BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c28250_g1_i1 len=1282 path=[1260:0-1281]

Length=1282
                                                                      Score     E

dbj|BAF46311.1|  cysteine proteinase precursor                          411   6e-138   Ipomoea nil [qian niu]
ref|XP_002523447.1|  cysteine protease, putative                        410   2e-137   Ricinus communis
ref|XP_010045985.1|  PREDICTED: ervatamin-B-like                        404   2e-135   
ref|XP_010091034.1|  KDEL-tailed cysteine endopeptidase CEP1            404   5e-135   
gb|AAK27968.1|AF242372_1  cysteine protease                             402   1e-134   Ipomoea batatas [batate]
gb|AAL14199.1|  cysteine proteinase precursor                           402   1e-134   Ipomoea batatas [batate]
ref|XP_010045986.1|  PREDICTED: ervatamin-B-like                        401   4e-134   
ref|XP_010099379.1|  KDEL-tailed cysteine endopeptidase CEP1            400   1e-133   
ref|XP_002523448.1|  cysteine protease, putative                        400   1e-133   Ricinus communis
gb|AFV30165.1|  cysteine proteinase                                     400   1e-133   
ref|XP_007048796.1|  Senescence-associated gene 12                      399   4e-133   
ref|XP_002522559.1|  cysteine protease, putative                        399   4e-133   Ricinus communis
ref|XP_011086004.1|  PREDICTED: senescence-specific cysteine prot...    397   2e-132   
ref|XP_010045988.1|  PREDICTED: ervatamin-B-like                        395   1e-131   
ref|XP_002280230.2|  PREDICTED: LOW QUALITY PROTEIN: senescence-s...    394   2e-131   Vitis vinifera
ref|XP_007048674.1|  Senescence-associated gene 12                      394   3e-131   
ref|XP_002316833.2|  hypothetical protein POPTR_0011s07520g             394   3e-131   Populus trichocarpa [western balsam poplar]
ref|XP_011045912.1|  PREDICTED: senescence-specific cysteine prot...    394   3e-131   
dbj|BAF56427.1|  cysteine proteinase                                    394   4e-131   Lotus japonicus
ref|XP_010045987.1|  PREDICTED: ervatamin-B-like                        394   4e-131   
ref|XP_006360707.1|  PREDICTED: vignain-like                            393   5e-131   
ref|XP_009775915.1|  PREDICTED: ervatamin-B-like                        393   7e-131   
ref|XP_007048792.1|  Senescence-associated gene 12                      392   1e-130   
emb|CDP18645.1|  unnamed protein product                                392   1e-130   
emb|CDP18644.1|  unnamed protein product                                392   1e-130   
ref|XP_002280204.1|  PREDICTED: senescence-specific cysteine prot...    392   2e-130   Vitis vinifera
ref|XP_009601306.1|  PREDICTED: ervatamin-B-like isoform X1             391   2e-130   
ref|XP_010103045.1|  KDEL-tailed cysteine endopeptidase CEP1            392   3e-130   
ref|XP_006467666.1|  PREDICTED: vignain-like                            391   3e-130   
gb|KDP21078.1|  hypothetical protein JCGZ_21549                         390   4e-130   
ref|XP_004252652.2|  PREDICTED: senescence-specific cysteine prot...    390   4e-130   
gb|KDP45578.1|  hypothetical protein JCGZ_17185                         391   4e-130   
ref|XP_002280246.1|  PREDICTED: senescence-specific cysteine prot...    390   8e-130   Vitis vinifera
ref|XP_011086001.1|  PREDICTED: senescence-specific cysteine prot...    389   2e-129   
ref|XP_004252606.1|  PREDICTED: senescence-specific cysteine prot...    389   2e-129   
ref|XP_006446793.1|  hypothetical protein CICLE_v10018274mg             389   2e-129   
ref|XP_006376349.1|  hypothetical protein POPTR_0013s12260g             389   2e-129   
ref|XP_004252607.1|  PREDICTED: senescence-specific cysteine prot...    389   2e-129   
emb|CAN64655.1|  hypothetical protein VITISV_005140                     389   2e-129   Vitis vinifera
ref|XP_006469011.1|  PREDICTED: vignain-like                            389   3e-129   
emb|CAN70559.1|  hypothetical protein VITISV_032465                     389   3e-129   Vitis vinifera
ref|XP_006446792.1|  hypothetical protein CICLE_v10018253mg             388   4e-129   
ref|XP_002280215.1|  PREDICTED: senescence-specific cysteine prot...    388   4e-129   Vitis vinifera
ref|XP_006469012.1|  PREDICTED: vignain-like                            388   7e-129   
gb|KDO63329.1|  hypothetical protein CISIN_1g047793mg                   387   1e-128   
ref|XP_011078044.1|  PREDICTED: senescence-specific cysteine prot...    387   1e-128   
ref|XP_010038688.1|  PREDICTED: ervatamin-B-like                        387   1e-128   
ref|XP_011038210.1|  PREDICTED: senescence-specific cysteine prot...    387   1e-128   
ref|XP_009601308.1|  PREDICTED: ervatamin-B-like isoform X3             387   1e-128   
ref|XP_011038211.1|  PREDICTED: senescence-specific cysteine prot...    387   1e-128   
ref|XP_006360708.1|  PREDICTED: vignain-like                            387   2e-128   
ref|XP_009601307.1|  PREDICTED: ervatamin-B-like isoform X2             386   2e-128   
ref|XP_009629965.1|  PREDICTED: ervatamin-B-like                        387   2e-128   
ref|XP_006469128.1|  PREDICTED: vignain-like                            387   2e-128   
ref|XP_011086005.1|  PREDICTED: senescence-specific cysteine prot...    387   2e-128   
ref|XP_006446763.1|  hypothetical protein CICLE_v10017432mg             386   3e-128   
emb|CDP05747.1|  unnamed protein product                                385   4e-128   
emb|CAL64936.1|  putative cysteine protease 8                           386   4e-128   Trifolium pratense [peavine clover]
gb|AAA50755.1|  cysteine proteinase                                     385   5e-128   Alnus glutinosa
ref|XP_011037399.1|  PREDICTED: senescence-specific cysteine prot...    385   5e-128   
emb|CDP18641.1|  unnamed protein product                                385   7e-128   
gb|EYU25672.1|  hypothetical protein MIMGU_mgv1a018700mg                385   8e-128   
ref|XP_006380493.1|  hypothetical protein POPTR_0007s07240g             385   8e-128   
ref|XP_009797968.1|  PREDICTED: vignain-like                            385   9e-128   
ref|XP_004505498.1|  PREDICTED: vignain-like                            385   1e-127   
ref|XP_002280263.1|  PREDICTED: senescence-specific cysteine prot...    384   1e-127   Vitis vinifera
ref|XP_011078542.1|  PREDICTED: senescence-specific cysteine prot...    384   2e-127   
ref|XP_006376431.1|  hypothetical protein POPTR_0013s12980g             384   2e-127   
gb|KDP23983.1|  hypothetical protein JCGZ_25371                         384   2e-127   
gb|AAP32198.1|  cysteine protease 12                                    384   2e-127   Trifolium repens [creeping white clover]
ref|XP_002310053.1|  hypothetical protein POPTR_0007s07200g             384   2e-127   Populus trichocarpa [western balsam poplar]
gb|AAP32195.1|  cysteine protease 5                                     384   2e-127   Trifolium repens [creeping white clover]
ref|XP_008228922.1|  PREDICTED: vignain-like                            383   3e-127   
dbj|BAF56428.1|  cysteine proteinase                                    384   3e-127   Lotus japonicus
ref|XP_008244498.1|  PREDICTED: ervatamin-B-like                        384   3e-127   
ref|XP_011009172.1|  PREDICTED: senescence-specific cysteine prot...    383   4e-127   
ref|XP_006449486.1|  hypothetical protein CICLE_v10018236mg             382   4e-127   
ref|XP_006380488.1|  hypothetical protein POPTR_0007s07170g             383   6e-127   
ref|XP_002525123.1|  cysteine protease, putative                        383   6e-127   Ricinus communis
gb|EYU25680.1|  hypothetical protein MIMGU_mgv1a019612mg                382   1e-126   
ref|XP_007214432.1|  hypothetical protein PRUPE_ppa025658mg             382   1e-126   
ref|XP_006362426.1|  PREDICTED: vignain-like                            382   1e-126   
ref|XP_010906196.1|  PREDICTED: senescence-specific cysteine prot...    382   2e-126   
ref|XP_002307151.2|  hypothetical protein POPTR_0005s09140g             380   2e-126   Populus trichocarpa [western balsam poplar]
ref|XP_011022002.1|  PREDICTED: senescence-specific cysteine prot...    382   2e-126   
gb|KHN13721.1|  Vignain                                                 381   2e-126   
ref|XP_008244476.1|  PREDICTED: ervatamin-B-like                        381   2e-126   
gb|KDP23984.1|  hypothetical protein JCGZ_25372                         381   2e-126   
ref|XP_007132875.1|  hypothetical protein PHAVU_011G132100g             381   2e-126   
ref|XP_003605890.1|  Cysteine proteinase                                381   3e-126   
ref|XP_008805390.1|  PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-...    381   3e-126   
ref|XP_007132275.1|  hypothetical protein PHAVU_011G081100g             381   3e-126   
ref|XP_007050065.1|  Senescence-associated gene 12                      381   3e-126   
ref|XP_007132887.1|  hypothetical protein PHAVU_011G133200g             381   4e-126   
ref|XP_003612210.1|  Cysteine proteinase                                380   5e-126   
ref|XP_008228868.1|  PREDICTED: LOW QUALITY PROTEIN: zingipain-2-...    380   5e-126   
gb|AFW76902.1|  hypothetical protein ZEAMMB73_056195                    380   5e-126   
ref|XP_007213386.1|  hypothetical protein PRUPE_ppa026372mg             380   6e-126   
ref|XP_007212667.1|  hypothetical protein PRUPE_ppa018342mg             379   7e-126   
ref|XP_003609015.1|  Cysteine proteinase                                380   7e-126   
ref|XP_007132861.1|  hypothetical protein PHAVU_011G130900g             380   8e-126   
ref|XP_007132895.1|  hypothetical protein PHAVU_011G134000g             380   8e-126   
ref|XP_003557016.1|  PREDICTED: vignain-like                            380   8e-126   
ref|XP_004973089.1|  PREDICTED: thiol protease SEN102-like              380   9e-126   
ref|XP_007212585.1|  hypothetical protein PRUPE_ppa015944mg             379   1e-125   
ref|XP_004505502.1|  PREDICTED: vignain-like                            380   1e-125   
ref|XP_004974540.1|  PREDICTED: thiol protease SEN102-like              379   1e-125   
gb|AAP32196.1|  cysteine protease 8                                     379   1e-125   Trifolium repens [creeping white clover]
ref|XP_008244499.1|  PREDICTED: ervatamin-B-like                        379   1e-125   
ref|XP_009623244.1|  PREDICTED: ervatamin-B-like                        379   2e-125   
ref|XP_006376351.1|  hypothetical protein POPTR_0013s12280g             379   2e-125   
ref|XP_004489011.1|  PREDICTED: vignain-like                            379   2e-125   
ref|XP_002306369.1|  hypothetical protein POPTR_0005s09080g             379   2e-125   Populus trichocarpa [western balsam poplar]
ref|XP_002531152.1|  cysteine protease, putative                        379   2e-125   Ricinus communis
ref|XP_004974538.1|  PREDICTED: thiol protease SEN102-like              378   3e-125   
dbj|BAF56430.1|  cysteine proteinase                                    378   3e-125   Lotus japonicus
ref|XP_007132865.1|  hypothetical protein PHAVU_011G131200g             378   4e-125   
gb|ADV74756.1|  cysteine protease                                       379   4e-125   
ref|XP_004974539.1|  PREDICTED: thiol protease SEN102-like              378   5e-125   
ref|XP_006592465.1|  PREDICTED: vignain-like                            377   7e-125   
ref|XP_004974541.1|  PREDICTED: thiol protease SEN102-like              377   8e-125   
ref|XP_003526232.1|  PREDICTED: vignain-like                            377   9e-125   
ref|XP_010317330.1|  PREDICTED: uncharacterized protein LOC101251741    392   9e-125   
gb|KHN08187.1|  Thiol protease SEN102                                   377   9e-125   
ref|XP_004975180.1|  PREDICTED: thiol protease SEN102-like              377   1e-124   
gb|KHN38752.1|  Vignain                                                 375   1e-124   
dbj|BAD29959.1|  cysteine protease                                      377   2e-124   Daucus carota [carrots]
ref|XP_002274223.1|  PREDICTED: senescence-specific cysteine prot...    376   2e-124   Vitis vinifera
gb|EYU19040.1|  hypothetical protein MIMGU_mgv1a026538mg                376   2e-124   
ref|XP_008659446.1|  PREDICTED: ervatamin-B-like                        376   2e-124   
dbj|BAD29955.1|  cysteine protease                                      377   2e-124   Daucus carota [carrots]
gb|AAT34987.1|  putative cysteine protease                              376   2e-124   Gossypium hirsutum [American cotton]
ref|XP_003556992.1|  PREDICTED: vignain-like                            376   3e-124   
ref|XP_003527349.1|  PREDICTED: vignain-like                            376   3e-124   
ref|XP_007132888.1|  hypothetical protein PHAVU_011G133300g             376   3e-124   
ref|XP_003607571.1|  Cysteine proteinase EP-B                           376   3e-124   
gb|AAR92154.1|  putative cysteine protease 1                            375   5e-124   Iris x hollandica [Dutch iris]
gb|KCW76137.1|  hypothetical protein EUGRSUZ_D00513                     375   5e-124   
ref|XP_010052206.1|  PREDICTED: ervatamin-B-like                        375   5e-124   
gb|KHN33962.1|  Vignain                                                 374   7e-124   
ref|XP_010277773.1|  PREDICTED: senescence-specific cysteine prot...    375   1e-123   
ref|XP_002531151.1|  cysteine protease, putative                        374   1e-123   Ricinus communis
gb|AFW86317.1|  hypothetical protein ZEAMMB73_339067                    378   1e-123   
ref|XP_002446222.1|  hypothetical protein SORBIDRAFT_06g005410          374   1e-123   Sorghum bicolor [broomcorn]
ref|XP_003527350.1|  PREDICTED: vignain-like                            374   1e-123   
ref|XP_003538185.1|  PREDICTED: vignain-like                            374   2e-123   
ref|XP_008669676.1|  PREDICTED: ervatamin-B-like                        374   2e-123   
ref|XP_003607548.1|  Cysteine protease                                  374   2e-123   
ref|XP_004505500.1|  PREDICTED: vignain-like                            374   2e-123   
gb|KCW84689.1|  hypothetical protein EUGRSUZ_B01506                     372   2e-123   
ref|XP_009344439.1|  PREDICTED: ervatamin-B-like                        373   3e-123   
ref|XP_007213554.1|  hypothetical protein PRUPE_ppa018048mg             373   4e-123   
ref|XP_008800071.1|  PREDICTED: ervatamin-B-like                        373   4e-123   
gb|EYU43350.1|  hypothetical protein MIMGU_mgv1a021555mg                372   4e-123   
ref|XP_011014442.1|  PREDICTED: senescence-specific cysteine prot...    374   4e-123   
ref|XP_004297572.1|  PREDICTED: vignain-like                            373   4e-123   
ref|XP_011021998.1|  PREDICTED: senescence-specific cysteine prot...    373   4e-123   
ref|XP_004506025.1|  PREDICTED: vignain-like                            373   5e-123   
ref|XP_010038689.1|  PREDICTED: ervatamin-B-like                        372   6e-123   
gb|EYU19037.1|  hypothetical protein MIMGU_mgv1a018631mg                372   6e-123   
ref|XP_004290089.1|  PREDICTED: vignain-like                            372   6e-123   
ref|XP_007025398.1|  Senescence-associated gene 12                      372   6e-123   
ref|XP_006592467.1|  PREDICTED: vignain-like                            372   7e-123   
ref|XP_006384060.1|  hypothetical protein POPTR_0004s05510g             372   9e-123   
ref|XP_002305072.2|  hypothetical protein POPTR_0004s05520g             372   1e-122   Populus trichocarpa [western balsam poplar]
ref|XP_009354268.1|  PREDICTED: ervatamin-B-like                        371   2e-122   
ref|XP_007132860.1|  hypothetical protein PHAVU_011G130800g             371   2e-122   
ref|XP_009354269.1|  PREDICTED: ervatamin-B-like                        371   2e-122   
gb|KDP45355.1|  hypothetical protein JCGZ_09604                         370   3e-122   
ref|XP_008342777.1|  PREDICTED: ervatamin-B-like                        370   4e-122   
ref|XP_007132896.1|  hypothetical protein PHAVU_011G134100g             369   4e-122   
ref|XP_008382007.1|  PREDICTED: ervatamin-B-like                        370   5e-122   
ref|XP_008353750.1|  PREDICTED: ervatamin-B-like                        370   5e-122   
ref|XP_008803660.1|  PREDICTED: ervatamin-B-like                        370   6e-122   
ref|XP_009359979.1|  PREDICTED: ervatamin-B-like                        370   6e-122   
gb|EYU25679.1|  hypothetical protein MIMGU_mgv1a023356mg                370   6e-122   
emb|CBI21977.3|  unnamed protein product                                368   7e-122   
ref|XP_008340724.1|  PREDICTED: vignain-like                            370   8e-122   
ref|XP_007227669.1|  hypothetical protein PRUPE_ppa025602mg             370   8e-122   
gb|AGT16936.1|  vignain-like protein                                    370   8e-122   
ref|XP_009357172.1|  PREDICTED: ervatamin-B-like                        370   9e-122   
ref|XP_008342776.1|  PREDICTED: ervatamin-B-like                        369   1e-121   
ref|XP_009354321.1|  PREDICTED: ervatamin-B-like                        371   1e-121   
ref|XP_008342782.1|  PREDICTED: ervatamin-B-like                        369   1e-121   
ref|XP_009617815.1|  PREDICTED: ervatamin-B-like                        369   1e-121   
emb|CAD40112.2|  OSJNBa0035O13.5                                        369   1e-121   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008342781.1|  PREDICTED: ervatamin-B-like                        369   1e-121   
ref|XP_002305073.2|  hypothetical protein POPTR_0004s05540g             369   1e-121   Populus trichocarpa [western balsam poplar]
ref|XP_004306597.1|  PREDICTED: vignain-like                            369   2e-121   
ref|XP_011005485.1|  PREDICTED: senescence-specific cysteine prot...    369   2e-121   
dbj|BAB13759.1|  cysteine proteinase                                    369   2e-121   Astragalus sinicus
ref|XP_007226492.1|  hypothetical protein PRUPE_ppa026538mg             369   2e-121   
ref|XP_008659445.1|  PREDICTED: ervatamin-B-like                        369   2e-121   
gb|KHN32069.1|  Vignain                                                 368   2e-121   
emb|CAH66275.1|  OSIGBa0147O06.5                                        369   2e-121   Oryza sativa [red rice]
ref|XP_011078435.1|  PREDICTED: senescence-specific cysteine prot...    369   2e-121   
ref|XP_004303175.1|  PREDICTED: vignain-like                            369   2e-121   
ref|XP_003539989.1|  PREDICTED: vignain-like                            369   3e-121   
ref|XP_006582264.1|  PREDICTED: vignain-like                            368   3e-121   
gb|KHN08873.1|  Vignain                                                 368   3e-121   
sp|A2XQE8.1|SAG39_ORYSI  RecName: Full=Senescence-specific cystei...    368   3e-121   Oryza sativa Indica Group [Indian rice]
ref|XP_009357173.1|  PREDICTED: ervatamin-B-like                        368   3e-121   
ref|XP_010035848.1|  PREDICTED: zingipain-2-like                        368   4e-121   
ref|XP_003607574.1|  Cysteine protease                                  368   4e-121   
sp|Q7XWK5.2|SAG39_ORYSJ  RecName: Full=Senescence-specific cystei...    368   4e-121   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008800073.1|  PREDICTED: ervatamin-B-like                        368   5e-121   
gb|EAY93078.1|  hypothetical protein OsI_14879                          367   5e-121   Oryza sativa Indica Group [Indian rice]
gb|KHN13720.1|  Vignain                                                 366   7e-121   
ref|XP_009359967.1|  PREDICTED: vignain-like                            367   7e-121   
emb|CAH66233.1|  H0825G02.10                                            367   8e-121   Oryza sativa [red rice]
ref|XP_006582263.1|  PREDICTED: vignain-like                            367   8e-121   
gb|KCW47322.1|  hypothetical protein EUGRSUZ_K01110                     365   1e-120   
ref|XP_006362428.1|  PREDICTED: vignain-like                            367   1e-120   
ref|XP_009361500.1|  PREDICTED: vignain-like                            367   1e-120   
ref|XP_008223852.1|  PREDICTED: ervatamin-B-like                        366   2e-120   
ref|XP_003539970.1|  PREDICTED: vignain-like                            366   2e-120   
ref|XP_009798361.1|  PREDICTED: ervatamin-B-like                        366   2e-120   
ref|XP_009767421.1|  PREDICTED: ervatamin-B-like                        366   2e-120   
ref|XP_006652104.1|  PREDICTED: vignain-like                            365   3e-120   
ref|XP_004297571.1|  PREDICTED: vignain-like                            365   4e-120   
ref|XP_008223851.1|  PREDICTED: ervatamin-B-like                        365   4e-120   
ref|XP_011008467.1|  PREDICTED: senescence-specific cysteine prot...    364   5e-120   
ref|XP_008348586.1|  PREDICTED: ervatamin-B-like                        365   6e-120   
ref|XP_004306851.1|  PREDICTED: vignain-like                            365   8e-120   
gb|KHN07750.1|  KDEL-tailed cysteine endopeptidase CEP1                 363   9e-120   
ref|XP_008362421.1|  PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-...    364   1e-119   
ref|XP_009359957.1|  PREDICTED: ervatamin-B-like                        364   2e-119   
ref|XP_009357171.1|  PREDICTED: ervatamin-B-like                        363   3e-119   
ref|XP_009365508.1|  PREDICTED: vignain-like                            370   3e-119   
gb|ADP02218.1|  Peptidase_C1 domain-containing protein                  362   5e-119   
gb|EMT08019.1|  Vignain                                                 361   5e-119   
gb|KDP40484.1|  hypothetical protein JCGZ_24483                         362   8e-119   
ref|XP_011014388.1|  PREDICTED: senescence-specific cysteine prot...    362   9e-119   
ref|XP_004975183.1|  PREDICTED: vignain-like                            362   1e-118   
ref|XP_009349242.1|  PREDICTED: vignain-like                            367   1e-118   
ref|XP_008225269.1|  PREDICTED: uncharacterized protein LOC103324934    375   1e-118   
gb|EMT20796.1|  Vignain                                                 363   2e-118   
ref|XP_002525124.1|  cysteine protease, putative                        361   2e-118   Ricinus communis
ref|XP_003527388.1|  PREDICTED: vignain-like                            361   2e-118   
ref|XP_003540013.1|  PREDICTED: vignain-like                            360   4e-118   
gb|EMS56453.1|  KDEL-tailed cysteine endopeptidase CEP1                 360   4e-118   
dbj|BAF56429.1|  cysteine proteinase                                    360   4e-118   Lotus japonicus
gb|EMT08022.1|  Vignain                                                 360   5e-118   
emb|CBI21976.3|  unnamed protein product                                359   7e-118   
ref|XP_004975182.1|  PREDICTED: vignain-like                            359   8e-118   
gb|KHN27806.1|  Vignain                                                 358   8e-118   
gb|KHN07749.1|  Vignain                                                 358   1e-117   
gb|KHN32068.1|  Vignain                                                 358   1e-117   
ref|XP_003526207.1|  PREDICTED: thiol protease SEN102-like              359   1e-117   
ref|XP_009759551.1|  PREDICTED: zingipain-2-like                        359   1e-117   
gb|EMT20795.1|  Vignain                                                 358   1e-117   
gb|ADV41672.1|  cysteine protease                                       359   2e-117   
ref|XP_003596314.1|  Cysteine proteinase                                358   2e-117   
gb|EMT15489.1|  Thiol protease SEN102                                   358   2e-117   
emb|CBI21973.3|  unnamed protein product                                357   2e-117   
ref|XP_006582267.1|  PREDICTED: thiol protease SEN102-like              358   3e-117   
ref|XP_004308524.1|  PREDICTED: vignain-like                            358   3e-117   
gb|KHN28095.1|  Thiol protease                                          357   4e-117   
ref|XP_006857797.1|  hypothetical protein AMTR_s00061p00215400          358   4e-117   
gb|EMT29821.1|  Thiol protease SEN102                                   357   7e-117   
emb|CBI21972.3|  unnamed protein product                                356   7e-117   
ref|XP_004975184.1|  PREDICTED: vignain-like                            357   7e-117   
gb|EMT29823.1|  Vignain                                                 357   9e-117   
gb|EMT29822.1|  Vignain                                                 356   1e-116   
ref|XP_008368631.1|  PREDICTED: ervatamin-B-like                        356   2e-116   
ref|XP_004233054.1|  PREDICTED: senescence-specific cysteine prot...    356   2e-116   
ref|XP_003599736.1|  Cysteine proteinase                                355   3e-116   
ref|XP_007132817.1|  hypothetical protein PHAVU_011G127000g             355   3e-116   
ref|XP_009608954.1|  PREDICTED: zingipain-2-like                        355   6e-116   
gb|EAY97106.1|  hypothetical protein OsI_19029                          355   6e-116   Oryza sativa Indica Group [Indian rice]
gb|KHN05669.1|  Vignain                                                 353   6e-116   
gb|AAW78661.2|  senescence-specific cysteine protease                   355   8e-116   Nicotiana tabacum [American tobacco]
ref|XP_006592475.1|  PREDICTED: vignain-like                            354   9e-116   
ref|XP_002446135.1|  hypothetical protein SORBIDRAFT_06g002170          354   1e-115   Sorghum bicolor [broomcorn]
ref|XP_004294729.1|  PREDICTED: vignain-like                            354   1e-115   
ref|XP_002446132.1|  hypothetical protein SORBIDRAFT_06g002150          354   1e-115   Sorghum bicolor [broomcorn]
ref|XP_006857795.1|  hypothetical protein AMTR_s00061p00215070          354   1e-115   
ref|XP_003607647.1|  Cysteine proteinase                                354   1e-115   
ref|XP_003578721.1|  PREDICTED: senescence-specific cysteine prot...    354   1e-115   
ref|XP_008663073.1|  PREDICTED: ervatamin-B-like                        354   1e-115   
ref|XP_004306836.1|  PREDICTED: vignain-like                            353   2e-115   
ref|XP_002446133.1|  hypothetical protein SORBIDRAFT_06g002160          353   2e-115   
ref|XP_009354265.1|  PREDICTED: ervatamin-B-like                        353   2e-115   
ref|XP_003578815.1|  PREDICTED: senescence-specific cysteine prot...    353   3e-115   
gb|ABA97421.1|  Vignain precursor, putative                             353   4e-115   
ref|XP_006380495.1|  hypothetical protein POPTR_0007s07290g             351   7e-115   
ref|XP_010052196.1|  PREDICTED: zingipain-2-like                        352   8e-115   
ref|XP_003578808.1|  PREDICTED: senescence-specific cysteine prot...    352   8e-115   
gb|AFK44139.1|  unknown                                                 352   8e-115   
ref|XP_006398274.1|  hypothetical protein EUTSA_v10000948mg             352   9e-115   
gb|KCW76116.1|  hypothetical protein EUGRSUZ_D00493                     352   1e-114   
ref|XP_004306813.1|  PREDICTED: vignain-like                            350   3e-114   
ref|XP_007132814.1|  hypothetical protein PHAVU_011G126700g             350   3e-114   
ref|XP_010052203.1|  PREDICTED: ervatamin-B-like                        350   3e-114   
emb|CDP18639.1|  unnamed protein product                                349   6e-114   
ref|XP_003578807.1|  PREDICTED: senescence-specific cysteine prot...    349   6e-114   
ref|XP_006857796.1|  hypothetical protein AMTR_s00061p00215230          350   6e-114   
ref|NP_001052232.2|  Os04g0203500                                       349   6e-114   
ref|XP_010906194.1|  PREDICTED: senescence-specific cysteine prot...    349   8e-114   
ref|XP_010239696.1|  PREDICTED: senescence-specific cysteine prot...    349   8e-114   
ref|XP_006362420.1|  PREDICTED: vignain-like                            349   9e-114   
ref|XP_003581047.2|  PREDICTED: senescence-specific cysteine prot...    349   9e-114   
ref|XP_003558756.1|  PREDICTED: senescence-specific cysteine prot...    349   1e-113   
gb|AHA62780.1|  RCR3-like cysteine protease                             349   1e-113   
gb|EEC84514.1|  hypothetical protein OsI_31214                          349   1e-113   
gb|KHN12137.1|  Thiol protease                                          348   1e-113   
gb|KFK31512.1|  hypothetical protein AALP_AA6G122300                    348   2e-113   
ref|XP_010912736.1|  PREDICTED: senescence-specific cysteine prot...    348   2e-113   
ref|XP_007021896.1|  Cysteine proteinases superfamily protein, pu...    348   2e-113   
ref|XP_010054320.1|  PREDICTED: ervatamin-B-like                        348   2e-113   
gb|EMT12294.1|  Vignain                                                 348   2e-113   
ref|XP_010052200.1|  PREDICTED: ervatamin-B-like                        348   3e-113   
ref|XP_010052199.1|  PREDICTED: ervatamin-B-like                        348   3e-113   
ref|XP_006663940.1|  PREDICTED: thiol protease SEN102-like              348   3e-113   
ref|XP_010052197.1|  PREDICTED: ervatamin-B-like                        348   4e-113   
ref|XP_010912725.1|  PREDICTED: zingipain-2-like                        347   4e-113   
ref|XP_007025415.1|  Senescence-associated gene 12, putative            347   4e-113   
gb|KCW76128.1|  hypothetical protein EUGRSUZ_D00504                     346   5e-113   
gb|AGT97048.1|  senescence-specific cysteine protease                   347   6e-113   
ref|XP_006281607.1|  hypothetical protein CARUB_v10027725mg             347   6e-113   
ref|XP_008669668.1|  PREDICTED: ervatamin-B-like                        347   7e-113   
ref|XP_010510777.1|  PREDICTED: ervatamin-B-like                        347   7e-113   
emb|CDP18638.1|  unnamed protein product                                347   8e-113   
ref|XP_008780645.1|  PREDICTED: vignain-like                            344   1e-112   
gb|KCW76123.1|  hypothetical protein EUGRSUZ_D00500                     347   1e-112   
ref|XP_006582265.1|  PREDICTED: thiol protease SEN102-like              346   1e-112   
ref|XP_002865220.1|  senescence-associated gene 12                      346   1e-112   
ref|XP_006582266.1|  PREDICTED: thiol protease SEN102-like              346   1e-112   
ref|XP_008779806.1|  PREDICTED: ervatamin-B-like                        345   1e-112   
ref|XP_007132874.1|  hypothetical protein PHAVU_011G132000g             345   1e-112   
gb|AHA62779.1|  RCR3-like cysteine protease                             346   1e-112   
ref|XP_003578813.1|  PREDICTED: senescence-specific cysteine prot...    346   1e-112   
gb|AHA62783.1|  RCR3-like cysteine protease                             346   1e-112   
ref|XP_003526209.1|  PREDICTED: thiol protease SEN102-like              346   2e-112   
ref|XP_010939512.1|  PREDICTED: senescence-specific cysteine prot...    345   2e-112   
ref|XP_010054319.1|  PREDICTED: zingipain-2-like                        345   3e-112   
gb|AHA62781.1|  RCR3-like cysteine protease                             345   3e-112   
ref|XP_002436841.1|  hypothetical protein SORBIDRAFT_10g009840          345   3e-112   
gb|AAC49135.1|  SAG12 protein                                           345   5e-112   
ref|NP_568651.1|  cysteine protease SAG12                               345   6e-112   
gb|EMT33085.1|  Vignain                                                 344   6e-112   
ref|XP_010441658.1|  PREDICTED: senescence-specific cysteine prot...    344   8e-112   
ref|XP_010481519.1|  PREDICTED: senescence-specific cysteine prot...    344   8e-112   
ref|XP_010494742.1|  PREDICTED: senescence-specific cysteine prot...    344   8e-112   
ref|XP_004505458.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    343   1e-111   
ref|XP_008779585.1|  PREDICTED: zingipain-2-like                        343   1e-111   
ref|XP_006857794.1|  hypothetical protein AMTR_s00061p00214890          343   2e-111   
ref|XP_009397226.1|  PREDICTED: zingipain-2-like                        343   3e-111   
gb|KHN27797.1|  Thiol protease SEN102                                   342   3e-111   
gb|AHA62782.1|  RCR3-like cysteine protease                             342   3e-111   
ref|XP_006294508.1|  hypothetical protein CARUB_v10023540mg             342   5e-111   
ref|XP_006367781.1|  PREDICTED: LOW QUALITY PROTEIN: KDEL-tailed ...    342   7e-111   
gb|ABF70145.1|  cysteine protease, putative                             343   8e-111   
ref|XP_002880913.1|  hypothetical protein ARALYDRAFT_481640             341   1e-110   
ref|XP_009128825.1|  PREDICTED: ervatamin-B                             341   1e-110   
gb|AAD53011.1|AF089848_1  senescence-specific cysteine protease         341   2e-110   
ref|XP_010518799.1|  PREDICTED: senescence-specific cysteine prot...    341   2e-110   
ref|XP_010054322.1|  PREDICTED: ervatamin-B-like                        341   2e-110   
ref|XP_002436840.1|  hypothetical protein SORBIDRAFT_10g009830          340   2e-110   
gb|EMT09279.1|  Thiol protease SEN102                                   338   3e-110   
ref|XP_003526212.1|  PREDICTED: thiol protease SEN102-like              340   3e-110   
ref|XP_010052198.1|  PREDICTED: ervatamin-B-like                        340   4e-110   
gb|KDO55227.1|  hypothetical protein CISIN_1g019112mg                   340   6e-110   
gb|AAP32194.1|  cysteine protease 1                                     337   6e-110   
ref|XP_010052201.1|  PREDICTED: ervatamin-B-like                        339   7e-110   
emb|CDX87758.1|  BnaC02g31910D                                          339   1e-109   
ref|XP_007132822.1|  hypothetical protein PHAVU_011G127400g             338   1e-109   
ref|XP_003526229.1|  PREDICTED: vignain-like                            336   1e-109   
ref|XP_003526215.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    338   1e-109   
ref|XP_009366072.1|  PREDICTED: zingipain-2-like                        338   2e-109   
emb|CBI30671.3|  unnamed protein product                                337   2e-109   
ref|XP_006470292.1|  PREDICTED: xylem cysteine proteinase 1-like ...    338   2e-109   
ref|XP_003526208.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    337   3e-109   
ref|XP_006408714.1|  hypothetical protein EUTSA_v10002030mg             337   5e-109   
ref|XP_003539770.1|  PREDICTED: vignain-like                            337   6e-109   
ref|XP_006468204.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    338   6e-109   
ref|XP_006292980.1|  hypothetical protein CARUB_v10019256mg             337   7e-109   
ref|XP_006421530.1|  hypothetical protein CICLE_v10005334mg             336   1e-108   
gb|ADP02219.1|  Peptidase_C1 domain-containing protein                  338   1e-108   
ref|XP_009407029.1|  PREDICTED: ervatamin-B-like                        336   1e-108   
ref|XP_010417893.1|  PREDICTED: ervatamin-B-like                        335   2e-108   
ref|XP_003596711.1|  Cysteine proteinase                                335   2e-108   
ref|XP_008364019.1|  PREDICTED: zingipain-2-like                        335   3e-108   
ref|XP_006470291.1|  PREDICTED: xylem cysteine proteinase 1-like ...    335   4e-108   
ref|XP_006446541.1|  hypothetical protein CICLE_v10015814mg             334   5e-108   
ref|XP_002877667.1|  hypothetical protein ARALYDRAFT_348033             334   6e-108   
ref|XP_008810168.1|  PREDICTED: ervatamin-B-like isoform X2             334   7e-108   
ref|XP_004505461.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    334   7e-108   
ref|NP_565649.1|  cysteine proteinase-like protein                      334   8e-108   
ref|XP_008810167.1|  PREDICTED: ervatamin-B-like isoform X1             335   8e-108   
ref|XP_010279091.1|  PREDICTED: ervatamin-B                             333   1e-107   
gb|KHG19386.1|  KDEL-tailed cysteine endopeptidase CEP2 -like pro...    331   1e-107   
ref|XP_002436842.1|  hypothetical protein SORBIDRAFT_10g009850          332   1e-107   
gb|KHN27801.1|  Vignain                                                 332   2e-107   
ref|XP_006470293.1|  PREDICTED: xylem cysteine proteinase 1-like ...    333   2e-107   
gb|AAX13273.1|  putative cysteine protease                              332   3e-107   
ref|XP_003599735.1|  Cysteine proteinase                                332   4e-107   
emb|CAD40110.2|  OSJNBa0035O13.9                                        331   4e-107   
gb|KHN34255.1|  KDEL-tailed cysteine endopeptidase CEP1                 330   8e-107   
ref|XP_006852527.1|  hypothetical protein AMTR_s00021p00178980          331   1e-106   
ref|XP_010686289.1|  PREDICTED: senescence-specific cysteine prot...    331   1e-106   
ref|XP_006470294.1|  PREDICTED: xylem cysteine proteinase 1-like ...    331   1e-106   
ref|XP_003540007.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    331   1e-106   
ref|XP_007214465.1|  hypothetical protein PRUPE_ppa023848mg             330   2e-106   
ref|XP_003624041.1|  Cysteine proteinase                                330   2e-106   
ref|NP_001239703.1|  uncharacterized protein LOC100799247 precursor     330   2e-106   
gb|EAY93080.1|  hypothetical protein OsI_14881                          329   2e-106   
ref|XP_007132818.1|  hypothetical protein PHAVU_011G127100g             330   3e-106   
ref|XP_010091035.1|  KDEL-tailed cysteine endopeptidase CEP1            330   3e-106   
emb|CAE03344.2|  OSJNBb0005B05.11                                       329   4e-106   
ref|XP_009101555.1|  PREDICTED: ervatamin-B-like                        330   4e-106   
gb|EYU28078.1|  hypothetical protein MIMGU_mgv1a009081mg                330   4e-106   
ref|XP_008244477.1|  PREDICTED: zingipain-2-like                        329   5e-106   
ref|XP_008669672.1|  PREDICTED: ervatamin-B-like                        328   5e-106   
ref|XP_003527330.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    329   6e-106   
ref|XP_004487579.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    328   8e-106   
ref|XP_003526217.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    328   9e-106   
ref|XP_006291442.1|  hypothetical protein CARUB_v10017578mg             328   1e-105   
ref|XP_010426443.1|  PREDICTED: ervatamin-B                             328   1e-105   
ref|XP_002446131.1|  hypothetical protein SORBIDRAFT_06g002140          328   1e-105   
gb|AAP32197.1|  cysteine protease 10                                    325   2e-105   
gb|KHN33935.1|  KDEL-tailed cysteine endopeptidase CEP1                 327   2e-105   
gb|AFW57869.1|  hypothetical protein ZEAMMB73_830006                    331   2e-105   
ref|XP_003540991.1|  PREDICTED: vignain-like                            327   5e-105   
ref|XP_006432601.1|  hypothetical protein CICLE_v10001718mg             327   5e-105   
gb|AAM73806.1|AF448505_1  cysteine proteinase                           327   6e-105   
ref|XP_006490014.1|  PREDICTED: xylem cysteine proteinase 1-like        327   7e-105   
ref|XP_006432617.1|  hypothetical protein CICLE_v10001723mg             325   2e-104   
ref|XP_010557424.1|  PREDICTED: ervatamin-B-like                        325   3e-104   
emb|CDY58055.1|  BnaA06g40240D                                          324   3e-104   
gb|KHN33932.1|  KDEL-tailed cysteine endopeptidase CEP1                 323   4e-104   
ref|XP_004305438.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    324   4e-104   
ref|XP_004487576.1|  PREDICTED: vignain-like                            323   7e-104   
ref|XP_009366071.1|  PREDICTED: ervatamin-B-like                        324   1e-103   
ref|XP_007214697.1|  hypothetical protein PRUPE_ppa026948mg             323   1e-103   
gb|KFK31525.1|  hypothetical protein AALP_AA6G123900                    323   2e-103   
ref|XP_009150151.1|  PREDICTED: macrodontain-1-like                     323   2e-103   
gb|KCW76139.1|  hypothetical protein EUGRSUZ_D00515                     322   2e-103   
ref|XP_007025413.1|  Maternal effect embryo arrest 18                   342   2e-103   
emb|CDP06286.1|  unnamed protein product                                320   3e-103   
ref|XP_008246197.1|  PREDICTED: vignain-like                            320   3e-103   
ref|XP_006432594.1|  hypothetical protein CICLE_v10001719mg             322   4e-103   
ref|NP_566920.1|  putative cysteine proteinase                          322   4e-103   
ref|XP_008225268.1|  PREDICTED: zingipain-2-like                        321   7e-103   
emb|CDY05926.1|  BnaC08g21030D                                          321   7e-103   
gb|KHN05670.1|  Vignain                                                 319   9e-103   
ref|XP_006652103.1|  PREDICTED: cysteine protease 1-like                321   1e-102   
ref|XP_006291447.1|  hypothetical protein CARUB_v10017584mg             320   2e-102   
emb|CDX73758.1|  BnaC08g22450D                                          320   2e-102   
gb|AFW86315.1|  hypothetical protein ZEAMMB73_539008                    319   2e-102   
ref|XP_008225270.1|  PREDICTED: zingipain-2-like                        320   2e-102   
ref|XP_003527331.1|  PREDICTED: vignain-like                            320   3e-102   
dbj|BAG16376.1|  cysteine protease                                      319   3e-102   
ref|XP_009149742.1|  PREDICTED: zingipain-2-like                        319   5e-102   
ref|XP_010054324.1|  PREDICTED: ervatamin-B-like                        319   5e-102   
ref|XP_010056876.1|  PREDICTED: zingipain-2-like                        319   5e-102   
emb|CAN62838.1|  hypothetical protein VITISV_003391                     317   6e-102   
ref|XP_006421532.1|  hypothetical protein CICLE_v10005342mg             318   1e-101   
gb|KCW76140.1|  hypothetical protein EUGRSUZ_D00517                     317   1e-101   
ref|XP_010040203.1|  PREDICTED: ervatamin-B-like                        318   1e-101   
ref|XP_006470296.1|  PREDICTED: xylem cysteine proteinase 1-like        318   2e-101   
ref|XP_007132821.1|  hypothetical protein PHAVU_011G127300g             317   2e-101   
dbj|BAG16370.1|  cysteine protease                                      317   3e-101   
emb|CDY08128.1|  BnaA06g15980D                                          317   3e-101   
ref|XP_010054325.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    321   4e-101   
ref|XP_004487577.1|  PREDICTED: vignain-like isoform X1                 316   5e-101   
ref|XP_004293931.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    316   8e-101   
ref|XP_008368206.1|  PREDICTED: zingipain-2-like                        316   8e-101   
ref|XP_008225219.1|  PREDICTED: ervatamin-C-like                        316   9e-101   
ref|XP_007211535.1|  hypothetical protein PRUPE_ppa008267mg             315   1e-100   
ref|XP_010054318.1|  PREDICTED: ervatamin-B-like                        315   2e-100   
ref|XP_009352795.1|  PREDICTED: ervatamin-B-like                        315   2e-100   
gb|KCW76118.1|  hypothetical protein EUGRSUZ_D00495                     315   2e-100   
gb|KDO77830.1|  hypothetical protein CISIN_1g043883mg                   315   3e-100   
ref|XP_008364021.1|  PREDICTED: ervatamin-B-like                        315   4e-100   
ref|XP_003624097.1|  Cysteine protease                                  314   4e-100   
ref|XP_010057075.1|  PREDICTED: ervatamin-B-like                        314   4e-100   
ref|XP_010054326.1|  PREDICTED: zingipain-2-like                        316   7e-100   
ref|XP_010040202.1|  PREDICTED: zingipain-2-like                        313   1e-99    
ref|XP_007025397.1|  Senescence-associated gene 12, putative            312   1e-99    
ref|XP_008345990.1|  PREDICTED: zingipain-2-like                        313   1e-99    
ref|XP_008226299.1|  PREDICTED: macrodontain-1-like                     313   1e-99    
ref|XP_008383642.1|  PREDICTED: zingipain-1-like                        313   1e-99    
ref|XP_010040207.1|  PREDICTED: ervatamin-B-like                        313   1e-99    
gb|KCW45396.1|  hypothetical protein EUGRSUZ_L00916                     312   2e-99    
ref|XP_004981743.1|  PREDICTED: cysteine proteinase EP-B 1-like         312   3e-99    
ref|XP_008228971.1|  PREDICTED: zingipain-2-like                        311   3e-99    
ref|XP_009774957.1|  PREDICTED: vignain-like                            312   3e-99    
ref|XP_003607546.1|  Cysteine proteinase                                311   4e-99    
gb|KDO47943.1|  hypothetical protein CISIN_1g048276mg                   311   5e-99    
ref|XP_009617207.1|  PREDICTED: vignain-like                            312   5e-99    
ref|XP_011100224.1|  PREDICTED: zingipain-2                             311   6e-99    
ref|XP_007214244.1|  hypothetical protein PRUPE_ppa023515mg             311   9e-99    
ref|XP_002881320.1|  hypothetical protein ARALYDRAFT_321132             310   9e-99    
ref|XP_007132871.1|  hypothetical protein PHAVU_011G131700g             308   9e-99    
gb|KDO63025.1|  hypothetical protein CISIN_1g018958mg                   311   1e-98    
ref|XP_008229136.1|  PREDICTED: zingipain-2                             310   1e-98    
gb|ABR16787.1|  unknown                                                 311   2e-98    
ref|XP_004487578.1|  PREDICTED: vignain-like isoform X2                 310   2e-98    
ref|XP_009352948.1|  PREDICTED: ervatamin-B-like                        311   2e-98    



>dbj|BAF46311.1| cysteine proteinase precursor [Ipomoea nil]
Length=339

 Score =   411 bits (1056),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 216/346 (62%), Positives = 257/346 (74%), Gaps = 8/346 (2%)
 Frame = -1

Query  1216  MVSRLIKNLIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAK  1037
             M S  +K LI  A + A  +  A S   L    D +M  RHE WMA+YGRVY +E EK K
Sbjct  1     MASNSLKLLIALALVFATSAYLATSRTLL----DSLMAVRHEQWMAQYGRVYKNEVEKTK  56

Query  1036  RFSIFKENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPF  857
             R++IFKENV+ IESFN+AG +PY LGIN FADLTN EF++++NGY   + P     + PF
Sbjct  57    RYNIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGY---ILPHECSSNTPF  113

Query  856   RYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQEL  677
             RYENV+ +P+ VDWRK+GAVTPVK+QG CGCCWAFSAVAA+EGI K+S G L+SLSEQEL
Sbjct  114   RYENVSAVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQEL  173

Query  676   VdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAG  497
             VDCD  G D GC GG MDDAF +II + GLTTES YPY G D G C  + +S  AAKI+G
Sbjct  174   VDCDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTD-GSCKKSKSSNSAAKISG  232

Query  496   YEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTG  317
             YEDVP NSE+AL +A A+QPVSVAIDA G   QFY+ GVFT  CGTEL+HGVT VGYG  
Sbjct  233   YEDVPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIA  292

Query  316   ERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             E G KYWL+KNSWG  WGE GY R+Q+DI+AKEG CGIA+  SYP+
Sbjct  293   EDGSKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPS  338



>ref|XP_002523447.1| cysteine protease, putative [Ricinus communis]
 gb|EEF38906.1| cysteine protease, putative [Ricinus communis]
Length=342

 Score =   410 bits (1053),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 212/345 (61%), Positives = 258/345 (75%), Gaps = 4/345 (1%)
 Frame = -1

Query  1213  VSRLIKNLIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKR  1034
             ++ + +N ++F A+L     A+++        D  M +RHE WMA+YGRVY D +EK +R
Sbjct  1     MATVSENKLMFVALLVVGLWASQAWS--RSLHDAAMNERHEMWMAKYGRVYKDNSEKERR  58

Query  1033  FSIFKENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFR  854
             F IF+ NV+ IESFN+ G+RPY L INEFADLTN+EF  +KNGYKR        +S  FR
Sbjct  59    FEIFRNNVEFIESFNKLGNRPYKLDINEFADLTNEEFKVSKNGYKRSSGVGLTEKS-SFR  117

Query  853   YENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELV  674
             Y NVT +P+++DWR+ GAVTP+K+QG CGCCWAFSAVAA+EGI K+S G+L+SLSEQELV
Sbjct  118   YANVTAVPTSMDWRQNGAVTPIKDQGQCGCCWAFSAVAAMEGITKLSTGKLISLSEQELV  177

Query  673   dcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGY  494
             DCD  G D GC GG MDDAF++I ++ GLTTE+ YPY G D G CN   A   AAKI GY
Sbjct  178   DCDTSGEDQGCEGGLMDDAFEFIKQNGGLTTEANYPYQGTD-GTCNTNKAGNDAAKITGY  236

Query  493   EDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGE  314
             EDVP NSE ALL+A A QPVSVAIDA G   QFY+GGVFT  CGTEL+HGVT VGYGT +
Sbjct  237   EDVPANSEDALLKAVASQPVSVAIDASGSAFQFYSGGVFTGDCGTELDHGVTAVGYGTSD  296

Query  313   RGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
              G KYWL+KNSWG  WGEDGY R++RDI+AKEG CGIA+ PSYPT
Sbjct  297   DGTKYWLVKNSWGTSWGEDGYIRMERDIEAKEGLCGIAMQPSYPT  341



>ref|XP_010045985.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW84687.1| hypothetical protein EUGRSUZ_B01504 [Eucalyptus grandis]
Length=342

 Score =   404 bits (1039),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 208/346 (60%), Positives = 255/346 (74%), Gaps = 7/346 (2%)
 Frame = -1

Query  1216  MVSRLIKNLI-VFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKA  1040
             M S L+  L+ V  A+L   +  A+S     E  +  M +RH+ WMAR+GRVY D+ EK 
Sbjct  1     MASPLVGKLVLVMVAVLGLWASQARS----RELHEATMRERHDQWMARHGRVYQDDAEKE  56

Query  1039  KRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMP  860
             +RFSIFK NV  +ESFN+ G++PYTL IN FADLT +EF +++NGY R  SPR    + P
Sbjct  57    RRFSIFKNNVDLVESFNKNGNKPYTLAINAFADLTIEEFKASRNGYMRSSSPRQV-STKP  115

Query  859   FRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQE  680
             FRYENVT +PS++DWRK+GAVTP+KNQG CG CWAFSAV A+EGI++++ G+L+SLSEQE
Sbjct  116   FRYENVTAVPSSMDWRKKGAVTPIKNQGQCGSCWAFSAVGAMEGIIQLTTGKLISLSEQE  175

Query  679   LVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIA  500
             LVDCD  G D GC GG MDDAFK+II  +GLTTE+ YPY   D G CN   A+  AAKI 
Sbjct  176   LVDCDTSGKDHGCEGGYMDDAFKFIIGRHGLTTETNYPYQAVD-GTCNARKANSSAAKIT  234

Query  499   GYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGT  320
             GY DVP N+E+ALL+A  HQPVSVAIDA     QFY+ G+FT  CGT L+HGVT VGYGT
Sbjct  235   GYADVPANNESALLKAVGHQPVSVAIDAGEWAFQFYSSGIFTGECGTNLDHGVTAVGYGT  294

Query  319   GERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYP  182
              E G KYWL+KNSWG  WGE GY R++RDIDAKEG CGIA+  S+P
Sbjct  295   SENGTKYWLVKNSWGTGWGEKGYIRMKRDIDAKEGLCGIAMMASFP  340



>ref|XP_010091034.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 ref|XP_010091036.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXC36678.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXC36680.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=343

 Score =   404 bits (1037),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 208/343 (61%), Positives = 255/343 (74%), Gaps = 7/343 (2%)
 Frame = -1

Query  1201  IKNLIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIF  1022
             ++   +F ++L     AA +      +D + M +RHE WMARYGR Y D++EK KRF IF
Sbjct  5     LQKTSIFVSLLVLGMWAALANGRALHEDANSMSERHEQWMARYGRTYKDDSEKEKRFQIF  64

Query  1021  KENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPR--NPWRSMPFRYE  848
             K NV+ IES N+AG++PY LGINEFAD TN+EF +++NGYKR   PR  NP     FRYE
Sbjct  65    KSNVEYIESVNKAGNKPYKLGINEFADQTNEEFRASRNGYKRSPIPRPINP----SFRYE  120

Query  847   NVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdc  668
             +VT +PS+VDWRK+GAVTPVK+QG CGCCWAFSAVAA+EGI +++ G+L+SLSEQELVDC
Sbjct  121   SVTKVPSSVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITQLTTGKLISLSEQELVDC  180

Query  667   dkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYED  488
             D  G D GC GG MDDAF +I+ + GLTTES YPY G D   CN   AS  AA I G+ED
Sbjct  181   DTSGTDQGCEGGLMDDAFDFILGNEGLTTESKYPYKGVDE-TCNKKKASSHAASITGHED  239

Query  487   VPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERG  308
             VP NSE AL +A A+QPVSVAIDA G   Q Y+ GVFT  CGTEL+HGVT VGYG  E G
Sbjct  240   VPANSEKALQKAVANQPVSVAIDAGGSDFQLYSSGVFTGECGTELDHGVTAVGYGKTEDG  299

Query  307   IKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
              KYWL+KNSWG  WGE+GY R++RD+DA+EG CGIA++ SYP+
Sbjct  300   TKYWLVKNSWGSSWGEEGYIRMERDVDAEEGLCGIAMEASYPS  342



>gb|AAK27968.1|AF242372_1 cysteine protease [Ipomoea batatas]
Length=339

 Score =   402 bits (1034),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 207/313 (66%), Positives = 242/313 (77%), Gaps = 4/313 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D +M  RHE WMA+YGRVY  E EK KRF+IFKENV+ IESFN+AG +PY LGIN FADL
Sbjct  30    DSLMVVRHEQWMAQYGRVYKTEAEKTKRFNIFKENVEYIESFNKAGTKPYKLGINAFADL  89

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN EF +++NGYK P    +   + PFRYENV+ +P+ VDWR +GAVTPVK+QG CGCCW
Sbjct  90    TNQEFKASRNGYKLP---HDCSSNTPFRYENVSSVPTTVDWRTKGAVTPVKDQGQCGCCW  146

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA+EGI K+S G L+SLSEQELVDCD  G D GC GG MDDAF +II + GLTTE
Sbjct  147   AFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGTDQGCEGGLMDDAFSFIINNKGLTTE  206

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             S YPY G D G C  + +S  AAKI+GYEDVP NSE+AL +A A+QPVSVAIDA G   Q
Sbjct  207   SNYPYQGTD-GSCKKSKSSNSAAKISGYEDVPANSESALEKAVANQPVSVAIDAGGSDFQ  265

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY+ GVFT  CGTEL+HGVT VGYG  E G KYWL+KNSWG  WGE GY R+Q+DI+AKE
Sbjct  266   FYSSGVFTGECGTELDHGVTAVGYGIAEDGSKYWLVKNSWGTSWGEKGYIRMQKDIEAKE  325

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYP+
Sbjct  326   GLCGIAMQSSYPS  338



>gb|AAL14199.1| cysteine proteinase precursor [Ipomoea batatas]
 gb|AAK15148.2| cysteine proteinase-like protein [Ipomoea batatas]
Length=341

 Score =   402 bits (1034),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 207/313 (66%), Positives = 243/313 (78%), Gaps = 4/313 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D +M  RHE WMA+YGRVY +E EK KRF+IFKENV+ IESFN+AG +PY LGIN FADL
Sbjct  32    DSLMVVRHEQWMAQYGRVYENEVEKTKRFNIFKENVEYIESFNKAGTKPYKLGINAFADL  91

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN EF +++NGYK P    +   + PFRYENV+ +P+ VDWR +GAVTPVK+QG CGCCW
Sbjct  92    TNQEFKASRNGYKLP---HDCSSNTPFRYENVSSVPTTVDWRTKGAVTPVKDQGQCGCCW  148

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA+EGI K+S G L+SLSEQELVDCD  G D GC GG MDDAF +II + GLTTE
Sbjct  149   AFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFSFIINNKGLTTE  208

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             S YPY G D G C  + +S  AAKI+GYEDVP NSE+AL +A A+QPVSVAIDA G   Q
Sbjct  209   SNYPYQGTD-GSCKKSKSSNSAAKISGYEDVPANSESALEKAVANQPVSVAIDAGGSDFQ  267

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY+ GVFT  CGTEL+HGVT VGYG  E G KYWL+KNSWG  WGE GY R+Q+DI+AKE
Sbjct  268   FYSSGVFTGECGTELDHGVTAVGYGIAEDGSKYWLVKNSWGTSWGEKGYIRMQKDIEAKE  327

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYP+
Sbjct  328   GLCGIAMQSSYPS  340



>ref|XP_010045986.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW84688.1| hypothetical protein EUGRSUZ_B01505 [Eucalyptus grandis]
Length=342

 Score =   401 bits (1031),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 209/347 (60%), Positives = 256/347 (74%), Gaps = 7/347 (2%)
 Frame = -1

Query  1216  MVSRLIKNLI-VFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKA  1040
             M S L+  L+ V  AIL   +   +S     E     M +RHE WMAR+G VY D+ EK 
Sbjct  1     MASTLVGKLVLVMVAILGLWASQVRS----RELHKATMRQRHEQWMARHGWVYQDDAEKE  56

Query  1039  KRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMP  860
             +RFSIFK NV  IESFN+ G++PYTL IN FADLT +EF +++NGYKR  SPR    + P
Sbjct  57    RRFSIFKNNVDFIESFNKDGNKPYTLAINAFADLTIEEFKASRNGYKRSSSPRQV-STKP  115

Query  859   FRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQE  680
             FRYE+VT +PS++DWRK+GAVTP+K+QG CG CWAFSAV A+EG  +++ G+L+SLSEQE
Sbjct  116   FRYEHVTAVPSSMDWRKKGAVTPIKDQGQCGSCWAFSAVGAMEGNNQLTTGKLISLSEQE  175

Query  679   LVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIA  500
             LVDCD  G D GC GG MD+AF++II ++GLTTE+ YPY   D G CN    +  AAKI 
Sbjct  176   LVDCDTSGEDQGCEGGFMDNAFEFIIGNHGLTTETNYPYQAVD-GTCNARKEASSAAKIT  234

Query  499   GYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGT  320
             GYEDVP NSE+ALL+A AHQPVSVAIDA     QFY+ G+FT  CGT L+HGVT VGYGT
Sbjct  235   GYEDVPANSESALLKAVAHQPVSVAIDAGESAFQFYSSGIFTGECGTNLDHGVTAVGYGT  294

Query  319   GERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
              E G KYWL+KNSWG  WGE+GY R++RDIDAKEG CGIA++ SYPT
Sbjct  295   SEDGTKYWLVKNSWGTGWGEEGYIRMKRDIDAKEGLCGIAMEASYPT  341



>ref|XP_010099379.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXB78104.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=348

 Score =   400 bits (1028),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 201/314 (64%), Positives = 241/314 (77%), Gaps = 1/314 (0%)
 Frame = -1

Query  1120  DDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFAD  941
             D   ++ RHE+WM+R+G VY D  EKAKRF IFKENV  IE+FN+A  +PY LGIN+FAD
Sbjct  35    DASTLKIRHEEWMSRHGIVYKDADEKAKRFEIFKENVARIEAFNRAAIKPYKLGINKFAD  94

Query  940   LTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCC  761
             LTN+EF++ +N +K  V       S  F+YENVT +PSA+DWRK+GAVTPVK+QG CGCC
Sbjct  95    LTNEEFITKRNKFKAHVCDSGRAISTSFKYENVTSVPSALDWRKKGAVTPVKDQGQCGCC  154

Query  760   WAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTT  581
             WAFS VAA+EGI K+S G+L+SLSEQELVDCD  G D GC+GG MD+AFK+I  + GLTT
Sbjct  155   WAFSTVAAMEGITKLSTGKLLSLSEQELVDCDVKGEDQGCNGGLMDEAFKFIQHNGGLTT  214

Query  580   ESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQL  401
             E+ YPY G D G CN    +  AAKI GYEDVP NSE  LL+A  HQPVSVAIDA G + 
Sbjct  215   EANYPYEGVD-GTCNAKKEATHAAKITGYEDVPANSEKDLLKAVTHQPVSVAIDASGFEF  273

Query  400   QFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAK  221
             QFY+GGVFT  CGT L+HGVT VGYG  + G KYWL+KNSWG++WGE GY R+QRD+DAK
Sbjct  274   QFYSGGVFTGACGTNLDHGVTAVGYGATKDGTKYWLVKNSWGKQWGEKGYIRMQRDVDAK  333

Query  220   EGRCGIALDPSYPT  179
             EG CGIA+  SYPT
Sbjct  334   EGLCGIAMMASYPT  347



>ref|XP_002523448.1| cysteine protease, putative [Ricinus communis]
 gb|EEF38907.1| cysteine protease, putative [Ricinus communis]
Length=341

 Score =   400 bits (1027),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 204/313 (65%), Positives = 244/313 (78%), Gaps = 3/313 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M +RHE WM +YGRVY D +EK +RF IF+ NV+ IESFN+ G+RPY L INEFADL
Sbjct  31    DAAMNERHEMWMVKYGRVYKDNSEKERRFEIFRNNVEFIESFNKPGNRPYKLDINEFADL  90

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF +++NGYKR  +     +S  FRY NVT +P+++DWR++GAVTP+K+QG CGCCW
Sbjct  91    TNEEFKASRNGYKRSSNVGLSEKS-SFRYGNVTAVPTSMDWRQKGAVTPIKDQGQCGCCW  149

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA+EGI K+S G+L+SLSEQELVDCD  G D GC GG MDDAF++I ++ GLTTE
Sbjct  150   AFSAVAAMEGITKLSTGKLISLSEQELVDCDTSGEDQGCEGGLMDDAFEFIKQNGGLTTE  209

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D G CN   A   AAKI GYEDVP NSE ALL+A A QPVSVAIDA G   Q
Sbjct  210   ANYPYQGTD-GTCNTNKAGNDAAKITGYEDVPANSEDALLKAVASQPVSVAIDASGSAFQ  268

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY+GGVFT  CGTEL+HGVT VGYGT + G KYWL+KNSWG  WGEDGY R++RDI+AKE
Sbjct  269   FYSGGVFTGDCGTELDHGVTAVGYGTSD-GTKYWLVKNSWGTSWGEDGYIRMERDIEAKE  327

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYPT
Sbjct  328   GLCGIAMQSSYPT  340



>gb|AFV30165.1| cysteine proteinase [Lotus japonicus]
Length=342

 Score =   400 bits (1027),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 203/313 (65%), Positives = 237/313 (76%), Gaps = 3/313 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M++RHE WMARYGRVY D  EK KRFSIFKENV  IE+ N AGD+PY LG+N+FADL
Sbjct  32    DASMQERHEQWMARYGRVYKDLQEKEKRFSIFKENVNYIEASNNAGDKPYKLGVNQFADL  91

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF++T+N +K  +S     R+  F+YENVT  PS VDWR+EGAVTPVKNQG CGCCW
Sbjct  92    TNEEFIATRNKFKGHMSSSIT-RTTTFKYENVT-APSTVDWRQEGAVTPVKNQGTCGCCW  149

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA EGI K+S G LVSLSEQELVDCD  G D GC GG MDDAFK+II++ GL TE
Sbjct  150   AFSAVAATEGIHKLSTGNLVSLSEQELVDCDTSGADQGCQGGLMDDAFKFIIQNGGLNTE  209

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D G CN    +   A I GYEDVP N+E AL QA A+QP+S+AIDA G   Q
Sbjct  210   AQYPYQGVD-GTCNTNEEATHVATITGYEDVPSNNEQALQQAVANQPISIAIDASGSDFQ  268

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
              Y  GVFT  CGT+L+HGV VVGYG  + G KYWL+KNSWG  WGE+GY R+QRD+DA E
Sbjct  269   NYQSGVFTGSCGTQLDHGVAVVGYGVSDDGTKYWLVKNSWGADWGEEGYIRMQRDVDAPE  328

