e-36   
gb|KHN27806.1|  Vignain                                                 138   2e-36   
ref|XP_008238897.1|  PREDICTED: cysteine proteinase COT44               139   2e-36   
ref|XP_008371737.1|  PREDICTED: vignain-like                            136   2e-36   
ref|XP_006384061.1|  hypothetical protein POPTR_0004s05530g             135   2e-36   
ref|XP_008362421.1|  PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-...    139   2e-36   
ref|XP_006388351.1|  hypothetical protein POPTR_0213s00200g             135   2e-36   
ref|XP_004234718.1|  PREDICTED: cysteine proteinase COT44-like          139   2e-36   
ref|XP_009798361.1|  PREDICTED: ervatamin-B-like                        139   2e-36   
ref|XP_010682353.1|  PREDICTED: vignain-like                            139   2e-36   
ref|XP_009608954.1|  PREDICTED: zingipain-2-like                        139   2e-36   
ref|XP_011100224.1|  PREDICTED: zingipain-2                             139   2e-36   
ref|XP_006306197.1|  hypothetical protein CARUB_v10011832mg             139   2e-36   
gb|AAW78661.2|  senescence-specific cysteine protease                   139   2e-36   
gb|AAP32197.1|  cysteine protease 10                                    137   2e-36   
ref|XP_004306813.1|  PREDICTED: vignain-like                            139   2e-36   
ref|XP_010059344.1|  PREDICTED: zingipain-2-like                        139   2e-36   
ref|XP_006283942.1|  hypothetical protein CARUB_v10005061mg             139   2e-36   
ref|XP_003540013.1|  PREDICTED: vignain-like                            138   2e-36   
ref|XP_008342776.1|  PREDICTED: ervatamin-B-like                        138   2e-36   
gb|AAS20467.1|  cysteine protease-like protein                          136   2e-36   
ref|XP_002280246.1|  PREDICTED: senescence-specific cysteine prot...    138   2e-36   
ref|NP_195406.2|  cysteine proteinase1                                  139   2e-36   
sp|Q94B08.2|GCP1_ARATH  RecName: Full=Germination-specific cystei...    139   2e-36   
gb|KHN05670.1|  Vignain                                                 137   3e-36   
gb|ABF70145.1|  cysteine protease, putative                             139   3e-36   
gb|KCW76125.1|  hypothetical protein EUGRSUZ_D00501                     139   3e-36   
ref|XP_007205396.1|  hypothetical protein PRUPE_ppa007467mg             139   3e-36   
ref|XP_009352948.1|  PREDICTED: ervatamin-B-like                        139   3e-36   
ref|XP_010057075.1|  PREDICTED: ervatamin-B-like                        138   3e-36   
ref|XP_008805113.1|  PREDICTED: vignain-like                            139   3e-36   
emb|CAN70559.1|  hypothetical protein VITISV_032465                     138   3e-36   
ref|XP_009349242.1|  PREDICTED: vignain-like                            140   3e-36   
gb|KHN33968.1|  Vignain                                                 135   3e-36   
ref|XP_003635767.1|  Cysteine proteinase                                138   3e-36   
gb|KHN13721.1|  Vignain                                                 138   3e-36   
ref|XP_007214244.1|  hypothetical protein PRUPE_ppa023515mg             138   3e-36   
ref|XP_004966191.1|  PREDICTED: oryzain alpha chain-like                139   3e-36   
ref|XP_002280204.1|  PREDICTED: senescence-specific cysteine prot...    138   3e-36   
ref|XP_008225219.1|  PREDICTED: ervatamin-C-like                        138   3e-36   
gb|AHA62781.1|  RCR3-like cysteine protease                             138   3e-36   
ref|XP_008356984.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    139   4e-36   
ref|XP_002450949.1|  hypothetical protein SORBIDRAFT_05g021550          139   4e-36   
ref|XP_010686291.1|  PREDICTED: zingipain-2-like                        138   4e-36   
gb|AAK27968.1|AF242372_1  cysteine protease                             138   4e-36   
gb|AHA62779.1|  RCR3-like cysteine protease                             138   4e-36   
ref|XP_002531152.1|  cysteine protease, putative                        138   4e-36   
gb|KHN05804.1|  Vignain                                                 137   4e-36   
ref|XP_010059348.1|  PREDICTED: zingipain-2-like                        138   4e-36   
gb|AHA62782.1|  RCR3-like cysteine protease                             138   5e-36   
ref|XP_007132875.1|  hypothetical protein PHAVU_011G132100g             138   5e-36   
gb|AAL14199.1|  cysteine proteinase precursor                           137   5e-36   
ref|NP_001067630.1|  Os11g0255300                                       138   5e-36   
ref|XP_006291442.1|  hypothetical protein CARUB_v10017578mg             137   5e-36   
gb|AAR92154.1|  putative cysteine protease 1                            137   5e-36   
ref|XP_003557016.1|  PREDICTED: vignain-like                            137   6e-36   
ref|XP_004987388.1|  PREDICTED: xylem cysteine proteinase 2-like        138   6e-36   
ref|XP_003526229.1|  PREDICTED: vignain-like                            136   6e-36   
gb|AAP32198.1|  cysteine protease 12                                    137   6e-36   
ref|XP_003578721.1|  PREDICTED: senescence-specific cysteine prot...    137   6e-36   
gb|EYU29820.1|  hypothetical protein MIMGU_mgv1a009422mg                137   7e-36   
gb|AAP32195.1|  cysteine protease 5                                     137   7e-36   
dbj|BAF46311.1|  cysteine proteinase precursor                          137   7e-36   
sp|P82474.1|CPGP2_ZINOF  RecName: Full=Zingipain-2; AltName: Full...    134   7e-36   
ref|XP_010040203.1|  PREDICTED: ervatamin-B-like                        137   7e-36   
ref|NP_566920.1|  putative cysteine proteinase                          137   7e-36   
ref|XP_006408714.1|  hypothetical protein EUTSA_v10002030mg             137   7e-36   
ref|XP_006362428.1|  PREDICTED: vignain-like                            137   7e-36   
dbj|BAJ95283.1|  predicted protein                                      137   8e-36   
ref|XP_002531151.1|  cysteine protease, putative                        137   8e-36   
ref|XP_003527350.1|  PREDICTED: vignain-like                            137   8e-36   
ref|XP_010054318.1|  PREDICTED: ervatamin-B-like                        137   8e-36   
gb|AAP32196.1|  cysteine protease 8                                     137   8e-36   
ref|XP_002437491.1|  hypothetical protein SORBIDRAFT_10g028010          138   8e-36   
ref|XP_004243398.1|  PREDICTED: ervatamin-B                             137   8e-36   
tpg|DAA42116.1|  TPA: hypothetical protein ZEAMMB73_388689              138   9e-36   
gb|KFK42951.1|  hypothetical protein AALP_AA1G060200                    137   9e-36   
ref|XP_011097243.1|  PREDICTED: cysteine proteinase COT44               137   9e-36   
ref|XP_010238315.1|  PREDICTED: ervatamin-B-like                        137   9e-36   
ref|XP_002280230.2|  PREDICTED: LOW QUALITY PROTEIN: senescence-s...    137   9e-36   
ref|XP_009767421.1|  PREDICTED: ervatamin-B-like                        137   9e-36   
ref|XP_006830174.1|  hypothetical protein AMTR_s00374p00005120          137   9e-36   
gb|KCW76118.1|  hypothetical protein EUGRSUZ_D00495                     137   1e-35   
ref|XP_010052196.1|  PREDICTED: zingipain-2-like                        137   1e-35   
emb|CAN64655.1|  hypothetical protein VITISV_005140                     137   1e-35   
ref|XP_010056876.1|  PREDICTED: zingipain-2-like                        137   1e-35   
ref|XP_006411912.1|  hypothetical protein EUTSA_v10025483mg             137   1e-35   
dbj|BAF00916.1|  cysteine proteinase                                    137   1e-35   
gb|KCW47322.1|  hypothetical protein EUGRSUZ_K01110                     136   1e-35   
ref|XP_003612210.1|  Cysteine proteinase                                137   1e-35   
ref|XP_002868998.1|  cysteine proteinase                                137   1e-35   
emb|CBI30671.3|  unnamed protein product                                136   1e-35   
gb|EYU34557.1|  hypothetical protein MIMGU_mgv1a007408mg                138   1e-35   
ref|XP_004505498.1|  PREDICTED: vignain-like                            137   1e-35   
ref|XP_003605890.1|  Cysteine proteinase                                136   1e-35   
ref|XP_003577598.1|  PREDICTED: vignain                                 137   1e-35   
gb|AFJ15104.1|  mexicain-like cystein protease                          136   1e-35   
gb|KCW76116.1|  hypothetical protein EUGRSUZ_D00493                     137   1e-35   
ref|XP_004231872.1|  PREDICTED: zingipain-2-like                        137   1e-35   
ref|XP_003607574.1|  Cysteine protease                                  136   1e-35   
ref|XP_010448692.1|  PREDICTED: zingipain-2-like                        137   1e-35   
ref|XP_002274223.1|  PREDICTED: senescence-specific cysteine prot...    136   1e-35   
ref|XP_007047371.1|  Granulin repeat cysteine protease family pro...    137   1e-35   
ref|XP_009352792.1|  PREDICTED: zingipain-1-like                        136   1e-35   
gb|KHN33962.1|  Vignain                                                 135   1e-35   
ref|XP_004489011.1|  PREDICTED: vignain-like                            136   1e-35   
ref|XP_010432076.1|  PREDICTED: germination-specific cysteine pro...    137   1e-35   
gb|KHN08187.1|  Thiol protease SEN102                                   136   1e-35   
ref|XP_010059331.1|  PREDICTED: zingipain-2-like                        136   2e-35   
gb|KDP30997.1|  hypothetical protein JCGZ_11373                         137   2e-35   
ref|XP_010038688.1|  PREDICTED: ervatamin-B-like                        136   2e-35   
ref|XP_008342781.1|  PREDICTED: ervatamin-B-like                        136   2e-35   
ref|XP_002280215.1|  PREDICTED: senescence-specific cysteine prot...    136   2e-35   
ref|NP_001237379.1|  cysteine proteinase precursor                      137   2e-35   
ref|XP_006582266.1|  PREDICTED: thiol protease SEN102-like              136   2e-35   
gb|EMT33085.1|  Vignain                                                 136   2e-35   
ref|XP_009793843.1|  PREDICTED: zingipain-2-like                        137   2e-35   
ref|XP_008229136.1|  PREDICTED: zingipain-2                             136   2e-35   
ref|XP_004293931.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    136   2e-35   
ref|XP_010446685.1|  PREDICTED: germination-specific cysteine pro...    137   2e-35   
ref|XP_004501841.1|  PREDICTED: vignain-like                            136   2e-35   
ref|XP_009775922.1|  PREDICTED: zingipain-2                             136   2e-35   
ref|XP_006380488.1|  hypothetical protein POPTR_0007s07170g             136   2e-35   
ref|XP_006494485.1|  PREDICTED: cysteine proteinase RD21a-like          137   2e-35   
ref|XP_010686289.1|  PREDICTED: senescence-specific cysteine prot...    136   2e-35   
gb|EMT12294.1|  Vignain                                                 136   2e-35   
ref|XP_006449484.1|  hypothetical protein CICLE_v10017947mg             136   2e-35   
ref|XP_003558756.1|  PREDICTED: senescence-specific cysteine prot...    136   2e-35   
pdb|2PNS|A  Chain A, 1.9 Angstrom Resolution Crystal Structure Of...    132   2e-35   
ref|XP_006592465.1|  PREDICTED: vignain-like                            136   2e-35   
ref|XP_007048673.1|  Senescence-associated gene 12, putative            135   2e-35   
ref|NP_001148894.1|  LOC100282514 precursor                             136   2e-35   
ref|XP_009784112.1|  PREDICTED: cysteine proteinase COT44-like          136   2e-35   
ref|XP_006652104.1|  PREDICTED: vignain-like                            135   2e-35   
ref|XP_004299172.1|  PREDICTED: vignain-like                            136   3e-35   
ref|XP_010038689.1|  PREDICTED: ervatamin-B-like                        135   3e-35   
emb|CAL64936.1|  putative cysteine protease 8                           135   3e-35   
ref|XP_006468205.1|  PREDICTED: actinidain-like                         135   3e-35   
ref|XP_004292313.1|  PREDICTED: xylem cysteine proteinase 1-like        136   3e-35   
ref|XP_008350674.1|  PREDICTED: zingipain-2-like                        135   3e-35   
ref|XP_006376349.1|  hypothetical protein POPTR_0013s12260g             135   3e-35   
ref|XP_003527349.1|  PREDICTED: vignain-like                            135   3e-35   
gb|KDO77829.1|  hypothetical protein CISIN_1g037516mg                   135   3e-35   
dbj|BAB13759.1|  cysteine proteinase                                    135   3e-35   
ref|XP_003638507.1|  Cysteine proteinase                                136   3e-35   
ref|XP_010058815.1|  PREDICTED: zingipain-2-like                        134   3e-35   
tpg|DAA40428.1|  TPA: Vignain                                           136   3e-35   
ref|XP_004977049.1|  PREDICTED: oryzain alpha chain-like                137   3e-35   
gb|AGW21712.1|  cysteine protease 2                                     131   3e-35   
ref|XP_009617814.1|  PREDICTED: zingipain-2-like                        135   3e-35   
ref|XP_009609587.1|  PREDICTED: zingipain-2-like                        132   3e-35   
ref|XP_003556992.1|  PREDICTED: vignain-like                            135   3e-35   
gb|EAY93078.1|  hypothetical protein OsI_14879                          135   3e-35   
gb|KCW74661.1|  hypothetical protein EUGRSUZ_E03389                     135   3e-35   
ref|XP_002872576.1|  hypothetical protein ARALYDRAFT_489965             136   3e-35   
emb|CAB16317.1|  cysteine proteinase precursor                          136   3e-35   
emb|CAB09698.1|  cysteine proteinase                                    135   3e-35   
gb|KFK30309.1|  hypothetical protein AALP_AA7G245200                    136   3e-35   
ref|XP_007025413.1|  Maternal effect embryo arrest 18                   140   3e-35   
ref|XP_004505502.1|  PREDICTED: vignain-like                            135   3e-35   
ref|XP_003607548.1|  Cysteine protease                                  135   3e-35   
ref|XP_007050065.1|  Senescence-associated gene 12                      135   4e-35   
gb|KCW73671.1|  hypothetical protein EUGRSUZ_E02263                     135   4e-35   
ref|XP_009759551.1|  PREDICTED: zingipain-2-like                        135   4e-35   
ref|XP_004975184.1|  PREDICTED: vignain-like                            135   4e-35   
gb|ADV41672.1|  cysteine protease                                       135   4e-35   
ref|XP_002972714.1|  hypothetical protein SELMODRAFT_98707              137   4e-35   
ref|XP_010248838.1|  PREDICTED: vignain-like                            136   4e-35   
emb|CAA40073.1|  endopeptidase (EP-C1)                                  135   4e-35   
ref|XP_004967598.1|  PREDICTED: xylem cysteine proteinase 2-like        135   4e-35   
ref|XP_007132865.1|  hypothetical protein PHAVU_011G131200g             135   4e-35   
tpg|DAA53037.1|  TPA: hypothetical protein ZEAMMB73_586844              140   4e-35   
ref|XP_006652103.1|  PREDICTED: cysteine protease 1-like                135   4e-35   
sp|P25803.2|CYSEP_PHAVU  RecName: Full=Vignain; AltName: Full=Bea...    135   4e-35   
ref|XP_011038211.1|  PREDICTED: senescence-specific cysteine prot...    135   4e-35   
gb|ACY38051.3|  cysteine proteinase C1A                                 135   4e-35   
ref|XP_007137980.1|  hypothetical protein PHAVU_009G170800g             135   4e-35   
ref|XP_002310708.2|  hypothetical protein POPTR_0007s10650g             135   4e-35   
ref|XP_009786836.1|  PREDICTED: vignain-like                            131   5e-35   
ref|XP_009145796.1|  PREDICTED: probable cysteine proteinase At3g...    136   5e-35   
ref|XP_006434710.1|  hypothetical protein CICLE_v100010542mg            134   5e-35   
ref|XP_010929952.1|  PREDICTED: vignain isoform X1                      135   5e-35   
ref|XP_010277012.1|  PREDICTED: low-temperature-induced cysteine ...    137   5e-35   
ref|XP_006469054.1|  PREDICTED: oryzain alpha chain-like                132   5e-35   
ref|XP_010522111.1|  PREDICTED: ervatamin-B                             135   5e-35   
emb|CDY46179.1|  BnaA05g20660D                                          136   5e-35   
gb|ABQ10200.1|  cysteine protease Cp2                                   135   5e-35   
ref|XP_003607571.1|  Cysteine proteinase EP-B                           135   5e-35   
ref|XP_002445702.1|  hypothetical protein SORBIDRAFT_07g024430          135   5e-35   
ref|XP_009385160.1|  PREDICTED: vignain-like                            135   5e-35   
emb|CAE54307.1|  cysteine proteinase                                    135   6e-35   
ref|XP_008454976.1|  PREDICTED: low-temperature-induced cysteine ...    137   6e-35   
ref|XP_009396268.1|  PREDICTED: oryzain alpha chain-like                136   6e-35   
gb|ACN27279.1|  unknown                                                 133   6e-35   
ref|XP_011038210.1|  PREDICTED: senescence-specific cysteine prot...    135   6e-35   
gb|AAW34135.1|  cysteine protease gp2b                                  135   6e-35   
sp|P83443.1|MDO1_PSEMR  RecName: Full=Macrodontain-1; AltName: Fu...    132   6e-35   
gb|AFP73327.1|  cysteine protease                                       135   6e-35   
gb|KHG00992.1|  Cysteinease RD21a -like protein                         135   6e-35   
gb|AER60490.1|  cysteine proteases                                      135   6e-35   
pdb|1S4V|A  Chain A, The 2.0 A Crystal Structure Of The Kdel-Tail...    132   6e-35   
gb|AFJ15103.1|  mexicain-like cystein protease                          135   6e-35   
ref|XP_004979206.1|  PREDICTED: vignain-like                            135   6e-35   
gb|AEP83812.2|  cysteine endopeptidase EP8                              135   7e-35   
ref|XP_006852216.1|  hypothetical protein AMTR_s00049p00133800          135   7e-35   
ref|XP_009796444.1|  PREDICTED: xylem cysteine proteinase 1-like        135   7e-35   
ref|XP_010437247.1|  PREDICTED: germination-specific cysteine pro...    135   7e-35   
ref|XP_008345990.1|  PREDICTED: zingipain-2-like                        134   7e-35   
ref|XP_008382503.1|  PREDICTED: xylem cysteine proteinase 1-like        135   7e-35   



>gb|KCW76140.1| hypothetical protein EUGRSUZ_D00517 [Eucalyptus grandis]
Length=324

 Score =   157 bits (398),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 105/151 (70%), Gaps = 8/151 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAA+E ITQI+TG+L+ LSEQQL+DC ++NYGC GGWM  AF +I+ NGG+  ++
Sbjct  133  WAFSAVAAIESITQIKTGKLLELSEQQLVDCTIENYGCSGGWMDTAFDYIIQNGGISSET  192

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPY A   +CNA  +  S A I GY++V A+ E  +L AV  QPVSV L   G  FQ Y
Sbjct  193  NYPYDASDGTCNAHMASLSVAKIVGYEDVPANNEGEILKAVAMQPVSVALDGSGQEFQLY  252

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +  SG+F+GN     CG+   HA+ I+GYGT
Sbjct  253  S--SGVFNGN-----CGTNMSHAVAIVGYGT  276



>gb|KCW76139.1| hypothetical protein EUGRSUZ_D00515 [Eucalyptus grandis]
Length=339

 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 105/151 (70%), Gaps = 8/151 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAA+E ITQI+TG+L+ LSEQQL+DC ++NYGC GGWM  AF +I+ NGG+  ++
Sbjct  148  WAFSAVAAIESITQIKTGKLLELSEQQLVDCTIENYGCSGGWMDTAFDYIIQNGGISSET  207

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPY A   +CNA  +  S A I GY++V A+ E  +L AV  QPVSV L   G  FQ Y
Sbjct  208  NYPYNASDGTCNAHMASLSVAKIVGYEDVPANNEGEILKAVAMQPVSVALDGSGREFQSY  267

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +  SG+F+GN     CG+   HA+ I+GYGT
Sbjct  268  S--SGVFNGN-----CGTNMSHAVAIVGYGT  291



>emb|CDP18637.1| unnamed protein product [Coffea canephora]
Length=243

 Score =   155 bits (391),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 108/153 (71%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGI Q++TG+L+ LSEQ+L+DC+   ++ GC GG M  AF FI++N GL  
Sbjct  50   WAFSAVAAMEGIHQLKTGKLISLSEQELVDCDTAGEDEGCNGGLMDDAFTFIINNNGLTT  109

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPYQAV  +CN+    N AA ITGY++V A+ E+ALL AV  QPVSV +   G  FQ
Sbjct  110  EANYPYQAVDGTCNSNKEANHAAKITGYEDVPANNEAALLKAVANQPVSVAIDASGNGFQ  169

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+  SG+F     AGDCG+   H +T +GYGT
Sbjct  170  FYS--SGVF-----AGDCGTELDHGVTAVGYGT  195



>ref|XP_010054326.1| PREDICTED: zingipain-2-like [Eucalyptus grandis]
Length=419

 Score =   157 bits (398),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 105/151 (70%), Gaps = 8/151 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAA+E ITQI+TG+L+ LSEQQL+DC ++NYGC GGWM  AF +I+ NGG+  ++
Sbjct  148  WAFSAVAAIESITQIKTGKLLELSEQQLVDCTIENYGCSGGWMDTAFDYIIQNGGISSET  207

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPY A   +CNA  +  S A I GY++V A+ E  +L AV  QPVSV L   G  FQ Y
Sbjct  208  NYPYDASDGTCNAHMASLSVAKIVGYEDVPANNEGEILKAVAMQPVSVALDGSGQEFQLY  267

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +  SG+F+GN     CG+   HA+ I+GYGT
Sbjct  268  S--SGVFNGN-----CGTNMSHAVAIVGYGT  291



>ref|XP_010054325.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP1-like [Eucalyptus 
grandis]
Length=473

 Score =   158 bits (399),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 105/151 (70%), Gaps = 8/151 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAA+E ITQI+TG+L+ LSEQQL+DC ++NYGC GGWM  AF +I+ NGG+  ++
Sbjct  171  WAFSAVAAIESITQIKTGKLLELSEQQLVDCTIENYGCSGGWMDTAFDYIIQNGGISSET  230

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPY A   +CNA  +  S A I GY++V A+ E  +L AV  QPVSV L   G  FQ Y
Sbjct  231  NYPYNASDGTCNAHMASLSVAKIVGYEDVPANNEGEILKAVAMQPVSVALDGSGREFQSY  290

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +  SG+F+GN     CG+   HA+ I+GYGT
Sbjct  291  S--SGVFNGN-----CGTNMSHAVAIVGYGT  314



>ref|XP_002523447.1| cysteine protease, putative [Ricinus communis]
 gb|EEF38906.1| cysteine protease, putative [Ricinus communis]
Length=342

 Score =   154 bits (388),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 105/153 (69%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGIT++ TG+L+ LSEQ+L+DC+   ++ GC GG M  AF+FI  NGGL  
Sbjct  149  WAFSAVAAMEGITKLSTGKLISLSEQELVDCDTSGEDQGCEGGLMDDAFEFIKQNGGLTT  208

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPYQ    +CN   +GN AA ITGY++V A+ E ALL AV  QPVSV +   G  FQ
Sbjct  209  EANYPYQGTDGTCNTNKAGNDAAKITGYEDVPANSEDALLKAVASQPVSVAIDASGSAFQ  268

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+   G+F+     GDCG+   H +T +GYGT
Sbjct  269  FYS--GGVFT-----GDCGTELDHGVTAVGYGT  294



>ref|XP_002523448.1| cysteine protease, putative [Ricinus communis]
 gb|EEF38907.1| cysteine protease, putative [Ricinus communis]
Length=341

 Score =   154 bits (388),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 105/153 (69%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGIT++ TG+L+ LSEQ+L+DC+   ++ GC GG M  AF+FI  NGGL  
Sbjct  149  WAFSAVAAMEGITKLSTGKLISLSEQELVDCDTSGEDQGCEGGLMDDAFEFIKQNGGLTT  208

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPYQ    +CN   +GN AA ITGY++V A+ E ALL AV  QPVSV +   G  FQ
Sbjct  209  EANYPYQGTDGTCNTNKAGNDAAKITGYEDVPANSEDALLKAVASQPVSVAIDASGSAFQ  268

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+   G+F+     GDCG+   H +T +GYGT
Sbjct  269  FYS--GGVFT-----GDCGTELDHGVTAVGYGT  294



>ref|XP_011005484.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=197

 Score =   149 bits (377),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 106/151 (70%), Gaps = 8/151 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFS VAA+EGI +++TG+L+ LSEQQL+DC++ N GC GG+M  AFQ+I+ NGGL  + 
Sbjct  6    WAFSTVAAIEGIIKLKTGKLISLSEQQLVDCDVGNNGCHGGFMDNAFQYIIRNGGLASED  65

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPYQ V  +CN++ + +  A ITGY++V  + E+ALL AV  QPVSV +   G  FQ+Y
Sbjct  66   NYPYQGVDGTCNSEKASSIEAEITGYEDVPQNNENALLQAVAKQPVSVGIDGGGQDFQFY  125

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
               SG+F      GDCG+   HA+T IGYGT
Sbjct  126  --KSGVFK-----GDCGTEQNHAVTAIGYGT  149



>ref|XP_011008467.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=305

 Score =   152 bits (385),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 107/151 (71%), Gaps = 8/151 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFS VAA+EGI +++TG+L+ LSEQQL+DC++ N GC GG+M  AFQ+I+ NGGL  + 
Sbjct  114  WAFSTVAAIEGIIKLKTGKLISLSEQQLVDCDVGNNGCHGGFMDNAFQYIIRNGGLASED  173

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPYQ V  +CN++ + +  A ITGY++V  + E+ALL AV  QPVSV++   G  FQ+Y
Sbjct  174  NYPYQGVDGTCNSEKASSIEAEITGYEDVPQNNENALLQAVAKQPVSVVVDGGGQDFQFY  233

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
               SG+F      GDCG+   HA+T IGYGT
Sbjct  234  --KSGVFK-----GDCGTEQNHAVTAIGYGT  257



>gb|KCW84689.1| hypothetical protein EUGRSUZ_B01506, partial [Eucalyptus grandis]
Length=295

 Score =   152 bits (384),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 109/153 (71%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGITQ+ TG+L  LSEQ+L+DC+   ++ GC GG M  AFQFI+ N GL  
Sbjct  116  WAFSAVAAMEGITQLTTGKLTSLSEQELVDCDRSGEDQGCGGGLMDDAFQFIISNHGLTT  175

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVAS-GESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPYQAV  +CNA+ + ++AA I+GY++V S  ESALL AV +QPVSV +      FQ
Sbjct  176  EANYPYQAVDNTCNARKAASTAAKISGYEDVPSNSESALLKAVAHQPVSVAIDAGETDFQ  235

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+  +GIF+     G+CG+   H +T +GYGT
Sbjct  236  FYS--TGIFT-----GECGTDLDHGVTAVGYGT  261



>ref|XP_006852525.1| hypothetical protein AMTR_s00021p00178750 [Amborella trichopoda]
 gb|ERN13992.1| hypothetical protein AMTR_s00021p00178750 [Amborella trichopoda]
Length=227

 Score =   150 bits (379),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 104/150 (69%), Gaps = 8/150 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAA+EGIT+I+TG+L+ LSEQQL+DC+ +N GC GG+M  AFQ+I  NGGL  +S
Sbjct  37   WAFSAVAALEGITKIKTGKLVSLSEQQLIDCDTENDGCMGGYMVTAFQYIRANGGLSTES  96

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPYQA   +C+ + +   AA+I GY+EV A+ E+ LL AV  QPVSV +   G  FQ+Y
Sbjct  97   NYPYQAADGNCDTRRASYHAASIRGYREVPANNENELLKAVVQQPVSVAIDASGYAFQFY  156

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
                GIFS     G CG+   H +T +GYG
Sbjct  157  --KGGIFS-----GACGTELNHGVTAVGYG  179



>gb|KCW76128.1| hypothetical protein EUGRSUZ_D00504 [Eucalyptus grandis]
Length=318

 Score =   152 bits (385),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 103/150 (69%), Gaps = 8/150 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAAMEGIT I+ G+LM LS Q+L+DC++ + GC GG M  AF+FI   GGL  ++
Sbjct  127  WAFSAVAAMEGITMIKKGKLMPLSVQELVDCDVDDNGCHGGLMDRAFKFIKSKGGLSTEA  186

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPYQA   +CN     N AA+ITGYQ+V A+ E ALL AV  QPVSV +   G  FQ+Y
Sbjct  187  NYPYQANNGTCNTAKMANPAASITGYQDVPANNEKALLQAVANQPVSVAIEGSGFNFQFY  246

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +  SG+FSG+     CG+   HA+T +GYG
Sbjct  247  S--SGVFSGS-----CGTSIDHAVTAVGYG  269



>ref|XP_010045987.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=364

 Score =   153 bits (387),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 109/153 (71%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGITQ+ TG+L  LSEQ+L+DC+   ++ GC GG M  AFQFI+ N GL  
Sbjct  171  WAFSAVAAMEGITQLTTGKLTSLSEQELVDCDRSGEDQGCGGGLMDDAFQFIISNHGLTT  230

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVAS-GESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPYQAV  +CNA+ + ++AA I+GY++V S  ESALL AV +QPVSV +      FQ
Sbjct  231  EANYPYQAVDNTCNARKAASTAAKISGYEDVPSNSESALLKAVAHQPVSVAIDAGETDFQ  290

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+  +GIF+     G+CG+   H +T +GYGT
Sbjct  291  FYS--TGIFT-----GECGTDLDHGVTAVGYGT  316



