BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c28275_g1_i1 len=870 path=[848:0-869]

Length=870
                                                                      Score     E

ref|XP_007041211.1|  Uncharacterized protein TCM_006157               93.6    2e-19   
gb|KCW57126.1|  hypothetical protein EUGRSUZ_I02770                   89.7    2e-18   
ref|XP_010657977.1|  PREDICTED: uncharacterized protein LOC104881045  75.1    4e-13   
gb|AFK43595.1|  unknown                                               73.6    2e-12   
ref|XP_011047899.1|  PREDICTED: uncharacterized protein LOC105142118  72.8    3e-12   
ref|XP_008218720.1|  PREDICTED: uncharacterized protein LOC103319013  71.6    8e-12   
gb|KGN56255.1|  hypothetical protein Csa_3G110030                     66.6    4e-10   
ref|XP_007224729.1|  hypothetical protein PRUPE_ppa024829mg           66.6    5e-10   
ref|XP_011096801.1|  PREDICTED: uncharacterized protein LOC105175871  65.9    2e-09   
ref|XP_006492577.1|  PREDICTED: G patch domain-containing protein...  65.5    2e-09   
ref|XP_006389515.1|  hypothetical protein POPTR_0022s00510g           64.3    3e-09   
ref|XP_010087925.1|  hypothetical protein L484_001375                 60.8    8e-08   
ref|XP_003592915.1|  hypothetical protein MTR_2g005710                59.7    1e-07   
ref|XP_006431626.1|  hypothetical protein CICLE_v10002589mg           60.1    1e-07   
gb|KDP42452.1|  hypothetical protein JCGZ_00249                       57.0    2e-06   
ref|XP_006385041.1|  hypothetical protein POPTR_0004s23330g           52.8    4e-05   
gb|EYU26466.1|  hypothetical protein MIMGU_mgv1a023299mg              51.2    8e-05   
ref|XP_006592657.1|  PREDICTED: uncharacterized protein LOC102666599  50.4    1e-04   
ref|XP_004485439.1|  PREDICTED: uncharacterized protein LOC101498644  50.4    1e-04   
ref|XP_011028357.1|  PREDICTED: uncharacterized protein LOC105128404  51.2    2e-04   
ref|XP_007148566.1|  hypothetical protein PHAVU_006G219300g           48.1    7e-04   
ref|XP_009399154.1|  PREDICTED: uncharacterized protein LOC103983628  48.5    8e-04   



>ref|XP_007041211.1| Uncharacterized protein TCM_006157 [Theobroma cacao]
 gb|EOX97042.1| Uncharacterized protein TCM_006157 [Theobroma cacao]
Length=163

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 89/149 (60%), Gaps = 20/149 (13%)
 Frame = +3

Query  183  MNRYAKIKADSNSKSKSRS----LEWSADPKSFSNTT-HHSQSPETQELNQV--KKENII  341
            MN Y+K+KA  N  S+S      +     PK  S+ T +H++  + QE+NQV  K  N I
Sbjct  1    MNGYSKMKAVGNGSSRSMDSSDLMPLPQTPKPISSITPNHTE--KNQEINQVVIKNSNPI  58

Query  342  SRNSDFDEHQEQEHQDDRSGFGVKLTRSSSVASNGASQQRFRLERAGSGRVKRAFSMRRS  521
            +   D  E ++++  ++   FG KL R+SSV+S+ A Q            VKRAFSMRRS
Sbjct  59   TTQQDSSEQEDEQEGNNEEMFGPKLRRNSSVSSSYALQ----------AAVKRAFSMRRS  108

Query  522  SSVSERYCRIHNQCATLSSPTIDDADMDS  608
            SSVSERYCRIH+Q  TL+SP  DD ++D+
Sbjct  109  SSVSERYCRIHDQSVTLASP-FDDEELDT  136



>gb|KCW57126.1| hypothetical protein EUGRSUZ_I02770 [Eucalyptus grandis]
Length=155

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 93/181 (51%), Gaps = 27/181 (15%)
 Frame = +3