Query  217   GRCGIALDPSYPT  179
             G CG+A+ PSYPT
Sbjct  329   GLCGLAMQPSYPT  341



>ref|XP_007048796.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92953.1| Senescence-associated gene 12 [Theobroma cacao]
Length=343

 Score =   399 bits (1024),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 200/337 (59%), Positives = 250/337 (74%), Gaps = 10/337 (3%)
 Frame = -1

Query  1189  IVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENV  1010
              +F      C   ++++Q      D  M +RHE WMARYGRVY D  E+ +RF+IFKENV
Sbjct  16    FIFIVGALVCEATSRTLQ------DASMYERHEQWMARYGRVYHDNNEREQRFNIFKENV  69

Query  1009  KAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIP  830
               I+SFN+A D+PY LG+N+FADLTN+EF +++N +K  +      ++  F+YEN+T +P
Sbjct  70    AHIDSFNRAKDKPYKLGVNQFADLTNEEFTASRNRFKGHMCSN---KATTFKYENLTALP  126

Query  829   SAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggd  650
             S VDWRK+GAVTP+K+QG CGCCWAFSAVAA+EG+ K++ G+L+SLSEQELVDCD  G D
Sbjct  127   STVDWRKKGAVTPIKDQGQCGCCWAFSAVAAMEGVTKLTTGKLISLSEQELVDCDTKGED  186

Query  649   lgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSE  470
              GC GG MDDAF++I  + GLTTES YPY G D G CN    +  AAKI G+EDVP NSE
Sbjct  187   QGCQGGLMDDAFQFIQNNKGLTTESDYPYKGVD-GTCNTNKEANHAAKINGFEDVPANSE  245

Query  469   AALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLL  290
              AL +A A+QPVSVAIDA G + QFY+GGVFT  CGT L+HGVT VGYG  + G KYWL+
Sbjct  246   DALQKAVANQPVSVAIDAGGFKFQFYSGGVFTGDCGTALDHGVTAVGYGVDDDGTKYWLV  305

Query  289   KNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             KNSWG  WGE+GY R+QRD+DAKEG CGIA+  SYPT
Sbjct  306   KNSWGTSWGEEGYIRMQRDVDAKEGLCGIAMQASYPT  342



>ref|XP_002522559.1| cysteine protease, putative [Ricinus communis]
 gb|EEF39859.1| cysteine protease, putative [Ricinus communis]
Length=344

 Score =   399 bits (1024),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 208/347 (60%), Positives = 257/347 (74%), Gaps = 6/347 (2%)
 Frame = -1

Query  1213  VSRLIKNLIVFAAILACCSKAAKS-MQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAK  1037
             ++ L+ N +V  A+L     A++S  + L+E     ME RH+ WM +YGRVY    EK K
Sbjct  1     MALLLHNKLVLMAMLLVTLWASQSWSRSLHEAS---MELRHKTWMTQYGRVYKGNVEKEK  57

Query  1036  RFSIFKENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSP-RNPWRSMP  860
             RF IFKENV+ IESFN  G++PY LGIN F DLTN+EF ++ NGY   +S  ++ +R+  
Sbjct  58    RFKIFKENVEFIESFNNNGNKPYKLGINAFTDLTNEEFRASHNGYTMSMSSHQSSYRTKS  117

Query  859   FRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQE  680
             FRYENVT +P ++DWR +GAVT +K+QG CGCCWAFSAVAA+EGI K+S G L+SLSEQE
Sbjct  118   FRYENVTAVPPSLDWRTKGAVTHIKDQGQCGCCWAFSAVAAMEGITKLSTGTLISLSEQE  177

Query  679   LVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIA  500
             LVDCD  G D GC GG MDDAF++II++NGLTTE+ YPY G D G CN   A+  AAKI 
Sbjct  178   LVDCDTSGMDQGCEGGLMDDAFEFIIENNGLTTEANYPYEGVD-GSCNTRKAANHAAKIT  236

Query  499   GYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGT  320
             GYE+VP   E AL +A A+QPVSVAIDA     Q Y+ G+FT  CGTEL+HGVTVVGYGT
Sbjct  237   GYENVPAYDEEALRKAVANQPVSVAIDAGESAFQHYSSGIFTGDCGTELDHGVTVVGYGT  296

Query  319   GERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
              + G KYWL+KNSWG  WGEDGY R++RDIDAKEG CGIA++PSYPT
Sbjct  297   SDDGTKYWLVKNSWGTSWGEDGYIRMERDIDAKEGLCGIAMEPSYPT  343



>ref|XP_011086004.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   397 bits (1020),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 205/337 (61%), Positives = 248/337 (74%), Gaps = 5/337 (1%)
 Frame = -1

Query  1189  IVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENV  1010
             +VFAA+L    +   S        D  M ++HE WMA++GRVY D+ EK+KRF IFKENV
Sbjct  9     LVFAALLVL--EMWGSQATARTLPDAAMIEKHEQWMAQFGRVYKDDAEKSKRFRIFKENV  66

Query  1009  KAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIP  830
             + IESFN+AG RPYTL IN+FADLTN+EF +++NGYK    P++   S  FRY NVT +P
Sbjct  67    EYIESFNEAGARPYTLAINKFADLTNEEFQASRNGYKMGSYPKSSMFS-SFRYANVTAVP  125

Query  829   SAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggd  650
             +++DWRK+GAVT VK+QG CGCCWAFSAVAA EGI +++ G+L+SLSEQELVDCD    +
Sbjct  126   ASMDWRKKGAVTGVKDQGQCGCCWAFSAVAATEGINQLTTGKLISLSEQELVDCDTSEDE  185

Query  649   lgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSE  470
                 G  MD+AF++II + G+TTES YPY G D G CN    S  AAKI GYEDVP NSE
Sbjct  186   GCNGGL-MDNAFEFIISNGGITTESNYPYEGVD-GTCNTKKESSSAAKITGYEDVPANSE  243

Query  469   AALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLL  290
              ALL+A A+QPVSVAIDA G   QFY+ GVFT  CGTEL+HGVT VGYG    G KYWL+
Sbjct  244   PALLKAVANQPVSVAIDASGSDFQFYSSGVFTGDCGTELDHGVTAVGYGKTSDGTKYWLV  303

Query  289   KNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             KNSWG  WGE+GY R+QRDIDA EG CGIA+  SYPT
Sbjct  304   KNSWGTSWGENGYIRMQRDIDAPEGLCGIAMQASYPT  340



>ref|XP_010045988.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=342

 Score =   395 bits (1014),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 208/347 (60%), Positives = 255/347 (73%), Gaps = 7/347 (2%)
 Frame = -1

Query  1216  MVSRLIKNLI-VFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKA  1040
             M S L+  L+ V  AIL   +  A+S     E     M +RHE  MAR+GRVY D+ EK 
Sbjct  1     MASTLVGKLVLVMVAILGLWASQARS----RELHGATMWERHEQRMARHGRVYQDDAEKE  56

Query  1039  KRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMP  860
             +RFSIFK NV  IESFN+ G++PYTL IN F DLT +EF +++NGYKR  SPR    + P
Sbjct  57    RRFSIFKNNVDFIESFNKDGNKPYTLAINAFVDLTIEEFKASRNGYKRSSSPRQV-STKP  115

Query  859   FRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQE  680
             FRYE+VT +PS++DWRK+GAV P+K+QG CG CWAFSAV A+EG  +++ G+L+SLSEQE
Sbjct  116   FRYEHVTAVPSSMDWRKKGAVMPIKDQGQCGSCWAFSAVGAMEGNNQLTTGKLISLSEQE  175

Query  679   LVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIA  500
             LVDCD  G D GC GG MD+AF++II ++GLTTE+ YPY   D G CN    +  AAKI 
Sbjct  176   LVDCDTSGEDQGCEGGFMDNAFEFIIGNHGLTTETNYPYQAVD-GTCNARKEASSAAKIN  234

Query  499   GYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGT  320
             GYEDVP NSE+ALL+A AHQPVSVAIDA     QFY+ G+FT  CGT L+HGVT VGYGT
Sbjct  235   GYEDVPANSESALLKAVAHQPVSVAIDAGESAFQFYSSGIFTGECGTNLDHGVTAVGYGT  294

Query  319   GERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
              E G KYWL+KNSWG  WGE+GY R++RDIDAKEG CGIA++ SYPT
Sbjct  295   SEDGTKYWLVKNSWGTGWGEEGYIRMKRDIDAKEGLCGIAMEASYPT  341



>ref|XP_002280230.2| PREDICTED: LOW QUALITY PROTEIN: senescence-specific cysteine 
protease SAG39 [Vitis vinifera]
Length=341

 Score =   394 bits (1012),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 195/310 (63%), Positives = 242/310 (78%), Gaps = 4/310 (1%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M +RHEDWMA+YGRVY D  EK+KR+ IFK+NV  IESFN+A D+ Y L INEFADLTN+
Sbjct  35    MYERHEDWMAQYGRVYKDADEKSKRYKIFKDNVARIESFNKAMDKSYKLSINEFADLTNE  94

Query  928   EFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFS  749
             EF +++N +K  +       +  F+YENVT +PS +DWRK+GAVTP+K+QG CG CWAFS
Sbjct  95    EFGTSRNRFKAHICST---EATSFKYENVTAVPSTIDWRKKGAVTPIKDQGQCGSCWAFS  151

Query  748   AVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGY  569
             AVAA+EGI ++S G+L+SLSEQELVDCD  G D GC+GG MDDAFK+I +++GLTTE+ Y
Sbjct  152   AVAAMEGITQLSTGKLISLSEQELVDCDTSGEDQGCNGGLMDDAFKFIKQNHGLTTEANY  211

Query  568   PYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYA  389
             PY G D G CN   A+  AAKI GYEDVP N+E AL +A  HQP++VAIDA G + QFY+
Sbjct  212   PYAGTD-GTCNRKKAAHPAAKINGYEDVPANNEKALQKAVVHQPIAVAIDAGGFEFQFYS  270

Query  388   GGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRC  209
              GVFT +CGTEL+HGV  VGYGT + G+KYWL+KNSWG  WGE+GY R+QRD+ AKEG C
Sbjct  271   SGVFTGQCGTELDHGVAAVGYGTSDDGMKYWLVKNSWGTGWGEEGYIRMQRDVTAKEGLC  330

Query  208   GIALDPSYPT  179
             GIA+  SYPT
Sbjct  331   GIAMQASYPT  340



>ref|XP_007048674.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92831.1| Senescence-associated gene 12 [Theobroma cacao]
Length=344

 Score =   394 bits (1012),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 199/313 (64%), Positives = 238/313 (76%), Gaps = 4/313 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M +RHE WMA+YGRVY D  +K KRF IFKENV  I++FN A  +PY LGIN+FADL
Sbjct  35    DSAMYERHEQWMAQYGRVYKDSNDKEKRFKIFKENVARIDAFNTANGKPYKLGINQFADL  94

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF +++N +K  +       +  F+YENVT +PSA+DWR++GAVTPVK+QG CGCCW
Sbjct  95    TNEEFTASRNRFKGHMCSNT---AASFKYENVTAVPSAMDWRQKGAVTPVKDQGQCGCCW  151

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA+EGI  I+ G+L+SLSEQELVDCD  G D GC GG MDDAFK+I K  GLTTE
Sbjct  152   AFSAVAAMEGINMITTGKLISLSEQELVDCDTKGEDQGCQGGLMDDAFKFIQKIQGLTTE  211

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D G CN    +  AAKI GYEDVP NSE  LL+A A+QPVSVAIDA G + Q
Sbjct  212   TDYPYRGVD-GTCNTNKEANHAAKINGYEDVPANSETVLLKAVANQPVSVAIDAGGFEFQ  270

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY+GG+FT  C T+L+HGVT VGYG G+ G KYWL+KNSWG  WGE GY R+QRD+DAKE
Sbjct  271   FYSGGIFTGACETQLDHGVTAVGYGVGDDGTKYWLVKNSWGTSWGEKGYIRMQRDVDAKE  330

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYPT
Sbjct  331   GLCGIAMAASYPT  343



>ref|XP_002316833.2| hypothetical protein POPTR_0011s07520g [Populus trichocarpa]
 gb|EEE97445.2| hypothetical protein POPTR_0011s07520g [Populus trichocarpa]
Length=362

 Score =   394 bits (1013),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 211/368 (57%), Positives = 265/368 (72%), Gaps = 12/368 (3%)
 Frame = -1

Query  1279  IPHHP*SSIQIHSPFLQQETKMVSRLIKNLIVFAAILACCSKAAKS-MQGLNEDDDDVME  1103
             I  HP  +I  +S  L   ++M + + +N ++FA +L      +    + L E     M 
Sbjct  5     ISSHP--TILAYSHNLAHFSRM-AFIPENKLIFAVVLLLGLWTSHVWSRSLYEAS---MM  58

Query  1102  KRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTNDEF  923
             +RHE WMA+YGR Y    EK +R +IFK NV+ IESFN+ G +PY L +NEFADLTN+EF
Sbjct  59    ERHETWMAQYGRAYKGHVEKERRLNIFKNNVEFIESFNKVGKKPYKLSVNEFADLTNEEF  118

Query  922   VSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAV  743
              +++NGYK      +   + PFRYENV+ +PS +DWRK+GAVTP+K+QG CGCCWAFSAV
Sbjct  119   QASRNGYKMSAHLSSS-STKPFRYENVSAVPSTMDWRKKGAVTPIKDQGQCGCCWAFSAV  177

Query  742   AAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPY  563
             AA EGI ++S G+L+SLSEQELVDCD  G D GC+GG MDDAF +II++ GLTTE+ YPY
Sbjct  178   AATEGITQLSTGKLISLSEQELVDCDTSGEDQGCNGGLMDDAFDFIIQNKGLTTEANYPY  237

Query  562   GGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGG  383
              G D G CN   A   AAKI GYEDVP NSEAALL+A A+QPVSVAIDA G   QFY+ G
Sbjct  238   QGAD-GACNSGKA---AAKITGYEDVPANSEAALLKAVANQPVSVAIDAGGSAFQFYSSG  293

Query  382   VFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGI  203
             VFT  CGT+L+HGVT VGYG  + G KYWL+KNSWG  WGE+GY R++RDIDA+EG CGI
Sbjct  294   VFTGDCGTDLDHGVTAVGYGMSDDGTKYWLVKNSWGTSWGENGYIRMERDIDAQEGLCGI  353

Query  202   ALDPSYPT  179
             A++ SYPT
Sbjct  354   AMEASYPT  361



>ref|XP_011045912.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=362

 Score =   394 bits (1013),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 198/310 (64%), Positives = 241/310 (78%), Gaps = 5/310 (2%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M +RHE WMA+YGR Y D  EK +R + FK NV+ IESFN+ G +PY L +NEFADL N+
Sbjct  57    MMERHETWMAQYGRAYKDRVEKERRLNTFKNNVEFIESFNKDGKKPYKLSVNEFADLMNE  116

Query  928   EFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFS  749
             EF +++NGYK P    +   + PFRYEN++ +PS +DWRK+GAVTP+K+QG CGCCWAFS
Sbjct  117   EFRASRNGYKMPAHLSSS-STNPFRYENISAVPSTMDWRKKGAVTPIKDQGQCGCCWAFS  175

Query  748   AVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGY  569
             AVAA EGI ++S G+L+SLSEQELVDCD  G D GC+GG MDDAF++II++ GLTTE+ Y
Sbjct  176   AVAATEGITQLSTGKLISLSEQELVDCDTSGEDQGCNGGFMDDAFEFIIQNKGLTTEANY  235

Query  568   PYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYA  389
             PY G D G CN   A   AAKI GYEDVP NSEAALL+A A+QPVSVAIDA G   QFY+
Sbjct  236   PYQGAD-GTCNSGKA---AAKITGYEDVPANSEAALLKAVANQPVSVAIDAGGSAFQFYS  291

Query  388   GGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRC  209
              GVFT  CGT+L+HGVT VGYG  + G KYWL+KNSWG  WGE+GY R++RDIDAKEG C
Sbjct  292   SGVFTGDCGTDLDHGVTAVGYGMSDDGTKYWLVKNSWGTSWGENGYIRMERDIDAKEGLC  351

Query  208   GIALDPSYPT  179
             GIA++ SYPT
Sbjct  352   GIAMEASYPT  361



>dbj|BAF56427.1| cysteine proteinase [Lotus japonicus]
Length=342

 Score =   394 bits (1011),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 201/313 (64%), Positives = 235/313 (75%), Gaps = 3/313 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M +RHE WMARYG+VY D  EK KRF+IF+ENVK IE+ N AG++PY LG+N+F DL
Sbjct  32    DASMHERHEQWMARYGKVYKDLQEKEKRFNIFQENVKYIEASNNAGNKPYKLGVNQFTDL  91

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN EF++T+N +K  +S     R+  F+YENVT  PS VDWR+EGAVTPVKNQG CGCCW
Sbjct  92    TNKEFIATRNKFKGHMSSSIT-RTTTFKYENVT-APSTVDWRQEGAVTPVKNQGTCGCCW  149

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA EGI K+S G LVSLSEQELVDCD  G D GC GG MDDAFK+II++ GL TE
Sbjct  150   AFSAVAATEGIHKLSTGNLVSLSEQELVDCDTSGADQGCQGGLMDDAFKFIIQNGGLNTE  209

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D G CN        A I GYEDVP N+E AL QA A+QP+SVAIDA G   Q
Sbjct  210   AQYPYQGVD-GTCNTNEEVTHVATITGYEDVPSNNEQALQQAVANQPISVAIDASGSDFQ  268

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
              Y  GVFT  CGT+L+HGV VVGYG  + G KYWL+KNSWGE WGE+GY R+QRD++A E
Sbjct  269   NYQSGVFTGSCGTQLDHGVAVVGYGVSDDGTKYWLVKNSWGEDWGEEGYIRMQRDVEAPE  328

Query  217   GRCGIALDPSYPT  179
             G CGIA+ PSYPT
Sbjct  329   GLCGIAMQPSYPT  341



>ref|XP_010045987.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=364

 Score =   394 bits (1013),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 202/314 (64%), Positives = 244/314 (78%), Gaps = 4/314 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M +RHE WMAR+GRVY D  EK + FSIFK  V+ IESFNQ G++PY L IN FADL
Sbjct  53    DATMRERHEQWMARHGRVYEDAAEKERCFSIFKTTVEYIESFNQDGNKPYKLAINAFADL  112

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSM-PFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCC  761
             T++EF +++ GYKR  S R    SM PF+YE+VT IPS++DWRK+GAVTP+K+QG CGC 
Sbjct  113   TSEEFKASRTGYKRSSSLRAA--SMKPFQYESVTAIPSSMDWRKKGAVTPIKDQGQCGCR  170

Query  760   WAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTT  581
             WAFSAVAA+EGI +++ G+L SLSEQELVDCD+ G D GC GG MDDAF++II ++GLTT
Sbjct  171   WAFSAVAAMEGITQLTTGKLTSLSEQELVDCDRSGEDQGCGGGLMDDAFQFIISNHGLTT  230

Query  580   ESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQL  401
             E+ YPY   D   CN   A+  AAKI+GYEDVP NSE+ALL+A AHQPVSVAIDA     
Sbjct  231   EANYPYQAVD-NTCNARKAASTAAKISGYEDVPSNSESALLKAVAHQPVSVAIDAGETDF  289

Query  400   QFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAK  221
             QFY+ G+FT  CGT+L+HGVT VGYGT E G KYWL+KNSWG  WGE+GY R+QRDIDA 
Sbjct  290   QFYSTGIFTGECGTDLDHGVTAVGYGTSENGTKYWLVKNSWGTGWGEEGYIRMQRDIDAA  349

Query  220   EGRCGIALDPSYPT  179
             EG CGIA++ SYPT
Sbjct  350   EGLCGIAMEASYPT  363



>ref|XP_006360707.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score =   393 bits (1010),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 202/338 (60%), Positives = 245/338 (72%), Gaps = 8/338 (2%)
 Frame = -1

Query  1189  IVFAAILACCSKAAKSM-QGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKEN  1013
             + F A+L    +A+++  +GL E     M ++HE WM  +GRVY D+ EKAKRF+IFK+N
Sbjct  9     LAFVALLVLGMQASQATSRGLYETS---MVQKHEQWMTHFGRVYKDDVEKAKRFNIFKDN  65

Query  1012  VKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDI  833
              K I S N+AG +PY L INEFADLTN+EF +T+NGYK P   ++P     F+YENVT  
Sbjct  66    TKYINSVNKAGIKPYKLDINEFADLTNEEFRATRNGYKMPSQKKSP-EITSFKYENVT-A  123

Query  832   PSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkggg  653
             P+ +DWR +GAVT +KNQG CGCCWAFSAVAA EGI KI  G+L+SLSEQELVDCD    
Sbjct  124   PATMDWRLKGAVTGIKNQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTSSD  183

Query  652   dlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNS  473
                  G  MDDAFK+IIK++GLTTES YPY G D G C     S  AAKI  YEDVP NS
Sbjct  184   MGCEGGL-MDDAFKFIIKNHGLTTESNYPYEGTD-GTCKTGKESSHAAKITSYEDVPANS  241

Query  472   EAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWL  293
             E+ALL+A A+QPVSVAIDA G   QFY+ GVFT  CGTEL+HGVT VGYG    G KYWL
Sbjct  242   ESALLKAVANQPVSVAIDASGSDFQFYSSGVFTGECGTELDHGVTAVGYGEASDGTKYWL  301

Query  292   LKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             +KNSWG  WGE+GY R+QR++D +EG CGIA++ SYPT
Sbjct  302   VKNSWGTSWGENGYIRMQRNVDTEEGLCGIAMEASYPT  339



>ref|XP_009775915.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=340

 Score =   393 bits (1009),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 207/338 (61%), Positives = 242/338 (72%), Gaps = 8/338 (2%)
 Frame = -1

Query  1189  IVFAAILACCSKAAKSM-QGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKEN  1013
             + F A+L     A+++  + LNE     M ++HE WMAR+GRVY D+ EKAKR  IFK N
Sbjct  9     LAFVALLVLGMWASQTTSRDLNEAS---MVQKHEYWMARFGRVYRDDAEKAKRLKIFKNN  65

Query  1012  VKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDI  833
             V  IES N+AG RPY LGINEFADLTN+EF +T NGYK   S +   +++ FRYENVT  
Sbjct  66    VDYIESVNKAGIRPYKLGINEFADLTNEEFRATHNGYKMS-SHQKSSKTISFRYENVT-A  123

Query  832   PSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkggg  653
             P+ +DWR +GAVT VK+QG CGCCWAFSAVAA EGI KI  G+L+SLSEQELVDCD    
Sbjct  124   PATIDWRTKGAVTGVKDQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTSSD  183

Query  652   dlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNS  473
                  G  MDDAF +IIK++GLTTES YPY G D G C     S   AKI GYEDVP NS
Sbjct  184   MGCEGGL-MDDAFTFIIKNHGLTTESNYPYEGTD-GTCKTRKESNHVAKITGYEDVPANS  241

Query  472   EAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWL  293
             E+ALL A A+QPVSVAIDA G   QFY+ GVFT  CGTEL+HGVT +GYG    G KYWL
Sbjct  242   ESALLSAVANQPVSVAIDASGSDFQFYSSGVFTGECGTELDHGVTAIGYGKTSDGTKYWL  301

Query  292   LKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             +KNSWG  WGE+GY R+QRDIDA EG CGIA+  SYPT
Sbjct  302   VKNSWGTSWGENGYIRMQRDIDAAEGTCGIAMQASYPT  339



>ref|XP_007048792.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92949.1| Senescence-associated gene 12 [Theobroma cacao]
Length=343

 Score =   392 bits (1007),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 197/337 (58%), Positives = 249/337 (74%), Gaps = 10/337 (3%)
 Frame = -1

Query  1189  IVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENV  1010
              +F      C   ++++Q      D  M +RHE WMARYGRVY D  E+ +RF+IFKENV
Sbjct  16    FIFIVGALVCEATSRTLQ------DASMYERHEQWMARYGRVYQDNNEREQRFNIFKENV  69

Query  1009  KAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIP  830
               I+SFN+A D+PY LG+N+FADLTNDEF +++N +K  +      ++  F+YENVT +P
Sbjct  70    ARIDSFNRAKDKPYKLGVNQFADLTNDEFTASRNRFKGHMCSN---QATTFKYENVTALP  126

Query  829   SAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggd  650
             S +DWRK+GAVTP+K+QG CG CWAFSAVAA+EG+ K++ G+L+SLSEQELVDCD  G D
Sbjct  127   STMDWRKKGAVTPIKDQGQCGSCWAFSAVAAMEGVTKLTTGKLISLSEQELVDCDTKGDD  186

Query  649   lgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSE  470
              GC GG MDDAF++I  + GLTTES YPY G D G+CN    +  AA I G+EDVP N+E
Sbjct  187   QGCQGGLMDDAFQFIQNNKGLTTESDYPYKGVD-GKCNTNKEANHAANINGHEDVPANNE  245

Query  469   AALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLL  290
              AL +A A+QPVSVAIDA G + QFY+ GVFT  CGT+L+HGVT VGYG  + G KYWL+
Sbjct  246   EALHKAVANQPVSVAIDAGGYEFQFYSSGVFTGDCGTDLDHGVTAVGYGADDDGTKYWLV  305

Query  289   KNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             KNSWG  WGE+GY R+QRD+DAKEG CGIA+  SYPT
Sbjct  306   KNSWGTSWGEEGYIRMQRDVDAKEGLCGIAMQASYPT  342



>emb|CDP18645.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   392 bits (1007),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 190/314 (61%), Positives = 241/314 (77%), Gaps = 2/314 (1%)
 Frame = -1

Query  1120  DDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFAD  941
             +D+ M +RHE WM+ +GRVY D+ EK +RF IFK+NV+ IE+FNQAG RPY LG+N+FAD
Sbjct  25    NDEAMVERHEQWMSLHGRVYTDDAEKERRFQIFKKNVEFIEAFNQAGKRPYKLGVNQFAD  84

Query  940   LTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCC  761
             LTN+EF +++NG+K   S +   R   F+YENVT +P+ +DWRK+GAV P+K+QG CG C
Sbjct  85    LTNEEFKASRNGFKASSSLK-LIRGASFKYENVTAVPATMDWRKKGAVAPIKDQGQCGSC  143

Query  760   WAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTT  581
             WAFSA+AA EGI K+S G+L+SLSEQE+VDCD+   D GC+GG M+DAF +I+K+ G+ +
Sbjct  144   WAFSAIAATEGITKLSTGKLISLSEQEIVDCDRTSQDQGCNGGEMEDAFAFIVKNKGIAS  203

Query  580   ESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQL  401
             E+ YPY   D G C+ T  +  AAKIAGYE VP N+EAALL+A A+QPVSV+IDA G+  
Sbjct  204   EATYPYTAAD-GTCSKTKEASHAAKIAGYEKVPANNEAALLKAVANQPVSVSIDASGMAF  262

Query  400   QFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAK  221
             QFY  GVFT  CGT+L+HGVT VGYG    G KYWL+KNSWG  WGE GY R+QR I AK
Sbjct  263   QFYTSGVFTGDCGTDLDHGVTAVGYGKASNGTKYWLVKNSWGTSWGESGYIRMQRGISAK  322

Query  220   EGRCGIALDPSYPT  179
             EG CGIA+D SYPT
Sbjct  323   EGLCGIAMDSSYPT  336



>emb|CDP18644.1| unnamed protein product [Coffea canephora]
Length=336

 Score =   392 bits (1006),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 193/314 (61%), Positives = 242/314 (77%), Gaps = 2/314 (1%)
 Frame = -1

Query  1120  DDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFAD  941
             +D+ M +R+E WM+ +GRVY D  EK +RF IFK+NV+ IESFN+AG+RPY LGIN+FAD
Sbjct  24    NDEAMVERYEQWMSLHGRVYKDSAEKERRFKIFKDNVEFIESFNRAGNRPYKLGINQFAD  83

Query  940   LTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCC  761
             LTN+EFV++ NG K   SPR  + S  F+YENVT +P+ VDWR +GAVTP+K+QG CG C
Sbjct  84    LTNEEFVASHNGLKMSSSPR-LFMSTSFKYENVTAVPATVDWRTKGAVTPIKDQGQCGSC  142

Query  760   WAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTT  581
             WAFSA+AA EGI K+S G+L+SLSEQE+VDCD+   D GC GG M+DAF++I+K+ G+ T
Sbjct  143   WAFSAIAATEGITKLSTGKLISLSEQEIVDCDRTSQDQGCSGGYMEDAFEFIVKNKGIAT  202

Query  580   ESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQL  401
             E+ YPY   D G C+ T  +  AAKIA YE VP NSEAALL+A A+QPVSV+IDA G+  
Sbjct  203   ETTYPYTAAD-GTCSKTKEASHAAKIASYEKVPANSEAALLKAVANQPVSVSIDAGGMAF  261

Query  400   QFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAK  221
             QFY+ GVFT  CGT+L+HGVT VGYG    G KYWL+KNSWG  WGE GY +++R I AK
Sbjct  262   QFYSSGVFTGDCGTDLDHGVTAVGYGKTSNGTKYWLVKNSWGTSWGESGYIKMKRGIAAK  321

Query  220   EGRCGIALDPSYPT  179
             EG CGIA+D SYPT
Sbjct  322   EGLCGIAMDSSYPT  335



>ref|XP_002280204.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score =   392 bits (1006),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 195/310 (63%), Positives = 241/310 (78%), Gaps = 4/310 (1%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M +RHEDWM +YGR Y D  EK+KR+ IFK+NV  IESFN+A D+ Y L INEFADLTN+
Sbjct  35    MYERHEDWMVQYGREYKDADEKSKRYKIFKDNVARIESFNKAMDKSYKLSINEFADLTNE  94

Query  928   EFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFS  749
             EF +++N +K  +       +  F+YENVT +PS VDWRK+GAVTP+K+QG CG CWAFS
Sbjct  95    EFRASRNRFKAHICST---EATSFKYENVTAVPSTVDWRKKGAVTPIKDQGQCGSCWAFS  151

Query  748   AVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGY  569
             AVAA+EGI ++S G+L+SLSEQELVDCD  G D GC GG MDDAFK+I +++GLTTE+ Y
Sbjct  152   AVAAMEGITQLSTGKLISLSEQELVDCDTSGEDQGCSGGLMDDAFKFIEQNHGLTTEANY  211

Query  568   PYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYA  389
             PY G D G CN   A+  AAKI GYEDVP N+E AL +A AHQP++VAIDA G + QFY+
Sbjct  212   PYAGTD-GTCNRKKAAHPAAKINGYEDVPANNEKALQKAVAHQPIAVAIDAGGSEFQFYS  270

Query  388   GGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRC  209
              GVFT +CGTEL+HGV+ VGYGT + G+KYWL+KNSWG  WGE+GY R+QRD+ AKEG C
Sbjct  271   SGVFTGQCGTELDHGVSAVGYGTSDDGMKYWLVKNSWGTGWGEEGYIRMQRDVTAKEGLC  330

Query  208   GIALDPSYPT  179
             GIA+  SYPT
Sbjct  331   GIAMQASYPT  340



>ref|XP_009601306.1| PREDICTED: ervatamin-B-like isoform X1 [Nicotiana tomentosiformis]
Length=341

 Score =   391 bits (1005),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 203/338 (60%), Positives = 244/338 (72%), Gaps = 7/338 (2%)
 Frame = -1

Query  1189  IVFAAILACCSKAAK-SMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKEN  1013
             + FAA+L     A++ S +GL E     M ++H  WMAR+GR Y D+ EKAKR  IFKEN
Sbjct  9     LAFAALLVLGMHASRASSRGLYEAS---MVQKHAQWMARFGRAYKDDAEKAKRLKIFKEN  65

Query  1012  VKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDI  833
              + I+S N+AG RPY LGIN+FADLTN+EF +T NGY+ P   ++   +  F+YENVT +
Sbjct  66    AEYIDSVNKAGIRPYKLGINDFADLTNEEFRATHNGYRMPSHQKSS-ETTSFKYENVTAL  124

Query  832   PSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkggg  653
              +++DWRK+GAVT VKNQG CGCCWAFSAVAA EGI KI  G+L+SLSEQELVDCD    
Sbjct  125   AASMDWRKKGAVTGVKNQGQCGCCWAFSAVAATEGINKIKNGKLISLSEQELVDCDTSWD  184

Query  652   dlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNS  473
                  G  MD AFKYIIK++GLTTES YPY G D G C     S  AAKI GY+DVP NS
Sbjct  185   MGCQGGL-MDYAFKYIIKNHGLTTESNYPYEGID-GTCKTGKKSKHAAKITGYKDVPANS  242

Query  472   EAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWL  293
             E+AL +A AHQPVSVAIDA G   QFY+ GVFT  CGTEL+HGVT +GYG    G  YWL
Sbjct  243   ESALQKAVAHQPVSVAIDASGPDFQFYSSGVFTGECGTELDHGVTAIGYGKTSDGTDYWL  302

Query  292   LKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             +KNSWG  WGE GY R+QR+IDA+EG CGIA++ SYPT
Sbjct  303   VKNSWGTSWGEKGYIRMQRNIDAEEGLCGIAMEASYPT  340



>ref|XP_010103045.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXB94643.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=359

 Score =   392 bits (1007),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 208/359 (58%), Positives = 255/359 (71%), Gaps = 23/359 (6%)
 Frame = -1

Query  1201  IKNLIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIF  1022
             ++   +F ++L     AA +      +D + M +RHE WMARYGR Y D++EK KRF IF
Sbjct  5     LQKTSIFVSLLVLGMWAALANGRALHEDANSMSERHEQWMARYGRTYKDDSEKEKRFQIF  64

Query  1021  KENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPR--NPWRSMPFRYE  848
             K NV+ IES N+AG++PY LGINEFAD TN+EF +++NGYKR   PR  NP     FRYE
Sbjct  65    KSNVEYIESVNKAGNKPYKLGINEFADQTNEEFRASRNGYKRSPIPRPINP----SFRYE  120

Query  847   NVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEG----------------IVKI  716
             +VT +PS+VDWRK+GAVTPVK+QG CGCCWAFSAVAA+EG                I ++
Sbjct  121   SVTKVPSSVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGLYGCCWAFSAVAAMEGITQL  180

Query  715   SGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCN  536
             + G+L+SLSEQELVDCD  G D GC GG MDDAF +I+ + GLTTES YPY G D   CN
Sbjct  181   TTGKLISLSEQELVDCDTSGTDQGCEGGLMDDAFDFILGNEGLTTESKYPYKGVDE-TCN  239

Query  535   LTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTE  356
                AS  AA I G+EDVP NSE AL +A A+QPVSVAIDA G   Q Y+ GVFT  CGTE
Sbjct  240   KKKASSHAASITGHEDVPANSEKALQKAVANQPVSVAIDAGGSDFQLYSSGVFTGECGTE  299

Query  355   LNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             L+HGVT VGYG  E G KYWL+KNSWG  WGE+GY R++RD+DA+EG CGIA++ SYP+
Sbjct  300   LDHGVTAVGYGKTEDGTKYWLVKNSWGSSWGEEGYIRMERDVDAEEGLCGIAMEASYPS  358



>ref|XP_006467666.1| PREDICTED: vignain-like [Citrus sinensis]
 gb|KDO77831.1| hypothetical protein CISIN_1g042468mg [Citrus sinensis]
Length=346

 Score =   391 bits (1005),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 213/350 (61%), Positives = 257/350 (73%), Gaps = 9/350 (3%)
 Frame = -1

Query  1216  MVSRLIKNLIVFAAILACCSKAAKS-MQGLNEDDDDVMEKRHEDWMARYGRVYADETEKA  1040
             M   L++N +V AAIL     A +S  + LN   D  M +RHE WMA+YGRVY D  EK 
Sbjct  1     MAMILLENKLVLAAILVLGVWAPQSWSRTLN---DATMNERHEMWMAQYGRVYRDNAEKE  57

Query  1039  KRFSIFKENVKAIESFN-QAGDRPYTLGINEFADLTNDEFVSTKNGYKR--PVSPRNPWR  869
              RF IFKENV+ I SFN +A ++PY LGINEFAD TN+EF + +NGYKR  P    +   
Sbjct  58    MRFKIFKENVEYIASFNNKARNKPYKLGINEFADQTNEEFRAPRNGYKRRLPSVRSSETT  117

Query  868   SMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLS  689
              + FRYEN + +P+++DWRK+GAVT VK+QG CGCCWAFSAVAA+EGI  I+  +L SLS
Sbjct  118   DVSFRYENAS-VPASIDWRKKGAVTGVKDQGQCGCCWAFSAVAAMEGINHITTRKLTSLS  176

Query  688   EQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAA  509
             EQELVDCD  G D GC GG MDDAF++II + GL TE+ YPY   D G CN   A+  AA
Sbjct  177   EQELVDCDTSGEDQGCEGGLMDDAFEFIISNKGLATEAKYPYKASD-GSCNKKEANPSAA  235

Query  508   KIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVG  329
             KI+GYEDVP N+EAAL++A A+QPVSVAIDA G   QFY+ GVFT +CGTEL+HGVT VG
Sbjct  236   KISGYEDVPSNNEAALMKAVANQPVSVAIDASGSDFQFYSSGVFTGQCGTELDHGVTAVG  295

Query  328   YGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             YGT + G KYWL+KNSWG  WGE+GY R+QRDIDAKEG CGIA+  SYPT
Sbjct  296   YGTADDGTKYWLVKNSWGTTWGENGYIRMQRDIDAKEGLCGIAMQASYPT  345



>gb|KDP21078.1| hypothetical protein JCGZ_21549 [Jatropha curcas]
Length=326

 Score =   390 bits (1003),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 198/310 (64%), Positives = 238/310 (77%), Gaps = 2/310 (1%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             +E+RHE WMA++ RVY D TEK  RF IF+ENVK IESFN+AG++ Y LGIN F DLTN 
Sbjct  18    LEERHEIWMAQHERVYKDATEKEMRFQIFRENVKFIESFNKAGNKSYKLGINAFTDLTNK  77

Query  928   EFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFS  749
             EF +++NGYKR     +   +  F+YENVT IPS++DWR +G VTP+K+QG CGCCWAFS
Sbjct  78    EFRASRNGYKRSSYSSSS-GTNSFKYENVTTIPSSLDWRSKGVVTPIKDQGQCGCCWAFS  136

Query  748   AVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGY  569
             AVAA+EGI K+S  +L+SLSEQEL+DCD  G D GC GG MDDAF++II++NGLTTE+ Y
Sbjct  137   AVAAMEGITKLSTEKLISLSEQELIDCDTSGIDQGCEGGLMDDAFEFIIQNNGLTTEANY  196

Query  568   PYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYA  389
             PY  +D G CN   A+  AA I  YEDVP N+E AL  A A+QPVSVAIDA     Q Y+
Sbjct  197   PYQAED-GTCNTEKAANHAATITSYEDVPENNEEALRMAVANQPVSVAIDAGESAFQHYS  255

Query  388   GGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRC  209
              G+FT  CGTEL+HGVTVVGYGT + G KYWL+KNSWG  WGEDGY R+QRDIDAKEG C
Sbjct  256   SGIFTGDCGTELDHGVTVVGYGTSDDGTKYWLVKNSWGTSWGEDGYIRMQRDIDAKEGLC  315

Query  208   GIALDPSYPT  179
             GIA+ PSYPT
Sbjct  316   GIAMQPSYPT  325



>ref|XP_004252652.2| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=322

 Score =   390 bits (1002),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 199/325 (61%), Positives = 235/325 (72%), Gaps = 8/325 (2%)
 Frame = -1

Query  1141  MQGLNEDDDDVME----KRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDR  974
             MQ       D+ E    KRHE WMAR+GRVY D+ EKAKRF IFK+N + I+S N AG +
Sbjct  1     MQAYQATSRDLYEASIVKRHEQWMARFGRVYKDDAEKAKRFKIFKDNTEYIDSVNMAGIK  60

Query  973   PYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVT  794
             PY L +NEFADLTNDEF  T+NGY+ P   ++P     F+YENVT  P+ +DWRK+GAVT
Sbjct  61    PYKLDVNEFADLTNDEFRVTRNGYRMPSHKKSP-EITSFKYENVT-APATMDWRKKGAVT  118

Query  793   PVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAF  614
              +K+QG CGCCWAFSAVAA EGI KI  G+L+SLSEQELVDCD         G  MDDAF
Sbjct  119   GIKDQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTSSDMGCEGGL-MDDAF  177

Query  613   KYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPV  434
             K+IIK++GLTTES YPY G D   C     S  AAKI  YEDVP NSE+ALL+A A+QPV
Sbjct  178   KFIIKNHGLTTESNYPYEGTD-STCKTGKESNHAAKITSYEDVPANSESALLKAVANQPV  236

Query  433   SVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDG  254
             SVAIDA G   QFY+ GVFT  CGTEL+HGVT VGYG    G KYWL+KNSWG  WGE+G
Sbjct  237   SVAIDASGSDFQFYSSGVFTGECGTELDHGVTAVGYGEASDGTKYWLVKNSWGTSWGENG  296

Query  253   YFRLQRDIDAKEGRCGIALDPSYPT  179
             Y R+QR++D +EG CGIA++ SYPT
Sbjct  297   YIRMQRNVDTEEGLCGIAMEASYPT  321



>gb|KDP45578.1| hypothetical protein JCGZ_17185 [Jatropha curcas]
Length=340

 Score =   391 bits (1004),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 209/339 (62%), Positives = 249/339 (73%), Gaps = 14/339 (4%)
 Frame = -1

Query  1192  LIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKEN  1013
             LI   A LA     A+S+Q      D  M +RHEDWMA+ GRVY D  EK  R+ IFKEN
Sbjct  14    LIFILAALAS-QAIARSLQ------DASMYERHEDWMAQNGRVYKDANEKEIRYKIFKEN  66

Query  1012  VKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYK-RPVSPRNPWRSMPFRYENVTD  836
             V+ IESFN+AG + Y LGIN+FADLTN+EF +++N +K    SP+      PFRYENVT 
Sbjct  67    VERIESFNKAGGKSYKLGINQFADLTNEEFKTSRNRFKGHMCSPQEG----PFRYENVTA  122

Query  835   IPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgg  656
             +PS++DWRK+GAVTP+K+QG CG CWAFSAVAAVEGI +++  +L+SLSEQELVDCD  G
Sbjct  123   VPSSMDWRKKGAVTPIKDQGQCGSCWAFSAVAAVEGITQLTSHKLISLSEQELVDCDTKG  182

Query  655   gdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMN  476
              D GC GG MDDAFK+I  + GLTTE+ YPY G D G CN    +  AAKI GYEDVP N
Sbjct  183   EDQGCQGGLMDDAFKFIENNQGLTTETNYPYEGSD-GTCNANKEANHAAKITGYEDVPAN  241

Query  475   SEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYW  296
              EAALL+A A QPVSVAIDA G Q QFY+ G+FT  CGTEL+HGV  VGYG    G+KYW
Sbjct  242   DEAALLKAVAQQPVSVAIDAGGFQFQFYSSGIFTGDCGTELDHGVAAVGYGV-SNGMKYW  300

Query  295   LLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             L+KNSWG +WGE GY R+QRDI+AKEG CGIA+  SYPT
Sbjct  301   LVKNSWGTQWGEVGYIRMQRDIEAKEGLCGIAMQASYPT  339



>ref|XP_002280246.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score =   390 bits (1002),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 194/310 (63%), Positives = 239/310 (77%), Gaps = 4/310 (1%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M +RHEDWM +YGR Y D  EK+KR+ IFK+NV  IESFN+A D+ Y L INEFADLTN+
Sbjct  35    MYERHEDWMVQYGREYKDADEKSKRYKIFKDNVARIESFNKAMDKSYKLSINEFADLTNE  94

Query  928   EFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFS  749
             EF +++N +K  +       +  F+YENVT +PS VDWRK+GAVTP+K+QG CG CWAFS
Sbjct  95    EFRASRNRFKAHICST---EATSFKYENVTAVPSTVDWRKKGAVTPIKDQGQCGSCWAFS  151

Query  748   AVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGY  569
             AVAA+EGI ++S G+L+SLSEQELVDCD  G D GC GG MDDAFK+I +++GLTTE+ Y
Sbjct  152   AVAAMEGITQLSTGKLISLSEQELVDCDTSGEDQGCSGGLMDDAFKFIEQNHGLTTEANY  211

Query  568   PYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYA  389
             PY G D G CN   A+  AAKI GYEDVP N+E AL +A AHQP++VAIDA G + QFY+
Sbjct  212   PYAGTD-GTCNRKKAAHPAAKINGYEDVPANNEKALQKAVAHQPIAVAIDASGSEFQFYS  270

Query  388   GGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRC  209
              GVFT +CGTEL+HGV  VGYGT + G+KYWL+KNSW   WGE+GY R+QRD+ AKEG C
Sbjct  271   SGVFTGQCGTELDHGVAAVGYGTSDDGMKYWLVKNSWSTGWGEEGYIRMQRDVTAKEGLC  330

Query  208   GIALDPSYPT  179
             GIA+  SYPT
Sbjct  331   GIAMQASYPT  340



>ref|XP_011086001.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   389 bits (1000),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 201/342 (59%), Positives = 245/342 (72%), Gaps = 4/342 (1%)
 Frame = -1

Query  1204  LIKNLIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSI  1025
             L  N I+F A L                D  ++EK HE W+A++GRVY D+ EKAKRF+I
Sbjct  3     LRPNWILFLAALVVLEIWGSQATARTLPDASMVEK-HEQWIAQFGRVYKDDAEKAKRFNI  61

Query  1024  FKENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYEN  845
             FKENV+ I+SFN+AG RPY L IN+FADLTN+EF +++NGYK     ++  +   FRY N
Sbjct  62    FKENVEYIQSFNEAGARPYKLAINKFADLTNEEFQASRNGYKMGSYGKSS-KVSSFRYAN  120

Query  844   VTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcd  665
             VT +P+++DWRK+GAVT VK+QG CGCCWAFSAVAA EGI +++ G L+SLSEQELVDCD
Sbjct  121   VTAVPASMDWRKKGAVTGVKDQGQCGCCWAFSAVAATEGINQLTTGNLISLSEQELVDCD  180

Query  664   kgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDV  485
                 +    G  MD+AF++II + G+TTES YPY G D G CN    S   AKI GYEDV
Sbjct  181   TSEDEGCNGGL-MDNAFEFIISNGGITTESNYPYEGVD-GTCNSKKESSHVAKITGYEDV  238

Query  484   PMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGI  305
             P NSE+ALL+A A+QPVSVAIDA G   QFY  GVFT +CGTEL+HGVT VGYG    G 
Sbjct  239   PANSESALLKAVANQPVSVAIDASGSDFQFYTSGVFTGQCGTELDHGVTAVGYGKTSDGT  298

Query  304   KYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             KYWL+KNSWG  WGE+GY R+QRDIDA EG CGIA+  SYPT
Sbjct  299   KYWLVKNSWGTSWGENGYIRMQRDIDAAEGLCGIAMQASYPT  340



>ref|XP_004252606.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=341

 Score =   389 bits (999),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 194/310 (63%), Positives = 231/310 (75%), Gaps = 4/310 (1%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M ++HE WM R+GRVY ++ EKAKRF IFK+N+  I+SFN+AG + Y L INEFADLTND
Sbjct  35    MVQKHEQWMTRFGRVYKNDVEKAKRFKIFKDNIDYIDSFNKAGTKSYKLDINEFADLTND  94

Query  928   EFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFS  749
             EF +T NGYK P   ++P     F+YENVT  P+ +DWR +GAVT +KNQG CGCCWAFS
Sbjct  95    EFRATHNGYKMPFQKKSP-EITSFKYENVT-APATMDWRLKGAVTGIKNQGQCGCCWAFS  152

Query  748   AVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGY  569
             AVAA EGI KI  G+L+SLSEQELVDCD         G  MDDAFK+IIK++GLTTES Y
Sbjct  153   AVAATEGINKIKTGKLISLSEQELVDCDTSSDMGCEGGL-MDDAFKFIIKNHGLTTESNY  211

Query  568   PYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYA  389
             PY G D   C     S  AAKI  YEDVP NSE++LL+A A+QPVSVAIDA G   QFY+
Sbjct  212   PYEGTD-STCKTGKESNHAAKITSYEDVPANSESSLLKAVANQPVSVAIDASGSDFQFYS  270

Query  388   GGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRC  209
              GVFT  CGTEL+HGVT VGYG    G KYWL+KNSWG  WGE+GY R+QR++DA+EG C
Sbjct  271   SGVFTGECGTELDHGVTAVGYGEASDGTKYWLVKNSWGTSWGENGYIRMQRNVDAEEGLC  330

Query  208   GIALDPSYPT  179
             GIA++ SYPT
Sbjct  331   GIAMEASYPT  340



>ref|XP_006446793.1| hypothetical protein CICLE_v10018274mg [Citrus clementina]
 gb|ESR60033.1| hypothetical protein CICLE_v10018274mg [Citrus clementina]
Length=341

 Score =   389 bits (999),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 194/313 (62%), Positives = 242/313 (77%), Gaps = 4/313 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M +R+E W ARYGRVY D  EK KRF+IFK+NV  IE+FN+A ++PY L +NEFADL
Sbjct  32    DAAMYERYEQWTARYGRVYRDNAEKEKRFTIFKQNVANIEAFNKASEKPYKLAVNEFADL  91

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF +++N +K  +      ++ PF+YENVT +PS +DWRK+GAVTPVK+QG CGCCW
Sbjct  92    TNEEFKASRNRFKGHMCSE---QTGPFKYENVTAVPSTMDWRKKGAVTPVKDQGQCGCCW  148

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA+EGI +++ G+L SLSEQELVDCD  G D GC+GG MD+AF+++ K+ G+TTE
Sbjct  149   AFSAVAAIEGINQLTTGKLASLSEQELVDCDVKGEDEGCNGGLMDNAFQFVQKNKGITTE  208

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
               YPY G D G+CN    +  AAKI G+EDVP NSE AL++A A+QPVSVAIDA G   Q
Sbjct  209   INYPYKGVD-GKCNAKEEANHAAKINGHEDVPANSETALMKAVANQPVSVAIDAGGFDFQ  267

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY+ GVFT  CGTEL+HGVT VGYG  + G KYWL+KNSWG  WGE+GY R+QRDIDAK+
Sbjct  268   FYSSGVFTGDCGTELDHGVTAVGYGAADDGTKYWLVKNSWGATWGEEGYIRMQRDIDAKQ  327

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYPT
Sbjct  328   GLCGIAMQASYPT  340



>ref|XP_006376349.1| hypothetical protein POPTR_0013s12260g [Populus trichocarpa]
 gb|ERP54146.1| hypothetical protein POPTR_0013s12260g [Populus trichocarpa]
Length=342

 Score =   389 bits (999),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 202/346 (58%), Positives = 250/346 (72%), Gaps = 5/346 (1%)
 Frame = -1

Query  1216  MVSRLIKNLIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAK  1037
             MVS + K    FA IL   + A +      E  +  M  RHE WM  YG+VYAD  EK +
Sbjct  1     MVS-ICKRQCFFAFILILGTWAYEVAS--RELQEPSMSARHEQWMETYGKVYADAAEKER  57

Query  1036  RFSIFKENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPF  857
             RF IFK+NV+ IESFN AG++PY L +N+FADLTN+E    +NGY+RP+  R P +   F
Sbjct  58    RFEIFKDNVEYIESFNTAGNKPYKLSVNKFADLTNEELKVARNGYRRPLQTR-PMKVTSF  116

Query  856   RYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQEL  677
             +YENVT +P+ +DWRK+GAVTP+K+QG CG CWAFS VAA EGI +++ G+LVSLSEQEL
Sbjct  117   KYENVTAVPATMDWRKKGAVTPIKDQGQCGSCWAFSTVAATEGINQLTTGKLVSLSEQEL  176

Query  676   VdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAG  497
             VDCD  G D GC GG M+D F++IIK++G+TTE+ YPY   D G CN    + R AKI G
Sbjct  177   VDCDTQGEDQGCEGGLMEDGFEFIIKNHGITTEANYPYQAAD-GTCNSRKEASRIAKITG  235

Query  496   YEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTG  317
             YE VP NSEAALL+A A QP+SV+IDA G   QFY+ GVFT +CGTEL+HGVT VGYG  
Sbjct  236   YESVPANSEAALLKAVASQPISVSIDAGGSDFQFYSSGVFTGQCGTELDHGVTAVGYGET  295

Query  316   ERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
               G KYWL+KNSWG  WGE+GY R+QRD +A+EG CGIA+D SYPT
Sbjct  296   SDGTKYWLVKNSWGTSWGEEGYIRMQRDTEAEEGLCGIAMDSSYPT  341



>ref|XP_004252607.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=340

 Score =   389 bits (999),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 198/338 (59%), Positives = 244/338 (72%), Gaps = 8/338 (2%)
 Frame = -1

Query  1189  IVFAAILACCSKAAKSM-QGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKEN  1013
             + F A+L    +A+++  +GL E     M ++H+ WM R+GRVY D+ EKAKRF IFK+N
Sbjct  9     LAFIALLVLVMQASQATSRGLYETS---MVQKHDQWMTRFGRVYKDDVEKAKRFKIFKDN  65

Query  1012  VKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDI  833
              + I+SFN+AG +PY L INEFADLTN+EF +T NGY+ P   ++P     F+YENVT  
Sbjct  66    TEYIDSFNKAGTKPYKLDINEFADLTNEEFRATHNGYRMPSQKKSP-EITSFKYENVT-A  123

Query  832   PSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkggg  653
             P+ +DWRK+GAVT +K+QG CGCCWAFSAVAA EGI KI  G+L+SLSEQELVDCD    
Sbjct  124   PATMDWRKKGAVTGIKDQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTSSD  183

Query  652   dlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNS  473
                  G  MDDAFK+IIK++GLTTES YPY G D   C     S  AAKI  YEDVP NS
Sbjct  184   MGCEGGL-MDDAFKFIIKNHGLTTESNYPYEGTD-STCKTGKESNHAAKITSYEDVPANS  241

Query  472   EAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWL  293
             E+ LL+A A+QPVSVAIDA     QFY+ GVFT  CGTEL+HGVT VGYG    G KYWL
Sbjct  242   ESDLLKAVANQPVSVAIDASASDFQFYSSGVFTGECGTELDHGVTAVGYGKASDGTKYWL  301

Query  292   LKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             +KNSWG  WGE+GY R+QR++D +EG CGIA++ SYPT
Sbjct  302   VKNSWGTSWGENGYIRMQRNVDTEEGLCGIAMEASYPT  339



>emb|CAN64655.1| hypothetical protein VITISV_005140 [Vitis vinifera]
Length=341

 Score =   389 bits (999),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 193/310 (62%), Positives = 241/310 (78%), Gaps = 4/310 (1%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M +RHEDWMA+YGRVY D  EK+KR+ IFK+NV  IESFN+A ++ Y L INEFADLTN+
Sbjct  35    MYERHEDWMAQYGRVYKDAGEKSKRYKIFKDNVARIESFNKAMNKSYKLSINEFADLTNE  94

Query  928   EFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFS  749
             EF +++N +K  +       +  F+YE+V  +PS VDWRK+GAVTP+K+QG CG CWAFS
Sbjct  95    EFRASRNRFKAHICST---EATSFKYEHVXAVPSTVDWRKKGAVTPIKDQGQCGSCWAFS  151

Query  748   AVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGY  569
             AVAA+EGI ++S G+L+SLSEQELVDCD  G D GC GG MDDAFK+I +++GLTTE+ Y
Sbjct  152   AVAAMEGITQLSTGKLISLSEQELVDCDTSGEDQGCSGGLMDDAFKFIEQNHGLTTEANY  211

Query  568   PYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYA  389
             PY G D G CN   A+  AAKI GYEDVP N+E AL +A AHQP++VAIDA G + QFY+
Sbjct  212   PYAGTD-GTCNRKKAAHPAAKINGYEDVPANNEKALQKAVAHQPIAVAIDAGGFEFQFYS  270

Query  388   GGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRC  209
              GVFT +CGTEL+HGV+ VGYGT + G+KYWL+KNSWG  WGE+GY R+QRD+  KEG C
Sbjct  271   SGVFTGQCGTELDHGVSAVGYGTSDDGMKYWLVKNSWGTGWGEEGYIRMQRDVTEKEGLC  330

Query  208   GIALDPSYPT  179
             GIA+  SYPT
Sbjct  331   GIAMQASYPT  340



>ref|XP_006469011.1| PREDICTED: vignain-like [Citrus sinensis]
Length=341

 Score =   389 bits (998),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 194/313 (62%), Positives = 241/313 (77%), Gaps = 4/313 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M +R+E W ARYGRVY D  EK KRF+IFK+NV  IE+FN+A  +PY L +NEFADL
Sbjct  32    DAAMYERYEQWTARYGRVYRDNVEKEKRFTIFKQNVAHIEAFNKASKKPYKLAVNEFADL  91

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF  ++N +K  +      ++ PF+YENVT +PS +DWRK+GAVTPVK+QG CGCCW
Sbjct  92    TNEEFKVSRNRFKGHMCSE---QTGPFKYENVTAVPSTMDWRKKGAVTPVKDQGQCGCCW  148

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA+EGI +++ G+L SLSEQELVDCD  G D GC+GG MD+AF+++ K+ G+TTE
Sbjct  149   AFSAVAAIEGINQLTTGKLASLSEQELVDCDVKGEDEGCNGGLMDNAFQFVQKNKGITTE  208

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D G+CN    +  AAKI G+EDVP NSE AL++A A+QPVSVAIDA G   Q
Sbjct  209   TNYPYKGVD-GKCNAKEEANHAAKINGHEDVPANSETALMKAVANQPVSVAIDAGGFDFQ  267

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY+ GVFT  CGTEL+HGVT VGYG  + G KYWL+KNSWG  WGE+GY R+QRDIDAK+
Sbjct  268   FYSSGVFTGDCGTELDHGVTAVGYGAADDGTKYWLVKNSWGTSWGEEGYIRMQRDIDAKQ  327

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYPT
Sbjct  328   GLCGIAMQASYPT  340



>emb|CAN70559.1| hypothetical protein VITISV_032465 [Vitis vinifera]
Length=341

 Score =   389 bits (998),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 193/310 (62%), Positives = 238/310 (77%), Gaps = 4/310 (1%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M +RHEDWM +YGR Y D  EK+KR+ IFK+NV  IESFN+A D+ Y L INEFADLTN+
Sbjct  35    MYERHEDWMVQYGREYKDADEKSKRYKIFKDNVARIESFNKAMDKSYKLSINEFADLTNE  94

Query  928   EFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFS  749
             EF +++N +K  +       +  F+YENVT +PS VDWRK+GAVTP+K+QG CG CWAFS
Sbjct  95    EFRASRNRFKAHICST---EATSFKYENVTAVPSTVDWRKKGAVTPIKDQGQCGSCWAFS  151

Query  748   AVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGY  569
             AVAA+EGI ++S G+L+SLSEQELVDCD  G D GC GG MDDAFK+I +++GLTTE+ Y
Sbjct  152   AVAAMEGITQLSTGKLISLSEQELVDCDTSGEDQGCSGGLMDDAFKFIEQNHGLTTEANY  211

Query  568   PYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYA  389
             PY G D G CN   A+  AAKI GYEDVP N+E AL +A AHQP++VAIDA G + QFY+
Sbjct  212   PYAGTD-GTCNRKKAAHPAAKINGYEDVPANNEKALQKAVAHQPIAVAIDASGSEFQFYS  270

Query  388   GGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRC  209
              GVFT +CGTEL+HGV  VGYGT + G+KYWL+KNSW   WGE+GY R+QRD+  KEG C
Sbjct  271   SGVFTGQCGTELDHGVAAVGYGTSDDGMKYWLVKNSWSTGWGEEGYIRMQRDVTVKEGLC  330

Query  208   GIALDPSYPT  179
             GIA+  SYPT
Sbjct  331   GIAMQASYPT  340



>ref|XP_006446792.1| hypothetical protein CICLE_v10018253mg [Citrus clementina]
 gb|ESR60032.1| hypothetical protein CICLE_v10018253mg [Citrus clementina]
Length=341

 Score =   388 bits (997),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 195/313 (62%), Positives = 240/313 (77%), Gaps = 4/313 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M +R+E W ARYGRVY D  EK KRF+IFK+NV  IE+FN+A  +PY L +NEFADL
Sbjct  32    DAAMYERYEQWTARYGRVYRDNAEKEKRFTIFKQNVAHIEAFNKASKKPYKLAVNEFADL  91

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF  ++N +K  +      ++ PF+YENVT +PS +DWRK+GAVTPVK+QG CGCCW
Sbjct  92    TNEEFKVSRNRFKGHMCSE---QTGPFKYENVTAVPSTMDWRKKGAVTPVKDQGQCGCCW  148

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA+EGI +++ G+L SLSEQELVDCD  G D GC+GG MD+AF+++ K+ G+TTE
Sbjct  149   AFSAVAAIEGINQLTTGKLASLSEQELVDCDVKGEDEGCNGGLMDNAFQFVQKNKGITTE  208

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D G+CN    +  AAKI G+EDVP NSE AL+ A A+QPVSVAIDA G   Q
Sbjct  209   TNYPYKGVD-GKCNAKEEANHAAKINGHEDVPANSETALMNAVANQPVSVAIDAGGSDFQ  267

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY+ GVFT  CGTEL+HGVT VGYG  + G KYWL+KNSWG  WGE+GY R+QRDIDAKE
Sbjct  268   FYSSGVFTGDCGTELDHGVTAVGYGAADDGTKYWLVKNSWGTSWGEEGYIRMQRDIDAKE  327

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYPT
Sbjct  328   GLCGIAMQASYPT  340



>ref|XP_002280215.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score =   388 bits (997),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 194/310 (63%), Positives = 240/310 (77%), Gaps = 4/310 (1%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M +RHEDWMA+YGRVY D  EK+KR+ IFK+NV  IESFN+A D+ Y L INEFADLTN+
Sbjct  35    MYERHEDWMAQYGRVYKDADEKSKRYKIFKDNVARIESFNKAMDKSYKLSINEFADLTNE  94

Query  928   EFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFS  749
             EF +++N +K  +       +  F+YE+V  +PS VDWRK+GAVTP+K+QG CG CWAFS
Sbjct  95    EFRASRNRFKAHICST---EATSFKYEHVAAVPSTVDWRKKGAVTPIKDQGQCGSCWAFS  151

Query  748   AVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGY  569
             AVAA+EGI ++S G+L+SLSEQELVDCD  G D GC+GG MDDAFK+I +++GL TE+ Y
Sbjct  152   AVAAMEGITQLSTGKLISLSEQELVDCDTSGEDQGCNGGLMDDAFKFIEQNHGLATEANY  211

Query  568   PYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYA  389
             PY G D G CN   A+  AAKI GYEDVP N+E AL +A AHQP++VAIDA G + QFY+
Sbjct  212   PYAGTD-GTCNRKKAAHPAAKINGYEDVPANNEKALQKAVAHQPIAVAIDAGGFEFQFYS  270

Query  388   GGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRC  209
              GVFT +CGTEL+HGV  VGYGT + G+KYWL+KNSWG  WGE GY R+QRD+ AKEG C
Sbjct  271   SGVFTGQCGTELDHGVAAVGYGTSDDGMKYWLVKNSWGTGWGEVGYIRMQRDVTAKEGLC  330

Query  208   GIALDPSYPT  179
             GIA+  SYPT
Sbjct  331   GIAMQASYPT  340



>ref|XP_006469012.1| PREDICTED: vignain-like [Citrus sinensis]
Length=341

 Score =   388 bits (996),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 195/313 (62%), Positives = 240/313 (77%), Gaps = 4/313 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M +R+E W ARYGRVY D  EK KRF+IFK NV  IE+FN+A  +PY L +NEFADL
Sbjct  32    DAAMYERYEQWTARYGRVYRDNVEKEKRFTIFKRNVAHIEAFNKASKKPYKLAVNEFADL  91

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF  ++N +K  +      ++ PF+YENVT +PS +DWRK+GAVTPVK+QG CGCCW
Sbjct  92    TNEEFKVSRNRFKGHMCSE---QTGPFKYENVTAVPSTMDWRKKGAVTPVKDQGQCGCCW  148

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA+EGI +++ G+L SLSEQELVDCD  G D GC+GG MD+AF+++ K+ G+TTE
Sbjct  149   AFSAVAAIEGINQLTTGKLASLSEQELVDCDVKGEDEGCNGGLMDNAFQFVQKNKGITTE  208