>ref|XP_010052200.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=342

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 103/150 (69%), Gaps = 8/150 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAAMEGIT I+ G+LM LS Q+L+DC++ + GC GG M  AF+FI   GGL  ++
Sbjct  151  WAFSAVAAMEGITMIKKGKLMPLSVQELVDCDVDDNGCHGGLMDRAFKFIKSKGGLSTEA  210

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPYQA   +CN     N AA+ITGYQ+V A+ E ALL AV  QPVSV +   G  FQ+Y
Sbjct  211  NYPYQANNGTCNTAKMANPAASITGYQDVPANNEKALLQAVANQPVSVAIEGSGFNFQFY  270

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +  SG+FSG+     CG+   HA+T +GYG
Sbjct  271  S--SGVFSGS-----CGTSIDHAVTAVGYG  293



>ref|XP_010052203.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76130.1| hypothetical protein EUGRSUZ_D00506 [Eucalyptus grandis]
Length=345

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 108/152 (71%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEG+TQ++  +L+ LS Q+L+DC++  K+ GCRGG+M  AF+F++ NGGL  
Sbjct  152  WAFSAVAAMEGLTQLKKRKLVPLSVQELVDCDVNGKDKGCRGGYMDSAFEFVISNGGLTT  211

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPYQ   ++CN   +   AA+ITGYQ+V A+ E ALL AV  QPVSV +   G  FQ
Sbjct  212  EAEYPYQGTDRTCNKAKTAKHAASITGYQDVPANNEKALLQAVANQPVSVAIEGGGLKFQ  271

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
             Y+  SG+F+G+     CG+   HA+T++GYG
Sbjct  272  LYS--SGVFTGS-----CGTDIDHAVTVVGYG  296



>ref|XP_008805390.1| PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 110/153 (72%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGIT+++TG+LM LSEQ+L+DC++   + GC GG M  AF+FI++N GL  
Sbjct  149  WAFSAVAAMEGITKLKTGKLMSLSEQELVDCDVASDDQGCDGGLMDNAFKFIINNRGLTT  208

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY+ +  +CN++ S +  A+I GY++V A+ E+ALL AV  QPVSV +    G FQ
Sbjct  209  ETNYPYKGIDGTCNSKKSASHVASIKGYEDVPANSEAALLKAVANQPVSVAIEASSGSFQ  268

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+  SGIF+G+     CG+   H +T +GYGT
Sbjct  269  FYS--SGIFTGS-----CGTDLDHGVTTVGYGT  294



>dbj|BAD29955.1| cysteine protease [Daucus carota]
Length=365

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 106/153 (69%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDC--NLKNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGITQ++TG+L+ LSEQ+L+DC  N ++ GC GG M +AF FI  N GL  
Sbjct  148  WAFSAVAAMEGITQLKTGKLISLSEQELVDCDTNGEDQGCEGGLMDYAFDFIQQNHGLST  207

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY     +CNA    N AATITG+++V A+ ESALL AV  QP+SV +   G  FQ
Sbjct  208  ETNYPYSGTDGTCNANKEANHAATITGHEDVPANSESALLKAVANQPISVAIDASGSDFQ  267

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+  SG+F+     G+CG+   H +T +GYGT
Sbjct  268  FYS--SGVFT-----GECGTELDHGVTAVGYGT  293



>ref|XP_011014387.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=197

 Score =   148 bits (373),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 105/151 (70%), Gaps = 8/151 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFS VAA+EGI +++TG+L+ LSEQQL+DC++ N GC GG M  AFQ+I+ NGGL  + 
Sbjct  6    WAFSTVAAIEGIIKLKTGKLISLSEQQLVDCDVGNKGCGGGIMDNAFQYIIRNGGLASED  65

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPYQ V  +CN++ + +  A ITGY++V  + E+ALL AV  QPVSV +   G  FQ+Y
Sbjct  66   NYPYQGVDGTCNSEKASSIEAEITGYEDVPQNNENALLQAVAKQPVSVGIDGGGQDFQFY  125

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
               SG+F      GDCG+   HA+T IGYGT
Sbjct  126  --KSGVFK-----GDCGTEQNHAVTAIGYGT  149



>gb|KDP45355.1| hypothetical protein JCGZ_09604 [Jatropha curcas]
Length=311

 Score =   150 bits (380),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 107/153 (70%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGIT+++TG L+ LSEQ+L+DC++  ++YGC GG+M  AFQ+I+ NGGL  
Sbjct  118  WAFSAVAAMEGITKLKTGNLISLSEQELVDCDVAGEDYGCDGGFMDTAFQYILKNGGLTS  177

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVASG-ESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPYQ     C+ + +  S A ITGY++V S  E ALL AV  QPVSV +   G  F+
Sbjct  178  EANYPYQGEDGICSKKKTATSMAKITGYEDVPSNSEKALLQAVANQPVSVAIDASGYDFR  237

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+  SG+F      GDC +   HA+T+IGYG+
Sbjct  238  FYS--SGVFK-----GDCPTDLNHAVTVIGYGS  263



>ref|XP_010045985.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW84687.1| hypothetical protein EUGRSUZ_B01504 [Eucalyptus grandis]
Length=342

 Score =   151 bits (381),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 109/153 (71%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAV AMEGI Q+ TG+L+ LSEQ+L+DC+   K++GC GG+M  AF+FI+   GL  
Sbjct  149  WAFSAVGAMEGIIQLTTGKLISLSEQELVDCDTSGKDHGCEGGYMDDAFKFIIGRHGLTT  208

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPYQAV  +CNA+ + +SAA ITGY +V A+ ESALL AV +QPVSV +      FQ
Sbjct  209  ETNYPYQAVDGTCNARKANSSAAKITGYADVPANNESALLKAVGHQPVSVAIDAGEWAFQ  268

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+  SGIF+     G+CG+   H +T +GYGT
Sbjct  269  FYS--SGIFT-----GECGTNLDHGVTAVGYGT  294



>ref|XP_008780645.1| PREDICTED: vignain-like, partial [Phoenix dactylifera]
Length=286

 Score =   149 bits (377),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 103/151 (68%), Gaps = 8/151 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAA EGI QI TG+L  LSEQQL+DC+ KN GC GG M  AF+FI+ N G+  ++
Sbjct  95   WAFSAVAATEGIAQISTGKLTSLSEQQLVDCDKKNGGCDGGIMDDAFKFIISNKGITTEA  154

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPY A   +C+   S + AATI+GY++V  + ES+LL AV  QPVSV +   G  FQ+Y
Sbjct  155  NYPYMAKDGTCDTNKSSSVAATISGYEDVPRNSESSLLQAVAKQPVSVAIEGSGKDFQFY  214

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +   G+F GN     CG+   HA+T++GYGT
Sbjct  215  S--GGVFMGN-----CGTDLDHAVTVVGYGT  238



>ref|XP_010054320.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76122.1| hypothetical protein EUGRSUZ_D00499 [Eucalyptus grandis]
Length=345

 Score =   151 bits (381),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 105/150 (70%), Gaps = 8/150 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAAMEGIT I+ G+L+ LS Q+L+DC+  + GC GG M  AF+FI+ NGGL  ++
Sbjct  152  WAFSAVAAMEGITMIKKGKLVPLSVQELVDCDDNDDGCMGGLMDSAFEFIVSNGGLTTEA  211

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPYQ +  +CN   + N AA+ITGYQ+V A+ E ALL AV  QPVSV +   G  FQ+Y
Sbjct  212  NYPYQGIDGTCNTAKTANQAASITGYQDVPANNEKALLQAVANQPVSVAIEGGGYNFQFY  271

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +  SG+F+G+     CG+   HA+T +GYG
Sbjct  272  S--SGVFTGS-----CGTDIDHAVTAVGYG  294



>ref|XP_010906196.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=342

 Score =   150 bits (380),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 112/153 (73%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGIT+++TG+L+ LSEQ+L+DC++  ++ GC GG M  AF+FI+ NGGL  
Sbjct  149  WAFSAVAAMEGITKLKTGKLISLSEQELVDCDVAGEDQGCEGGLMDDAFEFIIRNGGLTT  208

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY+ +  +CN + S + AA+I GY++V A+ E+ALL AV+ QPVSV +   G  FQ
Sbjct  209  ETNYPYKGIDGTCNTKKSFSHAASIKGYEDVPANSEAALLNAVSNQPVSVAIEASGYSFQ  268

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+  SG+F+G+     CG+   H +T +GYGT
Sbjct  269  FYS--SGVFTGS-----CGTDLDHGVTAVGYGT  294



>ref|XP_010045986.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW84688.1| hypothetical protein EUGRSUZ_B01505 [Eucalyptus grandis]
Length=342

 Score =   150 bits (380),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 108/153 (71%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAV AMEG  Q+ TG+L+ LSEQ+L+DC+   ++ GC GG+M  AF+FI+ N GL  
Sbjct  149  WAFSAVGAMEGNNQLTTGKLISLSEQELVDCDTSGEDQGCEGGFMDNAFEFIIGNHGLTT  208

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPYQAV  +CNA+   +SAA ITGY++V A+ ESALL AV +QPVSV +      FQ
Sbjct  209  ETNYPYQAVDGTCNARKEASSAAKITGYEDVPANSESALLKAVAHQPVSVAIDAGESAFQ  268

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+  SGIF+     G+CG+   H +T +GYGT
Sbjct  269  FYS--SGIFT-----GECGTNLDHGVTAVGYGT  294



>gb|KCW76123.1| hypothetical protein EUGRSUZ_D00500 [Eucalyptus grandis]
Length=345

 Score =   150 bits (380),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 105/150 (70%), Gaps = 8/150 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAAMEGIT I+ G+L+ LS Q+L+DC+  + GC GG M  AF+FI+ NGGL  ++
Sbjct  152  WAFSAVAAMEGITMIKKGKLVPLSVQELVDCDDNDDGCMGGLMDSAFEFIVSNGGLTTEA  211

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPYQ +  +CN   + N AA+ITGYQ+V A+ E ALL AV  QPVSV +   G  FQ+Y
Sbjct  212  NYPYQGIDGTCNTAKTANQAASITGYQDVPANNEKALLQAVANQPVSVSIEGGGYNFQFY  271

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +  SG+F+G+     CG+   HA+T +GYG
Sbjct  272  S--SGVFTGS-----CGTDIDHAVTAVGYG  294



>ref|XP_006388352.1| hypothetical protein POPTR_0213s00210g, partial [Populus trichocarpa]
 gb|ERP47266.1| hypothetical protein POPTR_0213s00210g, partial [Populus trichocarpa]
Length=194

 Score =   146 bits (369),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 103/151 (68%), Gaps = 8/151 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFS VAA+EGI +++TG L+ LSEQQL+DC   N GC+GG M  AFQ+I+ NGGL  + 
Sbjct  3    WAFSTVAAIEGIIKLQTGNLISLSEQQLVDCTAGNKGCQGGLMDTAFQYIIRNGGLTSED  62

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPYQ V  +C+++ + ++ A ITGY++V  + E+ALL AV  QPVSV +   G  F++Y
Sbjct  63   NYPYQGVDGTCSSEKAASTEAQITGYEDVPQNNENALLQAVAKQPVSVAVDGGGNDFRFY  122

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
               SG+F      GDCG+   H +T IGYGT
Sbjct  123  --KSGVFE-----GDCGTNLNHGVTAIGYGT  146



>ref|XP_009387347.1| PREDICTED: vignain-like [Musa acuminata subsp. malaccensis]
Length=359

 Score =   150 bits (380),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 101/151 (67%), Gaps = 8/151 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAA+EGI QIRT +L+ LSEQ+L++C+ +++GCRGG M +AF+FI  NGG+  ++
Sbjct  152  WAFSAVAAVEGINQIRTNELVPLSEQELVNCDKQDHGCRGGLMDYAFEFIKTNGGITTEA  211

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGMFQYY  358
            DYPY A Q  CN    G     I GY++V  + E AL+ AV  QPVSV +   G  FQ+Y
Sbjct  212  DYPYLAKQTKCNVIKKGCHVVVIDGYEDVPVNDEEALMKAVANQPVSVAVEASGPDFQFY  271

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +   G+F+     GDCG+   H + ++GYGT
Sbjct  272  S--EGVFT-----GDCGTALDHGVAVVGYGT  295



>ref|XP_010052199.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76124.1| hypothetical protein EUGRSUZ_D00500 [Eucalyptus grandis]
Length=345

 Score =   150 bits (379),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 105/150 (70%), Gaps = 8/150 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAAMEGIT I+ G+L+ LS Q+L+DC+  + GC GG M  AF+FI+ NGGL  ++
Sbjct  152  WAFSAVAAMEGITMIKKGKLVPLSVQELVDCDDNDDGCMGGLMDSAFEFIVSNGGLTTEA  211

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPYQ +  +CN   + N AA+ITGYQ+V A+ E ALL AV  QPVSV +   G  FQ+Y
Sbjct  212  NYPYQGIDGTCNTAKTANQAASITGYQDVPANNEKALLQAVANQPVSVSIEGGGYNFQFY  271

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +  SG+F+G+     CG+   HA+T +GYG
Sbjct  272  S--SGVFTGS-----CGTDIDHAVTAVGYG  294



>gb|AAT34987.1| putative cysteine protease [Gossypium hirsutum]
Length=344

 Score =   150 bits (379),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 108/152 (71%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA+EGITQI TG+L+ LSEQ+L+DC+ K  ++GC GG M  AF+FI++NGGL  
Sbjct  151  WAFSAVAAIEGITQISTGKLISLSEQELVDCDTKGIDHGCEGGLMDTAFEFIINNGGLTT  210

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +S+YPY+    +CN   +   A +ITGY++V A+ E AL+ AV +QPVSV +   G  FQ
Sbjct  211  ESNYPYKGEDGTCNFNKTNPIAVSITGYEDVPANDEQALMKAVAHQPVSVAIEAGGSDFQ  270

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+     G+CG+   HA+T +GYG
Sbjct  271  FYS--SGVFT-----GECGTELDHAVTAVGYG  295



>ref|XP_009616844.1| PREDICTED: zingipain-1-like [Nicotiana tomentosiformis]
Length=341

 Score =   150 bits (379),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 104/151 (69%), Gaps = 8/151 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDC-NLKNYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFSAVAA+EGI QI+TG L+ LSEQQLLDC N  N GC GG  T AF++I +NGGL  +
Sbjct  150  WAFSAVAAVEGINQIKTGDLVSLSEQQLLDCENTNNDGCGGGIRTEAFEYIAENGGLTTE  209

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEVASGESALLAAVTYQPVSVILTHDGGMFQYY  358
            S+YPY  +  +C++Q + +S  TI+GY+ V + ESALL AV  QPVS  +T     F++Y
Sbjct  210  SNYPYTGIPGTCDSQKAESSVVTISGYRSVDASESALLQAVANQPVSAGITIGSDEFRFY  269

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
              N GIF+G      CG   RHA+T++GYGT
Sbjct  270  --NGGIFNGK-----CGMTSRHAVTVVGYGT  293



>ref|XP_011014388.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=340

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 106/151 (70%), Gaps = 8/151 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAA+EGI +++TG+L+ LSEQQL+DCN  N GC+GG+M  AFQ+I+  GGL  + 
Sbjct  149  WAFSAVAAIEGIIKLKTGKLISLSEQQLVDCNAGNKGCQGGFMDTAFQYIIRKGGLTSEE  208

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPYQ V  +CN++ + +  A ITGY++V  + E+ALL AV  QPVSV +   G  FQ+Y
Sbjct  209  NYPYQGVDGTCNSEKAASIEAEITGYEDVPQNNENALLQAVAKQPVSVGIDGGGQDFQFY  268

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
               SG+F      GDCG+   HA+T IG+GT
Sbjct  269  --KSGVFK-----GDCGAEQNHAVTAIGFGT  292



>ref|XP_010912725.1| PREDICTED: zingipain-2-like [Elaeis guineensis]
Length=337

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 107/153 (70%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFS VAA+EGITQI  G L+ LSEQQ++DC++K  N GC GG+MT AFQ+++DNGG+  
Sbjct  144  WAFSTVAAIEGITQINNGNLVSLSEQQVVDCDVKDGNRGCHGGFMTRAFQYVIDNGGITT  203

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGMFQ  352
            + +YPY A   +C+   + +SAATI+GYQ V  + ES+LL AV+ QPVSV +   G  FQ
Sbjct  204  EENYPYMAADGTCDTNKASSSAATISGYQNVPVNDESSLLQAVSKQPVSVGIDGGGQDFQ  263

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+  SGIF     AG C +   HA+T IGYGT
Sbjct  264  HYS--SGIF-----AGPCETNMDHAVTAIGYGT  289



>ref|XP_010912736.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=339

 Score =   149 bits (377),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 109/153 (71%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFS++AA+EGITQI TG L+ LSEQQL+DC++K  N GC GG MT AFQ+++DNGG+  
Sbjct  146  WAFSSIAAIEGITQINTGNLVSLSEQQLVDCDVKDGNNGCNGGLMTRAFQYVIDNGGITT  205

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY A   +C+   + +SAATI+GY+ V  + ES+LL AV+ QPVSV +   G  FQ
Sbjct  206  ENNYPYMAADGTCDTDRASSSAATISGYENVPVNDESSLLQAVSNQPVSVGIDGGGQDFQ  265

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+  SGIF+     G C +   HA+T IGYGT
Sbjct  266  HYS--SGIFT-----GPCKTNMDHAVTAIGYGT  291



>ref|XP_006830175.1| hypothetical protein AMTR_s00374p00012080 [Amborella trichopoda]
 gb|ERM97591.1| hypothetical protein AMTR_s00374p00012080 [Amborella trichopoda]
Length=337

 Score =   149 bits (377),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 108/153 (71%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA+E IT+I+TG L+ LSEQ++LDC     + GC  G M  AF+FI++NGGL  
Sbjct  148  WAFSAVAAVESITKIKTGNLVSLSEQEVLDCVTGGVSRGCISGLMGEAFRFIINNGGLAR  207

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVASG-ESALLAAVTYQPVSVILTHDGGMFQ  352
            ++DYPYQ++Q +C+AQ S + A TITGY+ + SG E +LL AV  QPVSV +  DG  F+
Sbjct  208  ETDYPYQSIQGTCDAQKSSSKAGTITGYERILSGDEDSLLLAVANQPVSVGI--DGSGFE  265

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +   + G+F+     GDCG+   HA+TIIGYGT
Sbjct  266  FKHYSEGVFT-----GDCGTQMNHAVTIIGYGT  293



>ref|XP_011086004.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 105/151 (70%), Gaps = 9/151 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL-KNYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFSAVAA EGI Q+ TG+L+ LSEQ+L+DC+  ++ GC GG M  AF+FI+ NGG+  +
Sbjct  149  WAFSAVAATEGINQLTTGKLISLSEQELVDCDTSEDEGCNGGLMDNAFEFIISNGGITTE  208

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQY  355
            S+YPY+ V  +CN +   +SAA ITGY++V A+ E ALL AV  QPVSV +   G  FQ+
Sbjct  209  SNYPYEGVDGTCNTKKESSSAAKITGYEDVPANSEPALLKAVANQPVSVAIDASGSDFQF  268

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            Y+  SG+F+     GDCG+   H +T +GYG
Sbjct  269  YS--SGVFT-----GDCGTELDHGVTAVGYG  292



>ref|XP_010054319.1| PREDICTED: zingipain-2-like [Eucalyptus grandis]
 gb|KCW76119.1| hypothetical protein EUGRSUZ_D00496 [Eucalyptus grandis]
Length=345

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 104/150 (69%), Gaps = 8/150 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAAMEGIT I+ G+L+ LS Q+L+DC+  + GC GG M  AF+FI+ NGGL  ++
Sbjct  152  WAFSAVAAMEGITMIKKGKLVPLSVQELVDCDDNDEGCGGGLMDSAFKFIVSNGGLTTEA  211

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPYQ    +CN   + N AA+ITGYQ+V A+ E ALL AV  QPVSV +   G  FQ+Y
Sbjct  212  NYPYQGDDGTCNTAKTANPAASITGYQDVPANNEKALLQAVANQPVSVAIEGGGFDFQFY  271

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +  SG+F+G+     CGS   HA+T +GYG
Sbjct  272  S--SGVFTGS-----CGSDIDHAVTAVGYG  294



>ref|XP_010277773.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Nelumbo 
nucifera]
Length=345

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 108/153 (71%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGIT+++ G+L+ LSEQ+L+DC+    +YGC GG+M  AFQFI  NGGL  
Sbjct  152  WAFSAVAAMEGITKLKAGKLISLSEQELVDCDTAGGDYGCEGGFMDNAFQFIQHNGGLTT  211

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY+    +C+ + S  SAA I+GY++V A+ E ALL AV+ QPVSV +   G  FQ
Sbjct  212  EANYPYKQTDGTCDKRKSALSAAKISGYEDVPANNEVALLKAVSNQPVSVAIDAGGFDFQ  271

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+  SGIF+     G+CG+   H +T +GYGT
Sbjct  272  FYS--SGIFT-----GECGTNLDHGVTAVGYGT  297



>ref|XP_007025398.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOY28020.1| Senescence-associated gene 12 [Theobroma cacao]
Length=338

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 106/153 (69%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGI Q++TG+L+ LSEQ+L+DC++  ++ GC GG+M  AF+FI+ N GL  
Sbjct  145  WAFSAVAAMEGINQLKTGKLISLSEQELVDCDINGEDQGCNGGFMDNAFEFIISNKGLTT  204

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVASG-ESALLAAVTYQPVSVILTHDGGMFQ  352
            +S+YPY+ V  SCN + + N AA IT +++V S  E+ALL AV  QPVSV +   G  FQ
Sbjct  205  ESNYPYEGVDGSCNKKKAANHAAQITSFEDVPSNSEAALLKAVANQPVSVAIDAGGSDFQ  264

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y   SGIF+     G+C +   H +T +GYGT
Sbjct  265  HY--KSGIFT-----GECSTFLDHGVTAVGYGT  290



>ref|XP_002305073.2| hypothetical protein POPTR_0004s05540g [Populus trichocarpa]
 gb|EEE85584.2| hypothetical protein POPTR_0004s05540g [Populus trichocarpa]
Length=340

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 104/151 (69%), Gaps = 8/151 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFS VAA+EGI +++TG L+ LSEQQL+DC   N GC+GG M  AFQ+I+ NGGL  + 
Sbjct  149  WAFSTVAAIEGIIKLQTGNLISLSEQQLVDCTAGNKGCQGGLMDTAFQYIIRNGGLTSED  208

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPYQ V  +C+++ + ++ A ITGY++V  + E+ALL AV  QPVSV +   G  FQ+Y
Sbjct  209  NYPYQGVDGTCSSEKAASTEAQITGYEDVPQNNENALLQAVAKQPVSVAVEGGGHDFQFY  268

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
               SG+F      GDCG+   HA+T IGYGT
Sbjct  269  --KSGVFE-----GDCGTNLNHAVTAIGYGT  292



>ref|XP_010045988.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=342

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 107/153 (70%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAV AMEG  Q+ TG+L+ LSEQ+L+DC+   ++ GC GG+M  AF+FI+ N GL  
Sbjct  149  WAFSAVGAMEGNNQLTTGKLISLSEQELVDCDTSGEDQGCEGGFMDNAFEFIIGNHGLTT  208

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPYQAV  +CNA+   +SAA I GY++V A+ ESALL AV +QPVSV +      FQ
Sbjct  209  ETNYPYQAVDGTCNARKEASSAAKINGYEDVPANSESALLKAVAHQPVSVAIDAGESAFQ  268

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+  SGIF+     G+CG+   H +T +GYGT
Sbjct  269  FYS--SGIFT-----GECGTNLDHGVTAVGYGT  294



>ref|XP_002305072.2| hypothetical protein POPTR_0004s05520g [Populus trichocarpa]
 gb|EEE85583.2| hypothetical protein POPTR_0004s05520g [Populus trichocarpa]
Length=340

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 104/151 (69%), Gaps = 8/151 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFS VAA+EGI +++TG L+ LSEQQL+DC   N GC+GG M  AFQ+I+ NGGL  + 
Sbjct  149  WAFSTVAAIEGIIKLQTGNLISLSEQQLVDCTAGNKGCQGGHMDTAFQYIIRNGGLTSED  208

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPYQ V  +C+++ + ++ A ITGY++V  + E+ALL AV  QPVSV +   G  FQ+Y
Sbjct  209  NYPYQGVDGTCSSEKAASTEAQITGYEDVPQNNENALLQAVAKQPVSVAVEGGGHDFQFY  268

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
               SG+F      GDCG+   HA+T IGYGT
Sbjct  269  --KSGVFE-----GDCGTNLNHAVTAIGYGT  292



>ref|XP_010099379.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXB78104.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=348

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 104/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFS VAAMEGIT++ TG+L+ LSEQ+L+DC++K  + GC GG M  AF+FI  NGGL  
Sbjct  155  WAFSTVAAMEGITKLSTGKLLSLSEQELVDCDVKGEDQGCNGGLMDEAFKFIQHNGGLTT  214

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY+ V  +CNA+     AA ITGY++V A+ E  LL AVT+QPVSV +   G  FQ
Sbjct  215  EANYPYEGVDGTCNAKKEATHAAKITGYEDVPANSEKDLLKAVTHQPVSVAIDASGFEFQ  274

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+   G+F+G      CG+   H +T +GYG
Sbjct  275  FYS--GGVFTGA-----CGTNLDHGVTAVGYG  299



>ref|XP_009352795.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 108/154 (70%), Gaps = 11/154 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAA+EGITQI+TG+L+ LSEQQL+DC+  N GC+GGWM  AF +I  NGG+V + 
Sbjct  150  WAFSAVAAVEGITQIKTGKLISLSEQQLVDCDTDNNGCQGGWMGNAFAYIQRNGGIVSEE  209

Query  182  DYPYQAVQQS---CNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMF  349
            +YPYQ++  S   C+   +  +AA IT Y EV  + E+ LL AV+ QPVSV + +    F
Sbjct  210  NYPYQSLDGSAGTCDMNKANEAAAQITSYAEVHPNSETDLLKAVSMQPVSVAI-NTSPAF  268

Query  350  QYYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            Q+Y+   G+F+G+    DCG+   HA+TIIGYGT
Sbjct  269  QHYS--GGVFTGD----DCGTELNHAVTIIGYGT  296



>ref|XP_008800073.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score =   149 bits (375),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 106/151 (70%), Gaps = 10/151 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGIT++ TG+L+ LSEQ+L+DC+ K  + GC GG M  AF+FI+ NGGL  
Sbjct  149  WAFSAVAAMEGITKLSTGKLISLSEQELVDCDTKGEDQGCGGGLMDDAFKFIIKNGGLTT  208

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY+A   +CNA  S + AATI GY++V A+ E+ALL AV  QPVSV +   G  FQ
Sbjct  209  EANYPYEAADGTCNAGKSHSHAATIGGYEDVPANSEAALLKAVANQPVSVAIDAGGSAFQ  268

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGY  445
             Y+  SG+F+     GDCG+   H +T +GY
Sbjct  269  LYS--SGVFT-----GDCGTDLDHGVTAVGY  292



>ref|XP_008800071.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score =   148 bits (374),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 106/151 (70%), Gaps = 10/151 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGIT++ TG+L+ LSEQ+L+DC+ K  + GC GG M  AF+FI+ NGGL  
Sbjct  149  WAFSAVAAMEGITKLSTGKLISLSEQELVDCDTKGEDQGCGGGLMDDAFKFIIKNGGLTT  208

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY+A   +CNA  S + AATI GY++V A+ E+ALL AV  QPVSV +   G  FQ
Sbjct  209  EANYPYEAADGTCNAGKSHSHAATIGGYEDVPANSEAALLKAVANQPVSVAIDAGGSAFQ  268

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGY  445
             Y+  SG+F+     GDCG+   H +T +GY
Sbjct  269  LYS--SGVFT-----GDCGTELDHGVTAVGY  292



>ref|XP_011086005.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   148 bits (374),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 105/151 (70%), Gaps = 9/151 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL-KNYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFSAVAA EGI Q+ TG+L+ LSEQ+L+DC+  ++ GC GG M  AF+FI+ NGG+  +
Sbjct  149  WAFSAVAATEGINQLTTGKLISLSEQELVDCDTSEDEGCNGGLMDNAFEFIISNGGITTE  208

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQY  355
            S+YPY+AV  +CN++   + AA ITGY++V A+ ESALL AV  QPVSV +   G  FQ+
Sbjct  209  SNYPYEAVDGTCNSKKESSHAAKITGYEDVPANSESALLKAVANQPVSVAIDASGSDFQF  268

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            Y   SG+F+G      CG+   H +T +GYG
Sbjct  269  Y--TSGVFTGQ-----CGTELDHGVTAVGYG  292



>emb|CDP18641.1| unnamed protein product [Coffea canephora]
Length=338

 Score =   148 bits (373),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 104/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA EGI Q++TG+L+ LSEQ+L+DC+   ++ GC GG M  AF FI++N GL  
Sbjct  145  WAFSAVAATEGIHQLKTGKLISLSEQELVDCDTAGEDQGCNGGLMDDAFTFIINNKGLTT  204

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPYQAV  +CN       AA ITG+++V A+ E+ALL AV  QPVSV +   G  FQ
Sbjct  205  EANYPYQAVDGTCNTNKEAKPAAKITGFEDVPANNEAALLKAVANQPVSVAIDASGSAFQ  264

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+     GDCG+   H +T +GYG
Sbjct  265  FYS--SGVFT-----GDCGTELDHGVTAVGYG  289



>ref|XP_006849385.1| hypothetical protein AMTR_s01332p00008900 [Amborella trichopoda]
 gb|ERN10966.1| hypothetical protein AMTR_s01332p00008900 [Amborella trichopoda]
Length=349

 Score =   148 bits (373),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 107/153 (70%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA+E IT+I+TG  + LSEQ+L+DC     + GC+GG M  AFQFI++NGGL  
Sbjct  160  WAFSAVAAVESITKIKTGNSVSLSEQELVDCVTGGTSRGCQGGLMDEAFQFIINNGGLAS  219

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVASG-ESALLAAVTYQPVSVILTHDGGMFQ  352
            ++DYPYQA+  +C+AQ S +  +TITGYQ + SG E +LL AV  QPVSV +  DG  F+
Sbjct  220  EADYPYQAMDGACDAQKSSSKTSTITGYQNIPSGDEDSLLRAVANQPVSVGV--DGSGFE  277

