BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c28246_g1_i1 len=1012 path=[1:0-1011]

Length=1012
                                                                      Score     E

ref|XP_009777961.1|  PREDICTED: uncharacterized protein LOC104227416    280   1e-89   
ref|XP_009596399.1|  PREDICTED: uncharacterized protein LOC104092490    276   6e-88   
ref|XP_006349331.1|  PREDICTED: uncharacterized protein LOC102592013    274   2e-87   
emb|CDO97610.1|  unnamed protein product                                274   2e-87   
ref|XP_004230455.1|  PREDICTED: uncharacterized protein LOC101268616    271   2e-86   
ref|XP_011087688.1|  PREDICTED: uncharacterized protein LOC105169096    268   2e-85   
emb|CDO97608.1|  unnamed protein product                                267   8e-85   
ref|XP_011047931.1|  PREDICTED: uncharacterized protein LOC105142131    266   2e-84   
ref|XP_010030168.1|  PREDICTED: uncharacterized protein LOC104419998    265   8e-84   
ref|XP_006389536.1|  hypothetical protein POPTR_0022s00700g             265   1e-83   
ref|XP_011088116.1|  PREDICTED: uncharacterized protein LOC105169422    263   3e-83   
gb|KDP42435.1|  hypothetical protein JCGZ_00232                         262   7e-83   
ref|XP_002526458.1|  conserved hypothetical protein                     255   6e-80   Ricinus communis
ref|XP_008218737.1|  PREDICTED: uncharacterized protein LOC103319023    251   2e-78   
ref|XP_007226107.1|  hypothetical protein PRUPE_ppa010943mg             250   4e-78   
gb|EYU26482.1|  hypothetical protein MIMGU_mgv1a026928mg                248   2e-77   
ref|XP_008368178.1|  PREDICTED: uncharacterized protein LOC103431786    247   4e-77   
ref|XP_007041237.1|  Uncharacterized protein TCM_006175                 247   7e-77   
ref|XP_009410685.1|  PREDICTED: uncharacterized protein LOC103992624    245   2e-76   
ref|XP_009353743.1|  PREDICTED: uncharacterized protein LOC103944978    242   5e-75   
ref|XP_006385029.1|  hypothetical protein POPTR_0004s23220g             238   3e-73   
ref|XP_002869724.1|  hypothetical protein ARALYDRAFT_492419             237   3e-73   
ref|XP_010674193.1|  PREDICTED: uncharacterized protein LOC104890412    238   3e-73   
ref|XP_008810912.1|  PREDICTED: uncharacterized protein LOC103722217    238   3e-73   
emb|CDY08933.1|  BnaC08g11630D                                          237   5e-73   
ref|XP_010256253.1|  PREDICTED: uncharacterized protein LOC104596698    237   5e-73   
ref|XP_010277272.1|  PREDICTED: uncharacterized protein LOC104611772    237   6e-73   
ref|XP_010657994.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    236   6e-73   
ref|XP_006282893.1|  hypothetical protein CARUB_v10007137mg             235   2e-72   
gb|KFK28986.1|  hypothetical protein AALP_AA7G073800                    233   1e-71   
ref|XP_010911365.1|  PREDICTED: uncharacterized protein LOC105037387    235   1e-71   
ref|XP_006471187.1|  PREDICTED: uncharacterized protein LOC102623401    234   1e-71   
ref|XP_011028335.1|  PREDICTED: uncharacterized protein LOC105128394    233   2e-71   
ref|XP_010534186.1|  PREDICTED: uncharacterized protein LOC104809807    233   2e-71   
emb|CDY24837.1|  BnaA08g14730D                                          231   6e-71   
ref|NP_186892.1|  uncharacterized protein                               229   4e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009109249.1|  PREDICTED: uncharacterized protein LOC103834908    229   5e-70   
ref|XP_010439058.1|  PREDICTED: uncharacterized protein LOC104722562    229   7e-70   
ref|XP_010448580.1|  PREDICTED: uncharacterized protein LOC104731025    228   1e-69   
ref|XP_006471188.1|  PREDICTED: uncharacterized protein LOC102623701    227   3e-69   
ref|XP_006413446.1|  hypothetical protein EUTSA_v10026158mg             227   3e-69   
ref|XP_010433789.1|  PREDICTED: uncharacterized protein LOC104717852    226   5e-69   
ref|XP_009118017.1|  PREDICTED: uncharacterized protein LOC103843066    225   2e-68   
ref|XP_010463647.1|  PREDICTED: uncharacterized protein LOC104744317    225   2e-68   
gb|EMS48436.1|  hypothetical protein TRIUR3_02208                       225   2e-68   
ref|XP_010417271.1|  PREDICTED: uncharacterized protein LOC104703038    225   2e-68   
dbj|BAJ95368.1|  predicted protein                                      225   2e-68   
ref|XP_010497147.1|  PREDICTED: uncharacterized protein LOC104774184    224   3e-68   
emb|CDY34728.1|  BnaA01g32970D                                          224   3e-68   
ref|XP_009137953.1|  PREDICTED: uncharacterized protein LOC103861987    224   5e-68   
ref|XP_010485487.1|  PREDICTED: uncharacterized protein LOC104763805    224   6e-68   
ref|XP_006408418.1|  hypothetical protein EUTSA_v10021481mg             223   9e-68   
ref|NP_194162.1|  uncharacterized protein                               223   1e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006431669.1|  hypothetical protein CICLE_v10003600mg             223   2e-67   