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D G+CN    +  AAKI G+EDVP NSE AL++A A+QPVSVAIDA G   Q
Sbjct  209   TNYPYKGVD-GKCNAKEEANHAAKINGHEDVPANSETALMKAVANQPVSVAIDAGGSDFQ  267

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY+ GVFT  CGTEL+HGVT VGYG  + G KYWL+KNSWG  WGE+GY R+QRDIDAKE
Sbjct  268   FYSSGVFTGDCGTELDHGVTAVGYGAADDGTKYWLVKNSWGTSWGEEGYIRMQRDIDAKE  327

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYPT
Sbjct  328   GLCGIAMQASYPT  340



>gb|KDO63329.1| hypothetical protein CISIN_1g047793mg, partial [Citrus sinensis]
Length=324

 Score =   387 bits (993),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 191/312 (61%), Positives = 236/312 (76%), Gaps = 6/312 (2%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             + ++HE WM++YG+VY +  EK KRF IFK+NV+ IES N AG++PY L INEFAD TN 
Sbjct  16    LSEKHEQWMSKYGKVYKNPEEKEKRFRIFKDNVEFIESLNAAGNKPYKLSINEFADQTNQ  75

Query  928   EFVSTKNGYKRP--VSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWA  755
             EF + +NGY+RP  ++ R   +   F+YENV D+P+ +DWRK GAVTP+KNQG CG CWA
Sbjct  76    EFKAFRNGYRRPDGLTSR---KGTSFKYENVIDVPATMDWRKNGAVTPIKNQGPCGSCWA  132

Query  754   FSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTES  575
             FSAVAA EGI +++ G+L+SLSEQELV CD  G D GC GG M+DAFK+II ++G+TTE+
Sbjct  133   FSAVAATEGITQLTTGKLISLSEQELVSCDTSGVDHGCEGGEMEDAFKFIIHNDGITTEA  192

Query  574   GYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQF  395
              YPY   D G CN T  +   AKI GYE VP NSE ALL+A A+QPV+V+IDA G   QF
Sbjct  193   NYPYQAVD-GTCNKTNEASHVAKIKGYETVPANSEEALLKAVANQPVAVSIDASGSAFQF  251

Query  394   YAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEG  215
             Y+ GVFT  CGTEL+HGVT VGYG    G KYWL+KNSWG  WGE+GY R++RDIDAKEG
Sbjct  252   YSSGVFTGDCGTELDHGVTAVGYGATANGTKYWLVKNSWGTSWGEEGYIRMKRDIDAKEG  311

Query  214   RCGIALDPSYPT  179
              CGIA+D SYPT
Sbjct  312   LCGIAMDSSYPT  323



>ref|XP_011078044.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   387 bits (995),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 194/313 (62%), Positives = 234/313 (75%), Gaps = 3/313 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D    + HE WMA++GRVY DE EK+KRF IFKENV+ I SFN+A  RPY L IN+FADL
Sbjct  31    DAATVQEHEQWMAQFGRVYKDEAEKSKRFRIFKENVEYIRSFNEAAARPYRLAINKFADL  90

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EFV+++NGYK     ++  +   FRY NV+ +P+++DWR++GAVT VK+QG CGCCW
Sbjct  91    TNEEFVASRNGYKMGSYMKST-KVSSFRYANVSAVPASMDWRQKGAVTGVKDQGQCGCCW  149

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA EGI +++ G+L+SLSEQELVDCD    +    G  MDDAF++II + G+TTE
Sbjct  150   AFSAVAATEGINQLTTGKLISLSEQELVDCDTSEDEGCNGGL-MDDAFEFIISNGGITTE  208

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             S YPY G D G CN    S  AAKI GYEDVP NSE ALL+A A+QPVSVAIDA G   Q
Sbjct  209   SNYPYEGVD-GTCNSKKESSHAAKITGYEDVPANSEPALLKAVANQPVSVAIDASGSDFQ  267

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY+ GVFT  CGTEL+HGVT VGYG    G KYWL+KNSWG  WGE+GY R+QRDIDA E
Sbjct  268   FYSSGVFTGECGTELDHGVTAVGYGKTSDGTKYWLVKNSWGSSWGENGYIRMQRDIDAAE  327

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYPT
Sbjct  328   GLCGIAMQASYPT  340



>ref|XP_010038688.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW47321.1| hypothetical protein EUGRSUZ_K01109 [Eucalyptus grandis]
Length=340

 Score =   387 bits (994),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 200/313 (64%), Positives = 238/313 (76%), Gaps = 6/313 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             DD M + H  WMARYGRVY D  E+  RF IFK N + IESFN A D+PY LG+N+FADL
Sbjct  33    DDPMYEMHGQWMARYGRVYKDVEERQSRFEIFKANAQGIESFNHANDKPYRLGVNQFADL  92

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF   +N +K  +       +  FRYEN+T +PS++DWRK+GAVTPVKNQG CGCCW
Sbjct  93    TNEEF-KARNRFKSHMCST---EAASFRYENITAVPSSMDWRKKGAVTPVKNQGQCGCCW  148

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAAVEG+ +I+ G+L+SLSEQELVDCD GG D GC GG MD AF+++ KH GLTTE
Sbjct  149   AFSAVAAVEGVNEITTGKLISLSEQELVDCDVGGQDQGCEGGWMDSAFQFVEKH-GLTTE  207

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D G+CN+ + S RA  I GYEDVP NSE ALL+A A QPVSVAIDA G   Q
Sbjct  208   TNYPYNGTD-GKCNVKSESNRAVIIKGYEDVPANSEGALLKAVAKQPVSVAIDAGGFDFQ  266

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY+ GVFT  CGTEL+HGVT VGYGT + G K+WL+KNSWGE+WGE GY R+QRD+ AKE
Sbjct  267   FYSSGVFTGACGTELDHGVTAVGYGTSDDGTKFWLVKNSWGEEWGEKGYIRMQRDVSAKE  326

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYPT
Sbjct  327   GLCGIAMKASYPT  339



>ref|XP_011038210.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score =   387 bits (994),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 192/310 (62%), Positives = 235/310 (76%), Gaps = 2/310 (1%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M  RHE WMA +G+VYAD  EK +RF IFK+NV+ IESFN AG++PY L +N+FADLTN+
Sbjct  34    MSARHEQWMATFGKVYADAAEKERRFEIFKDNVEYIESFNTAGNKPYKLSVNKFADLTNE  93

Query  928   EFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFS  749
             E    +NGY+RP+  R P +   F YENVT +P+ +DWRK+GAVTP+K+QG CG CWAFS
Sbjct  94    ELKIARNGYRRPLQTR-PMKVTSFEYENVTAVPATMDWRKKGAVTPIKDQGQCGSCWAFS  152

Query  748   AVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGY  569
              VAA EGI +++ G+LVSLSEQELVDCD  G D GC GG M+D F++IIK++G+T+E+ Y
Sbjct  153   TVAATEGINQLTTGKLVSLSEQELVDCDTQGEDQGCEGGLMEDGFEFIIKNHGITSEANY  212

Query  568   PYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYA  389
             PY   D G CN    +   AKI GYE VP NSEAALL+A A+QP+SV+IDA G   QFY+
Sbjct  213   PYQAAD-GTCNSKKEASHIAKITGYESVPANSEAALLKAVANQPISVSIDAGGSDFQFYS  271

Query  388   GGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRC  209
              GVFT +CGTEL+HGVT VGYG    G KYWL KNSWG  WGE GY R+QRDIDA+EG C
Sbjct  272   SGVFTGQCGTELDHGVTAVGYGETSDGTKYWLFKNSWGTSWGEAGYIRMQRDIDAEEGLC  331

Query  208   GIALDPSYPT  179
             GIA+D SYPT
Sbjct  332   GIAMDSSYPT  341



>ref|XP_009601308.1| PREDICTED: ervatamin-B-like isoform X3 [Nicotiana tomentosiformis]
Length=323

 Score =   387 bits (993),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 194/310 (63%), Positives = 230/310 (74%), Gaps = 3/310 (1%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M ++H  WMAR+GR Y D+ EKAKR  IFKEN + I+S N+AG RPY LGIN+FADLTN+
Sbjct  16    MVQKHAQWMARFGRAYKDDAEKAKRLKIFKENAEYIDSVNKAGIRPYKLGINDFADLTNE  75

Query  928   EFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFS  749
             EF +T NGY+ P   ++   +  F+YENVT + +++DWRK+GAVT VKNQG CGCCWAFS
Sbjct  76    EFRATHNGYRMPSHQKSS-ETTSFKYENVTALAASMDWRKKGAVTGVKNQGQCGCCWAFS  134

Query  748   AVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGY  569
             AVAA EGI KI  G+L+SLSEQELVDCD         G  MD AFKYIIK++GLTTES Y
Sbjct  135   AVAATEGINKIKNGKLISLSEQELVDCDTSWDMGCQGGL-MDYAFKYIIKNHGLTTESNY  193

Query  568   PYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYA  389
             PY G D G C     S  AAKI GY+DVP NSE+AL +A AHQPVSVAIDA G   QFY+
Sbjct  194   PYEGID-GTCKTGKKSKHAAKITGYKDVPANSESALQKAVAHQPVSVAIDASGPDFQFYS  252

Query  388   GGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRC  209
              GVFT  CGTEL+HGVT +GYG    G  YWL+KNSWG  WGE GY R+QR+IDA+EG C
Sbjct  253   SGVFTGECGTELDHGVTAIGYGKTSDGTDYWLVKNSWGTSWGEKGYIRMQRNIDAEEGLC  312

Query  208   GIALDPSYPT  179
             GIA++ SYPT
Sbjct  313   GIAMEASYPT  322



>ref|XP_011038211.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score =   387 bits (994),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 196/338 (58%), Positives = 245/338 (72%), Gaps = 6/338 (2%)
 Frame = -1

Query  1192  LIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKEN  1013
             +I F  IL   +    S     E  +  M  RHE WMA +G+VYAD  EK +RF IFK+N
Sbjct  10    IIAFILILGTWAYEVAS----RELQEPSMSARHEQWMATFGKVYADAAEKERRFEIFKDN  65

Query  1012  VKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDI  833
             V+ IESFN AG++PY L +N+FADLT +E    +NGY+RP+  R P +   F YENVT +
Sbjct  66    VEYIESFNTAGNKPYKLSVNKFADLTTEELKVARNGYRRPLQTR-PMKVTSFEYENVTAV  124

Query  832   PSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkggg  653
             P+ +DWRK+GAVTP+K+QG CG CWAFS VAA EGI +++ G+LVSLSEQELVDCD  G 
Sbjct  125   PATMDWRKKGAVTPIKDQGQCGSCWAFSTVAATEGINQLTTGKLVSLSEQELVDCDTQGE  184

Query  652   dlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNS  473
             D GC GG M+D F++IIK++G+T+E+ YPY   D G CN    +   AKI GYE VP NS
Sbjct  185   DQGCEGGLMEDGFEFIIKNHGITSEANYPYQAAD-GTCNSKKEASHIAKITGYESVPANS  243

Query  472   EAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWL  293
             EAALL+A A+QP+SV+IDA G   QFY+ GVFT +CGTEL+HGVT VGYG    G KYWL
Sbjct  244   EAALLKAVANQPISVSIDAGGSDFQFYSSGVFTGQCGTELDHGVTAVGYGETSDGTKYWL  303

Query  292   LKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             +KNSWG  WGE+GY R+QRD+DA+EG CGIA+D SYPT
Sbjct  304   VKNSWGTSWGEEGYIRMQRDVDAEEGLCGIAMDSSYPT  341



>ref|XP_006360708.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score =   387 bits (993),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 199/338 (59%), Positives = 243/338 (72%), Gaps = 8/338 (2%)
 Frame = -1

Query  1189  IVFAAILACCSKAAKSM-QGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKEN  1013
             + F A+L    +A+++  +GL E     + K+HE WMAR+GRVY D+ EKAKRF IFK+N
Sbjct  9     LAFVALLVLGMQASQATSRGLYETS---IVKKHEQWMARFGRVYKDDVEKAKRFKIFKDN  65

Query  1012  VKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDI  833
              + I+S N AG +PY L +NEF+DLTN+EF +T NGY+ P   + P     F+YENVT  
Sbjct  66    TEYIDSVNMAGIKPYKLDVNEFSDLTNEEFRATHNGYRMPSQKKYP-EITSFKYENVT-A  123

Query  832   PSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkggg  653
             P+ +DWR +GAVT +KNQG CGCCWAFSAVAA EGI KI  G+L+SLSEQELVDCD    
Sbjct  124   PATMDWRLKGAVTGIKNQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTSSD  183

Query  652   dlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNS  473
                  G  MDDAFK+IIK++GLTTES YPY G D   C     S  AAKI  YEDVP NS
Sbjct  184   MGCEGGL-MDDAFKFIIKNHGLTTESNYPYEGTD-NTCKTGKESNHAAKITSYEDVPANS  241

Query  472   EAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWL  293
             E+ALL+A A+QPVSVAIDA G   QFY+ GVFT  CGTEL+HGVT VGYG    G KYWL
Sbjct  242   ESALLKAVANQPVSVAIDASGSDFQFYSSGVFTGECGTELDHGVTAVGYGEASDGTKYWL  301

Query  292   LKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             +KNSWG  WGE+GY R+QR++D +EG CGIA++ SYPT
Sbjct  302   VKNSWGTSWGENGYIRMQRNVDTEEGLCGIAMEASYPT  339



>ref|XP_009601307.1| PREDICTED: ervatamin-B-like isoform X2 [Nicotiana tomentosiformis]
Length=331

 Score =   386 bits (992),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 195/310 (63%), Positives = 230/310 (74%), Gaps = 3/310 (1%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M ++H  WMAR+GR Y D+ EKAKR  IFKEN + I+S N+AG RPY LGIN+FADLTN+
Sbjct  24    MVQKHAQWMARFGRAYKDDAEKAKRLKIFKENAEYIDSVNKAGIRPYKLGINDFADLTNE  83

Query  928   EFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFS  749
             EF +T NGY+ P S +    +  F+YENVT + +++DWRK+GAVT VKNQG CGCCWAFS
Sbjct  84    EFRATHNGYRMP-SHQKSSETTSFKYENVTALAASMDWRKKGAVTGVKNQGQCGCCWAFS  142

Query  748   AVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGY  569
             AVAA EGI KI  G+L+SLSEQELVDCD         G  MD AFKYIIK++GLTTES Y
Sbjct  143   AVAATEGINKIKNGKLISLSEQELVDCDTSWDMGCQGGL-MDYAFKYIIKNHGLTTESNY  201

Query  568   PYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYA  389
             PY G D G C     S  AAKI GY+DVP NSE+AL +A AHQPVSVAIDA G   QFY+
Sbjct  202   PYEGID-GTCKTGKKSKHAAKITGYKDVPANSESALQKAVAHQPVSVAIDASGPDFQFYS  260

Query  388   GGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRC  209
              GVFT  CGTEL+HGVT +GYG    G  YWL+KNSWG  WGE GY R+QR+IDA+EG C
Sbjct  261   SGVFTGECGTELDHGVTAIGYGKTSDGTDYWLVKNSWGTSWGEKGYIRMQRNIDAEEGLC  320

Query  208   GIALDPSYPT  179
             GIA++ SYPT
Sbjct  321   GIAMEASYPT  330



>ref|XP_009629965.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=343

 Score =   387 bits (993),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 202/348 (58%), Positives = 248/348 (71%), Gaps = 10/348 (3%)
 Frame = -1

Query  1213  VSRLIKNL-IVFAAILACCSKAAKSMQGLNED--DDDVMEKRHEDWMARYGRVYADETEK  1043
             ++RL  N  + FAA+L   S A+   Q  + D  +   M ++HE WM+ +GRVY D+ EK
Sbjct  1     MARLTFNWNLAFAALLVLVSFAS---QATSRDLYEAASMVQKHEQWMSHFGRVYKDDVEK  57

Query  1042  AKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSM  863
             AKRF IF+ NV+ IE  N+AG RPY LGINEFADL+N+EF  T+NGYK   S +   ++ 
Sbjct  58    AKRFKIFQHNVEYIEFVNKAGTRPYKLGINEFADLSNEEFRDTRNGYKM-TSHQQLSKTT  116

Query  862   PFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQ  683
              F+Y NVT  P+ +DWR +GAVT +K+QG CGCCWAFSAVAA EGI KI  G+L+SLSEQ
Sbjct  117   SFKYANVT-APATMDWRTKGAVTGIKDQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQ  175

Query  682   ELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKI  503
             ELVDCD         G  MDDAFK+IIK+NGLTTES YPY G +   C     S  AAKI
Sbjct  176   ELVDCDTSSDMGCEGGL-MDDAFKFIIKNNGLTTESNYPYEGTN-ATCKTGKESNHAAKI  233

Query  502   AGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYG  323
              GYEDVP NSE+ALL+A A+QP+SVAIDA G   QFY+ GVFT  CGTEL+HGVT +GYG
Sbjct  234   TGYEDVPANSESALLKAVANQPISVAIDASGSDFQFYSTGVFTGECGTELDHGVTAIGYG  293

Query  322   TGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
                 G +YWL+KNSWG  WGE+GY R+QRD+DA+EG CGIA+  SYPT
Sbjct  294   KTSDGTQYWLVKNSWGTSWGENGYIRMQRDVDAEEGLCGIAMQASYPT  341



>ref|XP_006469128.1| PREDICTED: vignain-like [Citrus sinensis]
Length=343

 Score =   387 bits (993),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 198/342 (58%), Positives = 246/342 (72%), Gaps = 7/342 (2%)
 Frame = -1

Query  1198  KNLIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFK  1019
             ++L   A I    + AA  +      +  + EK HE WM++YG+VY +  EK KRF IFK
Sbjct  6     QSLCKLALIFLILAIAASQVTSRKLQEASLSEK-HEQWMSKYGKVYKNPEEKEKRFRIFK  64

Query  1018  ENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRP--VSPRNPWRSMPFRYEN  845
             +NV+ IES N AG++PY L INEFAD TN EF + +NGY+RP  ++ R   +   F+YEN
Sbjct  65    DNVEFIESLNAAGNKPYKLSINEFADQTNQEFKAFRNGYRRPDGLTSR---KGTSFKYEN  121

Query  844   VTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcd  665
             V D+P+ +DWRK GAVTP+KNQG CG CWAFSAVAA EGI +++ G+L+SLSEQELV CD
Sbjct  122   VIDVPATMDWRKNGAVTPIKNQGPCGSCWAFSAVAATEGITQLTTGKLISLSEQELVSCD  181

Query  664   kgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDV  485
               G D GC GG M+DAFK+II ++G+TTE+ YPY   D G CN T  +   AKI GYE V
Sbjct  182   TSGVDHGCEGGEMEDAFKFIIHNDGITTEANYPYQAVD-GTCNKTNEASHVAKIKGYETV  240

Query  484   PMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGI  305
             P NSE ALL+A A+QPV+V+IDA G   QFY+ GVFT  CGTEL+HGVT VGYG    G 
Sbjct  241   PANSEEALLKAVANQPVAVSIDASGSAFQFYSSGVFTGDCGTELDHGVTAVGYGATANGT  300

Query  304   KYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             KYWL+KNSWG  WGE+GY R++RDIDAKEG CGIA+D SYPT
Sbjct  301   KYWLVKNSWGTSWGEEGYIRMKRDIDAKEGLCGIAMDSSYPT  342



>ref|XP_011086005.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   387 bits (993),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 191/313 (61%), Positives = 236/313 (75%), Gaps = 3/313 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M +RHE+WMA++GR Y D+ EKAKRF IFKENV+ I+SFN+AG RPY L +N+FADL
Sbjct  31    DASMIERHEEWMAQHGRAYKDDVEKAKRFKIFKENVEYIQSFNEAGTRPYKLAVNKFADL  90

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF +++NGYK     +   +   FRY NVT +P+++DWR++GAVT VK+QG CGCCW
Sbjct  91    TNEEFQASRNGYKMGSYGKAS-KVSSFRYANVTAVPTSMDWRQKGAVTGVKDQGQCGCCW  149

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA EGI +++ G+L+SLSEQELVDCD    +    G  MD+AF++II + G+TTE
Sbjct  150   AFSAVAATEGINQLTTGKLISLSEQELVDCDTSEDEGCNGGL-MDNAFEFIISNGGITTE  208

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             S YPY   D G CN    S  AAKI GYEDVP NSE+ALL+A A+QPVSVAIDA G   Q
Sbjct  209   SNYPYEAVD-GTCNSKKESSHAAKITGYEDVPANSESALLKAVANQPVSVAIDASGSDFQ  267

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY  GVFT +CGTEL+HGVT VGYG    G KYWL+KNSWG  WGE+GY R+QRD+DA E
Sbjct  268   FYTSGVFTGQCGTELDHGVTAVGYGKTSDGTKYWLVKNSWGTSWGENGYIRMQRDVDAAE  327

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYP+
Sbjct  328   GLCGIAMQASYPS  340



>ref|XP_006446763.1| hypothetical protein CICLE_v10017432mg [Citrus clementina]
 gb|ESR60003.1| hypothetical protein CICLE_v10017432mg [Citrus clementina]
Length=343

 Score =   386 bits (992),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 190/312 (61%), Positives = 236/312 (76%), Gaps = 6/312 (2%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             + ++HE WM++YG+VY +  EK KRF IFK+NV+ IES N AG++PY L +NEFAD TN 
Sbjct  35    LSEKHEQWMSKYGKVYKNPEEKEKRFRIFKDNVEFIESLNAAGNKPYKLSVNEFADQTNQ  94

Query  928   EFVSTKNGYKRP--VSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWA  755
             EF + +NGY+RP  ++ R   +   F+YENV D+P+ +DWRK GAVTP+KNQG CG CWA
Sbjct  95    EFKAFRNGYRRPNGLASR---KGTSFKYENVIDVPATMDWRKNGAVTPIKNQGPCGSCWA  151

Query  754   FSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTES  575
             FSAVAA EGI +++ G+L+SLSEQELV CD  G D GC GG M+DAFK+II ++G+TTE+
Sbjct  152   FSAVAATEGITQLTTGKLISLSEQELVSCDTSGVDHGCEGGEMEDAFKFIIHNDGITTEA  211

Query  574   GYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQF  395
              YPY   D G CN T  +   AKI GYE VP NSE ALL+A A+QPV+V+IDA G   QF
Sbjct  212   NYPYQAAD-GTCNKTKEASHVAKIKGYETVPANSEEALLKAVANQPVAVSIDASGSAFQF  270

Query  394   YAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEG  215
             Y+ GVFT  CGTEL+HGVT VGYG    G KYWL+KNSWG  WGE+GY R++RDIDAKEG
Sbjct  271   YSSGVFTGDCGTELDHGVTAVGYGATANGTKYWLVKNSWGTSWGEEGYIRMKRDIDAKEG  330

Query  214   RCGIALDPSYPT  179
              CGIA+D SYPT
Sbjct  331   LCGIAMDSSYPT  342



>emb|CDP05747.1| unnamed protein product [Coffea canephora]
Length=340

 Score =   385 bits (990),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 200/342 (58%), Positives = 244/342 (71%), Gaps = 9/342 (3%)
 Frame = -1

Query  1207  RLIKNLIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFS  1028
             +L+  L+ F  ++   S+A   +  L+E+D+  M + HE WMA YGRVY D+ EKAKRF 
Sbjct  6     KLMPILVSFFVLVIGASQATSRL--LHENDEAAMVEEHEKWMATYGRVYKDDAEKAKRFQ  63

Query  1027  IFKENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYE  848
             IFK+N + IESFN+AG + Y+L IN FAD+TN+EF   +NGYK    P    +S  FRYE
Sbjct  64    IFKKNFEYIESFNKAGTKTYSLSINRFADMTNEEF-RARNGYK----PFTSSKSASFRYE  118

Query  847   NVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdc  668
             NVTD+PS++DWR+EGAVTPVKNQG CGCCWAFSAVAA EG+ ++  GEL+SLSEQELVDC
Sbjct  119   NVTDVPSSLDWREEGAVTPVKNQGDCGCCWAFSAVAATEGVHQLKTGELISLSEQELVDC  178

Query  667   dkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYED  488
             D         G  MD AF +IIK++GLTTES YPY G D G C+       AA I  YED
Sbjct  179   DTDEDRGCEGGL-MDSAFSFIIKNHGLTTESHYPYLGID-GSCSANEEHPPAATIKSYED  236

Query  487   VPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERG  308
             VP N+E+ALL+A A+QPVSVAIDA G    FY+ GVFT  CGT L+HG T VGYG  E G
Sbjct  237   VPENNESALLKAVANQPVSVAIDAGGQDFAFYSSGVFTGECGTHLDHGATAVGYGISEDG  296

Query  307   IKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYP  182
             IKYWL+KNSWG  WGEDGY R+QRDI   +G CGIA++ SYP
Sbjct  297   IKYWLVKNSWGVDWGEDGYIRMQRDIHDVQGLCGIAMNASYP  338



>emb|CAL64936.1| putative cysteine protease 8 [Trifolium pratense]
Length=344

 Score =   386 bits (991),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 196/314 (62%), Positives = 236/314 (75%), Gaps = 3/314 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGD-RPYTLGINEFAD  941
             DD M +RH  WM++YG++Y D  E+  RF IFKENV  IE+FN A D + Y LGIN+FAD
Sbjct  32    DDSMYERHGQWMSQYGKIYKDHQERETRFKIFKENVNYIETFNNADDTKSYKLGINQFAD  91

Query  940   LTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCC  761
             LTN+EF++++N +K  +   +  R+  F+YENV+ IPS VDWRK+GAVTPVKNQG CGCC
Sbjct  92    LTNEEFIASRNKFKGHMCS-SIMRTTSFKYENVSGIPSTVDWRKKGAVTPVKNQGQCGCC  150

Query  760   WAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTT  581
             WAFSAVAA EGI K+S G+L+SLSEQELVDCD  G D GC GG MDDAFK+II+++GL+T
Sbjct  151   WAFSAVAATEGIHKLSTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFIIQNHGLST  210

Query  580   ESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQL  401
             E+ YPY G D G CN   AS +A  I GYEDVP NSE AL +A A+QP+SVAIDA G   
Sbjct  211   EAQYPYEGVD-GTCNANKASVQAVTITGYEDVPANSEQALQKAVANQPISVAIDASGSDF  269

Query  400   QFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAK  221
             QFY  GVFT  CGTEL+HGVT VGYG    G KYWL+KNSWG  WGE+GY  +QR I+A 
Sbjct  270   QFYKSGVFTGACGTELDHGVTAVGYGVSNDGTKYWLVKNSWGTDWGEEGYIMMQRGIEAA  329

Query  220   EGRCGIALDPSYPT  179
             EG CGIA+  SYPT
Sbjct  330   EGICGIAMQASYPT  343



>gb|AAA50755.1| cysteine proteinase [Alnus glutinosa]
Length=340

 Score =   385 bits (990),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 199/340 (59%), Positives = 248/340 (73%), Gaps = 12/340 (4%)
 Frame = -1

Query  1192  LIVFAAILACCSK--AAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFK  1019
             L+V   + A  S+  AA+S+Q      D  M +RHE+WMA YGRVY D  EK KR+ IF+
Sbjct  10    LVVMVTLGALASQLAAARSLQ------DASMRERHEEWMASYGRVYKDINEKQKRYKIFE  63

Query  1018  ENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVT  839
             ENV  IES N+  ++PY L +N+FADLTN+EF +++N +K  +      +S  F+Y NV+
Sbjct  64    ENVALIESSNKDANKPYKLSVNQFADLTNEEFKASRNRFKGHICST---KSTSFKYGNVS  120

Query  838   DIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkg  659
              +PSA+DWR +GAVTPVK+QG CGCCWAFSAVAA EGI K++ GEL+SLSEQELVDCD  
Sbjct  121   AVPSAMDWRMKGAVTPVKDQGQCGCCWAFSAVAATEGITKLTTGELISLSEQELVDCDTS  180

Query  658   ggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPM  479
             G D GC GG MD+AF +I  ++GL +E+ YPY G D G CN    +  AA+I G+EDVP 
Sbjct  181   GVDQGCEGGLMDNAFTFIQHNHGLASEANYPYKGVD-GTCNTNKQAIHAAEINGFEDVPA  239

Query  478   NSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKY  299
             NSE ALL A AHQPVSVAIDA G   QFY+ GVF   CGT+L+HGVT VGYGT + G KY
Sbjct  240   NSEEALLNAVAHQPVSVAIDAGGSGFQFYSKGVFIGACGTQLDHGVTAVGYGTSDDGTKY  299

Query  298   WLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             WL+KNSWG +WGE+GY R+QRD+DAKEG CGIA+  SYPT
Sbjct  300   WLVKNSWGTQWGEEGYIRMQRDVDAKEGLCGIAMKASYPT  339



>ref|XP_011037399.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score =   385 bits (990),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 194/316 (61%), Positives = 235/316 (74%), Gaps = 2/316 (1%)
 Frame = -1

Query  1126  EDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEF  947
             E  +  M  RHE WMA YG+VY D  E  +RF IFK+NV+ IESFN AG++PY L +N+F
Sbjct  28    ELQESSMSARHEQWMATYGKVYVDAAEIERRFKIFKDNVEYIESFNTAGNKPYKLSVNKF  87

Query  946   ADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCG  767
             AD TN+EF    NGY+RP   R P +   F+YENVT IP+A+DWRK+GAVTP+K+QG CG
Sbjct  88    ADQTNEEFKGAHNGYRRPFQTR-PMKVKSFKYENVTAIPAAMDWRKKGAVTPIKDQGQCG  146

Query  766   CCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGL  587
              CWAFS VAA EGI +++ G+LVSLSEQELVDCD  G D GC GG M+D F++IIK++G+
Sbjct  147   SCWAFSTVAATEGINQLTTGKLVSLSEQELVDCDTQGEDQGCEGGLMEDGFEFIIKNHGI  206

Query  586   TTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGL  407
             TTE+ YPY   D G CN    +   AKI GYE VP NSEA LL+A A+QP+SV+IDA G 
Sbjct  207   TTEANYPYQAAD-GTCNPEKRASHIAKITGYESVPANSEAELLKAVANQPISVSIDAGGS  265

Query  406   QLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDID  227
               QFY+ GVFT  CGTEL+HGVT VGYG    G KYWL+KNSWG  WGE+GY R+QRDID
Sbjct  266   DFQFYSSGVFTGECGTELDHGVTAVGYGKTSDGTKYWLVKNSWGTSWGEEGYIRMQRDID  325

Query  226   AKEGRCGIALDPSYPT  179
             A+EG CGIA+D SYPT
Sbjct  326   AEEGLCGIAMDSSYPT  341



>emb|CDP18641.1| unnamed protein product [Coffea canephora]
Length=338

 Score =   385 bits (989),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 203/346 (59%), Positives = 253/346 (73%), Gaps = 10/346 (3%)
 Frame = -1

Query  1213  VSRLIKNLIVFAAILACCSKAAKSM-QGLNEDDDDVMEKRHEDWMARYGRVYADETEKAK  1037
             ++ +  + ++F A L     A++++ + LNE     M ++HE WMA+ GRVY +E EK  
Sbjct  1     MASIATSKLIFTAFLMLTVLASQAVCRNLNEAS---MIEKHEQWMAQNGRVYKNEAEKGN  57

Query  1036  RFSIFKENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPF  857
             R+ IFKENV+ IESFN+AG + Y LGIN+FADLTN EF + +NGYK    P+   +   F
Sbjct  58    RYKIFKENVEFIESFNKAGTKSYKLGINQFADLTNVEFRAARNGYK----PK-ECKGTLF  112

Query  856   RYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQEL  677
             RYENV+ +P+A+DWRK+GAVT +K+QG CGCCWAFSAVAA EGI ++  G+L+SLSEQEL
Sbjct  113   RYENVSAVPAAMDWRKKGAVTGIKDQGQCGCCWAFSAVAATEGIHQLKTGKLISLSEQEL  172

Query  676   VdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAG  497
             VDCD  G D GC+GG MDDAF +II + GLTTE+ YPY   D G CN    +  AAKI G
Sbjct  173   VDCDTAGEDQGCNGGLMDDAFTFIINNKGLTTEANYPYQAVD-GTCNTNKEAKPAAKITG  231

Query  496   YEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTG  317
             +EDVP N+EAALL+A A+QPVSVAIDA G   QFY+ GVFT  CGTEL+HGVT VGYG  
Sbjct  232   FEDVPANNEAALLKAVANQPVSVAIDASGSAFQFYSSGVFTGDCGTELDHGVTAVGYGKS  291

Query  316   ERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
               G KYWL+KNSWG  WGE+GY  +QRDIDAKEG CGIA+  SYPT
Sbjct  292   SDGTKYWLVKNSWGTSWGENGYILMQRDIDAKEGLCGIAMQSSYPT  337



>gb|EYU25672.1| hypothetical protein MIMGU_mgv1a018700mg [Erythranthe guttata]
Length=343

 Score =   385 bits (989),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 190/310 (61%), Positives = 233/310 (75%), Gaps = 2/310 (1%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M +RHE WM +YGR Y ++ EKAKR++IFK+NV+ I+S N+A  R Y L IN+FADLTN+
Sbjct  35    MVERHEQWMVQYGRTYKNDAEKAKRYNIFKDNVEYIQSVNEAETRTYKLAINKFADLTNE  94

Query  928   EFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFS  749
             EF +++NGYK     ++  +   FRY NV+ +P ++DW K+GAVTPVK+QG CGCCWAFS
Sbjct  95    EFQASRNGYKMRSLSKSSSKVSSFRYANVSAVPPSIDWTKKGAVTPVKDQGQCGCCWAFS  154

Query  748   AVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGY  569
             AVAA EGI +++ G LVSLSEQELVDCD         G  MD+AF++II +NGLTTES Y
Sbjct  155   AVAATEGINQLTTGNLVSLSEQELVDCDTSEDQGCNGGL-MDNAFEFIISNNGLTTESNY  213

Query  568   PYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYA  389
             PY G D G CN    S  AA+I GYEDVP NSE+ALL+A A+QP+SVAIDA G   QFY+
Sbjct  214   PYEGVD-GTCNSKKESSHAARITGYEDVPSNSESALLKAVANQPISVAIDASGSDFQFYS  272

Query  388   GGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRC  209
             GGVFT +CGTEL+HGVT VGYG    G KYWL+KNSWG  WGE+GY R+QRDIDA EG C
Sbjct  273   GGVFTGQCGTELDHGVTAVGYGVTSDGTKYWLVKNSWGTSWGENGYIRMQRDIDAAEGLC  332

Query  208   GIALDPSYPT  179
             GIA+  SYPT
Sbjct  333   GIAMQASYPT  342



>ref|XP_006380493.1| hypothetical protein POPTR_0007s07240g [Populus trichocarpa]
 gb|ERP58290.1| hypothetical protein POPTR_0007s07240g [Populus trichocarpa]
Length=340

 Score =   385 bits (988),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 196/314 (62%), Positives = 243/314 (77%), Gaps = 7/314 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M +RHE WM +YGRVY D+TE+A R+SIFKENV  I++FN    + Y LG+N+FADL
Sbjct  32    DAPMYERHEQWMTQYGRVYKDDTERATRYSIFKENVARIDAFNSQTGKSYKLGVNQFADL  91

Query  937   TNDEFVSTKNGYK-RPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCC  761
             TN+EF +++N +K    SP+    + PFRYENV+ +PS +DWRKEGAVTPVK+QG CGCC
Sbjct  92    TNEEFKASRNRFKGHMCSPQ----AGPFRYENVSAVPSTMDWRKEGAVTPVKDQGQCGCC  147

Query  760   WAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTT  581
             WAFSAVAA+EGI K++ G+L+SLSEQE+VDCD  G D GC+GG MDDAFK+I ++ GLTT
Sbjct  148   WAFSAVAAMEGINKLTTGKLISLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIEQNKGLTT  207

Query  580   ESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQL  401
             E+ YPY G D G CN   A+  AAKI G+EDVP NSEAAL++A A QPVSVAIDA G   
Sbjct  208   EANYPYKGTD-GTCNTNKAAIHAAKITGFEDVPANSEAALMKAVAKQPVSVAIDAGGSDF  266

Query  400   QFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAK  221
             QFY+ G+FT  C T+L+HGVT VGYG  + G KYWL+KNSWG +WGE+GY R+Q+DI AK
Sbjct  267   QFYSSGIFTGSCDTQLDHGVTAVGYGVSD-GSKYWLVKNSWGAQWGEEGYIRMQKDISAK  325

Query  220   EGRCGIALDPSYPT  179
             EG CGIA+  SYPT
Sbjct  326   EGLCGIAMQASYPT  339



>ref|XP_009797968.1| PREDICTED: vignain-like [Nicotiana sylvestris]
Length=340

 Score =   385 bits (988),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 203/338 (60%), Positives = 245/338 (72%), Gaps = 8/338 (2%)
 Frame = -1

Query  1189  IVFAAILACCSKAAK-SMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKEN  1013
             + FAA+L    +A++ S +G  E     M ++HE WM R+ RVY D+ EK KR  IFKEN
Sbjct  9     LAFAALLVLGMQASRASSRGFYEGS---MVQKHEQWMDRFRRVYKDDAEKEKRLKIFKEN  65

Query  1012  VKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDI  833
              + I+S N+AG RPY LGINEFADLTN+EF +T NGYK     ++   +  F+YENVT  
Sbjct  66    AEYIDSVNKAGIRPYKLGINEFADLTNEEFRATHNGYKMRSHQKSS-ETTSFKYENVT-A  123

Query  832   PSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkggg  653
             P+++DWRK+GAVT VK+QG CGCCWAFSAVAA EGI KI  G+L+SLSEQELVDCD    
Sbjct  124   PTSIDWRKKGAVTGVKDQGQCGCCWAFSAVAATEGINKIKKGKLISLSEQELVDCDTSWN  183

Query  652   dlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNS  473
                  G  MD AFK+IIK++GLTTES YPY G D G C     S  AAKIAGYEDVP+NS
Sbjct  184   MGCQGGL-MDYAFKFIIKNHGLTTESNYPYEGID-GTCKTGKKSNHAAKIAGYEDVPVNS  241

Query  472   EAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWL  293
             E+ALL+A AHQPVSVAIDA G   QFY+ GVFT  CGTEL+HGVT +GYG    G  YWL
Sbjct  242   ESALLKAVAHQPVSVAIDASGPDFQFYSSGVFTGECGTELDHGVTAIGYGKTSDGTDYWL  301

Query  292   LKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             +KNSWG  WGE GY R++R+IDA+EG CGIA++ SYPT
Sbjct  302   VKNSWGTSWGEKGYIRMRRNIDAEEGLCGIAMEASYPT  339



>ref|XP_004505498.1| PREDICTED: vignain-like [Cicer arietinum]
Length=344

 Score =   385 bits (988),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 195/315 (62%), Positives = 235/315 (75%), Gaps = 3/315 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAG-DRPYTLGINEFAD  941
             DD M + HE WM  YG+VY D  EK KR  IF +N+  I++FN AG D+ Y LGIN++AD
Sbjct  32    DDSMYESHEQWMRHYGKVYKDSQEKEKRSKIFTQNINYIQAFNNAGNDKAYKLGINQYAD  91

Query  940   LTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCC  761
             LTN+EF+S++N +K  +   +  R+  F+YENV+ +PS VDWRK+GAVTPVKNQG CGCC
Sbjct  92    LTNEEFISSRNKFKGHMCS-SIIRTTTFKYENVSAVPSTVDWRKKGAVTPVKNQGQCGCC  150

Query  760   WAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTT  581
             WAFSAVAA EGI K+S G+L+SLSEQELVDCD  G D GC GG MDDAFK+II+++GL T
Sbjct  151   WAFSAVAATEGIHKLSTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFIIQNHGLDT  210

Query  580   ESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQL  401
             E+ YPY G D G CN   AS  AA I GYEDVP+N+E AL +A A+QP+SVAIDA G   
Sbjct  211   EAQYPYQGVD-GTCNANEASIHAATITGYEDVPVNNEQALQKAVANQPISVAIDASGSDF  269

Query  400   QFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAK  221
             QFY  GVFT  CGTEL+HGVT VGYG    G KYWL+KNSWG  WGE GY R+QR +DA 
Sbjct  270   QFYKSGVFTGSCGTELDHGVTAVGYGVSNDGTKYWLVKNSWGTDWGEQGYIRMQRGVDAA  329

Query  220   EGRCGIALDPSYPTL  176
             EG CGIA+  SYPT+
Sbjct  330   EGLCGIAMQASYPTV  344



>ref|XP_002280263.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=339

 Score =   384 bits (987),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 195/310 (63%), Positives = 234/310 (75%), Gaps = 6/310 (2%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M +RHEDWMARYGR+Y D  EK KRF IFK+NV  IESFN+A D+ Y L INEFADLTN+
Sbjct  35    MYERHEDWMARYGRMYKDANEKEKRFKIFKDNVARIESFNKAMDKTYKLSINEFADLTNE  94

Query  928   EFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFS  749
             EF S +N +K  +       +  F+YENVT +PS +DWRK+GAVTP+K+Q  CGCCWAFS
Sbjct  95    EFRSLRNRFKAHICSE----ATTFKYENVTAVPSTIDWRKKGAVTPIKDQQQCGCCWAFS  150

Query  748   AVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGY  569
             AVAA EGI +I+ G+L+SLSEQELVDCD GG + GC GG MDDAF++I  H GL +E+ Y
Sbjct  151   AVAATEGITQITTGKLISLSEQELVDCDTGGENQGCSGGLMDDAFRFIKIH-GLASEATY  209

Query  568   PYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYA  389
             PY G D G CN    +  AAKI GYEDVP N+E AL +A AHQPV+VAIDA G + QFY 
Sbjct  210   PYEGDD-GTCNSKKEAHPAAKIKGYEDVPANNEKALQKAVAHQPVAVAIDAGGFEFQFYT  268

Query  388   GGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRC  209
              GVFT +CGTEL+HGV  VGYG G+ G+ YWL+KNSWG  WGE+GY R+QRD+ AKEG C
Sbjct  269   SGVFTGQCGTELDHGVAAVGYGIGDDGMMYWLVKNSWGTGWGEEGYIRMQRDVTAKEGLC  328

Query  208   GIALDPSYPT  179
             GIA+  SYPT
Sbjct  329   GIAMQASYPT  338



>ref|XP_011078542.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   384 bits (987),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 193/313 (62%), Positives = 233/313 (74%), Gaps = 3/313 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D    + HE WMA++GRVY DE EK+KRF IFKENV+ I SFN+A  RPY L IN+FADL
Sbjct  31    DAATVQEHEQWMAQFGRVYKDEAEKSKRFRIFKENVEYIRSFNEAAARPYRLAINKFADL  90

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EFV+++NGYK     ++  +   FRY NV+ +P+++DWR++GAVT VK+QG CGCCW
Sbjct  91    TNEEFVASRNGYKMGSYMKST-KVSSFRYANVSAVPASMDWRQKGAVTGVKDQGQCGCCW  149

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA EGI +++  +L+SLSEQELVDCD    +    G  MDDAF++II + G+TTE
Sbjct  150   AFSAVAATEGINQLTTRKLISLSEQELVDCDTSEDEGCNGGL-MDDAFEFIISNGGITTE  208

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             S YPY G D G CN    S  AAKI GYEDVP NSE ALL+A A+QPVSVAIDA G   Q
Sbjct  209   SNYPYEGVD-GTCNSKKESSHAAKITGYEDVPANSEPALLKAVANQPVSVAIDASGSDFQ  267

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY+ GVFT  CGTEL+HGVT VGYG    G KYWL+KNSWG  WGE+GY R+QRDIDA E
Sbjct  268   FYSSGVFTGECGTELDHGVTAVGYGKTSDGTKYWLVKNSWGSSWGENGYIRMQRDIDAAE  327

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYPT
Sbjct  328   GLCGIAMQASYPT  340



>ref|XP_006376431.1| hypothetical protein POPTR_0013s12980g [Populus trichocarpa]
 gb|ERP54228.1| hypothetical protein POPTR_0013s12980g [Populus trichocarpa]
Length=342

 Score =   384 bits (987),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 190/316 (60%), Positives = 234/316 (74%), Gaps = 2/316 (1%)
 Frame = -1

Query  1126  EDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEF  947
             E  +  M  RHE WMA YG+VY D  EK +RF IFK NV+ IESFN AG++PY L +N+F
Sbjct  28    ELQESYMSARHEQWMATYGKVYVDAAEKERRFKIFKNNVEYIESFNTAGNKPYKLSVNKF  87

Query  946   ADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCG  767
             AD TN++F   +NGY+RP   R P +   F+YENVT +P+ +DWRK+GAVTP+K+QG CG
Sbjct  88    ADQTNEKFKGARNGYRRPFQTR-PMKVTSFKYENVTAVPATMDWRKKGAVTPIKDQGQCG  146

Query  766   CCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGL  587
              CWAFS VAA EGI +++ G+LVSLSEQELVDCD  G D GC GG M+D F++IIK++G+
Sbjct  147   SCWAFSTVAATEGINQLTTGKLVSLSEQELVDCDNQGEDQGCEGGLMEDGFEFIIKNHGI  206

Query  586   TTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGL  407
             TTE+ YPY   D G CN    +   AKI GYE VP NSEA LL+  A+QP+SV+IDA G 
Sbjct  207   TTEANYPYQAAD-GTCNSKKQASHIAKITGYESVPANSEAELLKVVANQPISVSIDAGGS  265

Query  406   QLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDID  227
               QFY+ GVFT +CGTEL+HGVT VGYG    G KYWL+KNSWG  WGE+GY R+QRDID
Sbjct  266   DFQFYSSGVFTGKCGTELDHGVTAVGYGETSDGTKYWLVKNSWGTSWGEEGYIRMQRDID  325

Query  226   AKEGRCGIALDPSYPT  179
              +EG CGIA+D SYPT
Sbjct  326   TEEGLCGIAMDSSYPT  341



>gb|KDP23983.1| hypothetical protein JCGZ_25371 [Jatropha curcas]
Length=340

 Score =   384 bits (986),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 205/344 (60%), Positives = 249/344 (72%), Gaps = 14/344 (4%)
 Frame = -1

Query  1207  RLIKNLIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFS  1028
             R+   LI     LA     A+S+Q      D  + +RHE WMA+YG+VY D  EK  R  
Sbjct  9     RISLALIFILGALAS-QAIARSLQ------DASINERHEKWMAQYGKVYKDANEKVIRRK  61

Query  1027  IFKENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYK-RPVSPRNPWRSMPFRY  851
             IFK NV+ IESFN+AG +PY LGIN+FADLTN+EF +++N +K    SP+    + PFRY
Sbjct  62    IFKRNVERIESFNKAGGKPYKLGINQFADLTNEEFKTSRNRFKGHMCSPQ----AGPFRY  117

Query  850   ENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVd  671
             ENVT +PS++DWRK+GAVTP+K+QG CG CWAFS VAAVEGI +++  +L+SLSEQELVD
Sbjct  118   ENVTAVPSSMDWRKKGAVTPIKDQGQCGSCWAFSTVAAVEGITQLTTKKLISLSEQELVD  177

Query  670   cdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYE  491
             CD  G D GC GG MDDAFK+I  + GLTTE+ YPY G D G CN    +  AAKI GYE
Sbjct  178   CDTKGEDQGCQGGLMDDAFKFIENNQGLTTEANYPYVGSD-GTCNTKKEANHAAKITGYE  236

Query  490   DVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGER  311
             DVP N+EAALL+A  +QPVSVAIDA G   QFY+ G+FT  CGTEL+HGV  VGYG    
Sbjct  237   DVPANNEAALLKAVTNQPVSVAIDAGGFAFQFYSSGIFTGDCGTELDHGVAAVGYGV-SN  295

Query  310   GIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             G KYWL+KNSWG +WGE+GY R+QRDIDAKEG CGIA+  SYPT
Sbjct  296   GTKYWLVKNSWGTQWGEEGYIRMQRDIDAKEGLCGIAMQASYPT  339



>gb|AAP32198.1| cysteine protease 12 [Trifolium repens]
Length=343

 Score =   384 bits (987),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 202/337 (60%), Positives = 242/337 (72%), Gaps = 5/337 (1%)
 Frame = -1

Query  1186  VFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVK  1007
             V  A+  C    A  +      DD + E RHE WM  YG+VY +  E+ KR  IF EN+K
Sbjct  10    VSLALFFCLGLLAIQVTSRTLQDDSIFE-RHEQWMTHYGKVYKNPQEREKRLRIFTENLK  68

Query  1006  AIESFNQAGDR-PYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIP  830
              IE+ N AG++ PY LGIN+FADLTN+EF++++N +K  +   +  R+  F+YEN T +P
Sbjct  69    YIEASNNAGNKKPYKLGINQFADLTNEEFIASRNKFKGHMCS-SIIRTTTFKYEN-TSVP  126

Query  829   SAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggd  650
             S VDWRK+GAVTPVKNQG CGCCWAFSA+AA EGI KIS G+LVSLSEQELVDCD  G D
Sbjct  127   STVDWRKKGAVTPVKNQGQCGCCWAFSAIAATEGIHKISTGKLVSLSEQELVDCDTNGVD  186

Query  649   lgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSE  470
              GC GG MDDAFK+II++NG++TE+GYPY G D G C    AS  AA I GYEDVP N+E
Sbjct  187   QGCEGGLMDDAFKFIIQNNGISTEAGYPYQGVD-GTCKANEASTSAATITGYEDVPANNE  245

Query  469   AALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLL  290
              AL +A A+QP+SVAIDA G   QFY  GVFT  CGTEL+HGVT VGYG    G KYWL+
Sbjct  246   NALQKAVANQPISVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGISNDGTKYWLV  305

Query  289   KNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             KNSWG  WGE+GY R+QR IDA EG CGIA+  SYPT
Sbjct  306   KNSWGTDWGEEGYIRMQRSIDAAEGLCGIAMQASYPT  342



>ref|XP_002310053.1| hypothetical protein POPTR_0007s07200g [Populus trichocarpa]
 ref|XP_006380490.1| hypothetical protein POPTR_0007s07190g [Populus trichocarpa]
 gb|EEE90503.1| hypothetical protein POPTR_0007s07200g [Populus trichocarpa]
 gb|ERP58287.1| hypothetical protein POPTR_0007s07190g [Populus trichocarpa]
Length=340

 Score =   384 bits (986),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 196/314 (62%), Positives = 242/314 (77%), Gaps = 7/314 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M +RHE WM +YGRVY D+ E+A R+SIFKENV  I++FN    + Y LG+N+FADL
Sbjct  32    DAPMYERHEQWMTQYGRVYKDDNERATRYSIFKENVARIDAFNSQTGKSYKLGVNQFADL  91

Query  937   TNDEFVSTKNGYK-RPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCC  761
             TN+EF +++N +K    SP+    + PFRYENV+ +PS VDWRKEGAVTPVK+QG CGCC
Sbjct  92    TNEEFKASRNRFKGHMCSPQ----AGPFRYENVSAVPSTVDWRKEGAVTPVKDQGQCGCC  147

Query  760   WAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTT  581
             WAFSAVAA+EGI K++ G+L+SLSEQE+VDCD  G D GC+GG MDDAFK+I ++ GLTT
Sbjct  148   WAFSAVAAMEGINKLTTGKLISLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIEQNKGLTT  207

Query  580   ESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQL  401
             E+ YPY G D G CN   A+  AAKI G+EDVP NSEAAL++A A QPVSVAIDA G   
Sbjct  208   EANYPYKGTD-GTCNTNKAAIHAAKITGFEDVPANSEAALMKAVAKQPVSVAIDAGGSDF  266

Query  400   QFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAK  221
             QFY+ G+FT  C T+L+HGVT VGYG  + G KYWL+KNSWG +WGE+GY R+Q+DI AK
Sbjct  267   QFYSSGIFTGSCDTQLDHGVTAVGYGVSD-GSKYWLVKNSWGAQWGEEGYIRMQKDISAK  325

Query  220   EGRCGIALDPSYPT  179
             EG CGIA+  SYPT
Sbjct  326   EGLCGIAMQASYPT  339



>gb|AAP32195.1| cysteine protease 5 [Trifolium repens]
Length=343

 Score =   384 bits (986),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 202/337 (60%), Positives = 242/337 (72%), Gaps = 5/337 (1%)
 Frame = -1

Query  1186  VFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVK  1007
             V  A+  C    A  +      DD + E RHE WM  YG+VY +  E+ KR  IF EN+K
Sbjct  10    VSLALFFCLGLLAIQVTSRTLQDDSIFE-RHEQWMTHYGKVYKNPQEREKRLRIFTENLK  68

Query  1006  AIESFNQAGD-RPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIP  830
              IE+ N AG+ +PY LGIN+FADLTN+EF++++N +K  +   +  R+  F+YEN T +P
Sbjct  69    YIEASNNAGNNKPYKLGINQFADLTNEEFIASRNKFKGHMCS-SIIRTTTFKYEN-TSVP  126

Query  829   SAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggd  650
             S VDWRK+GAVTPVKNQG CGCCWAFSA+AA EGI KIS G+LVSLSEQELVDCD  G D
Sbjct  127   STVDWRKKGAVTPVKNQGQCGCCWAFSAIAATEGIHKISTGKLVSLSEQELVDCDTNGVD  186

Query  649   lgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSE  470
              GC GG MDDAFK+II++NG++TE+GYPY G D G C    AS  AA I GYEDVP N+E
Sbjct  187   QGCEGGLMDDAFKFIIQNNGISTEAGYPYQGVD-GTCKANEASTSAATITGYEDVPANNE  245

Query  469   AALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLL  290
              AL +A A+QP+SVAIDA G   QFY  GVFT  CGTEL+HGVT VGYG    G KYWL+
Sbjct  246   NALQKAVANQPISVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGISNDGTKYWLV  305

Query  289   KNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             KNSWG  WGE+GY R+QR IDA EG CGIA+  SYPT
Sbjct  306   KNSWGTDWGEEGYIRMQRSIDAAEGLCGIAMQASYPT  342



>ref|XP_008228922.1| PREDICTED: vignain-like [Prunus mume]
Length=326

 Score =   383 bits (983),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 197/329 (60%), Positives = 243/329 (74%), Gaps = 11/329 (3%)
 Frame = -1

Query  1162  CSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQA  983
             C   ++S+Q      D  M  R+E WM RYGRVY D  EK  RF IFKENV  IES N  
Sbjct  7     CEATSRSLQ------DASMYGRYEQWMTRYGRVYNDVNEKENRFKIFKENVAFIESSNND  60

Query  982   GDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENV-TDIPSAVDWRKE  806
              ++PY LG+N+FADLTN+EF +++NG+K         ++  F+YENV   +P+A+DWRK+
Sbjct  61    VNKPYKLGVNQFADLTNEEFKASRNGFKGHECST---KTTSFKYENVKAPVPAAMDWRKK  117

Query  805   GAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRM  626
             GAVTP+K+QG CGCCWAFSAVAA EGI +++ G+L+SLSEQELVDCD  G D GC GG M
Sbjct  118   GAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTSGVDQGCEGGLM  177

Query  625   DDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAA  446
             DDAF++I +++GL+TE+ YPY G D G CN   A+  AAKI GYEDVP NSE ALL A A
Sbjct  178   DDAFQFIQQNHGLSTEANYPYNGVD-GSCNTKKAASIAAKITGYEDVPANSEKALLTAVA  236

Query  445   HQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKW  266
             HQPVSVAIDA G   QFY+ GVFT  CGT L+HGVT VGYG  + G KYWL+KNSWG +W
Sbjct  237   HQPVSVAIDAGGSDFQFYSSGVFTGSCGTSLDHGVTAVGYGVSDDGTKYWLVKNSWGTEW  296

Query  265   GEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             GE+GY R+QRD++AKEG CGIA++ SYPT
Sbjct  297   GEEGYIRMQRDVEAKEGLCGIAMEASYPT  325



>dbj|BAF56428.1| cysteine proteinase [Lotus japonicus]
Length=342

 Score =   384 bits (985),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 196/346 (57%), Positives = 255/346 (74%), Gaps = 5/346 (1%)
 Frame = -1

Query  1216  MVSRLIKNLIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAK  1037
             M S+ + N+   A +L     A ++     ED    +++RHE WM +YG+VY D  EK  
Sbjct  1     MASKTVLNISSLALLLVFGFLAFEANARTLEDVS--LKERHEQWMTQYGKVYTDSYEKEL  58

Query  1036  RFSIFKENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPF  857
             R +IFKENV+ IE+FN AG++PY LGIN+FADLTN+EF   +N +K  +   N  R+  F
Sbjct  59    RSNIFKENVQRIEAFNNAGNKPYKLGINQFADLTNEEF-KARNRFKGHMCS-NSTRTPTF  116

Query  856   RYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQEL  677
             +YE+V+ +P+++DWR++GAVTP+K+QG CGCCWAFSAVAA EGI K+S G+L+SLSEQEL
Sbjct  117   KYEDVSSVPASLDWRQKGAVTPIKDQGQCGCCWAFSAVAATEGITKLSTGKLISLSEQEL  176

Query  676   VdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAG  497
             VDCD  G D GC GG MDDAFK+I+++ GL TE+ YPY G D   CN    +  AA I G
Sbjct  177   VDCDTKGVDQGCEGGLMDDAFKFIMQNKGLNTEAKYPYQGVD-ATCNANAEAKDAASIKG  235

Query  496   YEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTG  317
             +EDVP NSE+ALL+A A+QP+SVAIDA G + QFY+ G+FT  CGTEL+HGVT VGYG  
Sbjct  236   FEDVPANSESALLKAVANQPISVAIDASGSEFQFYSSGLFTGSCGTELDHGVTAVGYGVS  295

Query  316   ERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             + G KYWL+KNSWGE+WGE+GY R+QRD+ A+EG CGIA+  SYPT
Sbjct  296   DDGTKYWLVKNSWGEQWGEEGYIRMQRDVAAEEGLCGIAMQASYPT  341



>ref|XP_008244498.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=345

 Score =   384 bits (985),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 201/347 (58%), Positives = 248/347 (71%), Gaps = 12/347 (3%)
 Frame = -1

Query  1213  VSRLIKNLIVFAAILACCSKA-AKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAK  1037
             + RL   L +   + A  SKA ++S+Q      D  M  RHE WM RYGRVY D  EK K
Sbjct  8     LCRLCTCLALIIMLGAWSSKATSRSLQ------DASMYGRHEQWMVRYGRVYTDNEEKEK  61

Query  1036  RFSIFKENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPF  857
             RF IFKENV  IES N    +PY L +N+F DLTN+EF++++N +K         ++  F
Sbjct  62    RFKIFKENVAYIESSNADASKPYKLRVNQFTDLTNEEFIASRNRFK---GHECSTKTTSF  118

Query  856   RYENVT-DIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQE  680
             +YENVT  +P+ +DWRK+GAVTP+K+QG CGCCWAFSAVAA EGI +++ G+LVSLSEQE
Sbjct  119   KYENVTASVPATMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLVSLSEQE  178

Query  679   LVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIA  500
             LVDCD  G D GC GG MDDAF++I +++GL+TE+ YPY G D G CN    +  AAKI 
Sbjct  179   LVDCDTKGVDQGCEGGLMDDAFQFIQQNHGLSTEANYPYNGVD-GTCNTKKEANIAAKIT  237

Query  499   GYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGT  320
             G+EDVP N E ALL A AHQPVSVAIDA G   QFY+ GVFT  CGT L+HGVT VGYG 
Sbjct  238   GHEDVPANDEKALLNAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGV  297

Query  319   GERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
              + G KYWL+KNSWG +WGE+GY R+QRD+DAKEG CGIA++ SYPT
Sbjct  298   SDDGTKYWLVKNSWGTEWGEEGYIRMQRDVDAKEGLCGIAMEASYPT  344



>ref|XP_011009172.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=340

 Score =   383 bits (984),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 195/314 (62%), Positives = 242/314 (77%), Gaps = 7/314 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M +RHE WM +YGRVY D+ E+A R+SIFKENV  I++FN    + Y LG+N+FADL
Sbjct  32    DAPMYERHEQWMTQYGRVYKDDNERATRYSIFKENVARIDAFNSQTGKSYKLGVNQFADL  91

Query  937   TNDEFVSTKNGYK-RPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCC  761
             TN+EF +++N +K    SP+    + PFRYENV+ +PS +DWRKEGAVTPVK+QG CGCC
Sbjct  92    TNEEFKASRNRFKGHMCSPQ----AGPFRYENVSAVPSTMDWRKEGAVTPVKDQGQCGCC  147

Query  760   WAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTT  581
             WAFSAVAA+EGI K++ G+L+SLSEQE+VDCD  G D GC+GG MDDAFK+I K+ GLTT
Sbjct  148   WAFSAVAAMEGINKLTTGKLISLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIEKNKGLTT  207

Query  580   ESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQL  401
             E+ YPY G   G CN   A+  AAKI G+EDVP NSEAAL++A A QPVSVAIDA G   
Sbjct  208   EANYPYKGTH-GTCNTKKAANHAAKITGFEDVPANSEAALMKAVAKQPVSVAIDAGGYDF  266

Query  400   QFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAK  221
             QFY+ G+FT  CGT+L+HGVT VGYG  + G KYWL+KNSWG +WGE+GY R+Q+D+ AK
Sbjct  267   QFYSSGIFTGSCGTQLDHGVTAVGYGVSD-GSKYWLVKNSWGAQWGEEGYIRMQKDVSAK  325

Query  220   EGRCGIALDPSYPT  179
             EG CGIA+  SYPT
Sbjct  326   EGLCGIAMQASYPT  339



>ref|XP_006449486.1| hypothetical protein CICLE_v10018236mg [Citrus clementina]
 gb|ESR62726.1| hypothetical protein CICLE_v10018236mg [Citrus clementina]
Length=312

 Score =   382 bits (981),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 200/313 (64%), Positives = 239/313 (76%), Gaps = 5/313 (2%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFN-QAGDRPYTLGINEFADLTN  932
             M +RHE WMA+YGRVY D  EK  RF IFKEN + I SFN +A ++PY LGINEFAD TN
Sbjct  1     MNERHEMWMAQYGRVYRDNAEKEMRFKIFKENAEYIASFNSKARNKPYKLGINEFADQTN  60

Query  931   DEFVSTKNGYKR--PVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             +EF + +NGYKR  P    +    + FRYENV+ +P+++DWRK GAVT VK+QG CGCCW
Sbjct  61    EEFRAPRNGYKRRLPNVRSSDTTDVSFRYENVS-VPASIDWRKNGAVTGVKDQGQCGCCW  119

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA+EGI +I+  +L SLSEQELVDCD  G D GC GG MDDAF++II + GL TE
Sbjct  120   AFSAVAAMEGINQITTRKLTSLSEQELVDCDTSGEDQGCEGGLMDDAFEFIINNKGLATE  179

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY   D G CN   A+  AAKI+GYEDVP N+EAAL++A A+QPVSVAIDA G   Q
Sbjct  180   AKYPYKASD-GSCNKKEANPSAAKISGYEDVPSNNEAALMKAVANQPVSVAIDASGSDFQ  238

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY+ GVFT +CGTEL+HGVT VGYGT + G KYWL+KNSWG  WGE+GY R+QRDIDAKE
Sbjct  239   FYSSGVFTGQCGTELDHGVTAVGYGTADDGTKYWLVKNSWGTTWGENGYIRMQRDIDAKE  298

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYPT
Sbjct  299   GLCGIAMQASYPT  311



>ref|XP_006380488.1| hypothetical protein POPTR_0007s07170g [Populus trichocarpa]
 gb|ERP58285.1| hypothetical protein POPTR_0007s07170g [Populus trichocarpa]
Length=340

 Score =   383 bits (983),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 195/314 (62%), Positives = 242/314 (77%), Gaps = 7/314 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M +RHE WM +YGRVY D+ E+A R+SIFKENV  I++FN    + Y LG+N+FADL
Sbjct  32    DAPMYERHEQWMTQYGRVYKDDNERATRYSIFKENVARIDAFNSQTGKSYKLGVNQFADL  91

Query  937   TNDEFVSTKNGYK-RPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCC  761
             TN+EF +++N +K    SP+    + PFRYENV+ +PS VDWRKEGAVTPVK+QG CGCC
Sbjct  92    TNEEFKASRNRFKGHMCSPQ----AGPFRYENVSAVPSTVDWRKEGAVTPVKDQGQCGCC  147