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +   + G+F+     GDCG+   HA+T IGYGT
Sbjct  278  FKHYSEGVFT-----GDCGTEMSHAVTAIGYGT  305



>ref|XP_004303175.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   147 bits (372),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 106/152 (70%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGITQ+ TG+L+ LSEQ+L+DC++  ++ GC GG M  AFQFI  N GL  
Sbjct  147  WAFSAVAAMEGITQLTTGKLISLSEQELVDCDVNGEDQGCEGGLMDDAFQFINQNHGLST  206

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY  V  +CNAQ   + AA+ITG+++V A+ ESALL AV  QP+SV +   G  FQ
Sbjct  207  EANYPYTGVDGTCNAQKEASHAASITGHEDVPANSESALLKAVANQPISVAIDASGSDFQ  266

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+G      CG+   H +T +GYG
Sbjct  267  FYS--SGVFTGT-----CGTSLDHGVTAVGYG  291



>ref|XP_007048792.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92949.1| Senescence-associated gene 12 [Theobroma cacao]
Length=343

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 102/152 (67%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEG+T++ TG+L+ LSEQ+L+DC+ K  + GC+GG M  AFQFI +N GL  
Sbjct  150  WAFSAVAAMEGVTKLTTGKLISLSEQELVDCDTKGDDQGCQGGLMDDAFQFIQNNKGLTT  209

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +SDYPY+ V   CN     N AA I G+++V A+ E AL  AV  QPVSV +   G  FQ
Sbjct  210  ESDYPYKGVDGKCNTNKEANHAANINGHEDVPANNEEALHKAVANQPVSVAIDAGGYEFQ  269

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+     GDCG+   H +T +GYG
Sbjct  270  FYS--SGVFT-----GDCGTDLDHGVTAVGYG  294



>ref|XP_004505522.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP2-like [Cicer 
arietinum]
Length=343

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 104/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKN--YGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA+EGI +I+TG+L+ LSEQ+L+DC++KN   GC GG M  AF FI+ NGGL  
Sbjct  151  WAFSAVAAVEGIHKIKTGELVSLSEQELVDCDVKNGNQGCEGGLMETAFTFIVKNGGLTT  210

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            + +YPY+ V  +CN + + + A +I+GY+EV A  E+ L AA ++QPVSV +   G  FQ
Sbjct  211  EKEYPYEGVDGTCNKEKAAHHAVSISGYEEVPAENEAKLKAAASHQPVSVAIDAGGYSFQ  270

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
             Y+   G+FS     G CG    HA+T++GYG
Sbjct  271  LYS--EGVFS-----GICGKQLNHAVTVVGYG  295



>ref|XP_002522559.1| cysteine protease, putative [Ricinus communis]
 gb|EEF39859.1| cysteine protease, putative [Ricinus communis]
Length=344

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 103/153 (67%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGIT++ TG L+ LSEQ+L+DC+    + GC GG M  AF+FI++N GL  
Sbjct  151  WAFSAVAAMEGITKLSTGTLISLSEQELVDCDTSGMDQGCEGGLMDDAFEFIIENNGLTT  210

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY+ V  SCN + + N AA ITGY+ V A  E AL  AV  QPVSV +      FQ
Sbjct  211  EANYPYEGVDGSCNTRKAANHAAKITGYENVPAYDEEALRKAVANQPVSVAIDAGESAFQ  270

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+  SGIF+     GDCG+   H +T++GYGT
Sbjct  271  HYS--SGIFT-----GDCGTELDHGVTVVGYGT  296



>gb|AFR11773.1| cysteine protease [Fragaria x ananassa]
Length=354

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 101/152 (66%), Gaps = 9/152 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFS VAA+EGI +I TG+L+ LSEQ+L+DC+ K N GC GG M +AF+FI+ NGG+  +
Sbjct  149  WAFSTVAAVEGINKIATGELVSLSEQELVDCDRKYNAGCNGGLMDYAFEFIIKNGGMDTE  208

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQY  355
            SDYPY+AV Q C+A    N   TI GY++V A  E AL  AV +QPVSV +   G   Q 
Sbjct  209  SDYPYKAVNQQCDASLENNKVVTIDGYEDVPAFNEEALKKAVAHQPVSVAIEAGGVALQL  268

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            Y  +SG+F+     G+CGS   H +  +GYGT
Sbjct  269  Y--DSGVFT-----GECGSALDHGVVAVGYGT  293



>gb|KFK31512.1| hypothetical protein AALP_AA6G122300 [Arabis alpina]
Length=342

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 105/150 (70%), Gaps = 8/150 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAA+EG TQI+ G+L+ LSEQQL+DC++ +YGCRGG M  AF+ I+  GGL  +S
Sbjct  151  WAFSAVAAIEGATQIKKGKLISLSEQQLVDCDINDYGCRGGLMDTAFEHIIATGGLTTES  210

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPY+    +CN++ +   A +I+GY++V  + E AL+ AV YQPVSV +   G  FQ+Y
Sbjct  211  NYPYKGEDGTCNSKKTNPKATSISGYEDVPVNDEKALMKAVAYQPVSVGIEGGGFDFQFY  270

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +  +G+F+     G+C +   HA+T +GYG
Sbjct  271  S--TGVFT-----GECTTSLDHAVTAVGYG  293



>ref|XP_008779806.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=326

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 107/153 (70%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFS+VAA+E IT+I+TG L+ LSEQQL+DC+    N GC GG MT AFQ+++DNGG+  
Sbjct  133  WAFSSVAAIEAITEIKTGNLVSLSEQQLVDCDTNDGNKGCDGGLMTRAFQYVIDNGGITT  192

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            + +YPY+A   +C+   + +SAATI+GY+ V A+ ES+LL AV  QPVSV +   G  FQ
Sbjct  193  EDNYPYKAADGTCDTNRASSSAATISGYETVPANDESSLLQAVANQPVSVGIDGSGPDFQ  252

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+  SGIF+     G C +   HA+T +GYGT
Sbjct  253  HYS--SGIFT-----GPCETEMTHAVTAVGYGT  278



>gb|KHN38752.1| Vignain [Glycine soja]
Length=308

 Score =   146 bits (368),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 105/153 (69%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA EGIT++ TG+L+ LSEQ+L+DC+ K  + GC GG M  AF+FI+ N GL  
Sbjct  115  WAFSAVAATEGITKLSTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFILQNKGLAA  174

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            ++ YPY+ V  +CNA+  GN AA+I GY++V A+ ESALL AV  QPVSV +   G  FQ
Sbjct  175  EAIYPYEGVDGTCNAKAEGNHAASIKGYEDVPANSESALLKAVANQPVSVAIEASGFEFQ  234

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+   G+F+G+     CG+   H +T +GYG 
Sbjct  235  FYS--GGVFTGS-----CGTNLDHGVTAVGYGV  260



>ref|XP_006857797.1| hypothetical protein AMTR_s00061p00215400 [Amborella trichopoda]
 gb|ERN19264.1| hypothetical protein AMTR_s00061p00215400 [Amborella trichopoda]
Length=347

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 107/153 (70%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA+EGITQI+TG+L+ LSEQ+++DC+ K  + GC GG+M  AF+FI++N GL  
Sbjct  154  WAFSAVAAVEGITQIKTGKLVSLSEQEVVDCDTKGEDQGCNGGFMDDAFEFIINNHGLTT  213

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVAS-GESALLAAVTYQPVSVILTHDGGMFQ  352
            ++ YPY+AV  +CN + + + AA ITGY++V +  E AL+ AV  QPVSV +   G  FQ
Sbjct  214  EAKYPYKAVDGTCNTKKASSGAAKITGYEDVPTNNEKALVKAVANQPVSVAIDASGYEFQ  273

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+   G+F+     GDCG+   H +T +GYG 
Sbjct  274  FYS--GGVFN-----GDCGTELDHGVTAVGYGV  299



>gb|KCW76137.1| hypothetical protein EUGRSUZ_D00513 [Eucalyptus grandis]
Length=328

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 105/153 (69%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA EGI Q+ TG L+ LS QQL+DC+ K  N GC GG++  AF+FI+DN GL  
Sbjct  135  WAFSAVAATEGIHQLTTGNLVSLSVQQLVDCDTKGDNRGCAGGFVNAAFKFIIDNDGLTT  194

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVASG-ESALLAAVTYQPVSVILTHDGGMFQ  352
            + +YPY+AV+ +C+A  + + AA ITGY++V S  ESAL  AV  QPVSV +  DG  FQ
Sbjct  195  EDNYPYEAVKGTCDAGQAESPAAKITGYEDVPSNSESALSQAVANQPVSVAIDADGSHFQ  254

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+   G+F+     GDC +   H +T++GYGT
Sbjct  255  FYS--GGVFT-----GDCQTDLDHGVTVVGYGT  280



>ref|XP_006384060.1| hypothetical protein POPTR_0004s05510g [Populus trichocarpa]
 gb|ERP61857.1| hypothetical protein POPTR_0004s05510g [Populus trichocarpa]
Length=339

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 106/153 (69%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA+EGI +++TG+L+ LSEQQL+DC++K  + GC GG M  AFQFI+ NGGL  
Sbjct  146  WAFSAVAAIEGIIKLKTGKLISLSEQQLVDCDVKGVDQGCGGGLMDNAFQFILRNGGLTS  205

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGMFQ  352
            ++ YPYQ V  +C ++ + +  A ITGY++V  + E+ALL AV  QPVSV +   G  FQ
Sbjct  206  EATYPYQGVDGTCKSKKTASIEAKITGYEDVPVNNENALLQAVAKQPVSVAVEGGGYDFQ  265

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y   SG+F      GDCG+   HA+T IGYGT
Sbjct  266  FY--KSGVFK-----GDCGTYLDHAVTAIGYGT  291



>ref|XP_010058990.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=284

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 98/150 (65%), Gaps = 7/150 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFS VAA+EGI  I  G L  LSEQQL+DC   N+GC GG++ +AF++I+ N G+  + 
Sbjct  94   WAFSVVAAVEGIVGITNGTLPVLSEQQLVDCVTTNFGCGGGYLEYAFEYIIQNQGIASED  153

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEVASGESALLAAVTYQPVSVILTHDGGMFQYYA  361
             YPY+AVQ +C+A  +   AA I G++ V SGE  L+ AV  QPVSVI+   G  FQYY+
Sbjct  154  SYPYEAVQGTCDATKAAEHAAQIKGFRYVLSGEDELMKAVAQQPVSVIIPSSGQEFQYYS  213

Query  362  SNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
               G+F+     G+CG    HA+ ++GYGT
Sbjct  214  --GGVFN-----GECGPKLDHAVVVVGYGT  236



>gb|EYU25679.1| hypothetical protein MIMGU_mgv1a023356mg, partial [Erythranthe 
guttata]
Length=347

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 103/151 (68%), Gaps = 9/151 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL-KNYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFSAVAA EGI Q+ TG L+ LSEQ+L+DC+  ++ GC GG M +AF+FI+ N GL  +
Sbjct  155  WAFSAVAATEGINQLTTGNLVSLSEQELVDCDTSEDQGCNGGLMDYAFEFIISNNGLTTE  214

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEVASG-ESALLAAVTYQPVSVILTHDGGMFQY  355
            S+YPY+ V  +CN++   +  A ITGY++V S  ESALL AV  QP+SV +   G  FQ+
Sbjct  215  SNYPYEGVDGTCNSKKESSHVAKITGYEDVPSNSESALLKAVVNQPISVAIDASGSDFQF  274

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            Y+  SG+F+G      CG+   H +T++GYG
Sbjct  275  YS--SGVFTGQ-----CGTELDHGVTVVGYG  298



>ref|XP_010052206.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=342

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 105/153 (69%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA EGI Q+ TG L+ LS QQL+DC+ K  N GC GG++  AF+FI+DN GL  
Sbjct  149  WAFSAVAATEGIHQLTTGNLVSLSVQQLVDCDTKGDNRGCAGGFVNAAFKFIIDNDGLTT  208

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVASG-ESALLAAVTYQPVSVILTHDGGMFQ  352
            + +YPY+AV+ +C+A  + + AA ITGY++V S  ESAL  AV  QPVSV +  DG  FQ
Sbjct  209  EDNYPYEAVKGTCDAGQAESPAAKITGYEDVPSNSESALSQAVANQPVSVAIDADGSHFQ  268

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+   G+F+     GDC +   H +T++GYGT
Sbjct  269  FYS--GGVFT-----GDCQTDLDHGVTVVGYGT  294



>ref|XP_009344439.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
 ref|XP_009344444.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=333

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 104/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA EGITQ+ TG+LM LSEQ+L+DC+   ++ GC GG M  AFQFI  N G+  
Sbjct  140  WAFSAVAATEGITQLTTGKLMSLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNHGIST  199

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY+ V  +CN +   + AA ITG+++V A+ E ALLAAV +QPVSV +   G  FQ
Sbjct  200  EANYPYEGVDGTCNTKKETSHAAKITGFEDVPANSEKALLAAVAHQPVSVAIDASGSDFQ  259

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+G      CG+   H +T +GYG
Sbjct  260  FYS--SGVFTGT-----CGTSLDHGVTAVGYG  284



>ref|XP_008225221.1| PREDICTED: vignain-like, partial [Prunus mume]
Length=194

 Score =   142 bits (359),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 101/153 (66%), Gaps = 12/153 (8%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA+EGI QI+TG+L+ LSEQQLLDC     N GC GG+MT +FQ+I  NGG+  
Sbjct  3    WAFSAVAAVEGINQIQTGELISLSEQQLLDCTSSYGNKGCDGGFMTSSFQYIQQNGGIAS  62

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGMFQ  352
            + +YPYQAV+ +CNA      A  ITGY++V  + E  LL AV+ QPVS+ +   G  F 
Sbjct  63   EENYPYQAVEGTCNAN---QPAVQITGYEKVPENSEEDLLKAVSRQPVSIAIDGSGAEFM  119

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
             Y   SG+FS      DCG+   HA+T +GYGT
Sbjct  120  NY--QSGVFSPT----DCGTKLTHAVTAVGYGT  146



>ref|XP_006417940.1| hypothetical protein EUTSA_v10008102mg [Eutrema salsugineum]
 gb|ESQ36293.1| hypothetical protein EUTSA_v10008102mg [Eutrema salsugineum]
Length=344

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 102/151 (68%), Gaps = 9/151 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNY--GCRGGWMTWAFQFIMDNGGLVM  175
            WAF+AVAA+EGI QI+TG+L+ LSEQQL+DC+   Y  GC GG M  A++FI  NGGL  
Sbjct  153  WAFAAVAAIEGINQIKTGKLVSLSEQQLIDCDTGTYNKGCSGGLMETAYEFIKTNGGLTT  212

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVASGESALLAAVTYQPVSVILTHDGGMFQY  355
            ++DYPY A + +C+ + + N   TI GYQ+VA  E++L  A   QPVSV +   G +FQ 
Sbjct  213  ETDYPYTAAEGTCDQEKAKNKVVTIQGYQKVAQNEASLRIAAAQQPVSVGIDAGGFIFQL  272

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            Y+  SG+F+G      CGS   HA+T++GYG
Sbjct  273  YS--SGVFTGY-----CGSNLNHAVTVVGYG  296



>dbj|BAF56430.1| cysteine proteinase [Lotus japonicus]
Length=341

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 104/153 (68%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA EGIT++ TG+L+ LSEQ+L+DC+ K  + GC GG M  AF+FIM N GL  
Sbjct  149  WAFSAVAATEGITKLSTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFIMQNKGLNT  208

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            ++ YPYQ V  +CNA      AA+I G+++V A+ ESALL AV  QP+SV +   G  FQ
Sbjct  209  EAKYPYQGVDATCNANAEAKDAASIKGFEDVPANSESALLKAVANQPISVAIDASGSEFQ  268

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+  SG+F+G+     CG+   H +T +GYG+
Sbjct  269  FYS--SGVFTGS-----CGTELDHGVTAVGYGS  294



>ref|XP_009352793.1| PREDICTED: zingipain-2-like [Pyrus x bretschneideri]
Length=344

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 106/154 (69%), Gaps = 11/154 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAA+EGITQI+TG+L+ LSEQQL+DC+  N GC+GGWM  AF +I  NGG+  + 
Sbjct  150  WAFSAVAAIEGITQIKTGKLISLSEQQLVDCDTDNNGCQGGWMGNAFAYIQRNGGIASEE  209

Query  182  DYPYQAVQQS---CNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMF  349
            +YPYQ++  S   C+   +  +AA IT Y EV  + E+ LL AV  QPVSV + +    F
Sbjct  210  NYPYQSLDGSAGTCDMNKANEAAAQITSYAEVHPNSETDLLKAVYMQPVSVAI-NTSPAF  268

Query  350  QYYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            Q+Y+   G+F+G+    DCG+   HA+TIIGYGT
Sbjct  269  QHYS--GGVFTGD----DCGTELNHAVTIIGYGT  296



>ref|XP_006857795.1| hypothetical protein AMTR_s00061p00215070 [Amborella trichopoda]
 gb|ERN19262.1| hypothetical protein AMTR_s00061p00215070 [Amborella trichopoda]
Length=342

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 107/153 (70%), Gaps = 12/153 (8%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGI QI+TG+L+ LSEQ+++DC+ K  + GC GG+M  AF+FI++N GL  
Sbjct  152  WAFSAVAAMEGIHQIKTGKLVSLSEQEVVDCDTKGEDQGCNGGFMDDAFKFIINNHGLTT  211

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVAS-GESALLAAVTYQPVSVILTHDGGMFQ  352
            ++ YPY+AV  SC   +S   AATITGY++V +  E ALL AVT QPVSV +   G  FQ
Sbjct  212  EAKYPYKAVDGSCKKASS--LAATITGYEDVPTNNEKALLKAVTSQPVSVAIDASGYEFQ  269

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+   G+F+GN     CG+   H +T +GYGT
Sbjct  270  FYS--GGVFTGN-----CGTELDHGVTAVGYGT  295



>ref|XP_008383642.1| PREDICTED: zingipain-1-like [Malus domestica]
Length=341

 Score =   146 bits (369),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 103/151 (68%), Gaps = 8/151 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAV A+EGI QI+T +L+ LSEQQL++C+  N GC+GGWM  AF +I  N G+  + 
Sbjct  150  WAFSAVTAVEGIIQIKTDKLISLSEQQLVNCDTDNNGCQGGWMVNAFAYIQRNXGITSEE  209

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPYQ+++ +C+      +AA IT Y EV  + E+ LL AV+ QPVSV + H    FQ+Y
Sbjct  210  NYPYQSLEGTCDTNKENEAAAQITSYAEVPPNSETDLLKAVSMQPVSVSI-HASPAFQHY  268

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +   G+F+G+    DCG+   HA+TIIGYGT
Sbjct  269  S--GGVFTGD----DCGTELNHAVTIIGYGT  293



>ref|XP_007048796.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92953.1| Senescence-associated gene 12 [Theobroma cacao]
Length=343

 Score =   146 bits (369),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 102/152 (67%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEG+T++ TG+L+ LSEQ+L+DC+ K  + GC+GG M  AFQFI +N GL  
Sbjct  150  WAFSAVAAMEGVTKLTTGKLISLSEQELVDCDTKGEDQGCQGGLMDDAFQFIQNNKGLTT  209

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +SDYPY+ V  +CN     N AA I G+++V A+ E AL  AV  QPVSV +   G  FQ
Sbjct  210  ESDYPYKGVDGTCNTNKEANHAAKINGFEDVPANSEDALQKAVANQPVSVAIDAGGFKFQ  269

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+   G+F+     GDCG+   H +T +GYG
Sbjct  270  FYS--GGVFT-----GDCGTALDHGVTAVGYG  294



>ref|XP_004290089.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   146 bits (369),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 106/152 (70%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGITQ+ TG+L+ LSEQ+L+DC++  ++ GC GG M  AF+FI  N GL  
Sbjct  147  WAFSAVAAMEGITQLTTGKLISLSEQELVDCDVNGEDQGCEGGLMDDAFEFINQNHGLST  206

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY  V  +CNAQ   + AA+ITG+++V A+ ESALL AV  QP+SV +   G  FQ
Sbjct  207  EANYPYTGVDGTCNAQKEASHAASITGHEDVPANSESALLKAVANQPISVAIDASGSDFQ  266

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+G      CG+   H +T +GYG
Sbjct  267  FYS--SGVFTGA-----CGTSLDHGVTAVGYG  291



>ref|XP_011078044.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   146 bits (369),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 105/151 (70%), Gaps = 9/151 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL-KNYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFSAVAA EGI Q+ TG+L+ LSEQ+L+DC+  ++ GC GG M  AF+FI+ NGG+  +
Sbjct  149  WAFSAVAATEGINQLTTGKLISLSEQELVDCDTSEDEGCNGGLMDDAFEFIISNGGITTE  208

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQY  355
            S+YPY+ V  +CN++   + AA ITGY++V A+ E ALL AV  QPVSV +   G  FQ+
Sbjct  209  SNYPYEGVDGTCNSKKESSHAAKITGYEDVPANSEPALLKAVANQPVSVAIDASGSDFQF  268

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            Y+  SG+F+     G+CG+   H +T +GYG
Sbjct  269  YS--SGVFT-----GECGTELDHGVTAVGYG  292



>ref|XP_008246197.1| PREDICTED: vignain-like, partial [Prunus mume]
Length=286

 Score =   145 bits (365),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 103/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA EGITQ+ TG+L+ LSEQ+L+DC+    + GC GG M  AFQFI  N GL  
Sbjct  133  WAFSAVAATEGITQLTTGKLISLSEQELVDCDTSGVDQGCEGGLMDDAFQFIQQNHGLST  192

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY  V  SCN + + + AA ITGY++V A+ E ALL AV +QPVSV +   G  FQ
Sbjct  193  EANYPYNGVDGSCNTKKAASIAAKITGYEDVPANSEKALLTAVAHQPVSVAIDAGGSDFQ  252

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+G+     CG+   H +T +GYG
Sbjct  253  FYS--SGVFTGS-----CGTSLDHGVTAVGYG  277



>gb|KCW74062.1| hypothetical protein EUGRSUZ_E02690 [Eucalyptus grandis]
Length=316

 Score =   145 bits (366),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 98/150 (65%), Gaps = 7/150 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFS VAA+EGI  I  G L  LSEQQL+DC   N+GC GG++ +AF++I+ N G+  + 
Sbjct  126  WAFSVVAAVEGIVGITNGTLPVLSEQQLVDCVTTNFGCGGGYLEYAFEYIIQNQGIASED  185

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEVASGESALLAAVTYQPVSVILTHDGGMFQYYA  361
             YPY+AVQ +C+A  +   AA I G++ V SGE  L+ AV  QPVSVI+   G  FQYY+
Sbjct  186  SYPYEAVQGTCDATKAAEHAAQIKGFRYVLSGEDELMKAVAQQPVSVIIPSSGQEFQYYS  245

Query  362  SNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
               G+F+     G+CG    HA+ ++GYGT
Sbjct  246  --GGVFN-----GECGPKLDHAVVVVGYGT  268



>dbj|BAF56428.1| cysteine proteinase [Lotus japonicus]
Length=342

 Score =   146 bits (368),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 103/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA EGIT++ TG+L+ LSEQ+L+DC+ K  + GC GG M  AF+FIM N GL  
Sbjct  149  WAFSAVAATEGITKLSTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFIMQNKGLNT  208

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            ++ YPYQ V  +CNA      AA+I G+++V A+ ESALL AV  QP+SV +   G  FQ
Sbjct  209  EAKYPYQGVDATCNANAEAKDAASIKGFEDVPANSESALLKAVANQPISVAIDASGSEFQ  268

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+G+     CG+   H +T +GYG
Sbjct  269  FYS--SGLFTGS-----CGTELDHGVTAVGYG  293



>gb|KHN05669.1| Vignain [Glycine soja]
Length=315

 Score =   145 bits (366),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 104/153 (68%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA EGIT++RTG+L+ LSEQ+L+DC+ K  + GC GG M  AF+FI+ N GL  
Sbjct  122  WAFSAVAATEGITKLRTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFILQNKGLAT  181

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            ++ YPY+    +CNA+  GN A +I GY++V A+ ESALL AV  QPVSV +   G  FQ
Sbjct  182  EAIYPYEGFDGTCNAKADGNHAGSIKGYEDVPANSESALLKAVANQPVSVAIEASGFKFQ  241

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+   G+F+G+     CG+   H +T +GYG 
Sbjct  242  FYS--GGVFTGS-----CGTNLDHGVTSVGYGV  267



>ref|XP_006281607.1| hypothetical protein CARUB_v10027725mg [Capsella rubella]
 gb|EOA14505.1| hypothetical protein CARUB_v10027725mg [Capsella rubella]
Length=346

 Score =   145 bits (367),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 101/150 (67%), Gaps = 8/150 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFS VAA+EG  QI+ G+L+ LSEQQL+DC+  +YGC GG M  AF  I   GGL  +S
Sbjct  155  WAFSVVAAIEGAAQIKKGKLISLSEQQLVDCDPNDYGCEGGLMDTAFAHIKATGGLTTES  214

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPY+    +CN++ +   A TITGY++V A+ ESAL+ AV +QPVSV +   G  FQ+Y
Sbjct  215  NYPYKGEDATCNSKKTSPKATTITGYEDVPANDESALMKAVAHQPVSVAIEGGGFAFQFY  274

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +  SG+FS     G+C +   HA+T +GYG
Sbjct  275  S--SGVFS-----GECTTNLDHAVTAVGYG  297



>gb|KDP38773.1| hypothetical protein JCGZ_05109 [Jatropha curcas]
Length=215

 Score =   142 bits (359),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 104/153 (68%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGIT++ TG+L+ LSEQ+L+DC+   ++ GC GG M  AF FI  NGGL  
Sbjct  22   WAFSAVAAMEGITKLSTGKLISLSEQELVDCDTSGEDQGCEGGLMDDAFGFIKKNGGLTT  81

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVAS-GESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPYQ    +CN + + + AA ITGY++VA+  E ALL AV  QPVSV +   G  FQ
Sbjct  82   EANYPYQGTDDTCNTKKAADKAAKITGYEDVAANSEQALLKAVANQPVSVTIDASGSAFQ  141

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+   G+F+     GDCG+   H +T +GYGT
Sbjct  142  FYS--GGVFT-----GDCGTELDHGVTAVGYGT  167



>ref|XP_008244498.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=345

 Score =   145 bits (367),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 102/152 (67%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA EGITQ+ TG+L+ LSEQ+L+DC+ K  + GC GG M  AFQFI  N GL  
Sbjct  152  WAFSAVAATEGITQLTTGKLVSLSEQELVDCDTKGVDQGCEGGLMDDAFQFIQQNHGLST  211

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY  V  +CN +   N AA ITG+++V A+ E ALL AV +QPVSV +   G  FQ
Sbjct  212  EANYPYNGVDGTCNTKKEANIAAKITGHEDVPANDEKALLNAVAHQPVSVAIDASGSDFQ  271

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+G      CG+   H +T +GYG
Sbjct  272  FYS--SGVFTGT-----CGTSLDHGVTAVGYG  296



>ref|XP_010054327.1| PREDICTED: vignain-like [Eucalyptus grandis]
Length=236

 Score =   143 bits (360),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 98/151 (65%), Gaps = 8/151 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFS +AA+E ITQI+TG L  LSEQQL+DC  +N GC GGWM   F++I+ NGG+  ++
Sbjct  45   WAFSTIAAVESITQIKTGNLPELSEQQLVDCTSRNNGCNGGWMDTTFEYIVQNGGITSEA  104

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEVAS-GESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPYQ    +C+   + +  AT+T Y++V +  E  LL AV  QPVS+ L   G   Q Y
Sbjct  105  NYPYQKADGTCDTSAASSIEATVTSYKDVPTNNEGELLKAVAMQPVSIALDASGQELQSY  164

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +  SGIF+     GDCG+   HA+TI+G GT
Sbjct  165  S--SGIFN-----GDCGTAMTHAVTIVGCGT  188



>ref|XP_007213386.1| hypothetical protein PRUPE_ppa026372mg [Prunus persica]
 gb|EMJ14585.1| hypothetical protein PRUPE_ppa026372mg [Prunus persica]
Length=345

 Score =   145 bits (367),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 102/152 (67%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA EGITQ+ TG+L+ LSEQ+L+DC+ K  + GC GG M  AFQFI  N GL  
Sbjct  152  WAFSAVAATEGITQLTTGKLVSLSEQELVDCDTKGVDQGCEGGLMDDAFQFIQQNHGLST  211

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY  V  +CN +   N AA ITG+++V A+ E ALL AV +QPVSV +   G  FQ
Sbjct  212  EANYPYNGVDGTCNTKKEANIAAKITGHEDVPANDEKALLNAVAHQPVSVAIDASGSDFQ  271

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+G      CG+   H +T +GYG
Sbjct  272  FYS--SGVFTGT-----CGTSLDHGVTAVGYG  296



>ref|XP_010052201.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76129.1| hypothetical protein EUGRSUZ_D00505 [Eucalyptus grandis]
Length=345

 Score =   145 bits (367),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 108/152 (71%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFS  AA+EGIT ++ G+L+ LS Q+L+DC++  KN GC+GG+M  AF+FI+  GGL  
Sbjct  152  WAFSVAAAIEGITMLKKGKLLSLSVQELVDCDVNGKNSGCKGGYMDSAFEFIISKGGLTT  211

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY+  +++CN   +G  AA+ITGY++V A+ E ALL AV  QPVSV +   G  FQ
Sbjct  212  EANYPYRGNERTCNTAKTGYHAASITGYEDVPANNEKALLQAVANQPVSVAVEAGGYDFQ  271

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+G+     CG+   HA+T++GYG
Sbjct  272  FYS--SGVFTGS-----CGTSVDHAVTVVGYG  296



>ref|XP_009797968.1| PREDICTED: vignain-like [Nicotiana sylvestris]
Length=340

 Score =   145 bits (367),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 102/151 (68%), Gaps = 9/151 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFSAVAA EGI +I+ G+L+ LSEQ+L+DC+   N GC+GG M +AF+FI+ N GL  +
Sbjct  148  WAFSAVAATEGINKIKKGKLISLSEQELVDCDTSWNMGCQGGLMDYAFKFIIKNHGLTTE  207