Query  183  MNRYAKIKADSNSKSKSRSLEWSADPKSFSNTTHHSQSPETQELNQVKKENIISRNSDFD  362
            MN Y+K+KA   +KS  RS+++S    SF        +P  + + +   E     +S F 
Sbjct  1    MNSYSKMKAFGTNKS--RSVDFSELLPSF-------PAPTPKPIAKAGVEEARPEDSSFS  51

Query  363  EHQEQEHQDDRSGFGVKLTRSSSVASNGASQQRFRLER-AGSGRVKRAFSMRRSSSVSER  539
            E ++ ++ D    FGV L RSSSV++   +  RFR +R   +G VKR FSMRRSSSVSER
Sbjct  52   EKEKDDYSDGER-FGVILGRSSSVST---ASDRFRFDRRKNAGIVKRVFSMRRSSSVSER  107

Query  540  YCRIHNQCATLSSPTIDDADMDSNNGDHAGETSPTSAEKISGTVKTTSEKFLRVCKRFLR  719
            YCRIH Q  TLSS   D         D   E    SA+K     K T     R CKR L 
Sbjct  108  YCRIHAQSVTLSSQADD---------DEGSEEVMGSAKK----KKNTGVNIFRACKRLLG  154

Query  720  L  722
            L
Sbjct  155  L  155



>ref|XP_010657977.1| PREDICTED: uncharacterized protein LOC104881045 [Vitis vinifera]
Length=163

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 89/190 (47%), Gaps = 37/190 (19%)
 Frame = +3

Query  183  MNRYAKIKADSNSKSKSRSLEWSADPKSFSNTTHHSQSPETQELNQVKKENIISRNSDFD  362
            MN Y K+K      +KSRS+++ AD  SF  T  ++Q+P ++     K            
Sbjct  1    MNGYPKMKFLRCRSTKSRSMDF-ADLLSFPQTPKNTQNPTSKTPYANKPTT---------  50

Query  363  EHQEQEHQDDRSG-----FGVKLTRSSSVASNGASQQRFRLERAGSGRVKRAFSMRRSSS  527
             H      DD  G     FG  L R+SSV S  + Q            VKRAFSMRRSSS
Sbjct  51   AHDSVSDPDDEDGIKGGSFGGVLRRNSSVTSAASLQSA----------VKRAFSMRRSSS  100

Query  528  VSERYCRIHNQCAT--LSSP--TIDDAD-MDSNNGDHAGETSPTSAEKISGTVKTTSEKF  692
            VSERYCRIH+Q AT  L SP   IDD + MD       G T  T + +     K  + K 
Sbjct  101  VSERYCRIHDQSATAFLQSPPNNIDDEESMD-------GGTMKTRSMEKKMKKKQKNGKI  153

Query  693  LRVCKRFLRL  722
             + CKR   L
Sbjct  154  FKACKRLFGL  163



>gb|AFK43595.1| unknown [Lotus japonicus]
Length=183

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 73/205 (36%), Positives = 99/205 (48%), Gaps = 47/205 (23%)
 Frame = +3

Query  183  MNRYAKIKADSNSKSKSRSLEWSADPKSF------------SNTTHHSQSPETQELNQVK  326
            M  Y+KI   S +  KSRS+++S    SF            ++T H ++ PE +E     
Sbjct  1    MKGYSKISTTSGATHKSRSIDFSDLLSSFPQTPKARTKTKSTSTAHTAKLPEDEE-----  55

Query  327  KENIISRNSDFDEHQEQEHQD----DRSG--FGVKLTRSSSVASNGASQQRFRLERAGSG  488
            + N I  N+      E E  D    D +G  FGV L RS S++S  A+   F+       
Sbjct  56   QPNYIYANT---REGEAEGTDKTSRDENGERFGVILGRSGSISS--ATSTGFQ------A  104