Query  760   WAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTT  581
             WAFSAVAA+EGI K++ G+L+SLSEQE+VDCD  G D GC+GG MDDAFK+I ++ GLTT
Sbjct  148   WAFSAVAAMEGINKLTTGKLISLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIEQNKGLTT  207

Query  580   ESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQL  401
             E+ YPY G D G CN   ++  AAKI G+EDVP NSEAAL++A A QPVSVAIDA G   
Sbjct  208   EANYPYKGTD-GTCNTKKSAIHAAKITGFEDVPANSEAALMKAVAKQPVSVAIDAGGSDF  266

Query  400   QFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAK  221
             QFY+ G+FT  C T+L+HGVT VGYG  + G KYWL+KNSWG +WGE+GY R+Q+DI AK
Sbjct  267   QFYSSGIFTGSCDTQLDHGVTAVGYGVSD-GSKYWLVKNSWGAQWGEEGYIRMQKDISAK  325

Query  220   EGRCGIALDPSYPT  179
             EG CGIA+  SYPT
Sbjct  326   EGLCGIAMQASYPT  339



>ref|XP_002525123.1| cysteine protease, putative [Ricinus communis]
 gb|EEF37250.1| cysteine protease, putative [Ricinus communis]
Length=349

 Score =   383 bits (984),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 198/337 (59%), Positives = 248/337 (74%), Gaps = 7/337 (2%)
 Frame = -1

Query  1189  IVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENV  1010
             I    +LA C+  A S + L+E +   M  RHE WMA++G+VY D+ EK +RF IFK NV
Sbjct  12    IALFFVLAMCADQAASRE-LHELE---MTGRHEKWMAKHGKVYKDDKEKLRRFQIFKSNV  67

Query  1009  KAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIP  830
               IESFN AG++ Y LGIN+FADLTN+EF +  NGYKRP+      +  PF+YENVT +P
Sbjct  68    VFIESFNTAGNKSYMLGINKFADLTNEEFRAFWNGYKRPLGASR--KITPFKYENVTALP  125

Query  829   SAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggd  650
             S++DWR +GAVTP+K+QGVCG CWAFSAVAA EGI K+  G+LVSLSEQELVDCD  G D
Sbjct  126   SSIDWRSKGAVTPIKDQGVCGSCWAFSAVAATEGIHKLRTGKLVSLSEQELVDCDVKGQD  185

Query  649   lgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSE  470
              GC GG M DAFK+I +H G+T+E+ YPY G+D G+C+    + RA KI GY+ VP NSE
Sbjct  186   KGCQGGLMVDAFKFIKRHGGMTSEANYPYQGRD-GKCDTKKEASRAVKITGYQAVPKNSE  244

Query  469   AALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLL  290
             AALL+A A+QPVSVAIDA  L  QFY  G+FT  CG ++NHGV  VGYG    G KYW++
Sbjct  245   AALLKAVANQPVSVAIDAGSLSFQFYRSGIFTGICGKDINHGVAAVGYGRSNSGSKYWIV  304

Query  289   KNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             KNSWG +WGE GY R++RD+ +KEG CGIA++ SYPT
Sbjct  305   KNSWGTEWGEKGYIRMKRDVRSKEGLCGIAMECSYPT  341



>gb|EYU25680.1| hypothetical protein MIMGU_mgv1a019612mg [Erythranthe guttata]
Length=328

 Score =   382 bits (980),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 187/313 (60%), Positives = 232/313 (74%), Gaps = 2/313 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M +RHE WM +YGR Y ++ EKA RF+IFK+NV+ I+S N+A  R Y L IN+FADL
Sbjct  17    DTSMVERHEQWMVQYGRTYKNDAEKANRFNIFKDNVEYIQSVNEAETRTYKLAINKFADL  76

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
              ++EF +++NGYK     ++  + + FRY NV+ +P ++DW K+GAVTPVK+QG CGCCW
Sbjct  77    KHEEFQASRNGYKMRSQSKSSSKVLSFRYANVSGVPPSMDWTKKGAVTPVKDQGQCGCCW  136

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA EGI +++ G LVSLSEQELVDCD         G  MD+AF++II +NGLTTE
Sbjct  137   AFSAVAATEGINQLTTGNLVSLSEQELVDCDTSEDQGCNGGL-MDNAFEFIISNNGLTTE  195

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             S YPY G D G CN    S  AA+I GYEDVP NSE+ALL+A A+QP+SVAIDA G  +Q
Sbjct  196   SNYPYEGVD-GTCNSKKESSHAARITGYEDVPSNSESALLKAVANQPISVAIDASGPDIQ  254

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY+ GVFT +CGTEL+HGVT VGYG    G KYWL+KNSWG  WGE+GY R+QRDI A E
Sbjct  255   FYSTGVFTGQCGTELDHGVTAVGYGATNDGTKYWLVKNSWGTSWGENGYIRMQRDIHAAE  314

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYPT
Sbjct  315   GLCGIAMQASYPT  327



>ref|XP_007214432.1| hypothetical protein PRUPE_ppa025658mg [Prunus persica]
 gb|EMJ15631.1| hypothetical protein PRUPE_ppa025658mg [Prunus persica]
Length=339

 Score =   382 bits (981),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 197/339 (58%), Positives = 248/339 (73%), Gaps = 13/339 (4%)
 Frame = -1

Query  1192  LIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKEN  1013
             +++F A   CC   ++S+Q      D  M  R+E WM RYGR+Y D  EK  RF IFKEN
Sbjct  12    ILMFGAW--CCEATSRSLQ------DASMYGRYEQWMTRYGRIYNDVNEKENRFKIFKEN  63

Query  1012  VKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENV-TD  836
             V  IES N   ++PY LG+N+FADLTN+EF +++NG+K         ++  F+YENV   
Sbjct  64    VAFIESSNNDVNKPYKLGVNQFADLTNEEFKASRNGFKGHECST---KTTSFKYENVKAP  120

Query  835   IPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgg  656
             +P+ +DWRK+GAVTP+K+QG CGCCWAFSAVAA EGI +++ G+L+SLSEQELVDCD  G
Sbjct  121   VPATMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTSG  180

Query  655   gdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMN  476
              D GC GG MDDAF++I +++GL+TE+ YPY G D G CN   A+  AAKI GYEDVP N
Sbjct  181   EDQGCEGGLMDDAFQFIQQNHGLSTEANYPYNGVD-GSCNTKKAASIAAKITGYEDVPAN  239

Query  475   SEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYW  296
             SE ALL A AHQPVSVAIDA G   QFY+ GVFT  CGT L+HGVT VGYG  + G K+W
Sbjct  240   SEKALLTAVAHQPVSVAIDAGGSDFQFYSSGVFTGACGTSLDHGVTAVGYGVSDDGTKFW  299

Query  295   LLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             L+KNSWG +WGE+GY R+QRD++AKEG CGIA++ SYPT
Sbjct  300   LVKNSWGTEWGEEGYIRMQRDVEAKEGLCGIAMEASYPT  338



>ref|XP_006362426.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score =   382 bits (981),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 198/310 (64%), Positives = 229/310 (74%), Gaps = 4/310 (1%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M ++HE WMA +GRVY D+TEKAKRF+IFK+N   IES N+AG RPY L IN FADLTN+
Sbjct  34    MVQKHEKWMAHFGRVYRDDTEKAKRFNIFKDNFDYIESINKAGMRPYKLRINGFADLTNE  93

Query  928   EFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFS  749
             EF +T NGYK   SP    ++  FRYENVT  P+ +DWRK+GAVT VK+QG CGCCWAFS
Sbjct  94    EFRATHNGYKMS-SPHMSSKTTFFRYENVT-APATMDWRKKGAVTGVKDQGQCGCCWAFS  151

Query  748   AVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGY  569
             AVAA EGI +I  G+L+SLSEQELVDCD         G  MDDAFK+IIK++GLTTES Y
Sbjct  152   AVAATEGINEIKTGKLISLSEQELVDCDTSSDMGCEGGL-MDDAFKFIIKNHGLTTESNY  210

Query  568   PYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYA  389
             PY G D G C     S  AAKI GYEDVP NSE+ALL A A+QPVSVAIDA G   QFY+
Sbjct  211   PYEGTD-GTCKTGKESNDAAKITGYEDVPANSESALLNAVANQPVSVAIDASGSDFQFYS  269

Query  388   GGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRC  209
              GVFT  CGTEL+HGVT VGYG    G KYWL+KNSWG  WGE+GY R+QR +  +EG C
Sbjct  270   SGVFTGECGTELDHGVTAVGYGITSDGTKYWLIKNSWGTSWGENGYIRMQRGVVPEEGLC  329

Query  208   GIALDPSYPT  179
             GIA+  SYPT
Sbjct  330   GIAMQASYPT  339



>ref|XP_010906196.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=342

 Score =   382 bits (980),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 200/346 (58%), Positives = 248/346 (72%), Gaps = 5/346 (1%)
 Frame = -1

Query  1216  MVSRLIKNLIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAK  1037
             M   L K+L +   +L  C+ A+ +   +    +  M +RHE WM+++GRVY D  EK +
Sbjct  1     MTLPLTKSLCMALFVLLLCTFASHATARML--SEMTMHERHEQWMSQHGRVYGDSAEKER  58

Query  1036  RFSIFKENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPF  857
             RF IFK NV+ IESFN AG+  Y LG+N+FADLT +EF +  NG+K P S      +  F
Sbjct  59    RFQIFKANVELIESFN-AGNSKYKLGVNQFADLTIEEFKAMMNGFK-PSSVNTFKATNVF  116

Query  856   RYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQEL  677
             RYENVT +P+++DWR EGAVTP+K+QG  GCCWAFSAVAA+EGI K+  G+L+SLSEQEL
Sbjct  117   RYENVTAVPTSMDWRAEGAVTPIKDQGDYGCCWAFSAVAAMEGITKLKTGKLISLSEQEL  176

Query  676   VdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAG  497
             VDCD  G D GC GG MDDAF++II++ GLTTE+ YPY G D G CN   +   AA I G
Sbjct  177   VDCDVAGEDQGCEGGLMDDAFEFIIRNGGLTTETNYPYKGID-GTCNTKKSFSHAASIKG  235

Query  496   YEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTG  317
             YEDVP NSEAALL A ++QPVSVAI+A G   QFY+ GVFT  CGT+L+HGVT VGYGT 
Sbjct  236   YEDVPANSEAALLNAVSNQPVSVAIEASGYSFQFYSSGVFTGSCGTDLDHGVTAVGYGTA  295

Query  316   ERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
               G KYWL+KNSWG  WGE GY R++RD+ AKEG CGIA+  SYPT
Sbjct  296   RDGTKYWLVKNSWGSSWGESGYVRMERDVAAKEGLCGIAMKASYPT  341



>ref|XP_002307151.2| hypothetical protein POPTR_0005s09140g, partial [Populus trichocarpa]
 gb|EEE94147.2| hypothetical protein POPTR_0005s09140g, partial [Populus trichocarpa]
Length=309

 Score =   380 bits (977),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 193/314 (61%), Positives = 242/314 (77%), Gaps = 7/314 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M +RHE WMA+YGRVY D+ EK  R++IFKENV  I++FN    + Y LG+N+FADL
Sbjct  1     DVSMYERHEQWMAQYGRVYKDDAEKETRYNIFKENVARIDAFNSQTGKSYNLGVNQFADL  60

Query  937   TNDEFVSTKNGYK-RPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCC  761
             TN+EF +++N +K    SP+    + PFRYENV+ +P+ +DWRK+GAVTPVK+QG CGCC
Sbjct  61    TNEEFKASRNRFKGHMCSPQ----AGPFRYENVSAVPATMDWRKKGAVTPVKDQGQCGCC  116

Query  760   WAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTT  581
             WAFSAVAA+EGI +++ G+L+SLSEQE+VDCD  G D GC+GG MDDAFK+I ++ GLTT
Sbjct  117   WAFSAVAAMEGINQLTTGKLISLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIEQNKGLTT  176

Query  580   ESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQL  401
             E+ YPY G D G CN       AAKI G++DVP NSEAAL++A A QPVSVAIDA G + 
Sbjct  177   EANYPYTGTD-GTCNTQKEVSHAAKITGFQDVPANSEAALMKAVAKQPVSVAIDAGGFEF  235

Query  400   QFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAK  221
             QFY+ G+FT  CGTEL+HGVT VGYG G  G KYWL+KNSWG +WGE+GY R+Q+DI AK
Sbjct  236   QFYSSGIFTGSCGTELDHGVTAVGYG-GSDGTKYWLVKNSWGAQWGEEGYIRMQKDISAK  294

Query  220   EGRCGIALDPSYPT  179
             EG CGIA+  SYPT
Sbjct  295   EGLCGIAMQASYPT  308



>ref|XP_011022002.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=365

 Score =   382 bits (982),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 202/353 (57%), Positives = 260/353 (74%), Gaps = 18/353 (5%)
 Frame = -1

Query  1219  KMVSRLIKN----LIVFAAILACCSKA-AKSMQGLNEDDDDVMEKRHEDWMARYGRVYAD  1055
             K + R  K     L +   ++A  SK+ A+++Q      D  M +RHE WMA+YGRVY D
Sbjct  24    KSIMRFTKQSQICLALLFVLVAWPSKSVARTLQ------DVSMYERHEQWMAQYGRVYKD  77

Query  1054  ETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYK-RPVSPRN  878
             + EK  R++IFKENV  I++FN    + Y LG+N+FADL+N+EF +++N +K    SP+ 
Sbjct  78    DAEKETRYNIFKENVARIDAFNSQTGKSYKLGVNQFADLSNEEFKASRNRFKGHMCSPQ-  136

Query  877   PWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELV  698
                + PFRYENV+ +P+ +DWRK+GAVTPVK+QG CGCCWAFSAVAA+EGI +++ G+L+
Sbjct  137   ---AGPFRYENVSAVPATMDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGINQLTTGKLI  193

Query  697   SLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASF  518
             SLSEQE+VDCD  G D GC+GG MDDAFK+I ++ GLTTE+ YPY G D G CN    + 
Sbjct  194   SLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIEQNKGLTTEANYPYTGTD-GTCNTQKEAN  252

Query  517   RAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVT  338
              AAKI G+EDVP NSEAAL++A A QPVSVAIDA G + QFY+ G+FT  CGTEL+HGVT
Sbjct  253   HAAKITGFEDVPANSEAALIKAVAKQPVSVAIDAGGFEFQFYSSGIFTGSCGTELDHGVT  312

Query  337   VVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
              VGYG G  G KYWL+KNSWG +WGE+GY R+Q+DI AKEG CGIA+  SYPT
Sbjct  313   AVGYG-GSDGTKYWLVKNSWGAQWGEEGYIRMQKDISAKEGLCGIAMQASYPT  364



>gb|KHN13721.1| Vignain [Glycine soja]
Length=326

 Score =   381 bits (978),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 190/313 (61%), Positives = 237/313 (76%), Gaps = 2/313 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M +RHE WM RYG+VY D  E+ KRF IFKENV  IE+FN A ++ Y L IN+FADL
Sbjct  15    DASMYERHEQWMTRYGKVYKDPQEREKRFRIFKENVNYIEAFNNAANKRYKLAINQFADL  74

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF++ +N +K  +   +  R+  F+YENVT +PS VDWR++GAVTP+K+QG CGCCW
Sbjct  75    TNEEFIAPRNRFKGHMCS-SIIRTTTFKYENVTAVPSTVDWRQKGAVTPIKDQGQCGCCW  133

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA EGI  ++ G+L+SLSEQELVDCD  G D GC GG MDDAFK++I+++GL TE
Sbjct  134   AFSAVAATEGIHALTSGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFVIQNHGLNTE  193

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D G+CN+  A+  AA I GYEDVP N+E AL +A A+QPVSVAIDA G   Q
Sbjct  194   ANYPYKGVD-GKCNVNEAANDAATITGYEDVPANNEKALQKAVANQPVSVAIDASGSDFQ  252

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY  GVFT  CGTEL+HGVT VGYG    G +YWL+KNSWG +WGE+GY R+QR +D++E
Sbjct  253   FYKSGVFTGSCGTELDHGVTAVGYGVSNDGTEYWLVKNSWGTEWGEEGYIRMQRGVDSEE  312

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYPT
Sbjct  313   GLCGIAMQASYPT  325



>ref|XP_008244476.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=339

 Score =   381 bits (979),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 196/329 (60%), Positives = 243/329 (74%), Gaps = 11/329 (3%)
 Frame = -1

Query  1162  CSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQA  983
             C   ++S+Q      D  M  ++E WM RYGRVY D  EK  RF IFKENV  IES N  
Sbjct  20    CEATSRSLQ------DASMYGKYEQWMTRYGRVYNDVNEKENRFKIFKENVAFIESSNND  73

Query  982   GDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENV-TDIPSAVDWRKE  806
              ++PY LG+N+FADLTN+EF +++NG+K         ++  F+YENV   +P+A+DWRK+
Sbjct  74    VNKPYKLGVNQFADLTNEEFKASRNGFKGHECST---KTTSFKYENVKAPVPAAMDWRKK  130

Query  805   GAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRM  626
             GAVTP+K+QG CGCCWAFSAVAA EGI +++ G+L+SLSEQELVDCD  G D GC GG M
Sbjct  131   GAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTSGVDQGCEGGLM  190

Query  625   DDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAA  446
             DDAF++I +++GL+TE+ YPY G D G CN   A+  AAKI GYEDVP NSE ALL A A
Sbjct  191   DDAFQFIQQNHGLSTEANYPYNGVD-GSCNTKKAASIAAKITGYEDVPANSEKALLTAVA  249

Query  445   HQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKW  266
             HQPVSVAIDA G   QFY+ GVFT  CGT L+HGVT VGYG  + G KYWL+KNSWG +W
Sbjct  250   HQPVSVAIDAGGSDFQFYSSGVFTGSCGTSLDHGVTAVGYGVSDDGTKYWLVKNSWGTEW  309

Query  265   GEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             GE+GY R+QRD++AKEG CGIA++ SYPT
Sbjct  310   GEEGYIRMQRDVEAKEGLCGIAMEASYPT  338



>gb|KDP23984.1| hypothetical protein JCGZ_25372 [Jatropha curcas]
Length=340

 Score =   381 bits (979),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 206/351 (59%), Positives = 252/351 (72%), Gaps = 17/351 (5%)
 Frame = -1

Query  1216  MVSRLIKNLIVFAAILACCSKA----AKSMQGLNEDDDDVMEKRHEDWMARYGRVYADET  1049
             M   +    I FA IL   + A    A+S+       D  M +RHE+WMA+YG VY D  
Sbjct  1     MAPTIQCRCICFAFILILVALAYQAEARSL------PDASMYERHEEWMAKYGIVYKDAN  54

Query  1048  EKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYK-RPVSPRNPW  872
             EK  R  IF ENV+ IE FN+A ++PY LGIN+FADLTN+EF +++N +K    SP+   
Sbjct  55    EKEMRHKIFNENVERIEYFNRAANKPYKLGINQFADLTNEEFKTSRNRFKGHMCSPQ---  111

Query  871   RSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSL  692
              + PFRYENVT +PS++DWRK+GAVTP+K+QG CG CWAFSAVAAVEGI +++  +L+SL
Sbjct  112   -AGPFRYENVTAVPSSMDWRKKGAVTPIKDQGQCGSCWAFSAVAAVEGITQLTTQKLISL  170

Query  691   SEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRA  512
             SEQELVDCD  G D GC GG MDDAFK+I  + GLTTE+ YPY G D G CN    +  A
Sbjct  171   SEQELVDCDTKGEDQGCQGGLMDDAFKFIETNQGLTTEANYPYEGSD-GTCNSNKEANHA  229

Query  511   AKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVV  332
             AKI GYEDVP N+EAALL+A A QPVSVAIDA G + QFY+ G+FT  CGTEL+HGV  V
Sbjct  230   AKITGYEDVPANNEAALLKAVAKQPVSVAIDAGGYEFQFYSSGIFTGDCGTELDHGVAAV  289

Query  331   GYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             GYG  + G  YWL+KNSWG +WGE+GY R+QRDIDAKEG CGIA+  SYPT
Sbjct  290   GYGVSQ-GTNYWLVKNSWGTQWGEEGYIRMQRDIDAKEGLCGIAMQASYPT  339



>ref|XP_007132875.1| hypothetical protein PHAVU_011G132100g [Phaseolus vulgaris]
 gb|ESW04869.1| hypothetical protein PHAVU_011G132100g [Phaseolus vulgaris]
Length=343

 Score =   381 bits (979),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 194/333 (58%), Positives = 245/333 (74%), Gaps = 3/333 (1%)
 Frame = -1

Query  1177  AILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIE  998
             A+L C +  A  +      D  + E RHE+WMARY RVY D  EK KRF IFK+N+  IE
Sbjct  13    AMLFCMAFWALQVTSRTLQDASIYE-RHEEWMARYSRVYKDPQEKEKRFRIFKQNMNYIE  71

Query  997   SFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVD  818
             +FN A ++PY L IN+FADLTN+EF++ +N +K  +   +  ++  F+YENVT +PS VD
Sbjct  72    AFNNAANKPYKLAINQFADLTNEEFIAPRNRFKGHMRS-SIIKTTTFKYENVTSVPSTVD  130

Query  817   WRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgch  638
             WR++GAVTPVK+QG CGCCWAFSAVA+ EGI +++ G+L+SLSEQELVDCD  G D GC 
Sbjct  131   WRQKGAVTPVKDQGQCGCCWAFSAVASAEGIHQLTTGKLISLSEQELVDCDTKGVDQGCE  190

Query  637   gGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALL  458
             GG MDDAFK+II++NGL TE+ YP+ G D G CN   AS  AA I GYEDVP N+E AL 
Sbjct  191   GGLMDDAFKFIIQNNGLNTEANYPFKGVD-GTCNAKAASSHAATIRGYEDVPANNEKALQ  249

Query  457   QAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSW  278
             +A  +QPVSVAIDA G   +FY  GVFT  CGTEL+HGVT VGYG  + G +YWL+KNSW
Sbjct  250   KAVTNQPVSVAIDASGSDFKFYKSGVFTGSCGTELDHGVTAVGYGVSDDGTEYWLVKNSW  309

Query  277   GEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             G +WGE+GY R+QR +D++EG CGIA+  SYPT
Sbjct  310   GTEWGEEGYIRMQRGVDSEEGLCGIAMQASYPT  342



>ref|XP_003605890.1| Cysteine proteinase [Medicago truncatula]
 gb|AES88087.1| papain family cysteine protease [Medicago truncatula]
Length=343

 Score =   381 bits (979),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 193/313 (62%), Positives = 233/313 (74%), Gaps = 3/313 (1%)
 Frame = -1

Query  1114  DVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQA-GDRPYTLGINEFADL  938
             D M +RH  WM++YG+VY D  E+ KRF IF ENV  IE+FN+   ++ YTLG+N+FADL
Sbjct  32    DDMYERHRQWMSQYGKVYKDSQEREKRFKIFTENVNYIEAFNKGDNNKLYTLGVNQFADL  91

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TNDEF S++N +K  +   +  R+  F+YEN + IPS+VDWRK+GAVTPVKNQG CGCCW
Sbjct  92    TNDEFTSSRNKFKGHMCS-SITRTSTFKYENASAIPSSVDWRKKGAVTPVKNQGQCGCCW  150

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA EGI K+S G+L+SLSEQELVDCD  G D GC GG MDDAFK+II+++GL TE
Sbjct  151   AFSAVAATEGIHKLSTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFIIQNHGLNTE  210

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D G CN    S  A  I GYEDVP N+E AL +A A+QP+SVAIDA G   Q
Sbjct  211   ANYPYQGVD-GTCNANKGSINAVTITGYEDVPTNNEQALQKAVANQPISVAIDASGSDFQ  269

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY  GVFT  CGTEL+HGVT VGYG    G KYWL+KNSWG +WGE+GY  +QR +DA E
Sbjct  270   FYKSGVFTGSCGTELDHGVTAVGYGVSNDGTKYWLVKNSWGTEWGEEGYIMMQRGVDAAE  329

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYPT
Sbjct  330   GLCGIAMQASYPT  342



>ref|XP_008805390.1| PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score =   381 bits (978),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 198/347 (57%), Positives = 250/347 (72%), Gaps = 7/347 (2%)
 Frame = -1

Query  1216  MVSRLIKNLIV-FAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKA  1040
             M   L K+L + F+ +L C   +  + + L+E     M +RHE WMA+ GR Y D  EK 
Sbjct  1     MTVPLPKSLCMGFSVLLLCACASHATARTLSEM---TMAERHEQWMAQQGRAYRDSAEKE  57

Query  1039  KRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMP  860
             +R+ IFK NV+ IESFN AG+  Y LG+N+FADLTN+EF +  NG+K P + +    +  
Sbjct  58    RRYQIFKANVELIESFN-AGNSKYKLGVNQFADLTNEEFKAMMNGFK-PSTLKTLKATNV  115

Query  859   FRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQE  680
             F YENVT +PS++DWR +GAVTP+K+QG CGCCWAFSAVAA+EGI K+  G+L+SLSEQE
Sbjct  116   FSYENVTAVPSSMDWRAKGAVTPIKDQGQCGCCWAFSAVAAMEGITKLKTGKLMSLSEQE  175

Query  679   LVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIA  500
             LVDCD    D GC GG MD+AFK+II + GLTTE+ YPY G D G CN   ++   A I 
Sbjct  176   LVDCDVASDDQGCDGGLMDNAFKFIINNRGLTTETNYPYKGID-GTCNSKKSASHVASIK  234

Query  499   GYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGT  320
             GYEDVP NSEAALL+A A+QPVSVAI+A     QFY+ G+FT  CGT+L+HGVT VGYGT
Sbjct  235   GYEDVPANSEAALLKAVANQPVSVAIEASSGSFQFYSSGIFTGSCGTDLDHGVTTVGYGT  294

Query  319   GERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
              + G KYWL+KNSWG  WGE GY R++RD+ AKEG CGIA++ SYPT
Sbjct  295   TKDGTKYWLVKNSWGSSWGEKGYIRMERDVAAKEGLCGIAMEASYPT  341



>ref|XP_007132275.1| hypothetical protein PHAVU_011G081100g [Phaseolus vulgaris]
 gb|ESW04269.1| hypothetical protein PHAVU_011G081100g [Phaseolus vulgaris]
Length=341

 Score =   381 bits (978),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 196/344 (57%), Positives = 249/344 (72%), Gaps = 11/344 (3%)
 Frame = -1

Query  1204  LIKNLIVFAAILACCS--KAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRF  1031
             L  + +    + A C+    A+++Q      D  M +RHE WM  +G++Y D +EK +++
Sbjct  6     LFHSTLALVIVFAFCALEANARTLQ------DASMRERHEQWMVTHGKLYLDSSEKEQKY  59

Query  1030  SIFKENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRY  851
              IFKENV+ IE+FN AG++PY LGIN+FADLTN+EF   +N +K  +      R+  F+Y
Sbjct  60    QIFKENVQRIEAFNNAGNKPYKLGINQFADLTNEEF-KARNRFKGHICSTIT-RTPTFKY  117

Query  850   ENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVd  671
             E+VT +P+++DWR++GAVTP+K+QG CG CWAFSAVAA EGI K+S G+L+SLSEQEL+D
Sbjct  118   EHVTALPTSLDWRQKGAVTPIKDQGQCGSCWAFSAVAATEGITKLSTGKLISLSEQELID  177

Query  670   cdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYE  491
             CD  G D GC GG MDDAFK+I+ + GLTTE+ YPY G D G CN    S  AA I GYE
Sbjct  178   CDTKGEDQGCEGGLMDDAFKFILNNKGLTTEATYPYEGID-GTCNAKAESSHAASIKGYE  236

Query  490   DVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGER  311
             DVP NSE+ALL+A A+QPVSVAIDA G + QFYAGGVF   C T L+HGVT VGYG  + 
Sbjct  237   DVPANSESALLKAVANQPVSVAIDASGYEFQFYAGGVFNGSCDTNLDHGVTAVGYGVSDD  296

Query  310   GIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             G KYWL+KNSWG KWGE GY R+QRD+ AKEG CGIA+  SYPT
Sbjct  297   GSKYWLVKNSWGVKWGEKGYIRMQRDVSAKEGLCGIAMLASYPT  340



>ref|XP_007050065.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX94222.1| Senescence-associated gene 12 [Theobroma cacao]
Length=342

 Score =   381 bits (978),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 200/338 (59%), Positives = 242/338 (72%), Gaps = 6/338 (2%)
 Frame = -1

Query  1192  LIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKEN  1013
             +I F  ILA C     S Q L+E     + +RHE WM  YGRVY ++ E   RFSIFK N
Sbjct  10    IIAFFLILAVCIPNVMSRQ-LHEAS---LSQRHEQWMEEYGRVYKNDAETELRFSIFKSN  65

Query  1012  VKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDI  833
             +  IESFN AG+RPY L INEFAD TN+EF + +NGY R        +   FRYENVT +
Sbjct  66    LAFIESFNAAGNRPYKLSINEFADQTNEEFRAYRNGYGR-AQRLTSRKETSFRYENVTAL  124

Query  832   PSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkggg  653
             P++VDWRK+GAVTP+K+Q  CG CWAFSAVAA EGI +++ G+L+SLSEQELVDCD  G 
Sbjct  125   PASVDWRKKGAVTPIKDQAQCGSCWAFSAVAATEGIHQLTTGKLISLSEQELVDCDTQGE  184

Query  652   dlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNS  473
             D GC GG M+DAF++II+++G+ +E  YPY G D G CN T  +  AA I GYE VP NS
Sbjct  185   DQGCAGGEMEDAFEFIIRNHGIASEVTYPYKGDD-GTCNKTKEASHAATITGYEVVPANS  243

Query  472   EAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWL  293
             E AL++A A+QPVSV+IDA G   QFY+ G+FT  CGTEL+HGVT VGYGT E G  YWL
Sbjct  244   EKALMKAVANQPVSVSIDAGGYAFQFYSSGIFTGDCGTELDHGVTAVGYGTSEDGTMYWL  303

Query  292   LKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             +KNSWG  WGE GY R+QRDI AKEG CGIA+D SYPT
Sbjct  304   VKNSWGTGWGEKGYIRMQRDIKAKEGLCGIAMDSSYPT  341



>ref|XP_007132887.1| hypothetical protein PHAVU_011G133200g [Phaseolus vulgaris]
 gb|ESW04881.1| hypothetical protein PHAVU_011G133200g [Phaseolus vulgaris]
Length=343

 Score =   381 bits (978),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 190/313 (61%), Positives = 233/313 (74%), Gaps = 2/313 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M +RHE+WM RYGRVY D  E+ KR  IFKENV  IE+FN A ++PY L +N+FADL
Sbjct  32    DASMNERHEEWMTRYGRVYKDPPEREKRLRIFKENVNYIEAFNNAANKPYKLAVNQFADL  91

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF++ +N +K  +      R+  F+YENVT +PS VDWR++GAVTPVK+QG CGCCW
Sbjct  92    TNEEFIAPRNRFKGHMCSSIT-RTTSFKYENVTAVPSTVDWRQKGAVTPVKDQGQCGCCW  150

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA EGI  ++ G+L+SLSEQELVDCD  G D GC GG MDDAFK++I++ GL TE
Sbjct  151   AFSAVAAAEGIHALTAGKLISLSEQELVDCDSKGVDQGCEGGLMDDAFKFVIQNQGLNTE  210

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D   CN   AS  AA I GYEDVP N+E AL +A  +QPVSVAIDA G   Q
Sbjct  211   ANYPYKGTD-ETCNANAASGHAATIKGYEDVPANNEKALQKAVVNQPVSVAIDASGSDFQ  269

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY  GVFT  CGTEL+HGVT VGYG  + G +YWL+KNSWG +WGE+GY R+QR +D++E
Sbjct  270   FYESGVFTGSCGTELDHGVTAVGYGVSDDGTEYWLVKNSWGTEWGEEGYIRMQRGVDSEE  329

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYPT
Sbjct  330   GLCGIAMQASYPT  342



>ref|XP_003612210.1| Cysteine proteinase [Medicago truncatula]
 gb|AES95168.1| papain family cysteine protease [Medicago truncatula]
Length=344

 Score =   380 bits (977),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 199/338 (59%), Positives = 241/338 (71%), Gaps = 9/338 (3%)
 Frame = -1

Query  1189  IVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENV  1010
             +VF   L      ++++Q      D  M +RHE WM  YG+VY D  E+ KRF IF EN+
Sbjct  14    LVFCLGLWAIQVTSRTLQ------DGSMHERHERWMNHYGKVYKDHQEREKRFKIFTENM  67

Query  1009  KAIESFNQA-GDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDI  833
             K IE+FN    +  Y LGIN+FADLTN+EFV+++N +K  +   +  R+  F+YENV+ I
Sbjct  68    KYIEAFNNGDNNESYKLGINQFADLTNEEFVASRNKFKGHMCS-SIIRTTTFKYENVSAI  126

Query  832   PSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkggg  653
             PS VDWRK+GAVTPVKNQG CGCCWAFSAVAA EGI K+S G+LVSLSEQELVDCD  G 
Sbjct  127   PSTVDWRKKGAVTPVKNQGQCGCCWAFSAVAATEGIHKLSTGKLVSLSEQELVDCDTKGV  186

Query  652   dlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNS  473
             D GC GG MDDAFK+II+++GL TE+ YPY G D G CN   AS +A  I GYEDVP N+
Sbjct  187   DQGCEGGLMDDAFKFIIQNHGLNTEAQYPYQGVD-GTCNANKASIQATTITGYEDVPANN  245

Query  472   EAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWL  293
             E AL +A A+QP+SVAIDA G   QFY  GVFT  CGTEL+HGVT VGYG    G KYWL
Sbjct  246   EQALQKAVANQPISVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSNDGTKYWL  305

Query  292   LKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             +KNSWG  WGE+GY  +QR ++A EG CGIA+  SYPT
Sbjct  306   VKNSWGTDWGEEGYIMMQRGVEAAEGLCGIAMQASYPT  343



>ref|XP_008228868.1| PREDICTED: LOW QUALITY PROTEIN: zingipain-2-like [Prunus mume]
Length=345

 Score =   380 bits (977),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 205/354 (58%), Positives = 255/354 (72%), Gaps = 18/354 (5%)
 Frame = -1

Query  1219  KMVSRLI-KNLIVFAAIL----ACCSKA-AKSMQGLNEDDDDVMEKRHEDWMARYGRVYA  1058
             + +SRL  K  +  A IL    AC S+A ++S+Q      D  M  RHE WMARYGR Y 
Sbjct  2     EFISRLQGKACVCLALILIMLGACSSEATSRSLQ------DASMYGRHEQWMARYGRTYN  55

Query  1057  DETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRN  878
             D  EK KRF+IFKENV  IES N   ++ Y L +N+FADLTNDEF +++N +K       
Sbjct  56    DIREKEKRFNIFKENV-XIESSNDDANKLYKLSVNQFADLTNDEFKASRNRFK---GHEC  111

Query  877   PWRSMPFRYENVT-DIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGEL  701
               ++  F+YENVT  +P+ +DWRK+GAVTP+K+QG CGCCWAFSAVAA EGI +++ G+L
Sbjct  112   STKTTSFKYENVTASVPTTMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKL  171

Query  700   VSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTAS  521
             +SLSEQELVDCD  G D GC GG MDDAF++I +++GL+TE+ YPY G D G CN    +
Sbjct  172   ISLSEQELVDCDTNGEDQGCEGGLMDDAFQFIQQNHGLSTEANYPYSGVD-GTCNTKKEA  230

Query  520   FRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGV  341
               AAKI GYEDVP NSE ALL+A A+QPVSVAIDA G   QFY+ GVFT  CGT L+HGV
Sbjct  231   SIAAKITGYEDVPTNSEQALLKAVANQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGV  290

Query  340   TVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             T VGYG G+ G K+WL+KNSWG +WGE+GY R+QRD+DA EG CGIA+  SYPT
Sbjct  291   TAVGYGVGDDGTKFWLVKNSWGTEWGEEGYIRMQRDVDAAEGLCGIAMSASYPT  344



>gb|AFW76902.1| hypothetical protein ZEAMMB73_056195 [Zea mays]
Length=340

 Score =   380 bits (976),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 203/341 (60%), Positives = 244/341 (72%), Gaps = 14/341 (4%)
 Frame = -1

Query  1180  AAILACCS-----KAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKE  1016
             A+ILA  S      AA + + LNED    M  RHE WMA+Y RVY D  EKA+RF +FK 
Sbjct  6     ASILAVLSFAFFCGAALAARDLNEDS--AMVARHEQWMAQYSRVYKDAAEKARRFEVFKA  63

Query  1015  NVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVT-  839
             NVK IESFN  G+R + LGIN+FADLTNDEF +TK    +   P     S  FRYENV+ 
Sbjct  64    NVKFIESFNTGGNRKFWLGINQFADLTNDEFRTTKT--NKGFKPSLDKVSTGFRYENVSV  121

Query  838   -DIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdk  662
               IP+ +DWR  GAVTP+K+QG CGCCWAFSAVAA EGIVKIS G+L+SLSEQELVDCD 
Sbjct  122   DAIPATIDWRTNGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLISLSEQELVDCDV  181

Query  661   gggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVP  482
              G D GC GG MDDAFK+IIK+ GLTTES YPY   D G+C   + S  AA I GYEDVP
Sbjct  182   HGEDQGCEGGLMDDAFKFIIKNGGLTTESNYPYTAAD-GKCK--SGSNSAANIKGYEDVP  238

Query  481   MNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIK  302
              N EAAL++A A+QPVSVA+D   +  QFY+GGV T  CGT+L+HG+  +GYG    G K
Sbjct  239   TNDEAALMKAVANQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDHGIAAIGYGKTSDGTK  298

Query  301   YWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             YWL+KNSWG  WGE+GY R+++DI  K+G CG+A++PSYPT
Sbjct  299   YWLMKNSWGTTWGENGYLRMEKDISDKKGMCGLAMEPSYPT  339



>ref|XP_007213386.1| hypothetical protein PRUPE_ppa026372mg [Prunus persica]
 gb|EMJ14585.1| hypothetical protein PRUPE_ppa026372mg [Prunus persica]
Length=345

 Score =   380 bits (976),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 192/314 (61%), Positives = 233/314 (74%), Gaps = 5/314 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M  RHE WM RYGRVY D  EK KRF IFKENV  IES N    +PY L +N+F DL
Sbjct  35    DASMYGRHEQWMTRYGRVYTDNEEKEKRFKIFKENVAYIESSNADTSKPYKLRVNQFTDL  94

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVT-DIPSAVDWRKEGAVTPVKNQGVCGCC  761
             TN+EF++++N +K         ++  F+YENVT  +P+ +DWRK+GAVTP+K+QG CGCC
Sbjct  95    TNEEFIASRNRFK---GHECSTKTTSFKYENVTTSVPATMDWRKKGAVTPIKDQGQCGCC  151

Query  760   WAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTT  581
             WAFSAVAA EGI +++ G+LVSLSEQELVDCD  G D GC GG MDDAF++I +++GL+T
Sbjct  152   WAFSAVAATEGITQLTTGKLVSLSEQELVDCDTKGVDQGCEGGLMDDAFQFIQQNHGLST  211

Query  580   ESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQL  401
             E+ YPY G D G CN    +  AAKI G+EDVP N E ALL A AHQPVSVAIDA G   
Sbjct  212   EANYPYNGVD-GTCNTKKEANIAAKITGHEDVPANDEKALLNAVAHQPVSVAIDASGSDF  270

Query  400   QFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAK  221
             QFY+ GVFT  CGT L+HGVT VGYG  + G KYWL+KNSWG +WGE+GY R+QRD+DAK
Sbjct  271   QFYSSGVFTGTCGTSLDHGVTAVGYGVSDDGTKYWLVKNSWGTEWGEEGYIRMQRDVDAK  330

Query  220   EGRCGIALDPSYPT  179
             EG CGIA++ SYPT
Sbjct  331   EGLCGIAMEASYPT  344



>ref|XP_007212667.1| hypothetical protein PRUPE_ppa018342mg [Prunus persica]
 gb|EMJ13866.1| hypothetical protein PRUPE_ppa018342mg [Prunus persica]
Length=326

 Score =   379 bits (974),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 194/329 (59%), Positives = 241/329 (73%), Gaps = 11/329 (3%)
 Frame = -1

Query  1162  CSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQA  983
             C   ++S+Q      D  M  R+E WM RYGRVY D  EK  RF IFKENV  IES N  
Sbjct  7     CEATSRSLQ------DASMYGRYEQWMTRYGRVYNDVNEKENRFKIFKENVAFIESSNND  60

Query  982   GDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENV-TDIPSAVDWRKE  806
              ++PY LG+N+FADLTN+EF +++NG+K         ++  F+YEN+   +P+ +DWRK+
Sbjct  61    VNKPYKLGVNQFADLTNEEFKASRNGFKGHECST---KTTSFKYENIKAPVPATMDWRKK  117

Query  805   GAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRM  626
             GAVTP+K+QG CGCCWAFSAVAA EGI +++ G+L+SLSEQELVDCD  G D GC GG M
Sbjct  118   GAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTSGEDQGCEGGLM  177

Query  625   DDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAA  446
             DDAF++I +++GL+ E+ YPY G D G CN   A+  AAKI GYEDVP NSE ALL A A
Sbjct  178   DDAFQFIQQNHGLSAEANYPYNGVD-GSCNTKKAASIAAKITGYEDVPANSEKALLTAVA  236

Query  445   HQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKW  266
             HQPVSVAIDA G   QFY+ GVFT  CGT L+HGVT VGYG  + G KYWL+KNSWG +W
Sbjct  237   HQPVSVAIDAGGSDFQFYSSGVFTGSCGTSLDHGVTAVGYGVSDDGTKYWLVKNSWGTEW  296

Query  265   GEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             GE+GY R+QRD++AKEG CGIA++ SYPT
Sbjct  297   GEEGYIRMQRDVEAKEGLCGIAMEASYPT  325



>ref|XP_003609015.1| Cysteine proteinase [Medicago truncatula]
 gb|AES91212.1| papain family cysteine protease [Medicago truncatula]
Length=345

 Score =   380 bits (976),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 193/313 (62%), Positives = 233/313 (74%), Gaps = 3/313 (1%)
 Frame = -1

Query  1114  DVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQ-AGDRPYTLGINEFADL  938
             D M +RHE WM++Y +VY D  E+ +R  IF  NV  IE FN  A ++ Y LGIN+FADL
Sbjct  34    DSMYERHEQWMSQYSKVYKDPQEREERHKIFTANVNYIEVFNNDANNKLYKLGINQFADL  93

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF++++N +K  +      ++  F+YENV+ IPS VDWRK+GAVTPVKNQG CGCCW
Sbjct  94    TNEEFIASRNKFKGHMCSSIA-KTTTFKYENVSAIPSTVDWRKKGAVTPVKNQGQCGCCW  152

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA EGI K+S G+LVSLSEQELVDCD  G D GC GG MDDAFK+II+++GL+TE
Sbjct  153   AFSAVAATEGITKLSTGKLVSLSEQELVDCDTKGVDQGCEGGLMDDAFKFIIQNHGLSTE  212

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D G CN   AS  AA I GYEDVP N+E AL +A A+QP+SVAIDA G   Q
Sbjct  213   AAYPYQGVD-GTCNANKASIHAATITGYEDVPANNEQALQKAVANQPISVAIDASGSDFQ  271

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY  GVF+  CGTEL+HGVT VGYG G  G KYWL+KNSWG  WGE+GY R+QR +DA E
Sbjct  272   FYKSGVFSGSCGTELDHGVTAVGYGVGNDGTKYWLVKNSWGTDWGEEGYIRMQRGVDAAE  331

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYPT
Sbjct  332   GLCGIAMQASYPT  344



>ref|XP_007132861.1| hypothetical protein PHAVU_011G130900g [Phaseolus vulgaris]
 gb|ESW04855.1| hypothetical protein PHAVU_011G130900g [Phaseolus vulgaris]
Length=343

 Score =   380 bits (976),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 190/313 (61%), Positives = 232/313 (74%), Gaps = 2/313 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M +RHE+WM RYGRVY D  E+ KR  IFKENV  IE+FN A ++PY L IN+FADL
Sbjct  32    DASMNERHEEWMTRYGRVYKDPQEREKRLRIFKENVNYIEAFNNAANKPYKLAINQFADL  91

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF++ +N +K  +      R+  F+YENVT +PS VDWR++GAVTPVK+QG CGCCW
Sbjct  92    TNEEFIAPRNRFKGHMCSSIT-RTTSFKYENVTAVPSTVDWRQKGAVTPVKDQGQCGCCW  150

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA EGI  ++ G+L+SLSEQELVDCD  G D GC GG MDDAFK++I++ GL TE
Sbjct  151   AFSAVAATEGIHALTAGKLISLSEQELVDCDSKGVDQGCEGGLMDDAFKFVIQNQGLNTE  210

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D   CN   AS  A  I GYEDVP N+E AL +A  +QPVSVAIDA G   Q
Sbjct  211   AKYPYKGTD-ETCNANAASGHAVTIKGYEDVPANNEKALQKAVVNQPVSVAIDASGSDFQ  269

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY  GVFT  CGTEL+HGVT VGYG  + G +YWL+KNSWG +WGE+GY R+QR +D++E
Sbjct  270   FYESGVFTGSCGTELDHGVTAVGYGVSDDGTEYWLVKNSWGTEWGEEGYIRMQRGVDSEE  329

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYPT
Sbjct  330   GLCGIAMQASYPT  342



>ref|XP_007132895.1| hypothetical protein PHAVU_011G134000g [Phaseolus vulgaris]
 gb|ESW04889.1| hypothetical protein PHAVU_011G134000g [Phaseolus vulgaris]
Length=343

 Score =   380 bits (976),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 189/313 (60%), Positives = 233/313 (74%), Gaps = 2/313 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M +RH +WM RYGRVY D  E+ KR  IFKENV  IE+FN A ++PY L +N+FADL
Sbjct  32    DTSMNERHAEWMTRYGRVYKDPQEREKRLRIFKENVNYIEAFNNAANKPYKLAVNQFADL  91

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF++ +N +K  +      R+  F+YENVT +PS VDWR++GAVTPVK+QG CGCCW
Sbjct  92    TNEEFIAPRNRFKGHMCSSIT-RTTSFKYENVTAVPSKVDWRQKGAVTPVKDQGQCGCCW  150

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA EGI  ++ G+L+SLSEQELVDCD  G D GC GG MDDAFK++I++ GL+TE
Sbjct  151   AFSAVAATEGIHALTAGKLISLSEQELVDCDSKGVDQGCEGGLMDDAFKFVIQNQGLSTE  210

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D   CN   AS  AA I GYEDVP N+E AL +A  +QPVSVAIDA G   Q
Sbjct  211   ANYPYKGTD-ETCNANAASGHAATIKGYEDVPANNEKALQKAVVNQPVSVAIDASGSDFQ  269

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY  GVFT  CGTEL+HGVT VGYG  + G +YWL+KNSWG +WGE+GY R+QR +D++E
Sbjct  270   FYESGVFTGSCGTELDHGVTAVGYGVSDDGTEYWLVKNSWGTEWGEEGYIRMQRGVDSEE  329

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYPT
Sbjct  330   GLCGIAMQASYPT  342



>ref|XP_003557016.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   380 bits (975),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 189/313 (60%), Positives = 237/313 (76%), Gaps = 2/313 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M +RHE WM RYG+VY D  E+ KRF IFKENV  IE+FN A ++ Y L IN+FADL
Sbjct  32    DASMYERHEQWMTRYGKVYKDPQEREKRFRIFKENVNYIEAFNNAANKRYKLAINQFADL  91

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF++ +N +K  +   +  R+  F+YENVT +PS VDWR++GAVTP+K+QG CGCCW
Sbjct  92    TNEEFIAPRNRFKGHMCS-SIIRTTTFKYENVTAVPSTVDWRQKGAVTPIKDQGQCGCCW  150

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA EGI  ++ G+L+SLSEQELVDCD  G D GC GG MDDAFK++I+++GL TE
Sbjct  151   AFSAVAATEGIHALTSGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFVIQNHGLNTE  210

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D G+CN+  A+  AA I GYEDVP N+E AL +A A+QPVSVAIDA G   Q
Sbjct  211   ANYPYKGVD-GKCNVNEAANDAATITGYEDVPANNEKALQKAVANQPVSVAIDASGSDFQ  269

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY  GVFT  CGTEL+HGVT VGYG    G +YWL+KNSWG +WGE+GY R+QR ++++E
Sbjct  270   FYKSGVFTGSCGTELDHGVTAVGYGVSNDGTEYWLVKNSWGTEWGEEGYIRMQRGVNSEE  329

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYPT
Sbjct  330   GLCGIAMQASYPT  342



>ref|XP_004973089.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   380 bits (975),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 198/337 (59%), Positives = 243/337 (72%), Gaps = 11/337 (3%)
 Frame = -1

Query  1177  AILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIE  998
             AIL C    + ++      DD  M  RHE WMA+Y RVY D  EKA+RF +FK NVK IE
Sbjct  10    AILGCAFLFSGALAARTLSDDSAMVARHEQWMAQYSRVYKDAAEKARRFEVFKANVKFIE  69

Query  997   SFNQAGDRPYTLGINEFADLTNDEFVSTKN--GYKRPVSPRNPWRSMPFRYENVT--DIP  830
             SFN AG+R + LG+N+FADLTNDEF +TK   G+K P   + P     FRYENV+   +P
Sbjct  70    SFNAAGNRKFWLGVNQFADLTNDEFRATKTNKGFK-PSPMKVP---TGFRYENVSIDALP  125

Query  829   SAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggd  650
             + +DWR +GAVTP+K+QG CGCCWAFSAVAA EGIVKIS G+L+SLSEQELVDCD  G D
Sbjct  126   ATIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLISLSEQELVDCDVHGED  185

Query  649   lgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSE  470
              GC GG MDDAFK+IIK+ GLTTESGYPY   D G+C   + S  AA I  YEDVP N+E
Sbjct  186   QGCEGGLMDDAFKFIIKNGGLTTESGYPYTAAD-GKCK--SGSNSAATIKSYEDVPANNE  242

Query  469   AALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLL  290
             AAL++A A+QPVSVA+D   +  QFY+GGV T  CGT+L+HG+  +GYG    G  YWL+
Sbjct  243   AALMKAVANQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDHGIAAIGYGKASDGTNYWLM  302

Query  289   KNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             KNSWG  WGE+GY R+++DI  K G CG+A++PSYPT
Sbjct  303   KNSWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPT  339



>ref|XP_007212585.1| hypothetical protein PRUPE_ppa015944mg [Prunus persica]
 gb|EMJ13784.1| hypothetical protein PRUPE_ppa015944mg [Prunus persica]
Length=339

 Score =   379 bits (974),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 196/329 (60%), Positives = 241/329 (73%), Gaps = 11/329 (3%)
 Frame = -1

Query  1162  CSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQA  983
             C   ++S+Q      D  M  R+E WM RYGRVY D  EK  RF IFKENV  IES N  
Sbjct  20    CEATSRSLQ------DASMYGRYEQWMTRYGRVYNDVNEKENRFKIFKENVAFIESSNND  73

Query  982   GDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENV-TDIPSAVDWRKE  806
              ++PY LG+N+FADLTN+EF +++NG+K         ++  F+YENV   +P+ +DWRK+
Sbjct  74    VNKPYKLGVNQFADLTNEEFKASRNGFKGHECST---KTTSFKYENVKAPVPATMDWRKK  130

Query  805   GAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRM  626
             GAVTPVK+QG CGCCWAFSAVAA EGI +++ G+L+SLSEQELVDCD  G D GC GG M
Sbjct  131   GAVTPVKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTSGEDQGCEGGLM  190

Query  625   DDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAA  446
             DDAF++I +++GL+ E+ YPY G D G CN   A+  AAKI GYEDVP NSE ALL A A
Sbjct  191   DDAFQFIQQNHGLSAEANYPYNGVD-GSCNTKKAASIAAKITGYEDVPANSEKALLTAVA  249

Query  445   HQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKW  266
             HQPVSVAIDA G   QFY+ GVFT  CGT L+HGVT VGYG  + G KYWL+KNSWG +W
Sbjct  250   HQPVSVAIDAGGSDFQFYSSGVFTGSCGTSLDHGVTAVGYGVSDDGTKYWLVKNSWGTEW  309

Query  265   GEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             GE+GY R+QRD++AKEG CGIA++ SYPT
Sbjct  310   GEEGYIRMQRDVEAKEGLCGIAMEASYPT  338



>ref|XP_004505502.1| PREDICTED: vignain-like [Cicer arietinum]
Length=345

 Score =   380 bits (975),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 193/314 (61%), Positives = 232/314 (74%), Gaps = 3/314 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGD-RPYTLGINEFAD  941
             DD M + HE WM  Y +VY D  EK KR  IF +N+  I++FN AG+ +PY LGIN++AD
Sbjct  33    DDSMYESHEQWMRHYAKVYKDSQEKDKRSKIFTQNINYIQAFNNAGNNKPYKLGINQYAD  92

Query  940   LTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCC  761
             LTN+EF+S++N +K  +   +  R+  F+Y+NVT +PS VDWRK+GAVTPVKNQG CGCC
Sbjct  93    LTNEEFISSRNKFKGHMCS-SIIRTTTFKYQNVTAVPSTVDWRKKGAVTPVKNQGQCGCC  151

Query  760   WAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTT  581
             WAFSAVAA EGI K+S G+L+SLSEQELVDCD  G D GC GG MDDAFK+II+++GL T
Sbjct  152   WAFSAVAATEGIHKLSTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFIIQNHGLDT  211

Query  580   ESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQL  401
             E+ YPY G D G C    AS  AA I GYEDVP N+E AL +A A+QP+SVAIDA G   
Sbjct  212   EAQYPYQGVD-GTCYANEASVHAATITGYEDVPANNEQALQKAVANQPISVAIDASGSDF  270

Query  400   QFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAK  221
             QFY  GVFT  CGTEL+HGVT VGYG    G KYWL+KNSWG  WGE GY R+QR +DA 
Sbjct  271   QFYKSGVFTGSCGTELDHGVTAVGYGVSNDGTKYWLVKNSWGTDWGEQGYIRMQRGVDAA  330

Query  220   EGRCGIALDPSYPT  179
             EG CGIA+  SYPT
Sbjct  331   EGLCGIAMQASYPT  344



>ref|XP_004974540.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   379 bits (974),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 196/335 (59%), Positives = 239/335 (71%), Gaps = 7/335 (2%)
 Frame = -1

Query  1177  AILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIE  998
             AIL C    + ++      DD  M  RHE WMA+Y RVY D  EKA+RF +F  NVK IE
Sbjct  10    AILGCAFLFSGALAARALSDDSAMVARHEQWMAQYSRVYKDAAEKARRFEVFNANVKFIE  69

Query  997   SFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVT--DIPSA  824
             SFN AG+R + LG+N+FADLTNDEF +TK       SP        FRYENV+   +P+ 
Sbjct  70    SFNAAGNRKFWLGVNQFADLTNDEFRATKTNKGFKHSPMKV--PTGFRYENVSIDALPAT  127

Query  823   VDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlg  644
             +DWR +GAVTP+K+QG CGCCWAFSAVAA EGIVKIS G+L+SLSEQELVDCD  G D G
Sbjct  128   IDWRSKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLISLSEQELVDCDVHGEDQG  187

Query  643   chgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAA  464
             C GG MDDAFK+IIK+ GLTTESGYPY   D G+C   + S  AA I GYEDVP N+EAA
Sbjct  188   CEGGLMDDAFKFIIKNGGLTTESGYPYTAAD-GKCK--SGSNSAATIKGYEDVPANNEAA  244

Query  463   LLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKN  284
             L++A A+QPVSVA+D   +  QFY+GGV T  CGT+L+HG+  +GYG    G  YWL+KN
Sbjct  245   LMKAVANQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDHGIAAIGYGKASDGTNYWLMKN  304

Query  283   SWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             SWG  WGE+GY R+++DI  K G CG+A++PSYPT
Sbjct  305   SWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPT  339



>gb|AAP32196.1| cysteine protease 8 [Trifolium repens]
Length=343

 Score =   379 bits (974),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 196/341 (57%), Positives = 241/341 (71%), Gaps = 8/341 (2%)
 Frame = -1

Query  1201  IKNLIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIF  1022
             I   +VF   L      ++++Q      DD M +RH  WM++YG++Y D  E+  RF IF
Sbjct  10    ISLALVFCLGLFAIQVTSRTLQ------DDSMYERHGQWMSQYGKIYKDHQERETRFKIF  63

Query  1021  KENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENV  842
              ENV  +E+ N    + Y LGIN+FADLTN+EFV+++N +K  +      R+  F+YENV
Sbjct  64    TENVNYVEASNADDTKSYKLGINQFADLTNEEFVASRNKFKGHMCSSIT-RTTTFKYENV  122

Query  841   TDIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdk  662
             + IPS VDWRK+GAVTPVKNQG CGCCWAFSAVAA EGI K+S G+L+SLSEQELVDCD 
Sbjct  123   SAIPSTVDWRKKGAVTPVKNQGQCGCCWAFSAVAATEGIHKLSTGKLISLSEQELVDCDT  182

Query  661   gggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVP  482
              G D GC GG MDDAFK+II+++GL+TE+ YPY G D G CN   AS +A  I GYEDVP
Sbjct  183   KGVDQGCEGGLMDDAFKFIIQNHGLSTEAQYPYEGVD-GTCNANKASVQAVTITGYEDVP  241

Query  481   MNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIK  302
              NSE AL +A A+QP+SVAIDA G   QFY  GVFT  CGTEL+HGVT VGYG    G K
Sbjct  242   ANSEQALQKAVANQPISVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSNDGTK  301

Query  301   YWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             YWL+KNSWG  WGE+GY  +QR ++A EG CGIA+  SYPT
Sbjct  302   YWLVKNSWGTDWGEEGYIMMQRGVEAAEGLCGIAMQASYPT  342



>ref|XP_008244499.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=345

 Score =   379 bits (974),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 199/347 (57%), Positives = 247/347 (71%), Gaps = 12/347 (3%)
 Frame = -1

Query  1213  VSRLIKNLIVFAAILACCSKA-AKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAK  1037
             + +L   L +   + A  SKA ++S+Q      D  M  RHE WM RYGRVY D  EK K
Sbjct  8     LCKLCTCLALIIMLGAWSSKATSRSLQ------DASMYGRHEQWMVRYGRVYTDNEEKEK  61

Query  1036  RFSIFKENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPF  857
             RF IFKENV  IES N    +PY L +N+F DLTN+EF++++N +K         ++  F
Sbjct  62    RFKIFKENVAYIESSNADSSKPYKLRVNQFTDLTNEEFIASRNRFK---GHECSTKTTSF  118

Query  856   RYENVT-DIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQE  680
             +YENVT  +P+ +DWRK+GAVTP+K+QG CGCCWAFSAVAA EGI +++ G+LVSLSEQE
Sbjct  119   KYENVTASVPATMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLVSLSEQE  178

Query  679   LVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIA  500
             LVDCD  G D GC GG MDDAF++I +++GL+TE+ YPY G D G CN    +  AAKI 
Sbjct  179   LVDCDTKGVDQGCEGGLMDDAFQFIQQNHGLSTEANYPYNGVD-GTCNTKKEANIAAKIT  237

Query  499   GYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGT  320
              +EDVP N E ALL A AHQPVSVAIDA G   QFY+ GVFT  CGT L+HGVT VGYG 
Sbjct  238   DHEDVPANDEKALLNAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGV  297

Query  319   GERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
              + G KYWL+KNSWG +WGE+GY R+QRD+DAKEG CGIA++ SYPT
Sbjct  298   SDDGTKYWLVKNSWGTEWGEEGYIRMQRDVDAKEGLCGIAMEASYPT  344



>ref|XP_009623244.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=341

 Score =   379 bits (974),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 191/308 (62%), Positives = 231/308 (75%), Gaps = 4/308 (1%)
 Frame = -1

Query  1102  KRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTNDEF  923
             ++H+ WM+ +GRVY D+ EKAKRF IFK+N + IE  N+ G RPY LGINEFADL+N+EF
Sbjct  37    QKHKQWMSLFGRVYKDDIEKAKRFKIFKDNFEYIEFVNKVGTRPYILGINEFADLSNEEF  96

Query  922   VSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAV  743
              +++NGYK   S +   +S  F+YENVT  P+ +DWR +GAVT +K+QG CGCCWAFSAV
Sbjct  97    KASRNGYKM-YSHQQLSKSTSFKYENVT-APATMDWRTKGAVTGIKDQGQCGCCWAFSAV  154

Query  742   AAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPY  563
             AA EGI KI  G+L+SLSEQELVDCD         G  MDDAFK+IIK+NGLTTES YPY
Sbjct  155   AATEGINKIKTGKLISLSEQELVDCDTRSDMGCEGGL-MDDAFKFIIKNNGLTTESNYPY  213

Query  562   GGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGG  383
              G D   C     S  AAKI GYEDVP NSE+ALL+A A+QP+SVAIDA G   QFY+ G
Sbjct  214   EGTD-ATCKTGKESNHAAKITGYEDVPDNSESALLKAVANQPISVAIDASGSDFQFYSSG  272

Query  382   VFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGI  203
             VFT +CGTEL+HGVT VGYG    G KYWL+KNSWG  WGE+GY R+QRD+DA+EG CGI
Sbjct  273   VFTGKCGTELDHGVTAVGYGKIGDGTKYWLVKNSWGTSWGENGYIRMQRDVDAEEGLCGI  332

Query  202   ALDPSYPT  179
             A+  SYP+
Sbjct  333   AMQASYPS  340



>ref|XP_006376351.1| hypothetical protein POPTR_0013s12280g [Populus trichocarpa]
 gb|ERP54148.1| hypothetical protein POPTR_0013s12280g [Populus trichocarpa]
Length=342

 Score =   379 bits (973),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 198/346 (57%), Positives = 247/346 (71%), Gaps = 5/346 (1%)
 Frame = -1

Query  1216  MVSRLIKNLIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAK  1037
             MVS + K L  FA IL     A +      E  +  M  RHE WMA +G+VYAD  E  +
Sbjct  1     MVS-ICKRLCFFAFILILGMWAYEVAS--RELQEPSMSARHEQWMATFGKVYADAAETER  57

Query  1036  RFSIFKENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPF  857
             RF IFK+NV+ IESFN  G++PY L +N+FAD TN+E    +NGY+RP+  R P +   F
Sbjct  58    RFEIFKDNVEYIESFNTTGNKPYKLSVNKFADQTNEELKVARNGYRRPLQTR-PMKVTSF  116

Query  856   RYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQEL  677
             +YENVT +P+ +DWRK+GAVT +K+QG CG CWAFS VAA EGI +++ G+LVSLSEQEL
Sbjct  117   KYENVTAVPATMDWRKKGAVTLIKDQGQCGSCWAFSTVAATEGINQLTTGKLVSLSEQEL  176

Query  676   VdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAG  497
             VDCD  G D GC GG M+D F++IIK++G+TTE+ YPY   D G CN    + R AKI G
Sbjct  177   VDCDIQGEDQGCEGGLMEDGFEFIIKNHGITTEANYPYQAAD-GTCNSKIEASRIAKITG  235

Query  496   YEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTG  317
             YE VP NSEAALL+A A+QP+SV+IDA G   QFY+ G FT +CGTEL+HGVT VGYG  
Sbjct  236   YESVPANSEAALLKAVANQPISVSIDAGGSDFQFYSSGDFTGQCGTELDHGVTAVGYGET  295

Query  316   ERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
               G KYWL+KNSWG  WGE+GY R+QRD +A+EG CGIA+D SYPT
Sbjct  296   SDGTKYWLVKNSWGTSWGEEGYIRMQRDTEAEEGLCGIAMDSSYPT  341



>ref|XP_004489011.1| PREDICTED: vignain-like [Cicer arietinum]
Length=343

 Score =   379 bits (974),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 193/313 (62%), Positives = 230/313 (73%), Gaps = 2/313 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             DD M +RHE WM +YG+VY +  E+ KRF IFKENV  IE  N  G++ Y LGINEFADL
Sbjct  32    DDSMHERHEQWMGQYGKVYKNAKEREKRFGIFKENVNYIEVSNSVGNKSYKLGINEFADL  91