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGMFQY  355
            S+YPY+ +  +C      N AA I GY++V  + ESALL AV +QPVSV +   G  FQ+
Sbjct  208  SNYPYEGIDGTCKTGKKSNHAAKIAGYEDVPVNSESALLKAVAHQPVSVAIDASGPDFQF  267

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            Y+  SG+F+     G+CG+   H +T IGYG
Sbjct  268  YS--SGVFT-----GECGTELDHGVTAIGYG  291



>gb|KDP38776.1| hypothetical protein JCGZ_05112 [Jatropha curcas]
Length=222

 Score =   142 bits (359),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 105/153 (69%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGIT++ TG+L+ LSEQ+L+DC+   ++ GC GG+M  AF FI  NGGL  
Sbjct  29   WAFSAVAAMEGITKLSTGKLISLSEQELVDCDTSGEDQGCEGGFMDDAFGFIKKNGGLTT  88

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVAS-GESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPYQ     CNA+ + + AA ITGY++VA+  E ALL AV  QPVSV +   G  FQ
Sbjct  89   EANYPYQGTDDPCNAKKAADKAAKITGYEDVAANSEQALLKAVANQPVSVTIDASGSAFQ  148

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+   G+F+     GDCG+   H +T +GYGT
Sbjct  149  FYS--GGVFT-----GDCGTELDHGVTAVGYGT  174



>ref|XP_006294508.1| hypothetical protein CARUB_v10023540mg [Capsella rubella]
 gb|EOA27406.1| hypothetical protein CARUB_v10023540mg [Capsella rubella]
Length=349

 Score =   145 bits (367),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 107/154 (69%), Gaps = 12/154 (8%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFSAVAA+EGI +I  GQL+ LSEQQLLDC+   N GCRGG M+ AF++I+ N G+  +
Sbjct  154  WAFSAVAAVEGINKITNGQLISLSEQQLLDCDRDFNQGCRGGIMSKAFEYIIKNQGITTE  213

Query  179  SDYPYQAVQQSCNA---QNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGM  346
            ++YPYQ  QQ+C+A   Q+S   AATI+GY+ V  + E ALL AV+ QPVSV +   G  
Sbjct  214  ANYPYQESQQTCSASTTQSSSFRAATISGYETVPMNDEEALLQAVSQQPVSVGIEGTGEA  273

Query  347  FQYYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            F++YA   G+F      G+CG+   HA+TI+GYG
Sbjct  274  FRHYA--GGVFD-----GECGTALHHAVTIVGYG  300



>ref|XP_007212667.1| hypothetical protein PRUPE_ppa018342mg [Prunus persica]
 gb|EMJ13866.1| hypothetical protein PRUPE_ppa018342mg [Prunus persica]
Length=326

 Score =   145 bits (365),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 104/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA EGITQ+ TG+L+ LSEQ+L+DC+   ++ GC GG M  AFQFI  N GL  
Sbjct  133  WAFSAVAATEGITQLTTGKLISLSEQELVDCDTSGEDQGCEGGLMDDAFQFIQQNHGLSA  192

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY  V  SCN + + + AA ITGY++V A+ E ALL AV +QPVSV +   G  FQ
Sbjct  193  EANYPYNGVDGSCNTKKAASIAAKITGYEDVPANSEKALLTAVAHQPVSVAIDAGGSDFQ  252

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+G+     CG+   H +T +GYG
Sbjct  253  FYS--SGVFTGS-----CGTSLDHGVTAVGYG  277



>ref|XP_010474538.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Camelina 
sativa]
Length=325

 Score =   145 bits (365),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 106/154 (69%), Gaps = 12/154 (8%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFSAV A+EGIT+I  GQL+ LSEQQLLDC+   N GCRGG M+ AF++I+ N G+  +
Sbjct  130  WAFSAVTAVEGITKITKGQLVSLSEQQLLDCDRDYNQGCRGGIMSKAFEYIIKNQGITTE  189

Query  179  SDYPYQAVQQSCNA---QNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGM  346
             +YPYQ  QQ+C++   Q+S   AATI+GY+ V  + E ALL AV+ QPVSV +   G  
Sbjct  190  DNYPYQESQQTCSSATTQSSSFRAATISGYETVPMNNEEALLQAVSQQPVSVGIEGSGAA  249

Query  347  FQYYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            F++Y+   GIF      G+CG+   HA+TI+GYG
Sbjct  250  FRHYS--GGIFD-----GECGTDLHHAVTIVGYG  276



>gb|KDP21078.1| hypothetical protein JCGZ_21549 [Jatropha curcas]
Length=326

 Score =   145 bits (365),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 103/153 (67%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGIT++ T +L+ LSEQ+L+DC+    + GC GG M  AF+FI+ N GL  
Sbjct  133  WAFSAVAAMEGITKLSTEKLISLSEQELIDCDTSGIDQGCEGGLMDDAFEFIIQNNGLTT  192

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPYQA   +CN + + N AATIT Y++V  + E AL  AV  QPVSV +      FQ
Sbjct  193  EANYPYQAEDGTCNTEKAANHAATITSYEDVPENNEEALRMAVANQPVSVAIDAGESAFQ  252

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+  SGIF+     GDCG+   H +T++GYGT
Sbjct  253  HYS--SGIFT-----GDCGTELDHGVTVVGYGT  278



>ref|XP_004289205.1| PREDICTED: cysteine proteinase RD21a-like, partial [Fragaria 
vesca subsp. vesca]
Length=385

 Score =   146 bits (368),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 101/152 (66%), Gaps = 9/152 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFS VAA+EGI +I TG+L+ LSEQ+L+DC+ K N GC GG M +AF+FI+ NGG+  +
Sbjct  180  WAFSTVAAVEGINKIATGELVSLSEQELVDCDRKYNAGCNGGLMDYAFEFIIKNGGMDTE  239

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQY  355
            SDYPY+AV Q C+A    N   +I GY++V A  E AL  AV +QPVSV +   G   Q 
Sbjct  240  SDYPYKAVNQQCDASLENNKVVSIDGYEDVPAFNEEALKKAVAHQPVSVAIEAGGVALQL  299

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            Y  +SG+F+     G+CGS   H +  +GYGT
Sbjct  300  Y--DSGVFT-----GECGSALDHGVVAVGYGT  324



>ref|XP_008225270.1| PREDICTED: zingipain-2-like [Prunus mume]
Length=341

 Score =   145 bits (366),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 102/152 (67%), Gaps = 12/152 (8%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA+EGI QI+TG+L+ LSEQQLLDC     N GC GG+MT +FQ+I  NGG+  
Sbjct  150  WAFSAVAAVEGINQIQTGELISLSEQQLLDCTSSYGNKGCDGGFMTSSFQYIQQNGGIAS  209

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGMFQ  352
            + +YPYQAV+ +CNA      A  ITGY++V  + E  LL AV+ QPVS+I+   G  F 
Sbjct  210  EENYPYQAVEGTCNA---NQPAVQITGYEKVPENSEEDLLKAVSRQPVSIIIDGSGAEFM  266

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
             Y   SG+FS      DCG+   HA+T++GYG
Sbjct  267  NY--QSGVFSPT----DCGTKTTHAVTVVGYG  292



>ref|XP_004506025.1| PREDICTED: vignain-like [Cicer arietinum]
Length=342

 Score =   145 bits (366),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 104/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA EGIT++ +G+L+ LSEQ+L+DC++K  + GC GG M  AF+F++ N GL  
Sbjct  149  WAFSAVAATEGITKLSSGKLVSLSEQELVDCDIKGVDQGCEGGLMDDAFKFMLQNKGLTT  208

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +  YPYQ V  +CNA+  GN  A+I GY++V A+ ESALL AV  QP+SV +   G  FQ
Sbjct  209  EVVYPYQGVDGTCNAKAEGNHVASIKGYEDVPANSESALLKAVANQPISVAIDASGSEFQ  268

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+G      CG+   H +T +GYG
Sbjct  269  FYS--SGVFTGT-----CGTELDHGVTAVGYG  293



>ref|XP_006449486.1| hypothetical protein CICLE_v10018236mg [Citrus clementina]
 gb|ESR62726.1| hypothetical protein CICLE_v10018236mg [Citrus clementina]
Length=312

 Score =   144 bits (364),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 103/153 (67%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGI QI T +L  LSEQ+L+DC+   ++ GC GG M  AF+FI++N GL  
Sbjct  119  WAFSAVAAMEGINQITTRKLTSLSEQELVDCDTSGEDQGCEGGLMDDAFEFIINNKGLAT  178

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVAS-GESALLAAVTYQPVSVILTHDGGMFQ  352
            ++ YPY+A   SCN + +  SAA I+GY++V S  E+AL+ AV  QPVSV +   G  FQ
Sbjct  179  EAKYPYKASDGSCNKKEANPSAAKISGYEDVPSNNEAALMKAVANQPVSVAIDASGSDFQ  238

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+  SG+F+G      CG+   H +T +GYGT
Sbjct  239  FYS--SGVFTGQ-----CGTELDHGVTAVGYGT  264



>ref|XP_006857796.1| hypothetical protein AMTR_s00061p00215230 [Amborella trichopoda]
 gb|ERN19263.1| hypothetical protein AMTR_s00061p00215230 [Amborella trichopoda]
Length=344

 Score =   145 bits (366),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 107/153 (70%), Gaps = 12/153 (8%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGI QI+TG+L+ LSEQ+++DC+ K  + GC GG M  AF+FI++N GL  
Sbjct  154  WAFSAVAAMEGIHQIKTGKLVSLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIINNHGLTT  213

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVAS-GESALLAAVTYQPVSVILTHDGGMFQ  352
            ++ YPY+AV  +C  + + + AATITGY++V +  E ALL AVT QPVSV +   G  FQ
Sbjct  214  EAKYPYKAVDGTC--KKASSIAATITGYEDVPTNNEKALLKAVTSQPVSVAIDASGYEFQ  271

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+   GIF+GN     CG+   H +T +GYGT
Sbjct  272  FYS--GGIFTGN-----CGTELDHGVTAVGYGT  297



>ref|XP_009357173.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   145 bits (365),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 104/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA EGITQ+ TG+L+ LSEQ+L+DC+   ++ GC GG M  AFQFI  N G+  
Sbjct  151  WAFSAVAATEGITQLTTGKLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNHGIST  210

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY  V  +CNA+   + AA ITG+++V A+ E ALLAAV +QPVSV +   G  FQ
Sbjct  211  EANYPYDGVDGACNAKKEASHAAKITGFEDVPANSEKALLAAVAHQPVSVAIDASGSDFQ  270

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+G      CG+   H +T +GYG
Sbjct  271  FYS--SGVFTGT-----CGTSLDHGVTAVGYG  295



>ref|XP_008228922.1| PREDICTED: vignain-like [Prunus mume]
Length=326

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 103/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA EGITQ+ TG+L+ LSEQ+L+DC+    + GC GG M  AFQFI  N GL  
Sbjct  133  WAFSAVAATEGITQLTTGKLISLSEQELVDCDTSGVDQGCEGGLMDDAFQFIQQNHGLST  192

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY  V  SCN + + + AA ITGY++V A+ E ALL AV +QPVSV +   G  FQ
Sbjct  193  EANYPYNGVDGSCNTKKAASIAAKITGYEDVPANSEKALLTAVAHQPVSVAIDAGGSDFQ  252

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+G+     CG+   H +T +GYG
Sbjct  253  FYS--SGVFTGS-----CGTSLDHGVTAVGYG  277



>ref|XP_006469012.1| PREDICTED: vignain-like [Citrus sinensis]
Length=341

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 103/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA+EGI Q+ TG+L  LSEQ+L+DC++K  + GC GG M  AFQF+  N G+  
Sbjct  148  WAFSAVAAIEGINQLTTGKLASLSEQELVDCDVKGEDEGCNGGLMDNAFQFVQKNKGITT  207

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY+ V   CNA+   N AA I G+++V A+ E+AL+ AV  QPVSV +   G  FQ
Sbjct  208  ETNYPYKGVDGKCNAKEEANHAAKINGHEDVPANSETALMKAVANQPVSVAIDAGGSDFQ  267

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+     GDCG+   H +T +GYG
Sbjct  268  FYS--SGVFT-----GDCGTELDHGVTAVGYG  292



>ref|XP_011045912.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=362

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 106/152 (70%), Gaps = 13/152 (9%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA EGITQ+ TG+L+ LSEQ+L+DC+   ++ GC GG+M  AF+FI+ N GL  
Sbjct  172  WAFSAVAATEGITQLSTGKLISLSEQELVDCDTSGEDQGCNGGFMDDAFEFIIQNKGLTT  231

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPYQ    +C   NSG +AA ITGY++V A+ E+ALL AV  QPVSV +   G  FQ
Sbjct  232  EANYPYQGADGTC---NSGKAAAKITGYEDVPANSEAALLKAVANQPVSVAIDAGGSAFQ  288

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+     GDCG+   H +T +GYG
Sbjct  289  FYS--SGVFT-----GDCGTDLDHGVTAVGYG  313



>ref|XP_010052197.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76117.1| hypothetical protein EUGRSUZ_D00494 [Eucalyptus grandis]
Length=369

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 102/153 (67%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGIT ++ G+L+ LSEQ+L+DC++   N GC GG M  AFQFI   GGL  
Sbjct  176  WAFSAVAAMEGITMLKKGKLVSLSEQELVDCDVNGVNEGCEGGLMDSAFQFIKSKGGLTS  235

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPYQ    +C    + N  A+ITGYQ+V A+ E ALL AV  QPVSV +   G  FQ
Sbjct  236  EANYPYQGNDGTCRTAKAANIVASITGYQDVPANNEKALLQAVANQPVSVAIEGSGFSFQ  295

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+   G+F+G+     CG+   HA+T +GYGT
Sbjct  296  FYS--GGVFTGS-----CGTSLDHAVTAVGYGT  321



>ref|XP_010417893.1| PREDICTED: ervatamin-B-like [Camelina sativa]
Length=349

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 107/154 (69%), Gaps = 12/154 (8%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCN-LKNYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFSAVAA+EGIT+I  GQL+ LSEQQLLDC+   N GCRGG M+ AF++I+ N G+  +
Sbjct  154  WAFSAVAAVEGITKITKGQLVSLSEQQLLDCDRYYNQGCRGGIMSKAFEYIIKNQGITTE  213

Query  179  SDYPYQAVQQSCNA---QNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGM  346
             +YPYQ  QQ+C++   Q+S   AATI+GY+ V  + E ALL AV+ QP+SV +   G  
Sbjct  214  DNYPYQESQQTCSSETTQSSSFRAATISGYETVPMNNEEALLQAVSQQPISVGIEGSGAA  273

Query  347  FQYYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            F++Y+   GIF      G+CG+   HA+TI+GYG
Sbjct  274  FRHYS--GGIFD-----GECGTDLHHAVTIVGYG  300



>ref|XP_010510777.1| PREDICTED: ervatamin-B-like [Camelina sativa]
Length=350

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 107/154 (69%), Gaps = 12/154 (8%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFSAVAA+EGIT+I  GQL+ LSEQQLLDC+   N GCRGG M+ AF++I+ N G+  +
Sbjct  155  WAFSAVAAVEGITKITKGQLVSLSEQQLLDCDRDYNQGCRGGIMSKAFEYIIKNQGITTE  214

Query  179  SDYPYQAVQQSCNA---QNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGM  346
             +YPYQ  +Q+C++   Q+S   AATI+GY+ V  + E ALL AV+ QPVSV +   G  
Sbjct  215  DNYPYQESEQTCSSATTQSSSFRAATISGYETVPMNNEEALLQAVSQQPVSVGIEGSGAA  274

Query  347  FQYYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            F++Y+   G+F      G+CG+   HA+TI+GYG
Sbjct  275  FRHYS--GGVFD-----GECGTDLHHAVTIVGYG  301



>ref|XP_004297571.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 104/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGITQ+ TG+L+ LSEQ+L+DC++  ++ GC GG M  AF FI  N GL  
Sbjct  148  WAFSAVAAMEGITQLTTGKLISLSEQELVDCDVNGEDQGCEGGLMDNAFDFINQNHGLST  207

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY  V  +CNAQ   + AA+ITG+++V A+ ESALL AV  QP+SV +   G  FQ
Sbjct  208  EANYPYTGVDGTCNAQKEASHAASITGHEDVPANSESALLKAVANQPISVAIDASGSDFQ  267

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
             Y+  SG+F+G      CG+   H +T +GYG
Sbjct  268  LYS--SGVFTGT-----CGTSLDHGVTAVGYG  292



>gb|KCW76141.1| hypothetical protein EUGRSUZ_D00518 [Eucalyptus grandis]
Length=286

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 98/151 (65%), Gaps = 8/151 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFS +AA+E ITQI+TG L  LSEQQL+DC  +N GC GGWM   F++I+ NGG+  ++
Sbjct  95   WAFSTIAAVESITQIKTGNLPELSEQQLVDCTSRNNGCNGGWMDTTFEYIVQNGGITSEA  154

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEVAS-GESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPYQ    +C+   + +  AT+T Y++V +  E  LL AV  QPVS+ L   G   Q Y
Sbjct  155  NYPYQKADGTCDTSAASSIEATVTSYKDVPTNNEGELLKAVAMQPVSIALDASGQELQSY  214

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +  SGIF+     GDCG+   HA+TI+G GT
Sbjct  215  S--SGIFN-----GDCGTAMTHAVTIVGCGT  238



>ref|XP_007216164.1| hypothetical protein PRUPE_ppa015341mg, partial [Prunus persica]
 gb|EMJ17363.1| hypothetical protein PRUPE_ppa015341mg, partial [Prunus persica]
Length=196

 Score =   140 bits (354),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 100/152 (66%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDC--NLKNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA EGITQ+ TG+L+ LSEQ+L+DC  N ++ GC GG M  AFQFI  N GL  
Sbjct  3    WAFSAVAATEGITQLTTGKLISLSEQELVDCDTNGEDQGCEGGLMDDAFQFIQQNHGLGT  62

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVAS-GESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY  V  +CN +   + AA ITGY++V +  E ALL AV  QPVSV +   G  FQ
Sbjct  63   EANYPYSGVDGTCNTKKEASIAAKITGYEDVPTNSEQALLKAVANQPVSVAIDASGSDFQ  122

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+G      CG+   H +T +GYG
Sbjct  123  FYS--SGVFTGT-----CGTSLDHGVTAVGYG  147



>ref|XP_009357171.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 103/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA EGITQ+ TG L+ LSEQ+L+DC+   ++ GC GG M  AFQFI  N G+  
Sbjct  151  WAFSAVAATEGITQLTTGTLISLSEQELVDCDTASEDQGCEGGLMDDAFQFIQQNHGIST  210

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY+ V  +CNA+   + AA ITG+++V A+ E  LLAAV +QPVSV +   G  FQ
Sbjct  211  EANYPYEGVDGTCNAKKEASHAAKITGFEDVPANSEKDLLAAVAHQPVSVAIDASGSDFQ  270

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+FSG      CG+   H +T +GYG
Sbjct  271  FYS--SGVFSGT-----CGTSLDHGVTAVGYG  295



>sp|P60994.1|ERVB_TABDI RecName: Full=Ervatamin-B; Short=ERV-B [Tabernaemontana divaricata]
 pdb|1IWD|A Chain A, Proposed Amino Acid Sequence And The 1.63 Angstrom X-ray 
Crystal Structure Of A Plant Cysteine Protease Ervatamin 
B: Insight Into The Structural Basis Of Its Stability And 
Substrate Specificity.
Length=215

 Score =   141 bits (355),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 99/151 (66%), Gaps = 10/151 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAA+E I +IRTGQL+ LSEQ+L+DC+  ++GC GGWM  AFQ+I+ NGG+    
Sbjct  26   WAFSAVAAVESINKIRTGQLISLSEQELVDCDTASHGCNGGWMNNAFQYIITNGGIDTQQ  85

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPY AVQ SC          +I G+Q V  + ESAL +AV  QPVSV +   G  FQ+Y
Sbjct  86   NYPYSAVQGSCKPYRL--RVVSINGFQRVTRNNESALQSAVASQPVSVTVEAAGAPFQHY  143

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +  SGIF+     G CG+   H + I+GYGT
Sbjct  144  S--SGIFT-----GPCGTAQNHGVVIVGYGT  167



>ref|XP_011005485.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=339

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 106/153 (69%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA+EGI +++TG+L+ L+EQQL+DC+++  + GC GG M  AFQFI+ NGGL  
Sbjct  146  WAFSAVAAIEGIIKLKTGKLISLTEQQLVDCDVEGLDQGCGGGLMDNAFQFILRNGGLTS  205

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGMFQ  352
            ++ YPYQ V  +C ++ + +  A ITGY++V  + E+ALL AV  QPVSV +   G  FQ
Sbjct  206  EATYPYQGVDGTCKSKKTASIEAKITGYEDVPVNNENALLQAVAKQPVSVAVEGGGYDFQ  265

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y   SG+F      GDCG+   HA+T IGYGT
Sbjct  266  FY--KSGVFK-----GDCGTYLDHAVTAIGYGT  291



>ref|XP_010054322.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76126.1| hypothetical protein EUGRSUZ_D00502 [Eucalyptus grandis]
Length=345

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 104/150 (69%), Gaps = 8/150 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAAMEGIT I+  +L+ LS Q+L+DC+  + GC GG M  AF+FI+ NGGL  ++
Sbjct  152  WAFSAVAAMEGITMIKKRKLVPLSVQELVDCDDNDDGCIGGLMDSAFEFIVSNGGLTTEA  211

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPYQ  + +CN   + N AA+ITGY++V A+ E ALL AV  QPVSV +   G  FQ+Y
Sbjct  212  NYPYQENKGTCNTAKAANPAASITGYKDVPANNEKALLQAVANQPVSVAIEGGGFDFQFY  271

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +  +G+F+G+     CG+   HA+T +GYG
Sbjct  272  S--TGVFTGS-----CGTDIDHAVTAVGYG  294



>ref|XP_008810168.1| PREDICTED: ervatamin-B-like isoform X2 [Phoenix dactylifera]
 ref|XP_008810169.1| PREDICTED: ervatamin-B-like isoform X2 [Phoenix dactylifera]
Length=336

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 106/152 (70%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFS+VAA+E ITQI+TG L+ LSEQQL+DC++   N GC GG MT AFQ+++DNGG+  
Sbjct  143  WAFSSVAAIEAITQIKTGNLVSLSEQQLVDCDVNDGNQGCDGGLMTRAFQYVIDNGGITT  202

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            + +YPY A   +C+   + +SAATI+GY+ V A+ ES+LL AV  QPVSV +   G  F+
Sbjct  203  EDNYPYMAANGTCDTNKTSSSAATISGYESVPANDESSLLQAVANQPVSVGIDGSGQDFR  262

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SGIF+     G C +   HA+T +GYG
Sbjct  263  HYS--SGIFT-----GPCETQMTHAVTAVGYG  287



>ref|XP_007212585.1| hypothetical protein PRUPE_ppa015944mg [Prunus persica]
 gb|EMJ13784.1| hypothetical protein PRUPE_ppa015944mg [Prunus persica]
Length=339

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 104/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA EGITQ+ TG+L+ LSEQ+L+DC+   ++ GC GG M  AFQFI  N GL  
Sbjct  146  WAFSAVAATEGITQLTTGKLISLSEQELVDCDTSGEDQGCEGGLMDDAFQFIQQNHGLSA  205

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY  V  SCN + + + AA ITGY++V A+ E ALL AV +QPVSV +   G  FQ
Sbjct  206  EANYPYNGVDGSCNTKKAASIAAKITGYEDVPANSEKALLTAVAHQPVSVAIDAGGSDFQ  265

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+G+     CG+   H +T +GYG
Sbjct  266  FYS--SGVFTGS-----CGTSLDHGVTAVGYG  290



>ref|XP_011086001.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 102/151 (68%), Gaps = 9/151 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL-KNYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFSAVAA EGI Q+ TG L+ LSEQ+L+DC+  ++ GC GG M  AF+FI+ NGG+  +
Sbjct  149  WAFSAVAATEGINQLTTGNLISLSEQELVDCDTSEDEGCNGGLMDNAFEFIISNGGITTE  208

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQY  355
            S+YPY+ V  +CN++   +  A ITGY++V A+ ESALL AV  QPVSV +   G  FQ+
Sbjct  209  SNYPYEGVDGTCNSKKESSHVAKITGYEDVPANSESALLKAVANQPVSVAIDASGSDFQF  268

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            Y   SG+F+G      CG+   H +T +GYG
Sbjct  269  YT--SGVFTGQ-----CGTELDHGVTAVGYG  292



>ref|XP_006446792.1| hypothetical protein CICLE_v10018253mg [Citrus clementina]
 gb|ESR60032.1| hypothetical protein CICLE_v10018253mg [Citrus clementina]
Length=341

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 103/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA+EGI Q+ TG+L  LSEQ+L+DC++K  + GC GG M  AFQF+  N G+  
Sbjct  148  WAFSAVAAIEGINQLTTGKLASLSEQELVDCDVKGEDEGCNGGLMDNAFQFVQKNKGITT  207

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY+ V   CNA+   N AA I G+++V A+ E+AL+ AV  QPVSV +   G  FQ
Sbjct  208  ETNYPYKGVDGKCNAKEEANHAAKINGHEDVPANSETALMNAVANQPVSVAIDAGGSDFQ  267

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+     GDCG+   H +T +GYG
Sbjct  268  FYS--SGVFT-----GDCGTELDHGVTAVGYG  292



>gb|KDP38777.1| hypothetical protein JCGZ_05113 [Jatropha curcas]
Length=222

 Score =   141 bits (355),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 103/153 (67%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGIT++ TG+L+ LSEQ+L+DC+   ++ GC GG M  AF FI  NGGL  
Sbjct  29   WAFSAVAAMEGITKLSTGKLISLSEQELVDCDTSGEDQGCEGGLMDDAFGFIKKNGGLTT  88

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPYQ    +CN + + + AA I GY++V A+ E ALL AV  QPVSV +   G  FQ
Sbjct  89   EANYPYQGTDDTCNTKKAADKAAKINGYEDVPANSEQALLKAVANQPVSVAIDASGSAFQ  148

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+   G+F+     GDCG+   H +T +GYGT
Sbjct  149  FYS--GGVFT-----GDCGTELDHGVTAVGYGT  174



>gb|EYU19040.1| hypothetical protein MIMGU_mgv1a026538mg [Erythranthe guttata]
Length=325

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 103/151 (68%), Gaps = 9/151 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL-KNYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFSAVAA EG+ Q++TG+L+ LSEQ+L+DC+  ++ GC GG M  AF+FI+ N GL  +
Sbjct  133  WAFSAVAATEGLNQLKTGKLISLSEQELVDCDTSEDQGCNGGLMDNAFEFIISNNGLTTE  192

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQY  355
            S+YPY+ V  +CN++   +  A ITGY++V A+ ESALL AV  QP+SV +   G  FQ+
Sbjct  193  SNYPYEGVDGTCNSKKESSHVAKITGYEDVPANSESALLKAVANQPISVAIDASGSDFQF  252

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            Y+   G+FSG      CG+   H +T +GYG
Sbjct  253  YS--GGVFSGQ-----CGTELDHGVTAVGYG  276



>ref|XP_003538185.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 104/153 (68%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA EGIT++ TG+L+ LSEQ+L+DC+ K  + GC GG M  AF+FI+ N GL  
Sbjct  150  WAFSAVAATEGITKLSTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFILQNKGLAA  209

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            ++ YPY+ V  +CNA+  GN A +I GY++V A+ ESALL AV  QPVSV +   G  FQ
Sbjct  210  EAIYPYEGVDGTCNAKAEGNHATSIKGYEDVPANSESALLKAVANQPVSVAIEASGFEFQ  269

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+   G+F+G+     CG+   H +T +GYG 
Sbjct  270  FYS--GGVFTGS-----CGTNLDHGVTAVGYGV  295



>gb|KDO63329.1| hypothetical protein CISIN_1g047793mg, partial [Citrus sinensis]
Length=324

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 101/152 (66%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA EGITQ+ TG+L+ LSEQ+L+ C+    ++GC GG M  AF+FI+ N G+  
Sbjct  131  WAFSAVAATEGITQLTTGKLISLSEQELVSCDTSGVDHGCEGGEMEDAFKFIIHNDGITT  190

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPYQAV  +CN  N  +  A I GY+ V A+ E ALL AV  QPV+V +   G  FQ
Sbjct  191  EANYPYQAVDGTCNKTNEASHVAKIKGYETVPANSEEALLKAVANQPVAVSIDASGSAFQ  250

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+     GDCG+   H +T +GYG
Sbjct  251  FYS--SGVFT-----GDCGTELDHGVTAVGYG  275



>ref|XP_008382007.1| PREDICTED: ervatamin-B-like [Malus domestica]
 ref|XP_008365747.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=343

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 103/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA EGITQ+ TG+L+ LSEQ+L+DC+   ++ GC GG M  AFQFI  N G+  
Sbjct  150  WAFSAVAATEGITQLTTGKLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNRGIST  209

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY  V  +CNA+   + AA ITG+++V A+ E ALL AV +QPVSV +   G  FQ
Sbjct  210  EANYPYDGVDGTCNAKKEASRAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDFQ  269

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+G      CG+   H +T +GYG
Sbjct  270  FYS--SGVFTGT-----CGTSLDHGVTAVGYG  294



>ref|XP_009629965.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=343

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 101/151 (67%), Gaps = 9/151 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFSAVAA EGI +I+TG+L+ LSEQ+L+DC+   + GC GG M  AF+FI+ N GL  +
Sbjct  150  WAFSAVAATEGINKIKTGKLISLSEQELVDCDTSSDMGCEGGLMDDAFKFIIKNNGLTTE  209

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQY  355
            S+YPY+    +C      N AA ITGY++V A+ ESALL AV  QP+SV +   G  FQ+
Sbjct  210  SNYPYEGTNATCKTGKESNHAAKITGYEDVPANSESALLKAVANQPISVAIDASGSDFQF  269