Query  489  RVKRAFSMRRSSSVSERYCRIHNQCAT------LSSP-TIDDADMDSNNGDHAGETSPTS  647
             +KRAFSMRRSSSVS++YCRIH+Q          SSP T+ D   D NN   A  ++  +
Sbjct  105  TMKRAFSMRRSSSVSDKYCRIHDQFIVNVASSSSSSPVTVRDHYDDDNNNTIADRSTNNN  164

Query  648  AEKISGTVKTTSEKFLRVCKRFLRL  722
              +  G       K LR CKR LRL
Sbjct  165  KHRGGG------GKILRACKRLLRL  183



>ref|XP_011047899.1| PREDICTED: uncharacterized protein LOC105142118 [Populus euphratica]
Length=165

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 69/191 (36%), Positives = 94/191 (49%), Gaps = 37/191 (19%)
 Frame = +3

Query  183  MNRYAKIKADSNSKSKSRSLEWSADPKSFSNTTHHSQSPETQELNQV------KKENIIS  344
            MN Y+KIK    ++S  RS+++S    +F   T  +  P  QE +++       K+N+IS
Sbjct  1    MNGYSKIKIFGTARS--RSMDFSDLSLAFPEPTKSNTEP--QETHKIVCDHDNTKKNMIS  56

Query  345  RNS----DFDEHQEQEHQDDRSGFGVKLTRSSSVASNGASQQRFRLERAGSGRVKRAFSM  512
              +         +E E  +   GFGVKL  SS  +S  A Q            VK+AF+ 
Sbjct  57   TGTTTQDSLSVLEEDEETNVGEGFGVKLRSSSVSSSASALQSA----------VKKAFAA  106

Query  513  RRSSSVSERYCRIHNQCATLSSPTID-DADMDSNNGDHAGETSPTSAEKISGTVKTTSEK  689
            RRS SVSERYCRIH+Q ATLSSP  D D  +D            T     S T K +  +
Sbjct  107  RRSCSVSERYCRIHDQSATLSSPIHDEDGTLD------------TMESTRSVTKKHSRGR  154

Query  690  FLRVCKRFLRL  722
            FL+VCK+   L
Sbjct  155  FLKVCKKLFGL  165



>ref|XP_008218720.1| PREDICTED: uncharacterized protein LOC103319013 [Prunus mume]
Length=169

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 98/190 (52%), Gaps = 31/190 (16%)
 Frame = +3

Query  183  MNRYAKIKADSNSKSKSRSLEWSADPKSFS-----NTTHHSQSPETQELNQVKKENIISR  347
            M++Y+KI    +S++ SRS+++S D +SFS     NTT+ ++  +TQE N   K+N  ++
Sbjct  1    MDKYSKINIMRHSQN-SRSIDFS-DLESFSPTQKSNTTNPTK--KTQETNLQIKKNSTTQ  56

Query  348  NSDFDEHQEQEHQDDRSGFGVKLTRSSSVASNGASQQRFRLERAGSG---RVKRAFSMRR  518
            +   DE  EQ+       FG      S V   G +        A SG     K AFSMRR
Sbjct  57   DQKGDEDDEQQGNSVGESFG------SVVVLKGINSISSSSSSAASGFQSAFKGAFSMRR  110

Query  519  SSSVSERYCRIHNQCAT--LSSPTIDDADMDSNNGDHAGETSPTSAEKISGTVKTTSEKF  692
            SSSVSERYCRIH+Q  T   SSP  DD D  +  G     T+ +  +K  G       K 
Sbjct  111  SSSVSERYCRIHDQSTTTLTSSPNDDDEDQAAAWG-----TTRSMKKKHKGG------KI  159

Query  693  LRVCKRFLRL  722
            L+ CKRF  L
Sbjct  160  LKACKRFFGL  169



>gb|KGN56255.1| hypothetical protein Csa_3G110030 [Cucumis sativus]
Length=170

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 48/77 (62%), Gaps = 2/77 (3%)
 Frame = +3