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN EFV+++N +   +   +  ++  F+Y NV+ +PS VDWR EGAVTPVK+QG CGCCW
Sbjct  92    TNHEFVASRNKFNAYLDGSST-KTTTFKYHNVSAVPSTVDWRLEGAVTPVKDQGQCGCCW  150

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVA+ EGI K+S G LVSLSEQELVDCD  G D GC GG MDDAFK+II++NGL TE
Sbjct  151   AFSAVASTEGIHKLSTGNLVSLSEQELVDCDTSGEDQGCEGGLMDDAFKFIIQNNGLNTE  210

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D G CN        A I+GYEDVP N E AL +A A+QP+SVAIDA G   Q
Sbjct  211   AEYPYQGVD-GTCNTNEEGNHVATISGYEDVPANDELALQKAVANQPISVAIDASGSDFQ  269

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY+ GVFT  CGTEL+HGV VVGYG  E  I+YWL+KNSWG KWGE+GY R+QR +DA E
Sbjct  270   FYSSGVFTGSCGTELDHGVAVVGYGVSEDEIEYWLVKNSWGIKWGEEGYIRMQRGVDALE  329

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYPT
Sbjct  330   GLCGIAMQASYPT  342



>ref|XP_002306369.1| hypothetical protein POPTR_0005s09080g [Populus trichocarpa]
 gb|EEE93365.1| hypothetical protein POPTR_0005s09080g [Populus trichocarpa]
Length=340

 Score =   379 bits (973),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 193/326 (59%), Positives = 249/326 (76%), Gaps = 13/326 (4%)
 Frame = -1

Query  1153  AAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDR  974
             AA+++Q      D  M +RHE WMA+YGRVY D+ EK  R++IFKENV  I++FN    +
Sbjct  26    AARTLQ------DVSMYERHEQWMAQYGRVYKDDAEKETRYNIFKENVARIDAFNSQTGK  79

Query  973   PYTLGINEFADLTNDEFVSTKNGYK-RPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAV  797
              Y LG+N+FADL+N+EF +++N +K    SP+    + PFRYENV+ +P+ +DWRK+GAV
Sbjct  80    SYKLGVNQFADLSNEEFKASRNRFKGHMCSPQ----AGPFRYENVSAVPATMDWRKKGAV  135

Query  796   TPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDA  617
             TPVK+QG CGCCWAFSAVAA+EGI +++ G+L+SLSEQE+VDCD  G D GC+GG MDDA
Sbjct  136   TPVKDQGQCGCCWAFSAVAAMEGINQLTTGKLISLSEQEVVDCDTKGEDQGCNGGLMDDA  195

Query  616   FKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQP  437
             FK+I ++ GLTTE+ YPY G D G CN    +  AAKI G+EDVP NSEAAL++A A QP
Sbjct  196   FKFIEQNKGLTTEANYPYTGTD-GTCNTQKEATHAAKITGFEDVPANSEAALMKAVAKQP  254

Query  436   VSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGED  257
             VSVAIDA G + QFY+ G+FT  CGT+L+HGVT VGYG  + G KYWL+KNSWG +WGE+
Sbjct  255   VSVAIDAGGFEFQFYSSGIFTGSCGTQLDHGVTAVGYGISD-GTKYWLVKNSWGAQWGEE  313

Query  256   GYFRLQRDIDAKEGRCGIALDPSYPT  179
             GY R+Q+DI AKEG CGIA+  SYP+
Sbjct  314   GYIRMQKDISAKEGLCGIAMQASYPS  339



>ref|XP_002531152.1| cysteine protease, putative [Ricinus communis]
 gb|EEF31237.1| cysteine protease, putative [Ricinus communis]
Length=340

 Score =   379 bits (972),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 195/338 (58%), Positives = 249/338 (74%), Gaps = 12/338 (4%)
 Frame = -1

Query  1192  LIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKEN  1013
             LI F   LA     A+++Q      D  + ++HE+WM R+ RVY+D  EK  R+ IFKEN
Sbjct  14    LIFFLGALAS-QAIARTLQ------DASIHEKHEEWMTRFKRVYSDAKEKEIRYKIFKEN  66

Query  1012  VKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDI  833
             V+ IESFN+A ++ Y LGIN+FADLTN+EF +++N +K  +      ++ PFRYEN+T +
Sbjct  67    VQRIESFNKASEKSYKLGINQFADLTNEEFKTSRNRFKGHMCSS---QAGPFRYENITAV  123

Query  832   PSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkggg  653
             PS++DWRKEGAVT +K+QG CG CWAFSAVAAVEGI +++  +L+SLSEQELVDCD  G 
Sbjct  124   PSSMDWRKEGAVTAIKDQGQCGSCWAFSAVAAVEGITQLATSKLISLSEQELVDCDTKGE  183

Query  652   dlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNS  473
             D GC GG MDDAFK+I ++ GLTTE+ YPY G D G CN    +  AAKI G+EDVP N+
Sbjct  184   DQGCQGGLMDDAFKFIEQNQGLTTEANYPYEGSD-GTCNTKQEANHAAKINGFEDVPANN  242

Query  472   EAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWL  293
             E AL++A A QPVSVAIDA G + QFY+ G+FT  CGTEL+HGV  VGYG    G+ YWL
Sbjct  243   EGALMKAVAKQPVSVAIDAGGFEFQFYSSGIFTGDCGTELDHGVAAVGYGE-SNGMNYWL  301

Query  292   LKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             +KNSWG +WGE+GY R+Q+DIDAKEG CGIA+  SYPT
Sbjct  302   VKNSWGTQWGEEGYIRMQKDIDAKEGLCGIAMQASYPT  339



>ref|XP_004974538.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   378 bits (971),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 198/337 (59%), Positives = 243/337 (72%), Gaps = 11/337 (3%)
 Frame = -1

Query  1177  AILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIE  998
             AIL C    + ++      DD  M  RHE WMA+Y RVY D  EKA+RF +FK NVK IE
Sbjct  10    AILGCAFLFSGALAARALSDDSAMVARHEQWMAQYSRVYKDAAEKARRFEVFKANVKFIE  69

Query  997   SFNQAGDRPYTLGINEFADLTNDEFVSTKN--GYKRPVSPRNPWRSMPFRYENVT--DIP  830
             SFN AG+R + LG+N+FADLTNDEF +TK   G+K P   + P     FRYENV+   +P
Sbjct  70    SFNAAGNRKFWLGVNQFADLTNDEFRATKTNKGFK-PSPMKVP---TGFRYENVSIDALP  125

Query  829   SAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggd  650
             + +DWR +GAVTP+K+QG CGCCWAFSAVAA EGIVKIS G+L+SLSEQELVDCD  G D
Sbjct  126   ATIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLISLSEQELVDCDVHGED  185

Query  649   lgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSE  470
              GC GG MDDAFK+IIK+ GLTTESGYPY   D  +C   + S  AA I GYEDVP N+E
Sbjct  186   QGCEGGLMDDAFKFIIKNGGLTTESGYPYTAAD-DKCK--SGSNSAATIKGYEDVPANNE  242

Query  469   AALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLL  290
             AAL++A A+QPVSVA+D   +  QFY+GGV T  CGT+L+HG+  +GYG    G  YWL+
Sbjct  243   AALMKAVANQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDHGIAAIGYGKASDGTNYWLM  302

Query  289   KNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             KNSWG  WGE+GY R+++DI  K G CG+A++PSYPT
Sbjct  303   KNSWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPT  339



>dbj|BAF56430.1| cysteine proteinase [Lotus japonicus]
Length=341

 Score =   378 bits (971),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 191/314 (61%), Positives = 240/314 (76%), Gaps = 4/314 (1%)
 Frame = -1

Query  1120  DDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFAD  941
             +D  M +RHE WMA+YG+VY D  EK  R  IFKENV+ IE+FN AG++ Y LGIN+FAD
Sbjct  31    EDASMHERHEQWMAQYGKVYKDSYEKELRSKIFKENVQRIEAFNNAGNKSYKLGINQFAD  90

Query  940   LTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCC  761
             LTN+EF   +N +K  +   N  R+  F+YE+VT +P+++DWR++GAVTP+K+QG CGCC
Sbjct  91    LTNEEF-KARNRFKGHMCS-NSTRTPTFKYEHVTSVPASLDWRQKGAVTPIKDQGQCGCC  148

Query  760   WAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTT  581
             WAFSAVAA EGI K+S G+L+SLSEQELVDCD  G D GC GG MDDAFK+I+++ GL T
Sbjct  149   WAFSAVAATEGITKLSTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFIMQNKGLNT  208

Query  580   ESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQL  401
             E+ YPY G D   CN    +  AA I G+EDVP NSE+ALL+A A+QP+SVAIDA G + 
Sbjct  209   EAKYPYQGVD-ATCNANAEAKDAASIKGFEDVPANSESALLKAVANQPISVAIDASGSEF  267

Query  400   QFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAK  221
             QFY+ GVFT  CGTEL+HGVT VGYG+ + G KYWL+KNSWGE+WGE GY R+QRD+ A+
Sbjct  268   QFYSSGVFTGSCGTELDHGVTAVGYGS-DGGTKYWLVKNSWGEQWGEQGYIRMQRDVAAE  326

Query  220   EGRCGIALDPSYPT  179
             EG CG A+  SYPT
Sbjct  327   EGLCGFAMQASYPT  340



>ref|XP_007132865.1| hypothetical protein PHAVU_011G131200g [Phaseolus vulgaris]
 gb|ESW04859.1| hypothetical protein PHAVU_011G131200g [Phaseolus vulgaris]
Length=344

 Score =   378 bits (971),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 191/314 (61%), Positives = 235/314 (75%), Gaps = 2/314 (1%)
 Frame = -1

Query  1120  DDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFAD  941
             DD  M +RHE+WM RYG VY D  E+ KRF IFK+NV  IE+FN A ++PY LG N+FAD
Sbjct  32    DDVSMYERHEEWMTRYGSVYKDPEEREKRFRIFKKNVNYIETFNNAANKPYQLGTNQFAD  91

Query  940   LTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCC  761
             LTN+EF++ +N +K  +   +  R+  F+YENVT IPS VDWR++GAVTPVK+QG CGCC
Sbjct  92    LTNEEFIAGRNRFKGHMCS-SILRTTTFKYENVTTIPSTVDWRQKGAVTPVKDQGQCGCC  150

Query  760   WAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTT  581
             WAFSAVAA EGI  ++ G+L+SLSEQELVDCD  G D GC GG MD AFK+IIK++G+ T
Sbjct  151   WAFSAVAATEGIHALTSGKLISLSEQELVDCDTKGVDQGCEGGFMDGAFKFIIKNHGINT  210

Query  580   ESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQL  401
             E  YPY G D G+CN    +   A I GYEDVP+N+E+AL +A + QPVSVAIDA G   
Sbjct  211   EVNYPYKGVD-GKCNAKAEAVNGATITGYEDVPVNNESALEKAVSSQPVSVAIDASGSDF  269

Query  400   QFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAK  221
             QFY  GVF+  CGTEL+HGVT VGYG  + G KYWL+KNSWG +WGE+GY R+QRD+ A 
Sbjct  270   QFYKSGVFSGSCGTELDHGVTAVGYGVSDDGKKYWLVKNSWGTEWGEEGYIRMQRDVAAA  329

Query  220   EGRCGIALDPSYPT  179
             EG CGIA+  SYPT
Sbjct  330   EGLCGIAMMASYPT  343



>gb|ADV74756.1| cysteine protease [Lactuca sativa]
Length=363

 Score =   379 bits (973),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 193/315 (61%), Positives = 233/315 (74%), Gaps = 1/315 (0%)
 Frame = -1

Query  1120  DDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFAD  941
             +D  M  RHE WMA +GR+Y DE EK  RF IFK NV  I++ N   D+ YTL +N+FAD
Sbjct  47    NDPTMIARHEQWMAHHGRIYTDENEKQLRFQIFKNNVAYIDAHNARSDQSYTLEVNKFAD  106

Query  940   LTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCC  761
             LTNDEF +++NGYK+     +   S  FRY NV+ +P  VDWRKEGAVTPVK+QG CGCC
Sbjct  107   LTNDEFRASRNGYKKQPDSDSHVVSGLFRYANVSAVPDEVDWRKEGAVTPVKDQGDCGCC  166

Query  760   WAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTT  581
             WAFSAVAA+EGI K+  G+LVSLSEQELVDCD  G D GC GG M++AF++I K  GL  
Sbjct  167   WAFSAVAAMEGINKLENGKLVSLSEQELVDCDIDGIDQGCEGGLMENAFQFIEKRKGLAA  226

Query  580   ESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQL  401
             ES YPY G+D G CN   A+  AAKI+G+E VP N+E ALLQA A+QPVS+AIDA G + 
Sbjct  227   ESVYPYTGED-GICNTKKAAIPAAKISGHEKVPANNEKALLQAVANQPVSIAIDASGYEF  285

Query  400   QFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAK  221
             QFY+GGVFT  CGTEL+H +T VGYG    G KYWL+KNSWG  WGE+GY R++RD  AK
Sbjct  286   QFYSGGVFTGSCGTELDHAITAVGYGATMDGTKYWLMKNSWGASWGENGYIRIKRDSLAK  345

Query  220   EGRCGIALDPSYPTL  176
             EG CGIA+DPSYP +
Sbjct  346   EGLCGIAMDPSYPVV  360



>ref|XP_004974539.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   378 bits (970),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 195/335 (58%), Positives = 238/335 (71%), Gaps = 7/335 (2%)
 Frame = -1

Query  1177  AILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIE  998
             AIL C    + ++      DD  M  RHE WMA+Y RVY D  EKA+R  +F  NVK IE
Sbjct  10    AILGCAFLFSGALAARALSDDSAMVARHEQWMAQYSRVYKDAAEKARRLEVFNANVKFIE  69

Query  997   SFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVT--DIPSA  824
             SFN AG+R + LG+N+FADLTNDEF +TK       SP        FRYENV+   +P+ 
Sbjct  70    SFNAAGNRKFWLGVNQFADLTNDEFRATKTNKGFKHSPMKV--PTGFRYENVSIDALPAT  127

Query  823   VDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlg  644
             +DWR +GAVTP+K+QG CGCCWAFSAVAA EGIVKIS G+L+SLSEQELVDCD  G D G
Sbjct  128   IDWRSKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLISLSEQELVDCDVHGEDQG  187

Query  643   chgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAA  464
             C GG MDDAFK+IIK+ GLTTESGYPY   D G+C   + S  AA I GYEDVP N+EAA
Sbjct  188   CEGGLMDDAFKFIIKNGGLTTESGYPYTAAD-GKCK--SGSNSAATIKGYEDVPANNEAA  244

Query  463   LLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKN  284
             L++A A+QPVSVA+D   +  QFY+GGV T  CGT+L+HG+  +GYG    G  YWL+KN
Sbjct  245   LMKAVANQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDHGIAAIGYGKASDGTNYWLMKN  304

Query  283   SWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             SWG  WGE+GY R+++DI  K G CG+A++PSYPT
Sbjct  305   SWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPT  339



>ref|XP_006592465.1| PREDICTED: vignain-like [Glycine max]
 ref|XP_006607017.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   377 bits (969),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 188/313 (60%), Positives = 234/313 (75%), Gaps = 2/313 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M +RHE WM RYG+VY D  E+ KRF IFKENV  IE+FN A ++ Y L IN+FADL
Sbjct  32    DASMYERHEQWMTRYGKVYKDPQEREKRFRIFKENVNYIEAFNNAANKRYKLAINQFADL  91

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF++ +N +K  +   +  R+  F+YENVT +PS VDWR++GAVTP+K+QG CGCCW
Sbjct  92    TNEEFIAPRNRFKGHMCS-SIIRTTTFKYENVTAVPSTVDWRQKGAVTPIKDQGQCGCCW  150

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA EGI  ++ G+L+SLSEQELVDCD  G D GC GG MDDAFK++I+++GL TE
Sbjct  151   AFSAVAATEGIHALTSGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFVIQNHGLNTE  210

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D G+CN   A+     I GYEDVP N+E AL +A A+QPVSVAIDA G   Q
Sbjct  211   ANYPYKGVD-GKCNANEAANDVVTITGYEDVPANNEKALQKAVANQPVSVAIDASGSDFQ  269

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY  GVFT  CGTEL+HGVT VGYG    G +YWL+KNSWG +WGE+GY R+QR +D++E
Sbjct  270   FYKSGVFTGSCGTELDHGVTAVGYGVSNDGTEYWLVKNSWGTEWGEEGYIRMQRGVDSEE  329

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYPT
Sbjct  330   GLCGIAMQASYPT  342



>ref|XP_004974541.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   377 bits (969),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 195/335 (58%), Positives = 238/335 (71%), Gaps = 7/335 (2%)
 Frame = -1

Query  1177  AILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIE  998
             AIL C    + ++      DD  M  RHE WMA+Y RVY D  EKA+R  +F  NVK IE
Sbjct  10    AILGCAFLFSGALAARALSDDSAMVARHEQWMAQYSRVYKDAAEKARRLEVFNANVKFIE  69

Query  997   SFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVT--DIPSA  824
             SFN AG+R + LG+N+FADLTNDEF +TK       SP        FRYENV+   +P+ 
Sbjct  70    SFNAAGNRKFWLGVNQFADLTNDEFRATKTNKGFKHSPMKV--PTGFRYENVSIDALPAT  127

Query  823   VDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlg  644
             +DWR +GAVTP+K+QG CGCCWAFSAVAA EGIVKIS G+L+SLSEQELVDCD  G D G
Sbjct  128   IDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLISLSEQELVDCDVHGEDQG  187

Query  643   chgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAA  464
             C GG MDDAFK+IIK+ GLTTESGYPY   D G+C   + S  AA I GYEDVP N+EAA
Sbjct  188   CEGGLMDDAFKFIIKNGGLTTESGYPYTAAD-GKCK--SGSNSAATIKGYEDVPANNEAA  244

Query  463   LLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKN  284
             L++A A+QPVSVA+D   +  QFY+GGV T  CGT+L+HG+  +GYG    G  YWL+KN
Sbjct  245   LMKAVANQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDHGIAAIGYGKASDGTNYWLMKN  304

Query  283   SWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             SWG  WGE+GY R+++DI  K G CG+A++PSYPT
Sbjct  305   SWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPT  339



>ref|XP_003526232.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   377 bits (969),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 199/346 (58%), Positives = 247/346 (71%), Gaps = 4/346 (1%)
 Frame = -1

Query  1216  MVSRLIKNLIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAK  1037
             MV++   N I  A +L  C              D  M +RHE WM RYG+VY D  E+ K
Sbjct  1     MVAKKHFNHISLAMLL--CMTFLAFQVTCRTLQDASMYERHEQWMTRYGKVYKDPQEREK  58

Query  1036  RFSIFKENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPF  857
             RF +FKENV  IE+FN A ++ Y LGIN+FADLTN EF++ +NG+K  +   +  R+  F
Sbjct  59    RFRVFKENVNYIEAFNNAANKSYKLGINQFADLTNKEFIAPRNGFKGHMCS-SIIRTTTF  117

Query  856   RYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQEL  677
             ++ENVT  PS VDWR++GAVTP+K+QG CGCCWAFSAVAA EGI  +S G+L+SLSEQEL
Sbjct  118   KFENVTATPSTVDWRQKGAVTPIKDQGQCGCCWAFSAVAATEGIHALSAGKLISLSEQEL  177

Query  676   VdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAG  497
             VDCD  G D GC GG MDDAFK+II+++GL TE+ YPY G D G+CN   A+  AA I G
Sbjct  178   VDCDTKGVDQGCEGGLMDDAFKFIIQNHGLNTEANYPYKGVD-GKCNANEAAKNAATITG  236

Query  496   YEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTG  317
             YEDVP N+E AL +A A+QPVSVAIDA G   QFY  GVFT  CGTEL+HGVT VGYG  
Sbjct  237   YEDVPANNEMALQKAVANQPVSVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVS  296

Query  316   ERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             + G +YWL+KNSWG +WGE+GY R+QR +D++EG CGIA+  SYPT
Sbjct  297   DDGTEYWLVKNSWGTEWGEEGYIRMQRGVDSEEGLCGIAMQASYPT  342



>ref|XP_010317330.1| PREDICTED: uncharacterized protein LOC101251741 [Solanum lycopersicum]
Length=802

 Score =   392 bits (1008),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 216/367 (59%), Positives = 258/367 (70%), Gaps = 12/367 (3%)
 Frame = -1

Query  1267  P*SSIQIHSPFL---QQETKMVSRLI-KNLIVFAAILACCSKAAKSMQGLNEDDDDVMEK  1100
             P S IQ  S  L   QQ+ +M   +  K+  +  A+L   +    S + LNE     M +
Sbjct  443   PKSLIQALSNLLTDNQQKVQMALTINWKSAFLALAVLTMWTIEVTSRE-LNEAS---MVQ  498

Query  1099  RHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTNDEFV  920
             +HE WMAR+GRVY D+ EKAKRF+IFK+NV  IES N++G RPY L IN FADLTN+EF 
Sbjct  499   KHEKWMARFGRVYRDDAEKAKRFNIFKDNVDYIESINKSGMRPYKLSINGFADLTNEEFR  558

Query  919   STKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVA  740
             +T NGYK P S +   +++ FRYE+VT  P+ +DWRK+GAVT VK+QG CGCCWAFSAVA
Sbjct  559   ATHNGYK-PSSHQKSSKTVSFRYEDVT-APATMDWRKKGAVTGVKDQGQCGCCWAFSAVA  616

Query  739   AVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYG  560
             A EGI +I  G+L+SLSEQELVDCD         G  MDDAFK+IIK++GLTTES YPY 
Sbjct  617   ATEGINEIKTGKLISLSEQELVDCDTSSDMGCEGGL-MDDAFKFIIKNHGLTTESNYPYE  675

Query  559   GQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGV  380
             G D G C     S  AAKI GYEDVP NSE++LL A A+QPVSVAIDA G   QFY+ GV
Sbjct  676   GTD-GTCKTGKKSNGAAKITGYEDVPANSESSLLSAVANQPVSVAIDASGSDFQFYSSGV  734

Query  379   FTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIA  200
             FT  CGTEL+HGVT VGYG    G KYWL+KNSWG  WGE+GY R+QR IDAKEG CGIA
Sbjct  735   FTGECGTELDHGVTAVGYGITSDGTKYWLVKNSWGTSWGENGYIRMQRGIDAKEGICGIA  794

Query  199   LDPSYPT  179
             +  SYPT
Sbjct  795   MQASYPT  801



>gb|KHN08187.1| Thiol protease SEN102 [Glycine soja]
Length=326

 Score =   377 bits (967),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 188/313 (60%), Positives = 234/313 (75%), Gaps = 2/313 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M +RHE WM RYG+VY D  E+ KRF IFKENV  IE+FN A ++ Y L IN+FADL
Sbjct  15    DASMYERHEQWMTRYGKVYKDPQEREKRFRIFKENVNYIEAFNNAANKRYKLAINQFADL  74

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF++ +N +K  +   +  R+  F+YENVT +PS VDWR++GAVTP+K+QG CGCCW
Sbjct  75    TNEEFIAPRNRFKGHMCS-SIIRTTTFKYENVTAVPSTVDWRQKGAVTPIKDQGQCGCCW  133

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA EGI  ++ G+L+SLSEQELVDCD  G D GC GG MDDAFK++I+++GL TE
Sbjct  134   AFSAVAATEGIHALTSGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFVIQNHGLNTE  193

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D G+CN   A+     I GYEDVP N+E AL +A A+QPVSVAIDA G   Q
Sbjct  194   ANYPYKGVD-GKCNANEAANDVVTITGYEDVPANNEKALQKAVANQPVSVAIDASGSDFQ  252

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY  GVFT  CGTEL+HGVT VGYG    G +YWL+KNSWG +WGE+GY R+QR +D++E
Sbjct  253   FYKSGVFTGSCGTELDHGVTAVGYGVSNDGTEYWLVKNSWGTEWGEEGYIRMQRGVDSEE  312

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYPT
Sbjct  313   GLCGIAMQASYPT  325



>ref|XP_004975180.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   377 bits (968),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 191/316 (60%), Positives = 236/316 (75%), Gaps = 7/316 (2%)
 Frame = -1

Query  1120  DDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFAD  941
             DD  M  RHE WMA++GR+Y D+ EKA+RF +FK NVK IE+FN AG+R + LG+N+FAD
Sbjct  29    DDSAMVARHEQWMAQHGRLYKDDAEKARRFEVFKTNVKFIETFNAAGNRKFWLGVNQFAD  88

Query  940   LTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTD--IPSAVDWRKEGAVTPVKNQGVCG  767
             LTNDEF +TK    +  +P        FRY NV+   +P+ VDWR +GAVTP+K+QG CG
Sbjct  89    LTNDEFRATKT--NKGFNPNAVKVPTGFRYANVSTDALPATVDWRTKGAVTPIKDQGQCG  146

Query  766   CCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGL  587
             CCWAFSAVAA+EGIVKIS G+L+SLSEQELVDCD  G D GC+GG MDDAF +IIK+ GL
Sbjct  147   CCWAFSAVAAMEGIVKISTGKLISLSEQELVDCDVHGEDQGCNGGEMDDAFTFIIKNGGL  206

Query  586   TTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGL  407
             TTES YPY  QD G+C   + S  AA I GYEDVP N EAAL++A A+QPVSVA+D   +
Sbjct  207   TTESSYPYAAQD-GQCKAGSNS--AATIKGYEDVPANDEAALMKAVANQPVSVAVDGGDM  263

Query  406   QLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDID  227
               QFY+GGV T  CGT+L+HG+  +GYGT   G KYWLLKNSWG  WGE+G+ R+++DI 
Sbjct  264   TFQFYSGGVMTGSCGTDLDHGIAAIGYGTASDGTKYWLLKNSWGTTWGENGFLRMEKDIS  323

Query  226   AKEGRCGIALDPSYPT  179
              K G CG+A+ PSYPT
Sbjct  324   DKRGMCGLAMQPSYPT  339



>gb|KHN38752.1| Vignain [Glycine soja]
Length=308

 Score =   375 bits (964),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 190/309 (61%), Positives = 234/309 (76%), Gaps = 3/309 (1%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M +RHE WMA +G+VY    EK +++  FKENV+ IE+FN AG++PY LGIN FADLTN+
Sbjct  1     MRERHEQWMAIHGKVYTHSYEKEQKYQTFKENVQRIEAFNNAGNKPYKLGINHFADLTNE  60

Query  928   EFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFS  749
             EF +  N +K  V  +   R+  FRYENVT +P+++DWR++GAVTP+K+QG CGCCWAFS
Sbjct  61    EFKAI-NRFKGHVCSKRT-RTTTFRYENVTAVPASLDWRQKGAVTPIKDQGQCGCCWAFS  118

Query  748   AVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGY  569
             AVAA EGI K+S G+L+SLSEQELVDCD  G D GC GG MDDAFK+I+++ GL  E+ Y
Sbjct  119   AVAATEGITKLSTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFILQNKGLAAEAIY  178

Query  568   PYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYA  389
             PY G D G CN       AA I GYEDVP NSE+ALL+A A+QPVSVAI+A G + QFY+
Sbjct  179   PYEGVD-GTCNAKAEGNHAASIKGYEDVPANSESALLKAVANQPVSVAIEASGFEFQFYS  237

Query  388   GGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRC  209
             GGVFT  CGT L+HGVT VGYG  + G KYWL+KNSWG KWG+ GY R+QRD+ AKEG C
Sbjct  238   GGVFTGSCGTNLDHGVTAVGYGVSDDGTKYWLVKNSWGVKWGDKGYIRMQRDVAAKEGLC  297

Query  208   GIALDPSYP  182
             GIA+  SYP
Sbjct  298   GIAMLASYP  306



>dbj|BAD29959.1| cysteine protease [Daucus carota]
Length=361

 Score =   377 bits (969),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 196/348 (56%), Positives = 245/348 (70%), Gaps = 5/348 (1%)
 Frame = -1

Query  1222  TKMVSRLIKNLIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEK  1043
             T   +   K+ ++ A IL        + + L E     M +RHE WM +YGRVY DE EK
Sbjct  18    TSTTNMAFKHFMIAALILLGAWACQATSRTLPEAS---MFERHEQWMIQYGRVYKDEAEK  74

Query  1042  AKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSM  863
             + RF IF +NVK IE FN+ G + Y L +NEFAD TN+EF +++NGYK  VS R P ++ 
Sbjct  75    SVRFQIFMDNVKFIEEFNKDGRQSYKLAVNEFADQTNEEFQASRNGYKMAVSSR-PSQTT  133

Query  862   PFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQ  683
              FRYENVT +PS++DWRK+GAVTPVK+QG CG CWAFS +AA EGI K+  G+L+SLSEQ
Sbjct  134   LFRYENVTAVPSSMDWRKKGAVTPVKDQGQCGSCWAFSTIAATEGITKLKTGKLISLSEQ  193

Query  682   ELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKI  503
             ELVDCDK G D GC GG M+D F++I+K+ G+  E+ YPY   D G CN    + RAAKI
Sbjct  194   ELVDCDKTGEDQGCEGGYMEDGFEFIVKNKGIALEASYPYTAAD-GTCNSKEEASRAAKI  252

Query  502   AGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYG  323
             +GYE VP NSE ALL+A A+QPVSV+IDA G+  QFY+ GVFT  CGT+L+HGVT VGYG
Sbjct  253   SGYEKVPANSETALLKAVANQPVSVSIDASGVAFQFYSSGVFTGECGTDLDHGVTAVGYG  312

Query  322   TGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
                 G KYWL+KNSWG  WG+ GY  +QR + AK G CGIA+D SYPT
Sbjct  313   KTSDGTKYWLVKNSWGASWGDSGYIMMQRGVAAKGGLCGIAMDASYPT  360



>ref|XP_002274223.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Vitis 
vinifera]
Length=340

 Score =   376 bits (966),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 196/310 (63%), Positives = 231/310 (75%), Gaps = 2/310 (1%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M +RHEDWM  YGR Y D  EK +RF IFKENV+ IES N AG+R Y L INEFAD TN+
Sbjct  32    MSERHEDWMGLYGRTYKDIAEKERRFKIFKENVEYIESVNSAGNRRYKLSINEFADQTNE  91

Query  928   EFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFS  749
             EF +++NGY     PR+      FRYENV  +PS++DWRK+GAVTP+K+QG CGCCWAFS
Sbjct  92    EFKASRNGYNMSSRPRSS-EITSFRYENVAAVPSSMDWRKKGAVTPIKDQGQCGCCWAFS  150

Query  748   AVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGY  569
             AVAA+EG+ ++  GEL+SLSEQELVDCD  G D GC GG MD AF++II + GLTTE+ Y
Sbjct  151   AVAAMEGVTQLKTGELISLSEQELVDCDTSGEDQGCGGGLMDSAFEFIIGNGGLTTEANY  210

Query  568   PYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYA  389
             PY G D   CN   A+  AAKI  YEDVP NSEAALL+A A  PVSVAIDA G   QFY+
Sbjct  211   PYKGVD-ATCNKKKAASSAAKIKNYEDVPANSEAALLKAVAQHPVSVAIDAGGSDFQFYS  269

Query  388   GGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRC  209
              GVFT +CGTEL+HGVT VGYG  + G KYWL+KNSWG  WGEDGY  ++RDI A EG C
Sbjct  270   SGVFTGQCGTELDHGVTAVGYGKTDDGTKYWLVKNSWGTGWGEDGYIWMERDIGADEGLC  329

Query  208   GIALDPSYPT  179
             GIA++ SYPT
Sbjct  330   GIAMEASYPT  339



>gb|EYU19040.1| hypothetical protein MIMGU_mgv1a026538mg [Erythranthe guttata]
Length=325

 Score =   376 bits (965),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 185/311 (59%), Positives = 232/311 (75%), Gaps = 3/311 (1%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M ++HE WM +YGR Y D+ EKA R+ IFK+NV+ I+S ++A +R Y L IN+FADLT+D
Sbjct  16    MIEKHEQWMLQYGRTYKDDAEKAFRYKIFKQNVEYIQSVDEAENRTYKLAINKFADLTSD  75

Query  928   EFVSTKNGYKR-PVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAF  752
             EF +++NG+K    S ++ +    FRY NV+ +P ++DW K+GAVTPVK+QG CGCCWAF
Sbjct  76    EFKASRNGFKMGSQSIKSSFEVSSFRYGNVSAVPPSIDWTKKGAVTPVKDQGQCGCCWAF  135

Query  751   SAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESG  572
             SAVAA EG+ ++  G+L+SLSEQELVDCD         G  MD+AF++II +NGLTTES 
Sbjct  136   SAVAATEGLNQLKTGKLISLSEQELVDCDTSEDQGCNGGL-MDNAFEFIISNNGLTTESN  194

Query  571   YPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFY  392
             YPY G D G CN    S   AKI GYEDVP NSE+ALL+A A+QP+SVAIDA G   QFY
Sbjct  195   YPYEGVD-GTCNSKKESSHVAKITGYEDVPANSESALLKAVANQPISVAIDASGSDFQFY  253

Query  391   AGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGR  212
             +GGVF+ +CGTEL+HGVT VGYG    G KYWL+KNSWG  WGE+GY R+QRDIDA EG 
Sbjct  254   SGGVFSGQCGTELDHGVTAVGYGVTSDGTKYWLVKNSWGSSWGENGYIRMQRDIDAAEGL  313

Query  211   CGIALDPSYPT  179
             CGIA+  SYPT
Sbjct  314   CGIAMQASYPT  324



>ref|XP_008659446.1| PREDICTED: ervatamin-B-like [Zea mays]
Length=340

 Score =   376 bits (966),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 194/337 (58%), Positives = 240/337 (71%), Gaps = 7/337 (2%)
 Frame = -1

Query  1183  FAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKA  1004
              +AI+        +M   +  DD VM  RHE WMA+Y RVY D +EKA+RF +FK NV+ 
Sbjct  8     ISAIIGFAFFCGAAMAARDLSDDSVMVARHEQWMAQYSRVYKDASEKARRFEVFKANVQF  67

Query  1003  IESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTD--IP  830
             IESFN  G+  + LG+N+FADLTNDEF STK    + +   N      FRYENV+   +P
Sbjct  68    IESFNAGGNNKFWLGVNQFADLTNDEFRSTKT--NKGLKSSNMKIPTGFRYENVSADALP  125

Query  829   SAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggd  650
             + +DWR +GAVTP+K+QG CGCCWAFSAVAA EGIVKIS G+LVSL+EQELVDCD  G D
Sbjct  126   TTIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLVSLAEQELVDCDVHGED  185

Query  649   lgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSE  470
              GC GG MDDAFK+IIK+ GLTTES YPY   D G+C   + S  AA I GYEDVP N E
Sbjct  186   QGCEGGLMDDAFKFIIKNGGLTTESSYPYTAAD-GKCK--SGSNSAATIKGYEDVPANDE  242

Query  469   AALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLL  290
             AAL++A A+QPVSVA+D   +  QFY+GGV T  CGT+L+HG+  +GYG    G KYWL+
Sbjct  243   AALMKAVANQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDHGIAAIGYGKTSDGTKYWLM  302

Query  289   KNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             KNSWG  WGE+GY R+++DI  K G CG+A++PSYPT
Sbjct  303   KNSWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPT  339



>dbj|BAD29955.1| cysteine protease [Daucus carota]
Length=365

 Score =   377 bits (968),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 193/338 (57%), Positives = 245/338 (72%), Gaps = 11/338 (3%)
 Frame = -1

Query  1192  LIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKEN  1013
             L+    +LA  + A    + LNE     M + H+ WMARYGRVY    EK +R +IF+EN
Sbjct  14    LLFTIGVLASLAAA----RSLNEAS---MTETHDQWMARYGRVYKTANEKNRRSTIFQEN  66

Query  1012  VKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDI  833
             +K I++FN+A ++PY LG+NEFADLTN+EF +++N +K  V       +  FRYENVT +
Sbjct  67    LKYIQTFNKANNKPYKLGVNEFADLTNEEFTTSRNKFKSHVCAT---VTNVFRYENVTAV  123

Query  832   PSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkggg  653
             P+ +DWRK+GAVTP+KNQG CGCCWAFSAVAA+EGI ++  G+L+SLSEQELVDCD  G 
Sbjct  124   PATMDWRKKGAVTPIKNQGQCGCCWAFSAVAAMEGITQLKTGKLISLSEQELVDCDTNGE  183

Query  652   dlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNS  473
             D GC GG MD AF +I +++GL+TE+ YPY G D G CN    +  AA I G+EDVP NS
Sbjct  184   DQGCEGGLMDYAFDFIQQNHGLSTETNYPYSGTD-GTCNANKEANHAATITGHEDVPANS  242

Query  472   EAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWL  293
             E+ALL+A A+QP+SVAIDA G   QFY+ GVFT  CGTEL+HGVT VGYGT   G KYWL
Sbjct  243   ESALLKAVANQPISVAIDASGSDFQFYSSGVFTGECGTELDHGVTAVGYGTAADGTKYWL  302

Query  292   LKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             +KNSWG  WGE+GY ++QR + A EG CGIA+  SYPT
Sbjct  303   VKNSWGTSWGEEGYIQMQRGVAAAEGLCGIAMQASYPT  340



>gb|AAT34987.1| putative cysteine protease [Gossypium hirsutum]
Length=344

 Score =   376 bits (966),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 200/346 (58%), Positives = 247/346 (71%), Gaps = 9/346 (3%)
 Frame = -1

Query  1204  LIKNLIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETE--KAKRF  1031
             L++  +  A +L+ C   +  + GL+    D    RHE+WM+++GRVYADE E  K KRF
Sbjct  3     LLQIFLFVALVLSFC--FSIQLAGLSRPLLDEDSMRHEEWMSQHGRVYADEQEDHKNKRF  60

Query  1030  SIFKENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRP-VSPRNPWRSMPFR  854
             ++FKENV+ IE FN    + + L IN+FADLTN+EF ++ NG+K P V      +  PFR
Sbjct  61    NVFKENVERIEEFNDG--KTFKLAINQFADLTNEEFRASYNGFKGPMVLSSQITKPTPFR  118

Query  853   YENVTD-IPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQEL  677
             YENV+  +P +VDWRK+GAVTPVKNQG CGCCWAFSAVAA+EGI +IS G+L+SLSEQEL
Sbjct  119   YENVSSALPVSVDWRKKGAVTPVKNQGQCGCCWAFSAVAAIEGITQISTGKLISLSEQEL  178

Query  676   VdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAG  497
             VDCD  G D GC GG MD AF++II + GLTTES YPY G+D G CN    +  A  I G
Sbjct  179   VDCDTKGIDHGCEGGLMDTAFEFIINNGGLTTESNYPYKGED-GTCNFNKTNPIAVSITG  237

Query  496   YEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTG  317
             YEDVP N E AL++A AHQPVSVAI+A G   QFY+ GVFT  CGTEL+H VT VGYG  
Sbjct  238   YEDVPANDEQALMKAVAHQPVSVAIEAGGSDFQFYSSGVFTGECGTELDHAVTAVGYGES  297

Query  316   ERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             E G KYW++KNSWG KWGE GY  +Q+DI  K+G CGIA+  SYPT
Sbjct  298   EDGSKYWIVKNSWGTKWGESGYIEMQKDIKVKQGLCGIAMQASYPT  343



>ref|XP_003556992.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   376 bits (966),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 189/313 (60%), Positives = 234/313 (75%), Gaps = 2/313 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M +RHE+WM RY +VY D  E+ +RF IFKENV  IE+FN A ++PYTLGIN+FADL
Sbjct  32    DASMYERHEEWMGRYAKVYKDPQERERRFKIFKENVNYIEAFNNAANKPYTLGINQFADL  91

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF++ +N +K  +   +  R+  F+YENVT IPS VDWR++GAVTP+K+QG CGCCW
Sbjct  92    TNEEFIAPRNRFKGHMCS-SITRTTTFKYENVTAIPSTVDWRQKGAVTPIKDQGQCGCCW  150

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA EGI  +S G+L+SLSEQE+VDCD  G D GC GG MD AFK+II+++GL  E
Sbjct  151   AFSAVAATEGIHALSAGKLISLSEQEVVDCDTKGEDQGCAGGFMDGAFKFIIQNHGLNNE  210

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
               YPY   D G+CN   A+   A I GYEDVP+N+E AL +A A+QPVSVAIDA G   Q
Sbjct  211   PNYPYKAVD-GKCNAKAAANHVATITGYEDVPVNNEKALQKAVANQPVSVAIDASGSDFQ  269

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY  GVFT  CGTEL+HGVT VGYG    G +YWL+KNSWG +WGE+GY R+QR + A+E
Sbjct  270   FYQSGVFTGSCGTELDHGVTAVGYGVSADGTEYWLVKNSWGTEWGEEGYIRMQRGVKAEE  329

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYPT
Sbjct  330   GLCGIAMMASYPT  342



>ref|XP_003527349.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   376 bits (965),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 189/313 (60%), Positives = 234/313 (75%), Gaps = 2/313 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M +RHE+WM RY +VY D  E+ +RF IFKENV  IE+FN A ++PYTLGIN+FADL
Sbjct  32    DASMYERHEEWMGRYAKVYKDPQERERRFKIFKENVNYIEAFNNAANKPYTLGINQFADL  91

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF++ +N +K  +   +  R+  F+YENVT IPS VDWR++GAVTP+K+QG CGCCW
Sbjct  92    TNEEFIAPRNRFKGHMCS-SITRTTTFKYENVTAIPSTVDWRQKGAVTPIKDQGQCGCCW  150

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA EGI  +S G+L+SLSEQE+VDCD  G D GC GG MD AFK+II+++GL  E
Sbjct  151   AFSAVAATEGIHALSAGKLISLSEQEVVDCDTKGEDQGCAGGFMDGAFKFIIQNHGLNNE  210

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
               YPY   D G+CN   A+   A I GYEDVP+N+E AL +A A+QPVSVAIDA G   Q
Sbjct  211   PNYPYKAVD-GKCNAKAAANHVATITGYEDVPVNNEKALQKAVANQPVSVAIDASGSDFQ  269

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY  GVFT  CGTEL+HGVT VGYG    G +YWL+KNSWG +WGE+GY R+QR + A+E
Sbjct  270   FYQSGVFTGSCGTELDHGVTAVGYGVSADGTEYWLVKNSWGTEWGEEGYIRMQRGVKAEE  329

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYPT
Sbjct  330   GLCGIAMMASYPT  342



>ref|XP_007132888.1| hypothetical protein PHAVU_011G133300g [Phaseolus vulgaris]
 gb|ESW04882.1| hypothetical protein PHAVU_011G133300g [Phaseolus vulgaris]
Length=343

 Score =   376 bits (965),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 196/313 (63%), Positives = 236/313 (75%), Gaps = 2/313 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M +RHE WM RY RVY D  EK KRF IFKENVK IE+FN A ++ Y L IN+FADL
Sbjct  32    DASMHERHEQWMTRYSRVYKDPEEKEKRFRIFKENVKYIEAFNNAANKAYNLAINQFADL  91

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF++ +N +K  V   +  R+  F+YENV+ +PS VDWR++GAVTPVK+QG CGCCW
Sbjct  92    TNEEFIAPRNRFKGHVCS-SITRTTTFKYENVSAVPSTVDWRQKGAVTPVKDQGQCGCCW  150

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA EGI K+S G+L+SLSEQELVDCD  G D GC GG MDDAFK+II+++GL TE
Sbjct  151   AFSAVAATEGIHKLSTGKLISLSEQELVDCDIKGVDQGCGGGLMDDAFKFIIQNHGLNTE  210

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D G+CN   A+  AA I GYEDVP N+E AL +A  +QPVSVAIDA G   Q
Sbjct  211   ASYPYKGVD-GKCNANAAANHAATITGYEDVPANNEKALQKAVTNQPVSVAIDASGSDFQ  269

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY  GVFT  CGTEL+HGVT VGYG  + G KYWL+KNSWG +WGE+GY R+QR + A+E
Sbjct  270   FYKSGVFTGSCGTELDHGVTAVGYGVSDDGRKYWLVKNSWGTEWGEEGYIRMQRGVAAEE  329

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYPT
Sbjct  330   GLCGIAMMASYPT  342



>ref|XP_003607571.1| Cysteine proteinase EP-B [Medicago truncatula]
 gb|AAQ63885.1| putative cysteine proteinase [Medicago truncatula]
 gb|AES89768.1| papain family cysteine protease [Medicago truncatula]
Length=345

 Score =   376 bits (965),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 194/334 (58%), Positives = 239/334 (72%), Gaps = 4/334 (1%)
 Frame = -1

Query  1177  AILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIE  998
             A+  C    A  +      DD ++ ++HE WM  YG+VY D  E+  R  IFKENV  IE
Sbjct  14    ALFFCLGLFAIQVTSRTLQDDSIIYEKHEQWMVHYGKVYKDLQERENRLKIFKENVNYIE  73

Query  997   SFNQAGD-RPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAV  821
             + N AG+ + Y LGIN+FADLTN+EF++++N +K  +      ++  F+YEN + +PS V
Sbjct  74    ASNNAGNNKLYKLGINQFADLTNEEFIASRNKFKGHMCSSIT-KTSTFKYENAS-VPSTV  131

Query  820   DWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgc  641
             DWRK+GAVTPVKNQG CGCCWAFSAVAA EGI K+S G+LVSLSEQELVDCD  G D GC
Sbjct  132   DWRKKGAVTPVKNQGQCGCCWAFSAVAATEGIHKLSTGKLVSLSEQELVDCDTKGVDQGC  191

Query  640   hgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAAL  461
              GG MDDAFK+II+++GL TE+ YPY G D G C+   AS  A  I GYEDVP N+E AL
Sbjct  192   EGGLMDDAFKFIIQNHGLNTEAQYPYQGVD-GTCSANKASIHAVTITGYEDVPANNEQAL  250

Query  460   LQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNS  281
              +A A+QP+SVAIDA G   QFY  GVFT  CGTEL+HGVT VGYG G  G KYWL+KNS
Sbjct  251   QKAVANQPISVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVGNDGTKYWLVKNS  310

Query  280   WGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             WG  WGE+GY ++QR +DA EG CGIA++ SYPT
Sbjct  311   WGTDWGEEGYIKMQRGVDAAEGLCGIAMEASYPT  344



>gb|AAR92154.1| putative cysteine protease 1 [Iris x hollandica]
Length=340

 Score =   375 bits (964),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 197/347 (57%), Positives = 248/347 (71%), Gaps = 12/347 (3%)
 Frame = -1

Query  1219  KMVSRLIKNLIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKA  1040
             K V  L    ++  AI A   +A +S+      ++  M +RHE WMA++GRVY +  EKA
Sbjct  5     KTVKLLPALALLIVAIWASQGEAGRSL-----GENKSMLERHEQWMAQHGRVYKNAAEKA  59

Query  1039  KRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMP  860
              RF IF+ NV+ IESFN A +  + LG+N+FADLTN+EF  T+N  K    P     +  
Sbjct  60    HRFEIFRANVERIESFN-AENHKFKLGVNQFADLTNEEF-KTRNTLK----PSKMASTKS  113

Query  859   FRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQE  680
             F+YENVT +P+ +DWR +GAVTP+K+QG CG CWAFSAVAA EGI K+S G+L+SLSEQE
Sbjct  114   FKYENVTAVPATMDWRTKGAVTPIKDQGQCGSCWAFSAVAATEGITKLSTGKLISLSEQE  173

Query  679   LVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIA  500
             +VDCD    D GC+GG MDDAF+YIIK+ G+TTE+ YPY   D G CN   A+  AA I 
Sbjct  174   VVDCDVTSDDQGCNGGEMDDAFEYIIKNKGITTEANYPYKAAD-GTCNTKKAASHAASIT  232

Query  499   GYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGT  320
             GYEDV +NSEAALL+AAA+QP++VAIDA     Q Y+ GVFT  CGT+L+HGVT+VGYG 
Sbjct  233   GYEDVTVNSEAALLKAAANQPIAVAIDAGDFAFQMYSSGVFTGDCGTDLDHGVTLVGYGA  292

Query  319   GERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
                G KYWL+KNSWG  WGEDGY R++RD+DAKEG CGIA+D SYPT
Sbjct  293   TSDGTKYWLVKNSWGTSWGEDGYIRMERDVDAKEGLCGIAMDASYPT  339



>gb|KCW76137.1| hypothetical protein EUGRSUZ_D00513 [Eucalyptus grandis]
Length=328

 Score =   375 bits (962),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 198/310 (64%), Positives = 233/310 (75%), Gaps = 2/310 (1%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M +RHE WMAR+GRVY  + EK +RF IFK NV+ IESFN+   RPY LGIN FADLTND
Sbjct  20    MRERHEQWMARHGRVYKADGEKERRFMIFKNNVEFIESFNENNTRPYKLGINGFADLTND  79

Query  928   EFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFS  749
             EF +T+NGYKR  S  +      FRYENVT +PS VDWR++GAVTPVK QG CGCCWAFS
Sbjct  80    EFKATRNGYKRSSSVSSS-GPKSFRYENVTAVPSTVDWRQKGAVTPVKEQGQCGCCWAFS  138

Query  748   AVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGY  569
             AVAA EGI +++ G LVSLS Q+LVDCD  G + GC GG ++ AFK+II ++GLTTE  Y
Sbjct  139   AVAATEGIHQLTTGNLVSLSVQQLVDCDTKGDNRGCAGGFVNAAFKFIIDNDGLTTEDNY  198

Query  568   PYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYA  389
             PY     G C+   A   AAKI GYEDVP NSE+AL QA A+QPVSVAIDA G   QFY+
Sbjct  199   PYEAVK-GTCDAGQAESPAAKITGYEDVPSNSESALSQAVANQPVSVAIDADGSHFQFYS  257

Query  388   GGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRC  209
             GGVFT  C T+L+HGVTVVGYGT + G KYWL+KNSWG  WGE+GY R++RDIDA EG C
Sbjct  258   GGVFTGDCQTDLDHGVTVVGYGTSDDGTKYWLVKNSWGAGWGENGYIRMKRDIDAVEGLC  317

Query  208   GIALDPSYPT  179
             GIA+  +YPT
Sbjct  318   GIAIRAAYPT  327



>ref|XP_010052206.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=342

 Score =   375 bits (964),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 198/310 (64%), Positives = 233/310 (75%), Gaps = 2/310 (1%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M +RHE WMAR+GRVY  + EK +RF IFK NV+ IESFN+   RPY LGIN FADLTND
Sbjct  34    MRERHEQWMARHGRVYKADGEKERRFMIFKNNVEFIESFNENNTRPYKLGINGFADLTND  93

Query  928   EFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFS  749
             EF +T+NGYKR  S  +      FRYENVT +PS VDWR++GAVTPVK QG CGCCWAFS
Sbjct  94    EFKATRNGYKRSSSVSSS-GPKSFRYENVTAVPSTVDWRQKGAVTPVKEQGQCGCCWAFS  152

Query  748   AVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGY  569
             AVAA EGI +++ G LVSLS Q+LVDCD  G + GC GG ++ AFK+II ++GLTTE  Y
Sbjct  153   AVAATEGIHQLTTGNLVSLSVQQLVDCDTKGDNRGCAGGFVNAAFKFIIDNDGLTTEDNY  212

Query  568   PYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYA  389
             PY     G C+   A   AAKI GYEDVP NSE+AL QA A+QPVSVAIDA G   QFY+
Sbjct  213   PYEAVK-GTCDAGQAESPAAKITGYEDVPSNSESALSQAVANQPVSVAIDADGSHFQFYS  271

Query  388   GGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRC  209
             GGVFT  C T+L+HGVTVVGYGT + G KYWL+KNSWG  WGE+GY R++RDIDA EG C
Sbjct  272   GGVFTGDCQTDLDHGVTVVGYGTSDDGTKYWLVKNSWGAGWGENGYIRMKRDIDAVEGLC  331

Query  208   GIALDPSYPT  179
             GIA+  +YPT
Sbjct  332   GIAIRAAYPT  341



>gb|KHN33962.1| Vignain [Glycine soja]
Length=309

 Score =   374 bits (959),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 188/310 (61%), Positives = 233/310 (75%), Gaps = 2/310 (1%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M +RHE+WM RY +VY D  E+ +RF IFKENV  IE+FN A ++PYTLGIN+FADLTN+
Sbjct  1     MYERHEEWMGRYAKVYKDPQERERRFKIFKENVNYIEAFNNAANKPYTLGINQFADLTNE  60

Query  928   EFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFS  749
             EF++ +N +K  +   +  R+  F+YENVT IPS VDWR++GAVTP+K+QG CGCCWAFS
Sbjct  61    EFIAPRNRFKGHMC-SSITRTTTFKYENVTAIPSTVDWRQKGAVTPIKDQGQCGCCWAFS  119

Query  748   AVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGY  569
             AVAA EGI  +S G+L+SLSEQE+VDCD  G D GC GG MD AFK+II+++GL  E  Y
Sbjct  120   AVAATEGIHALSAGKLISLSEQEVVDCDTKGEDQGCAGGFMDGAFKFIIQNHGLNNEPNY  179

Query  568   PYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYA  389
             PY   D G+CN   A+   A I GYEDVP+N+E AL +A A+QPVSVAIDA G   QFY 
Sbjct  180   PYKAVD-GKCNAKAAANHVATITGYEDVPVNNEKALQKAVANQPVSVAIDASGSDFQFYQ  238

Query  388   GGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRC  209
              GVFT  CGTEL+HGVT VGYG    G +YWL+KNSWG +WGE+GY R+QR + A+EG C
Sbjct  239   SGVFTGSCGTELDHGVTAVGYGVSADGTEYWLVKNSWGTEWGEEGYIRMQRGVKAEEGLC  298

Query  208   GIALDPSYPT  179
             GIA+  SYPT
Sbjct  299   GIAMMASYPT  308



>ref|XP_010277773.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Nelumbo 
nucifera]
Length=345

 Score =   375 bits (962),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 186/309 (60%), Positives = 234/309 (76%), Gaps = 3/309 (1%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M +RHE WMA +G +Y D  EK KRF+IFK+NV+ IE+FN AG++PY L +N FAD TN+
Sbjct  38    MLERHEQWMASHGVLYEDAVEKEKRFTIFKDNVERIEAFNMAGNKPYKLSVNRFADQTNE  97

Query  928   EFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFS  749
             EF +++NGYKR   P +   S  FRYEN+T +  ++DWR +GAVTP+K+QG CGCCWAFS
Sbjct  98    EFKASRNGYKRSTQPSSSKTS--FRYENMTSVLPSMDWRSKGAVTPIKDQGDCGCCWAFS  155

Query  748   AVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGY  569
             AVAA+EGI K+  G+L+SLSEQELVDCD  GGD GC GG MD+AF++I  + GLTTE+ Y
Sbjct  156   AVAAMEGITKLKAGKLISLSEQELVDCDTAGGDYGCEGGFMDNAFQFIQHNGGLTTEANY  215

Query  568   PYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYA  389
             PY   D G C+   ++  AAKI+GYEDVP N+E ALL+A ++QPVSVAIDA G   QFY+
Sbjct  216   PYKQTD-GTCDKRKSALSAAKISGYEDVPANNEVALLKAVSNQPVSVAIDAGGFDFQFYS  274

Query  388   GGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRC  209
              G+FT  CGT L+HGVT VGYGT   G KYWL+KNSWG  WGE GY R++RD+ +KEG C
Sbjct  275   SGIFTGECGTNLDHGVTAVGYGTSSDGTKYWLVKNSWGTTWGEKGYIRMKRDVASKEGLC  334

Query  208   GIALDPSYP  182
             GIA+  SYP
Sbjct  335   GIAMQASYP  343



>ref|XP_002531151.1| cysteine protease, putative [Ricinus communis]
 gb|EEF31236.1| cysteine protease, putative [Ricinus communis]
Length=340

 Score =   374 bits (961),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 189/313 (60%), Positives = 237/313 (76%), Gaps = 5/313 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M ++HE+WM+R+GRVY D  EK  R+ IFKENV+ IESFN+A  + Y LGIN+FADL
Sbjct  32    DASMHEKHEEWMSRFGRVYNDGNEKEIRYKIFKENVQRIESFNKASGKSYKLGINQFADL  91

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF +++N +K  +      ++ PFRYEN+T  PS++DWRK+GAVT +K+QG CG CW
Sbjct  92    TNEEFKTSRNRFKGHMCSS---QAGPFRYENLTAAPSSMDWRKKGAVTAIKDQGQCGSCW  148

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAAVEGI +++  +L+SLSEQELVDCD  G D GC GG MDDAFK+I ++ GLTTE
Sbjct  149   AFSAVAAVEGITQLATSKLISLSEQELVDCDTKGEDQGCQGGLMDDAFKFIEQNQGLTTE  208

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D G CN    +  AAKI G+EDVP N+E AL++A A QPVSVAIDA G   Q
Sbjct  209   ANYPYEGSD-GTCNTKQEANHAAKINGFEDVPANNEGALMKAVAKQPVSVAIDAGGFGFQ  267

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY+ G+FT  CGTEL+HGV  VGYG    G+ YWL+KNSWG +WGE+GY R+Q+DIDAKE
Sbjct  268   FYSSGIFTGDCGTELDHGVAAVGYGE-SNGMNYWLVKNSWGTQWGEEGYIRMQKDIDAKE  326

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYPT
Sbjct  327   GLCGIAMQASYPT  339



>gb|AFW86317.1| hypothetical protein ZEAMMB73_339067 [Zea mays]
Length=433

 Score =   378 bits (970),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/355 (55%), Positives = 247/355 (70%), Gaps = 12/355 (3%)
 Frame = -1

Query  1237  FLQQETKMVSRLIKNLIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYA  1058
              +Q+ T    +   + I+  A     + AA+ +      DD VM  RHE WMA+Y RVY 
Sbjct  88    LMQRSTMATLKASISAIIGFAFFCGAAMAARDLS-----DDSVMVARHEQWMAQYSRVYK  142

Query  1057  DETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRN  878
             D +EKA+RF +FK NV+ IESFN  G+  + LG+N+FADLTNDEF STK    + +   N
Sbjct  143   DASEKARRFEVFKANVQFIESFNAGGNNKFWLGVNQFADLTNDEFRSTKT--NKGLKSSN  200

Query  877   PWRSMPFRYENVTD--IPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGE  704
                   FRYENV+   +P+ +DWR +GAVTP+K+QG CGCCWAFSAVAA EGIVKIS G+
Sbjct  201   MKIPTGFRYENVSADALPTTIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGK  260

Query  703   LVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTA  524
             LVSL+EQELVDCD  G D GC GG MDDAFK+IIK+ GLTTES YPY   D G+C   + 
Sbjct  261   LVSLAEQELVDCDVHGEDQGCEGGLMDDAFKFIIKNGGLTTESSYPYTAAD-GKCK--SG  317

Query  523   SFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHG  344
             S  AA I GYEDVP N EAAL++A A+QPVSVA+D   +  QFY+GGV T  CGT+L+HG
Sbjct  318   SNSAATIKGYEDVPANDEAALMKAVANQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDHG  377

Query  343   VTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             +  +GYG    G KYWL+KNSWG  WGE+GY R+++DI  K G CG+A++PSYPT
Sbjct  378   IAAIGYGKTSDGTKYWLMKNSWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPT  432



>ref|XP_002446222.1| hypothetical protein SORBIDRAFT_06g005410 [Sorghum bicolor]
 gb|EES10550.1| hypothetical protein SORBIDRAFT_06g005410 [Sorghum bicolor]
Length=340

 Score =   374 bits (961),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 202/345 (59%), Positives = 247/345 (72%), Gaps = 13/345 (4%)
 Frame = -1

Query  1201  IKNLIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIF  1022
             +K  I+    LA    AA + + LN  DD  M  RHE WMA+Y RVY D TEKA+RF +F
Sbjct  4     LKGSILAILGLALFCGAALAARDLN--DDSAMVARHEQWMAQYNRVYKDATEKAQRFEVF  61

Query  1021  KENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKN--GYKRPVSPRNPWRSMPFRYE  848
             K NVK IESFN  G+R + LG+N+FADLTNDEF +TK   G+K P   + P     FRYE
Sbjct  62    KANVKFIESFNAGGNRKFWLGVNQFADLTNDEFRATKTNKGFK-PSPVKVP---TGFRYE  117

Query  847   NVT--DIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELV  674
             NV+   +P+++DWR +GAVTP+K+QG CGCCWAFSAVAA EGIVKIS  +L+SLSEQELV
Sbjct  118   NVSVDALPASIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTDKLISLSEQELV  177

Query  673   dcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGY  494
             DCD  G D GC GG MDDAFK+IIK+ GLTTES YPY   D G+C   T S  AA I G+
Sbjct  178   DCDVHGEDQGCEGGLMDDAFKFIIKNGGLTTESSYPYTATD-GKCKSGTNS--AANIKGF  234

Query  493   EDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGE  314
             EDVP N EAAL++A A+QPVSVA+D   +  Q Y+GGV T  CGT+L+HG+  +GYG   
Sbjct  235   EDVPANDEAALMKAVANQPVSVAVDGGDMTFQLYSGGVMTGSCGTDLDHGIAAIGYGQTS  294

Query  313   RGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
              G KYWLLKNSWG  WGE+GY R+++DI  K G CG+A++PSYPT
Sbjct  295   DGTKYWLLKNSWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPT  339



>ref|XP_003527350.1| PREDICTED: vignain-like [Glycine max]
 ref|XP_003556993.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   374 bits (961),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 196/348 (56%), Positives = 246/348 (71%), Gaps = 8/348 (2%)
 Frame = -1

Query  1222  TKMVSRLIKNLIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEK  1043
             TK+    I   + F         A++++Q      D  M +RHE WMARYG+VY D  EK
Sbjct  3     TKIQFHHISLALFFCLGFLAFQVASRTLQ------DASMYERHEQWMARYGKVYKDPEEK  56

Query  1042  AKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSM  863
              KRF +FKENV  IE+FN A ++PY LGIN+FADLT++EF+  +N +       N  R+ 
Sbjct  57    EKRFRVFKENVNYIEAFNNAANKPYKLGINQFADLTSEEFIVPRNRFNGHTRSSNT-RTT  115

Query  862   PFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQ  683
              F+YENVT +P ++DWR++GAVTP+KNQG CGCCWAFSA+AA EGI KIS G+LVSLSEQ
Sbjct  116   TFKYENVTVLPDSIDWRQKGAVTPIKNQGSCGCCWAFSAIAATEGIHKISTGKLVSLSEQ  175

Query  682   ELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKI  503
             E+VDCD  G D GC GG MD AFK+II+++G+ TE+ YPY G D G+CN+   +  AA I
Sbjct  176   EVVDCDTKGTDHGCEGGYMDGAFKFIIQNHGINTEASYPYKGVD-GKCNIKEEAVHAATI  234

Query  502   AGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYG  323
              GYEDVP+N+E AL +A A+QPVSVAIDA G   QFY  G+FT  CGTEL+HGVT VGYG
Sbjct  235   TGYEDVPINNEKALQKAVANQPVSVAIDASGADFQFYKSGIFTGSCGTELDHGVTAVGYG  294

Query  322   TGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
                 G KYWL+KNSWG +WGE+GY  +QR + A EG CGIA+  SYPT
Sbjct  295   ENNEGTKYWLVKNSWGTEWGEEGYIMMQRGVKAVEGICGIAMMASYPT  342



>ref|XP_003538185.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   374 bits (960),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 190/313 (61%), Positives = 234/313 (75%), Gaps = 3/313 (1%)
 Frame = -1

Query  1120  DDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFAD  941
             +D  M +RHE WMA +G+VY    EK +++  FKENV+ IE+FN AG++PY LGIN FAD
Sbjct  32    EDAPMRERHEQWMAIHGKVYTHSYEKEQKYQTFKENVQRIEAFNHAGNKPYKLGINHFAD  91

Query  940   LTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCC  761
             LTN+EF +  N +K  V  +   R+  FRYEN+T +P+ +DWR+EGAVTP+K+QG CGCC
Sbjct  92    LTNEEFKAI-NRFKGHVCSKIT-RTPTFRYENMTAVPATLDWRQEGAVTPIKDQGQCGCC  149

Query  760   WAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTT  581
             WAFSAVAA EGI K+S G+L+SLSEQELVDCD  G D GC GG MDDAFK+I+++ GL  
Sbjct  150   WAFSAVAATEGITKLSTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFILQNKGLAA  209