ref|XP_002882229.1|  hypothetical protein ARALYDRAFT_896211             223   2e-67   
emb|CBI29711.3|  unnamed protein product                                223   3e-67   
emb|CDY03457.1|  BnaC01g16250D                                          221   5e-67   
ref|XP_006851260.1|  hypothetical protein AMTR_s00180p00057430          220   2e-66   
ref|XP_006659030.1|  PREDICTED: uncharacterized protein LOC102709583    219   3e-66   
ref|XP_004972417.1|  PREDICTED: uncharacterized protein LOC101783676    219   9e-66   
ref|XP_006299851.1|  hypothetical protein CARUB_v10016054mg             218   2e-65   
ref|XP_004300087.1|  PREDICTED: uncharacterized protein LOC101310319    217   3e-65   
ref|XP_002509425.1|  conserved hypothetical protein                     214   2e-64   Ricinus communis
ref|XP_004491124.1|  PREDICTED: uncharacterized protein LOC101495511    214   3e-64   
ref|NP_001175354.1|  Os08g0106501                                       214   4e-64   
ref|XP_006467726.1|  PREDICTED: uncharacterized protein LOC102608272    213   5e-64   
gb|EAZ05316.1|  hypothetical protein OsI_27521                          213   6e-64   Oryza sativa Indica Group [Indian rice]
ref|XP_004486106.1|  PREDICTED: uncharacterized protein LOC101512239    212   1e-63   
ref|XP_006449412.1|  hypothetical protein CICLE_v10016696mg             212   2e-63   
ref|XP_010087431.1|  hypothetical protein L484_018458                   210   7e-63   
ref|XP_002265414.1|  PREDICTED: uncharacterized protein LOC100244781    209   1e-62   Vitis vinifera
gb|ABR16877.1|  unknown                                                 209   3e-62   Picea sitchensis
gb|ABR17763.1|  unknown                                                 209   4e-62   Picea sitchensis
ref|XP_007025538.1|  Uncharacterized protein TCM_029803                 206   4e-61   
ref|XP_006364305.1|  PREDICTED: uncharacterized protein LOC102579399    206   5e-61   
ref|XP_010686399.1|  PREDICTED: uncharacterized protein LOC104900624    206   6e-61   
ref|XP_004505097.1|  PREDICTED: uncharacterized protein LOC101491785    205   7e-61   
emb|CDO99489.1|  unnamed protein product                                205   7e-61   
ref|XP_003593648.1|  hypothetical protein MTR_2g014550                  205   8e-61   
ref|XP_002278769.1|  PREDICTED: uncharacterized protein LOC100262407    204   2e-60   Vitis vinifera
ref|XP_009775864.1|  PREDICTED: uncharacterized protein LOC104225708    204   2e-60   
gb|KDP21013.1|  hypothetical protein JCGZ_21484                         204   2e-60   
ref|XP_008383697.1|  PREDICTED: uncharacterized protein LOC103446381    204   2e-60   
ref|XP_008371416.1|  PREDICTED: uncharacterized protein LOC103434834    204   2e-60   
ref|XP_009344263.1|  PREDICTED: uncharacterized protein LOC103936119    204   3e-60   
ref|XP_004233838.1|  PREDICTED: uncharacterized protein LOC101249147    203   3e-60   
emb|CBI30614.3|  unnamed protein product                                205   4e-60   
gb|AFK44846.1|  unknown                                                 203   4e-60   
ref|XP_011027771.1|  PREDICTED: uncharacterized protein LOC105127982    203   8e-60   
gb|KHN08488.1|  hypothetical protein glysoja_014253                     202   1e-59   
ref|XP_010260334.1|  PREDICTED: uncharacterized protein LOC104599477    202   1e-59   
ref|XP_008225153.1|  PREDICTED: uncharacterized protein LOC103324819    202   1e-59   
ref|XP_007212044.1|  hypothetical protein PRUPE_ppa011352mg             202   2e-59   
ref|XP_010111173.1|  hypothetical protein L484_015056                   202   2e-59   
ref|XP_007159369.1|  hypothetical protein PHAVU_002G232400g             201   2e-59   
ref|XP_011096362.1|  PREDICTED: uncharacterized protein LOC105175576    202   3e-59   
gb|KHN15494.1|  hypothetical protein glysoja_038165                     201   3e-59   
ref|XP_002305111.2|  hypothetical protein POPTR_0004s04870g             202   4e-59   Populus trichocarpa [western balsam poplar]
ref|XP_007148117.1|  hypothetical protein PHAVU_006G181900g             200   5e-59   
gb|ACU15779.1|  unknown                                                 200   9e-59   Glycine max [soybeans]
gb|KEH30980.1|  transmembrane protein, putative                         199   1e-58   
ref|XP_010057364.1|  PREDICTED: uncharacterized protein LOC104445239    199   2e-58   
ref|XP_004293868.1|  PREDICTED: uncharacterized protein LOC101295896    199   2e-58   
ref|XP_006361068.1|  PREDICTED: uncharacterized protein LOC102594723    198   3e-58   
gb|EPS66984.1|  hypothetical protein M569_07790                         198   3e-58   
ref|XP_006377414.1|  hypothetical protein POPTR_0011s05700g             199   4e-58   
gb|EYU28015.1|  hypothetical protein MIMGU_mgv1a013603mg                198   5e-58   