Query  492  VKRAFSMRRSSSVSERYCRIHNQCATLSSPTIDDADMDSNNGDHAGETSPTSAEKISGTV  671
            VKRA SMRRSSSV+ERYCRIH+Q AT +SP I+D +M+  +    G+    S  +     
Sbjct  96   VKRALSMRRSSSVAERYCRIHDQFATFASP-IEDDEMEGGDWKERGKIG-GSEIRKKKKK  153

Query  672  KTTSEKFLRVCKRFLRL  722
            K  +EK +R CKR   L
Sbjct  154  KNAAEKIVRACKRIFGL  170



>ref|XP_007224729.1| hypothetical protein PRUPE_ppa024829mg [Prunus persica]
 gb|EMJ25928.1| hypothetical protein PRUPE_ppa024829mg [Prunus persica]
Length=168

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 91/187 (49%), Gaps = 26/187 (14%)
 Frame = +3

Query  183  MNRYAKIKADSNSKSKSRSLEWSADPKSFSNT----THHSQSPETQELNQVKKENIISRN  350
            M++Y+KI   S +   SRS+++S D  SFS T    T  + + +TQE N   K+N  +++
Sbjct  1    MDKYSKIMRHSQN---SRSIDFS-DLVSFSPTQKSNTTTNPTKKTQETNLQIKKNSTTQD  56

Query  351  SDFDEHQEQEHQDDRSGFG--VKLTRSSSVASNGASQQRFRLERAGSGRVKRAFSMRRSS  524
               DE  EQ+       FG  V L R+     N  S              K AFSMRRSS
Sbjct  57   QKGDEDDEQQGNSVGESFGSVVALKRN-----NSISSSSSLAASGFQSAFKGAFSMRRSS  111

Query  525  SVSERYCRIHNQ-CATLSSPTIDDADMDSNNGDHAGETSPTSAEKISGTVKTTSEKFLRV  701
            SVSERYCRIH+Q   TL+S  IDD +      D A     T + K     K    K L+ 
Sbjct  112  SVSERYCRIHDQSTTTLTSSPIDDDE------DQAAAWGTTRSMK----KKHKGGKILKA  161

Query  702  CKRFLRL  722
            CKRF  L
Sbjct  162  CKRFFGL  168



>ref|XP_011096801.1| PREDICTED: uncharacterized protein LOC105175871 [Sesamum indicum]
Length=207

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 89/188 (47%), Gaps = 33/188 (18%)
 Frame = +3

Query  183  MNRYAKIKADSNSKSKS---RSLEWSADPKSF-SNTTHHSQSPETQELNQVKKENIISRN  350
            MN Y++IK  S ++SKS     L +S    SF +N+   S+ PE      +K  N I  N
Sbjct  45   MNGYSRIKKASTTRSKSVDFSDLSFSHHTLSFCTNSKFKSREPEPYLGKALKIHNPIPEN  104

Query  351  SDFDEHQEQEHQDDRSGFGVKLTRSSSVASNGASQQRFRLERAGSGR----VKRAFSMRR  518
                   EQE +D     GV L R  SV+S   S Q+   E+  S      VKR+FS+RR
Sbjct  105  -------EQE-EDAGEVLGVILGRKHSVSS-ATSDQKVVAEQESSSSFQTVVKRSFSIRR  155

Query  519  SSSVSERYCRIHNQCATLSSPTIDDADMDSNNGDHAGETSPTSAEKISGTVKTTSEKFLR  698
            S+SVSE Y RIH+Q           +D+ + + D  G  S +    +         KFL+
Sbjct  156  SASVSEGYSRIHHQ-----------SDLTAKDDDQPGTVSTSQNRHVK-----KKGKFLK  199

Query  699  VCKRFLRL  722
             C+R  RL
Sbjct  200  ACRRLFRL  207



>ref|XP_006492577.1| PREDICTED: G patch domain-containing protein 8-like [Citrus sinensis]
Length=196

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 99/172 (58%), Gaps = 41/172 (24%)
 Frame = +3