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            Y+  +G+F+     G+CG+   H +T IGYG
Sbjct  270  YS--TGVFT-----GECGTELDHGVTAIGYG  293



>ref|XP_009357172.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=343

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 103/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA EGITQ+ TG+L+ LSEQ+L+DC+   ++ GC GG M  AFQFI  N G+  
Sbjct  150  WAFSAVAATEGITQLTTGKLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNRGIST  209

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY  V  +CNA+   + AA ITG+++V A+ E ALL AV +QPVSV +   G  FQ
Sbjct  210  EANYPYDGVDGTCNAKKEASRAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDFQ  269

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+G      CG+   H +T +GYG
Sbjct  270  FYS--SGVFTGT-----CGTSLDHGVTAVGYG  294



>ref|XP_010426443.1| PREDICTED: ervatamin-B [Camelina sativa]
Length=340

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 101/150 (67%), Gaps = 9/150 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAA+EGI +I  G L+ LSEQQLLDC+ +NYGC GG M  AF +I++N G+  + 
Sbjct  150  WAFSAVAAVEGIMKIAKGNLVSLSEQQLLDCSTENYGCNGGLMDKAFNYIINNQGITTED  209

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGMFQYY  358
             YPYQ  QQ+C++ +S  +AATI+ Y+ V  + E ALL AV+ QPVSV +   G  F+ Y
Sbjct  210  SYPYQESQQTCDSTHS--AAATISDYKTVTQNDEEALLKAVSQQPVSVAIDGSGAAFKQY  267

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
              + GIF G     DCG+   H +TI+GYG
Sbjct  268  --DGGIFDGE----DCGTNLSHGVTIVGYG  291



>ref|XP_008810167.1| PREDICTED: ervatamin-B-like isoform X1 [Phoenix dactylifera]
Length=362

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 106/152 (70%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFS+VAA+E ITQI+TG L+ LSEQQL+DC++   N GC GG MT AFQ+++DNGG+  
Sbjct  169  WAFSSVAAIEAITQIKTGNLVSLSEQQLVDCDVNDGNQGCDGGLMTRAFQYVIDNGGITT  228

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            + +YPY A   +C+   + +SAATI+GY+ V A+ ES+LL AV  QPVSV +   G  F+
Sbjct  229  EDNYPYMAANGTCDTNKTSSSAATISGYESVPANDESSLLQAVANQPVSVGIDGSGQDFR  288

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SGIF+     G C +   HA+T +GYG
Sbjct  289  HYS--SGIFT-----GPCETQMTHAVTAVGYG  313



>ref|XP_004233054.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=351

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 104/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEG+ Q++TG+L+ LSEQ+L+DC+++  + GC GG +  AFQFI+ N GL  
Sbjct  158  WAFSAVAAMEGLHQLKTGKLIPLSEQELVDCDVEGEDLGCTGGLLDTAFQFIIKNKGLTT  217

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPYQA    CN + S  S A ITGY++V A+ E ALL AV  QPVSV +  DG  F 
Sbjct  218  EANYPYQAADGVCNKKKSALSVAKITGYEDVPANNEKALLQAVANQPVSVAI--DGSSFD  275

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +   +SG+FSG+     C +   HA+T +GYG
Sbjct  276  FQFYSSGVFSGS-----CSTWLNHAVTAVGYG  302



>ref|XP_011078542.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 104/151 (69%), Gaps = 9/151 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL-KNYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFSAVAA EGI Q+ T +L+ LSEQ+L+DC+  ++ GC GG M  AF+FI+ NGG+  +
Sbjct  149  WAFSAVAATEGINQLTTRKLISLSEQELVDCDTSEDEGCNGGLMDDAFEFIISNGGITTE  208

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQY  355
            S+YPY+ V  +CN++   + AA ITGY++V A+ E ALL AV  QPVSV +   G  FQ+
Sbjct  209  SNYPYEGVDGTCNSKKESSHAAKITGYEDVPANSEPALLKAVANQPVSVAIDASGSDFQF  268

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            Y+  SG+F+     G+CG+   H +T +GYG
Sbjct  269  YS--SGVFT-----GECGTELDHGVTAVGYG  292



>ref|XP_008244476.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=339

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 103/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA EGITQ+ TG+L+ LSEQ+L+DC+    + GC GG M  AFQFI  N GL  
Sbjct  146  WAFSAVAATEGITQLTTGKLISLSEQELVDCDTSGVDQGCEGGLMDDAFQFIQQNHGLST  205

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY  V  SCN + + + AA ITGY++V A+ E ALL AV +QPVSV +   G  FQ
Sbjct  206  EANYPYNGVDGSCNTKKAASIAAKITGYEDVPANSEKALLTAVAHQPVSVAIDAGGSDFQ  265

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+G+     CG+   H +T +GYG
Sbjct  266  FYS--SGVFTGS-----CGTSLDHGVTAVGYG  290



>ref|XP_009775915.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=340

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 101/151 (67%), Gaps = 9/151 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFSAVAA EGI +I+TG+L+ LSEQ+L+DC+   + GC GG M  AF FI+ N GL  +
Sbjct  148  WAFSAVAATEGINKIKTGKLISLSEQELVDCDTSSDMGCEGGLMDDAFTFIIKNHGLTTE  207

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQY  355
            S+YPY+    +C  +   N  A ITGY++V A+ ESALL+AV  QPVSV +   G  FQ+
Sbjct  208  SNYPYEGTDGTCKTRKESNHVAKITGYEDVPANSESALLSAVANQPVSVAIDASGSDFQF  267

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            Y+  SG+F+     G+CG+   H +T IGYG
Sbjct  268  YS--SGVFT-----GECGTELDHGVTAIGYG  291



>ref|XP_002865220.1| senescence-associated gene 12 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41479.1| senescence-associated gene 12 [Arabidopsis lyrata subsp. lyrata]
Length=346

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 103/150 (69%), Gaps = 8/150 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAA+EG TQI+ G+L+ LSEQQL+DC+  ++GC GG M  AF+ IM  GGL  +S
Sbjct  155  WAFSAVAAIEGATQIKKGKLISLSEQQLVDCDTNDFGCEGGLMDTAFEHIMATGGLTTES  214

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPY+    +CN++ +   A +ITGY++V  + E AL+ AV +QPVSV +   G  FQ+Y
Sbjct  215  NYPYKGEDATCNSKKTNPKATSITGYEDVPVNDEQALMKAVAHQPVSVGIEGGGFDFQFY  274

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +  SG+F+     G+C +   HA+T IGYG
Sbjct  275  S--SGVFT-----GECTTYLDHAVTAIGYG  297



>ref|NP_563764.1| Cysteine proteinases superfamily protein [Arabidopsis thaliana]
 gb|AAF80223.1|AC025290_12 Contains similarity to a cysteine endopeptidase 1 from Phaseolus 
vulgaris gb|U52970 and is a member of the papain cysteine 
protease family PF|00112 [Arabidopsis thaliana]
 gb|AEE27969.1| Cysteine proteinases superfamily protein [Arabidopsis thaliana]
Length=343

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 100/152 (66%), Gaps = 9/152 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNY--GCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA+EGI +I+TG L+ LSEQQL+DC++  Y  GC GG M  AF+FI  NGGL  
Sbjct  152  WAFSAVAAIEGINKIKTGNLVSLSEQQLIDCDVGTYNKGCSGGLMETAFEFIKTNGGLAT  211

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVASGESALLAAVTYQPVSVILTHDGGMFQY  355
            ++DYPY  ++ +C+ + S N   TI GYQ+VA  E++L  A   QPVSV +   G +FQ 
Sbjct  212  ETDYPYTGIEGTCDQEKSKNKVVTIQGYQKVAQNEASLQIAAAQQPVSVGIDAGGFIFQL  271

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            Y+  SG+F+       CG+   H +T++GYG 
Sbjct  272  YS--SGVFTNY-----CGTNLNHGVTVVGYGV  296



>ref|XP_008244499.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=345

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 101/152 (66%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA EGITQ+ TG+L+ LSEQ+L+DC+ K  + GC GG M  AFQFI  N GL  
Sbjct  152  WAFSAVAATEGITQLTTGKLVSLSEQELVDCDTKGVDQGCEGGLMDDAFQFIQQNHGLST  211

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY  V  +CN +   N AA IT +++V A+ E ALL AV +QPVSV +   G  FQ
Sbjct  212  EANYPYNGVDGTCNTKKEANIAAKITDHEDVPANDEKALLNAVAHQPVSVAIDASGSDFQ  271

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+G      CG+   H +T +GYG
Sbjct  272  FYS--SGVFTGT-----CGTSLDHGVTAVGYG  296



>ref|XP_004252652.2| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=322

 Score =   143 bits (361),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 100/151 (66%), Gaps = 9/151 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFSAVAA EGI +I+TG+L+ LSEQ+L+DC+   + GC GG M  AF+FI+ N GL  +
Sbjct  130  WAFSAVAATEGINKIKTGKLISLSEQELVDCDTSSDMGCEGGLMDDAFKFIIKNHGLTTE  189

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQY  355
            S+YPY+    +C      N AA IT Y++V A+ ESALL AV  QPVSV +   G  FQ+
Sbjct  190  SNYPYEGTDSTCKTGKESNHAAKITSYEDVPANSESALLKAVANQPVSVAIDASGSDFQF  249

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            Y+  SG+F+     G+CG+   H +T +GYG
Sbjct  250  YS--SGVFT-----GECGTELDHGVTAVGYG  273



>ref|XP_006663343.1| PREDICTED: vignain-like [Oryza brachyantha]
Length=325

 Score =   143 bits (361),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 102/152 (67%), Gaps = 9/152 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL-KNYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFSAVAA+EG+ +I TG+L+ LSEQ+L+DC+   N GC GG M +AFQFI  NGG+  +
Sbjct  108  WAFSAVAAVEGVNKISTGKLVSLSEQELVDCDAGDNQGCNGGLMDYAFQFIKKNGGITTE  167

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQY  355
            S+YPY+AVQ  CN   + +   TI GY++V A+ ESAL  AV  QPV+V +   G  FQ+
Sbjct  168  SNYPYRAVQGRCNRAKASSHDVTIDGYEDVPANDESALQKAVANQPVAVAIEASGQDFQF  227

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            Y+   G+F+     G+CG+   H +  +GYGT
Sbjct  228  YS--EGVFT-----GECGTDLDHGVAAVGYGT  252



>ref|XP_008779585.1| PREDICTED: zingipain-2-like [Phoenix dactylifera]
Length=326

 Score =   143 bits (361),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 108/153 (71%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDC--NLKNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFS+VAA+E ITQI+TG L+ LSEQQL+DC  N  N+GC GG+MT AFQ++++NGG+  
Sbjct  133  WAFSSVAAIEAITQIKTGNLVYLSEQQLVDCDANDGNHGCHGGFMTGAFQYVINNGGITT  192

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY+A   +C+   + +SAATI GY+ V A+ ES+LL AVT QPVSV +   G  F+
Sbjct  193  ENNYPYRANDGTCDTNRASSSAATIGGYESVPANDESSLLQAVTNQPVSVGIDGSGQDFR  252

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y    GIF+     G C +   HA+T +GYGT
Sbjct  253  HY--KGGIFT-----GACETNMNHAVTAVGYGT  278



>ref|XP_006348972.1| PREDICTED: oryzain alpha chain-like [Solanum tuberosum]
Length=288

 Score =   142 bits (358),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 98/150 (65%), Gaps = 9/150 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA+EGI +I+TG+L+ LSEQQL+DC++   N GC+GG+M  AF +IM+NGG+  
Sbjct  91   WAFSAVAAIEGINKIKTGKLVSLSEQQLMDCDVYSDNQGCKGGFMESAFDYIMENGGITT  150

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVASGESALLAAVTYQPVSVILTHDGGMFQY  355
              +YPY   +Q CN + +     TI+ Y++V   E +L  A+  QP+SV +   G  FQ 
Sbjct  151  SKNYPYIGKEQKCNTKKAKQHEVTISNYEKVPPNEESLQVAINKQPISVAIDASGYSFQL  210

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGY  445
            Y+   GIFSG      CG+   HA+T+IGY
Sbjct  211  YS--GGIFSGY-----CGNSLNHAVTLIGY  233



>ref|XP_003607546.1| Cysteine proteinase [Medicago truncatula]
 ref|XP_003637651.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89743.1| papain family cysteine protease [Medicago truncatula]
Length=345

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 105/152 (69%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAF+AVAA+EGI +I++G+L+ LSEQ+L+DC++K  N GC+GG M  A+ FI++NGGL  
Sbjct  153  WAFAAVAAVEGINKIKSGKLISLSEQELIDCDVKSGNQGCQGGLMETAYTFIIENGGLTT  212

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            + DYPY+ V  +C  + + + AA+I+GY+EV A  E+ L AA  +QPVSV +   G  FQ
Sbjct  213  EQDYPYEGVDGTCKMEKAAHYAASISGYEEVPADNEAKLKAAAAHQPVSVAIDAGGYSFQ  272

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+   G+FS     G CG    H +T++GYG
Sbjct  273  FYS--EGVFS-----GICGKQLNHGVTVVGYG  297



>ref|XP_009365508.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=542

 Score =   146 bits (368),  Expect = 4e-38, Method: Composition-based stats.
 Identities = 74/152 (49%), Positives = 105/152 (69%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAM+GIT++ TG+L+ LSEQ+L+DC+    + GC GG M  AFQFI  N GL  
Sbjct  349  WAFSAVAAMKGITKLTTGKLISLSEQELVDCDTSSVDQGCEGGLMDDAFQFITQNHGLST  408

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY  V  +CN +N  + AATITG+++V A+ E+ALL AV  QP+SV++   G  FQ
Sbjct  409  ETNYPYTGVDGTCNTKNEASHAATITGHEDVPANSEAALLKAVANQPISVVIDAGGSDFQ  468

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+G      CG+   H +T +G+G
Sbjct  469  FYS--SGVFTGT-----CGTSLDHGVTAVGFG  493



>ref|XP_006362426.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score =   143 bits (361),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 101/151 (67%), Gaps = 9/151 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFSAVAA EGI +I+TG+L+ LSEQ+L+DC+   + GC GG M  AF+FI+ N GL  +
Sbjct  148  WAFSAVAATEGINEIKTGKLISLSEQELVDCDTSSDMGCEGGLMDDAFKFIIKNHGLTTE  207

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQY  355
            S+YPY+    +C      N AA ITGY++V A+ ESALL AV  QPVSV +   G  FQ+
Sbjct  208  SNYPYEGTDGTCKTGKESNDAAKITGYEDVPANSESALLNAVANQPVSVAIDASGSDFQF  267

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            Y+  SG+F+     G+CG+   H +T +GYG
Sbjct  268  YS--SGVFT-----GECGTELDHGVTAVGYG  291



>ref|XP_006292980.1| hypothetical protein CARUB_v10019256mg [Capsella rubella]
 gb|EOA25878.1| hypothetical protein CARUB_v10019256mg [Capsella rubella]
Length=339

 Score =   143 bits (361),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 103/151 (68%), Gaps = 9/151 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAA+EGI +I  G+L+ LSEQQL+DCN +N GC GG M  AF +I++N G+  + 
Sbjct  149  WAFSAVAAVEGIMKIAKGELVSLSEQQLVDCNRENKGCGGGIMWKAFNYIINNQGITTED  208

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGMFQYY  358
             YPYQA QQ+C++ +S   AATI+ Y+ V  + E ALL AV+ QPVSV +   G  F++Y
Sbjct  209  SYPYQASQQTCDSTHS--IAATISAYETVPQNDEEALLKAVSQQPVSVAIDGSGAAFKHY  266

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +   GIF       DCG+   HA+TI+GYGT
Sbjct  267  S--GGIFEDE----DCGTHLTHAVTIVGYGT  291



>ref|XP_003580686.1| PREDICTED: oryzain alpha chain-like isoform X1 [Brachypodium 
distachyon]
Length=360

 Score =   144 bits (362),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 96/151 (64%), Gaps = 8/151 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFSA+AA+E I QI TG+L+ LSEQ+L+DC+   N GC GG M  AF+FI+ NGG+  D
Sbjct  159  WAFSAIAAVESINQIVTGELISLSEQELMDCDTSYNAGCDGGLMDDAFEFIISNGGIDTD  218

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEVASGESALLAAVTYQPVSVILTHDGGMFQYY  358
             DYPY+A   SC+A      A TI  Y+++   E +L  AV+ QPVSV +   G  FQ Y
Sbjct  219  EDYPYKARNDSCDANKRNRKAVTIDDYEDLRMNEKSLQKAVSNQPVSVAIEAGGRDFQLY  278

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
               SGIF+G      CG+   HA TI+GYG+
Sbjct  279  --KSGIFTGT-----CGTDLDHATTIVGYGS  302



>ref|XP_006469011.1| PREDICTED: vignain-like [Citrus sinensis]
Length=341

 Score =   143 bits (361),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 103/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA+EGI Q+ TG+L  LSEQ+L+DC++K  + GC GG M  AFQF+  N G+  
Sbjct  148  WAFSAVAAIEGINQLTTGKLASLSEQELVDCDVKGEDEGCNGGLMDNAFQFVQKNKGITT  207

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY+ V   CNA+   N AA I G+++V A+ E+AL+ AV  QPVSV +   G  FQ
Sbjct  208  ETNYPYKGVDGKCNAKEEANHAAKINGHEDVPANSETALMKAVANQPVSVAIDAGGFDFQ  267

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+     GDCG+   H +T +GYG
Sbjct  268  FYS--SGVFT-----GDCGTELDHGVTAVGYG  292



>ref|XP_007214432.1| hypothetical protein PRUPE_ppa025658mg [Prunus persica]
 gb|EMJ15631.1| hypothetical protein PRUPE_ppa025658mg [Prunus persica]
Length=339

 Score =   143 bits (361),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 103/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA EGITQ+ TG+L+ LSEQ+L+DC+   ++ GC GG M  AFQFI  N GL  
Sbjct  146  WAFSAVAATEGITQLTTGKLISLSEQELVDCDTSGEDQGCEGGLMDDAFQFIQQNHGLST  205

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY  V  SCN + + + AA ITGY++V A+ E ALL AV +QPVSV +   G  FQ
Sbjct  206  EANYPYNGVDGSCNTKKAASIAAKITGYEDVPANSEKALLTAVAHQPVSVAIDAGGSDFQ  265

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+G      CG+   H +T +GYG
Sbjct  266  FYS--SGVFTGA-----CGTSLDHGVTAVGYG  290



>gb|AAC49135.1| SAG12 protein [Arabidopsis thaliana]
Length=346

 Score =   143 bits (361),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 102/150 (68%), Gaps = 8/150 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAA+EG TQI+ G+L+ LSEQQL+DC+  ++GC GG M  AF+ I   GGL  +S
Sbjct  155  WAFSAVAAIEGATQIKKGKLISLSEQQLVDCDTNDFGCEGGLMDTAFEHIKATGGLTTES  214

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGMFQYY  358
            DYPY+    +CN++ +   A +ITGY++V  + E AL+ AV +QPVSV +   G  FQ+Y
Sbjct  215  DYPYKGEDATCNSKKTNPKATSITGYEDVPVNDEQALMKAVAHQPVSVGIEGGGFDFQFY  274

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +  SG+F+     G+C +   HA+T IGYG
Sbjct  275  S--SGVFT-----GECTTYLDHAVTAIGYG  297



>ref|XP_010518799.1| PREDICTED: senescence-specific cysteine protease SAG12 [Tarenaya 
hassleriana]
Length=348

 Score =   143 bits (361),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 103/150 (69%), Gaps = 8/150 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFS VAA+EG T+I+ G+L+ LSEQQL+DC+  +YGC GG +  AF+ I ++ GL  ++
Sbjct  157  WAFSVVAAIEGATKIKKGKLISLSEQQLVDCDKYDYGCEGGLLDTAFEHIKESHGLTTEA  216

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPY     +CN++ +   AATITGY++V A+ E AL+ AVT QPVSV +   G  FQ+Y
Sbjct  217  NYPYNGEDGTCNSKKASAKAATITGYEDVPANDEKALMKAVTNQPVSVAIEGGGFEFQFY  276

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +  SG+F+G      CG+   HA+ ++GYG
Sbjct  277  S--SGVFTGQ-----CGTDLDHAVAVVGYG  299



>ref|XP_006469128.1| PREDICTED: vignain-like [Citrus sinensis]
Length=343

 Score =   143 bits (361),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 101/152 (66%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA EGITQ+ TG+L+ LSEQ+L+ C+    ++GC GG M  AF+FI+ N G+  
Sbjct  150  WAFSAVAATEGITQLTTGKLISLSEQELVSCDTSGVDHGCEGGEMEDAFKFIIHNDGITT  209

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPYQAV  +CN  N  +  A I GY+ V A+ E ALL AV  QPV+V +   G  FQ
Sbjct  210  EANYPYQAVDGTCNKTNEASHVAKIKGYETVPANSEEALLKAVANQPVAVSIDASGSAFQ  269

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+     GDCG+   H +T +GYG
Sbjct  270  FYS--SGVFT-----GDCGTELDHGVTAVGYG  294



>ref|XP_009623244.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=341

 Score =   143 bits (360),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 100/151 (66%), Gaps = 9/151 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFSAVAA EGI +I+TG+L+ LSEQ+L+DC+ + + GC GG M  AF+FI+ N GL  +
Sbjct  149  WAFSAVAATEGINKIKTGKLISLSEQELVDCDTRSDMGCEGGLMDDAFKFIIKNNGLTTE  208

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGMFQY  355
            S+YPY+    +C      N AA ITGY++V  + ESALL AV  QP+SV +   G  FQ+
Sbjct  209  SNYPYEGTDATCKTGKESNHAAKITGYEDVPDNSESALLKAVANQPISVAIDASGSDFQF  268

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            Y+  SG+F+G      CG+   H +T +GYG
Sbjct  269  YS--SGVFTGK-----CGTELDHGVTAVGYG  292



>ref|XP_009761201.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=344

 Score =   143 bits (361),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 97/152 (64%), Gaps = 9/152 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDC--NLKNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA+EGI +I+TG+L+ LSEQ+L+DC  N  N GC GG+M  AF FI  NGG+  
Sbjct  148  WAFSAVAAVEGINKIKTGKLVSLSEQELVDCDVNSDNQGCNGGFMEKAFSFIKKNGGITT  207

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVASGESALLAAVTYQPVSVILTHDGGMFQY  355
            + +YPY    Q CN   +   A TI+GY+ VA  E +L AAVT QP+SV +   G  FQ 
Sbjct  208  EKNYPYVGKDQKCNTTKAKQHAVTISGYEMVAKNEESLQAAVTKQPISVAIDASGYDFQL  267

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            YA   G++SG      CG+   H +T+IGYG 
Sbjct  268  YA--GGVYSGF-----CGNSLNHGVTLIGYGV  292



>ref|XP_004297572.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score =   143 bits (360),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 103/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGITQ+ TG+L+ LSEQ+L+DC++  ++ GC GG M  AF FI  N GL  
Sbjct  148  WAFSAVAAMEGITQLTTGKLISLSEQELVDCDVNGEDQGCEGGLMDNAFDFINQNHGLST  207

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            ++ YPY  V  +CNAQ   + AA+ITG+++V A+ ESALL AV  QP+SV +   G  FQ
Sbjct  208  EAHYPYTGVDGTCNAQKEASHAASITGHEDVPANSESALLKAVANQPISVAIDASGSDFQ  267

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
             Y+  SG+F+G      CG+   H +T +GYG
Sbjct  268  LYS--SGVFTGT-----CGTSLDHGVTAVGYG  292



>ref|XP_004306851.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   143 bits (360),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 103/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGITQ+ TG+L+ LSEQ+L+DC++  ++ GC GG M  AF+FI  N GL  
Sbjct  147  WAFSAVAAMEGITQLTTGKLISLSEQELVDCDVNGEDQGCEGGLMDNAFEFINQNHGLST  206

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVASG-ESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY  V  +CNA+   N AA+ITG+++V    ESAL  AV  QP+SV +   G  FQ
Sbjct  207  EANYPYTGVDGTCNAKKEANHAASITGHEDVPPNDESALQKAVANQPISVAIDASGSGFQ  266

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+     G CG+   H +T +GYG
Sbjct  267  FYS--SGVFT-----GPCGTSLDHGVTAVGYG  291



>ref|XP_010240524.1| PREDICTED: oryzain alpha chain-like isoform X2 [Brachypodium 
distachyon]
Length=355

 Score =   143 bits (361),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 96/151 (64%), Gaps = 8/151 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFSA+AA+E I QI TG+L+ LSEQ+L+DC+   N GC GG M  AF+FI+ NGG+  D
Sbjct  159  WAFSAIAAVESINQIVTGELISLSEQELMDCDTSYNAGCDGGLMDDAFEFIISNGGIDTD  218

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEVASGESALLAAVTYQPVSVILTHDGGMFQYY  358
             DYPY+A   SC+A      A TI  Y+++   E +L  AV+ QPVSV +   G  FQ Y
Sbjct  219  EDYPYKARNDSCDANKRNRKAVTIDDYEDLRMNEKSLQKAVSNQPVSVAIEAGGRDFQLY  278

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
               SGIF+G      CG+   HA TI+GYG+
Sbjct  279  --KSGIFTGT-----CGTDLDHATTIVGYGS  302



>ref|XP_010091034.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 ref|XP_010091036.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXC36678.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXC36680.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=343

 Score =   143 bits (360),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 103/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGITQ+ TG+L+ LSEQ+L+DC+    + GC GG M  AF FI+ N GL  
Sbjct  150  WAFSAVAAMEGITQLTTGKLISLSEQELVDCDTSGTDQGCEGGLMDDAFDFILGNEGLTT  209

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +S YPY+ V ++CN + + + AA+ITG+++V A+ E AL  AV  QPVSV +   G  FQ
Sbjct  210  ESKYPYKGVDETCNKKKASSHAASITGHEDVPANSEKALQKAVANQPVSVAIDAGGSDFQ  269

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
             Y+  SG+F+     G+CG+   H +T +GYG
Sbjct  270  LYS--SGVFT-----GECGTELDHGVTAVGYG  294



>ref|XP_010939512.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=339

 Score =   143 bits (360),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 109/152 (72%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKN--YGCRGGWMTWAFQFIMDNGGLVM  175
            WAFS+VAA+EGITQI TG L+ LSEQQL++C++ +   GC+GG+MT AF ++++NGG+  
Sbjct  146  WAFSSVAAIEGITQINTGNLVSLSEQQLVNCDVNDGDNGCQGGFMTRAFHYVINNGGITS  205

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY+A   +C+   + +S ATI+GY+ V A+ ES+LL AV+ QPVSV +   G  FQ
Sbjct  206  EANYPYKAADGTCDTNKASSSVATISGYENVPANDESSLLQAVSKQPVSVGIDGGGKDFQ  265

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            YY+  SGIF+G      C +   HA+T IGYG
Sbjct  266  YYS--SGIFTGA-----CTTDMDHAVTAIGYG  290



>ref|XP_006360708.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score =   143 bits (360),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 100/151 (66%), Gaps = 9/151 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFSAVAA EGI +I+TG+L+ LSEQ+L+DC+   + GC GG M  AF+FI+ N GL  +
Sbjct  148  WAFSAVAATEGINKIKTGKLISLSEQELVDCDTSSDMGCEGGLMDDAFKFIIKNHGLTTE  207

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQY  355
            S+YPY+    +C      N AA IT Y++V A+ ESALL AV  QPVSV +   G  FQ+
Sbjct  208  SNYPYEGTDNTCKTGKESNHAAKITSYEDVPANSESALLKAVANQPVSVAIDASGSDFQF  267

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            Y+  SG+F+     G+CG+   H +T +GYG
Sbjct  268  YS--SGVFT-----GECGTELDHGVTAVGYG  291



>ref|XP_006470293.1| PREDICTED: xylem cysteine proteinase 1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006470295.1| PREDICTED: xylem cysteine proteinase 1-like [Citrus sinensis]
Length=346

 Score =   143 bits (360),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 101/151 (67%), Gaps = 8/151 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAA+EGITQI  G+L+ LSEQQL+DC+  N+GC GG M  AF++I++N GL  ++
Sbjct  156  WAFSAVAAVEGITQITRGKLIELSEQQLVDCSTDNHGCSGGLMDKAFEYIIENKGLATEA  215

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEVASG-ESALLAAVTYQPVSVILTHDGGMFQYY  358
            DYPY+  + +C+ Q     AATI+ Y+++  G E ALL AV+ QPVSV +   G  F +Y
Sbjct  216  DYPYRHEEGTCDNQKEKAVAATISKYEDLPKGDEQALLQAVSNQPVSVCVDASGRAFHFY  275

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
               SG+ +      DCG+   H + ++G+GT
Sbjct  276  --KSGVLN-----ADCGNNCDHGVAVVGFGT  299



>gb|KDP45578.1| hypothetical protein JCGZ_17185 [Jatropha curcas]
Length=340

 Score =   143 bits (360),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 104/153 (68%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA+EGITQ+ + +L+ LSEQ+L+DC+ K  + GC+GG M  AF+FI +N GL  
Sbjct  148  WAFSAVAAVEGITQLTSHKLISLSEQELVDCDTKGEDQGCQGGLMDDAFKFIENNQGLTT  207

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY+    +CNA    N AA ITGY++V A+ E+ALL AV  QPVSV +   G  FQ
Sbjct  208  ETNYPYEGSDGTCNANKEANHAAKITGYEDVPANDEAALLKAVAQQPVSVAIDAGGFQFQ  267

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+  SGIF+     GDCG+   H +  +GYG 
Sbjct  268  FYS--SGIFT-----GDCGTELDHGVAAVGYGV  293



>ref|XP_006470294.1| PREDICTED: xylem cysteine proteinase 1-like isoform X2 [Citrus 
sinensis]
 gb|KDO38136.1| hypothetical protein CISIN_1g019063mg [Citrus sinensis]
Length=346

 Score =   143 bits (360),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 101/151 (67%), Gaps = 8/151 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAA+EGITQI  G+L+ LSEQQL+DC+  N+GC GG M  AF++I++N GL  ++
Sbjct  156  WAFSAVAAVEGITQITRGKLIELSEQQLVDCSTDNHGCSGGLMDKAFEYIIENKGLATEA  215