ref|XP_009614893.1|  PREDICTED: uncharacterized protein LOC104107719    197   6e-58   
ref|XP_011001224.1|  PREDICTED: uncharacterized protein LOC105108575    198   7e-58   
ref|XP_003593647.1|  hypothetical protein MTR_2g014520                  197   9e-58   
ref|XP_009624698.1|  PREDICTED: uncharacterized protein LOC104115715    197   1e-57   
ref|XP_008439807.1|  PREDICTED: uncharacterized protein LOC103484494    197   2e-57   
ref|XP_004248460.1|  PREDICTED: uncharacterized protein LOC101254947    196   2e-57   
ref|NP_001144303.1|  hypothetical protein                               194   2e-56   Zea mays [maize]
ref|XP_003541524.1|  PREDICTED: uncharacterized protein LOC100784415    194   2e-56   
ref|XP_008798336.1|  PREDICTED: uncharacterized protein LOC103713249    194   2e-56   
ref|XP_009800282.1|  PREDICTED: uncharacterized protein LOC104246213    193   3e-56   
ref|XP_010245585.1|  PREDICTED: uncharacterized protein LOC104589093    193   6e-56   
ref|XP_010518775.1|  PREDICTED: uncharacterized protein LOC104798405    192   9e-56   
ref|XP_004134946.1|  PREDICTED: uncharacterized protein LOC101202820    191   2e-55   
ref|XP_002444870.1|  hypothetical protein SORBIDRAFT_07g000680          192   2e-55   Sorghum bicolor [broomcorn]
gb|EYU22091.1|  hypothetical protein MIMGU_mgv1a013831mg                189   1e-54   
ref|XP_010919356.1|  PREDICTED: uncharacterized protein LOC105043490    189   2e-54   
ref|XP_004168540.1|  PREDICTED: uncharacterized protein LOC101230301    187   2e-54   
ref|XP_006844888.1|  hypothetical protein AMTR_s00058p00125960          191   2e-54   
ref|XP_010924438.1|  PREDICTED: uncharacterized protein LOC105047277    187   4e-54   
ref|XP_009371494.1|  PREDICTED: uncharacterized protein LOC103960740    188   4e-54   
ref|XP_011100240.1|  PREDICTED: uncharacterized protein LOC105178468    187   9e-54   
ref|XP_006471189.1|  PREDICTED: uncharacterized protein LOC102623995    197   9e-54   
emb|CDX76524.1|  BnaA08g08760D                                          186   2e-53   
emb|CDY55785.1|  BnaC03g76810D                                          185   3e-53   
ref|XP_006414104.1|  hypothetical protein EUTSA_v10027225mg             185   4e-53   
ref|XP_008225181.1|  PREDICTED: uncharacterized protein LOC103324847    186   5e-53   
ref|XP_003526262.1|  PREDICTED: uncharacterized protein LOC100796945    184   7e-53   
ref|XP_009131711.1|  PREDICTED: uncharacterized protein LOC103856352    185   7e-53   
ref|XP_004252030.1|  PREDICTED: uncharacterized protein LOC101254876    185   7e-53   
ref|XP_006398291.1|  hypothetical protein EUTSA_v10001025mg             184   8e-53   
emb|CDX78854.1|  BnaA01g09210D                                          185   9e-53   
ref|XP_007213542.1|  hypothetical protein PRUPE_ppa019527mg             184   9e-53   
ref|XP_009394826.1|  PREDICTED: uncharacterized protein LOC103980228    183   2e-52   
emb|CDY60883.1|  BnaC01g40900D                                          184   2e-52   
ref|XP_009395997.1|  PREDICTED: uncharacterized protein LOC103981121    183   2e-52   
ref|XP_004305429.1|  PREDICTED: uncharacterized protein LOC101293416    182   3e-52   
ref|XP_008455952.1|  PREDICTED: uncharacterized protein LOC103496014    183   4e-52   
ref|XP_009108361.1|  PREDICTED: uncharacterized protein LOC103834060    182   6e-52   
ref|XP_006284515.1|  hypothetical protein CARUB_v10005715mg             182   6e-52   
ref|XP_008359069.1|  PREDICTED: uncharacterized protein LOC103422787    182   7e-52   
ref|XP_006655587.1|  PREDICTED: uncharacterized protein LOC102706010    182   8e-52   
ref|XP_007132680.1|  hypothetical protein PHAVU_011G115500g             181   8e-52   
emb|CDY33452.1|  BnaA06g36210D                                          182   1e-51   
ref|XP_010517535.1|  PREDICTED: uncharacterized protein LOC104792959    182   1e-51   
gb|KFK28517.1|  hypothetical protein AALP_AA7G006800                    182   1e-51   
ref|XP_008344773.1|  PREDICTED: uncharacterized protein LOC103407659    181   1e-51   
gb|KGN63201.1|  hypothetical protein Csa_2G408960                       182   1e-51   
ref|XP_006352030.1|  PREDICTED: uncharacterized protein LOC102584291    181   2e-51   
ref|XP_009101545.1|  PREDICTED: uncharacterized protein LOC103827755    181   3e-51   
ref|XP_002867993.1|  hypothetical protein ARALYDRAFT_914840             179   6e-51   
ref|NP_199421.1|  uncharacterized protein                               179   1e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006281752.1|  hypothetical protein CARUB_v10027911mg             179   2e-50   
ref|XP_002865206.1|  hypothetical protein ARALYDRAFT_916829             179   2e-50   
emb|CDY34571.1|  BnaC03g56710D                                          178   2e-50   
ref|XP_004505628.1|  PREDICTED: uncharacterized protein LOC101497875    177   2e-50   