Query  183  MNRYAKIKADSNSKSKSRSLEWSAD----PKSFSNTTH-HSQSPET--QEL---NQVKKE  332
            MN Y+K+K   ++KS  RS+++S+D    P S S T +   + PET  +EL   N + K 
Sbjct  1    MNGYSKMKIIGDTKS--RSIDFSSDLFPSPPSLSETRNPKPEIPETNLEELIKSNPLTKT  58

Query  333  NIISRNSD-------FDEHQEQEHQDDR-------------SGFG--VKLTRSSSVASNG  446
            N I+ NS+       F E +E+E ++D+               FG  +KL+R+S+V+++ 
Sbjct  59   NNITSNSNKTQDSFSFSEQEEEEEEEDQVCNINYNNNNNDGEKFGSHIKLSRNSTVSASS  118

Query  447  ASQQRFRLERAGSGRVKRAFSMRRSSSVSERYCRIHNQCATLSSPTIDDADM  602
            A+    +        VKRAFSMRRSSSVSERY RIH+Q  T++SP I+D D+
Sbjct  119  AASHALQYT------VKRAFSMRRSSSVSERYSRIHDQSVTVTSP-IEDEDL  163



>ref|XP_006389515.1| hypothetical protein POPTR_0022s00510g [Populus trichocarpa]
 gb|ERP48429.1| hypothetical protein POPTR_0022s00510g [Populus trichocarpa]
Length=167

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 72/191 (38%), Positives = 103/191 (54%), Gaps = 35/191 (18%)
 Frame = +3

Query  183  MNRYAKIKADSNSKSKSRSLEWSADPKSFSNTTHHSQSPETQELNQV------KKENIIS  344
            MN Y+KIK    ++S  RS+++S    +F   T     P  QE N++       K+N+IS
Sbjct  1    MNGYSKIKIFGTARS--RSMDFSDLSLAFPEPTKSHTEP--QETNKIVGDHDNTKKNMIS  56

Query  345  RNS----DFDEHQEQEHQDDRSGFGVKLTRSSSVASNGASQQRFRLERAGSGRVKRAFSM  512
             ++         +E E  +   GFG KL RSSSV+S+ ++ Q           VK+AFS+
Sbjct  57   TDTTTQDSLSVLEEDEENNVVEGFGAKLRRSSSVSSSASALQS---------AVKKAFSV  107

Query  513  RRSSSVSERYCRIHNQCATLSSPTID-DADMDSNNGDHAGETSPTSAEKISGTVKTTSEK  689
             RSSSVSERYCRIH+Q ATLSSP  D D  +D+       E++ +  +K S      S +
Sbjct  108  TRSSSVSERYCRIHDQSATLSSPIHDEDGTLDTM------ESTRSVTKKHS-----RSGR  156

Query  690  FLRVCKRFLRL  722
            FL+VCK+   L
Sbjct  157  FLKVCKKLFGL  167



>ref|XP_010087925.1| hypothetical protein L484_001375 [Morus notabilis]
 gb|EXB30760.1| hypothetical protein L484_001375 [Morus notabilis]
Length=200

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 80/175 (46%), Gaps = 61/175 (35%)
 Frame = +3

Query  192  YAKIKADSNSKSKSRSLEWSAD-PKSFSNTTHHSQSPETQELNQVKKENIIS--------  344
            Y+KI      KSKS  L++S+D P SF  TT +S   +   L+Q+ K N  +        
Sbjct  5    YSKINIIDTHKSKS--LDFSSDLPMSFPQTTPNSSRSKIH-LDQIIKTNTDATVTKETTN  61

Query  345  ------------------------RNSDFDEHQEQEHQD-------DRSGFG-----VKL  416
                                    RN D D  +E E+ +       D++ FG       L
Sbjct  62   KTTQADNSSSSSSLSSSSSSSPRKRNDDHDHREEVENVNGDIARKADKAAFGSSSNNAVL  121

Query  417  TRSSSVASNGASQQRFRLERAGSGRVKRAFSMRRSSSVSERYCRIHNQCATLSSP  581
             R+SSV+++ ++             VKR  SMRRSSSVSERYCRIH+Q  TL+SP
Sbjct  122  GRNSSVSNSMSA-------------VKRVLSMRRSSSVSERYCRIHDQSVTLASP  163