Query  580   ESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQL  401
             E+ YPY G D G CN       A  I GYEDVP NSE+ALL+A A+QPVSVAI+A G + 
Sbjct  210   EAIYPYEGVD-GTCNAKAEGNHATSIKGYEDVPANSESALLKAVANQPVSVAIEASGFEF  268

Query  400   QFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAK  221
             QFY+GGVFT  CGT L+HGVT VGYG  + G KYWL+KNSWG KWG+ GY R+QRD+ AK
Sbjct  269   QFYSGGVFTGSCGTNLDHGVTAVGYGVSDDGTKYWLVKNSWGVKWGDKGYIRMQRDVAAK  328

Query  220   EGRCGIALDPSYP  182
             EG CGIA+  SYP
Sbjct  329   EGLCGIAMLASYP  341



>ref|XP_008669676.1| PREDICTED: ervatamin-B-like [Zea mays]
 tpg|DAA38581.1| TPA: hypothetical protein ZEAMMB73_156486 [Zea mays]
Length=347

 Score =   374 bits (960),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 199/345 (58%), Positives = 245/345 (71%), Gaps = 14/345 (4%)
 Frame = -1

Query  1186  VFAAILAC----CSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFK  1019
             +  AIL C    CS A  + + L  DD+  M  RHE WM ++GRVY DET+KA RF +FK
Sbjct  7     LLLAILGCGVCLCSAAVLAARELGGDDELAMVARHEQWMVQHGRVYKDETDKAHRFLVFK  66

Query  1018  ENVKAIESFNQA---GDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYE  848
              NVK IESFN A   G+R + LG+N+FADLTNDEF +TK    +  +P        FRY+
Sbjct  67    ANVKFIESFNAAAAAGNRKFWLGVNQFADLTNDEFRATKT--NKGFNPNVVKVPTGFRYQ  124

Query  847   NVT--DIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELV  674
             N++   +P  VDWR +GAVTP+K+QG CGCCWAFSAVAA EGIVKIS G+L SLSEQELV
Sbjct  125   NLSIDALPQTVDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLTSLSEQELV  184

Query  673   dcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGY  494
             DCD  G D GC+GG MDDAFK+IIK+ GLTTES YPY  QD G+C   + S  AA I GY
Sbjct  185   DCDVHGEDQGCNGGEMDDAFKFIIKNGGLTTESNYPYTAQD-GQCK--SGSNGAATIKGY  241

Query  493   EDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGE  314
             EDVP N EAAL++A A QPVSVA+D   +  QFY+GGV T  CGT+L+HG+  +GYG   
Sbjct  242   EDVPANDEAALMKAVASQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDHGIAAIGYGKTS  301

Query  313   RGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
              G KYWL+KNSWG  WGE+G+ R+++DI  K+G CG+A+ PSYPT
Sbjct  302   DGTKYWLMKNSWGTTWGENGFLRMEKDIADKKGMCGLAMQPSYPT  346



>ref|XP_003607548.1| Cysteine protease [Medicago truncatula]
 ref|XP_003637653.1| Cysteine protease [Medicago truncatula]
 gb|AES89745.1| papain family cysteine protease [Medicago truncatula]
Length=345

 Score =   374 bits (960),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 193/317 (61%), Positives = 235/317 (74%), Gaps = 5/317 (2%)
 Frame = -1

Query  1126  EDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGD-RPYTLGINE  950
             +DD ++ EK HE WM  YG+VY D  E+  R  IFKENV  IE+ N AG+ + Y LGIN+
Sbjct  32    QDDSNIYEK-HEQWMVHYGKVYKDLQERENRLKIFKENVNYIEASNNAGNNKLYKLGINQ  90

Query  949   FADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVC  770
             FADLTN+EF++++N +K  +      ++  F+YEN + +PS VDWRK+GAVTPVKNQG C
Sbjct  91    FADLTNEEFIASRNKFKGHMCSSIT-KTSTFKYENAS-VPSTVDWRKKGAVTPVKNQGQC  148

Query  769   GCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNG  590
             GCCWAFSAVAA EGI K+S G+LVSLSEQELVDCD  G D GC GG MDDAFK+II+++G
Sbjct  149   GCCWAFSAVAATEGIHKLSTGKLVSLSEQELVDCDTKGVDQGCEGGLMDDAFKFIIQNHG  208

Query  589   LTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARG  410
             L TE+ YPY G D G C+   AS  A  I GYEDVP N+E AL +A A+QP+SVAIDA G
Sbjct  209   LNTEAQYPYQGVD-GTCSANKASIHAVTITGYEDVPANNEQALQKAVANQPISVAIDASG  267

Query  409   LQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDI  230
                QFY  GVFT  CGTEL+HGVT VGYG G  G KYWL+KNSWG  WGE+GY ++QR +
Sbjct  268   SDFQFYKSGVFTGSCGTELDHGVTAVGYGVGNDGTKYWLVKNSWGTDWGEEGYIKMQRGV  327

Query  229   DAKEGRCGIALDPSYPT  179
             DA EG CGIA++ SYPT
Sbjct  328   DAAEGLCGIAMEASYPT  344



>ref|XP_004505500.1| PREDICTED: vignain-like [Cicer arietinum]
Length=345

 Score =   374 bits (959),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 190/314 (61%), Positives = 231/314 (74%), Gaps = 3/314 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGD-RPYTLGINEFAD  941
             DD M + H+ WM  Y +VY D  EK KR  IF +N+  I++FN AG+ +PY LGIN++AD
Sbjct  33    DDSMYESHDQWMRHYAKVYKDSQEKEKRSKIFTQNINYIQAFNNAGNNKPYKLGINQYAD  92

Query  940   LTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCC  761
             LTN+EF++++N +K  +   +  R+  F+Y+NVT +PS VDWRK+GAVTPVKNQG CGCC
Sbjct  93    LTNEEFIASRNKFKGHMCS-SIIRTTTFKYQNVTALPSTVDWRKKGAVTPVKNQGQCGCC  151

Query  760   WAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTT  581
             WAFSAVAA EGI K+S G+L+SLSEQELVDCD  G D GC GG MDDAFK+II+++GL T
Sbjct  152   WAFSAVAATEGIHKLSTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFIIQNHGLDT  211

Query  580   ESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQL  401
             E+ YPY G D G C    AS  AA I GYEDV  N+E AL +A A+QP+SVAIDA G   
Sbjct  212   EAQYPYQGVD-GTCYANEASVHAATITGYEDVAANNEQALQKALANQPISVAIDASGSDF  270

Query  400   QFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAK  221
             QFY  GVFT  CGTEL+HGVT VGYG    G KYWL+KNSWG  WGE GY R+QR +DA 
Sbjct  271   QFYKSGVFTGSCGTELDHGVTAVGYGVSNDGTKYWLVKNSWGTDWGEQGYIRMQRGVDAA  330

Query  220   EGRCGIALDPSYPT  179
             EG CGIA+  SYPT
Sbjct  331   EGLCGIAMQASYPT  344



>gb|KCW84689.1| hypothetical protein EUGRSUZ_B01506, partial [Eucalyptus grandis]
Length=295

 Score =   372 bits (954),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 192/298 (64%), Positives = 232/298 (78%), Gaps = 4/298 (1%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M +RHE WMAR+GRVY D  EK + FSIFK  V+ IESFNQ G++PY L IN FADLT++
Sbjct  1     MRERHEQWMARHGRVYEDAAEKERCFSIFKTTVEYIESFNQDGNKPYKLAINAFADLTSE  60

Query  928   EFVSTKNGYKRPVSPRNPWRSM-PFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAF  752
             EF +++ GYKR  S R    SM PF+YE+VT IPS++DWRK+GAVTP+K+QG CGC WAF
Sbjct  61    EFKASRTGYKRSSSLRAA--SMKPFQYESVTAIPSSMDWRKKGAVTPIKDQGQCGCRWAF  118

Query  751   SAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESG  572
             SAVAA+EGI +++ G+L SLSEQELVDCD+ G D GC GG MDDAF++II ++GLTTE+ 
Sbjct  119   SAVAAMEGITQLTTGKLTSLSEQELVDCDRSGEDQGCGGGLMDDAFQFIISNHGLTTEAN  178

Query  571   YPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFY  392
             YPY   D   CN   A+  AAKI+GYEDVP NSE+ALL+A AHQPVSVAIDA     QFY
Sbjct  179   YPYQAVD-NTCNARKAASTAAKISGYEDVPSNSESALLKAVAHQPVSVAIDAGETDFQFY  237

Query  391   AGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             + G+FT  CGT+L+HGVT VGYGT E G KYWL+KNSWG  WGE+GY R+QRDIDA E
Sbjct  238   STGIFTGECGTDLDHGVTAVGYGTSENGTKYWLVKNSWGTGWGEEGYIRMQRDIDAAE  295



>ref|XP_009344439.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
 ref|XP_009344444.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=333

 Score =   373 bits (958),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 190/314 (61%), Positives = 232/314 (74%), Gaps = 5/314 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M  R+E W+ RYGRVY D  EK  RF IFKENV  IES N+  ++PY L +N+FADL
Sbjct  23    DAPMYGRYEQWLTRYGRVYNDVNEKETRFKIFKENVAFIESSNKYANKPYKLSVNQFADL  82

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVT-DIPSAVDWRKEGAVTPVKNQGVCGCC  761
             TN+EF ++KNG+K         ++  F+YENVT  +P+ +DWRK+GAVTP+K+QG CGCC
Sbjct  83    TNEEFKASKNGFK---GHECSTKTTSFKYENVTASLPATMDWRKKGAVTPIKDQGQCGCC  139

Query  760   WAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTT  581
             WAFSAVAA EGI +++ G+L+SLSEQELVDCD  G D GC GG MDDAF++I +++G++T
Sbjct  140   WAFSAVAATEGITQLTTGKLMSLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNHGIST  199

Query  580   ESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQL  401
             E+ YPY G D G CN    +  AAKI G+EDVP NSE ALL A AHQPVSVAIDA G   
Sbjct  200   EANYPYEGVD-GTCNTKKETSHAAKITGFEDVPANSEKALLAAVAHQPVSVAIDASGSDF  258

Query  400   QFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAK  221
             QFY+ GVFT  CGT L+HGVT VGYG  E G KYWL+KNSWG +WGE GY R+QRD+ A 
Sbjct  259   QFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWGAEWGEAGYIRMQRDVAAA  318

Query  220   EGRCGIALDPSYPT  179
             EG CGIA+  SYPT
Sbjct  319   EGLCGIAMAASYPT  332



>ref|XP_007213554.1| hypothetical protein PRUPE_ppa018048mg [Prunus persica]
 gb|EMJ14753.1| hypothetical protein PRUPE_ppa018048mg [Prunus persica]
Length=343

 Score =   373 bits (958),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 189/315 (60%), Positives = 234/315 (74%), Gaps = 4/315 (1%)
 Frame = -1

Query  1123  DDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFA  944
             D    M  RHE WMARY  +Y D+ E+ KRF IFK+NV+ IESFN A ++PY L IN FA
Sbjct  32    DAHTSMLDRHEQWMARYVPIYKDDEEREKRFQIFKDNVEFIESFNYASNQPYKLNINGFA  91

Query  943   DLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGC  764
             D +++EF +++N Y+  ++  +     PFRYENVT IPS++DWRK+GAVTP+K+QG CGC
Sbjct  92    DQSHEEFQASRNRYRTSLNTMSS--KTPFRYENVTAIPSSMDWRKKGAVTPIKDQGECGC  149

Query  763   CWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLT  584
             CWAFSAVAA EG  K+  G+LVSLSEQELVDCD  G + GC GG MDDAFK+++++ GL 
Sbjct  150   CWAFSAVAATEGTTKLKSGKLVSLSEQELVDCDTQGENQGCEGGLMDDAFKFVMRNKGLA  209

Query  583   TESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQ  404
              E+ YPY G D G CN    ++ AAKI GYEDVP N E ALL+A A+QPVSVAIDA G +
Sbjct  210   AEANYPYRGID-GICNKNKVAYHAAKITGYEDVPAN-ELALLKAVANQPVSVAIDAGGYE  267

Query  403   LQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDA  224
              QFY+ G+ T  CGT LNHGVTVVGYGTG  G KYWL+KNSWG +WGE GY R+QRD+  
Sbjct  268   FQFYSRGILTGDCGTHLNHGVTVVGYGTGADGTKYWLVKNSWGAEWGEGGYVRIQRDVHT  327

Query  223   KEGRCGIALDPSYPT  179
             ++G CGIA+  SYPT
Sbjct  328   RQGLCGIAMKASYPT  342



>ref|XP_008800071.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score =   373 bits (958),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 190/313 (61%), Positives = 229/313 (73%), Gaps = 2/313 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M+++HE WMA YGRVY D  EK +RF IF+ NV+ IESFN AG+  + LG N+FADL
Sbjct  31    DVSMKEKHEQWMALYGRVYKDAAEKERRFKIFQANVELIESFN-AGNHKFKLGANQFADL  89

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF +            +   +  F+YEN T +P ++DWR +GAVTP+K+QG CGCCW
Sbjct  90    TNEEFRAVHTXXXXXXXASSGMATKSFKYENATAVPVSMDWRAKGAVTPIKDQGQCGCCW  149

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA+EGI K+S G+L+SLSEQELVDCD  G D GC GG MDDAFK+IIK+ GLTTE
Sbjct  150   AFSAVAAMEGITKLSTGKLISLSEQELVDCDTKGEDQGCGGGLMDDAFKFIIKNGGLTTE  209

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY   D G CN   +   AA I GYEDVP NSEAALL+A A+QPVSVAIDA G   Q
Sbjct  210   ANYPYEAAD-GTCNAGKSHSHAATIGGYEDVPANSEAALLKAVANQPVSVAIDAGGSAFQ  268

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
              Y+ GVFT  CGTEL+HGVT VGY     G KYWL+KNSWG  WGE+GY R++RD+DAKE
Sbjct  269   LYSSGVFTGDCGTELDHGVTAVGYDKTSDGTKYWLVKNSWGSSWGENGYIRMERDVDAKE  328

Query  217   GRCGIALDPSYPT  179
             G CGIA++ SYPT
Sbjct  329   GLCGIAMEASYPT  341



>gb|EYU43350.1| hypothetical protein MIMGU_mgv1a021555mg [Erythranthe guttata]
Length=325

 Score =   372 bits (956),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 191/314 (61%), Positives = 229/314 (73%), Gaps = 4/314 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M K HE WM + GRVY ++ EKA R+ IFK NV+ I+S N A  RPY L +N+FADL
Sbjct  14    DASMVKMHEKWMVQNGRVYKNDAEKAFRYKIFKANVEYIQSSNNAETRPYKLAVNKFADL  73

Query  937   TNDEFVSTKNGYKR-PVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCC  761
             TN+EF +++NGYK    S     +   FRY NVT +P+++DW K+GAVTPVK+QG CGCC
Sbjct  74    TNEEFQASRNGYKMGSRSKSPSSKVSSFRYGNVT-VPTSIDWTKKGAVTPVKDQGQCGCC  132

Query  760   WAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTT  581
             WAFSAVAA EGI +++ G L+SLSEQELVDCD         G  MD+AF++II +NGLTT
Sbjct  133   WAFSAVAATEGINQLTTGNLISLSEQELVDCDTSEDQGCNGGL-MDNAFEFIISNNGLTT  191

Query  580   ESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQL  401
             ES YPY G D G CN    S   AKI GYEDVP NSE+ALL+A A QP+SVAIDA G   
Sbjct  192   ESNYPYEGVD-GTCNSKKESSHVAKITGYEDVPANSESALLKAVAKQPISVAIDASGSDF  250

Query  400   QFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAK  221
             QFY+GGVFT +CGTEL+HGVT VGYG    G KYWL+KNSWG  WGE+GY R+QRDIDA+
Sbjct  251   QFYSGGVFTGQCGTELDHGVTAVGYGVTSDGTKYWLVKNSWGSSWGENGYIRMQRDIDAE  310

Query  220   EGRCGIALDPSYPT  179
             EG CGIA+  SYPT
Sbjct  311   EGLCGIAMQASYPT  324



>ref|XP_011014442.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=360

 Score =   374 bits (959),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 191/314 (61%), Positives = 239/314 (76%), Gaps = 7/314 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M +RHE WM +YGRVY D+ E+A R+SIFKENV  +++FN    + Y LG+N+FADL
Sbjct  52    DAPMYERHEQWMTQYGRVYKDDNERATRYSIFKENVARVDAFNSQTGKSYKLGVNQFADL  111

Query  937   TNDEFVSTKNGYK-RPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCC  761
             TN+EF +++N +K    SP+    + PFRYENV+ +PS +DWRKEGAVTP K+QG CGCC
Sbjct  112   TNEEFKASRNRFKGHMCSPQ----AGPFRYENVSAVPSTMDWRKEGAVTPAKDQGQCGCC  167

Query  760   WAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTT  581
             WAFSAVAA+EGI K++ G+L+ LSEQE+VDCD  G D GC+GG MDDAFK+I ++ GLTT
Sbjct  168   WAFSAVAAIEGINKLTTGKLIFLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIEQNKGLTT  227

Query  580   ESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQL  401
             E+ YPY G D G CN   A+  AAKI G+E VP NSEAAL++A A QPVSVAIDA G   
Sbjct  228   EANYPYKGTD-GTCNTKKATNHAAKITGFEYVPANSEAALMKAVAEQPVSVAIDAGGYDF  286

Query  400   QFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAK  221
             QFY+ G+FT  C T+L+HGVT VGYG  + G KYWL+KNSWG +WGE+GY R+Q+DI AK
Sbjct  287   QFYSSGIFTGSCDTQLDHGVTAVGYGVSD-GSKYWLVKNSWGAQWGEEGYIRMQKDIPAK  345

Query  220   EGRCGIALDPSYPT  179
             EG CGIA+  SYPT
Sbjct  346   EGLCGIAMQASYPT  359



>ref|XP_004297572.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score =   373 bits (957),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 188/313 (60%), Positives = 235/313 (75%), Gaps = 5/313 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M  R+E WMARYGRVY D  EK KRF IFKENV  +ES N    +PYTL +N+FADL
Sbjct  33    DASMYGRYEQWMARYGRVYNDINEKEKRFQIFKENVAIVESSNNDASKPYTLSVNQFADL  92

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF++++N +K         ++M F+YEN T +P+ VDWR++GAVTPVK+QG CGCCW
Sbjct  93    TNEEFIASRNRFK---GHECSTKTMSFKYENFT-VPATVDWRQKGAVTPVKDQGQCGCCW  148

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA+EGI +++ G+L+SLSEQELVDCD  G D GC GG MD+AF +I +++GL+TE
Sbjct  149   AFSAVAAMEGITQLTTGKLISLSEQELVDCDVNGEDQGCEGGLMDNAFDFINQNHGLSTE  208

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D G CN    +  AA I G+EDVP NSE+ALL+A A+QP+SVAIDA G   Q
Sbjct  209   AHYPYTGVD-GTCNAQKEASHAASITGHEDVPANSESALLKAVANQPISVAIDASGSDFQ  267

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
              Y+ GVFT  CGT L+HGVT VGYG  + G KYWL+KNSWG +WGE+GY R+QRD+DA E
Sbjct  268   LYSSGVFTGTCGTSLDHGVTAVGYGISDDGTKYWLVKNSWGAQWGEEGYIRMQRDVDAPE  327

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYPT
Sbjct  328   GLCGIAMAASYPT  340



>ref|XP_011021998.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=339

 Score =   373 bits (957),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 195/340 (57%), Positives = 252/340 (74%), Gaps = 14/340 (4%)
 Frame = -1

Query  1192  LIVFAAILACCSKA-AKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKE  1016
             L +   ++A  SK+ A+++Q      D  M +RHE WMA+YGRVY D  EK  R++IFK 
Sbjct  11    LALLFVLVAWPSKSVARTLQ------DVSMYERHEQWMAQYGRVYKDNAEKETRYNIFKA  64

Query  1015  NVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYK-RPVSPRNPWRSMPFRYENVT  839
             NV  I+ FN    + Y LG+N+FADL+N+EF +++N +K    SP+    + PFRYENV+
Sbjct  65    NVARIDEFNSQTGKSYKLGVNQFADLSNEEFKASRNRFKGHMCSPQ----AGPFRYENVS  120

Query  838   DIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkg  659
              +P ++DWRK+GAVTPVK+QG CGCCWAFSAVAA+EGI +++ G+L+SLSEQE+VDCD  
Sbjct  121   AVPDSMDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGINQLTTGKLISLSEQEVVDCDTK  180

Query  658   ggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPM  479
             G D GC+GG MDDAFK+I ++ GLTTE+ YPY G D G CN    +  AAKI G+EDVP 
Sbjct  181   GEDQGCNGGLMDDAFKFIEQNKGLTTEANYPYTGTD-GTCNTQKEANHAAKITGFEDVPA  239

Query  478   NSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKY  299
             NSEAAL++A A QPVSVAIDA G + QFY+ G+FT  CGT+L+HGVT VGYG  + G KY
Sbjct  240   NSEAALIKAVAKQPVSVAIDAGGFEFQFYSSGIFTGSCGTQLDHGVTAVGYGISD-GTKY  298

Query  298   WLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             WL+KNSWG +WGE GY R+Q+DI AKEG CGIA+  SYP+
Sbjct  299   WLVKNSWGAQWGEGGYIRMQKDISAKEGLCGIAMQASYPS  338



>ref|XP_004506025.1| PREDICTED: vignain-like [Cicer arietinum]
Length=342

 Score =   373 bits (957),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 189/314 (60%), Positives = 237/314 (75%), Gaps = 3/314 (1%)
 Frame = -1

Query  1120  DDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFAD  941
             +D  + +R+E WM + G+VY    EKA R+ IFKENV+ IE+FN+ G++PY LGIN+FAD
Sbjct  31    EDASLLERYEQWMTQNGKVYKGSQEKALRYQIFKENVQFIEAFNKGGNKPYKLGINQFAD  90

Query  940   LTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCC  761
             LTN+EF  T+N +K  +      R+  F+YE+VT +P+A+DWR++GAVTP+K+QG CG C
Sbjct  91    LTNEEF-KTRNKFKGHMCSTIT-RTPTFKYEHVTSVPAALDWRQKGAVTPIKDQGQCGSC  148

Query  760   WAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTT  581
             WAFSAVAA EGI K+S G+LVSLSEQELVDCD  G D GC GG MDDAFK+++++ GLTT
Sbjct  149   WAFSAVAATEGITKLSSGKLVSLSEQELVDCDIKGVDQGCEGGLMDDAFKFMLQNKGLTT  208

Query  580   ESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQL  401
             E  YPY G D G CN        A I GYEDVP NSE+ALL+A A+QP+SVAIDA G + 
Sbjct  209   EVVYPYQGVD-GTCNAKAEGNHVASIKGYEDVPANSESALLKAVANQPISVAIDASGSEF  267

Query  400   QFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAK  221
             QFY+ GVFT  CGTEL+HGVT VGYG  E G KYWL+KNSWG +WGE GY R++R++ AK
Sbjct  268   QFYSSGVFTGTCGTELDHGVTAVGYGVSEDGTKYWLVKNSWGTQWGEQGYIRMERNVVAK  327

Query  220   EGRCGIALDPSYPT  179
             EG CGIA+  SYPT
Sbjct  328   EGLCGIAMQASYPT  341



>ref|XP_010038689.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=340

 Score =   372 bits (956),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 194/337 (58%), Positives = 236/337 (70%), Gaps = 11/337 (3%)
 Frame = -1

Query  1189  IVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENV  1010
             ++F    + C  A  ++Q      DD M + HE WMARY RVY D  E+  RF IFK N 
Sbjct  14    LIFLLGASACQAAGHALQ-----QDDPMYEMHEQWMARYERVYKDMDERQSRFQIFKANT  68

Query  1009  KAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIP  830
             + IESFN+   +PY L +N+FADLTN+EF   +N +K  V       +  F+Y N T +P
Sbjct  69    QRIESFNRGSGKPYKLSVNQFADLTNEEF-KARNRFKSHVCSA---EAASFKYGNGTAVP  124

Query  829   SAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggd  650
             S++DWRK+GAVTPVKNQG CGCCWAFSAV AVEG+ +I+ G+L+SLSEQELVDCD     
Sbjct  125   SSMDWRKKGAVTPVKNQGQCGCCWAFSAVTAVEGVHEITTGKLISLSEQELVDCDVRSQY  184

Query  649   lgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSE  470
              GC GG MD AF+++ KH GLTTE  YPY G D G+CN    S RA  I GYEDVP NSE
Sbjct  185   QGCEGGWMDSAFQFVEKH-GLTTEMNYPYTGTD-GKCNAKRESNRAVTIKGYEDVPANSE  242

Query  469   AALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLL  290
              ALL+A A+QPVSVAIDA G + QFY+ GVFT  CGT+L+HGV  VGYGT +   KYWL+
Sbjct  243   EALLKAVANQPVSVAIDAGGFEFQFYSSGVFTGACGTDLDHGVAAVGYGTSDDSTKYWLV  302

Query  289   KNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             KNSWG KWGE+GY R+QRD+ AKEG CGIA+  SYPT
Sbjct  303   KNSWGAKWGEEGYIRMQRDVTAKEGLCGIAMKASYPT  339



>gb|EYU19037.1| hypothetical protein MIMGU_mgv1a018631mg [Erythranthe guttata]
Length=325

 Score =   372 bits (955),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 184/311 (59%), Positives = 230/311 (74%), Gaps = 3/311 (1%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M ++HE WM + GR Y D+ EKA R+ IFK+NV+ I+S ++A +  Y L IN+FADLTN+
Sbjct  16    MIEKHEQWMVQCGRTYKDDAEKAFRYKIFKQNVEYIQSVDEAQNWTYKLAINKFADLTNE  75

Query  928   EFVSTKNGYKR-PVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAF  752
             EF +++NG+K+   S ++ +    FRY NV+ +P ++DW K+GAVTPVK+QG CGCCWAF
Sbjct  76    EFQASRNGFKKGSQSIKSSFEVSSFRYGNVSAVPPSIDWTKKGAVTPVKDQGQCGCCWAF  135

Query  751   SAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESG  572
             SAVAA EG+ +I  G L+SLSEQELVDCD         G  MD+AF++II +NGLTTES 
Sbjct  136   SAVAATEGLNQIKTGNLISLSEQELVDCDTSEDQGCNDGL-MDNAFEFIISNNGLTTESN  194

Query  571   YPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFY  392
             YPY G D G CN    S   AKI GYEDVP NSE+ALL+A A+QP+SVAIDA G   QFY
Sbjct  195   YPYEGVD-GTCNSKKESSHVAKITGYEDVPANSESALLKAVANQPISVAIDASGSDFQFY  253

Query  391   AGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGR  212
             +GGVF+ +CGTEL+HGVT VGYG    G KYWL+KNSWG  WGE+GY R+QRDIDA EG 
Sbjct  254   SGGVFSGQCGTELDHGVTAVGYGVTSDGTKYWLVKNSWGSSWGENGYIRMQRDIDAAEGL  313

Query  211   CGIALDPSYPT  179
             CGIA+  SYPT
Sbjct  314   CGIAMQASYPT  324



>ref|XP_004290089.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   372 bits (956),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 186/313 (59%), Positives = 236/313 (75%), Gaps = 5/313 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D +M  R+E WM RYGR+Y+D  EK KRF IFKENV  IES N   ++PY L +N FADL
Sbjct  32    DALMYGRYEQWMIRYGRIYSDTDEKEKRFKIFKENVAFIESSNDEANKPYKLSVNGFADL  91

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF +++N +K         ++  F+YEN T +P+ +DWR++GAVTP+K+QG CGCCW
Sbjct  92    TNEEFTASRNRFK---GHECSTKTTSFKYENAT-VPTKMDWRQKGAVTPIKDQGQCGCCW  147

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA+EGI +++ G+L+SLSEQELVDCD  G D GC GG MDDAF++I +++GL+TE
Sbjct  148   AFSAVAAMEGITQLTTGKLISLSEQELVDCDVNGEDQGCEGGLMDDAFEFINQNHGLSTE  207

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D G CN    +  AA I G+EDVP NSE+ALL+A A+QP+SVAIDA G   Q
Sbjct  208   ANYPYTGVD-GTCNAQKEASHAASITGHEDVPANSESALLKAVANQPISVAIDASGSDFQ  266

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY+ GVFT  CGT L+HGVT VGYG G+ G KYWL+KNSWG +WGE GY R+QRD+DA E
Sbjct  267   FYSSGVFTGACGTSLDHGVTAVGYGVGDDGTKYWLVKNSWGAEWGEQGYIRMQRDVDAPE  326

Query  217   GRCGIALDPSYPT  179
             G CGIA++ SYPT
Sbjct  327   GLCGIAMEASYPT  339



>ref|XP_007025398.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOY28020.1| Senescence-associated gene 12 [Theobroma cacao]
Length=338

 Score =   372 bits (956),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 191/310 (62%), Positives = 230/310 (74%), Gaps = 3/310 (1%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M  R E W+A  GRVY D +EK KR  IFKENV+ IES N    + Y LG+NEF DLTN+
Sbjct  31    MSDRFEQWLASCGRVYQDASEKEKRLQIFKENVEYIESHNADTSKKYKLGVNEFTDLTNE  90

Query  928   EFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFS  749
             EF + +NGYK  + P    +   FRYENV  +PS++DWRK+GAVT +K+QG CGCCWAFS
Sbjct  91    EFKAMRNGYK--LRPSTSSKKSSFRYENVAAVPSSMDWRKKGAVTNIKDQGQCGCCWAFS  148

Query  748   AVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGY  569
             AVAA+EGI ++  G+L+SLSEQELVDCD  G D GC+GG MD+AF++II + GLTTES Y
Sbjct  149   AVAAMEGINQLKTGKLISLSEQELVDCDINGEDQGCNGGFMDNAFEFIISNKGLTTESNY  208

Query  568   PYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYA  389
             PY G D G CN   A+  AA+I  +EDVP NSEAALL+A A+QPVSVAIDA G   Q Y 
Sbjct  209   PYEGVD-GSCNKKKAANHAAQITSFEDVPSNSEAALLKAVANQPVSVAIDAGGSDFQHYK  267

Query  388   GGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRC  209
              G+FT  C T L+HGVT VGYGT + G KYWL+KNSWG  WGEDGY R+QRDIDA+EG C
Sbjct  268   SGIFTGECSTFLDHGVTAVGYGTADDGTKYWLVKNSWGTSWGEDGYIRMQRDIDAEEGLC  327

Query  208   GIALDPSYPT  179
             GIA++ SYPT
Sbjct  328   GIAMEASYPT  337



>ref|XP_006592467.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   372 bits (956),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 190/313 (61%), Positives = 236/313 (75%), Gaps = 2/313 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M +RHE WM RYG+VY D  E+ KRF IFKENV  IE+FN A ++ Y L IN+FADL
Sbjct  32    DASMYERHEQWMTRYGKVYKDPQEREKRFRIFKENVNYIEAFNNAANKRYKLAINQFADL  91

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF++ +N +K  +   +  R+  F+YENVT +PS VDWR++GAVTP+K+QG CGCCW
Sbjct  92    TNEEFIAPRNRFKGHMCS-SIIRTTTFKYENVTAVPSTVDWRQKGAVTPIKDQGQCGCCW  150

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA EGI  ++ G+L+SLSEQELVDCD  G D GC GG MDDAFK++I+++GL TE
Sbjct  151   AFSAVAATEGIHALTSGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFVIQNHGLNTE  210

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D G+CN   A+  AA I GYEDVP N+E AL +A A+QPVSVAIDA G   Q
Sbjct  211   ANYPYKGVD-GKCNANEAANNAATITGYEDVPANNEKALQKAVANQPVSVAIDASGSDFQ  269

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY  GVFT  CGTEL+HGVT VGYG    G +YWL+KNSWG +WGE+GY R+QR +D++E
Sbjct  270   FYKSGVFTGSCGTELDHGVTAVGYGVSNDGTEYWLVKNSWGTEWGEEGYIRMQRGVDSEE  329

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYPT
Sbjct  330   GLCGIAMQASYPT  342



>ref|XP_006384060.1| hypothetical protein POPTR_0004s05510g [Populus trichocarpa]
 gb|ERP61857.1| hypothetical protein POPTR_0004s05510g [Populus trichocarpa]
Length=339

 Score =   372 bits (955),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 186/315 (59%), Positives = 233/315 (74%), Gaps = 4/315 (1%)
 Frame = -1

Query  1123  DDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFA  944
             D+ + M KRHE+WMA++GRVY D  EK KR+ IFKEN++ IE+FN   DR Y LG+N+FA
Sbjct  28    DEQEYMLKRHEEWMAQHGRVYGDMKEKEKRYLIFKENIERIEAFNNGSDRGYKLGVNKFA  87

Query  943   DLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGC  764
             DLTN+EF +  +GYKR  S      S  FR+EN++ IP+++DWRK GAVTPVK+QG CGC
Sbjct  88    DLTNEEFRAMHHGYKRQSSK---LMSSSFRHENLSAIPTSMDWRKAGAVTPVKDQGTCGC  144

Query  763   CWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLT  584
             CWAFSAVAA+EGI+K+  G+L+SLSEQ+LVDCD  G D GC GG MD+AF++I+++ GLT
Sbjct  145   CWAFSAVAAIEGIIKLKTGKLISLSEQQLVDCDVKGVDQGCGGGLMDNAFQFILRNGGLT  204

Query  583   TESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQ  404
             +E+ YPY G D G C     +   AKI GYEDVP+N+E ALLQA A QPVSVA++  G  
Sbjct  205   SEATYPYQGVD-GTCKSKKTASIEAKITGYEDVPVNNENALLQAVAKQPVSVAVEGGGYD  263

Query  403   LQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDA  224
              QFY  GVF   CGT L+H VT +GYGT   G  YWL+KNSWG  WGE GY R+QR I A
Sbjct  264   FQFYKSGVFKGDCGTYLDHAVTAIGYGTNSDGTNYWLVKNSWGTSWGESGYMRMQRGIGA  323

Query  223   KEGRCGIALDPSYPT  179
             +EG CG+A+D SYPT
Sbjct  324   REGLCGVAMDASYPT  338



>ref|XP_002305072.2| hypothetical protein POPTR_0004s05520g [Populus trichocarpa]
 gb|EEE85583.2| hypothetical protein POPTR_0004s05520g [Populus trichocarpa]
Length=340

 Score =   372 bits (955),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 185/339 (55%), Positives = 232/339 (68%), Gaps = 6/339 (2%)
 Frame = -1

Query  1195  NLIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKE  1016
             N  +F   L   +  A  +     D+ + M KRHE+WMA++GRVY D  EK KR+ IFKE
Sbjct  7     NTRIFVPFLLILAAWATKIACRPLDEQEYMLKRHEEWMAQHGRVYGDMKEKEKRYLIFKE  66

Query  1015  NVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTD  836
             N++ IE+FN   DR Y LG+N+FADLTN+EF +  +GYKR  S      S  FRYEN++D
Sbjct  67    NIERIEAFNNGSDRGYKLGVNKFADLTNEEFRAMYHGYKRQSSK---LMSSSFRYENLSD  123

Query  835   IPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgg  656
             IP+++DWR +GAVTPVK+QG CGCCWAFS VAA+EGI+K+  G L+SLSEQ+LVDC  G 
Sbjct  124   IPTSMDWRNDGAVTPVKDQGTCGCCWAFSTVAAIEGIIKLQTGNLISLSEQQLVDCTAGN  183

Query  655   gdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMN  476
                      MD AF+YII++ GLT+E  YPY G D G C+   A+   A+I GYEDVP N
Sbjct  184   KGCQGG--HMDTAFQYIIRNGGLTSEDNYPYQGVD-GTCSSEKAASTEAQITGYEDVPQN  240

Query  475   SEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYW  296
             +E ALLQA A QPVSVA++  G   QFY  GVF   CGT LNH VT +GYGT   G  YW
Sbjct  241   NENALLQAVAKQPVSVAVEGGGHDFQFYKSGVFEGDCGTNLNHAVTAIGYGTDSDGTDYW  300

Query  295   LLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             L+KNSWG  WGE+GY R++R I + EG CG+A+D SYPT
Sbjct  301   LVKNSWGTSWGENGYMRMRRGIGSSEGLCGVAMDASYPT  339



>ref|XP_009354268.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   371 bits (953),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 190/314 (61%), Positives = 232/314 (74%), Gaps = 5/314 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M  R+E W+ARYGRVY D  EK  RF IFKENV  IES N+  + PY L +N+FADL
Sbjct  34    DASMYGRYEQWLARYGRVYNDVDEKETRFKIFKENVAFIESSNKDANTPYKLRVNQFADL  93

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTD-IPSAVDWRKEGAVTPVKNQGVCGCC  761
             TN+EF +++NG+K         ++  F+YENVT  +P+ +DWRK+GAVTPVK+QG CGCC
Sbjct  94    TNEEFKASRNGFKGHECST---KTTSFKYENVTAALPATMDWRKKGAVTPVKDQGQCGCC  150

Query  760   WAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTT  581
             WAFSAVAA EG+ +++ G+L+SLSEQELVDCD  G D GC GG MDDAF++I +++G++T
Sbjct  151   WAFSAVAATEGVTQLTTGKLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNHGIST  210

Query  580   ESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQL  401
             E+ YPY G D G CN    +  AAKI G+EDVP NSE ALL A AHQPVSVAIDA G   
Sbjct  211   ETNYPYNGVD-GTCNTKKEAIIAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDF  269

Query  400   QFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAK  221
             QFY+ GVFT  CGT L+HGVT VGYG  E G KYWL+KNSWG +WGE GY R+QRD+ A 
Sbjct  270   QFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWGAEWGEAGYIRMQRDVAAP  329

Query  220   EGRCGIALDPSYPT  179
             EG CGIA+  SYPT
Sbjct  330   EGLCGIAMSASYPT  343



>ref|XP_007132860.1| hypothetical protein PHAVU_011G130800g [Phaseolus vulgaris]
 gb|ESW04854.1| hypothetical protein PHAVU_011G130800g [Phaseolus vulgaris]
Length=343

 Score =   371 bits (953),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 193/313 (62%), Positives = 234/313 (75%), Gaps = 2/313 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M + HE WM RY RVY D  E+ KRF IFKENV  IE+FN A  +PY+L IN+FADL
Sbjct  32    DASMHETHEQWMTRYSRVYKDPEEREKRFRIFKENVNYIEAFNNAASKPYSLAINQFADL  91

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF++ +N +K  +   +  R+  F+YENV+ +PS VDWR++GAVTPVK+QG CGCCW
Sbjct  92    TNEEFIAPRNRFKGHMCS-SIIRTTTFKYENVSAVPSTVDWRQKGAVTPVKDQGQCGCCW  150

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAV A EGI K+S G+L+SLSEQELVDCD  G D GC GG MDDAFK+II+++GL TE
Sbjct  151   AFSAVGATEGIHKLSTGKLISLSEQELVDCDIKGVDQGCGGGLMDDAFKFIIQNHGLNTE  210

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D G+CN   A+  AA I GYEDVP N+E AL  A A+QPVSVAIDA G   Q
Sbjct  211   ASYPYKGVD-GKCNANAAANHAATITGYEDVPANNEKALQTAVANQPVSVAIDASGSDFQ  269

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY  GVFT  CGTEL+HGVT VGYG  + G KYWL+KNSWG +WGE+GY R+QR + A+E
Sbjct  270   FYKSGVFTGSCGTELDHGVTAVGYGVSDDGRKYWLVKNSWGTEWGEEGYIRMQRGVAAEE  329

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYPT
Sbjct  330   GLCGIAMMASYPT  342



>ref|XP_009354269.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=333

 Score =   371 bits (952),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 188/314 (60%), Positives = 233/314 (74%), Gaps = 5/314 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  +  R+E W+ARYGRVY D  EK  RF IFKENV  IES N+  ++P+ L +N+FADL
Sbjct  23    DASIYARYEQWLARYGRVYNDVDEKEIRFKIFKENVAFIESSNKDANKPHKLSVNQFADL  82

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTD-IPSAVDWRKEGAVTPVKNQGVCGCC  761
             TN+EF +++NG+K         ++  F+YENVT  +P+ +DWRK+GAVTPVK+QG CGCC
Sbjct  83    TNEEFKASRNGFK---GHECSTKTTSFKYENVTAALPATMDWRKKGAVTPVKDQGQCGCC  139

Query  760   WAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTT  581
             WAFSAVAA EG+ +++ G+L+SLSEQELVDCD  G D GC GG MDDAF++I +++G++T
Sbjct  140   WAFSAVAATEGVTQLTTGKLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNHGIST  199

Query  580   ESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQL  401
             E+ YPY G D G CN    +  AAKI G+EDVP NSE ALL A AHQPVSVAIDA G   
Sbjct  200   ETNYPYNGVD-GTCNTKKEAIIAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDF  258

Query  400   QFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAK  221
             QFY+ GVFT  CGT L+HGVT VGYG  E G KYWL+KNSWG +WGE GY R+QRD+ A 
Sbjct  259   QFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWGAEWGEAGYIRMQRDVAAP  318

Query  220   EGRCGIALDPSYPT  179
             EG CGIA+  SYPT
Sbjct  319   EGLCGIAMSASYPT  332



>gb|KDP45355.1| hypothetical protein JCGZ_09604 [Jatropha curcas]
Length=311

 Score =   370 bits (949),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 189/311 (61%), Positives = 230/311 (74%), Gaps = 2/311 (1%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M KRHE+W A++GRVY D  EK K++ +FK+N++ IESFN   DR Y LG+N+FADLT++
Sbjct  1     MLKRHEEWRAQHGRVYKDTAEKQKKYLVFKDNLERIESFNNGVDRGYKLGLNKFADLTDE  60

Query  928   EFVSTKNGYKRPVSP-RNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAF  752
             EF +   GYK P S   +  +S  FRY NVT +P+ +DWRK GAVTPVK+QG CG CWAF
Sbjct  61    EFQAMHLGYKSPPSKLMSTSKSRSFRYRNVTSVPTTIDWRKAGAVTPVKDQGSCGSCWAF  120

Query  751   SAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESG  572
             SAVAA+EGI K+  G L+SLSEQELVDCD  G D GC GG MD AF+YI+K+ GLT+E+ 
Sbjct  121   SAVAAMEGITKLKTGNLISLSEQELVDCDVAGEDYGCDGGFMDTAFQYILKNGGLTSEAN  180

Query  571   YPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFY  392
             YPY G+D G C+    +   AKI GYEDVP NSE ALLQA A+QPVSVAIDA G   +FY
Sbjct  181   YPYQGED-GICSKKKTATSMAKITGYEDVPSNSEKALLQAVANQPVSVAIDASGYDFRFY  239

Query  391   AGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGR  212
             + GVF   C T+LNH VTV+GYG+   G KYWLLKNSWG  WGE+GY R+QR+I A EG 
Sbjct  240   SSGVFKGDCPTDLNHAVTVIGYGSSSDGTKYWLLKNSWGTGWGENGYMRMQREISANEGL  299

Query  211   CGIALDPSYPT  179
             CGIA+  SYPT
Sbjct  300   CGIAMKASYPT  310



>ref|XP_008342777.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score =   370 bits (950),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 188/314 (60%), Positives = 231/314 (74%), Gaps = 5/314 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M  R++ W+ARYGR+Y D  EK  RF IFKENV  IE  N+  ++PY L +N+FADL
Sbjct  23    DASMYGRYKQWLARYGRIYNDTNEKETRFKIFKENVAFIEFSNKDANKPYKLSVNQFADL  82

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVT-DIPSAVDWRKEGAVTPVKNQGVCGCC  761
             TN+EF +T+NG+K         ++  F+YENVT  +P+ +DWRK+GAVTPVK+QG CGCC
Sbjct  83    TNEEFKATRNGFK---GHECSTKTSSFKYENVTVPLPATMDWRKKGAVTPVKDQGQCGCC  139

Query  760   WAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTT  581
             WAFSAVAA EGI +++ G+L+SLSEQ LVDCD  G D GC GG MDDAF++I +++G++T
Sbjct  140   WAFSAVAATEGITQLTTGKLISLSEQXLVDCDTAGEDQGCEGGLMDDAFQFIQQNHGIST  199

Query  580   ESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQL  401
             E+ YPY G D G CN    +  AAKI G+EDVP NSE ALL A AHQPVSVAIDA G   
Sbjct  200   EANYPYNGVD-GTCNTKKEAIIAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDF  258

Query  400   QFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAK  221
             QFY+ GVFT  CGT L+HGVT VGYG  E G KYWL+KNSWG +WGE GY R+QRD+ A 
Sbjct  259   QFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWGAEWGEAGYIRMQRDVAAA  318

Query  220   EGRCGIALDPSYPT  179
             EG CGIA+  SYPT
Sbjct  319   EGLCGIAMSASYPT  332



>ref|XP_007132896.1| hypothetical protein PHAVU_011G134100g [Phaseolus vulgaris]
 gb|ESW04890.1| hypothetical protein PHAVU_011G134100g [Phaseolus vulgaris]
Length=308

 Score =   369 bits (947),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 195/310 (63%), Positives = 234/310 (75%), Gaps = 3/310 (1%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M +RHE WM RY RVY D  EK KRF IFKENV  IE+FN A ++ Y L IN+FADLTN+
Sbjct  1     MHERHEQWMTRYSRVYKDPEEKEKRFRIFKENVNYIEAFNNAANKAYNLAINQFADLTNE  60

Query  928   EFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFS  749
             EF++ +N +K  V      R+  F+YENV+ +PS VDWR +GAVTPVK+QG CGCCWAFS
Sbjct  61    EFIAPRNRFKGHVCSSIT-RTTTFKYENVSAVPSTVDWRLKGAVTPVKDQGQCGCCWAFS  119

Query  748   AVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGY  569
             AVAA EGI K+S G+L+SLSEQELVDCD  G D GC GG MDDAFK+II+++GL TE+ Y
Sbjct  120   AVAATEGIHKLSTGKLISLSEQELVDCDIKGVDQGCGGGLMDDAFKFIIQNHGLNTEASY  179

Query  568   PYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYA  389
             PY G D G+CN   A+  AA I GYEDVP+N+E AL +A A+QPVSVAIDA G   QFY 
Sbjct  180   PYKGVD-GKCNANAAANHAATITGYEDVPVNNEKALQKAVANQPVSVAIDASGSDFQFYK  238

Query  388   GGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRC  209
              GVFT  CGTEL+HGVT VGYG  + G KYWL+KNSWG +WGE+GY R+QR + A+EG C
Sbjct  239   SGVFTGSCGTELDHGVTAVGYGVSDDG-KYWLVKNSWGTEWGEEGYIRMQRGVAAEEGLC  297

Query  208   GIALDPSYPT  179
             GIA+  SYPT
Sbjct  298   GIAMMASYPT  307



>ref|XP_008382007.1| PREDICTED: ervatamin-B-like [Malus domestica]
 ref|XP_008365747.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=343

 Score =   370 bits (950),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 190/315 (60%), Positives = 232/315 (74%), Gaps = 8/315 (3%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M  R+E W+ RYGRVY D  EK  RF IFKENV  IES N+  ++PY L +N+FADL
Sbjct  34    DASMYGRYEQWLTRYGRVYNDVNEKETRFKIFKENVAFIESSNKDANKPYRLSVNQFADL  93

Query  937   TNDEFVSTKNGYK-RPVSPRNPWRSMPFRYENVT-DIPSAVDWRKEGAVTPVKNQGVCGC  764
             TN+EF +++NG+K    S +       F+YEN+T  +P+ +DWRK+GAVTP+K+QG CGC
Sbjct  94    TNEEFKASRNGFKGHECSTKTS-----FKYENLTASLPATMDWRKKGAVTPIKDQGQCGC  148

Query  763   CWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLT  584
             CWAFSAVAA EGI +++ G+L+SLSEQELVDCD  G D GC GG MDDAF++I ++ G++
Sbjct  149   CWAFSAVAATEGITQLTTGKLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNRGIS  208

Query  583   TESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQ  404
             TE+ YPY G D G CN    + RAAKI G+EDVP NSE ALL A AHQPVSVAIDA G  
Sbjct  209   TEANYPYDGVD-GTCNAKKEASRAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSD  267

Query  403   LQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDA  224
              QFY+ GVFT  CGT L+HGVT VGYG  E G KYWL+KNSWG +WGE GY R+QRD+ A
Sbjct  268   FQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWGTEWGEAGYIRMQRDVAA  327

Query  223   KEGRCGIALDPSYPT  179
              EG CGIA+  SYPT
Sbjct  328   GEGLCGIAMAASYPT  342



>ref|XP_008353750.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=344

 Score =   370 bits (950),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 188/314 (60%), Positives = 231/314 (74%), Gaps = 5/314 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M  R+E W+ARYGRVY D  EK  RF IFKENV  IES N+  ++PY L +N+FADL
Sbjct  34    DASMYGRYEQWLARYGRVYNDVDEKETRFKIFKENVAFIESSNKDANKPYKLSVNQFADL  93

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTD-IPSAVDWRKEGAVTPVKNQGVCGCC  761
             TN+EF +++NG+K         ++  F+Y+NVT  +P+ +DWR +GAVTPVK+QG CGCC
Sbjct  94    TNEEFKASRNGFK---GHECSTKTTSFKYKNVTAALPATMDWRTKGAVTPVKDQGQCGCC  150

Query  760   WAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTT  581
             WAFSAVAA EG+ +++ G L+SLSEQELVDCD  G D GC GG MDDAF++I +++G++T
Sbjct  151   WAFSAVAATEGVTQLTTGRLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNHGIST  210

Query  580   ESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQL  401
             E+ YPY G D G CN    +  AAKI G+EDVP NSE ALL A AHQPVSVAIDA G   
Sbjct  211   ETNYPYNGVD-GTCNTKKEAIIAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDF  269

Query  400   QFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAK  221
             QFY+ GVFT  CGT L+HGVT VGYG  E G KYWL+KNSWG +WGE GY R+QRD+ A 
Sbjct  270   QFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWGXEWGEXGYIRMQRDVAAA  329

Query  220   EGRCGIALDPSYPT  179
             EG CGIA+  SYPT
Sbjct  330   EGLCGIAMSASYPT  343



>ref|XP_008803660.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
 ref|XP_008812192.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=338

 Score =   370 bits (950),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 193/315 (61%), Positives = 225/315 (71%), Gaps = 10/315 (3%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D +M  RHE WM +YGRVY D  EK  RF IFK NV  IES NQAG R Y L IN+FADL
Sbjct  31    DSLMAARHERWMVQYGRVYKDAAEKEHRFQIFKANVDYIESTNQAGHRKYKLNINQFADL  90

Query  937   TNDEFVSTKNGYKRPVSPRNPWRS--MPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGC  764
             T +EF ++  G+K    P+ P R+    FRY NVTD+P +VDWR +GAVTP+K+QG CGC
Sbjct  91    TTEEFRASYTGFK----PK-PMRATGQNFRYANVTDVPPSVDWRSKGAVTPIKDQGQCGC  145

Query  763   CWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLT  584
             CWAFSAV A EGI +IS G+L SLSEQ+LVDCDK  G  G     MDDAFKYII + G+T
Sbjct  146   CWAFSAVVATEGIAQISTGKLTSLSEQQLVDCDKVNGGCGGGI--MDDAFKYIISNKGIT  203

Query  583   TESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQ  404
             TE+ YPY  ++ G C+   +S  AA I+GYEDVP NSE++LLQA A QPVSVAI+  G  
Sbjct  204   TEANYPYVAKE-GTCDTNKSSSVAATISGYEDVPRNSESSLLQAVAKQPVSVAIEGSGKD  262

Query  403   LQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDA  224
              QFY+G VF   CGT+L+H VTVVGYGT   G KYWLLKNSWG  WGE GY RL RDID 
Sbjct  263   FQFYSGDVFMGNCGTDLDHAVTVVGYGTATDGTKYWLLKNSWGTTWGEKGYMRLLRDIDD  322

Query  223   KEGRCGIALDPSYPT  179
              EG CGIA+ PSYPT
Sbjct  323   AEGLCGIAMQPSYPT  337



>ref|XP_009359979.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=342

 Score =   370 bits (950),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 195/337 (58%), Positives = 240/337 (71%), Gaps = 9/337 (3%)
 Frame = -1

Query  1189  IVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENV  1010
             + F  IL   S  A S        D  M  ++E WMA YGR YAD  EK KRF+IFKENV
Sbjct  14    LAFIFILGALSSQATS----RTLQDASMYAKYEQWMASYGRAYADINEKEKRFNIFKENV  69

Query  1009  KAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIP  830
               IES N   ++ Y L +N+FADLTN+EF +++NG+   +      ++  F+YENVT  P
Sbjct  70    AFIESSNNDANKLYKLSVNQFADLTNEEFKASRNGF---MGHECSTKTTAFKYENVT-AP  125

Query  829   SAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggd  650
               VDWR +GAVTP+K+QG CGCCWAFSAVAA+EGI K++ G+L+SLSEQELVDCD  G D
Sbjct  126   PTVDWRNKGAVTPIKDQGQCGCCWAFSAVAAMEGITKLTTGKLISLSEQELVDCDTSGVD  185

Query  649   lgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSE  470
              GC GG MDDAF++I K++GL+TE+ YPY G D G CN    +  AAKI GYEDVP NSE
Sbjct  186   QGCGGGLMDDAFQFINKNHGLSTETNYPYTGVD-GTCNTKKEASHAAKITGYEDVPANSE  244

Query  469   AALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLL  290
              ALL+A A+QP+SVAIDA G   QFY+ GVFT  CGT L+HGVT VGYG    G KYWL+
Sbjct  245   EALLKAVANQPISVAIDAGGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGISADGTKYWLV  304

Query  289   KNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             KNSWG +WGE+GY R+QR ++AKEG CGIA++ SYPT
Sbjct  305   KNSWGTQWGEEGYIRMQRGVEAKEGLCGIAMEASYPT  341



>gb|EYU25679.1| hypothetical protein MIMGU_mgv1a023356mg, partial [Erythranthe 
guttata]
Length=347

 Score =   370 bits (950),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 185/313 (59%), Positives = 227/313 (73%), Gaps = 2/313 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  + +RHE WM +YGR Y ++ EKAKRF+IFK+NV+ I+S N+   R Y L IN+FADL
Sbjct  36    DASIVERHEQWMVQYGRTYKNDAEKAKRFNIFKDNVEYIQSVNETETRAYKLAINKFADL  95

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF +++NGYK     ++  +   + Y NV+ +P ++DW K+GAVTPVK+QG CGCCW
Sbjct  96    TNEEFQASRNGYKMRSQSKSSSKVSSYMYANVSAVPPSMDWTKKGAVTPVKDQGQCGCCW  155

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA EGI +++ G LVSLSEQELVDCD         G  MD AF++II +NGLTTE
Sbjct  156   AFSAVAATEGINQLTTGNLVSLSEQELVDCDTSEDQGCNGGL-MDYAFEFIISNNGLTTE  214

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             S YPY G D G CN    S   AKI GYEDVP NSE+ALL+A  +QP+SVAIDA G   Q
Sbjct  215   SNYPYEGVD-GTCNSKKESSHVAKITGYEDVPSNSESALLKAVVNQPISVAIDASGSDFQ  273

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY+ GVFT +CGTEL+HGVTVVGYG      KYWL+KNSWG  WGE+GY R+QRDID  E
Sbjct  274   FYSSGVFTGQCGTELDHGVTVVGYGVTSDETKYWLVKNSWGTSWGENGYIRMQRDIDTVE  333

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYPT
Sbjct  334   GLCGIAMQASYPT  346



>emb|CBI21977.3| unnamed protein product [Vitis vinifera]
Length=297

 Score =   368 bits (945),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 189/302 (63%), Positives = 227/302 (75%), Gaps = 6/302 (2%)
 Frame = -1

Query  1084  MARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNG  905
             MARYGR+Y D  EK KRF IFK+NV  IESFN+A D+ Y L INEFADLTN+EF S +N 
Sbjct  1     MARYGRMYKDANEKEKRFKIFKDNVARIESFNKAMDKTYKLSINEFADLTNEEFRSLRNR  60

Query  904   YKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGI  725
             +K  +       +  F+YENVT +PS +DWRK+GAVTP+K+Q  CGCCWAFSAVAA EGI
Sbjct  61    FKAHICSE----ATTFKYENVTAVPSTIDWRKKGAVTPIKDQQQCGCCWAFSAVAATEGI  116

Query  724   VKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLG  545
              +I+ G+L+SLSEQELVDCD GG + GC GG MDDAF++I  H GL +E+ YPY G D G
Sbjct  117   TQITTGKLISLSEQELVDCDTGGENQGCSGGLMDDAFRFIKIH-GLASEATYPYEGDD-G  174

Query  544   RCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERC  365
              CN    +  AAKI GYEDVP N+E AL +A AHQPV+VAIDA G + QFY  GVFT +C
Sbjct  175   TCNSKKEAHPAAKIKGYEDVPANNEKALQKAVAHQPVAVAIDAGGFEFQFYTSGVFTGQC  234

Query  364   GTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSY  185
             GTEL+HGV  VGYG G+ G+ YWL+KNSWG  WGE+GY R+QRD+ AKEG CGIA+  SY
Sbjct  235   GTELDHGVAAVGYGIGDDGMMYWLVKNSWGTGWGEEGYIRMQRDVTAKEGLCGIAMQASY  294

Query  184   PT  179
             PT
Sbjct  295   PT  296



>ref|XP_008340724.1| PREDICTED: vignain-like [Malus domestica]
Length=338

 Score =   370 bits (949),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 187/313 (60%), Positives = 235/313 (75%), Gaps = 5/313 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M  ++E WMA YGRVY +  EK KRF+IFK NV  IES N   ++PY L +N+FADL
Sbjct  30    DPSMYGKYEQWMAHYGRVYTNINEKEKRFNIFKANVDFIESSNNDANKPYKLKVNQFADL  89

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF +++N   R +      ++  F+YENVT  P+ VDWRK+GAVTP+K+QG CGCCW
Sbjct  90    TNEEFKASRN---RFMGHECSTKTTSFKYENVT-APATVDWRKKGAVTPIKDQGQCGCCW  145

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA+EGI K++ G+L+SLSEQELVDCD  G D GC GG MDDAF++I +++GL+TE
Sbjct  146   AFSAVAAMEGITKLTTGKLISLSEQELVDCDTSGVDQGCEGGLMDDAFQFITQNHGLSTE  205

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D G CN    +  AA I G+EDVP NSEAALL+A A+QP+SVAIDA G   Q
Sbjct  206   TNYPYTGVD-GTCNTKKEASHAATITGHEDVPANSEAALLKAVANQPISVAIDAGGSDFQ  264

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY+ GVFT  CGT L+HGVT VG+G    G KYWL+KNSWG +WGE+GY R+QRD++AKE
Sbjct  265   FYSSGVFTGTCGTSLDHGVTAVGFGVSADGTKYWLVKNSWGAEWGEEGYIRMQRDVEAKE  324

Query  217   GRCGIALDPSYPT  179
             G CGIA++ SYPT
Sbjct  325   GLCGIAMEASYPT  337



>ref|XP_007227669.1| hypothetical protein PRUPE_ppa025602mg [Prunus persica]
 gb|EMJ28868.1| hypothetical protein PRUPE_ppa025602mg [Prunus persica]
Length=342

 Score =   370 bits (949),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 189/313 (60%), Positives = 232/313 (74%), Gaps = 5/313 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M  ++E WMARYGRVY D  EK  RF IFKENV  IES N   ++PY L +N+FADL
Sbjct  34    DASMYGKYEQWMARYGRVYTDIQEKEMRFKIFKENVAFIESSNSDANKPYKLSVNQFADL  93

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF +++NG+   +      ++  F+YENVT  P  VDWR +GAVTP+K+QG CGCCW
Sbjct  94    TNEEFKASRNGF---LGHECSTKTTTFKYENVT-APPTVDWRTKGAVTPIKDQGQCGCCW  149

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA+EGI K++ G L+SLSEQELVDCD  G D GC GG MDDAF++I +++GL+TE
Sbjct  150   AFSAVAAMEGITKLTTGNLISLSEQELVDCDTKGVDQGCEGGLMDDAFQFINQNHGLSTE  209

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D G CN    +  AAKI G+EDVP NSEAALL+A A+QP+SVAIDA G   Q
Sbjct  210   TNYPYTGVD-GTCNTKKEASHAAKITGHEDVPANSEAALLKAVANQPISVAIDAGGSDFQ  268

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY+ GVFT  CGT L+HGVT VGYG    G KYWL+KNSWG +WGE GY R+QR ++AKE
Sbjct  269   FYSSGVFTGSCGTSLDHGVTAVGYGVSADGTKYWLVKNSWGTEWGEKGYIRMQRGVEAKE  328

Query  217   GRCGIALDPSYPT  179
             G CGIA++ SYPT
Sbjct  329   GLCGIAMEASYPT  341



>gb|AGT16936.1| vignain-like protein [Saccharum hybrid cultivar R570]
Length=341

 Score =   370 bits (949),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 200/343 (58%), Positives = 245/343 (71%), Gaps = 12/343 (3%)
 Frame = -1

Query  1198  KNLIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFK  1019
             K LI    + A    AA + + LN DDD  M +RHE WMA+Y RVY D TEKA+RF +FK
Sbjct  5     KALIFGILVGAFLCSAALAARDLN-DDDSAMVERHEQWMAQYSRVYKDATEKAQRFEVFK  63

Query  1018  ENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKN--GYKRPVSPRNPWRSMPFRYEN  845
              NVK IESFN A +R + LG+N+FADLT DEF +TK   G+K P   + P     FRYEN
Sbjct  64    VNVKFIESFNAARNRKFWLGVNQFADLTIDEFRATKTNKGFK-PSRVKVP---TGFRYEN  119

Query  844   VTD--IPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVd  671
             V+   +P++VDWR +GAVTP+K+QG CGCCWAFSAVAA EGIVKIS G+L SLSEQEL+D
Sbjct  120   VSVDVLPASVDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLTSLSEQELID  179

Query  670   cdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYE  491
             CD  G D GC GG MDDAFK+I+K+ GLTTES YPY   D G+C   + S  AA I GYE
Sbjct  180   CDVHGEDQGCEGGLMDDAFKFIVKNGGLTTESSYPYTAAD-GKCK--SRSNSAATIKGYE  236

Query  490   DVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGER  311
             DVP N EAAL++A A+QPVSVA+D   +  QFY+GGV    CGT L+HG+  +GYG    
Sbjct  237   DVPANDEAALMKAVANQPVSVAVDGGDMTFQFYSGGVIAGSCGTNLDHGIAAIGYGKTSD  296

Query  310   GIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYP  182
             G KYWL+KNSWG  WGE+GY R+++DI  K G CG+A++PSYP
Sbjct  297   GTKYWLMKNSWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYP  339



>ref|XP_009357172.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=343

 Score =   370 bits (949),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 189/315 (60%), Positives = 232/315 (74%), Gaps = 8/315 (3%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M  R+E W+ RYGR+Y D  EK  RF IFKENV  IES N+  ++PY L +N+FADL
Sbjct  34    DARMYGRYEQWLTRYGRIYNDVNEKETRFKIFKENVAFIESSNKDANKPYRLSVNQFADL  93

Query  937   TNDEFVSTKNGYK-RPVSPRNPWRSMPFRYENVT-DIPSAVDWRKEGAVTPVKNQGVCGC  764
             TN+EF +++NG+K    S +       F+YEN+T  +P+ +DWRK+GAVTP+K+QG CGC
Sbjct  94    TNEEFKTSRNGFKGHECSTKTS-----FKYENLTASLPATMDWRKKGAVTPIKDQGQCGC  148

Query  763   CWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLT  584
             CWAFSAVAA EGI +++ G+L+SLSEQELVDCD  G D GC GG MDDAF++I ++ G++
Sbjct  149   CWAFSAVAATEGITQLTTGKLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNRGIS  208

Query  583   TESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQ  404
             TE+ YPY G D G CN    + RAAKI G+EDVP NSE ALL A AHQPVSVAIDA G  
Sbjct  209   TEANYPYDGVD-GTCNAKKEASRAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSD  267

Query  403   LQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDA  224
              QFY+ GVFT  CGT L+HGVT VGYG  E G KYWL+KNSWG +WGE GY R+QRD+ A
Sbjct  268   FQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWGAEWGEAGYIRMQRDVAA  327