ref|XP_009101549.1|  PREDICTED: uncharacterized protein LOC103827757    179   3e-50   
ref|XP_010441629.1|  PREDICTED: uncharacterized protein LOC104724778    178   4e-50   
emb|CDX77629.1|  BnaC07g18830D                                          178   4e-50   
ref|XP_008811089.1|  PREDICTED: uncharacterized protein LOC103722318    177   4e-50   
emb|CDY70034.1|  BnaAnng32400D                                          178   4e-50   
emb|CDX77630.1|  BnaC07g18840D                                          177   5e-50   
ref|XP_003566981.1|  PREDICTED: uncharacterized protein LOC100827369    177   6e-50   
emb|CDP12432.1|  unnamed protein product                                177   9e-50   
ref|XP_009785080.1|  PREDICTED: uncharacterized protein LOC104233393    176   1e-49   
ref|XP_010494774.1|  PREDICTED: uncharacterized protein LOC104771868    176   2e-49   
ref|XP_002275299.1|  PREDICTED: uncharacterized protein LOC100245474    176   2e-49   Vitis vinifera
ref|XP_010481500.1|  PREDICTED: uncharacterized protein LOC104760291    176   2e-49   
ref|XP_003607515.1|  hypothetical protein MTR_4g078870                  176   2e-49   
ref|NP_567556.1|  uncharacterized protein                               175   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003567905.1|  PREDICTED: uncharacterized protein LOC100824681    176   3e-49   
ref|XP_009589871.1|  PREDICTED: uncharacterized protein LOC104087172    175   3e-49   
ref|XP_010093959.1|  hypothetical protein L484_010525                   176   3e-49   
ref|XP_011043659.1|  PREDICTED: uncharacterized protein LOC105139057    175   4e-49   
ref|XP_010904899.1|  PREDICTED: uncharacterized protein LOC105032218    175   4e-49   
emb|CAN65382.1|  hypothetical protein VITISV_028557                     176   5e-49   Vitis vinifera
ref|XP_008783285.1|  PREDICTED: uncharacterized protein LOC103702573    173   9e-49   
ref|XP_002876900.1|  hypothetical protein ARALYDRAFT_484296             174   9e-49   
gb|AAU10653.1|  unknown protein                                         174   2e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004961228.1|  PREDICTED: uncharacterized protein LOC101778359    173   2e-48   
emb|CDY38387.1|  BnaC01g09960D                                          171   6e-48   
ref|XP_006446706.1|  hypothetical protein CICLE_v10017623mg             171   1e-47   
emb|CDX92877.1|  BnaC07g41350D                                          171   1e-47   
ref|XP_002867447.1|  predicted protein                                  170   1e-47   
emb|CDY29909.1|  BnaA03g49300D                                          170   2e-47   
ref|XP_009413807.1|  PREDICTED: uncharacterized protein LOC103995042    169   5e-47   
ref|XP_006372758.1|  hypothetical protein POPTR_0017s04770g             169   7e-47   
ref|XP_010555098.1|  PREDICTED: uncharacterized protein LOC104824685    168   8e-47   
ref|XP_009129595.1|  PREDICTED: uncharacterized protein LOC103854413    168   9e-47   
emb|CDY35189.1|  BnaA01g08420D                                          168   1e-46   
emb|CDP18222.1|  unnamed protein product                                169   1e-46   
gb|EMS59461.1|  hypothetical protein TRIUR3_20370                       166   9e-46   
ref|XP_010070119.1|  PREDICTED: uncharacterized protein LOC104456912    165   1e-45   
ref|XP_010686483.1|  PREDICTED: uncharacterized protein LOC104900690    166   1e-45   
ref|XP_010433212.1|  PREDICTED: uncharacterized protein LOC104717...    165   2e-45   
ref|XP_010686397.1|  PREDICTED: uncharacterized protein LOC104900622    164   3e-45   
ref|XP_010666457.1|  PREDICTED: uncharacterized protein LOC104883611    164   4e-45   
ref|XP_010916779.1|  PREDICTED: uncharacterized protein LOC105041523    163   5e-45   
gb|AAU44525.1|  hypothetical protein AT4G28485                          163   1e-44   Arabidopsis thaliana [mouse-ear cress]
gb|AAY78804.1|  hypothetical protein At4g28485                          162   1e-44   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ97707.1|  predicted protein                                      164   2e-44   
ref|XP_010914345.1|  PREDICTED: uncharacterized protein LOC105039777    163   2e-44   
ref|XP_007043697.1|  Galactose-1-phosphate uridylyltransferase, p...    162   4e-44   
ref|XP_008656733.1|  PREDICTED: uncharacterized protein LOC103636163    161   8e-44   
ref|XP_008776531.1|  PREDICTED: uncharacterized protein LOC103696625    161   9e-44   
gb|AFW83516.1|  hypothetical protein ZEAMMB73_128939                    160   9e-44   
ref|XP_010038679.1|  PREDICTED: uncharacterized protein LOC104427259    160   1e-43   
ref|XP_008656036.1|  PREDICTED: uncharacterized protein LOC103635334    161   2e-43   
ref|XP_002312247.1|  hypothetical protein POPTR_0008s08670g             160   2e-43   Populus trichocarpa [western balsam poplar]
ref|XP_011017214.1|  PREDICTED: uncharacterized protein LOC105120630    161   2e-43   