>ref|XP_003592915.1| hypothetical protein MTR_2g005710 [Medicago truncatula]
 gb|ABE79562.1| hypothetical protein MtrDRAFT_AC140550g13v2 [Medicago truncatula]
 gb|AES63166.1| hypothetical protein MTR_2g005710 [Medicago truncatula]
 gb|AFK36725.1| unknown [Medicago truncatula]
Length=156

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 46/77 (60%), Gaps = 10/77 (13%)
 Frame = +3

Query  492  VKRAFSMRRSSSVSERYCRIHNQCATLSSPTIDDADMDSNNGDHAGETSPTSAEKISGTV  671
            +KRAFS+RRSSSVSERYCRIH+Q   ++S    D D+  N+G   GE   T   +  G  
Sbjct  90   MKRAFSIRRSSSVSERYCRIHDQSMAIASD--HDLDIIINDG---GEGKTTEKRRQKG--  142

Query  672  KTTSEKFLRVCKRFLRL  722
                +K L+ CKR L L
Sbjct  143  ---GKKILKACKRLLGL  156



>ref|XP_006431626.1| hypothetical protein CICLE_v10002589mg [Citrus clementina]
 gb|ESR44866.1| hypothetical protein CICLE_v10002589mg [Citrus clementina]
Length=189

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 93/171 (54%), Gaps = 40/171 (23%)
 Frame = +3

Query  183  MNRYAKIKADSNSKSKSRSLEWSAD--PKSFSNTTHHSQSPETQE--LNQVKKENIISRN  350
            MN Y+K+K   ++KS  RS+++S+D  P S S +   +  PE  E  L ++ K N +++ 
Sbjct  1    MNGYSKMKIIGDTKS--RSIDFSSDLFPSSPSLSETRNPKPEIPESNLEELIKSNPLTKT  58

Query  351  SD-------------FDEHQEQEHQD------------DRSGFG--VKLTRSSSVASNGA  449
            ++             F E +E+E +D            D   FG  +KL R+S+V+++ A
Sbjct  59   NNTTSNRNKTQDSFSFSEQEEEEEEDQVCNINYNNNNNDGEKFGSHIKLRRNSTVSASSA  118

Query  450  SQQRFRLERAGSGRVKRAFSMRRSSSVSERYCRIHNQCATLSSPTIDDADM  602
            +    +        VKRAFSMRRSSSVSERY RIH+Q  T++SP  +D D+
Sbjct  119  ASHALQYT------VKRAFSMRRSSSVSERYSRIHDQSVTVTSP-FEDEDL  162



>gb|KDP42452.1| hypothetical protein JCGZ_00249 [Jatropha curcas]
Length=190

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 82/159 (52%), Gaps = 28/159 (18%)
 Frame = +3

Query  258  PKSFSNTTHHSQSPETQELNQVKKENIISRNSD-FDEHQEQEHQDDRSG--FGV-KLTRS  425
            PK  +N   + +SP    L+ ++++   + N + F+ ++ + +    SG  F + KL R+
Sbjct  56   PKPLTNKIKNQESP----LSWIQEDQASNNNGEIFNSYKLKRNTSVSSGEIFNIQKLKRN  111

Query  426  SSVASNGASQQRFRLERAGSGRVKRAFSMRRSSSVSERYCRIHNQCATLSSPTIDDADMD  605
            SSV+S            A    VK+AFSM+RSSSVSERYCRIH+Q   + S T    D D
Sbjct  112  SSVSSAST---------AIHSAVKKAFSMKRSSSVSERYCRIHDQSLAIPSTTCGGGDDD  162

Query  606  SNNGDHAGETSPTSAEKISGTVKTTSEKFLRVCKRFLRL  722
             ++ D       T + K     +  S++ LR CK+ L L
Sbjct  163  DDSLD------TTRSMK-----RKNSKRILRACKKLLGL  190