Query  223   KEGRCGIALDPSYPT  179
              EG CGIA+  SYPT
Sbjct  328   AEGLCGIAMAASYPT  342



>ref|XP_008342776.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score =   369 bits (947),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 188/314 (60%), Positives = 229/314 (73%), Gaps = 5/314 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M  R+E W+ARYGRVY D  EK  RF IFKENV  IES N+  ++PY L +N+F DL
Sbjct  23    DASMYGRYEQWLARYGRVYNDVDEKETRFKIFKENVAFIESSNKDANKPYKLSVNQFXDL  82

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTD-IPSAVDWRKEGAVTPVKNQGVCGCC  761
             TN+EF +++NG+K         ++  F+YENVT  +P+ +DWRK+GAVTPVK+QG CGCC
Sbjct  83    TNEEFKASRNGFK---GHECSTKTTSFKYENVTAALPATMDWRKKGAVTPVKDQGQCGCC  139

Query  760   WAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTT  581
             WAFSAVAA EG+ +++ G L+SLSEQELVDCD  G D GC GG MDDAF++I +++G++T
Sbjct  140   WAFSAVAATEGVTQLTTGXLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNHGIST  199

Query  580   ESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQL  401
             E  YPY G D G CN    +  AAKI G+EDVP NSE ALL A AHQPVSVAIDA G   
Sbjct  200   EXNYPYBGVD-GTCNTKKEAIIAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDF  258

Query  400   QFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAK  221
             QFY+ GVFT  CGT L+HGVT VGYG  E G KYWL+ NSWG +WGE GY R+QRD+ A 
Sbjct  259   QFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVXNSWGAEWGEXGYIRMQRDVAAP  318

Query  220   EGRCGIALDPSYPT  179
             EG CGIA+  SYPT
Sbjct  319   EGLCGIAMSASYPT  332



>ref|XP_009354321.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=393

 Score =   371 bits (953),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 189/314 (60%), Positives = 233/314 (74%), Gaps = 5/314 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M  R+E W+ARYGRVY D  EK  RF IFKENV  IES N+  ++P+ L +N+FADL
Sbjct  83    DASMYGRYEQWLARYGRVYNDVDEKEIRFKIFKENVAFIESSNKDANKPHKLSVNQFADL  142

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTD-IPSAVDWRKEGAVTPVKNQGVCGCC  761
             TN+EF +++NG+K         ++  F+YENVT  +P+ +DWRK+GAVTPVK+QG CGCC
Sbjct  143   TNEEFKASRNGFK---GHECSTKTTSFKYENVTAALPATMDWRKKGAVTPVKDQGQCGCC  199

Query  760   WAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTT  581
             WAFSAVAA EG+ +++ G+L+SLSEQELVDCD  G D GC GG MDDAF++I +++G++T
Sbjct  200   WAFSAVAATEGVTQLTTGKLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNHGIST  259

Query  580   ESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQL  401
             E+ YPY G D G CN    +  AAKI G+EDVP NSE ALL A AHQPVSVAIDA G   
Sbjct  260   ETNYPYNGVD-GTCNTKKEAIIAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDF  318

Query  400   QFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAK  221
             QFY+ GVFT  CGT L+HGVT VGYG  E G KYWL+KNSWG +WGE GY R+QRD+ A 
Sbjct  319   QFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWGAEWGEAGYIRMQRDVAAP  378

Query  220   EGRCGIALDPSYPT  179
             EG CGIA+  SYPT
Sbjct  379   EGLCGIAMSASYPT  392



>ref|XP_008342782.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score =   369 bits (947),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 187/314 (60%), Positives = 231/314 (74%), Gaps = 5/314 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M  R++ W+ARYGR+Y D  EK  RF IFKENV  IE  N+  ++PY L +N+FADL
Sbjct  23    DASMYGRYKQWLARYGRIYNDTNEKETRFKIFKENVAFIEFSNKDANKPYKLSVNQFADL  82

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVT-DIPSAVDWRKEGAVTPVKNQGVCGCC  761
             TN+EF +T+NG+K         ++  F+YENVT  +P+ +DWRK+GAVTPVK+QG CGCC
Sbjct  83    TNEEFKATRNGFK---GHECSTKTSSFKYENVTVPLPATMDWRKKGAVTPVKDQGQCGCC  139

Query  760   WAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTT  581
             WAFSAVAA EGI +++ G+L+SLSEQ LVDCD  G D GC GG MD+AF++I +++G++T
Sbjct  140   WAFSAVAATEGITQLTTGKLISLSEQVLVDCDTAGEDQGCEGGLMDBAFQFIQQNHGIST  199

Query  580   ESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQL  401
             E+ YPY G D G CN    +  AAKI G+EDVP NSE ALL A AHQPVSVAIDA G   
Sbjct  200   EANYPYBGVD-GTCNTKKEAIIAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDF  258

Query  400   QFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAK  221
             QFY+ GVFT  CGT L+HGVT VGYG  E G KYWL+KNSWG +WGE GY R+QRD+ A 
Sbjct  259   QFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWGAEWGEAGYIRMQRDVAAA  318

Query  220   EGRCGIALDPSYPT  179
             EG CGIA+  SYPT
Sbjct  319   EGLCGIAMSASYPT  332



>ref|XP_009617815.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=339

 Score =   369 bits (947),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 183/309 (59%), Positives = 232/309 (75%), Gaps = 5/309 (2%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             + ++HE WM++YGRVY D+T+KAKR   FK+N++ IES N+   R Y LGIN+FAD+TN+
Sbjct  34    ITEKHEQWMSQYGRVYKDDTKKAKRLETFKQNLEYIESTNKDVTRTYKLGINQFADMTNE  93

Query  928   EFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFS  749
             EF + +NGY+  +S +   ++  F+YENVT +P ++DWRK+GAVT +K+QG CGCCWAFS
Sbjct  94    EFKAIRNGYR--ISSQQKIKNTSFQYENVT-VPYSMDWRKKGAVTKIKDQGQCGCCWAFS  150

Query  748   AVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGY  569
             AVAA EGI KI  G+L+SLSEQELVDCD         G  MDDAFKYIIK++GLT+ES Y
Sbjct  151   AVAATEGINKIKTGKLISLSEQELVDCDTNSNQGCEGGL-MDDAFKYIIKNHGLTSESNY  209

Query  568   PYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYA  389
             PY G D G C     S   AKI+GY+DVP NSE+ALL+A A+QPVSVAIDA G   QFY+
Sbjct  210   PYKGID-GTCKTEKESNHIAKISGYKDVPENSESALLKAVANQPVSVAIDASGSDFQFYS  268

Query  388   GGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRC  209
              G+FT +CGTEL+HGV  VGYG  + G KYW++KNSWG  WGE+GY R++RDI AK G C
Sbjct  269   SGIFTGKCGTELDHGVVAVGYGATKDGTKYWIVKNSWGVSWGENGYIRMKRDIVAKTGLC  328

Query  208   GIALDPSYP  182
             GIA+  SYP
Sbjct  329   GIAMKASYP  337



>emb|CAD40112.2| OSJNBa0035O13.5 [Oryza sativa Japonica Group]
 gb|EAZ29777.1| hypothetical protein OsJ_13835 [Oryza sativa Japonica Group]
Length=339

 Score =   369 bits (947),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 199/344 (58%), Positives = 246/344 (72%), Gaps = 11/344 (3%)
 Frame = -1

Query  1201  IKNLIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIF  1022
             I   ++FA IL+C    +  +    + D   M  RHE WM +YGRVY D TEKA+RF IF
Sbjct  3     IPKALLFA-ILSCLCLCSAVLAAREQSDHAAMVARHERWMEQYGRVYKDATEKARRFEIF  61

Query  1021  KENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTK-NGYKRPVSPRNPWRSMPFRYEN  845
             K NV  IESFN AG+  + LG+N+FADLTN EF +TK N    P + R P     FRYEN
Sbjct  62    KANVAFIESFN-AGNHKFWLGVNQFADLTNYEFRATKTNKGFIPSTVRVP---TTFRYEN  117

Query  844   VT--DIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVd  671
             V+   +P+ VDWR +GAVTP+K+QG CGCCWAFSAVAA+EGIVK+S G+L+SLSEQELVD
Sbjct  118   VSIDTLPATVDWRTKGAVTPIKDQGQCGCCWAFSAVAAMEGIVKLSTGKLISLSEQELVD  177

Query  670   cdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYE  491
             CD  G D GC GG MDDAFK+IIK+ GLTTES YPY   D G+CN    S  AA I GYE
Sbjct  178   CDVHGEDQGCEGGLMDDAFKFIIKNGGLTTESKYPYTAAD-GKCN--GGSNSAATIKGYE  234

Query  490   DVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGER  311
             DVP N+EAAL++A A+QPVSVA+D   +  QFY+GGV T  CGT+L+HG+  +GYG    
Sbjct  235   DVPANNEAALMKAVANQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDHGIVAIGYGKDGD  294

Query  310   GIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             G +YWLLKNSWG  WGE+G+ R+++DI  K G CG+A++PSYPT
Sbjct  295   GTQYWLLKNSWGTTWGENGFLRMEKDISDKRGMCGLAMEPSYPT  338



>ref|XP_008342781.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score =   369 bits (946),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 188/314 (60%), Positives = 229/314 (73%), Gaps = 5/314 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M  R+E W+ARYGRVY D  EK  RF IFKENV  IES N+  ++PY L +N+F DL
Sbjct  23    DASMYGRYEQWLARYGRVYNDVDEKETRFKIFKENVAFIESSNKDANKPYKLSVNQFXDL  82

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTD-IPSAVDWRKEGAVTPVKNQGVCGCC  761
             TN+EF +++NG+K         ++  F+YENVT  +P+ +DWRK+GAVTPVK+QG CGCC
Sbjct  83    TNEEFKASRNGFK---GHECSTKTTSFKYENVTAALPATMDWRKKGAVTPVKDQGQCGCC  139

Query  760   WAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTT  581
             WAFSAVAA EG+ +++ G L+SLSEQELVDCD  G D GC GG MDDAF++  +++G++T
Sbjct  140   WAFSAVAATEGVTQLTTGXLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFXQQNHGIST  199

Query  580   ESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQL  401
             E  YPY G D G CN    +  AAKI G+EDVP NSE ALL A AHQPVSVAIDA G   
Sbjct  200   EXNYPYBGVD-GTCNTKKEAIIAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDF  258

Query  400   QFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAK  221
             QFY+ GVFT  CGT L+HGVT VGYG  E G KYWL+KNSWG +WGE GY R+QRD+ A 
Sbjct  259   QFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWGAEWGEXGYIRMQRDVAAP  318

Query  220   EGRCGIALDPSYPT  179
             EG CGIA+  SYPT
Sbjct  319   EGLCGIAMSASYPT  332



>ref|XP_002305073.2| hypothetical protein POPTR_0004s05540g [Populus trichocarpa]
 gb|EEE85584.2| hypothetical protein POPTR_0004s05540g [Populus trichocarpa]
Length=340

 Score =   369 bits (947),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 185/339 (55%), Positives = 231/339 (68%), Gaps = 6/339 (2%)
 Frame = -1

Query  1195  NLIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKE  1016
             N  +F   L   +  A  +     D+ + M KRHE+WMA++GRVY D  EK KR+ IFKE
Sbjct  7     NTRIFLPFLLILAAWATKIACRPLDEQEYMLKRHEEWMAQHGRVYGDMKEKEKRYLIFKE  66

Query  1015  NVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTD  836
             N++ IE+FN   DR Y LG+N+FADLTN+EF +  +GYKR  S      S  FRYEN++D
Sbjct  67    NIERIEAFNNGSDRGYKLGVNKFADLTNEEFRAMYHGYKRQSSK---LMSSSFRYENLSD  123

Query  835   IPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgg  656
             IP+++DWR +GAVTPVK+QG CGCCWAFS VAA+EGI+K+  G L+SLSEQ+LVDC  G 
Sbjct  124   IPTSMDWRNDGAVTPVKDQGTCGCCWAFSTVAAIEGIIKLQTGNLISLSEQQLVDCTAGN  183

Query  655   gdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMN  476
                      MD AF+YII++ GLT+E  YPY G D G C+   A+   A+I GYEDVP N
Sbjct  184   KGCQGGL--MDTAFQYIIRNGGLTSEDNYPYQGVD-GTCSSEKAASTEAQITGYEDVPQN  240

Query  475   SEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYW  296
             +E ALLQA A QPVSVA++  G   QFY  GVF   CGT LNH VT +GYGT   G  YW
Sbjct  241   NENALLQAVAKQPVSVAVEGGGHDFQFYKSGVFEGDCGTNLNHAVTAIGYGTDSDGTDYW  300

Query  295   LLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             L+KNSWG  WGE+GY R++R I + EG CG+A D SYPT
Sbjct  301   LVKNSWGTSWGENGYMRMRRGIGSSEGLCGVAKDASYPT  339



>ref|XP_004306597.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   369 bits (947),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 187/313 (60%), Positives = 233/313 (74%), Gaps = 5/313 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M  R+E WMAR+GRV++   EK  RF IFKEN+  IES N    + + LG+N+FA L
Sbjct  32    DVTMYGRYEQWMARHGRVFSSIDEKESRFKIFKENLAYIESSNNDASKTFRLGVNQFAHL  91

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF S  NG+K   S     ++  FRYENVT +P+ +DWR +GAVTP+KNQG CGCCW
Sbjct  92    TNEEFTSLSNGFKGHESST---KTSSFRYENVT-VPATMDWRSKGAVTPIKNQGQCGCCW  147

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA+EGI +++ G+L+SLSEQELVDCDK G D GC GG MDDAF++I +++GL+TE
Sbjct  148   AFSAVAAMEGITQLTMGKLISLSEQELVDCDKSGEDQGCEGGLMDDAFEFINQNHGLSTE  207

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D G+CN    +  AA I G+EDVP NSE+ALL+A A QP+SVAIDA G   Q
Sbjct  208   ANYPYTGVD-GKCNARKEASHAASITGHEDVPANSESALLKAVASQPISVAIDASGSDFQ  266

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY+ GVFT  CGT L+HGVT VGYG  + G KYWL+KNSWG +WGE+GY R+QRD+DA E
Sbjct  267   FYSSGVFTGTCGTSLDHGVTAVGYGVSDDGTKYWLVKNSWGAQWGEEGYIRMQRDVDAAE  326

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYPT
Sbjct  327   GLCGIAMAASYPT  339



>ref|XP_011005485.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=339

 Score =   369 bits (947),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 185/315 (59%), Positives = 232/315 (74%), Gaps = 4/315 (1%)
 Frame = -1

Query  1123  DDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFA  944
             D+ + M KRHE+WMA++GRVY D  EK KR+ IFKEN++ IE+FN   DR Y LG+N+FA
Sbjct  28    DEQEYMLKRHEEWMAQHGRVYEDMKEKEKRYLIFKENIERIEAFNSGSDRGYKLGVNKFA  87

Query  943   DLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGC  764
             DLTN+EF +  +GYKR  S      S  FR+EN++ IP ++DWRK GAVTPVK+QG CGC
Sbjct  88    DLTNEEFRAMHHGYKRQSSK---LMSSSFRHENLSAIPPSMDWRKAGAVTPVKDQGSCGC  144

Query  763   CWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLT  584
             CWAFSAVAA+EGI+K+  G+L+SL+EQ+LVDCD  G D GC GG MD+AF++I+++ GLT
Sbjct  145   CWAFSAVAAIEGIIKLKTGKLISLTEQQLVDCDVEGLDQGCGGGLMDNAFQFILRNGGLT  204

Query  583   TESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQ  404
             +E+ YPY G D G C     +   AKI GYEDVP+N+E ALLQA A QPVSVA++  G  
Sbjct  205   SEATYPYQGVD-GTCKSKKTASIEAKITGYEDVPVNNENALLQAVAKQPVSVAVEGGGYD  263

Query  403   LQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDA  224
              QFY  GVF   CGT L+H VT +GYGT   G  YWL+KNSWG  WGE GY R+QR I A
Sbjct  264   FQFYKSGVFKGDCGTYLDHAVTAIGYGTNSDGTNYWLVKNSWGTSWGESGYMRMQRGIGA  323

Query  223   KEGRCGIALDPSYPT  179
             +EG CG+A+D SYPT
Sbjct  324   REGLCGVAMDASYPT  338



>dbj|BAB13759.1| cysteine proteinase [Astragalus sinicus]
Length=343

 Score =   369 bits (947),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 187/312 (60%), Positives = 230/312 (74%), Gaps = 2/312 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M +RH+ WM +Y ++Y D  E  KRF IFKENV  IE+ N+ G R Y LG+N+F DL
Sbjct  32    DASMYERHQQWMGQYAKIYNDHQEWEKRFQIFKENVNYIETSNKEGGRFYKLGVNQFVDL  91

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF++ +N +K  +   +  R+  ++YENVT +PS VDWR++GAVTPVK+QG CGCCW
Sbjct  92    TNEEFIAPRNRFKGHMCS-SIIRTNTYKYENVTTVPSNVDWRQKGAVTPVKDQGQCGCCW  150

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA EGI ++S G+L+SLSEQELVDCD  G D GC GG MDDAFK+II+++GL TE
Sbjct  151   AFSAVAATEGIHQLSTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFIIQNHGLDTE  210

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D G CN   AS  AA I  YEDVP N+E AL +A A+QP+SVAIDA G   Q
Sbjct  211   AKYPYQGVD-GTCNANEASINAATITSYEDVPTNNEQALQKAVANQPISVAIDASGSDFQ  269

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY  GVFT  CGTEL+HGVT VGYG  + G KYWL+KNSWG  WGE+GY R+QR +DA E
Sbjct  270   FYTSGVFTGSCGTELDHGVTAVGYGVSDDGTKYWLVKNSWGTSWGEEGYIRMQRGVDAVE  329

Query  217   GRCGIALDPSYP  182
             G CGIA+  SYP
Sbjct  330   GLCGIAMQASYP  341



>ref|XP_007226492.1| hypothetical protein PRUPE_ppa026538mg [Prunus persica]
 gb|EMJ27691.1| hypothetical protein PRUPE_ppa026538mg [Prunus persica]
Length=342

 Score =   369 bits (946),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 189/313 (60%), Positives = 231/313 (74%), Gaps = 5/313 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M  ++E WMARYGRVY D  EK  RF IFKENV  IES N   ++PY L +N+FADL
Sbjct  34    DASMYGKYEQWMARYGRVYTDIQEKEMRFKIFKENVAFIESSNSDANKPYKLSVNQFADL  93

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF +++NG+   +      ++  F+YENVT  P  VDWR +GAVTP+K+QG CGCCW
Sbjct  94    TNEEFKASRNGF---LGHECSTKTTTFKYENVT-APPTVDWRTKGAVTPIKDQGQCGCCW  149

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA+EGI K++ G L+SLSEQELVDCD  G D GC GG MDDAF++I +++GL TE
Sbjct  150   AFSAVAAMEGITKLTTGNLISLSEQELVDCDTKGVDQGCEGGLMDDAFQFISQNHGLRTE  209

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D G CN    +  AAKI G+EDVP NSEAALL+A A+QP+SVAIDA G   Q
Sbjct  210   TNYPYTGVD-GTCNTKKEASHAAKITGHEDVPANSEAALLKAVANQPISVAIDAGGSDFQ  268

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY+ GVFT  CGT L+HGVT VGYG    G KYWL+KNSWG +WGE GY R+QR ++AKE
Sbjct  269   FYSSGVFTGSCGTSLDHGVTAVGYGVSADGTKYWLVKNSWGTEWGEKGYIRMQRGVEAKE  328

Query  217   GRCGIALDPSYPT  179
             G CGIA++ SYPT
Sbjct  329   GLCGIAMEASYPT  341



>ref|XP_008659445.1| PREDICTED: ervatamin-B-like [Zea mays]
 gb|AFW86316.1| hypothetical protein ZEAMMB73_635707 [Zea mays]
Length=340

 Score =   369 bits (946),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 192/337 (57%), Positives = 236/337 (70%), Gaps = 11/337 (3%)
 Frame = -1

Query  1177  AILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIE  998
             AIL        ++   +  DD  M  RHE WMA+Y RVY D +EKA+RF +FK NVK IE
Sbjct  10    AILGFAFFCGAALAARDLSDDSAMVARHEQWMAQYSRVYKDASEKARRFEVFKANVKFIE  69

Query  997   SFNQAGDRPYTLGINEFADLTNDEF--VSTKNGYKRPVSPRNPWRSMPFRYENVT--DIP  830
             SFN  G+  + LG+N+FADLTNDEF  + T  G+K      N      FRYENV+   +P
Sbjct  70    SFNAGGNNKFWLGVNQFADLTNDEFRSIKTNKGFKSS----NMKIPTGFRYENVSVDALP  125

Query  829   SAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggd  650
             + +DWR +GAVTP+K+QG CGCCWAFSAVAA EGIVKIS G+LVSL+EQELVDCD  G D
Sbjct  126   TTIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLVSLAEQELVDCDVHGED  185

Query  649   lgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSE  470
              GC GG MDDAFK+II + GLTTES YPY   D G+C   + S  AA I GYEDVP N E
Sbjct  186   QGCEGGLMDDAFKFIINNGGLTTESSYPYTAAD-GKCK--SGSNSAATIKGYEDVPANDE  242

Query  469   AALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLL  290
             AAL++A A+QPVSVA+D   +  QFY+ GV T  CGT+L+HG+  +GYG    G KYWL+
Sbjct  243   AALMKAVANQPVSVAVDGGDMTFQFYSSGVMTGSCGTDLDHGIAAIGYGKTSDGTKYWLM  302

Query  289   KNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             KNSWG  WGE+GY R+++DI  K G CG+A++PSYPT
Sbjct  303   KNSWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPT  339



>gb|KHN32069.1| Vignain [Glycine soja]
Length=333

 Score =   368 bits (945),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 189/319 (59%), Positives = 235/319 (74%), Gaps = 7/319 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M +RHE WM RYG+VY D  E+ KRF IFKENV  IE+FN A ++ Y L IN+FADL
Sbjct  15    DASMYERHEQWMTRYGKVYKDPQEREKRFRIFKENVNYIEAFNNAANKRYKLAINQFADL  74

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF++ +N +K  +   +  R+  F+YENVT +PS VDWR++GAVTP+K+QG CGCCW
Sbjct  75    TNEEFIAPRNRFKGHMCS-SIIRTTTFKYENVTAVPSTVDWRQKGAVTPIKDQGQCGCCW  133

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA EGI  ++ G+L+SLSEQELVDCD  G D GC GG MDDAFK++I+++GL TE
Sbjct  134   AFSAVAATEGIHALTSGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFVIQNHGLNTE  193

Query  577   SGYPYGGQDLG-RCN-----LTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDA  416
             + YPY G D   RC      L  A+  AA I GYEDVP N+E AL +A A+QPVSVAIDA
Sbjct  194   ANYPYKGVDGNQRCCYYYWVLNEAANDAATITGYEDVPANNEKALQKAVANQPVSVAIDA  253

Query  415   RGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQR  236
              G   QFY  GVFT  CGTEL+HGVT VGYG    G +YWL+KNSWG +WGE+GY R+QR
Sbjct  254   SGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSNDGTEYWLVKNSWGTEWGEEGYIRMQR  313

Query  235   DIDAKEGRCGIALDPSYPT  179
              ++++EG CGIA+  SYPT
Sbjct  314   GVNSEEGLCGIAMQASYPT  332



>emb|CAH66275.1| OSIGBa0147O06.5 [Oryza sativa Indica Group]
Length=339

 Score =   369 bits (946),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 194/339 (57%), Positives = 239/339 (71%), Gaps = 10/339 (3%)
 Frame = -1

Query  1186  VFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVK  1007
             +  AIL C    +  +      DD  M  RHE WMA+YGR+Y D+ EKA+RF +FK NV 
Sbjct  7     LLFAILGCLCLCSAVLAARELSDDAAMAARHERWMAQYGRMYKDDAEKARRFEVFKANVA  66

Query  1006  AIESFNQAGDRPYTLGINEFADLTNDEFVSTK-NGYKRPVSPRNPWRSMPFRYENVT--D  836
              IESFN AG+  + LG+N+FADLTNDEF STK N    P + R P     FRYENV    
Sbjct  67    FIESFN-AGNHKFWLGVNQFADLTNDEFRSTKTNKGFIPSTTRVP---TGFRYENVNIDA  122

Query  835   IPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgg  656
             +P+ +DWR +G VTP+K+QG CGCCWAFSAVAA+EGIVK+S G+L+SLSEQELVDCD  G
Sbjct  123   LPATMDWRTKGVVTPIKDQGQCGCCWAFSAVAAMEGIVKLSTGKLISLSEQELVDCDVHG  182

Query  655   gdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMN  476
              D GC GG MDDAFK+IIK+ GLTTES YPY   D  +C   + S   A I GYEDVP N
Sbjct  183   EDQGCEGGLMDDAFKFIIKNGGLTTESNYPYAAAD-DKCK--SVSNSVASIKGYEDVPAN  239

Query  475   SEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYW  296
             +EAAL++A A+QPVSVA+D   +  QFY GGV T  CGT+L+HG+  +GYG    G KYW
Sbjct  240   NEAALMKAVANQPVSVAVDGGDMTFQFYKGGVMTGSCGTDLDHGIVAIGYGKASDGTKYW  299

Query  295   LLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             LLKNSWG  WGE+G+ R+++DI  K G CG+A++PSYPT
Sbjct  300   LLKNSWGTTWGENGFLRMEKDISDKRGMCGLAMEPSYPT  338



>ref|XP_011078435.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=340

 Score =   369 bits (946),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 186/309 (60%), Positives = 232/309 (75%), Gaps = 4/309 (1%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M +RHE+WM RYGRVY +E EK  R+ IFK+NV+ IE+FN AG RPY LGIN FAD TN+
Sbjct  34    MLERHEEWMERYGRVYKNEEEKMMRYKIFKDNVEFIEAFNAAGTRPYKLGINAFADQTNE  93

Query  928   EFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFS  749
             EF + +NG  +    +   ++ PF+YENV+ +PS++DWRK+GAVTPVK+QG CG CWAFS
Sbjct  94    EFKAARNGLFKV---QKLSKATPFKYENVSALPSSMDWRKKGAVTPVKDQGQCGSCWAFS  150

Query  748   AVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGY  569
             A+AA EGI +IS G+L+SLSEQE+VDCDK   D GC GG M+DAF++II + G+ +ES Y
Sbjct  151   AIAATEGINQISTGKLISLSEQEIVDCDKTSQDQGCEGGYMEDAFEFIIDNKGIASESTY  210

Query  568   PYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYA  389
             PY   D G CN    S  AAKI  YE VP N+E ALL+A A QPVSV+IDA G++ QFY+
Sbjct  211   PYSATD-GTCNKKEESPIAAKITSYEKVPENNEKALLKAVAKQPVSVSIDAGGMEFQFYS  269

Query  388   GGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRC  209
              GVFT  CGT+L+HGVT VGYG    G KYWL+KNSWG  WGE+GY  ++RD+ AKEG C
Sbjct  270   SGVFTGDCGTDLDHGVTAVGYGKTSDGTKYWLVKNSWGTSWGEEGYIMMERDVAAKEGLC  329

Query  208   GIALDPSYP  182
             GIA+D SYP
Sbjct  330   GIAMDSSYP  338



>ref|XP_004303175.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   369 bits (946),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 185/313 (59%), Positives = 235/313 (75%), Gaps = 5/313 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D +M  R+E WMARY RVY+D  EK KRF IFKENV  +ES N   ++PY L +N FADL
Sbjct  32    DVIMYGRYEQWMARYERVYSDFDEKEKRFQIFKENVAFVESSNGEANKPYKLSVNRFADL  91

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF +++N +K          +  ++YENVT +P+ +DWR++GAVTP+K+QG CGCCW
Sbjct  92    TNEEFTASRNRFK---GHECSTETTSYKYENVT-VPATMDWRQKGAVTPIKDQGQCGCCW  147

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA+EGI +++ G+L+SLSEQELVDCD  G D GC GG MDDAF++I +++GL+TE
Sbjct  148   AFSAVAAMEGITQLTTGKLISLSEQELVDCDVNGEDQGCEGGLMDDAFQFINQNHGLSTE  207

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D G CN    +  AA I G+EDVP NSE+ALL+A A+QP+SVAIDA G   Q
Sbjct  208   ANYPYTGVD-GTCNAQKEASHAASITGHEDVPANSESALLKAVANQPISVAIDASGSDFQ  266

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY+ GVFT  CGT L+HGVT VGYG  + G KYWL+KNSWG +WGE GY R+QRD+DA+E
Sbjct  267   FYSSGVFTGTCGTSLDHGVTAVGYGVSDNGTKYWLVKNSWGAEWGEGGYIRMQRDVDAQE  326

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYPT
Sbjct  327   GLCGIAMAASYPT  339



>ref|XP_003539989.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   369 bits (946),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 189/313 (60%), Positives = 235/313 (75%), Gaps = 2/313 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M +RHE+WMARY +VY D  E+ KRF IFKENV  IE+FN A D+PY LGIN+FADL
Sbjct  32    DASMYERHEEWMARYAKVYKDPEEREKRFKIFKENVNYIEAFNNAADKPYKLGINQFADL  91

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF++ +N +K  +      R+  F+YENVT +PS VDWR++GAVTP+K+QG CGCCW
Sbjct  92    TNEEFIAPRNKFKGHMCSSIT-RTTTFKYENVTALPSTVDWRQKGAVTPIKDQGQCGCCW  150

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA EGI  ++ G+L+SLSEQE+VDCD  G D GC GG MD AFK+II+++GL TE
Sbjct  151   AFSAVAATEGIHALNSGKLISLSEQEVVDCDTKGEDQGCAGGFMDGAFKFIIQNHGLNTE  210

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY   D G+CN   A+  AA I GYEDVP+N+E AL +A A+QPVSVAIDA G   Q
Sbjct  211   ANYPYKAVD-GKCNANEAANHAATITGYEDVPVNNEKALQKAVANQPVSVAIDASGSDFQ  269

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY  GVFT  CGT+L+HGVT VGYG    G +YWL+KNSWG +WGE+GY  +QR + A+E
Sbjct  270   FYKTGVFTGSCGTQLDHGVTAVGYGVSADGTQYWLVKNSWGTEWGEEGYIMMQRGVKAQE  329

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYPT
Sbjct  330   GLCGIAMMASYPT  342



>ref|XP_006582264.1| PREDICTED: vignain-like [Glycine max]
 gb|KHN33267.1| Vignain [Glycine soja]
Length=338

 Score =   368 bits (945),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 188/341 (55%), Positives = 241/341 (71%), Gaps = 12/341 (4%)
 Frame = -1

Query  1198  KNLIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFK  1019
             ++++    +L+ C+    S + L+E     M +RHE WM +YG+VY D  EK KR  IFK
Sbjct  8     QHILALVLLLSICTSQVMS-RNLHEAS---MSERHEQWMKKYGKVYKDAAEKQKRLLIFK  63

Query  1018  ENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVT  839
             +NV+ IESFN AG++PY L IN  AD TN+EFV++ NGYK     +      PF+Y NVT
Sbjct  64    DNVEFIESFNAAGNKPYKLSINHLADQTNEEFVASHNGYKY----KGSHSQTPFKYGNVT  119

Query  838   DIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkg  659
             DIP+AVDWR+ GAVT VK+QG CG CWAFS VAA EGI +IS G L+SLSEQELVDCD  
Sbjct  120   DIPTAVDWRQNGAVTAVKDQGQCGSCWAFSTVAATEGIYQISTGMLMSLSEQELVDCDSV  179

Query  658   ggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPM  479
                       M+D F++IIK+ G+++E+ YPY   D G C+ +  +  AA+I GYE VP 
Sbjct  180   DHGCDGGL--MEDGFEFIIKNGGISSEANYPYTAVD-GTCDASKEASPAAQIKGYETVPA  236

Query  478   NSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGI-K  302
             NSE AL QA A+QPVSV+IDA G   QFY+ GVFT +CGT+L+HGVTVVGYGT + G  +
Sbjct  237   NSEEALQQAVANQPVSVSIDAGGSGFQFYSSGVFTGQCGTQLDHGVTVVGYGTTDDGTHE  296

Query  301   YWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             YW++KNSWG +WGE+GY R+QR IDA+EG CGIA+D SYPT
Sbjct  297   YWIVKNSWGTQWGEEGYIRMQRGIDAQEGLCGIAMDASYPT  337



>gb|KHN08873.1| Vignain [Glycine soja]
Length=335

 Score =   368 bits (945),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 188/341 (55%), Positives = 241/341 (71%), Gaps = 12/341 (4%)
 Frame = -1

Query  1198  KNLIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFK  1019
             ++++    +L+ C+    S + L+E     M +RHE WM +YG+VY D  EK KR  IFK
Sbjct  5     QHILALVLLLSICTSQVMS-RNLHEAS---MSERHEQWMKKYGKVYKDAAEKQKRLLIFK  60

Query  1018  ENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVT  839
             +NV+ IESFN AG++PY L IN  AD TN+EFV++ NGYK     +      PF+Y NVT
Sbjct  61    DNVEFIESFNAAGNKPYKLSINHLADQTNEEFVASHNGYKY----KGSHSQTPFKYGNVT  116

Query  838   DIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkg  659
             DIP+AVDWR+ GAVT VK+QG CG CWAFS VAA EGI +IS G L+SLSEQELVDCD  
Sbjct  117   DIPTAVDWRQNGAVTAVKDQGQCGSCWAFSTVAATEGIYQISTGMLMSLSEQELVDCDSV  176

Query  658   ggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPM  479
                       M+D F++IIK+ G+++E+ YPY   D G C+ +  +  AA+I GYE VP 
Sbjct  177   DHGCDGGL--MEDGFEFIIKNGGISSEANYPYTAVD-GTCDASKEASPAAQIKGYETVPA  233

Query  478   NSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGI-K  302
             NSE AL QA A+QPVSV+IDA G   QFY+ GVFT +CGT+L+HGVTVVGYGT + G  +
Sbjct  234   NSEEALQQAVANQPVSVSIDAGGSGFQFYSSGVFTGQCGTQLDHGVTVVGYGTTDDGTHE  293

Query  301   YWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             YW++KNSWG +WGE+GY R+QR IDA+EG CGIA+D SYPT
Sbjct  294   YWIVKNSWGTQWGEEGYIRMQRGIDAQEGLCGIAMDASYPT  334



>sp|A2XQE8.1|SAG39_ORYSI RecName: Full=Senescence-specific cysteine protease SAG39; AltName: 
Full=Cysteine proteinase SAG39; AltName: Full=Protein 
SENESCENCE-ASSOCIATED GENE 39; Flags: Precursor [Oryza sativa 
Indica Group]
 gb|EAY93058.1| hypothetical protein OsI_14861 [Oryza sativa Indica Group]
Length=339

 Score =   368 bits (945),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 196/336 (58%), Positives = 238/336 (71%), Gaps = 10/336 (3%)
 Frame = -1

Query  1177  AILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIE  998
             AIL C    +  +      DD  M  RHE WMA+YGRVY D+ EKA+RF +FK NV  IE
Sbjct  10    AILGCLCLCSAVLAARELSDDAAMAARHERWMAQYGRVYRDDAEKARRFEVFKANVAFIE  69

Query  997   SFNQAGDRPYTLGINEFADLTNDEFVSTK-NGYKRPVSPRNPWRSMPFRYENVT--DIPS  827
             SFN AG+  + LG+N+FADLTNDEF  TK N    P + R P     FRYENV    +P+
Sbjct  70    SFN-AGNHNFWLGVNQFADLTNDEFRWTKTNKGFIPSTTRVP---TGFRYENVNIDALPA  125

Query  826   AVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdl  647
              VDWR +GAVTP+K+QG CGCCWAFSAVAA+EGIVK+S G+L+SLSEQELVDCD  G D 
Sbjct  126   TVDWRTKGAVTPIKDQGQCGCCWAFSAVAAMEGIVKLSTGKLISLSEQELVDCDVHGEDQ  185

Query  646   gchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEA  467
             GC GG MDDAFK+IIK+ GLTTES YPY   D  +C   + S   A I GYEDVP N+EA
Sbjct  186   GCEGGLMDDAFKFIIKNGGLTTESNYPYAAAD-DKCK--SVSNSVASIKGYEDVPANNEA  242

Query  466   ALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLK  287
             AL++A A+QPVSVA+D   +  QFY GGV T  CGT+L+HG+  +GYG    G KYWLLK
Sbjct  243   ALMKAVANQPVSVAVDGGDMTFQFYKGGVMTGSCGTDLDHGIVAIGYGKASDGTKYWLLK  302

Query  286   NSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             NSWG  WGE+G+ R+++DI  K G CG+A++PSYPT
Sbjct  303   NSWGTTWGENGFLRMEKDISDKRGMCGLAMEPSYPT  338



>ref|XP_009357173.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   368 bits (945),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 187/314 (60%), Positives = 230/314 (73%), Gaps = 5/314 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M  R+E W+ RYGRVY +  EK  RF IF ENV  IES N+  ++PY L +N+FADL
Sbjct  34    DASMYGRYEQWLTRYGRVYNNVNEKETRFKIFNENVAFIESSNKYANKPYKLSVNQFADL  93

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVT-DIPSAVDWRKEGAVTPVKNQGVCGCC  761
             TN+EF +++NG+K          +  F+YENVT  +P+ +DWRK+GAVTP+K+QG CGCC
Sbjct  94    TNEEFKASRNGFKGHECST---ETTSFKYENVTASLPATMDWRKKGAVTPIKDQGQCGCC  150

Query  760   WAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTT  581
             WAFSAVAA EGI +++ G+L+SLSEQELVDCD  G D GC GG MDDAF++I +++G++T
Sbjct  151   WAFSAVAATEGITQLTTGKLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNHGIST  210

Query  580   ESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQL  401
             E+ YPY G D G CN    +  AAKI G+EDVP NSE ALL A AHQPVSVAIDA G   
Sbjct  211   EANYPYDGVD-GACNAKKEASHAAKITGFEDVPANSEKALLAAVAHQPVSVAIDASGSDF  269

Query  400   QFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAK  221
             QFY+ GVFT  CGT L+HGVT VGYG  E G KYWL+KNSWG +WGE GY R+QRD+ A 
Sbjct  270   QFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWGAEWGEAGYIRMQRDVAAA  329

Query  220   EGRCGIALDPSYPT  179
             EG CGIA+  SYPT
Sbjct  330   EGLCGIAMAASYPT  343



>ref|XP_010035848.1| PREDICTED: zingipain-2-like [Eucalyptus grandis]
 gb|KCW47319.1| hypothetical protein EUGRSUZ_K01106 [Eucalyptus grandis]
Length=336

 Score =   368 bits (944),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 193/313 (62%), Positives = 237/313 (76%), Gaps = 10/313 (3%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             DD M + H  WMARYGRVY D  EK  RF IFK NV+ IE FNQA D+PY LG+N+F DL
Sbjct  33    DDPMYEMHGQWMARYGRVYKDVEEKQSRFEIFKVNVRGIELFNQANDKPYKLGVNQFVDL  92

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             T +EF   +N ++  +       +  F+YEN+T +PS++DWR++GAVTPVKNQG CGCCW
Sbjct  93    TIEEF-KARNRFESHMCST---EAASFKYENITAVPSSMDWREKGAVTPVKNQGQCGCCW  148

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAAVEGI +I+ G+L+SLSEQELVDCD GG D GC GG M+ AF+++ KH GLTTE
Sbjct  149   AFSAVAAVEGINEITTGKLISLSEQELVDCDVGGQDQGCEGGWMNGAFQFVEKH-GLTTE  207

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D G+CN+  A      I GYEDVP NSE ALL+A A+QPVSVA+DA G + Q
Sbjct  208   TYYPYKGTD-GKCNVEGAVI----IKGYEDVPANSEEALLKAVANQPVSVAVDAGGFEFQ  262

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY+ GVFT  CGTEL+HGVT VGYGT + G K+WL+KN+WGE+WGE+GY R+QRD+ AKE
Sbjct  263   FYSSGVFTGACGTELDHGVTAVGYGTSDDGTKFWLVKNTWGEEWGEEGYIRMQRDVSAKE  322

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYPT
Sbjct  323   GLCGIAMKASYPT  335



>ref|XP_003607574.1| Cysteine protease [Medicago truncatula]
 gb|AES89771.1| papain family cysteine protease [Medicago truncatula]
Length=345

 Score =   368 bits (945),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 189/315 (60%), Positives = 233/315 (74%), Gaps = 4/315 (1%)
 Frame = -1

Query  1120  DDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGD-RPYTLGINEFA  944
             DD ++ ++HE WM  YG+VY D  E+  R  IFKENV  IE+ N AG+ + Y LGIN+FA
Sbjct  33    DDSIIYEKHEQWMVHYGKVYKDLQERENRLKIFKENVNYIEASNNAGNNKLYKLGINQFA  92

Query  943   DLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGC  764
             D+TN+EF++++N +K  +      ++  F+YEN + +PS VDWRK+GAVTPVKNQG CGC
Sbjct  93    DITNEEFIASRNKFKGHMCSSIT-KTSTFKYENAS-VPSTVDWRKKGAVTPVKNQGQCGC  150

Query  763   CWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLT  584
             CWAFSAVAA EGI K+S G+LVSLSEQELVDCD  G D GC GG MDDAFK+II+++GL 
Sbjct  151   CWAFSAVAATEGIHKLSTGKLVSLSEQELVDCDTKGVDQGCEGGLMDDAFKFIIQNHGLH  210

Query  583   TESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQ  404
             TE+ YPY G D G C+    S  AA IAGYEDVP N+E AL +A A+QP+SVAIDA G  
Sbjct  211   TEAQYPYQGVD-GTCSANETSTPAATIAGYEDVPANNENALQKAVANQPISVAIDASGSD  269

Query  403   LQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDA  224
              QFY  GVFT  CGT+L+HGVT VGYG    G KYWL+KNSWG  WGE+GY R+QR +DA
Sbjct  270   FQFYKSGVFTGSCGTQLDHGVTAVGYGISNDGTKYWLVKNSWGNDWGEEGYIRMQRSVDA  329

Query  223   KEGRCGIALDPSYPT  179
              +G CGIA+  SYPT
Sbjct  330   AQGLCGIAMMASYPT  344



>sp|Q7XWK5.2|SAG39_ORYSJ RecName: Full=Senescence-specific cysteine protease SAG39; AltName: 
Full=Cysteine proteinase SAG39; AltName: Full=Protein 
SENESCENCE-ASSOCIATED GENE 39; Flags: Precursor [Oryza sativa 
Japonica Group]
 emb|CAD40026.2| OSJNBa0052O21.11 [Oryza sativa Japonica Group]
 gb|EAZ29764.1| hypothetical protein OsJ_13822 [Oryza sativa Japonica Group]
Length=339

 Score =   368 bits (944),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 195/337 (58%), Positives = 239/337 (71%), Gaps = 12/337 (4%)
 Frame = -1

Query  1177  AILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIE  998
             AIL C    +  +      DD  M  RHE WMA+YGRVY D+ EKA+RF +FK NV  IE
Sbjct  10    AILGCLCLCSAVLAARELSDDAAMAARHERWMAQYGRVYRDDAEKARRFEVFKANVAFIE  69

Query  997   SFNQAGDRPYTLGINEFADLTNDEF--VSTKNGYKRPVSPRNPWRSMPFRYENVT--DIP  830
             SFN AG+  + LG+N+FADLTNDEF  + T  G+  P + R P     FRYENV    +P
Sbjct  70    SFN-AGNHNFWLGVNQFADLTNDEFRWMKTNKGFI-PSTTRVP---TGFRYENVNIDALP  124

Query  829   SAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggd  650
             + VDWR +GAVTP+K+QG CGCCWAFSAVAA+EGIVK+S G+L+SLSEQELVDCD  G D
Sbjct  125   ATVDWRTKGAVTPIKDQGQCGCCWAFSAVAAMEGIVKLSTGKLISLSEQELVDCDVHGED  184

Query  649   lgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSE  470
              GC GG MDDAFK+IIK+ GLTTES YPY   D  +C   + S   A I GYEDVP N+E
Sbjct  185   QGCEGGLMDDAFKFIIKNGGLTTESNYPYAAAD-DKCK--SVSNSVASIKGYEDVPANNE  241

Query  469   AALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLL  290
             AAL++A A+QPVSVA+D   +  QFY GGV T  CGT+L+HG+  +GYG    G KYWLL
Sbjct  242   AALMKAVANQPVSVAVDGGDMTFQFYKGGVMTGSCGTDLDHGIVAIGYGKASDGTKYWLL  301

Query  289   KNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             KNSWG  WGE+G+ R+++DI  K G CG+A++PSYPT
Sbjct  302   KNSWGTTWGENGFLRMEKDISDKRGMCGLAMEPSYPT  338



>ref|XP_008800073.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score =   368 bits (944),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 187/313 (60%), Positives = 227/313 (73%), Gaps = 2/313 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D   +++HE WMA YGR Y D  EK +RF IF+ NV+ IESFN AG+  + LG N+FADL
Sbjct  31    DVSTKEKHEQWMALYGRAYKDAAEKERRFKIFQANVELIESFN-AGNHKFKLGANQFADL  89

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF +            +   +  F+YEN T +P ++DWR +GAVTP+K+QG CGCCW
Sbjct  90    TNEEFRAVHTXXXXXXXASSGMATKSFKYENATAVPVSMDWRAKGAVTPIKDQGQCGCCW  149

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA+EGI K+S G+L+SLSEQELVDCD  G D GC GG MDDAFK+IIK+ GLTTE
Sbjct  150   AFSAVAAMEGITKLSTGKLISLSEQELVDCDTKGEDQGCGGGLMDDAFKFIIKNGGLTTE  209

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY   D G CN   +   AA I GYEDVP NSEAALL+A A+QPVSVAIDA G   Q
Sbjct  210   ANYPYEAAD-GTCNAGKSHSHAATIGGYEDVPANSEAALLKAVANQPVSVAIDAGGSAFQ  268

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
              Y+ GVFT  CGT+L+HGVT VGY     G KYWL+KNSWG  WGE+GY R++RD+DAKE
Sbjct  269   LYSSGVFTGDCGTDLDHGVTAVGYDKTSDGTKYWLVKNSWGSSWGENGYIRMERDVDAKE  328

Query  217   GRCGIALDPSYPT  179
             G CGIA++ SYPT
Sbjct  329   GLCGIAMEASYPT  341



>gb|EAY93078.1| hypothetical protein OsI_14879 [Oryza sativa Indica Group]
Length=339

 Score =   367 bits (943),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 198/344 (58%), Positives = 246/344 (72%), Gaps = 11/344 (3%)
 Frame = -1

Query  1201  IKNLIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIF  1022
             I   ++FA IL+C    +  +    + D   M  RHE WM +YGRVY D TEKA+RF IF
Sbjct  3     IPKALLFA-ILSCLCLCSAVLAAREQSDHAAMVARHERWMEQYGRVYKDATEKARRFEIF  61

Query  1021  KENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTK-NGYKRPVSPRNPWRSMPFRYEN  845
             K NV  IESFN AG+  + LG+N+FADLTN EF +TK N    P + R P     FRYEN
Sbjct  62    KANVAFIESFN-AGNHKFWLGVNQFADLTNYEFRATKTNKGFIPSTVRVP---TTFRYEN  117

Query  844   VT--DIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVd  671
             V+   +P+ VDWR +GAVTP+K+QG CGCCWAFSAVAA+EGIVK+S G+L+SLSEQELVD
Sbjct  118   VSIDTLPATVDWRTKGAVTPIKDQGQCGCCWAFSAVAAMEGIVKLSTGKLISLSEQELVD  177

Query  670   cdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYE  491
             CD  G D GC GG MDDAFK+IIK+ GLTTES YPY   D G+CN    S  AA I GYE
Sbjct  178   CDVHGEDQGCEGGLMDDAFKFIIKNGGLTTESKYPYTAAD-GKCN--GGSNSAATIKGYE  234

Query  490   DVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGER  311
             +VP N+EAAL++A A+QPVSVA+D   +  QFY+GGV T  CGT+L+HG+  +GYG    
Sbjct  235   EVPANNEAALMKAVANQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDHGIVAIGYGKDGD  294

Query  310   GIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             G +YWLLKNSWG  WGE+G+ R+++DI  K G CG+A++PSYPT
Sbjct  295   GTQYWLLKNSWGTTWGENGFLRMEKDISDKRGMCGLAMEPSYPT  338



>gb|KHN13720.1| Vignain [Glycine soja]
Length=309

 Score =   366 bits (939),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 188/310 (61%), Positives = 234/310 (75%), Gaps = 2/310 (1%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M +RHE+WMARY +VY D  E+ KRF IFKENV  IE+FN A D+PY LGIN+FADLTN+
Sbjct  1     MYERHEEWMARYAKVYKDPEEREKRFKIFKENVNYIEAFNNAADKPYKLGINQFADLTNE  60

Query  928   EFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFS  749
             EF++ +N +K  +      R+  F+YENVT +PS VDWR++GAVTP+K+QG CGCCWAFS
Sbjct  61    EFIAPRNRFKGHMCSSIT-RTTTFKYENVTALPSTVDWRQKGAVTPIKDQGQCGCCWAFS  119

Query  748   AVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGY  569
             AVAA EGI  ++ G+L+SLSEQE+VDCD  G D GC GG MD AFK+II+++GL TE+ Y
Sbjct  120   AVAATEGIHALNSGKLISLSEQEVVDCDTKGEDQGCAGGFMDGAFKFIIQNHGLNTEANY  179

Query  568   PYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYA  389
             PY   D G+CN   A+  AA I GYEDVP+N+E AL +A A+QPVSVAIDA G   QFY 
Sbjct  180   PYKAVD-GKCNANEAANHAATITGYEDVPVNNEKALQKAVANQPVSVAIDASGSDFQFYK  238

Query  388   GGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRC  209
              GVFT  CGT+L+HGVT VGYG    G +YWL+KNSWG +WGE+GY  +QR + A+EG C
Sbjct  239   TGVFTGSCGTQLDHGVTAVGYGVSADGTQYWLVKNSWGTEWGEEGYIMMQRGVKAQEGLC  298

Query  208   GIALDPSYPT  179
             GIA+  SYPT
Sbjct  299   GIAMMASYPT  308



>ref|XP_009359967.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=342

 Score =   367 bits (943),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 190/313 (61%), Positives = 234/313 (75%), Gaps = 5/313 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M  R+E WMARYGRVY+D  EK KRF+IFKENV  IES N   ++ + L +N+FADL
Sbjct  34    DASMYGRYEQWMARYGRVYSDINEKEKRFNIFKENVAFIESSNNDANKLHKLSVNQFADL  93

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF +++N   R +      ++  F+YENVT  P  +DWRK+GAVTPVK+QG CGCCW
Sbjct  94    TNEEFKASRN---RFMGHECSAKTTSFKYENVT-APPTLDWRKKGAVTPVKDQGQCGCCW  149

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA+EGI K++ G+L+SLSEQELVDCD  G D GC GG MDDAF++I +++GL+TE
Sbjct  150   AFSAVAAMEGITKLTTGKLISLSEQELVDCDTSGVDQGCEGGLMDDAFQFINQNHGLSTE  209

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D G CN    +  AAKI G+EDVP NSE ALL+A A+QP+SVAIDA G   Q
Sbjct  210   TNYPYTGVD-GTCNTKKEANHAAKITGHEDVPANSEEALLKAVANQPISVAIDAGGSDFQ  268

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY+ GVFT  CGT L+HGVT VGYG    G KYWL+KNSWG +WGE+GY R+QR I AKE
Sbjct  269   FYSSGVFTGTCGTSLDHGVTAVGYGVSADGTKYWLVKNSWGTEWGEEGYIRMQRGIKAKE  328

Query  217   GRCGIALDPSYPT  179
             G CGIA++ SYPT
Sbjct  329   GLCGIAMEASYPT  341



>emb|CAH66233.1| H0825G02.10 [Oryza sativa Indica Group]
Length=339

 Score =   367 bits (942),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 198/344 (58%), Positives = 245/344 (71%), Gaps = 11/344 (3%)
 Frame = -1

Query  1201  IKNLIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIF  1022
             I   ++FA IL+C    +  +    + D   M  RHE WM +YGRVY D TEKA+RF IF
Sbjct  3     IPKALLFA-ILSCLCLCSAVLAAREQSDHAAMVARHERWMEQYGRVYKDATEKARRFEIF  61

Query  1021  KENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTK-NGYKRPVSPRNPWRSMPFRYEN  845
             K NV  IESFN AG+  + L +N+FADLTN EF +TK N    P + R P     FRYEN
Sbjct  62    KANVAFIESFN-AGNHKFWLSVNQFADLTNYEFRATKTNKGFIPSTVRVP---TTFRYEN  117

Query  844   VT--DIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVd  671
             V+   +P+ VDWR +GAVTP+K+QG CGCCWAFSAVAA+EGIVK+S G+L+SLSEQELVD
Sbjct  118   VSIDTLPATVDWRTKGAVTPIKDQGQCGCCWAFSAVAAMEGIVKLSTGKLISLSEQELVD  177

Query  670   cdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYE  491
             CD  G D GC GG MDDAFK+IIK+ GLTTES YPY   D G+CN    S  AA I GYE
Sbjct  178   CDVHGEDQGCEGGLMDDAFKFIIKNGGLTTESKYPYTAAD-GKCN--GGSNSAATIKGYE  234

Query  490   DVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGER  311
             DVP N+EAAL++A A+QPVSVA+D   +  QFY+GGV T  CGT+L+HG+  +GYG    
Sbjct  235   DVPANNEAALMKAVANQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDHGIVAIGYGKDGD  294

Query  310   GIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             G +YWLLKNSWG  WGE+G+ R+++DI  K G CG+A++PSYPT
Sbjct  295   GTQYWLLKNSWGTTWGENGFLRMEKDISDKRGMCGLAMEPSYPT  338



>ref|XP_006582263.1| PREDICTED: vignain-like [Glycine max]
Length=338

 Score =   367 bits (942),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 188/341 (55%), Positives = 240/341 (70%), Gaps = 12/341 (4%)
 Frame = -1

Query  1198  KNLIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFK  1019
             ++++    +L+ C+    S + L+E     M +RHE WM +YG+VY D  EK KR  IFK
Sbjct  8     QHILALVLLLSICTSQVMS-RNLHEAS---MSERHEQWMKKYGKVYKDAAEKQKRLLIFK  63

Query  1018  ENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVT  839
             +NV+ IESFN AG++PY L IN  AD TN+EFV++ NGYK     +      PF+Y NVT
Sbjct  64    DNVEFIESFNAAGNKPYKLSINHLADQTNEEFVASHNGYKY----KGSHSQTPFKYGNVT  119

Query  838   DIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkg  659
             DIP+AVDWR+ GAVT VK+QG CG CWAFS VAA EGI +IS G L+SLSEQELVDCD  
Sbjct  120   DIPTAVDWRQNGAVTAVKDQGQCGSCWAFSTVAATEGIYQISTGMLMSLSEQELVDCDSV  179

Query  658   ggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPM  479
                       M+D F++IIK+ G+++E+ YPY   D G C+ +  +  AA+I GYE VP 
Sbjct  180   DHGCDGGL--MEDGFEFIIKNGGISSEANYPYTAVD-GTCDASKEASPAAQIKGYETVPA  236

Query  478   NSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGI-K  302
             NSE AL QA A+QPVSV+IDA G   QFY+ GVFT +CGT+L+HGVTVVGYGT + G  +
Sbjct  237   NSEEALQQAVANQPVSVSIDAGGSGFQFYSSGVFTGQCGTQLDHGVTVVGYGTTDDGTHE  296

Query  301   YWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             YW++KNSWG +WGE+GY R+QR IDA EG CGIA+D SYPT
Sbjct  297   YWIVKNSWGTQWGEEGYIRMQRGIDALEGLCGIAMDASYPT  337



>gb|KCW47322.1| hypothetical protein EUGRSUZ_K01110 [Eucalyptus grandis]
Length=305

 Score =   365 bits (938),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 188/310 (61%), Positives = 225/310 (73%), Gaps = 6/310 (2%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M + HE WMARY RVY D  E+  RF IFK N + IESFN+   +PY L +N+FADLTN+
Sbjct  1     MYEMHEQWMARYERVYKDMDERQSRFQIFKANTQRIESFNRGSGKPYKLSVNQFADLTNE  60

Query  928   EFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFS  749
             EF   +N +K  V       +  F+Y N T +PS++DWRK+GAVTPVKNQG CGCCWAFS
Sbjct  61    EF-KARNRFKSHVCSA---EAASFKYGNGTAVPSSMDWRKKGAVTPVKNQGQCGCCWAFS  116

Query  748   AVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGY  569
             AV AVEG+ +I+ G+L+SLSEQELVDCD      GC GG MD AF+++ KH GLTTE  Y
Sbjct  117   AVTAVEGVHEITTGKLISLSEQELVDCDVRSQYQGCEGGWMDSAFQFVEKH-GLTTEMNY  175

Query  568   PYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYA  389
             PY G D G+CN    S RA  I GYEDVP NSE ALL+A A+QPVSVAIDA G + QFY+
Sbjct  176   PYTGTD-GKCNAKRESNRAVTIKGYEDVPANSEEALLKAVANQPVSVAIDAGGFEFQFYS  234

Query  388   GGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRC  209
              GVFT  CGT+L+HGV  VGYGT +   KYWL+KNSWG KWGE+GY R+QRD+ AKEG C
Sbjct  235   SGVFTGACGTDLDHGVAAVGYGTSDDSTKYWLVKNSWGAKWGEEGYIRMQRDVTAKEGLC  294

Query  208   GIALDPSYPT  179
             GIA+  SYPT
Sbjct  295   GIAMKASYPT  304



>ref|XP_006362428.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=341

 Score =   367 bits (941),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 192/310 (62%), Positives = 227/310 (73%), Gaps = 4/310 (1%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M +++E WMAR+GRVY D+TEKAKRF+IFK+N   I+S N+AG RPY L IN FADLTN+
Sbjct  35    MVQKNEKWMARFGRVYRDDTEKAKRFNIFKDNFDYIQSINKAGMRPYKLSINGFADLTNE  94

Query  928   EFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFS  749
             EF +T NGYK   S     ++  FRYENVT  P+ +DWRK+GAVT VK+Q  CGCCWAFS
Sbjct  95    EFRATHNGYKMS-SHHTSSKTTFFRYENVT-APATMDWRKKGAVTGVKDQWQCGCCWAFS  152

Query  748   AVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGY  569
             AVAA +GI +I  G+L+SLSEQELVDCD         G  MDDAFK+IIK++GLTTES Y
Sbjct  153   AVAATKGINEIKTGKLISLSEQELVDCDTSSDMGCEGGL-MDDAFKFIIKNHGLTTESNY  211

Query  568   PYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYA  389
             PY G D G C     S  AAKI GYEDVP NSE+ALL A A+QPVSVAIDA G   QFY+
Sbjct  212   PYEGTD-GTCKTGKESNDAAKITGYEDVPANSESALLNAVANQPVSVAIDASGSDFQFYS  270

Query  388   GGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRC  209
              GVFT   GT+L+HGVT VGYG    G KYWL+KNSWG  WGE+GY R+QR +  +EG C
Sbjct  271   SGVFTGEYGTDLDHGVTAVGYGITSDGTKYWLVKNSWGTSWGENGYIRMQRGVVPEEGIC  330

Query  208   GIALDPSYPT  179
             GIA+  SYPT
Sbjct  331   GIAMQASYPT  340



>ref|XP_009361500.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=342

 Score =   367 bits (941),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 190/313 (61%), Positives = 233/313 (74%), Gaps = 5/313 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M  R+E WMA YGRVY+D  EK KRF+IFKENV  IES N   ++ + L +N+FADL
Sbjct  34    DASMYGRYEQWMAHYGRVYSDINEKEKRFNIFKENVAFIESSNNDANKLHKLSVNQFADL  93

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF +++N   R +      ++  F+YENVT  P  VDWRK+GAVTPVK+QG CGCCW
Sbjct  94    TNEEFKASRN---RFMGHECSAKTTSFKYENVT-APPTVDWRKKGAVTPVKDQGQCGCCW  149

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA+EGI K++ G+L+SLSEQELVDCD  G D GC GG MDDAF++I +++GL+TE
Sbjct  150   AFSAVAAMEGITKLTTGKLISLSEQELVDCDTSGVDQGCEGGLMDDAFQFINQNHGLSTE  209

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D G CN    +  AAKI G+EDVP NSE ALL+A A+QP+SVAIDA G   Q
Sbjct  210   TNYPYTGVD-GTCNTKKEANHAAKITGHEDVPANSEEALLKAVANQPISVAIDAGGSDFQ  268

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY+ GVFT  CGT L+HGVT VGYG    G KYWL+KNSWG +WGE+GY R+QR I AKE
Sbjct  269   FYSSGVFTGTCGTSLDHGVTAVGYGVSADGTKYWLVKNSWGTEWGEEGYIRMQRGIKAKE  328

Query  217   GRCGIALDPSYPT  179
             G CGIA++ SYPT
Sbjct  329   GLCGIAMEASYPT  341



>ref|XP_008223852.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=342

 Score =   366 bits (940),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 188/313 (60%), Positives = 231/313 (74%), Gaps = 5/313 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M  ++E WM RYGRV+    EK  RF IFKENV  IES N   ++PY L +N+FADL
Sbjct  34    DASMYGKYEQWMTRYGRVFTGVQEKEMRFKIFKENVAFIESSNSDANKPYKLSVNQFADL  93

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF +++NG+   +      ++  F+YENVT  P  VDWR +GAVTP+K+QG CGCCW
Sbjct  94    TNEEFKASRNGF---LGHECSTKTTTFKYENVT-APPTVDWRTKGAVTPIKDQGQCGCCW  149

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA+EGI K+S G L+SLSEQELVDCD  G D GC GG MDDAF++I +++GL+TE
Sbjct  150   AFSAVAAMEGITKLSTGNLISLSEQELVDCDTKGVDQGCEGGLMDDAFQFINQNHGLSTE  209

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D G CN    +  AAKI G+EDVP NSEAALL+A A+QPVSVAIDA G   Q
Sbjct  210   TNYPYTGVD-GTCNTKKEASHAAKITGHEDVPANSEAALLKAVANQPVSVAIDAGGSDFQ  268

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY+ GVFT  CGT L+HGVT VGYG  + G KYWL+KNSWG +WGE GY R+QR ++AKE
Sbjct  269   FYSSGVFTGACGTSLDHGVTAVGYGVSDDGTKYWLVKNSWGTEWGEKGYIRMQRGVEAKE  328

Query  217   GRCGIALDPSYPT  179
             G CGIA++ SYPT
Sbjct  329   GLCGIAMEASYPT  341



>ref|XP_003539970.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   366 bits (940),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 188/313 (60%), Positives = 235/313 (75%), Gaps = 2/313 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M +RHE+WMARY +VY D  E+ KRF IFKENV  IE+FN A ++PY LGIN+FADL
Sbjct  32    DASMYERHEEWMARYAKVYKDPEEREKRFKIFKENVNYIEAFNNAANKPYKLGINQFADL  91

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF++ +N +K  +      R+  F+YENVT +PS VDWR++GAVTP+K+QG CGCCW
Sbjct  92    TNEEFIAPRNRFKGHMCSSIT-RTTTFKYENVTALPSTVDWRQKGAVTPIKDQGQCGCCW  150

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA EGI  ++ G+L+SLSEQE+VDCD  G D GC GG MD AFK+II+++GL TE
Sbjct  151   AFSAVAATEGIHALNSGKLISLSEQEVVDCDTKGEDQGCAGGFMDGAFKFIIQNHGLNTE  210

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY   D G+CN   A+  AA I GYEDVP+N+E AL +A A+QPVSVAIDA G   Q
Sbjct  211   ANYPYKAVD-GKCNANEAANHAATITGYEDVPVNNEKALQKAVANQPVSVAIDASGSDFQ  269

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY  GVFT  CGT+L+HGVT VGYG    G +YWL+KNSWG +WGE+GY  +QR + A+E
Sbjct  270   FYKTGVFTGSCGTQLDHGVTAVGYGVSADGTQYWLVKNSWGTEWGEEGYIMMQRGVKAQE  329

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYPT
Sbjct  330   GLCGIAMMASYPT  342