ref|XP_004969493.1|  PREDICTED: uncharacterized protein LOC101760980    159   3e-43   
ref|XP_010088151.1|  hypothetical protein L484_013595                   159   7e-43   
gb|EMS57393.1|  hypothetical protein TRIUR3_27181                       157   1e-42   
ref|XP_003614085.1|  hypothetical protein MTR_5g044580                  158   2e-42   
ref|XP_004306141.1|  PREDICTED: uncharacterized protein LOC101296994    158   2e-42   
ref|NP_001145367.1|  hypothetical protein                               158   3e-42   Zea mays [maize]
ref|XP_002441515.1|  hypothetical protein SORBIDRAFT_09g028420          157   4e-42   Sorghum bicolor [broomcorn]
ref|XP_002315049.1|  hypothetical protein POPTR_0010s17550g             157   5e-42   Populus trichocarpa [western balsam poplar]
ref|XP_010912092.1|  PREDICTED: uncharacterized protein LOC105038102    155   8e-42   
ref|NP_001057588.1|  Os06g0352200                                       156   2e-41   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011013354.1|  PREDICTED: uncharacterized protein LOC105117400    155   2e-41   
ref|XP_010447973.1|  PREDICTED: uncharacterized protein LOC104730496    154   3e-41   
ref|XP_008379358.1|  PREDICTED: uncharacterized protein LOC103442357    155   3e-41   
ref|XP_009380594.1|  PREDICTED: uncharacterized protein LOC103968949    155   3e-41   
ref|XP_007139565.1|  hypothetical protein PHAVU_008G040400g             154   3e-41   
ref|XP_004491811.1|  PREDICTED: uncharacterized protein LOC101510550    154   4e-41   
ref|XP_002517851.1|  conserved hypothetical protein                     154   4e-41   Ricinus communis
ref|XP_009376318.1|  PREDICTED: uncharacterized protein LOC103965024    154   5e-41   
ref|XP_007139518.1|  hypothetical protein PHAVU_008G036500g             153   6e-41   
ref|XP_009360650.1|  PREDICTED: uncharacterized protein LOC103951099    154   9e-41   
ref|XP_008657262.1|  PREDICTED: uncharacterized protein LOC103636687    153   1e-40   
ref|XP_010674991.1|  PREDICTED: uncharacterized protein LOC104891047    152   1e-40   
ref|XP_010244772.1|  PREDICTED: uncharacterized protein LOC104588512    152   2e-40   
gb|EMT12942.1|  hypothetical protein F775_20176                         152   2e-40   
ref|XP_008230772.1|  PREDICTED: uncharacterized protein LOC103330011    153   2e-40   
ref|XP_007216891.1|  hypothetical protein PRUPE_ppa020648mg             152   2e-40   
ref|XP_008353425.1|  PREDICTED: uncharacterized protein LOC103416995    152   2e-40   
ref|XP_009381725.1|  PREDICTED: uncharacterized protein LOC103969806    152   2e-40   
ref|XP_004971846.1|  PREDICTED: uncharacterized protein LOC101769380    152   2e-40   
ref|XP_010024460.1|  PREDICTED: uncharacterized protein LOC104414940    151   2e-40   
ref|XP_002437096.1|  hypothetical protein SORBIDRAFT_10g021060          154   3e-40   Sorghum bicolor [broomcorn]
ref|XP_010024463.1|  PREDICTED: uncharacterized protein LOC104414942    151   3e-40   
ref|XP_011075510.1|  PREDICTED: uncharacterized protein LOC105159971    152   3e-40   
ref|XP_008781019.1|  PREDICTED: uncharacterized protein LOC103700896    151   4e-40   
gb|EMT31472.1|  hypothetical protein F775_13695                         151   5e-40   
ref|XP_009403823.1|  PREDICTED: uncharacterized protein LOC103987288    150   6e-40   
ref|XP_009595904.1|  PREDICTED: uncharacterized protein LOC104092105    151   6e-40   
ref|XP_009799783.1|  PREDICTED: uncharacterized protein LOC104245803    151   7e-40   
ref|XP_011023527.1|  PREDICTED: uncharacterized protein LOC105124...    150   7e-40   
ref|XP_011023530.1|  PREDICTED: uncharacterized protein LOC105124...    150   8e-40   
ref|XP_011023529.1|  PREDICTED: uncharacterized protein LOC105124...    150   9e-40   
ref|XP_011023528.1|  PREDICTED: uncharacterized protein LOC105124...    150   9e-40   
ref|XP_010939799.1|  PREDICTED: uncharacterized protein LOC105058544    150   1e-39   
ref|XP_010941734.1|  PREDICTED: uncharacterized protein LOC105059916    149   1e-39   
ref|XP_003553088.1|  PREDICTED: uncharacterized protein LOC100802901    150   1e-39   
ref|XP_009774121.1|  PREDICTED: uncharacterized protein LOC104224215    150   2e-39   
gb|EEE64691.1|  hypothetical protein OsJ_19546                          150   3e-39   Oryza sativa Japonica Group [Japonica rice]
gb|EMT16128.1|  hypothetical protein F775_19787                         149   3e-39   
gb|EYU28766.1|  hypothetical protein MIMGU_mgv1a018679mg                149   3e-39   
ref|XP_003621241.1|  hypothetical protein MTR_7g010890                  149   3e-39   
ref|XP_006431160.1|  hypothetical protein CICLE_v10013797mg             149   4e-39   
gb|KDO74937.1|  hypothetical protein CISIN_1g0286151mg                  147   4e-39   
ref|XP_003553091.1|  PREDICTED: uncharacterized protein LOC100806096    149   4e-39   
ref|XP_004965424.1|  PREDICTED: uncharacterized protein LOC101752838    150   5e-39   