>ref|XP_006385041.1| hypothetical protein POPTR_0004s23330g [Populus trichocarpa]
 gb|ERP62838.1| hypothetical protein POPTR_0004s23330g [Populus trichocarpa]
Length=169

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 77/152 (51%), Gaps = 26/152 (17%)
 Frame = +3

Query  183  MNRYAKIKADSNSKSKS-----RSLEWSADPKSFSNTTHHSQSPETQELNQ-VKKENII-  341
            MN Y+KIK    + S+S      SL +    KS ++T+   Q  ET+ +NQ +   N+I 
Sbjct  1    MNGYSKIKIFGAANSRSIDFSDLSLAFPEPTKSNTSTSLEHQESETKIINQDINTMNVIR  60

Query  342  ------SRNSDFDEHQEQEHQDDRSGFGVKLTRSSSVASNGASQQRFRLERAGSGRVKRA  503
                  +        ++ +  D    F +KL R+ SV+S+ ++ ++             A
Sbjct  61   SGTTSATTQDSLSVLEDDQENDVEERFSMKLRRNPSVSSSASAVKK-------------A  107

Query  504  FSMRRSSSVSERYCRIHNQCATLSSPTIDDAD  599
            FSMRRS+SVSE YCRIHNQ  T +SP  D+ D
Sbjct  108  FSMRRSTSVSEAYCRIHNQSMTSASPIHDEDD  139



>gb|EYU26466.1| hypothetical protein MIMGU_mgv1a023299mg [Erythranthe guttata]
Length=135

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 39/59 (66%), Gaps = 9/59 (15%)
 Frame = +3

Query  402  FGV-KLTRSSSVASNGASQQRFRLERAGSGRVKRAFSMRRSSSVSERYCRIHNQCATLS  575
            FG  K  R+SSV+ + +        R  S  VK+AFSMRRSSSVSERYCRIH+Q  TL+
Sbjct  50   FGAPKFDRNSSVSCSKS--------RHVSSSVKKAFSMRRSSSVSERYCRIHDQHVTLA  100



>ref|XP_006592657.1| PREDICTED: uncharacterized protein LOC102666599 [Glycine max]
 gb|KHN31595.1| hypothetical protein glysoja_043038 [Glycine soja]
Length=104

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 36/77 (47%), Gaps = 24/77 (31%)
 Frame = +3

Query  492  VKRAFSMRRSSSVSERYCRIHNQCATLSSPTIDDADMDSNNGDHAGETSPTSAEKISGTV  671
             +RAFSMRRSSSVSERYCRIH+Q    + P I         G +                
Sbjct  52   FQRAFSMRRSSSVSERYCRIHDQ---YTPPPIGSKKKQRGGGPN----------------  92

Query  672  KTTSEKFLRVCKRFLRL  722
                 K L+ CKR LRL
Sbjct  93   -----KILKACKRLLRL  104



>ref|XP_004485439.1| PREDICTED: uncharacterized protein LOC101498644 [Cicer arietinum]
Length=112

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 68/135 (50%), Gaps = 25/135 (19%)
 Frame = +3

Query  312  LNQVKKENIISRNSDFDEHQEQEHQDDRSGFGVKLTRSSSVASNGASQQRFRLERAGSGR  491
            +N   K + I+ ++D  E +E + + +R  FGV L +SSSV+S+ +S   F        R
Sbjct  1    MNGYSKIDTITTDADHKEIKELDEKGER--FGVILGKSSSVSSSSSSAYGFH------AR  52

Query  492  VKRAFSMRRSSSVSERYCRIHNQCATLSSPTIDDADMDSNNGDHAGETSPTSAEKISGTV  671
            +KRA SM R SSV+ERY RIH+Q   ++S             DH  ET   + +K  G  
Sbjct  53   MKRAISMGRCSSVTERYGRIHDQNMAIASS------------DHDTETRSVNNKKHKG--  98