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEVASG-ESALLAAVTYQPVSVILTHDGGMFQYY  358
            DYPY+  + +C+ Q     AATI+ Y+++  G E ALL AV+ QPVSV +   G  F +Y
Sbjct  216  DYPYRHEEGTCDNQKEKAVAATISKYEDLPKGDEQALLQAVSNQPVSVCVDASGRAFHFY  275

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
               SG+ +      DCG+   H + ++G+GT
Sbjct  276  --KSGVLN-----ADCGNNCDHGVAVVGFGT  299



>ref|XP_010481519.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Camelina 
sativa]
Length=342

 Score =   143 bits (360),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 103/150 (69%), Gaps = 8/150 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAA+EG  QI+ G+L+ LSEQQL+DC+  N+GC GG M  AF+ I   GGL  +S
Sbjct  151  WAFSAVAAIEGAAQIKKGKLISLSEQQLVDCDTNNFGCEGGLMDTAFEHIKATGGLTTES  210

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPY+    SCN++ +   A +ITGY++V A+ E+AL+ AV +QPVSV +   G  FQ+Y
Sbjct  211  NYPYKGEDGSCNSKKTNPKATSITGYEDVPANDENALMKAVAHQPVSVGIEGGGFDFQFY  270

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +  SG+F+     G+C +   HA+T IGYG
Sbjct  271  S--SGVFT-----GECTTYLDHAVTAIGYG  293



>ref|XP_007025397.1| Senescence-associated gene 12, putative [Theobroma cacao]
 gb|EOY28019.1| Senescence-associated gene 12, putative [Theobroma cacao]
Length=322

 Score =   142 bits (358),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 105/153 (69%), Gaps = 11/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA+EG+TQ++ G+L+ LSEQQL+DC++K  + GC GG M  AFQFI  N GL  
Sbjct  130  WAFSAVAAIEGLTQLKKGKLISLSEQQLVDCDIKGEDEGCEGGLMDNAFQFIKTNRGLTT  189

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY+  +  C  +++   AATI GY++V A+ E ALL AV  QPVSV +   G  FQ
Sbjct  190  EANYPYRGSEGECKNKHA-TPAATIAGYEDVPANNEKALLQAVANQPVSVAIEGSGWAFQ  248

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y   SG+FS     G+CG+   HA+T IGYGT
Sbjct  249  FY--ESGVFS-----GECGTYLDHAVTAIGYGT  274



>ref|XP_009372437.1| PREDICTED: cysteine proteinase COT44-like [Pyrus x bretschneideri]
Length=366

 Score =   143 bits (361),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 98/152 (64%), Gaps = 9/152 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFS VAA+EGI QI TG+L+ LSEQ+L+DC+   N GC GG M +AF+FI+ NGG+  +
Sbjct  152  WAFSTVAAVEGINQIVTGELVSLSEQELVDCDRSYNAGCNGGLMDYAFEFIIQNGGMDTE  211

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEVAS-GESALLAAVTYQPVSVILTHDGGMFQY  355
            SDYPY+A  Q CN     N   +I GY++V S  E+AL  AV +QPVSV +   G   Q 
Sbjct  212  SDYPYKAYDQKCNVALENNKVVSIDGYEDVPSYDENALKKAVAHQPVSVAIEAGGRALQL  271

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            Y   SG+F+     G+CGS   H +  +GYGT
Sbjct  272  Y--QSGVFT-----GECGSALDHGVVAVGYGT  296



>ref|XP_008338342.1| PREDICTED: cysteine proteinase COT44-like [Malus domestica]
Length=366

 Score =   143 bits (361),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 98/152 (64%), Gaps = 9/152 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFS VAA+EGI QI TG+L+ LSEQ+L+DC+   N GC GG M +AF+FI+ NGG+  +
Sbjct  152  WAFSTVAAVEGINQIVTGELVSLSEQELVDCDRSYNAGCNGGLMDYAFEFIIQNGGMDTE  211

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEVAS-GESALLAAVTYQPVSVILTHDGGMFQY  355
            SDYPY+A  Q CN     N   +I GY++V S  E+AL  AV +QPVSV +   G   Q 
Sbjct  212  SDYPYKAYDQKCNVALEXNKVVSIDGYEDVPSYDENALKKAVAHQPVSVAIEAGGRALQL  271

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            Y   SG+F+     G+CGS   H +  +GYGT
Sbjct  272  Y--ESGVFT-----GECGSALDHGVVAVGYGT  296



>ref|XP_009119072.1| PREDICTED: ervatamin-B [Brassica rapa]
 emb|CDY57814.1| BnaA10g28030D [Brassica napus]
Length=344

 Score =   143 bits (360),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 104/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNY--GCRGGWMTWAFQFIMDNGGLVM  175
            WAF+ VAA+EGIT+I+TG L+ LSEQQL+DC+  +Y  GC GG M  A+++++ NGGLV 
Sbjct  152  WAFATVAAIEGITKIKTGNLIPLSEQQLIDCDTGSYNKGCSGGLMETAYEYLIANGGLVA  211

Query  176  DSDYPYQAVQQS-CNAQNSGNSAATITGYQEVASGESALLAAVTYQPVSVILTHDGGMFQ  352
              DYPY A   + C+ + S N   TITGY++VA  E++L  A   QPVSV +  DG +FQ
Sbjct  212  LDDYPYTATDGTGCDQEKSQNKIVTITGYEKVAPNEASLEVAAAQQPVSVGIDADGFIFQ  271

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+G      CGS   HA+T++GYG
Sbjct  272  FYS--SGVFTGY-----CGSSLNHAVTVVGYG  296



>ref|XP_002889596.1| hypothetical protein ARALYDRAFT_887827 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65855.1| hypothetical protein ARALYDRAFT_887827 [Arabidopsis lyrata subsp. 
lyrata]
Length=343

 Score =   142 bits (359),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 100/152 (66%), Gaps = 9/152 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNY--GCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA+EGI +I+TG L+ LSEQQL+DC++  Y  GC GG M  AF+FI  NGGL  
Sbjct  152  WAFSAVAAIEGINKIKTGNLVSLSEQQLIDCDVGTYNKGCSGGLMETAFEFIKSNGGLTT  211

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVASGESALLAAVTYQPVSVILTHDGGMFQY  355
            ++DYPY  ++ +C+ + + N   TI GYQ+VA  E++L  A   QPVSV +   G +FQ 
Sbjct  212  ETDYPYTGIEGTCDQEKAKNKVVTIQGYQKVAQNEASLQIAAAQQPVSVGIDAGGFIFQL  271

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            Y+  SG+F+       CG+   H +T++GYG 
Sbjct  272  YS--SGVFTSY-----CGTNLNHGVTVVGYGV  296



>gb|KDP23983.1| hypothetical protein JCGZ_25371 [Jatropha curcas]
Length=340

 Score =   142 bits (359),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 103/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFS VAA+EGITQ+ T +L+ LSEQ+L+DC+ K  + GC+GG M  AF+FI +N GL  
Sbjct  148  WAFSTVAAVEGITQLTTKKLISLSEQELVDCDTKGEDQGCQGGLMDDAFKFIENNQGLTT  207

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY     +CN +   N AA ITGY++V A+ E+ALL AVT QPVSV +   G  FQ
Sbjct  208  EANYPYVGSDGTCNTKKEANHAAKITGYEDVPANNEAALLKAVTNQPVSVAIDAGGFAFQ  267

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SGIF+     GDCG+   H +  +GYG
Sbjct  268  FYS--SGIFT-----GDCGTELDHGVAAVGYG  292



>ref|XP_009609383.1| PREDICTED: ervatamin-B [Nicotiana tomentosiformis]
Length=309

 Score =   142 bits (357),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 97/152 (64%), Gaps = 9/152 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA+EGI +I+TG+L+ LSEQQL+DC++   N GC GG+M  AF FI  NGG+  
Sbjct  114  WAFSAVAAVEGINKIKTGKLVSLSEQQLVDCDVYSDNQGCNGGFMEKAFAFIKKNGGITT  173

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVASGESALLAAVTYQPVSVILTHDGGMFQY  355
            + +YPY    Q CN   +   A TI+GY+ V   E +L AAVT QP+SV +   G  FQ 
Sbjct  174  EKNYPYVGKDQRCNTTKAKQHAVTISGYEMVPKNEESLQAAVTKQPISVAIDASGYDFQL  233

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            YA   G++SG      CG+   H +T+IGYG 
Sbjct  234  YA--GGVYSGF-----CGNSLNHGVTLIGYGV  258



>ref|XP_002316833.2| hypothetical protein POPTR_0011s07520g [Populus trichocarpa]
 gb|EEE97445.2| hypothetical protein POPTR_0011s07520g [Populus trichocarpa]
Length=362

 Score =   143 bits (360),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 104/152 (68%), Gaps = 13/152 (9%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA EGITQ+ TG+L+ LSEQ+L+DC+   ++ GC GG M  AF FI+ N GL  
Sbjct  172  WAFSAVAATEGITQLSTGKLISLSEQELVDCDTSGEDQGCNGGLMDDAFDFIIQNKGLTT  231

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPYQ    +C   NSG +AA ITGY++V A+ E+ALL AV  QPVSV +   G  FQ
Sbjct  232  EANYPYQGADGAC---NSGKAAAKITGYEDVPANSEAALLKAVANQPVSVAIDAGGSAFQ  288

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+     GDCG+   H +T +GYG
Sbjct  289  FYS--SGVFT-----GDCGTDLDHGVTAVGYG  313



>ref|XP_002524912.1| cysteine protease, putative [Ricinus communis]
 gb|EEF37409.1| cysteine protease, putative [Ricinus communis]
Length=366

 Score =   143 bits (360),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 99/152 (65%), Gaps = 9/152 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFS +AA+EG+ +I TG+L+ LSEQ+L+DC+   N GC GG M  AFQFI++NGG+  D
Sbjct  163  WAFSTIAAVEGVNKIVTGELISLSEQELVDCDRSYNAGCNGGLMDNAFQFIINNGGIDTD  222

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQY  355
             DYPYQAV   C+     N A TI G+++V A  E AL  AV +QPVSV +   G   Q+
Sbjct  223  KDYPYQAVDGKCDTTKVKNKAVTIDGFEDVMAFDEMALQKAVAHQPVSVAIEASGMALQF  282

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            Y   SG+F+     G+CGS   H + I+GYGT
Sbjct  283  Y--QSGVFT-----GECGSALDHGVVIVGYGT  307



>ref|XP_006446793.1| hypothetical protein CICLE_v10018274mg [Citrus clementina]
 gb|ESR60033.1| hypothetical protein CICLE_v10018274mg [Citrus clementina]
Length=341

 Score =   142 bits (358),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 102/152 (67%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA+EGI Q+ TG+L  LSEQ+L+DC++K  + GC GG M  AFQF+  N G+  
Sbjct  148  WAFSAVAAIEGINQLTTGKLASLSEQELVDCDVKGEDEGCNGGLMDNAFQFVQKNKGITT  207

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            + +YPY+ V   CNA+   N AA I G+++V A+ E+AL+ AV  QPVSV +   G  FQ
Sbjct  208  EINYPYKGVDGKCNAKEEANHAAKINGHEDVPANSETALMKAVANQPVSVAIDAGGFDFQ  267

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+     GDCG+   H +T +GYG
Sbjct  268  FYS--SGVFT-----GDCGTELDHGVTAVGYG  292



>gb|KFK31525.1| hypothetical protein AALP_AA6G123900 [Arabis alpina]
Length=341

 Score =   142 bits (358),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 102/151 (68%), Gaps = 10/151 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAA+EGIT+I  G+L+ LSEQQLLDC   N+GC GG ++ AFQ+I++N G+  + 
Sbjct  152  WAFSAVAAVEGITKITKGELVSLSEQQLLDCTSDNHGCDGGTLSKAFQYIINNQGITTED  211

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPYQA QQ C A  +G+ AATI+G+  V  + E ALL  V+ QPVSV +       QY 
Sbjct  212  NYPYQAEQQIC-ASTTGSVAATISGFARVPRNDEEALLKTVSQQPVSVAIDASYAFKQY-  269

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
              + G+F      G+CG+   HA+TIIGYGT
Sbjct  270  --SGGVFD-----GECGTQLNHAVTIIGYGT  293



>ref|XP_006362420.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=347

 Score =   142 bits (358),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 103/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEG+ Q+ TG+L+ LSEQ+L+DC+++  + GC GG +  AFQFI+ N GL  
Sbjct  154  WAFSAVAAMEGVHQVTTGKLIPLSEQELVDCDVEGEDVGCTGGLLDTAFQFIIKNKGLTT  213

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY+A    CN + S  S A ITGY++V A+ E ALL AV  QPVSV +  DG  F 
Sbjct  214  EANYPYEAADGVCNKKKSAVSVAKITGYEDVPANNEKALLQAVANQPVSVAI--DGSSFD  271

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +   +SG+FSG+     C +   HA+T +GYG
Sbjct  272  FQFYSSGVFSGS-----CSTWLNHAVTAVGYG  298



>emb|CDX86529.1| BnaC08g01740D [Brassica napus]
Length=410

 Score =   143 bits (361),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 104/151 (69%), Gaps = 9/151 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAF+AVAA+EGI +I+TG L+ LSEQQL+DC++   N GC GG MT A+++++ NGGLV 
Sbjct  152  WAFTAVAAIEGINKIKTGNLVSLSEQQLIDCDVGAFNKGCSGGLMTTAYEYLIANGGLVT  211

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVASGESALLAAVTYQPVSVILTHDGGMFQY  355
            ++DYPY A+Q SC+ + S N   T+ GY +V   E++L AA   QPVSV +   G +FQ 
Sbjct  212  EADYPYTAIQGSCDQEKSQNKVVTVQGYTKVEQNEASLQAATAQQPVSVGIDAGGFIFQL  271

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            Y+  SG+F+G      CG+   H +T++GYG
Sbjct  272  YS--SGVFTGF-----CGNHLNHGVTVVGYG  295



>ref|XP_004306597.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 103/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGITQ+  G+L+ LSEQ+L+DC+   ++ GC GG M  AF+FI  N GL  
Sbjct  147  WAFSAVAAMEGITQLTMGKLISLSEQELVDCDKSGEDQGCEGGLMDDAFEFINQNHGLST  206

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY  V   CNA+   + AA+ITG+++V A+ ESALL AV  QP+SV +   G  FQ
Sbjct  207  EANYPYTGVDGKCNARKEASHAASITGHEDVPANSESALLKAVASQPISVAIDASGSDFQ  266

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+G      CG+   H +T +GYG
Sbjct  267  FYS--SGVFTGT-----CGTSLDHGVTAVGYG  291



>ref|XP_010103045.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXB94643.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=359

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 103/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGITQ+ TG+L+ LSEQ+L+DC+    + GC GG M  AF FI+ N GL  
Sbjct  166  WAFSAVAAMEGITQLTTGKLISLSEQELVDCDTSGTDQGCEGGLMDDAFDFILGNEGLTT  225

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +S YPY+ V ++CN + + + AA+ITG+++V A+ E AL  AV  QPVSV +   G  FQ
Sbjct  226  ESKYPYKGVDETCNKKKASSHAASITGHEDVPANSEKALQKAVANQPVSVAIDAGGSDFQ  285

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
             Y+  SG+F+     G+CG+   H +T +GYG
Sbjct  286  LYS--SGVFT-----GECGTELDHGVTAVGYG  310



>ref|XP_009361500.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=342

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 101/152 (66%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGIT++ TG+L+ LSEQ+L+DC+    + GC GG M  AFQFI  N GL  
Sbjct  149  WAFSAVAAMEGITKLTTGKLISLSEQELVDCDTSGVDQGCEGGLMDDAFQFINQNHGLST  208

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY  V  +CN +   N AA ITG+++V A+ E ALL AV  QP+SV +   G  FQ
Sbjct  209  ETNYPYTGVDGTCNTKKEANHAAKITGHEDVPANSEEALLKAVANQPISVAIDAGGSDFQ  268

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+G      CG+   H +T +GYG
Sbjct  269  FYS--SGVFTGT-----CGTSLDHGVTAVGYG  293



>ref|XP_010462580.1| PREDICTED: ervatamin-B-like [Camelina sativa]
Length=312

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 101/151 (67%), Gaps = 9/151 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNY--GCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA+EGI +I+TG L+ LSEQQL+DC++  Y  GC GG M  AF++I  NGGLV 
Sbjct  121  WAFSAVAAIEGINKIKTGNLVSLSEQQLIDCDVGTYNKGCSGGLMETAFEYIKTNGGLVT  180

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVASGESALLAAVTYQPVSVILTHDGGMFQY  355
            ++DYPY  ++ +C+ + + N   TI GY++VA  E++L  A   QPVSV +   G +FQ 
Sbjct  181  ETDYPYTGIEGTCDQEKTKNKVVTIQGYKKVAQNEASLQIAAAQQPVSVGIDAGGFIFQL  240

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            Y+  SG+F+       CG+   H +T++GYG
Sbjct  241  YS--SGVFTSY-----CGTNLNHGVTVVGYG  264



>ref|XP_010070600.1| PREDICTED: cysteine proteinase COT44-like [Eucalyptus grandis]
 gb|KCW59473.1| hypothetical protein EUGRSUZ_H02220 [Eucalyptus grandis]
Length=386

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 97/151 (64%), Gaps = 8/151 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFS VAA+EGI QI TG+L+ LSEQ+L+DC+ K N GC GG M +AF+FI+ NGG+  +
Sbjct  167  WAFSTVAAVEGINQIVTGELISLSEQELVDCDRKHNSGCNGGLMDYAFEFIIKNGGMDTE  226

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEVASGESALLAAVTYQPVSVILTHDGGMFQYY  358
             DYPY  +   C+A    +   TI GY++V   ESAL  AV +QPVS+ +   G  FQ Y
Sbjct  227  QDYPYNGIGGKCDASRVNSKVVTIDGYEDVPPYESALKKAVAHQPVSIAIEASGRAFQLY  286

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
               SG+F+     G+CG    H + ++GYG+
Sbjct  287  --QSGVFT-----GECGISLDHGVIVVGYGS  310



>ref|XP_007213554.1| hypothetical protein PRUPE_ppa018048mg [Prunus persica]
 gb|EMJ14753.1| hypothetical protein PRUPE_ppa018048mg [Prunus persica]
Length=343

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 100/152 (66%), Gaps = 9/152 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA EG T++++G+L+ LSEQ+L+DC+   +N GC GG M  AF+F+M N GL  
Sbjct  151  WAFSAVAATEGTTKLKSGKLVSLSEQELVDCDTQGENQGCEGGLMDDAFKFVMRNKGLAA  210

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVASGESALLAAVTYQPVSVILTHDGGMFQY  355
            +++YPY+ +   CN       AA ITGY++V + E ALL AV  QPVSV +   G  FQ+
Sbjct  211  EANYPYRGIDGICNKNKVAYHAAKITGYEDVPANELALLKAVANQPVSVAIDAGGYEFQF  270

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            Y+   GI +     GDCG+   H +T++GYGT
Sbjct  271  YS--RGILT-----GDCGTHLNHGVTVVGYGT  295



>ref|XP_009359967.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=342

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 101/152 (66%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGIT++ TG+L+ LSEQ+L+DC+    + GC GG M  AFQFI  N GL  
Sbjct  149  WAFSAVAAMEGITKLTTGKLISLSEQELVDCDTSGVDQGCEGGLMDDAFQFINQNHGLST  208

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY  V  +CN +   N AA ITG+++V A+ E ALL AV  QP+SV +   G  FQ
Sbjct  209  ETNYPYTGVDGTCNTKKEANHAAKITGHEDVPANSEEALLKAVANQPISVAIDAGGSDFQ  268

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+G      CG+   H +T +GYG
Sbjct  269  FYS--SGVFTGT-----CGTSLDHGVTAVGYG  293



>ref|XP_007132275.1| hypothetical protein PHAVU_011G081100g [Phaseolus vulgaris]
 gb|ESW04269.1| hypothetical protein PHAVU_011G081100g [Phaseolus vulgaris]
Length=341

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 104/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA EGIT++ TG+L+ LSEQ+L+DC+ K  + GC GG M  AF+FI++N GL  
Sbjct  148  WAFSAVAATEGITKLSTGKLISLSEQELIDCDTKGEDQGCEGGLMDDAFKFILNNKGLTT  207

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            ++ YPY+ +  +CNA+   + AA+I GY++V A+ ESALL AV  QPVSV +   G  FQ
Sbjct  208  EATYPYEGIDGTCNAKAESSHAASIKGYEDVPANSESALLKAVANQPVSVAIDASGYEFQ  267

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +YA   G+F+G+     C +   H +T +GYG
Sbjct  268  FYA--GGVFNGS-----CDTNLDHGVTAVGYG  292



>dbj|BAM66994.1| germination-specific cysteine protease 1, partial [Raphanus sativus]
Length=235

 Score =   139 bits (351),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 99/152 (65%), Gaps = 9/152 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFS  A +EGI +I TG+L+ LSEQ+L+DC+   N GC GG M +AFQFIM NGGL  +
Sbjct  29   WAFSTAAVVEGINKIVTGELISLSEQELVDCDKSYNQGCNGGLMDYAFQFIMKNGGLNTE  88

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEVASG-ESALLAAVTYQPVSVILTHDGGMFQY  355
             DYPY+     CN+    +   TI GY++V +  E+AL  AV+YQPVSV +   G +FQ+
Sbjct  89   QDYPYRGSDGKCNSLLKNSKVVTIDGYEDVPTNDETALKRAVSYQPVSVAIDAGGRVFQH  148

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            Y   SGIF+     G+CG+   HA+  +GYG+
Sbjct  149  Y--QSGIFT-----GECGTKMDHAVVAVGYGS  173



>ref|XP_008811650.1| PREDICTED: vignain-like [Phoenix dactylifera]
Length=302

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 103/144 (72%), Gaps = 10/144 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGIT+++TG+LM LSEQ+L+DC++   + GC GG M  AF+FI++N GL  
Sbjct  149  WAFSAVAAMEGITKLKTGKLMSLSEQELVDCDVASDDQGCDGGLMDNAFKFIINNRGLTT  208

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY+ +  +CN++ S +  A+I GY++V A+ E+ALL AV  QPVSV +    G FQ
Sbjct  209  ETNYPYKGIDGTCNSKKSASHVASIKGYEDVPANSEAALLKAVANQPVSVAIEASSGSFQ  268

Query  353  YYASNSGIFSGNDGAGDCGSGFRH  424
            +Y+  SGIF+G+     CG+   H
Sbjct  269  FYS--SGIFTGS-----CGTDLDH  285



>ref|XP_006857794.1| hypothetical protein AMTR_s00061p00214890 [Amborella trichopoda]
 gb|ERN19261.1| hypothetical protein AMTR_s00061p00214890 [Amborella trichopoda]
Length=342

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 106/153 (69%), Gaps = 12/153 (8%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGI +I+TG+L+ LSEQ+++DC+ K  + GC GG M  AF+FI++N GL  
Sbjct  152  WAFSAVAAMEGIHEIKTGKLVSLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIINNHGLTT  211

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVAS-GESALLAAVTYQPVSVILTHDGGMFQ  352
            ++ YPY+AV  +C  + + + AATITGY++V +  E ALL AV  QPVSV +   G  FQ
Sbjct  212  EAKYPYKAVDGTC--KKASSIAATITGYEDVPTNNEKALLKAVASQPVSVAIDASGYEFQ  269

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+   G+F+GN     CG+   H +T +GYGT
Sbjct  270  FYS--RGVFTGN-----CGTELDHGVTAVGYGT  295



>ref|XP_008228868.1| PREDICTED: LOW QUALITY PROTEIN: zingipain-2-like [Prunus mume]
Length=345

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 100/152 (66%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDC--NLKNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA EGITQ+ TG+L+ LSEQ+L+DC  N ++ GC GG M  AFQFI  N GL  
Sbjct  152  WAFSAVAATEGITQLTTGKLISLSEQELVDCDTNGEDQGCEGGLMDDAFQFIQQNHGLST  211

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVAS-GESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY  V  +CN +   + AA ITGY++V +  E ALL AV  QPVSV +   G  FQ
Sbjct  212  EANYPYSGVDGTCNTKKEASIAAKITGYEDVPTNSEQALLKAVANQPVSVAIDASGSDFQ  271

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+G      CG+   H +T +GYG
Sbjct  272  FYS--SGVFTGT-----CGTSLDHGVTAVGYG  296



>gb|EYU19037.1| hypothetical protein MIMGU_mgv1a018631mg [Erythranthe guttata]
Length=325

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 101/151 (67%), Gaps = 9/151 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL-KNYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFSAVAA EG+ QI+TG L+ LSEQ+L+DC+  ++ GC  G M  AF+FI+ N GL  +
Sbjct  133  WAFSAVAATEGLNQIKTGNLISLSEQELVDCDTSEDQGCNDGLMDNAFEFIISNNGLTTE  192

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQY  355
            S+YPY+ V  +CN++   +  A ITGY++V A+ ESALL AV  QP+SV +   G  FQ+
Sbjct  193  SNYPYEGVDGTCNSKKESSHVAKITGYEDVPANSESALLKAVANQPISVAIDASGSDFQF  252

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            Y+   G+FSG      CG+   H +T +GYG
Sbjct  253  YS--GGVFSGQ-----CGTELDHGVTAVGYG  276



>ref|XP_009150151.1| PREDICTED: macrodontain-1-like [Brassica rapa]
Length=344

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 105/153 (69%), Gaps = 11/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFSAVAA+EGIT+I  G+L+ LSEQQL+DC+   N GC GG M+ AF++I++N G+  +
Sbjct  150  WAFSAVAAVEGITKIAKGELISLSEQQLVDCSRDYNKGCGGGIMSKAFEYIINNQGITTE  209

Query  179  SDYPYQAVQQSC--NAQNSGNSAATITGYQEVASG-ESALLAAVTYQPVSVILTHDGGMF  349
             +YPYQ  QQ+C  N Q+S   AATI+GY+ + S  E ALL AV+ QPVS ++   G  F
Sbjct  210  DNYPYQGSQQTCGSNTQSSDYLAATISGYETIPSNDEEALLKAVSQQPVSTVIDGSGDAF  269

Query  350  QYYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +YY+   G+F      G+CG+   HA+ I+GYG
Sbjct  270  KYYS--GGVFD-----GECGTEMSHAVAIVGYG  295



>ref|XP_008340724.1| PREDICTED: vignain-like [Malus domestica]
Length=338

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 103/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGIT++ TG+L+ LSEQ+L+DC+    + GC GG M  AFQFI  N GL  
Sbjct  145  WAFSAVAAMEGITKLTTGKLISLSEQELVDCDTSGVDQGCEGGLMDDAFQFITQNHGLST  204

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY  V  +CN +   + AATITG+++V A+ E+ALL AV  QP+SV +   G  FQ
Sbjct  205  ETNYPYTGVDGTCNTKKEASHAATITGHEDVPANSEAALLKAVANQPISVAIDAGGSDFQ  264

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+G      CG+   H +T +G+G
Sbjct  265  FYS--SGVFTGT-----CGTSLDHGVTAVGFG  289



>ref|XP_003609015.1| Cysteine proteinase [Medicago truncatula]
 gb|AES91212.1| papain family cysteine protease [Medicago truncatula]
Length=345

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 102/152 (67%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA EGIT++ TG+L+ LSEQ+L+DC+ K  + GC GG M  AF+FI+ N GL  
Sbjct  152  WAFSAVAATEGITKLSTGKLVSLSEQELVDCDTKGVDQGCEGGLMDDAFKFIIQNHGLST  211

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            ++ YPYQ V  +CNA  +   AATITGY++V A+ E AL  AV  QP+SV +   G  FQ
Sbjct  212  EAAYPYQGVDGTCNANKASIHAATITGYEDVPANNEQALQKAVANQPISVAIDASGSDFQ  271

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y   SG+FSG+     CG+   H +T +GYG
Sbjct  272  FY--KSGVFSGS-----CGTELDHGVTAVGYG  296



>ref|XP_010475355.1| PREDICTED: ervatamin-B-like [Camelina sativa]
Length=312

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 101/151 (67%), Gaps = 9/151 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNY--GCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA+EGI +I+TG L+ LSEQQL+DC++  Y  GC GG M  AF++I  NGGLV 
Sbjct  121  WAFSAVAAIEGINKIKTGNLVSLSEQQLIDCDVDTYNKGCSGGLMETAFEYIKTNGGLVT  180

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVASGESALLAAVTYQPVSVILTHDGGMFQY  355
            ++DYPY  ++ +C+ + + N   TI G+++VA  E++L  A   QPVSV +   G +FQ 
Sbjct  181  ETDYPYTGIEGTCDQEKTKNKVVTIQGFKKVAQNEASLQIAAAQQPVSVGIDAGGFIFQL  240

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            Y+  SG+F+       CG+   H +T++GYG
Sbjct  241  YS--SGVFTSY-----CGTNLNHGVTVVGYG  264



>ref|XP_009110997.1| PREDICTED: ervatamin-B-like [Brassica rapa]
Length=343

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 102/151 (68%), Gaps = 9/151 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAF+ VAA+EGI +I+TG L+ LSEQQL+DC++   N GC GG +T A+++++ NGGLV 
Sbjct  152  WAFAVVAAIEGINKIKTGNLVSLSEQQLIDCDVSAFNKGCSGGLLTTAYEYLIPNGGLVT  211

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVASGESALLAAVTYQPVSVILTHDGGMFQY  355
            ++DYPY A+Q +C+ + S N   TI GY +V   E +L AA   QPVSV +   G +FQ 
Sbjct  212  EADYPYTAIQGTCDQEKSQNKVVTIQGYTKVEQNEESLQAATAQQPVSVGIDAGGFIFQL  271

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            Y+  SG+F+G      CG+   H +T++GYG
Sbjct  272  YS--SGVFTGF-----CGNHLNHGVTVVGYG  295



>gb|KDO55227.1| hypothetical protein CISIN_1g019112mg [Citrus sinensis]
Length=346