ref|XP_007032549.1|  Gb:AAC24089.1                                      148   5e-39   
gb|EMS63911.1|  hypothetical protein TRIUR3_21547                       149   5e-39   
ref|XP_006827264.1|  hypothetical protein AMTR_s00010p00262790          148   5e-39   
ref|XP_006845802.1|  hypothetical protein AMTR_s00019p00255810          147   6e-39   
ref|XP_008246531.1|  PREDICTED: uncharacterized protein LOC103344692    148   7e-39   
ref|XP_008795123.1|  PREDICTED: uncharacterized protein LOC103710958    147   8e-39   
ref|XP_002278425.1|  PREDICTED: uncharacterized protein LOC100243883    147   9e-39   Vitis vinifera
ref|XP_010683169.1|  PREDICTED: uncharacterized protein LOC104897901    148   1e-38   
ref|XP_008460881.1|  PREDICTED: uncharacterized protein LOC103499624    147   1e-38   
gb|EMT29931.1|  hypothetical protein F775_19617                         148   1e-38   
ref|XP_004146729.1|  PREDICTED: uncharacterized protein LOC101222659    147   2e-38   
gb|EPS58472.1|  hypothetical protein M569_16342                         147   2e-38   
ref|XP_010926631.1|  PREDICTED: uncharacterized protein LOC105048856    147   2e-38   
emb|CDP00855.1|  unnamed protein product                                147   2e-38   
ref|XP_009380593.1|  PREDICTED: uncharacterized protein LOC103968948    146   3e-38   
dbj|BAJ98080.1|  predicted protein                                      145   4e-38   
ref|XP_002512325.1|  conserved hypothetical protein                     146   5e-38   
ref|XP_002522445.1|  conserved hypothetical protein                     145   6e-38   
ref|XP_002319568.1|  hypothetical protein POPTR_0013s02820g             145   6e-38   
ref|XP_008802593.1|  PREDICTED: uncharacterized protein LOC103716395    145   6e-38   
ref|XP_010046624.1|  PREDICTED: uncharacterized protein LOC104435602    145   8e-38   
ref|XP_008809149.1|  PREDICTED: uncharacterized protein LOC103720946    144   1e-37   
gb|KDP41207.1|  hypothetical protein JCGZ_15614                         145   1e-37   
gb|EMT14009.1|  hypothetical protein F775_32425                         145   1e-37   
gb|EEC70698.1|  hypothetical protein OsI_02061                          144   2e-37   
ref|XP_007147832.1|  hypothetical protein PHAVU_006G158800g             144   2e-37   
gb|EMT03075.1|  hypothetical protein F775_17628                         144   2e-37   
ref|XP_006355155.1|  PREDICTED: uncharacterized protein LOC102591030    144   2e-37   
gb|EMT07708.1|  hypothetical protein F775_14289                         144   3e-37   
ref|NP_001043108.1|  Os01g0389700                                       144   3e-37   
ref|XP_011092679.1|  PREDICTED: uncharacterized protein LOC105172799    144   3e-37   
ref|XP_007030781.1|  Uncharacterized protein TCM_026517                 144   3e-37   
ref|XP_003594057.1|  hypothetical protein MTR_2g020850                  143   3e-37   
gb|EMT03248.1|  hypothetical protein F775_19809                         144   3e-37   
gb|EAY74176.1|  hypothetical protein OsI_02060                          144   3e-37   
gb|KFK39449.1|  hypothetical protein AALP_AA3G246500                    143   4e-37   
ref|XP_010024461.1|  PREDICTED: uncharacterized protein LOC104414941    143   4e-37   
ref|NP_001059434.1|  Os07g0407900                                       145   4e-37   
ref|XP_004486087.1|  PREDICTED: uncharacterized protein LOC101506121    142   5e-37   
gb|EMT07706.1|  hypothetical protein F775_14287                         143   6e-37   
ref|XP_006658493.1|  PREDICTED: uncharacterized protein LOC102714661    144   6e-37   
gb|EMT16127.1|  hypothetical protein F775_19786                         143   6e-37   
ref|XP_008790315.1|  PREDICTED: uncharacterized protein LOC103707561    143   6e-37   
ref|XP_002315542.1|  hypothetical protein POPTR_0010s02840g             142   7e-37   
ref|XP_004239396.1|  PREDICTED: uncharacterized protein LOC101263909    143   7e-37   
ref|XP_006644193.1|  PREDICTED: uncharacterized protein LOC102703432    143   7e-37   
ref|XP_004965304.1|  PREDICTED: uncharacterized protein LOC101766221    143   7e-37   
ref|XP_010649829.1|  PREDICTED: uncharacterized protein LOC100264790    142   8e-37   
ref|XP_006489209.1|  PREDICTED: uncharacterized protein LOC102626738    142   8e-37   
ref|XP_007154200.1|  hypothetical protein PHAVU_003G098400g             142   9e-37   
ref|XP_003565771.1|  PREDICTED: uncharacterized protein LOC100831528    142   1e-36   
ref|XP_010111869.1|  hypothetical protein L484_020662                   142   1e-36   
ref|XP_002457653.1|  hypothetical protein SORBIDRAFT_03g011250          142   1e-36   
ref|XP_004305023.1|  PREDICTED: uncharacterized protein LOC101304693    142   1e-36   
ref|XP_010528343.1|  PREDICTED: uncharacterized protein LOC104805...    142   1e-36   
ref|XP_006845800.1|  hypothetical protein AMTR_s00019p00255550          142   1e-36   