Query  672  KTTSEKFLRVCKRFL  716
                   L+ CKR L
Sbjct  99   ---GNNILKACKRLL  110



>ref|XP_011028357.1| PREDICTED: uncharacterized protein LOC105128404 [Populus euphratica]
Length=179

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 80/155 (52%), Gaps = 32/155 (21%)
 Frame = +3

Query  183  MNRYAKIKADSNSKSKSR-----SLEWSADPKSFSNTTHHSQSPETQELNQ-VKKENIIS  344
            MN Y+KIK    + S+S      SL +    KS ++T    Q  ET+ +NQ +   N+I 
Sbjct  15   MNGYSKIKIFGAANSRSIDFSDPSLAFPEPAKSNTSTFLEHQESETKIINQDINTMNVIR  74

Query  345  RN----------SDFDEHQEQEHQDDRSGFGVKLTRSSSVASNGASQQRFRLERAGSGRV  494
                        S F++ QE + ++  S   +KL R+ SV+S+ ++ ++           
Sbjct  75   SGTTSATTQDSLSVFEDDQENDVEERLS---MKLRRNPSVSSSASAVKK-----------  120

Query  495  KRAFSMRRSSSVSERYCRIHNQCATLSSPTIDDAD  599
              AFSMRRS+SVSE YCRIHNQ  T +SP  D+ D
Sbjct  121  --AFSMRRSTSVSEGYCRIHNQSMTSASPIHDEDD  153



>ref|XP_007148566.1| hypothetical protein PHAVU_006G219300g [Phaseolus vulgaris]
 gb|ESW20560.1| hypothetical protein PHAVU_006G219300g [Phaseolus vulgaris]
Length=111

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 50/108 (46%), Gaps = 30/108 (28%)
 Frame = +3

Query  402  FGVKLTRSSSVASNGASQ-QRFRLERAGSGRVKRAFSMRRSSSVSERYCRIHNQCATLSS  578
            FGV L RS+SV+S   S  + F +       +KRAFSM RSSSVSERYCR          
Sbjct  31   FGVILGRSASVSSRCCSASEGFEVT------MKRAFSMGRSSSVSERYCR----------  74

Query  579  PTIDDADMDSNNGDHAGETSPTSAEKISGTVKTTSEKFLRVCKRFLRL  722
              ID+  M+S   +   E       KI           L+ CKR LR 
Sbjct  75   --IDETAMESGIEESKEERGVRMKMKI-----------LKACKRLLRF  109



>ref|XP_009399154.1| PREDICTED: uncharacterized protein LOC103983628 [Musa acuminata 
subsp. malaccensis]
Length=162

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 60/183 (33%), Positives = 81/183 (44%), Gaps = 28/183 (15%)
 Frame = +3

Query  183  MNRYAKIKADSNSKSKSRSLEWSADPKSFSNTTHHSQSPETQELNQVKKENIISRNSDFD  362
            M  Y+++   + S +KSRS+E+S DP  FS     +     Q+    +  ++I     F 
Sbjct  1    MGGYSRMGVVTGSTAKSRSMEFS-DPTFFSPPPKEAPEEPQQK----EAADVIKPVDHFS  55

Query  363  EHQEQEHQDDRSG-----FGVKLTRSSSVASNGASQQRFRLERAGSGRVKRAFSMRRSSS  527
              Q+Q+ +++        FGV L+R+ S AS   S     L+ A    V RAFSMRRSSS
Sbjct  56   WLQQQQEEEEEEEEGGQRFGVILSRTCSSASQRFSNGSTGLQSA----VMRAFSMRRSSS  111

Query  528  VSERYCRIHNQCATLSSPTIDDADMDSNNGDHAGETSPTSAEKISGTVKTTSEKFLRVCK  707
            V E Y RIH           D  D D    D   E       +     K    KFLR CK
Sbjct  112  VREGYWRIH-----------DTGDED-GGADLLEEEQQMRYSRK--KKKKNKGKFLRACK  157

Query  708  RFL  716
            R L
Sbjct  158  RLL  160



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1791060323195