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 99/151 (66%), Gaps = 8/151 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAA+EGITQI  G+L+ LSEQQL+DC+  N GC GG M  AF++I++N GL  ++
Sbjct  156  WAFSAVAAVEGITQITGGKLIELSEQQLVDCSTDNNGCSGGLMDKAFEYIIENKGLATEA  215

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEVASG-ESALLAAVTYQPVSVILTHDGGMFQYY  358
            DYPYQ  Q +C+ Q    +AATI  Y+++  G E ALL AVT QPVSV +   G  F++Y
Sbjct  216  DYPYQQEQGTCDKQKEKAAAATIGKYEDLPKGDEHALLQAVTKQPVSVCVEASGQAFRFY  275

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
                G+ +      +CG    H + ++G+GT
Sbjct  276  --KRGVLN-----AECGDNCDHGVAVVGFGT  299



>ref|XP_009601308.1| PREDICTED: ervatamin-B-like isoform X3 [Nicotiana tomentosiformis]
Length=323

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 102/151 (68%), Gaps = 9/151 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFSAVAA EGI +I+ G+L+ LSEQ+L+DC+   + GC+GG M +AF++I+ N GL  +
Sbjct  131  WAFSAVAATEGINKIKNGKLISLSEQELVDCDTSWDMGCQGGLMDYAFKYIIKNHGLTTE  190

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQY  355
            S+YPY+ +  +C        AA ITGY++V A+ ESAL  AV +QPVSV +   G  FQ+
Sbjct  191  SNYPYEGIDGTCKTGKKSKHAAKITGYKDVPANSESALQKAVAHQPVSVAIDASGPDFQF  250

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            Y+  SG+F+     G+CG+   H +T IGYG
Sbjct  251  YS--SGVFT-----GECGTELDHGVTAIGYG  274



>ref|XP_006446541.1| hypothetical protein CICLE_v10015814mg [Citrus clementina]
 gb|ESR59781.1| hypothetical protein CICLE_v10015814mg [Citrus clementina]
Length=346

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 100/151 (66%), Gaps = 8/151 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAA+EGITQI  G+L+ LSEQQL+DC+  N GC GG M  AF++I++N GL  ++
Sbjct  156  WAFSAVAAVEGITQITGGKLIELSEQQLVDCSTDNNGCSGGLMDKAFEYIIENKGLATEA  215

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEVASG-ESALLAAVTYQPVSVILTHDGGMFQYY  358
            DYPYQ  Q +C+ Q    +AATI  Y+++  G E ALL AVT QPVSV +   G  F++Y
Sbjct  216  DYPYQQEQGTCDEQKEKAAAATIGKYEDLPKGDEHALLQAVTKQPVSVCVEASGQAFRFY  275

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
                G+ +      +CG+   H + ++G+GT
Sbjct  276  --ERGVLN-----AECGNNCDHGVAVVGFGT  299



>gb|EYU43350.1| hypothetical protein MIMGU_mgv1a021555mg [Erythranthe guttata]
Length=325

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 101/151 (67%), Gaps = 9/151 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL-KNYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFSAVAA EGI Q+ TG L+ LSEQ+L+DC+  ++ GC GG M  AF+FI+ N GL  +
Sbjct  133  WAFSAVAATEGINQLTTGNLISLSEQELVDCDTSEDQGCNGGLMDNAFEFIISNNGLTTE  192

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQY  355
            S+YPY+ V  +CN++   +  A ITGY++V A+ ESALL AV  QP+SV +   G  FQ+
Sbjct  193  SNYPYEGVDGTCNSKKESSHVAKITGYEDVPANSESALLKAVAKQPISVAIDASGSDFQF  252

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            Y+   G+F+G      CG+   H +T +GYG
Sbjct  253  YS--GGVFTGQ-----CGTELDHGVTAVGYG  276



>ref|XP_010431170.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Camelina 
sativa]
Length=314

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 99/150 (66%), Gaps = 9/150 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAA+EGI +I  G L+ LSEQQLLDC+ +NYGC GG M  AF +I++N G+  + 
Sbjct  155  WAFSAVAAVEGIMKIAKGNLVSLSEQQLLDCSTENYGCNGGLMDKAFNYIINNQGITTED  214

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGMFQYY  358
             YPYQ  QQ+C++ +S  +AATI+ Y+ V  + E ALL AV+ QPVSV +   G  F+ Y
Sbjct  215  SYPYQESQQTCDSTHS--AAATISDYKTVTQNDEEALLKAVSQQPVSVAIDGSGAAFKQY  272

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
                 IF G     DCG+   H +TI+GYG
Sbjct  273  EGR--IFDGE----DCGTNLSHGITIVGYG  296



>ref|XP_007226492.1| hypothetical protein PRUPE_ppa026538mg [Prunus persica]
 gb|EMJ27691.1| hypothetical protein PRUPE_ppa026538mg [Prunus persica]
Length=342

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 103/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGIT++ TG L+ LSEQ+L+DC+ K  + GC GG M  AFQFI  N GL  
Sbjct  149  WAFSAVAAMEGITKLTTGNLISLSEQELVDCDTKGVDQGCEGGLMDDAFQFISQNHGLRT  208

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY  V  +CN +   + AA ITG+++V A+ E+ALL AV  QP+SV +   G  FQ
Sbjct  209  ETNYPYTGVDGTCNTKKEASHAAKITGHEDVPANSEAALLKAVANQPISVAIDAGGSDFQ  268

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+G+     CG+   H +T +GYG
Sbjct  269  FYS--SGVFTGS-----CGTSLDHGVTAVGYG  293



>ref|XP_009601307.1| PREDICTED: ervatamin-B-like isoform X2 [Nicotiana tomentosiformis]
Length=331

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 102/151 (68%), Gaps = 9/151 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFSAVAA EGI +I+ G+L+ LSEQ+L+DC+   + GC+GG M +AF++I+ N GL  +
Sbjct  139  WAFSAVAATEGINKIKNGKLISLSEQELVDCDTSWDMGCQGGLMDYAFKYIIKNHGLTTE  198

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQY  355
            S+YPY+ +  +C        AA ITGY++V A+ ESAL  AV +QPVSV +   G  FQ+
Sbjct  199  SNYPYEGIDGTCKTGKKSKHAAKITGYKDVPANSESALQKAVAHQPVSVAIDASGPDFQF  258

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            Y+  SG+F+     G+CG+   H +T IGYG
Sbjct  259  YS--SGVFT-----GECGTELDHGVTAIGYG  282



>ref|XP_006470292.1| PREDICTED: xylem cysteine proteinase 1-like isoform X2 [Citrus 
sinensis]
Length=346

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 99/151 (66%), Gaps = 8/151 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAA+EGITQI  G+L+ LSEQQL+DC+  N GC GG M  AF++I++N GL  ++
Sbjct  156  WAFSAVAAVEGITQITGGKLIELSEQQLVDCSTDNNGCSGGLMDKAFEYIIENKGLATEA  215

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEVASG-ESALLAAVTYQPVSVILTHDGGMFQYY  358
            DYPYQ  Q +C+ Q    +AATI  Y+++  G E ALL AVT QPVSV +   G  F++Y
Sbjct  216  DYPYQQEQGTCDKQKEKAAAATIGKYEDLPKGDEHALLQAVTKQPVSVCVEASGQAFRFY  275

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
                G+ +      +CG    H + ++G+GT
Sbjct  276  --KRGVLN-----AECGDNCDHGVAVVGFGT  299



>ref|XP_007211535.1| hypothetical protein PRUPE_ppa008267mg [Prunus persica]
 gb|EMJ12734.1| hypothetical protein PRUPE_ppa008267mg [Prunus persica]
Length=339

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 99/151 (66%), Gaps = 10/151 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFS VAA+EGI QI+TG L+ LSEQQLLDC   NYGC GG +   F++I  + G+  + 
Sbjct  150  WAFSVVAAVEGINQIKTGNLISLSEQQLLDCTSGNYGCGGGSLPTTFEYIQQSEGIAREE  209

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPY+A Q +CNA      A  ITGY++V A+ E  LL AV+ QPVS+ +   G  F++Y
Sbjct  210  NYPYEAEQGTCNA---NQPAVQITGYEQVPANSEEDLLKAVSMQPVSIAIDASGEEFKHY  266

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
               SG+FS      DCG+   HA+T++GYGT
Sbjct  267  --RSGVFSNT----DCGTTLDHAVTVVGYGT  291



>ref|XP_004252606.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=341

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 100/151 (66%), Gaps = 9/151 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFSAVAA EGI +I+TG+L+ LSEQ+L+DC+   + GC GG M  AF+FI+ N GL  +
Sbjct  149  WAFSAVAATEGINKIKTGKLISLSEQELVDCDTSSDMGCEGGLMDDAFKFIIKNHGLTTE  208

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQY  355
            S+YPY+    +C      N AA IT Y++V A+ ES+LL AV  QPVSV +   G  FQ+
Sbjct  209  SNYPYEGTDSTCKTGKESNHAAKITSYEDVPANSESSLLKAVANQPVSVAIDASGSDFQF  268

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            Y+  SG+F+     G+CG+   H +T +GYG
Sbjct  269  YS--SGVFT-----GECGTELDHGVTAVGYG  292



>gb|AAB23155.1| COT44=cysteine proteinase homolog [Brassica napus, seedling, 
rapid cycling base population CrGC5, Peptide, 328 aa]
Length=328

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 97/152 (64%), Gaps = 9/152 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFS  AA+EGI +I TG+L+ LSEQ+L+DC+   N GC GG M +AFQFIM NGGL  +
Sbjct  125  WAFSTAAAVEGINKIVTGELVSLSEQELVDCDKSYNQGCNGGLMDYAFQFIMKNGGLNTE  184

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEVASG-ESALLAAVTYQPVSVILTHDGGMFQY  355
             DYPY      CN+    +   TI GY++V S  E+AL  AV+YQPVSV +   G  FQ+
Sbjct  185  KDYPYHGTNGKCNSLLKNSRVVTIDGYEDVPSKDETALKRAVSYQPVSVAIDAGGRAFQH  244

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            Y   SGIF+G      CG+   HA+  +GYG+
Sbjct  245  YQ--SGIFTGK-----CGTNMDHAVVAVGYGS  269



>sp|P25251.1|CYSP4_BRANA RecName: Full=Cysteine proteinase COT44; Flags: Precursor, partial 
[Brassica napus]
Length=328

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 97/152 (64%), Gaps = 9/152 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFS  AA+EGI +I TG+L+ LSEQ+L+DC+   N GC GG M +AFQFIM NGGL  +
Sbjct  125  WAFSTAAAVEGINKIVTGELVSLSEQELVDCDKSYNQGCNGGLMDYAFQFIMKNGGLNTE  184

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEVASG-ESALLAAVTYQPVSVILTHDGGMFQY  355
             DYPY      CN+    +   TI GY++V S  E+AL  AV+YQPVSV +   G  FQ+
Sbjct  185  KDYPYHGTNGKCNSLLKNSRVVTIDGYEDVPSKDETALKRAVSYQPVSVAIDAGGRAFQH  244

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            Y   SGIF+G      CG+   HA+  +GYG+
Sbjct  245  YQ--SGIFTGK-----CGTNMDHAVVAVGYGS  269



>ref|XP_011021998.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=339

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 102/152 (67%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGI Q+ TG+L+ LSEQ+++DC+ K  + GC GG M  AF+FI  N GL  
Sbjct  147  WAFSAVAAMEGINQLTTGKLISLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIEQNKGLTT  206

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY     +CN Q   N AA ITG+++V A+ E+AL+ AV  QPVSV +   G  FQ
Sbjct  207  EANYPYTGTDGTCNTQKEANHAAKITGFEDVPANSEAALIKAVAKQPVSVAIDAGGFEFQ  266

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SGIF+G+     CG+   H +T +GYG
Sbjct  267  FYS--SGIFTGS-----CGTQLDHGVTAVGYG  291



>ref|XP_007227669.1| hypothetical protein PRUPE_ppa025602mg [Prunus persica]
 gb|EMJ28868.1| hypothetical protein PRUPE_ppa025602mg [Prunus persica]
Length=342

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 103/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGIT++ TG L+ LSEQ+L+DC+ K  + GC GG M  AFQFI  N GL  
Sbjct  149  WAFSAVAAMEGITKLTTGNLISLSEQELVDCDTKGVDQGCEGGLMDDAFQFINQNHGLST  208

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY  V  +CN +   + AA ITG+++V A+ E+ALL AV  QP+SV +   G  FQ
Sbjct  209  ETNYPYTGVDGTCNTKKEASHAAKITGHEDVPANSEAALLKAVANQPISVAIDAGGSDFQ  268

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+G+     CG+   H +T +GYG
Sbjct  269  FYS--SGVFTGS-----CGTSLDHGVTAVGYG  293



>ref|XP_010906195.1| PREDICTED: senescence-specific cysteine protease SAG39-like isoform 
X2 [Elaeis guineensis]
Length=246

 Score =   139 bits (350),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 106/152 (70%), Gaps = 9/152 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAF+ VAAMEGIT+++T +L+ LSEQ+L++C++  ++ GC GG    A +FI+ NGGL  
Sbjct  52   WAFAVVAAMEGITKLKTHKLISLSEQELVECDVGGEDEGCNGGLPDAALEFIIKNGGLAT  111

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY+ +  +CN + S + AA+I GY++V A+ E+ALL AV  QPVSV +   G  FQ
Sbjct  112  ETNYPYKGMDGTCNTKKSASHAASIKGYEQVPANSEAALLKAVANQPVSVNIDSGGSSFQ  171

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +YA  SG+F+G    G C +   H++T +GYG
Sbjct  172  FYA--SGVFTG----GSCETDLDHSVTAVGYG  197



>ref|XP_010052198.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76120.1| hypothetical protein EUGRSUZ_D00497 [Eucalyptus grandis]
Length=345

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 102/150 (68%), Gaps = 8/150 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAAMEGIT IR G+L+ LS Q+L+DC+  + GC GG +   F+FI+ NGGL  ++
Sbjct  152  WAFSAVAAMEGITMIRKGKLVPLSVQELVDCDDNDEGCGGGLVDCVFKFIVSNGGLTTEA  211

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YP Q  + +CN   +   AA+ITGYQ+V A+ E ALL AV  QPVSV +   G  FQ+Y
Sbjct  212  NYPCQGNKGTCNTAKAATPAASITGYQDVPANNEKALLQAVANQPVSVAIEGGGFDFQFY  271

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +  SG+F+G+     CG+   HA+T +GYG
Sbjct  272  S--SGVFTGS-----CGTDIDHAVTAVGYG  294



>ref|XP_006470291.1| PREDICTED: xylem cysteine proteinase 1-like isoform X1 [Citrus 
sinensis]
Length=346

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 99/151 (66%), Gaps = 8/151 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAA+EGITQI  G+L+ LSEQQL+DC+  N GC GG M  AF++I++N GL  ++
Sbjct  156  WAFSAVAAVEGITQITGGKLIELSEQQLVDCSTDNNGCSGGLMDKAFEYIIENKGLATEA  215

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEVASG-ESALLAAVTYQPVSVILTHDGGMFQYY  358
            DYPYQ  Q +C+ Q    +AATI  Y+++  G E ALL AVT QPVSV +   G  F++Y
Sbjct  216  DYPYQQEQGTCDKQKEKAAAATIGKYEDLPKGDEHALLQAVTKQPVSVCVEASGQAFRFY  275

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
                G+ +      +CG    H + ++G+GT
Sbjct  276  --KRGVLN-----AECGDNCDHGVAVVGFGT  299



>ref|XP_006467666.1| PREDICTED: vignain-like [Citrus sinensis]
 gb|KDO77831.1| hypothetical protein CISIN_1g042468mg [Citrus sinensis]
Length=346

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 101/153 (66%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGI  I T +L  LSEQ+L+DC+   ++ GC GG M  AF+FI+ N GL  
Sbjct  153  WAFSAVAAMEGINHITTRKLTSLSEQELVDCDTSGEDQGCEGGLMDDAFEFIISNKGLAT  212

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVAS-GESALLAAVTYQPVSVILTHDGGMFQ  352
            ++ YPY+A   SCN + +  SAA I+GY++V S  E+AL+ AV  QPVSV +   G  FQ
Sbjct  213  EAKYPYKASDGSCNKKEANPSAAKISGYEDVPSNNEAALMKAVANQPVSVAIDASGSDFQ  272

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+  SG+F+G      CG+   H +T +GYGT
Sbjct  273  FYS--SGVFTGQ-----CGTELDHGVTAVGYGT  298



>gb|EYU25672.1| hypothetical protein MIMGU_mgv1a018700mg [Erythranthe guttata]
Length=343

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 101/151 (67%), Gaps = 9/151 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL-KNYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFSAVAA EGI Q+ TG L+ LSEQ+L+DC+  ++ GC GG M  AF+FI+ N GL  +
Sbjct  151  WAFSAVAATEGINQLTTGNLVSLSEQELVDCDTSEDQGCNGGLMDNAFEFIISNNGLTTE  210

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEVASG-ESALLAAVTYQPVSVILTHDGGMFQY  355
            S+YPY+ V  +CN++   + AA ITGY++V S  ESALL AV  QP+SV +   G  FQ+
Sbjct  211  SNYPYEGVDGTCNSKKESSHAARITGYEDVPSNSESALLKAVANQPISVAIDASGSDFQF  270

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            Y+   G+F+G      CG+   H +T +GYG
Sbjct  271  YS--GGVFTGQ-----CGTELDHGVTAVGYG  294



>ref|XP_011022002.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=365

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 102/152 (67%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGI Q+ TG+L+ LSEQ+++DC+ K  + GC GG M  AF+FI  N GL  
Sbjct  173  WAFSAVAAMEGINQLTTGKLISLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIEQNKGLTT  232

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY     +CN Q   N AA ITG+++V A+ E+AL+ AV  QPVSV +   G  FQ
Sbjct  233  EANYPYTGTDGTCNTQKEANHAAKITGFEDVPANSEAALIKAVAKQPVSVAIDAGGFEFQ  292

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SGIF+G+     CG+   H +T +GYG
Sbjct  293  FYS--SGIFTGS-----CGTELDHGVTAVGYG  317



>ref|XP_004487576.1| PREDICTED: vignain-like [Cicer arietinum]
Length=338

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 101/151 (67%), Gaps = 9/151 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKN-YGCRGGWMTWAFQFIMDNGGLVMD  178
            WAF+AVAA EGI +I+TG+L+ LSEQ+L+DC   N YGC GG+   A++FI  NGG+  +
Sbjct  146  WAFTAVAATEGIHKIKTGKLVSLSEQELIDCVKGNSYGCNGGYTEDAYEFIAKNGGITSE  205

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGMFQY  355
            S YPY+ V++ CN +    S A I GY++V  + E+A+L AV  QP+ V +      FQ+
Sbjct  206  SKYPYKGVEKKCNMKKGAYSVAKIKGYEKVPKNNENAILKAVANQPIIVYIEATQRAFQF  265

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            Y+  SGIF+G      CG+ F HA+TIIGYG
Sbjct  266  YS--SGIFTGK-----CGTDFDHAVTIIGYG  289



>ref|XP_008340386.1| PREDICTED: cysteine proteinase COT44-like [Malus domestica]
Length=366

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 99/152 (65%), Gaps = 9/152 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFS VAA+EGI QI TG+L+ LSEQ+L+DC+   N GC GG M +AF+FI+ NGG+  +
Sbjct  152  WAFSTVAAVEGINQIVTGELVSLSEQELVDCDTSYNAGCNGGLMDYAFEFIILNGGIDTE  211

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEVAS-GESALLAAVTYQPVSVILTHDGGMFQY  355
            SDYPY+A  Q CN     N+  +I GY++V S  E+AL  AV +QPVSV +   G   Q 
Sbjct  212  SDYPYKAYDQKCNVALEKNTVVSIDGYEDVPSYDENALKKAVAHQPVSVAIEAGGLALQL  271

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            Y   SG+F+     G+CGS   H +  +GYGT
Sbjct  272  Y--QSGVFT-----GECGSALDHGVVAVGYGT  296



>gb|KDP23984.1| hypothetical protein JCGZ_25372 [Jatropha curcas]
Length=340

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 103/153 (67%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA+EGITQ+ T +L+ LSEQ+L+DC+ K  + GC+GG M  AF+FI  N GL  
Sbjct  148  WAFSAVAAVEGITQLTTQKLISLSEQELVDCDTKGEDQGCQGGLMDDAFKFIETNQGLTT  207

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY+    +CN+    N AA ITGY++V A+ E+ALL AV  QPVSV +   G  FQ
Sbjct  208  EANYPYEGSDGTCNSNKEANHAAKITGYEDVPANNEAALLKAVAKQPVSVAIDAGGYEFQ  267

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+  SGIF+     GDCG+   H +  +GYG 
Sbjct  268  FYS--SGIFT-----GDCGTELDHGVAAVGYGV  293



>ref|NP_568651.1| cysteine protease SAG12 [Arabidopsis thaliana]
 sp|Q9FJ47.1|SAG12_ARATH RecName: Full=Senescence-specific cysteine protease SAG12; AltName: 
Full=Cysteine proteinase SAG12; AltName: Full=Protein 
SENESCENCE-ASSOCIATED GENE 12; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK43946.1|AF370131_1 putative senescence-specific cysteine protease SAG12 [Arabidopsis 
thaliana]
 dbj|BAB09317.1| senescence-specific cysteine protease [Arabidopsis thaliana]
 gb|AAK64131.1| putative senescence-specific cysteine protease SAG12 [Arabidopsis 
thaliana]
 gb|AED95312.1| cysteine protease [Arabidopsis thaliana]
Length=346

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 102/150 (68%), Gaps = 8/150 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAA+EG TQI+ G+L+ LSEQQL+DC+  ++GC GG M  AF+ I   GGL  +S
Sbjct  155  WAFSAVAAIEGATQIKKGKLISLSEQQLVDCDTNDFGCEGGLMDTAFEHIKATGGLTTES  214

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPY+    +CN++ +   A +ITGY++V  + E AL+ AV +QPVSV +   G  FQ+Y
Sbjct  215  NYPYKGEDATCNSKKTNPKATSITGYEDVPVNDEQALMKAVAHQPVSVGIEGGGFDFQFY  274

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +  SG+F+     G+C +   HA+T IGYG
Sbjct  275  S--SGVFT-----GECTTYLDHAVTAIGYG  297



>ref|XP_006285150.1| hypothetical protein CARUB_v10006494mg [Capsella rubella]
 gb|EOA18048.1| hypothetical protein CARUB_v10006494mg [Capsella rubella]
Length=351

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 100/152 (66%), Gaps = 9/152 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFS VAA+E I +I TG+L+ LSEQ+L+DC++ N+GC GG M  AFQF+++N GL   S
Sbjct  156  WAFSTVAAVESINKIVTGELISLSEQELVDCSIDNHGCNGGLMDSAFQFLINNNGLEYQS  215

Query  182  DYPYQAVQQSCNA-QNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQY  355
            DYPYQAVQ  CN  QN+      I GY++V A+ E++L  AV +QPVSV +      F  
Sbjct  216  DYPYQAVQGYCNHNQNTSKKVIKIDGYEDVPANNENSLQKAVAHQPVSVAIDKKSQGFML  275

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            Y   SGI++     G CG+   HA+ I+GYGT
Sbjct  276  Y--KSGIYT-----GPCGTDLDHAVVIVGYGT  300



>ref|XP_008348586.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=344

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 103/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA EGITQ+ TG L+ LSEQ+L+DC+   ++ GC GG M  AFQFI  N G+  
Sbjct  151  WAFSAVAATEGITQLTTGTLISLSEQELVDCDTASEDQGCEGGLMDDAFQFIQQNHGIGT  210

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY+ V  +CN++   + AA ITG+++V A+ E  LLAAV +QPVSV +   G  FQ
Sbjct  211  EANYPYEGVDGTCNSKKEASHAAKITGFEDVPANSEKDLLAAVAHQPVSVAIDASGSDFQ  270

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+G      CG+   H +T +GYG
Sbjct  271  FYS--SGVFTGT-----CGTSLDHGVTAVGYG  295



>ref|XP_008223852.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=342

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 102/152 (67%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGIT++ TG L+ LSEQ+L+DC+ K  + GC GG M  AFQFI  N GL  
Sbjct  149  WAFSAVAAMEGITKLSTGNLISLSEQELVDCDTKGVDQGCEGGLMDDAFQFINQNHGLST  208

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY  V  +CN +   + AA ITG+++V A+ E+ALL AV  QPVSV +   G  FQ
Sbjct  209  ETNYPYTGVDGTCNTKKEASHAAKITGHEDVPANSEAALLKAVANQPVSVAIDAGGSDFQ  268

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+G      CG+   H +T +GYG
Sbjct  269  FYS--SGVFTGA-----CGTSLDHGVTAVGYG  293



>ref|XP_008803660.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
 ref|XP_008812192.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=338

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 102/151 (68%), Gaps = 8/151 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAV A EGI QI TG+L  LSEQQL+DC+  N GC GG M  AF++I+ N G+  ++
Sbjct  147  WAFSAVVATEGIAQISTGKLTSLSEQQLVDCDKVNGGCGGGIMDDAFKYIISNKGITTEA  206

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPY A + +C+   S + AATI+GY++V  + ES+LL AV  QPVSV +   G  FQ+Y
Sbjct  207  NYPYVAKEGTCDTNKSSSVAATISGYEDVPRNSESSLLQAVAKQPVSVAIEGSGKDFQFY  266

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            + +  +F GN     CG+   HA+T++GYGT
Sbjct  267  SGD--VFMGN-----CGTDLDHAVTVVGYGT  290



>ref|XP_009407029.1| PREDICTED: ervatamin-B-like [Musa acuminata subsp. malaccensis]
Length=339

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 104/153 (68%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA EGI +++TG+L+ LS Q+L+DC++  ++ GC GG +  AF+FI+ NGGL  
Sbjct  145  WAFSAVAAAEGIIKLKTGKLIPLSVQELIDCSVYGEDRGCNGGAVEDAFEFIISNGGLTT  204

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVAS-GESALLAAVTYQPVSVILTHDGGMFQ  352
            D++YPY A   +C+A  S +  ATI+GY+ V   GE +LL AV  QPVSV +   G  FQ
Sbjct  205  DANYPYTASDGTCDAVKSSSKEATISGYESVPGIGEPSLLKAVARQPVSVAIDAGGPEFQ  264

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+  SG+F+G      CG+   H +T++GYGT
Sbjct  265  FYS--SGVFTGK-----CGTNLDHGVTVVGYGT  290



>emb|CDY10188.1| BnaC05g04310D [Brassica napus]
Length=343

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 103/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNY--GCRGGWMTWAFQFIMDNGGLVM  175
            WAF+ VAA+EGIT+I+TG L+ LSEQQL+DC+  +Y  GC GG M  A+++++ NGGL  
Sbjct  151  WAFATVAAIEGITKIKTGNLIPLSEQQLIDCDTGSYNKGCSGGLMETAYEYLIANGGLAA  210

Query  176  DSDYPYQAVQQS-CNAQNSGNSAATITGYQEVASGESALLAAVTYQPVSVILTHDGGMFQ  352
              DYPY A   + C+ + S N   TITGY++VA  E++L  A   QPVSV +  DG +FQ
Sbjct  211  LDDYPYTATDGTGCDQEKSQNKVVTITGYEKVAPNEASLEVAAAQQPVSVGIDADGFIFQ  270

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+G      CGS   HA+T++GYG
Sbjct  271  FYS--SGVFTGY-----CGSSLNHAVTVVGYG  295



>ref|XP_009359957.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=342

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 102/152 (67%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGIT++ TG+L+ LSEQ+L+DC+    + GC+GG M  AFQFI  N GL  
Sbjct  149  WAFSAVAAMEGITKLTTGKLISLSEQELVDCDTSGVDQGCQGGLMDDAFQFINQNHGLST  208

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY  V  +CN +   N AA ITG+++V A+ E AL+ AV  QP+SV +   G  FQ
Sbjct  209  EANYPYTGVDGTCNTKKEANHAAKITGHEDVPANREDALMKAVANQPISVAIDASGSDFQ  268

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+G      CG+   H +T +GYG
Sbjct  269  FYS--SGVFTGT-----CGTSLDHGVTAVGYG  293



>ref|XP_004957245.1| PREDICTED: vignain-like [Setaria italica]
Length=358

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 97/150 (65%), Gaps = 8/150 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAAMEGI QI+ G+L+ LSEQ+L+DC+ +  GC GG+M+WAF+F+M N GL  + 
Sbjct  155  WAFSAVAAMEGINQIKNGKLVSLSEQELVDCDTEAVGCAGGYMSWAFEFVMKNRGLTTER  214

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPYQ +  +C       SA +I+GYQ V AS E  LL AV  QPVSV +  D G F + 
Sbjct  215  NYPYQGMNGNCQTPKLNQSAVSISGYQNVTASSEPDLLRAVAAQPVSVAV--DAGSFVWQ  272

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
                G+F+     G C +   H +T++GYG
Sbjct  273  LYGGGVFT-----GPCTAELNHGVTVVGYG  297



>ref|XP_011078435.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=340

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 100/152 (66%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSA+AA EGI QI TG+L+ LSEQ+++DC+   ++ GC GG+M  AF+FI+DN G+  
Sbjct  147  WAFSAIAATEGINQISTGKLISLSEQEIVDCDKTSQDQGCEGGYMEDAFEFIIDNKGIAS  206

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGMFQ  352
            +S YPY A   +CN +     AA IT Y++V  + E ALL AV  QPVSV +   G  FQ
Sbjct  207  ESTYPYSATDGTCNKKEESPIAAKITSYEKVPENNEKALLKAVAKQPVSVSIDAGGMEFQ  266

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+     GDCG+   H +T +GYG
Sbjct  267  FYS--SGVFT-----GDCGTDLDHGVTAVGYG  291



>ref|XP_009367558.1| PREDICTED: cysteine proteinase COT44-like [Pyrus x bretschneideri]
Length=366

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 99/152 (65%), Gaps = 9/152 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFS VAA+EGI QI TG+L+ LSEQ+L+DC+   N GC GG M +AF+FI+ NGG+  +
Sbjct  152  WAFSTVAAVEGINQIVTGELVSLSEQELVDCDRTYNAGCDGGLMDYAFEFIILNGGIDTE  211