ref|XP_007154201.1|  hypothetical protein PHAVU_003G098500g             142   1e-36   
ref|XP_007207654.1|  hypothetical protein PRUPE_ppa021534mg             140   2e-36   
ref|XP_004968801.1|  PREDICTED: uncharacterized protein LOC101784054    142   2e-36   
gb|KFK26910.1|  hypothetical protein AALP_AA8G309600                    142   2e-36   
gb|EMS63835.1|  hypothetical protein TRIUR3_32626                       142   2e-36   
ref|XP_010105680.1|  hypothetical protein L484_011291                   140   3e-36   
ref|XP_007227278.1|  hypothetical protein PRUPE_ppa017516mg             140   3e-36   
gb|EMS65942.1|  hypothetical protein TRIUR3_06105                       141   3e-36   
gb|AFK48704.1|  unknown                                                 140   4e-36   
gb|EPS61229.1|  hypothetical protein M569_13572                         140   4e-36   
ref|XP_010236366.1|  PREDICTED: uncharacterized protein LOC100833397    140   5e-36   
gb|EAY90186.1|  hypothetical protein OsI_11750                          139   6e-36   
gb|EMT03249.1|  hypothetical protein F775_09289                         140   7e-36   
ref|XP_006419744.1|  hypothetical protein CICLE_v10005996mg             139   7e-36   
ref|XP_004508330.1|  PREDICTED: uncharacterized protein LOC101512884    140   8e-36   
ref|XP_009352167.1|  PREDICTED: uncharacterized protein LOC103943583    139   8e-36   
gb|KHN03024.1|  hypothetical protein glysoja_009890                     140   8e-36   
ref|XP_011090899.1|  PREDICTED: uncharacterized protein LOC105171466    139   8e-36   
ref|XP_008675476.1|  PREDICTED: uncharacterized protein LOC103651591    141   9e-36   
ref|XP_002438110.1|  hypothetical protein SORBIDRAFT_10g008180          140   9e-36   
ref|XP_010528342.1|  PREDICTED: uncharacterized protein LOC104805...    140   9e-36   
ref|XP_009402533.1|  PREDICTED: uncharacterized protein LOC103986298    140   9e-36   
ref|NP_001043106.1|  Os01g0388700                                       140   1e-35   
gb|EMT07707.1|  hypothetical protein F775_14288                         140   1e-35   
ref|XP_003528659.1|  PREDICTED: uncharacterized protein LOC100819528    139   1e-35   
ref|XP_010914346.1|  PREDICTED: uncharacterized protein LOC105039778    138   1e-35   
ref|XP_007223510.1|  hypothetical protein PRUPE_ppa011867mg             139   1e-35   
ref|XP_009402791.1|  PREDICTED: uncharacterized protein LOC103986498    139   1e-35   
ref|XP_003557899.1|  PREDICTED: uncharacterized protein LOC100830766    139   1e-35   
ref|XP_008361977.1|  PREDICTED: uncharacterized protein LOC103425667    139   1e-35   
dbj|BAD22062.1|  hypothetical protein                                   139   2e-35   
ref|XP_009335668.1|  PREDICTED: uncharacterized protein LOC103928362    139   2e-35   
ref|XP_010036256.1|  PREDICTED: uncharacterized protein LOC104425295    139   2e-35   
ref|XP_003557584.2|  PREDICTED: uncharacterized protein LOC100840153    139   2e-35   
emb|CDY38622.1|  BnaA05g19650D                                          138   2e-35   
ref|XP_010045885.1|  PREDICTED: uncharacterized protein LOC104434703    138   2e-35   
ref|XP_006406257.1|  hypothetical protein EUTSA_v10021605mg             137   2e-35   
gb|EAY85849.1|  hypothetical protein OsI_07211                          139   2e-35   
ref|XP_008223063.1|  PREDICTED: uncharacterized protein LOC103322890    138   2e-35   
ref|XP_002455931.1|  hypothetical protein SORBIDRAFT_03g027420          139   3e-35   
ref|XP_008444039.1|  PREDICTED: uncharacterized protein LOC103487490    139   3e-35   
gb|KFK39625.1|  hypothetical protein AALP_AA3G268200                    137   3e-35   
gb|EMT03250.1|  hypothetical protein F775_42868                         139   3e-35   
gb|KCW84362.1|  hypothetical protein EUGRSUZ_B01214                     137   3e-35   
ref|XP_006645913.1|  PREDICTED: uncharacterized protein LOC102713318    144   3e-35   
ref|XP_008390773.1|  PREDICTED: uncharacterized protein LOC103453018    137   4e-35   
ref|XP_006405607.1|  hypothetical protein EUTSA_v10027899mg             139   4e-35   
gb|KDO43218.1|  hypothetical protein CISIN_1g035725mg                   134   5e-35   
ref|XP_004305025.1|  PREDICTED: uncharacterized protein LOC101305287    138   5e-35   
gb|KFK25288.1|  hypothetical protein AALP_AA8G092900                    138   5e-35   
ref|NP_001050198.1|  Os03g0370400                                       137   5e-35   
ref|XP_002312376.1|  hypothetical protein POPTR_0008s11410g             136   7e-35   
ref|XP_008223061.1|  PREDICTED: uncharacterized protein LOC103322888    137   8e-35   
ref|XP_009109446.1|  PREDICTED: uncharacterized protein LOC103835095    136   8e-35   
ref|NP_001143575.1|  uncharacterized protein LOC100276273               136   8e-35   
ref|XP_008223143.1|  PREDICTED: uncharacterized protein LOC103322962    136   8e-35   