>ref|XP_009798361.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=339

 Score =   366 bits (939),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 182/309 (59%), Positives = 229/309 (74%), Gaps = 5/309 (2%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             + ++HE WM +YGRVY D+TEK +R   FK+N++ IES N+   R Y LGIN+FAD+TN+
Sbjct  34    ITEKHEQWMTQYGRVYTDDTEKTERLETFKQNLEYIESINKDVTRTYKLGINQFADMTNE  93

Query  928   EFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFS  749
             EF +++NGY+  +S +   ++  F+YENVT +  ++DWRK+GAVT +K+QG CGCCWAFS
Sbjct  94    EFKASRNGYR--ISSQQKIKTTFFQYENVT-VAYSMDWRKKGAVTKIKDQGQCGCCWAFS  150

Query  748   AVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGY  569
             AVAA EGI KI  G+L+SLSEQELVDCD         G  MDDAFKYIIK++GLT+ES Y
Sbjct  151   AVAATEGINKIKTGKLISLSEQELVDCDTSSNQGCEGGL-MDDAFKYIIKNHGLTSESNY  209

Query  568   PYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYA  389
             PY G D G C     S   AKI GY+DVP NSE ALL+A A+QPVSVAIDA G   QFY+
Sbjct  210   PYKGID-GTCKTEKESNHVAKIRGYKDVPENSELALLKAVANQPVSVAIDASGSDFQFYS  268

Query  388   GGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRC  209
              G+FT +CGTEL+HGVT VGYG  + G KYW++KNSWG  WGE+GY R++RDI AK G C
Sbjct  269   SGIFTGKCGTELDHGVTTVGYGATKDGTKYWIVKNSWGVSWGENGYIRMKRDIVAKTGLC  328

Query  208   GIALDPSYP  182
             GIA+  SYP
Sbjct  329   GIAMKASYP  337



>ref|XP_009767421.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=334

 Score =   366 bits (939),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 189/341 (55%), Positives = 237/341 (70%), Gaps = 8/341 (2%)
 Frame = -1

Query  1201  IKNLIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIF  1022
             +K LI+  AIL   +    +   +    D+ +  ++E WM +YGRVY +  EK   F IF
Sbjct  1     MKFLILLFAILGIWASKTTARTLV----DEPLMLKYEQWMIQYGRVYKNNAEKDSHFKIF  56

Query  1021  KENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENV  842
             K+N + IE+FN A ++PY LGIN FADLTN+EF + +NG K P       +   FRYENV
Sbjct  57    KKNAERIEAFNDAANQPYKLGINAFADLTNEEFRAARNGLKIPFCEP---KITSFRYENV  113

Query  841   TDIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdk  662
             T IP+ +DWR +GAVTP+K+QG CG CWAFSA+AA EGI K+S G+L+SLSEQEL+DCD+
Sbjct  114   TAIPTTMDWRIKGAVTPIKDQGQCGSCWAFSAIAATEGITKLSTGKLISLSEQELMDCDR  173

Query  661   gggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVP  482
                D GC GG M+DAF++I+K+ GLTTE+ YPY   D  +CN    S   A I GYE VP
Sbjct  174   NSEDQGCEGGYMEDAFEFIVKNKGLTTETTYPYKAAD-EKCNTKKESSHVADIKGYEKVP  232

Query  481   MNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIK  302
               +E ALL A A+QP+SV+IDA     QFY  GVFT  CGTEL+HGVT VGYG  E G K
Sbjct  233   KYNEKALLNAVANQPISVSIDASDFSFQFYTSGVFTGTCGTELDHGVTAVGYGKAEDGTK  292

Query  301   YWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             YWL+KNSWG  WGE+GY R++RDIDAKEG CGIA+D SYPT
Sbjct  293   YWLIKNSWGSSWGENGYIRMERDIDAKEGLCGIAMDASYPT  333



>ref|XP_006652104.1| PREDICTED: vignain-like [Oryza brachyantha]
Length=342

 Score =   365 bits (938),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 198/344 (58%), Positives = 243/344 (71%), Gaps = 19/344 (6%)
 Frame = -1

Query  1183  FAAILAC---CSK--AAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFK  1019
               A+L C   CS   AA+ +     DDD  M  RHE WMA+YGRVY D  EKA+RF +FK
Sbjct  8     LVAVLGCLYLCSAVLAARELG----DDDAAMAARHERWMAQYGRVYKDAAEKARRFEVFK  63

Query  1018  ENVKAIESFNQAGDRPYTLGINEFADLTNDEF--VSTKNGYKRPVSPRNPWRSMPFRYEN  845
              NV  IESFN  G R + LG+N+FADLTN EF   +T  G+  P + R P     FRYEN
Sbjct  64    ANVAFIESFNGGGGRKFWLGVNQFADLTNYEFRATNTNKGFI-PSTVRVP---TGFRYEN  119

Query  844   VT--DIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVd  671
             V+   +P+ VDWR +GAVTP+K+QG CGCCWAFSAVAA+EGIVK+S G+L+SLSEQELVD
Sbjct  120   VSIDALPATVDWRTKGAVTPIKDQGQCGCCWAFSAVAAMEGIVKLSTGKLISLSEQELVD  179

Query  670   cdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYE  491
             CD  G D GC GG MDDAFK+I+ + GLTTES YPY   D G+C   + S  AA I GYE
Sbjct  180   CDVHGEDQGCEGGLMDDAFKFIVNNGGLTTESNYPYTAAD-GKCKGGSGS-AAATIKGYE  237

Query  490   DVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGER  311
             DVP N EAAL++A A QPVSVA+D   +  QFY+GGV +  CGT+L+HG+  +GYGT   
Sbjct  238   DVPANDEAALMKAVASQPVSVAVDGGDMTFQFYSGGVMSGSCGTDLDHGIVAIGYGTAGD  297

Query  310   GIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             G KYWLLKNSWG  WGE+G+ R+++DI  K G CG+A++PSYPT
Sbjct  298   GTKYWLLKNSWGTTWGENGFLRMEKDISDKRGMCGLAMEPSYPT  341



>ref|XP_004297571.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score =   365 bits (938),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 184/313 (59%), Positives = 232/313 (74%), Gaps = 5/313 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M  R+E WMARYGRVY D  EK KRF IFK NV  +ES N    +PY L +N+FADL
Sbjct  33    DASMYGRYEQWMARYGRVYNDINEKEKRFQIFKANVAIVESSNNDASKPYKLSVNQFADL  92

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF++++N +K         ++  F+YENVT +P+ VDWR++GAVTPVK+QG CGCCW
Sbjct  93    TNEEFITSRNRFK---GHECSTKTTSFKYENVT-VPATVDWRQKGAVTPVKDQGQCGCCW  148

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA+EGI +++ G+L+SLSEQELVDCD  G D GC GG MD+AF +I +++GL+TE
Sbjct  149   AFSAVAAMEGITQLTTGKLISLSEQELVDCDVNGEDQGCEGGLMDNAFDFINQNHGLSTE  208

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D G CN    +  AA I G+EDVP NSE+ALL+A A+QP+SVAIDA G   Q
Sbjct  209   ANYPYTGVD-GTCNAQKEASHAASITGHEDVPANSESALLKAVANQPISVAIDASGSDFQ  267

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
              Y+ GVFT  CGT L+HGVT VGYG  + G +YWL+KNSWG +WGE+GY R+QRD+ A E
Sbjct  268   LYSSGVFTGTCGTSLDHGVTAVGYGVSDDGTQYWLVKNSWGAQWGEEGYIRMQRDVTAPE  327

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYPT
Sbjct  328   GLCGIAMAASYPT  340



>ref|XP_008223851.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=342

 Score =   365 bits (938),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 188/313 (60%), Positives = 232/313 (74%), Gaps = 5/313 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M  ++E WMARY RVY D  EK  RF IFKENV  IES N   ++PY L +N+FADL
Sbjct  34    DASMYGKYEQWMARYERVYMDIQEKEMRFKIFKENVAFIESSNGNTNKPYKLSVNQFADL  93

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF +++NG+   +      ++  F+YENVT  P  VDWR +GAVTP+K+QG CGCCW
Sbjct  94    TNEEFKASRNGF---LGHECSTKTTTFKYENVT-APPTVDWRTKGAVTPIKDQGQCGCCW  149

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA+EGI K++ G L+SLSEQELVDCD  G D GC GG MDDAF++I +++GL+TE
Sbjct  150   AFSAVAAMEGITKLTTGNLISLSEQELVDCDTKGVDQGCEGGLMDDAFQFINQNHGLSTE  209

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D G CN    +  AAKI G+EDVP NSEAALL+A A+QP+SVAIDA G   Q
Sbjct  210   TNYPYTGVD-GTCNTKKEASHAAKITGHEDVPANSEAALLKAVANQPISVAIDAGGSDFQ  268

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY+ GVFT  CGT L+HGVT VGYG  + G KYWL+KNSWG +WGE GY R+QR ++AKE
Sbjct  269   FYSSGVFTGACGTSLDHGVTAVGYGVSDDGTKYWLVKNSWGTEWGEKGYIRMQRGVEAKE  328

Query  217   GRCGIALDPSYPT  179
             G CGIA++ SYPT
Sbjct  329   GLCGIAMEASYPT  341



>ref|XP_011008467.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=305

 Score =   364 bits (934),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 183/310 (59%), Positives = 219/310 (71%), Gaps = 6/310 (2%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M KRH +WMA+YGRVY D  EK KR+ IFKEN++ IE+FN   DR Y LG+N+FADLTN+
Sbjct  1     MLKRHGEWMAQYGRVYGDMKEKDKRYLIFKENIERIEAFNNGSDRGYKLGVNKFADLTNE  60

Query  928   EFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFS  749
             EF +  +GYKR  S      S  FRYEN++DIP+++DWR   AVTPVK+QG CGCCWAFS
Sbjct  61    EFRAMYHGYKRQSSK---LMSSSFRYENLSDIPTSMDWRNAEAVTPVKDQGRCGCCWAFS  117

Query  748   AVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGY  569
              VAA+EGI+K+  G+L+SLSEQ+LVDCD G          MD+AF+YII++ GL +E  Y
Sbjct  118   TVAAIEGIIKLKTGKLISLSEQQLVDCDVGNNGCHGGF--MDNAFQYIIRNGGLASEDNY  175

Query  568   PYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYA  389
             PY G D G CN   AS   A+I GYEDVP N+E ALLQA A QPVSV +D  G   QFY 
Sbjct  176   PYQGVD-GTCNSEKASSIEAEITGYEDVPQNNENALLQAVAKQPVSVVVDGGGQDFQFYK  234

Query  388   GGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRC  209
              GVF   CGTE NH VT +GYGT   G  YWL+KNSWG  WGE GY R+QR I A EG C
Sbjct  235   SGVFKGDCGTEQNHAVTAIGYGTDSDGTDYWLVKNSWGTSWGESGYMRMQRGIGASEGLC  294

Query  208   GIALDPSYPT  179
             G+A+D SYPT
Sbjct  295   GVAMDASYPT  304



>ref|XP_008348586.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=344

 Score =   365 bits (937),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 187/314 (60%), Positives = 226/314 (72%), Gaps = 5/314 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  +  R+E W+ RYGRVY D  EK  RF IFKENV  IES N   ++PY L +N+FADL
Sbjct  34    DASIYGRYEQWLTRYGRVYNDVNEKETRFKIFKENVAFIESSNXDANKPYKLSVNQFADL  93

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVT-DIPSAVDWRKEGAVTPVKNQGVCGCC  761
             TN+EF  ++NG+K         ++  F+YENVT  +P+ +DWRK+GAVTPVK+QG CGCC
Sbjct  94    TNEEFKVSRNGFKGHECST---KTTSFKYENVTASLPATMDWRKKGAVTPVKDQGQCGCC  150

Query  760   WAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTT  581
             WAFSAVAA EGI +++ G L+SLSEQELVDCD    D GC GG MDDAF++I +++G+ T
Sbjct  151   WAFSAVAATEGITQLTTGTLISLSEQELVDCDTASEDQGCEGGLMDDAFQFIQQNHGIGT  210

Query  580   ESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQL  401
             E+ YPY G D G CN    +  AAKI G+EDVP NSE  LL A AHQPVSVAIDA G   
Sbjct  211   EANYPYEGVD-GTCNSKKEASHAAKITGFEDVPANSEKDLLAAVAHQPVSVAIDASGSDF  269

Query  400   QFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAK  221
             QFY+ GVFT  CGT L+HGVT VGYG  E G KYWL+KNSWG +WGE GY R+QRD+ A 
Sbjct  270   QFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWGAEWGEAGYIRMQRDVAAA  329

Query  220   EGRCGIALDPSYPT  179
             EG CGIA+  SYPT
Sbjct  330   EGLCGIAMAASYPT  343



>ref|XP_004306851.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   365 bits (936),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 185/313 (59%), Positives = 236/313 (75%), Gaps = 5/313 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D +   R+E WMARYGRVY D TEK +RF IFK N   IES N  G++PY LG+N+FADL
Sbjct  32    DALAYGRYEQWMARYGRVYNDATEKEERFKIFKANEAFIESSNNEGNKPYKLGLNQFADL  91

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF++++N   R +      +S  F+YEN T +P+ +DWR++GAVTPVK+QG CGCCW
Sbjct  92    TNEEFIASRN---RFLGHECSTKSTTFKYENST-VPATIDWRQKGAVTPVKDQGQCGCCW  147

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA+EGI +++ G+L+SLSEQELVDCD  G D GC GG MD+AF++I +++GL+TE
Sbjct  148   AFSAVAAMEGITQLTTGKLISLSEQELVDCDVNGEDQGCEGGLMDNAFEFINQNHGLSTE  207

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D G CN    +  AA I G+EDVP N E+AL +A A+QP+SVAIDA G   Q
Sbjct  208   ANYPYTGVD-GTCNAKKEANHAASITGHEDVPPNDESALQKAVANQPISVAIDASGSGFQ  266

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY+ GVFT  CGT L+HGVT VGYG  + G K+WL+KNSWG +WGE+GY R+QRDI A E
Sbjct  267   FYSSGVFTGPCGTSLDHGVTAVGYGVSDDGTKFWLVKNSWGAQWGEEGYIRMQRDIPAPE  326

Query  217   GRCGIALDPSYPT  179
             G CGIA++PSYPT
Sbjct  327   GLCGIAMEPSYPT  339



>gb|KHN07750.1| KDEL-tailed cysteine endopeptidase CEP1 [Glycine soja]
Length=309

 Score =   363 bits (932),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 189/310 (61%), Positives = 231/310 (75%), Gaps = 2/310 (1%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M +RHE WMARY +VY D  E+ KRF IFKENV  IE+FN A ++ Y L IN+FADLTN+
Sbjct  1     MYERHEQWMARYAKVYKDPQEREKRFRIFKENVNYIETFNSADNKSYKLDINQFADLTNE  60

Query  928   EFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFS  749
             EF++ +N +K  +      R+  F+YENVT IPS VDWR++GAVTP+K+QG CGCCWAFS
Sbjct  61    EFIAPRNRFKGHMCSSIT-RTTTFKYENVTAIPSTVDWRQKGAVTPIKDQGQCGCCWAFS  119

Query  748   AVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGY  569
             AVAA EGI  ++ G+L+SLSEQE+VDCD  G D GC GG MD AFK+II+++GL TE  Y
Sbjct  120   AVAATEGIHALNAGKLISLSEQEVVDCDTKGQDQGCAGGFMDGAFKFIIQNHGLNTEPNY  179

Query  568   PYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYA  389
             PY   D G+CN   A+  AA I GYEDVP+N+E AL +A A+QPVSVAIDA G   QFY 
Sbjct  180   PYKAAD-GKCNAKAAANHAATITGYEDVPVNNEKALQKAVANQPVSVAIDASGSDFQFYK  238

Query  388   GGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRC  209
              GVFT  CGTEL+HGVT VGYG    G +YWL+KNSWG +WGE+GY R+QR + AKEG C
Sbjct  239   SGVFTGSCGTELDHGVTAVGYGVSADGTEYWLVKNSWGTEWGEEGYIRMQRGVKAKEGLC  298

Query  208   GIALDPSYPT  179
             GIA+  SYPT
Sbjct  299   GIAMMASYPT  308



>ref|XP_008362421.1| PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-like [Malus domestica]
Length=344

 Score =   364 bits (934),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 188/314 (60%), Positives = 227/314 (72%), Gaps = 5/314 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M  R+E W+A YGRV+ D  EK  RF IFKENV  IE  N+   +PY L +N+FADL
Sbjct  34    DASMYGRYEQWLALYGRVHNDINEKETRFKIFKENVAFIEFSNKDAHKPYKLSVNQFADL  93

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVT-DIPSAVDWRKEGAVTPVKNQGVCGCC  761
             TN+EF +T+NG+K         ++  F+YENVT  +P+ +DWRK+GAVTPVK+ G CGCC
Sbjct  94    TNEEFKATRNGFKGHECST---KASSFKYENVTVPLPATMDWRKKGAVTPVKDXGQCGCC  150

Query  760   WAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTT  581
             WAFSAVAA EGI +++ G L+SLSEQELVDCD  G D GC GG MDDAF++I +++G++T
Sbjct  151   WAFSAVAATEGITQLTTGNLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNHGIST  210

Query  580   ESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQL  401
             E  YPY G D G CN    +  AAKI G+EDVP NSE ALL A AHQPVSVAIDA G   
Sbjct  211   EXNYPYNGVD-GTCNTKKEAIIAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDF  269

Query  400   QFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAK  221
             QFY+ GVFT  CGT L+HGVT VGYG  E G KYWL+KNSWG +WGE GY R+QRD+ A 
Sbjct  270   QFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWGAEWGEAGYIRMQRDVAAA  329

Query  220   EGRCGIALDPSYPT  179
             EG CGIA+  SYPT
Sbjct  330   EGLCGIAMSASYPT  343



>ref|XP_009359957.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=342

 Score =   364 bits (934),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 186/313 (59%), Positives = 233/313 (74%), Gaps = 5/313 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M  ++E WMARYGRVY    EK KRF+IFKENV  IES N+  ++ Y L +N+FADL
Sbjct  34    DASMYGKYEQWMARYGRVYTGINEKEKRFNIFKENVAFIESSNKDANKLYKLSVNQFADL  93

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN++F +++NG+   +          F+YENVT  P  VDWRK+GAVTP+K+QG CGCCW
Sbjct  94    TNEQFKASRNGF---MGHECSAAKTSFKYENVT-APPTVDWRKKGAVTPIKDQGQCGCCW  149

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA+EGI K++ G+L+SLSEQELVDCD  G D GC GG MDDAF++I +++GL+TE
Sbjct  150   AFSAVAAMEGITKLTTGKLISLSEQELVDCDTSGVDQGCQGGLMDDAFQFINQNHGLSTE  209

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D G CN    +  AAKI G+EDVP N E AL++A A+QP+SVAIDA G   Q
Sbjct  210   ANYPYTGVD-GTCNTKKEANHAAKITGHEDVPANREDALMKAVANQPISVAIDASGSDFQ  268

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY+ GVFT  CGT L+HGVT VGYG  + G KYWL+KNSWG +WGE+GY R+QR I+AKE
Sbjct  269   FYSSGVFTGTCGTSLDHGVTAVGYGVSDDGTKYWLVKNSWGTEWGEEGYIRMQRGIEAKE  328

Query  217   GRCGIALDPSYPT  179
             G CGIA++ SYPT
Sbjct  329   GLCGIAMEASYPT  341



>ref|XP_009357171.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   363 bits (932),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 185/314 (59%), Positives = 228/314 (73%), Gaps = 5/314 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  +  R+E W+ RYGRVY D  EK  RF IFKENV  IES N+  ++P  L +N+FADL
Sbjct  34    DASIYGRYEQWLTRYGRVYNDVNEKETRFKIFKENVAFIESSNKDANKPCRLSVNQFADL  93

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVT-DIPSAVDWRKEGAVTPVKNQGVCGCC  761
             TN+EF +++NG+K         ++  F+YENVT  +P+ +DWRK+GAVTPVK+QG CGCC
Sbjct  94    TNEEFKASRNGFKGHECST---KTSSFKYENVTASLPATMDWRKKGAVTPVKDQGQCGCC  150

Query  760   WAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTT  581
             WAFSAVAA EGI +++ G L+SLSEQELVDCD    D GC GG MDDAF++I +++G++T
Sbjct  151   WAFSAVAATEGITQLTTGTLISLSEQELVDCDTASEDQGCEGGLMDDAFQFIQQNHGIST  210

Query  580   ESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQL  401
             E+ YPY G D G CN    +  AAKI G+EDVP NSE  LL A AHQPVSVAIDA G   
Sbjct  211   EANYPYEGVD-GTCNAKKEASHAAKITGFEDVPANSEKDLLAAVAHQPVSVAIDASGSDF  269

Query  400   QFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAK  221
             QFY+ GVF+  CGT L+HGVT VGYG  E G KYWL+KNSWG +WGE GY R+QRD+ A 
Sbjct  270   QFYSSGVFSGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWGAEWGEAGYIRMQRDVAAA  329

Query  220   EGRCGIALDPSYPT  179
             EG CGIA+  SYPT
Sbjct  330   EGLCGIAMAASYPT  343



>ref|XP_009365508.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=542

 Score =   370 bits (950),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 185/313 (59%), Positives = 233/313 (74%), Gaps = 5/313 (2%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M  ++E WMARYGRVY D  EK KRF+IFK NV  IES N   ++PY L +N+FADL
Sbjct  234   DASMYGKYEQWMARYGRVYTDINEKEKRFNIFKANVDFIESSNNDANKPYKLKVNQFADL  293

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF +++N   R +      ++  F+YENVT  P+ VDWRK+GAVTP+K+QG CGCCW
Sbjct  294   TNEEFKTSRN---RFMGHECSTKTTSFKYENVT-APATVDWRKKGAVTPIKDQGQCGCCW  349

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA++GI K++ G+L+SLSEQELVDCD    D GC GG MDDAF++I +++GL+TE
Sbjct  350   AFSAVAAMKGITKLTTGKLISLSEQELVDCDTSSVDQGCEGGLMDDAFQFITQNHGLSTE  409

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G D G CN    +  AA I G+EDVP NSEAALL+A A+QP+SV IDA G   Q
Sbjct  410   TNYPYTGVD-GTCNTKNEASHAATITGHEDVPANSEAALLKAVANQPISVVIDAGGSDFQ  468

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY+ GVFT  CGT L+HGVT VG+G    G KYWL+KNSWG +WGE+GY R+QRD++ KE
Sbjct  469   FYSSGVFTGTCGTSLDHGVTAVGFGVSADGTKYWLVKNSWGAEWGEEGYIRMQRDVEVKE  528

Query  217   GRCGIALDPSYPT  179
             G CGIA++ SYPT
Sbjct  529   GLCGIAMEASYPT  541



>gb|ADP02218.1| Peptidase_C1 domain-containing protein [Triticum aestivum]
 gb|EMT08021.1| Vignain [Aegilops tauschii]
Length=341

 Score =   362 bits (930),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 189/339 (56%), Positives = 237/339 (70%), Gaps = 8/339 (2%)
 Frame = -1

Query  1186  VFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVK  1007
             +  AI+ C    + ++    E  D  M +RHE WMA++ RVY D TEKA+RF +FK NV 
Sbjct  7     LLLAIVGCICLCSSAVLSARELGDTAMVERHEQWMAKFNRVYKDGTEKAQRFEVFKANVA  66

Query  1006  AIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSP-RNPWRSMPFRYENVT--D  836
              IESFN A +R + LG+N+F DLTNDEF +TK      +S  R P     F+Y NV+   
Sbjct  67    FIESFN-AENRKFWLGVNQFTDLTNDEFRATKTNKGLKMSGGRAP---TGFKYSNVSIDA  122

Query  835   IPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgg  656
             +P+AVDWR +G VTP+K+QG CGCCWAFSAV A EGIVK+S G+L+SLSEQELVDCD  G
Sbjct  123   LPTAVDWRTKGVVTPIKDQGQCGCCWAFSAVVATEGIVKLSTGKLISLSEQELVDCDVHG  182

Query  655   gdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMN  476
              D GC GG MDDAFK+IIK+ GLTTE+ YPY  QD G+C  + AS   A I GYEDVP N
Sbjct  183   VDQGCEGGEMDDAFKFIIKNGGLTTEANYPYTAQD-GQCKTSIASNSVATIKGYEDVPAN  241

Query  475   SEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYW  296
              E++L++A A+QPVSVA+D   +  Q Y+GGV T  CGT+L+HG+  +GYG    G KYW
Sbjct  242   DESSLMKAVANQPVSVAVDGGDVIFQHYSGGVMTGSCGTDLDHGIAAIGYGMTSDGTKYW  301

Query  295   LLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             LLKNSWG  WGE GY R+++DI  K G CG+A+ PSYPT
Sbjct  302   LLKNSWGTTWGESGYLRMEKDISDKSGMCGLAMQPSYPT  340



>gb|EMT08019.1| Vignain [Aegilops tauschii]
Length=309

 Score =   361 bits (927),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 188/314 (60%), Positives = 229/314 (73%), Gaps = 10/314 (3%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M +RHE WMA++ RVY D TEKA+RF +FK NV  IESFN AG+  + LG+N+F DLTND
Sbjct  1     MVERHEQWMAKFNRVYKDGTEKAQRFEVFKANVAFIESFN-AGNHKFWLGVNQFTDLTND  59

Query  928   EFVSTKN--GYKRPVSPRNPWRSMPFRYENVTD--IPSAVDWRKEGAVTPVKNQGVCGCC  761
             EF +TK   G KR  S         F+Y NV+   +P+AVDWR +GAVTP+K+QG CGCC
Sbjct  60    EFKATKTNKGLKRSGSQA----PTGFKYNNVSTDALPAAVDWRTKGAVTPIKDQGQCGCC  115

Query  760   WAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTT  581
             WAFSAVAA EGIVK+S G+LVSLSEQELVDCD  G D GC GG MDDAFK+IIK+ GLTT
Sbjct  116   WAFSAVAATEGIVKLSTGKLVSLSEQELVDCDIHGVDQGCEGGEMDDAFKFIIKNGGLTT  175

Query  580   ESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQL  401
             E+ YPY  QD G+C  + AS   A I GYEDVP N E++L++A A+QPVSVA+D   +  
Sbjct  176   EANYPYTAQD-GQCKTSIASNSVATIKGYEDVPANDESSLMKAVANQPVSVAVDGGDVIF  234

Query  400   QFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAK  221
             Q Y+GGV T  CGT+L+HG+  +GYG    G KYWLLKNSWG  WGE GY R+++DI  K
Sbjct  235   QHYSGGVMTGSCGTDLDHGIATIGYGMTSDGTKYWLLKNSWGTTWGESGYLRMEKDISDK  294

Query  220   EGRCGIALDPSYPT  179
              G CG+A+ PSYPT
Sbjct  295   SGMCGLAMQPSYPT  308



>gb|KDP40484.1| hypothetical protein JCGZ_24483 [Jatropha curcas]
Length=339

 Score =   362 bits (929),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 187/311 (60%), Positives = 230/311 (74%), Gaps = 6/311 (2%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M ++HE WM RYGRVY D+ EK  R+ IFKENV+ I+SFN    R Y LG+N+FADLTN+
Sbjct  35    MYRKHEQWMTRYGRVYKDDNEKEMRYKIFKENVERIDSFNSDTRRSYRLGVNQFADLTNE  94

Query  928   EFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFS  749
             EF + +N +K  +      ++ PFRY+NVT +P+ +DWRK+GAVTP+K+QG CG CWAFS
Sbjct  95    EFNTARNRFKGHMCSA---QAGPFRYQNVTAVPATMDWRKKGAVTPIKDQGQCGSCWAFS  151

Query  748   AVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGY  569
             AVAAVEGI +I  G+L++LSEQELVDCD  G D GC GG MDDAFK+I KH GL +E+ Y
Sbjct  152   AVAAVEGIAQIKTGKLIALSEQELVDCDNNGEDQGCQGGLMDDAFKFIEKH-GLASEATY  210

Query  568   PYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYA  389
             PY   +   CN    +  A KI GYEDVP N EAALL A A+QPVSVAIDA G + QFY+
Sbjct  211   PYHAAE-SACNTKEEAKPAVKITGYEDVPANDEAALLNAVANQPVSVAIDASGFEFQFYS  269

Query  388   GGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRC  209
              G+FT  CGTEL+HGV  VGYG  + G K+WL+KNSWG +WGE GY R+QRDI AKEG C
Sbjct  270   SGIFTGSCGTELDHGVAAVGYGVND-GNKFWLVKNSWGTQWGEKGYIRMQRDIAAKEGLC  328

Query  208   GIALDPSYPTL  176
             GIA+  SYPT+
Sbjct  329   GIAMQASYPTM  339



>ref|XP_011014388.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=340

 Score =   362 bits (928),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 186/339 (55%), Positives = 227/339 (67%), Gaps = 6/339 (2%)
 Frame = -1

Query  1195  NLIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKE  1016
             N  +F   L   +  A  +     D+ + M KRH +WMA+YGRVY D  EK KR+ IFKE
Sbjct  7     NTHIFLPFLLILAAWATKIACRPLDEQEYMLKRHGEWMAQYGRVYGDMKEKDKRYLIFKE  66

Query  1015  NVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTD  836
             N++ IE+FN   DR Y LG+N+FADLTN+EF +  +GYKR  S      S  FRYEN++D
Sbjct  67    NIERIEAFNNGSDRGYKLGVNKFADLTNEEFRAMYHGYKRQSSK---LMSSSFRYENLSD  123

Query  835   IPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgg  656
             IP+++DWR   AVTPVK+QG CG CWAFSAVAA+EGI+K+  G+L+SLSEQ+LVDC+ G 
Sbjct  124   IPTSMDWRNAEAVTPVKDQGRCGSCWAFSAVAAIEGIIKLKTGKLISLSEQQLVDCNAGN  183

Query  655   gdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMN  476
                      MD AF+YII+  GLT+E  YPY G D G CN   A+   A+I GYEDVP N
Sbjct  184   KGCQGGF--MDTAFQYIIRKGGLTSEENYPYQGVD-GTCNSEKAASIEAEITGYEDVPQN  240

Query  475   SEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYW  296
             +E ALLQA A QPVSV ID  G   QFY  GVF   CG E NH VT +G+GT   G  YW
Sbjct  241   NENALLQAVAKQPVSVGIDGGGQDFQFYKSGVFKGDCGAEQNHAVTAIGFGTDSDGTDYW  300

Query  295   LLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             L+KNSWG  WGE GY R+QR I A EG CG+A+D SYPT
Sbjct  301   LVKNSWGTSWGESGYMRMQRGIGASEGLCGVAMDASYPT  339



>ref|XP_004975183.1| PREDICTED: vignain-like [Setaria italica]
Length=338

 Score =   362 bits (928),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 193/345 (56%), Positives = 240/345 (70%), Gaps = 11/345 (3%)
 Frame = -1

Query  1204  LIKNLIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSI  1025
             ++ +     AIL C    + S+    E  D  M +RHE WM  YGRVY D  EKA+RF +
Sbjct  1     MVSSKAFLLAILGCACLCS-SILAARELSDAAMVERHEKWMVEYGRVYKDTAEKAQRFEV  59

Query  1024  FKENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTK-NGYKRPVSPRNPWRSMPFRYE  848
             FK+NV  IESFN AG+  + L +N+FADLTNDEF +TK N   +P+S   P     F+YE
Sbjct  60    FKDNVAFIESFN-AGNTKFWLAVNQFADLTNDEFRATKANKGFKPISTSVP---TGFKYE  115

Query  847   N--VTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELV  674
             N  V  +P+ VDWR +GAVTP+KNQG CGCCWAFSAVAA+EGIVK+S G L+SLSEQELV
Sbjct  116   NLSVNALPTTVDWRTKGAVTPIKNQGQCGCCWAFSAVAAMEGIVKLSTGSLISLSEQELV  175

Query  673   dcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGY  494
             DCD    D GC GG MD AF+++IK+ GLTTES YPY   D G+C   + S  AA I G+
Sbjct  176   DCDTHSMDEGCEGGWMDSAFEFVIKNGGLTTESNYPYKAVD-GKCKGGSKS--AATIKGH  232

Query  493   EDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGE  314
             EDVP+N+EAAL++A A+QPVSVA+DA      FY+GGV T  CGTEL+HG+  +GYG   
Sbjct  233   EDVPVNNEAALMKAVANQPVSVAVDAGDRTFMFYSGGVMTGTCGTELDHGIAAIGYGVES  292

Query  313   RGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
              G KYWLLKNSWG  WGE G+ R+++DI  K G CG+A+ PSYPT
Sbjct  293   DGTKYWLLKNSWGTTWGEKGFLRMEKDISDKRGMCGLAMKPSYPT  337



>ref|XP_009349242.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=484

 Score =   367 bits (941),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 193/337 (57%), Positives = 239/337 (71%), Gaps = 9/337 (3%)
 Frame = -1

Query  1189  IVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENV  1010
             + F  IL   S  A S        D  M  ++E WMARYGR YA+  EK K F+IFKENV
Sbjct  156   LAFIFILGALSSQATS----RTLQDASMYAKYEQWMARYGRAYAEINEKEKHFNIFKENV  211

Query  1009  KAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIP  830
               IES N   ++ Y L +N+FADLTN+EF +++NG+   +      ++  F+YENVT  P
Sbjct  212   AFIESSNNDANKLYKLSVNQFADLTNEEFKASRNGF---MGHECSTKTTAFKYENVT-AP  267

Query  829   SAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggd  650
               VDWR +GAVTP+K+QG CGCCWAFSAVAA+EGI K++ G+L+SLSEQELVDCD  G D
Sbjct  268   PTVDWRNKGAVTPIKDQGQCGCCWAFSAVAAMEGITKLTTGKLISLSEQELVDCDTSGVD  327

Query  649   lgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSE  470
              GC GG MDDAF++I K++GL+TE+ YPY G D G CN    +  AA+I GYEDVP NSE
Sbjct  328   QGCGGGLMDDAFQFINKNHGLSTETNYPYTGVD-GTCNTKKEASHAAQITGYEDVPANSE  386

Query  469   AALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLL  290
              ALL+A A+QP+SVAIDA G   QFY+ GVFT  CGT L+HGVT VGYG    G KYWL+
Sbjct  387   EALLKAVANQPISVAIDAGGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGISADGTKYWLV  446

Query  289   KNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             KNSWG +WGE+GY R+QR + AKEG CGIA++ SYPT
Sbjct  447   KNSWGTQWGEEGYIRMQRGVKAKEGLCGIAMEASYPT  483



>ref|XP_008225269.1| PREDICTED: uncharacterized protein LOC103324934 [Prunus mume]
Length=768

 Score =   375 bits (964),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 189/315 (60%), Positives = 235/315 (75%), Gaps = 4/315 (1%)
 Frame = -1

Query  1123  DDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFA  944
             D    M  RH+ WMARY  +Y D+ E+ KRF IFK+NV+ IESFN A ++PY L IN FA
Sbjct  457   DAHTSMLDRHKQWMARYVHIYKDDEEREKRFQIFKDNVEFIESFNYASNQPYKLNINGFA  516

Query  943   DLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGC  764
             D +++EF +++N Y+  ++P +     PFRYENVT IPS++DWRK+GAVTP+K+QG CGC
Sbjct  517   DQSHEEFQASRNRYRTSLNPMS--SKTPFRYENVTAIPSSMDWRKKGAVTPIKDQGECGC  574

Query  763   CWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLT  584
             CWAFSAVAA EG  K+  G+LVSLSEQELVDCD  G + GC GG MDDAFK+++++ GL 
Sbjct  575   CWAFSAVAATEGTTKLKSGKLVSLSEQELVDCDTQGENRGCEGGLMDDAFKFVMRNKGLA  634

Query  583   TESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQ  404
              E+ YPY G D G CN    ++ AAKI GYEDVP N E ALL+A A+QPVSVAIDA G +
Sbjct  635   AEASYPYRGVD-GICNKNKVAYHAAKITGYEDVPAN-ELALLKAVANQPVSVAIDAGGYE  692

Query  403   LQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDA  224
              QFY+ G+ T  CGT LNHGVTVVGYGTG  G KYWL+KNSWG +WGE GY R+QRD+  
Sbjct  693   FQFYSRGILTGDCGTHLNHGVTVVGYGTGADGTKYWLVKNSWGAEWGEGGYVRIQRDVHT  752

Query  223   KEGRCGIALDPSYPT  179
             ++G CGIA+  SYPT
Sbjct  753   RQGLCGIAIKASYPT  767



>gb|EMT20796.1| Vignain [Aegilops tauschii]
Length=394

 Score =   363 bits (932),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 198/356 (56%), Positives = 241/356 (68%), Gaps = 14/356 (4%)
 Frame = -1

Query  1234  LQQETKMVSRLIKNLIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYAD  1055
             + Q  K    + K LI+  +IL C    +  +     +DD  M  RHE WM +Y RVY D
Sbjct  48    VAQSIKHTMAISKALIL--SILGCLCFCSSVLAARELNDDLSMVARHERWMVQYNRVYKD  105

Query  1054  ETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTK--NGYKRPVSPR  881
              TEKA RF +FK NV  IESFN A +R + LGIN+F DLTN+EF +TK   GY RP   R
Sbjct  106   TTEKAHRFEVFKANVGFIESFN-AENRKFYLGINQFTDLTNEEFKATKANKGY-RPSLER  163

Query  880   NPWRSMPFRYENVT--DIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGG  707
              P     FRYENV+   +P  +DWR +GAVTP+K+QG CGCCWAFSAVAA EGIVK+  G
Sbjct  164   VP---TGFRYENVSLDALPETIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKLKTG  220

Query  706   ELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTT  527
             +L+SLSEQELVDCD  G D GC GG MDDAFK+IIK+ GLTTES YPY   D  +C   +
Sbjct  221   KLISLSEQELVDCDVHGEDQGCEGGLMDDAFKFIIKNGGLTTESNYPYTAAD-DKCK--S  277

Query  526   ASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNH  347
              +  AA I  YEDVP N+E AL+QA A QPVSVA+D   +  QFY GGV T  CGT+L+H
Sbjct  278   GTNDAATIKSYEDVPANNEGALMQAVASQPVSVAVDGGDMTFQFYKGGVMTGSCGTDLDH  337

Query  346   GVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             G+  +GYG    G KYWLLKNSWG  WGE+GY R+++DI  K G CG+A++PSYPT
Sbjct  338   GIAAIGYGKTSDGTKYWLLKNSWGTTWGENGYLRMEKDITDKRGMCGLAMEPSYPT  393



>ref|XP_002525124.1| cysteine protease, putative [Ricinus communis]
 gb|EEF37251.1| cysteine protease, putative [Ricinus communis]
Length=342

 Score =   361 bits (926),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 187/338 (55%), Positives = 241/338 (71%), Gaps = 7/338 (2%)
 Frame = -1

Query  1192  LIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKEN  1013
             LI    +LA  +  A +     E  +  M +RHE WMA++G+VY D+ EK +RF IFK N
Sbjct  11    LIALFFVLAMWADQAST----RELHESTMVERHEKWMAKHGKVYKDDEEKLRRFQIFKNN  66

Query  1012  VKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDI  833
             V+ IES N AG+  Y LGIN FADLTN+EF ++ NGYKRP+         PF+YENVT +
Sbjct  67    VEFIESSNAAGNNSYMLGINRFADLTNEEFRASWNGYKRPLDASRI--VTPFKYENVTAL  124

Query  832   PSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkggg  653
             P ++DWR++GAVT +K+Q  CG CWAFSAVAA EG+ K+  G+LVSLSEQELVDCD  G 
Sbjct  125   PYSMDWRRKGAVTSIKDQRECGSCWAFSAVAATEGVHKLRTGKLVSLSEQELVDCDVKGE  184

Query  652   dlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNS  473
             D GC GG M+DAFK+I ++ G+TTE+ Y Y G+D G+C+    +   AKI GY+ VP NS
Sbjct  185   DKGCQGGLMEDAFKFIKRNGGITTEANYAYRGRD-GKCDTKKEASHVAKITGYQVVPENS  243

Query  472   EAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWL  293
             EAALL+A AHQPVSV+IDA  +  QFY  G++   CG++LNHGV  VGYGT   G KYW+
Sbjct  244   EAALLKAVAHQPVSVSIDAGSMSFQFYQSGIYAGSCGSDLNHGVAAVGYGTSSSGSKYWI  303

Query  292   LKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             +KNSWG +WGE GY R++RDI +++G CGIA+D SYPT
Sbjct  304   VKNSWGPEWGERGYVRMKRDITSRKGLCGIAMDCSYPT  341



>ref|XP_003527388.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   361 bits (926),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 188/313 (60%), Positives = 232/313 (74%), Gaps = 2/313 (1%)
 Frame = -1

Query  1117  DDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADL  938
             D  M +RH  WMARY +VY D  E+ KRF IFKENV  IE+FN A ++ Y L IN+FADL
Sbjct  32    DASMYERHAQWMARYAKVYKDPQEREKRFRIFKENVNYIETFNSADNKSYKLDINQFADL  91

Query  937   TNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             TN+EF++ +N +K  +   +  R+  F+YENVT IPS VDWR++GAVTP+K+QG CGCCW
Sbjct  92    TNEEFIAPRNRFKGHMCS-SITRTTTFKYENVTVIPSTVDWRQKGAVTPIKDQGQCGCCW  150

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA EGI  ++ G+L+SLSEQE+VDCD  G D GC GG MD AFK+II+++GL TE
Sbjct  151   AFSAVAATEGIHALNAGKLISLSEQEVVDCDTKGQDQGCAGGFMDGAFKFIIQNHGLNTE  210

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
               YPY   D G+CN   A+  AA I GYEDVP+N+E AL +A A+QPVSVAIDA G   Q
Sbjct  211   PNYPYKAAD-GKCNAKAAANHAATITGYEDVPVNNEKALQKAVANQPVSVAIDASGSDFQ  269

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY  GVFT  CGTEL+HGVT VGYG    G +YWL+KNSWG +WGE+GY R+QR + A+E
Sbjct  270   FYKSGVFTGSCGTELDHGVTAVGYGVSADGTEYWLVKNSWGTEWGEEGYIRMQRGVKAEE  329

Query  217   GRCGIALDPSYPT  179
             G CGIA+  SYPT
Sbjct  330   GLCGIAMMASYPT  342



>ref|XP_003540013.1| PREDICTED: vignain-like [Glycine max]
 ref|XP_003540014.1| PREDICTED: vignain-like [Glycine max]
 gb|KHN27798.1| Vignain [Glycine soja]
 gb|KHN27800.1| Vignain [Glycine soja]
Length=337

 Score =   360 bits (924),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 181/340 (53%), Positives = 235/340 (69%), Gaps = 11/340 (3%)
 Frame = -1

Query  1198  KNLIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFK  1019
             ++++    +L+ C+    S + L+E     M +RHE WM +YG+VY D  EK KR  IFK
Sbjct  8     QHILALVLLLSICTSQVMS-RNLHEAS---MSERHEQWMKKYGKVYKDAAEKQKRLLIFK  63

Query  1018  ENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVT  839
             +NV+ IESFN AG+RPY L IN  AD TN+EFV++ NGYK     +      PF+YENVT
Sbjct  64    DNVEFIESFNAAGNRPYKLSINHLADQTNEEFVASHNGYKH----KGSHSQTPFKYENVT  119

Query  838   DIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkg  659
              +P+AVDWR+ GAVT VK+QG CG CWAFS VAA EGI +I+   L+SLSEQELVDCD  
Sbjct  120   GVPNAVDWRENGAVTAVKDQGQCGSCWAFSTVAATEGIYQITTSMLMSLSEQELVDCDSV  179

Query  658   ggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPM  479
                       M+  F++IIK+ G+++E+ YPY   D G C+    +  AA+I GYE VP 
Sbjct  180   DHGCDGG--YMEGGFEFIIKNGGISSEANYPYTAVD-GTCDANKEASPAAQIKGYETVPA  236

Query  478   NSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKY  299
             NSE AL +A A+QPVSV IDA G   QFY+ GVFT +CGT+L+HGVT VGYG+ + G +Y
Sbjct  237   NSEDALQKAVANQPVSVTIDAGGSAFQFYSSGVFTGQCGTQLDHGVTAVGYGSTDDGTQY  296

Query  298   WLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             W++KNSWG +WGE+GY R+QR  DA+EG CGIA+D SYPT
Sbjct  297   WIVKNSWGTQWGEEGYIRMQRGTDAQEGLCGIAMDASYPT  336



>gb|EMS56453.1| KDEL-tailed cysteine endopeptidase CEP1 [Triticum urartu]
Length=339

 Score =   360 bits (924),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 190/335 (57%), Positives = 232/335 (69%), Gaps = 8/335 (2%)
 Frame = -1

Query  1177  AILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIE  998
             AIL C    + ++     + D  M  RHE WM  YGRVY D  EKA+RF IF+ N + IE
Sbjct  10    AILGCLCFCSSALGARELNGDLSMVARHEGWMTEYGRVYKDAAEKAQRFEIFQANARFIE  69

Query  997   SFNQAGDRPYTLGINEFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVT--DIPSA  824
             SFN AG+  + L IN+FADL+NDEF +TK    +   P        FRYEN++   +P+ 
Sbjct  70    SFN-AGNSKFWLSINQFADLSNDEFRATKT--NKGFIPNKVKVPTEFRYENMSFDALPAM  126

Query  823   VDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlg  644
             VDWR +GA+TP+KNQG CGCCWAFSAVAA EGIVK+S G LVSLSEQELVDCD  G D G
Sbjct  127   VDWRTKGAITPIKNQGQCGCCWAFSAVAATEGIVKLSTGNLVSLSEQELVDCDVHGEDQG  186

Query  643   chgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAA  464
             C GG MDDAFK+IIK+ GLT ES YPY G D  +C   + S   A I GYEDVP N E A
Sbjct  187   CEGGLMDDAFKFIIKNGGLTKESSYPYAGAD-DKCK--SGSNSVATIKGYEDVPTNDEGA  243

Query  463   LLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKN  284
             L++A A QPVSVA+D   +  QFY+GGV T  CGT+L+HG+  +GYGT   G KYWLLKN
Sbjct  244   LMKAVASQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDHGIAAIGYGTTSDGTKYWLLKN  303

Query  283   SWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             SWG  WGE+GY R+++DI  K+G CG+A++PSYPT
Sbjct  304   SWGTTWGENGYLRMEKDIADKKGMCGLAMEPSYPT  338



>dbj|BAF56429.1| cysteine proteinase [Lotus japonicus]
Length=341

 Score =   360 bits (924),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 193/318 (61%), Positives = 235/318 (74%), Gaps = 7/318 (2%)
 Frame = -1

Query  1132  LNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGIN  953
             L+E +  ++E RHE WMA+Y +VY D  EK KRF IFK+NV+ IESFN AG++PY LG+N
Sbjct  30    LHETETSLIE-RHEQWMAKYDKVYKDAAEKEKRFLIFKDNVEFIESFNAAGNKPYKLGVN  88

Query  952   EFADLTNDEFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGV  773
               ADLT +EF +++NG KR  S      +  F+YENVT IP++VDWRK+GAVTP+K+QG 
Sbjct  89    HLADLTIEEFKASRNGLKR--SYDYEVGTTSFKYENVTAIPASVDWRKKGAVTPIKDQGQ  146

Query  772   CGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHN  593
             CG CWAFS VAA EGI KIS G+LVSLSEQELVDCD+ G D GC GG M+D F++IIK+ 
Sbjct  147   CGSCWAFSTVAATEGIHKISTGKLVSLSEQELVDCDRKGTDQGCEGGYMEDGFEFIIKNG  206

Query  592   GLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDAR  413
             G+TTE+ YPY   D G C   TA   AA+I GYE VP+NSE ALL+A A+QPVSV+IDA 
Sbjct  207   GITTEANYPYKAVD-GSCKNATAP--AAQIKGYEKVPVNSEKALLKAVANQPVSVSIDAA  263

Query  412   GLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRD  233
                  FY+ G+FT  CGTEL+HGVT VGYG    G  YW++KNSWG  WGE GY R+QR 
Sbjct  264   DGSFMFYSSGIFTGECGTELDHGVTAVGYGRA-NGTDYWIVKNSWGTVWGEQGYIRMQRG  322

Query  232   IDAKEGRCGIALDPSYPT  179
             I AKEG CGIA+D SYPT
Sbjct  323   IAAKEGLCGIAMDSSYPT  340



>gb|EMT08022.1| Vignain [Aegilops tauschii]
Length=341

 Score =   360 bits (924),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 191/342 (56%), Positives = 237/342 (69%), Gaps = 14/342 (4%)
 Frame = -1

Query  1192  LIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSIFKEN  1013
             L +  +I  C S    ++    E  D  M ++HE WMA++ RVY D TEKA+RF  FK N
Sbjct  9     LAIIGSIYLCSS----TVLSARELGDAAMVEKHEQWMAKFNRVYKDSTEKAQRFKAFKAN  64

Query  1012  VKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKN--GYKRPVSPRNPWRSMPFRYENVT  839
             V  IESFN  G+  + LG+N+F DLTNDEF +TK   G KR    R P R   F+Y NV+
Sbjct  65    VAFIESFN-TGNHKFWLGVNQFTDLTNDEFRATKTNKGLKRN-GARAPTR---FKYNNVS  119

Query  838   D--IPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELVdcd  665
                +P+AVDWR +G VTP+K+QG CGCCWAFSAVAA EGIVK+S G+LVSLSEQELVDCD
Sbjct  120   TDALPAAVDWRTKGVVTPIKDQGQCGCCWAFSAVAATEGIVKLSTGKLVSLSEQELVDCD  179

Query  664   kgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGYEDV  485
               G D GC GG MDDAFK+IIK+ GLTTE+ YPY  QD G+C  +T S   A I GYEDV
Sbjct  180   VHGVDQGCEGGEMDDAFKFIIKNGGLTTEANYPYTAQD-GQCKTSTTSNSVATIKGYEDV  238

Query  484   PMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGERGI  305
             P N E++L++A A+QPVSVA+D   +  Q Y+GGV T  CGT+L+HG+  +GYG    G 
Sbjct  239   PANDESSLMKAVANQPVSVAVDGGDVIFQHYSGGVMTGSCGTDLDHGIVAIGYGMTSDGT  298

Query  304   KYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYPT  179
             K+WLLKNSW   WGE GY R+++DI  K G CG+A+ PSYPT
Sbjct  299   KFWLLKNSWSTTWGESGYLRMEKDISDKSGMCGLAMQPSYPT  340



>emb|CBI21976.3| unnamed protein product [Vitis vinifera]
Length=322

 Score =   359 bits (921),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 183/310 (59%), Positives = 225/310 (73%), Gaps = 23/310 (7%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M +RHEDWMA+YGRVY D  EK+KR+ IFK+NV  IESFN+A D+ Y L INEFADLTN+
Sbjct  35    MYERHEDWMAQYGRVYKDADEKSKRYKIFKDNVARIESFNKAMDKSYKLSINEFADLTNE  94

Query  928   EFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFS  749
             EF +++N +K  +       +  F+YENVT +PS +DWRK+GAVTP+K+QG CG CWAFS
Sbjct  95    EFGTSRNRFKAHICST---EATSFKYENVTAVPSTIDWRKKGAVTPIKDQGQCGSCWAFS  151

Query  748   AVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGY  569
             AVAA+EGI ++S G+L+SLSEQELVDCD  G D GC               NG    + Y
Sbjct  152   AVAAMEGITQLSTGKLISLSEQELVDCDTSGEDQGC---------------NG----ANY  192

Query  568   PYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYA  389
             PY G D G CN   A+  AAKI GYEDVP N+E AL +A  HQP++VAIDA G + QFY+
Sbjct  193   PYAGTD-GTCNRKKAAHPAAKINGYEDVPANNEKALQKAVVHQPIAVAIDAGGFEFQFYS  251

Query  388   GGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRC  209
              GVFT +CGTEL+HGV  VGYGT + G+KYWL+KNSWG  WGE+GY R+QRD+ AKEG C
Sbjct  252   SGVFTGQCGTELDHGVAAVGYGTSDDGMKYWLVKNSWGTGWGEEGYIRMQRDVTAKEGLC  311

Query  208   GIALDPSYPT  179
             GIA+  SYPT
Sbjct  312   GIAMQASYPT  321



>ref|XP_004975182.1| PREDICTED: vignain-like [Setaria italica]
Length=338

 Score =   359 bits (922),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 192/344 (56%), Positives = 239/344 (69%), Gaps = 11/344 (3%)
 Frame = -1

Query  1204  LIKNLIVFAAILACCSKAAKSMQGLNEDDDDVMEKRHEDWMARYGRVYADETEKAKRFSI  1025
             ++ +     AIL C    + S+    E  D  M +RHE WM  YGRVY D  EKA+RF +
Sbjct  1     MVSSKAFLLAILGCACLCS-SILAARELSDAAMVERHEKWMVEYGRVYKDTAEKAQRFEV  59

Query  1024  FKENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTK-NGYKRPVSPRNPWRSMPFRYE  848
             FK+NV  IESFN AG+  + L +N+FADLTNDEF +TK N   +P+S   P     F+YE
Sbjct  60    FKDNVAFIESFN-AGNTKFWLAVNQFADLTNDEFRATKANKGFKPISTSVP---TGFKYE  115

Query  847   N--VTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGIVKISGGELVSLSEQELV  674
             N  V  +P+ VDWR +GAVTP+KNQG CGCCWAFSAVAA+EGIVK+S G L+SLSEQELV
Sbjct  116   NLSVNALPTTVDWRTKGAVTPIKNQGQCGCCWAFSAVAAMEGIVKLSTGSLISLSEQELV  175

Query  673   dcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLGRCNLTTASFRAAKIAGY  494
             DCD    D GC GG MD AF+++IK+ GLTTES YPY   D G+C   + S  AA I G+
Sbjct  176   DCDTHSMDEGCEGGWMDSAFEFVIKNGGLTTESNYPYKAVD-GKCKGGSKS--AATIKGH  232

Query  493   EDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERCGTELNHGVTVVGYGTGE  314
             EDVP+N+EAAL++A A+QPVSVA+DA      FY+GGV T  CGTEL+HG+  +GYG   
Sbjct  233   EDVPVNNEAALMKAVANQPVSVAVDAGDRTFMFYSGGVMTGTCGTELDHGIAAIGYGVES  292

Query  313   RGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSYP  182
              G KYWLLKNSWG  WGE G+ R+++DI  K G CG+A+ PSYP
Sbjct  293   DGTKYWLLKNSWGTTWGEKGFLRMEKDISDKRGMCGLAMKPSYP  336



>gb|KHN27806.1| Vignain [Glycine soja]
Length=313

 Score =   358 bits (919),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 177/310 (57%), Positives = 222/310 (72%), Gaps = 7/310 (2%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M +RHE WM +YG+VY D  EK KR  IFK+NV+ IESFN AG++PY LGIN  AD TN+
Sbjct  10    MSERHEQWMKKYGKVYKDAAEKQKRLLIFKDNVEFIESFNAAGNKPYKLGINHLADQTNE  69

Query  928   EFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFS  749
             EFV++ NGYK   S        PF+YENVT +P+AVDWR+ GAVT VK+QG CG CWAFS
Sbjct  70    EFVASHNGYKHKASHSQ----TPFKYENVTGVPNAVDWRENGAVTAVKDQGQCGSCWAFS  125

Query  748   AVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGY  569
              VAA EGI +I+   L+SLSEQELVDCD            M+  F++IIK+ G+++E+ Y
Sbjct  126   TVAATEGIYQITTSMLMSLSEQELVDCDSVDHGCDGG--YMEGGFEFIIKNGGISSEANY  183

Query  568   PYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYA  389
             PY   D G C+    +  AA+I GYE VP NSE AL +A A+QPVSV IDA G   QFY+
Sbjct  184   PYTAVD-GTCDANKEASPAAQIKGYETVPANSEDALQKAVANQPVSVTIDAGGSAFQFYS  242

Query  388   GGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRC  209
              GVFT +CGT+L+HGVT VGYG+ + G +YW++KNSWG +WGE+GY R+QR  DA+EG C
Sbjct  243   SGVFTGQCGTQLDHGVTAVGYGSTDDGTQYWIVKNSWGTQWGEEGYIRMQRGTDAQEGLC  302

Query  208   GIALDPSYPT  179
             GIA+D SYPT
Sbjct  303   GIAMDASYPT  312



>gb|KHN07749.1| Vignain [Glycine soja]
Length=301

 Score =   358 bits (918),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 185/302 (61%), Positives = 229/302 (76%), Gaps = 2/302 (1%)
 Frame = -1

Query  1084  MARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTNDEFVSTKNG  905
             M RYG+VY D  E+ KRF +FKENV  IE+FN A ++ Y LGIN+FADLTN EF++ +NG
Sbjct  1     MTRYGKVYKDPQEREKRFRVFKENVNYIEAFNNAANKSYKLGINQFADLTNKEFIAPRNG  60

Query  904   YKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFSAVAAVEGI  725
             +K  +   +  R+  F++ENVT  PS VDWR++GAVTP+K+QG CGCCWAFSAVAA EGI
Sbjct  61    FKGHMCS-SIIRTTTFKFENVTATPSTVDWRQKGAVTPIKDQGQCGCCWAFSAVAATEGI  119

Query  724   VKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGYPYGGQDLG  545
               +S G+L+SLSEQELVDCD  G D GC GG MDDAFK+II+++GL TE+ YPY G D G
Sbjct  120   HALSAGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFIIQNHGLNTEANYPYKGVD-G  178

Query  544   RCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYAGGVFTERC  365
             +CN   A+  AA I GYEDVP N+E AL +A A+QPVSVAIDA G   QFY  GVFT  C
Sbjct  179   KCNANEAAKNAATITGYEDVPANNEMALQKAVANQPVSVAIDASGSDFQFYKSGVFTGSC  238

Query  364   GTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRCGIALDPSY  185
             GTEL+HGVT VGYG  + G +YWL+KNS G +WGE+GY R+QR +D++EG CGIA+  SY
Sbjct  239   GTELDHGVTAVGYGVSDDGTEYWLVKNSRGTEWGEEGYIRMQRGVDSEEGLCGIAMQASY  298

Query  184   PT  179
             PT
Sbjct  299   PT  300



>gb|KHN32068.1| Vignain [Glycine soja]
Length=309

 Score =   358 bits (918),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 185/310 (60%), Positives = 232/310 (75%), Gaps = 2/310 (1%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M +RHE+WMARY +VY D  E+ KRF IFKENV  IE+FN A ++PY LGIN+FADLTN+
Sbjct  1     MYERHEEWMARYAKVYKDPEEREKRFKIFKENVNYIEAFNNAANKPYKLGINQFADLTNE  60

Query  928   EFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFS  749
             EF+  +N +   +   +   +  F+YENVT +PS VDWR++GAVTP+K+QG CGCCWAFS
Sbjct  61    EFIVPRNRFNGHMR-FSFITTTTFKYENVTALPSTVDWRQKGAVTPIKDQGQCGCCWAFS  119

Query  748   AVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGY  569
             AVAA EGI  ++ G+L+SLSEQE+VDCD  G D GC GG MD AFK+II+++GL TE+ Y
Sbjct  120   AVAATEGIHALNSGKLISLSEQEVVDCDTKGEDQGCAGGFMDGAFKFIIQNHGLNTEANY  179

Query  568   PYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYA  389
             PY   D G+CN   A+  AA I GYEDVP+N+E AL +A A+QPVSVAIDA G   QFY 
Sbjct  180   PYKAVD-GKCNANEAANHAATITGYEDVPVNNEKALQKAVANQPVSVAIDASGSDFQFYK  238

Query  388   GGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRC  209
              GVFT  CGT+L+HGVT VGYG    G +YWL+KNSWG +WGE+GY  +QR + A+EG C
Sbjct  239   TGVFTGSCGTQLDHGVTAVGYGVSADGTQYWLVKNSWGTEWGEEGYIMMQRGVKAQEGLC  298

Query  208   GIALDPSYPT  179
             GIA+  SYPT
Sbjct  299   GIAMMASYPT  308



>ref|XP_003526207.1| PREDICTED: thiol protease SEN102-like [Glycine max]
Length=336

 Score =   359 bits (921),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 183/310 (59%), Positives = 229/310 (74%), Gaps = 8/310 (3%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M +RHE WM  YG+VY D  EK KRF IFK+NV+ IESFN  G++PY LG+N  ADLT +
Sbjct  34    MRERHEQWMTEYGKVYKDAAEKDKRFQIFKDNVEFIESFNADGNKPYKLGVNHLADLTVE  93

Query  928   EFVSTKNGYKRPVSPRNPWRSMPFRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCWAFS  749
             EF +++NG+KRP    + + +  F+YENVT IP+A+DWR +GAVTP+K+QG CG CWAFS
Sbjct  94    EFKASRNGFKRP----HEFSTTTFKYENVTAIPAAIDWRTKGAVTPIKDQGQCGSCWAFS  149

Query  748   AVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTESGY  569
              +AA EGI +I+ G+LVSLSEQELVDCD  G D GC GG M+D F++IIK+ G+T+E+ Y
Sbjct  150   TIAATEGIHQITTGKLVSLSEQELVDCDTKGVDQGCEGGYMEDGFEFIIKNGGITSETNY  209

Query  568   PYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQFYA  389
             PY   D G+CN  T+    A+I GYE VP NSE AL +A A+QPVSV+IDA G    FY+
Sbjct  210   PYKAVD-GKCNKATSP--VAQIKGYEKVPPNSETALQKAVANQPVSVSIDADGAGFMFYS  266

Query  388   GGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKEGRC  209
              G++   CGTEL+HGVT VGYGT   G  YW++KNSWG +WGE GY R+QR I AK G C
Sbjct  267   SGIYNGECGTELDHGVTAVGYGTA-NGTDYWIVKNSWGTQWGEKGYVRMQRGIAAKHGLC  325

Query  208   GIALDPSYPT  179
             GIALD SYPT
Sbjct  326   GIALDSSYPT  335



>ref|XP_009759551.1| PREDICTED: zingipain-2-like [Nicotiana sylvestris]
Length=349

 Score =   359 bits (922),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 183/313 (58%), Positives = 224/313 (72%), Gaps = 5/313 (2%)
 Frame = -1

Query  1108  MEKRHEDWMARYGRVYADETEKAKRFSIFKENVKAIESFNQAGDRPYTLGINEFADLTND  929
             M  RH+ W+A + +VY D  EK  RF IFKENV+ IE+FN   D+ Y LG+N+F+DLTN+
Sbjct  38    MRARHDQWIAHHDKVYKDLNEKEMRFKIFKENVERIEAFNAGEDKGYKLGVNKFSDLTNE  97

Query  928   EFVSTKNGYKRPVSPRNPWRSMP---FRYENVTDIPSAVDWRKEGAVTPVKNQGVCGCCW  758
             +F     GYKR   P+    S P   FRY NVTDIP  +DWRK+GAVTP+K+Q  CGCCW
Sbjct  98    KFRVLHTGYKRS-HPKVMSSSKPKTHFRYANVTDIPPTMDWRKKGAVTPIKDQKECGCCW  156

Query  757   AFSAVAAVEGIVKISGGELVSLSEQELVdcdkgggdlgchgGRMDDAFKYIIKHNGLTTE  578
             AFSAVAA EG+ ++  G+L+ LSEQELVDCD  G D GC GG +D AF +I+K+ GLTTE
Sbjct  157   AFSAVAATEGLHQLKTGKLIPLSEQELVDCDVEGEDEGCSGGLLDTAFDFILKNKGLTTE  216

Query  577   SGYPYGGQDLGRCNLTTASFRAAKIAGYEDVPMNSEAALLQAAAHQPVSVAIDARGLQLQ  398
             + YPY G+D G CN   ++  AAKIAGYEDVP NSE ALLQA A+QPVSVAID      Q
Sbjct  217   ANYPYKGED-GVCNKKKSALSAAKIAGYEDVPANSEKALLQAVANQPVSVAIDGSSFDFQ  275

Query  397   FYAGGVFTERCGTELNHGVTVVGYGTGERGIKYWLLKNSWGEKWGEDGYFRLQRDIDAKE  218
             FY+ GVF+  C T LNH VT VGYG    G KYW++KNSWG KWG+ GY R++RD+  KE
Sbjct  276   FYSSGVFSGSCSTWLNHAVTAVGYGATSDGTKYWIIKNSWGSKWGDSGYMRIKRDVHEKE  335

Query  217   GRCGIALDPSYPT  179
             G CG+A+D SYPT
Sbjct  336   GLCGLAMDASYPT  348



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3285328168100