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEVAS-GESALLAAVTYQPVSVILTHDGGMFQY  355
            SDYPY+A  Q CN     N+  +I GY++V S  E+AL  AV +QPVSV +   G   Q 
Sbjct  212  SDYPYKAYDQKCNVALEKNTVVSIDGYEDVPSYDENALKKAVAHQPVSVAIEAGGMALQL  271

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            Y   SG+F+     G+CGS   H +  +GYGT
Sbjct  272  Y--QSGVFT-----GECGSALDHGVVAVGYGT  296



>ref|XP_010054324.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76138.1| hypothetical protein EUGRSUZ_D00514 [Eucalyptus grandis]
Length=339

 Score =   140 bits (354),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 101/151 (67%), Gaps = 9/151 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAA+E ITQI+TG+L+ LSEQQL+DC +KN GC  GWM  AF + + NGG+  ++
Sbjct  148  WAFSAVAAIESITQIKTGKLLELSEQQLVDC-IKNSGCSRGWMDTAFDYTIQNGGITSET  206

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQYY  358
             YPY A   +C+   +  S A I GY++V A+ E  +L AV  QPVSV +  DG   +++
Sbjct  207  KYPYIATNGTCHVPTASLSVAKIVGYEDVPANNEGEILKAVAMQPVSVSI--DGSRREFH  264

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
              +SG+F+GN     CG+   HA+ I+GYGT
Sbjct  265  LYSSGVFNGN-----CGTEVTHAVAIVGYGT  290



>gb|AEK97329.1| chromoplast senescence-associated protein 12 [Brassica rapa var. 
parachinensis]
Length=260

 Score =   139 bits (350),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 104/149 (70%), Gaps = 8/149 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAA+EG TQI+ G+L+ LSEQQL+DC+  ++GC GG +  AF+ IM  GGL  +S
Sbjct  69   WAFSAVAAIEGATQIKKGKLISLSEQQLVDCDTNDFGCSGGLIDTAFEHIMATGGLTTES  128

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPY+    +C  +++  SAA+ITGY++V  + E+AL+ AV +QPVSV +   G  FQ+Y
Sbjct  129  NYPYKGEDATCKIKSTXPSAASITGYEDVPVNDENALMKAVAHQPVSVGIEGGGFDFQFY  188

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGY  445
            +  SG+F+     G+C +   HA+T +GY
Sbjct  189  S--SGVFT-----GECTTYLDHAVTAVGY  210



>ref|XP_004308524.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 104/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAV AMEGITQ+ TG+L+ LSEQ+L+DC++   + GC GG M  AFQF++ N G+  
Sbjct  148  WAFSAVGAMEGITQLTTGKLISLSEQELVDCDVNGVDQGCSGGLMDDAFQFVIQNHGINT  207

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY A   +CNA+ +   AATITG+++V A+ ESALL AV  QP+SV +   G  FQ
Sbjct  208  EANYPYTAADGTCNAKKAAGHAATITGHEDVPANSESALLKAVANQPISVAIDASGYDFQ  267

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
             Y+  SG+F+G      CG+   H +T +GYG
Sbjct  268  LYS--SGVFTGT-----CGTELDHGVTAVGYG  292



>emb|CDY15571.1| BnaA08g28550D [Brassica napus]
Length=343

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 102/151 (68%), Gaps = 9/151 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAF+ VAA+EGI +I+TG L+ LSEQQL+DC++   N GC GG +T A+++++ NGGLV 
Sbjct  152  WAFAVVAAIEGINKIKTGNLVSLSEQQLIDCDVSAFNKGCSGGLLTTAYEYLIPNGGLVT  211

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVASGESALLAAVTYQPVSVILTHDGGMFQY  355
            ++DYPY A+Q +C+ + S N   TI GY +V   E +L AA   QPVSV +   G +FQ 
Sbjct  212  EADYPYTAIQGTCDQEKSQNKVFTIQGYTKVEQNEESLQAATAQQPVSVGIDAGGFIFQL  271

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            Y+  SG+F+G      CG+   H +T++GYG
Sbjct  272  YS--SGVFTGF-----CGNHLNHGVTVVGYG  295



>gb|EYU25680.1| hypothetical protein MIMGU_mgv1a019612mg [Erythranthe guttata]
Length=328

 Score =   140 bits (354),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 101/151 (67%), Gaps = 9/151 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL-KNYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFSAVAA EGI Q+ TG L+ LSEQ+L+DC+  ++ GC GG M  AF+FI+ N GL  +
Sbjct  136  WAFSAVAATEGINQLTTGNLVSLSEQELVDCDTSEDQGCNGGLMDNAFEFIISNNGLTTE  195

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEVASG-ESALLAAVTYQPVSVILTHDGGMFQY  355
            S+YPY+ V  +CN++   + AA ITGY++V S  ESALL AV  QP+SV +   G   Q+
Sbjct  196  SNYPYEGVDGTCNSKKESSHAARITGYEDVPSNSESALLKAVANQPISVAIDASGPDIQF  255

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            Y+  +G+F+G      CG+   H +T +GYG
Sbjct  256  YS--TGVFTGQ-----CGTELDHGVTAVGYG  279



>gb|AAC35211.1| cysteine proteinase [Hemerocallis hybrid cultivar]
Length=359

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 100/151 (66%), Gaps = 9/151 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFS V A+EGI QI+T +L+ LSEQQL+DC+ KN GC GG M +AF FI +NGGL  + 
Sbjct  154  WAFSTVVAVEGINQIKTNELVSLSEQQLVDCDTKNSGCNGGLMDYAFDFIKNNGGLSSED  213

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGMFQYY  358
             YPY A Q+SC ++ + ++  TI GYQ+V  + E+AL+ AV  QPVSV +   G  FQ+Y
Sbjct  214  SYPYLAEQKSCGSE-ANSAVVTIDGYQDVPRNNEAALMKAVANQPVSVAIEASGYAFQFY  272

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +   G+FSG+     CG+   H +  +GYG 
Sbjct  273  S--QGVFSGH-----CGTELDHGVAAVGYGV  296



>ref|XP_009128825.1| PREDICTED: ervatamin-B [Brassica rapa]
 emb|CDY50483.1| BnaA02g24130D [Brassica napus]
Length=346

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 104/149 (70%), Gaps = 8/149 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAA+EG TQI+ G+L+ LSEQQL+DC+  ++GC GG M  AF+ IM  GGL  +S
Sbjct  155  WAFSAVAAIEGATQIKKGKLISLSEQQLVDCDTNDFGCSGGLMDTAFEHIMATGGLTTES  214

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPY+    +C  +++  SAA+ITGY++V  + E+AL+ AV +QPVSV +   G  FQ+Y
Sbjct  215  NYPYKGEDATCKIKSTKPSAASITGYEDVPVNDENALMKAVAHQPVSVGIEGGGFDFQFY  274

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGY  445
            +  SG+F+     G+C +   HA+T +GY
Sbjct  275  S--SGVFT-----GECTTYLDHAVTAVGY  296



>gb|AGT97048.1| senescence-specific cysteine protease [Capsicum annuum]
Length=347

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 103/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAME + Q++TG+L  LSEQ+L+DC+++  + GC GG +  AF+FIM N GL  
Sbjct  154  WAFSAVAAMESLHQLKTGKLNPLSEQELVDCDVEGEDVGCSGGLLDTAFKFIMKNKGLTT  213

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY+     CN + S  SAA ITGY++V A+ E ALL AV  QPVSV +  DG  F 
Sbjct  214  EANYPYEGADGVCNKKKSAVSAAKITGYEDVPANNEKALLQAVANQPVSVAI--DGSSFD  271

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            + + +SG+FSG+     C +   HA+T +GYG
Sbjct  272  FQSYSSGVFSGS-----CSTWLNHAVTAVGYG  298



>emb|CDX69285.1| BnaC01g01680D [Brassica napus]
Length=374

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 97/152 (64%), Gaps = 9/152 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFS  AA+EGI +I TG+L+ LSEQ+L+DC+   N GC GG M +AFQFIM NGGL  +
Sbjct  171  WAFSTAAAVEGINKIVTGELVSLSEQELVDCDKSYNQGCNGGLMDYAFQFIMKNGGLNTE  230

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEVASG-ESALLAAVTYQPVSVILTHDGGMFQY  355
             DYPY      CN+    +   TI GY++V S  E+AL  AV+YQPVSV +   G  FQ+
Sbjct  231  KDYPYHGTNGKCNSLLKNSRVVTIDGYEDVPSKDETALKRAVSYQPVSVAIDAGGRAFQH  290

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            Y   SGIF+G      CG+   HA+  +GYG+
Sbjct  291  Y--QSGIFTGK-----CGTNMDHAVVAVGYGS  315



>ref|XP_009397226.1| PREDICTED: zingipain-2-like [Musa acuminata subsp. malaccensis]
Length=365

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 108/154 (70%), Gaps = 11/154 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAF+ VAA+EGIT+I TG+L+ LSEQQL+DC++  K+ GC+GG M  AF+FI++NGG+  
Sbjct  137  WAFTVVAAVEGITKIATGKLISLSEQQLVDCDVHGKDQGCQGGDMDAAFEFIVNNGGITS  196

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVASG-ESALLAAVTYQPVSVILTHDGGM-F  349
            +++YPY+ VQ+ CNA N+    ATI  +++V +  E AL  AV  QPVSV +     + F
Sbjct  197  EANYPYEEVQRLCNAHNASFVVATIESHEDVPTNDEKALRKAVANQPVSVGIDAGSSLDF  256

Query  350  QYYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            Q+Y+   G+FS     G+CG+   HA+T++GYGT
Sbjct  257  QFYS--GGVFS-----GECGTDLDHAVTVVGYGT  283



>ref|XP_009392372.1| PREDICTED: ervatamin-B-like [Musa acuminata subsp. malaccensis]
Length=261

 Score =   139 bits (349),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 99/153 (65%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA+EGIT I+TG+L+ LSEQ+L+DC++  KN+GC GG+M  AF+F+  N GL  
Sbjct  69   WAFSAVAAIEGITYIKTGKLIPLSEQELVDCDINGKNHGCSGGFMQNAFEFVRSNHGLTS  128

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +S YPY+  Q+ C      +  +TI+GY+ V A  E +LL AV  QPVSV +   G  FQ
Sbjct  129  ESKYPYKGFQEECRGNQLHDHVSTISGYKAVTARSEHSLLEAVAKQPVSVAIDAGGFGFQ  188

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            +Y+   GIF      G CGS   H +  +GYGT
Sbjct  189  FYS--HGIFD-----GPCGSSLNHGVLAVGYGT  214



>ref|XP_009601306.1| PREDICTED: ervatamin-B-like isoform X1 [Nicotiana tomentosiformis]
Length=341

 Score =   140 bits (354),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 102/151 (68%), Gaps = 9/151 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFSAVAA EGI +I+ G+L+ LSEQ+L+DC+   + GC+GG M +AF++I+ N GL  +
Sbjct  149  WAFSAVAATEGINKIKNGKLISLSEQELVDCDTSWDMGCQGGLMDYAFKYIIKNHGLTTE  208

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQY  355
            S+YPY+ +  +C        AA ITGY++V A+ ESAL  AV +QPVSV +   G  FQ+
Sbjct  209  SNYPYEGIDGTCKTGKKSKHAAKITGYKDVPANSESALQKAVAHQPVSVAIDASGPDFQF  268

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            Y+  SG+F+     G+CG+   H +T IGYG
Sbjct  269  YS--SGVFT-----GECGTELDHGVTAIGYG  292



>ref|XP_008225268.1| PREDICTED: zingipain-2-like [Prunus mume]
Length=341

 Score =   140 bits (354),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 100/152 (66%), Gaps = 12/152 (8%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA+EGI QI+TG+L+ LSEQQLLDC     N GC GG+MT +FQ+I  NGG+  
Sbjct  150  WAFSAVAAVEGINQIQTGELISLSEQQLLDCTSSYGNKGCDGGFMTSSFQYIQQNGGIAT  209

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            + +YPYQ  Q  C+A      A  ITGY++V A+ E  LL AV+ QPVS+I+   G  F 
Sbjct  210  EENYPYQGAQGICSA---NQPAVQITGYEQVPANSEEDLLKAVSRQPVSIIIDGSGAEFM  266

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
             Y   SG+FS      DCG+   HA+T++GYG
Sbjct  267  NY--QSGVFSPT----DCGTKTTHAVTVVGYG  292



>ref|XP_004304987.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=368

 Score =   141 bits (355),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 102/153 (67%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFS VA +EGIT+I++ +L+ LSEQQL+DCN    N GCRGG M  AF++I +NGG+  
Sbjct  165  WAFSTVATIEGITKIKSDKLISLSEQQLVDCNRDQINRGCRGGDMEDAFKYIEENGGITT  224

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            + +Y Y+   ++C+   +   AA ITGY+ V  + E+ LL AV  QPVSV +  +G  F+
Sbjct  225  EENYQYKGTDETCDTTKTNEYAAKITGYEMVPPNSENDLLKAVAMQPVSVGIDANGEEFR  284

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
             YA  SG+FSGN     CG+   HA+TI+GYGT
Sbjct  285  AYA--SGVFSGN-----CGTNLNHAVTIVGYGT  310



>ref|XP_006398274.1| hypothetical protein EUTSA_v10000948mg [Eutrema salsugineum]
 dbj|BAJ33714.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ39727.1| hypothetical protein EUTSA_v10000948mg [Eutrema salsugineum]
Length=347

 Score =   140 bits (354),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 102/150 (68%), Gaps = 8/150 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAA+EG T+I+ G+L+ LSEQQL+DC+  ++GC GG M  AF+ IM  GGL  +S
Sbjct  156  WAFSAVAAIEGATKIKKGKLISLSEQQLVDCDTNDFGCSGGLMDTAFEHIMATGGLTTES  215

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPY+    +C  +N+  +A +ITGY++V  + E AL+ AV +QPVS+ +   G  FQ+Y
Sbjct  216  NYPYKGKDATCKIKNTKPTATSITGYEDVPVNDEKALMKAVAHQPVSIGIEGGGFDFQFY  275

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
               SG+F+     G+C +   HA+T +GYG
Sbjct  276  G--SGVFT-----GECTTYLDHAVTAVGYG  298



>ref|XP_004306836.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score =   140 bits (354),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 103/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAV AMEGITQ+ TG+L+ LSEQ+L+DC++   + GC GG M  AFQF++ N G+  
Sbjct  148  WAFSAVGAMEGITQLTTGKLISLSEQELVDCDVNGVDQGCSGGLMDDAFQFVIQNHGINT  207

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY A   +CNA+     AATITG+++V A+ ESALL AV  QP+SV +   G  FQ
Sbjct  208  EANYPYTAADGTCNAKKEAGHAATITGHEDVPANSESALLKAVANQPISVAIDASGYDFQ  267

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
             Y+  SG+F+G      CG+   H +T +GYG
Sbjct  268  LYS--SGVFTGT-----CGTELDHGVTAVGYG  292



>emb|CDY44047.1| BnaA08g15590D [Brassica napus]
Length=384

 Score =   141 bits (356),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 99/152 (65%), Gaps = 9/152 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFS  AA+EGI +I TG+L+ LSEQ+L+DC+   N GC GG M +AFQFIM NGGL  +
Sbjct  180  WAFSTAAAVEGINKIVTGELISLSEQELVDCDRSYNQGCNGGLMDYAFQFIMKNGGLNTE  239

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEVAS-GESALLAAVTYQPVSVILTHDGGMFQY  355
             DYPY+     CN+    +   TI GY++V +  E+AL  AV+YQPVSV +   G +FQ+
Sbjct  240  QDYPYRGSNGKCNSLLKNSRVVTIDGYEDVPTEDETALKRAVSYQPVSVAIEAGGRVFQH  299

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            Y   SGIF+G      CG+   HA+  +GYG+
Sbjct  300  YQ--SGIFTGK-----CGTNLDHAVVAVGYGS  324



>ref|XP_009109364.1| PREDICTED: cysteine proteinase COT44-like [Brassica rapa]
Length=374

 Score =   141 bits (355),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 99/152 (65%), Gaps = 9/152 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFS  AA+EGI +I TG+L+ LSEQ+L+DC+   N GC GG M +AFQFIM NGGL  +
Sbjct  170  WAFSTAAAVEGINKIVTGELISLSEQELVDCDRSYNQGCNGGLMDYAFQFIMKNGGLNTE  229

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEVAS-GESALLAAVTYQPVSVILTHDGGMFQY  355
             DYPY+     CN+    +   TI GY++V +  E+AL  AV+YQPVSV +   G +FQ+
Sbjct  230  QDYPYRGSNGKCNSLLKNSRVVTIDGYEDVPTEDETALKRAVSYQPVSVAIEAGGRVFQH  289

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            Y   SGIF+G      CG+   HA+  +GYG+
Sbjct  290  YQ--SGIFTGK-----CGTNLDHAVVAVGYGS  314



>emb|CDY22445.1| BnaC03g61580D [Brassica napus]
Length=374

 Score =   141 bits (355),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 99/152 (65%), Gaps = 9/152 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFS  AA+EGI +I TG+L+ LSEQ+L+DC+   N GC GG M +AFQFIM NGGL  +
Sbjct  170  WAFSTAAAVEGINKIVTGELISLSEQELVDCDRSYNQGCNGGLMDYAFQFIMKNGGLNTE  229

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEVAS-GESALLAAVTYQPVSVILTHDGGMFQY  355
             DYPY+     CN+    +   TI GY++V +  E+AL  AV+YQPVSV +   G +FQ+
Sbjct  230  QDYPYRGSNGKCNSLLKNSKVVTIDGYEDVPTEDETALKRAVSYQPVSVAIEAGGRVFQH  289

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            Y   SGIF+G      CG+   HA+  +GYG+
Sbjct  290  YQ--SGIFTGK-----CGTNLDHAVVAVGYGS  314



>gb|KFK23231.1| hypothetical protein AALP_AAs59427U000100 [Arabis alpina]
Length=248

 Score =   138 bits (348),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 101/150 (67%), Gaps = 8/150 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFS VAA+EG+ QI+ G+L+ LSEQQL+DC+  ++GC GGWM  AF+ I+  GGL  +S
Sbjct  57   WAFSVVAAIEGVAQIKKGKLISLSEQQLVDCDTNDFGCSGGWMDSAFEHIIATGGLTTES  116

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPY     +CN++ +   A +I+GY++V  + E AL+ AV +QPVS+ +   G  FQ+Y
Sbjct  117  NYPYIGEDGTCNSKKTNPKATSISGYEDVPVNDEQALMKAVAHQPVSIAIEGGGFDFQFY  176

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +  +G+F+G      C +   HA+ ++GYG
Sbjct  177  S--TGVFTGG-----CTTSLDHAVLMVGYG  199



>ref|XP_009354269.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=333

 Score =   140 bits (353),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 101/152 (66%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA EG+TQ+ TG+L+ LSEQ+L+DC+   ++ GC GG M  AFQFI  N G+  
Sbjct  140  WAFSAVAATEGVTQLTTGKLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNHGIST  199

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY  V  +CN +     AA ITG+++V A+ E ALL AV +QPVSV +   G  FQ
Sbjct  200  ETNYPYNGVDGTCNTKKEAIIAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDFQ  259

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+G      CG+   H +T +GYG
Sbjct  260  FYS--SGVFTGT-----CGTSLDHGVTAVGYG  284



>emb|CDX87758.1| BnaC02g31910D [Brassica napus]
Length=346

 Score =   140 bits (354),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 104/149 (70%), Gaps = 8/149 (5%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGCRGGWMTWAFQFIMDNGGLVMDS  181
            WAFSAVAA+EG TQI+ G+L+ LSEQQL+DC+  ++GC GG M  AF+ IM  GGL  +S
Sbjct  155  WAFSAVAAIEGATQIKKGKLISLSEQQLVDCDTNDFGCSGGLMDTAFEHIMATGGLTTES  214

Query  182  DYPYQAVQQSCNAQNSGNSAATITGYQEVA-SGESALLAAVTYQPVSVILTHDGGMFQYY  358
            +YPY+    +C  +++  SAA+ITGY++V  + E+AL+ AV +QPVSV +   G  FQ+Y
Sbjct  215  NYPYKGEDANCKIKSTKPSAASITGYEDVPVNDENALMKAVAHQPVSVGIEGGGFDFQFY  274

Query  359  ASNSGIFSGNDGAGDCGSGFRHAMTIIGY  445
            +  SG+F+     G+C +   HA+T +GY
Sbjct  275  S--SGVFT-----GECTTYLDHAVTAVGY  296



>ref|XP_008780330.1| PREDICTED: vignain-like [Phoenix dactylifera]
Length=186

 Score =   136 bits (343),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 102/145 (70%), Gaps = 10/145 (7%)
 Frame = +2

Query  26   MEGITQIRTGQLMRLSEQQLLDCNL--KNYGCRGGWMTWAFQFIMDNGGLVMDSDYPYQA  199
            MEGIT+++TG L+ LSEQ+L+DC++  ++ GC GG M  AF+FI+  GGL  +++YPY+ 
Sbjct  1    MEGITKLKTGNLISLSEQELVDCDVAGEDQGCEGGLMDDAFKFIIRTGGLTTETNYPYKG  60

Query  200  VQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQYYASNSGI  376
            +  +CN + S + AA+I GY++V A+ E+ALL AVT QPVSV +   G  FQ+Y+  SGI
Sbjct  61   IDGTCNNKKSPSHAASIKGYEDVPANSEAALLKAVTNQPVSVAIEASGSSFQFYS--SGI  118

Query  377  FSGNDGAGDCGSGFRHAMTIIGYGT  451
            F+G+     CG+   H +T +GYGT
Sbjct  119  FTGS-----CGTDLDHGVTAVGYGT  138



>ref|XP_008223851.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=342

 Score =   140 bits (353),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 102/152 (67%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGIT++ TG L+ LSEQ+L+DC+ K  + GC GG M  AFQFI  N GL  
Sbjct  149  WAFSAVAAMEGITKLTTGNLISLSEQELVDCDTKGVDQGCEGGLMDDAFQFINQNHGLST  208

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY  V  +CN +   + AA ITG+++V A+ E+ALL AV  QP+SV +   G  FQ
Sbjct  209  ETNYPYTGVDGTCNTKKEASHAAKITGHEDVPANSEAALLKAVANQPISVAIDAGGSDFQ  268

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+G      CG+   H +T +GYG
Sbjct  269  FYS--SGVFTGA-----CGTSLDHGVTAVGYG  293



>ref|XP_009359979.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=342

 Score =   140 bits (353),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 101/152 (66%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGIT++ TG+L+ LSEQ+L+DC+    + GC GG M  AFQFI  N GL  
Sbjct  149  WAFSAVAAMEGITKLTTGKLISLSEQELVDCDTSGVDQGCGGGLMDDAFQFINKNHGLST  208

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY  V  +CN +   + AA ITGY++V A+ E ALL AV  QP+SV +   G  FQ
Sbjct  209  ETNYPYTGVDGTCNTKKEASHAAKITGYEDVPANSEEALLKAVANQPISVAIDAGGSDFQ  268

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SG+F+G      CG+   H +T +GYG
Sbjct  269  FYS--SGVFTGT-----CGTSLDHGVTAVGYG  293



>ref|XP_002307151.2| hypothetical protein POPTR_0005s09140g, partial [Populus trichocarpa]
 gb|EEE94147.2| hypothetical protein POPTR_0005s09140g, partial [Populus trichocarpa]
Length=309

 Score =   139 bits (351),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 102/152 (67%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGI Q+ TG+L+ LSEQ+++DC+ K  + GC GG M  AF+FI  N GL  
Sbjct  117  WAFSAVAAMEGINQLTTGKLISLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIEQNKGLTT  176

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY     +CN Q   + AA ITG+Q+V A+ E+AL+ AV  QPVSV +   G  FQ
Sbjct  177  EANYPYTGTDGTCNTQKEVSHAAKITGFQDVPANSEAALMKAVAKQPVSVAIDAGGFEFQ  236

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SGIF+G+     CG+   H +T +GYG
Sbjct  237  FYS--SGIFTGS-----CGTELDHGVTAVGYG  261



>ref|XP_008797119.1| PREDICTED: vignain-like [Phoenix dactylifera]
Length=271

 Score =   139 bits (349),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 100/152 (66%), Gaps = 9/152 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFS V A+EGI QI+T +L+ LSEQQL+DC+ + N GC GG M  AF+FI+ NGG+  +
Sbjct  64   WAFSTVVAVEGINQIKTRELISLSEQQLVDCDDRDNNGCNGGLMEHAFEFIVRNGGITTE  123

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQY  355
            ++YPY+A    C+A    ++  TI GY+ V A+ E+AL+ AV +QPVS  +   G  FQ+
Sbjct  124  AEYPYRAKDGRCDASKENSAVVTIDGYENVPANNEAALMKAVAHQPVSAAIEASGTAFQF  183

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            Y+   G+F+G      CG+   H + I+GYGT
Sbjct  184  YS--EGVFTGA-----CGTDLDHGVAIVGYGT  208



>ref|XP_008349211.1| PREDICTED: zingipain-2-like [Malus domestica]
Length=345

 Score =   140 bits (353),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 106/155 (68%), Gaps = 12/155 (8%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL-KNYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFSAVAA+EGITQI+TG+L+ LSEQQL+ C+   N GC+GGWM  AF +I  NGG+  +
Sbjct  150  WAFSAVAAVEGITQIKTGKLISLSEQQLVXCDTDNNRGCQGGWMVBAFAYIXQNGGIXSE  209

Query  179  SDYPYQAV---QQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGM  346
             +YPYQ++   + +C+   +  +AA IT Y EV  + E+ LL AV+ QPVSV +      
Sbjct  210  ENYPYQSLDGSEGTCDMNKAXEAAARITSYAEVPPNSETDLLKAVSMQPVSVAINMSPA-  268

Query  347  FQYYASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            FQ+Y+   G+F+G+    DCG+   HA+T+IGYGT
Sbjct  269  FQHYS--GGVFTGD----DCGTSLDHAVTVIGYGT  297



>gb|AIA26572.1| cysteine protease [Cicer arietinum]
 gb|AJA74417.1| cysteine protease [Cicer arietinum]
Length=347

 Score =   140 bits (353),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 94/152 (62%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAA+EGI +I+TG+L+ LSEQ+L+DC+ K  N GC GG M  AF +I  +GGL  
Sbjct  154  WAFSAVAAVEGINKIKTGKLVSLSEQELIDCDTKSGNEGCEGGDMEIAFSYIKKHGGLDS  213

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEVASG-ESALLAAVTYQPVSVILTHDGGMFQ  352
              DYPY+     CN   +     TI GY+ V +G E  L AAV YQPVSV     G  FQ
Sbjct  214  SKDYPYEGTDGKCNKAKAEKHVVTINGYESVPAGNEKMLKAAVCYQPVSVATDAGGYAFQ  273

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+   GIFSG+     CG    H MTI+GYG
Sbjct  274  FYS--KGIFSGS-----CGKDLNHGMTIVGYG  298



>ref|XP_004294729.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   140 bits (353),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 104/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGITQ+ TG+L+ LSEQ+L+DC++   + GC GG M  AF+F++ N G+  
Sbjct  147  WAFSAVAAMEGITQLTTGKLISLSEQELVDCDVNGVDQGCSGGEMDDAFKFVIQNHGINT  206

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY A   +CNA+     AATITG+++V A+ ESALL AV  QP++V +   G  FQ
Sbjct  207  EANYPYTAADGTCNAKKEAGHAATITGHEDVPANSESALLKAVANQPIAVAIDASGFDFQ  266

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
             Y+  SG+F+G      CG+   H +T +GYG
Sbjct  267  LYS--SGVFTGT-----CGTELDHGVTAVGYG  291



>ref|XP_011009172.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=340

 Score =   140 bits (353),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 104/152 (68%), Gaps = 10/152 (7%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGCRGGWMTWAFQFIMDNGGLVM  175
            WAFSAVAAMEGI ++ TG+L+ LSEQ+++DC+ K  + GC GG M  AF+FI  N GL  
Sbjct  148  WAFSAVAAMEGINKLTTGKLISLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIEKNKGLTT  207

Query  176  DSDYPYQAVQQSCNAQNSGNSAATITGYQEV-ASGESALLAAVTYQPVSVILTHDGGMFQ  352
            +++YPY+    +CN + + N AA ITG+++V A+ E+AL+ AV  QPVSV +   G  FQ
Sbjct  208  EANYPYKGTHGTCNTKKAANHAAKITGFEDVPANSEAALMKAVAKQPVSVAIDAGGYDFQ  267

Query  353  YYASNSGIFSGNDGAGDCGSGFRHAMTIIGYG  448
            +Y+  SGIF+G+     CG+   H +T +GYG
Sbjct  268  FYS--SGIFTGS-----CGTQLDHGVTAVGYG  292



>ref|XP_009137836.1| PREDICTED: cysteine proteinase COT44 [Brassica rapa]
Length=374

 Score =   140 bits (354),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 97/152 (64%), Gaps = 9/152 (6%)
 Frame = +2

Query  2    WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGCRGGWMTWAFQFIMDNGGLVMD  178
            WAFS  AA+EGI +I TG+L+ LSEQ+L+DC+   N GC GG M +AFQFIM NGGL  +
Sbjct  171  WAFSTAAAVEGINKIVTGELISLSEQELVDCDKSYNQGCNGGLMDYAFQFIMKNGGLNTE  230

Query  179  SDYPYQAVQQSCNAQNSGNSAATITGYQEVASG-ESALLAAVTYQPVSVILTHDGGMFQY  355
             DYPY      CN+    +   TI GY++V S  E+AL  AV+YQPVSV +   G  FQ+
Sbjct  231  QDYPYHGTNGKCNSLLKNSRVVTIDGYEDVPSKDETALKRAVSYQPVSVAIDAGGRAFQH  290

Query  356  YASNSGIFSGNDGAGDCGSGFRHAMTIIGYGT  451
            Y   SGIF+G      CG+   HA+  +GYG+
Sbjct  291  Y--QSGIFTGK-----CGTTMDHAVVAVGYGS  315



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 521547509808