emb|CDY37280.1|  BnaA01g25000D                                          136   8e-35   
ref|XP_004508329.1|  PREDICTED: uncharacterized protein LOC101512577    137   9e-35   
ref|XP_006285870.1|  hypothetical protein CARUB_v10007365mg             138   1e-34   
ref|XP_009145474.1|  PREDICTED: uncharacterized protein LOC103869169    136   1e-34   
ref|XP_009387184.1|  PREDICTED: uncharacterized protein LOC103974145    136   1e-34   
ref|NP_566687.1|  DUF679 domain membrane protein 2                      136   1e-34   
dbj|BAK05645.1|  predicted protein                                      137   1e-34   
ref|XP_007221659.1|  hypothetical protein PRUPE_ppb009805mg             136   1e-34   
ref|NP_198781.1|  uncharacterized protein                               137   1e-34   
gb|AFW85238.1|  hypothetical protein ZEAMMB73_186641                    136   2e-34   
gb|AFW88282.1|  hypothetical protein ZEAMMB73_902531                    135   2e-34   
ref|XP_002870771.1|  hypothetical protein ARALYDRAFT_494025             137   2e-34   
ref|XP_010435868.1|  PREDICTED: uncharacterized protein LOC104719614    137   2e-34   
gb|ABK28729.1|  unknown                                                 137   2e-34   
emb|CAN73827.1|  hypothetical protein VITISV_003176                     142   2e-34   
dbj|BAK02329.1|  predicted protein                                      135   2e-34   
emb|CDY44328.1|  BnaC05g30650D                                          135   2e-34   
ref|XP_009139910.1|  PREDICTED: uncharacterized protein LOC103863904    137   2e-34   
emb|CDX74441.1|  BnaA04g09480D                                          137   2e-34   
ref|XP_010510347.1|  PREDICTED: uncharacterized protein LOC104786603    135   2e-34   
ref|XP_009408744.1|  PREDICTED: uncharacterized protein LOC103991110    135   2e-34   
ref|XP_010036244.1|  PREDICTED: uncharacterized protein LOC104425287    135   2e-34   
ref|XP_009628599.1|  PREDICTED: uncharacterized protein LOC104118916    135   3e-34   
ref|NP_001144876.1|  uncharacterized protein LOC100277972               135   3e-34   
ref|XP_010450786.1|  PREDICTED: uncharacterized protein LOC104732887    136   3e-34   
ref|XP_003565769.2|  PREDICTED: uncharacterized protein LOC100830611    138   4e-34   
ref|XP_004984268.1|  PREDICTED: uncharacterized protein LOC101785245    135   4e-34   
ref|XP_010466402.1|  PREDICTED: uncharacterized protein LOC104746582    134   4e-34   
ref|NP_001031010.1|  uncharacterized protein                            136   4e-34   
ref|XP_010548895.1|  PREDICTED: uncharacterized protein LOC104820226    134   4e-34   
ref|XP_010553995.1|  PREDICTED: uncharacterized protein LOC104823904    136   4e-34   
dbj|BAJ94807.1|  predicted protein                                      135   5e-34   
gb|KCW84360.1|  hypothetical protein EUGRSUZ_B01212                     135   6e-34   
gb|EYU40520.1|  hypothetical protein MIMGU_mgv1a023255mg                135   6e-34   
gb|EPS61228.1|  hypothetical protein M569_13571                         134   7e-34   
gb|EMS65326.1|  hypothetical protein TRIUR3_19533                       134   7e-34   
ref|XP_009774298.1|  PREDICTED: uncharacterized protein LOC104224365    134   7e-34   
ref|XP_006650125.1|  PREDICTED: uncharacterized protein LOC102701151    134   1e-33   
ref|XP_002885448.1|  hypothetical protein ARALYDRAFT_898603             133   1e-33   
ref|XP_004296768.1|  PREDICTED: uncharacterized protein LOC101311466    134   1e-33   
ref|XP_009145473.1|  PREDICTED: uncharacterized protein LOC103869164    133   1e-33   
emb|CDY38623.1|  BnaA05g19640D                                          133   1e-33   
ref|XP_004305022.1|  PREDICTED: uncharacterized protein LOC101304116    134   1e-33   
ref|XP_006300191.1|  hypothetical protein CARUB_v10016427mg             133   1e-33   
ref|XP_010041635.1|  PREDICTED: uncharacterized protein LOC104430587    134   1e-33   
emb|CDO98951.1|  unnamed protein product                                134   2e-33   
ref|XP_002883310.1|  hypothetical protein ARALYDRAFT_898600             133   2e-33   
ref|XP_006584405.1|  PREDICTED: uncharacterized protein LOC100794857    133   2e-33   
gb|EMT28510.1|  hypothetical protein F775_11484                         132   2e-33   
ref|XP_010042202.1|  PREDICTED: cell wall integrity and stress re...    134   3e-33   
ref|XP_009385032.1|  PREDICTED: uncharacterized protein LOC103972420    132   3e-33   
ref|XP_006399451.1|  hypothetical protein EUTSA_v10014525mg             134   3e-33   
gb|KDP40058.1|  hypothetical protein JCGZ_02056                         132   3e-33   
ref|XP_009339949.1|  PREDICTED: uncharacterized protein LOC103932125    132   3e-33   
gb|EYU45596.1|  hypothetical protein MIMGU_mgv1a013892mg                132   4e-33   
emb|CDY19288.1|  BnaC01g31920D                                          131   5e-33   
gb|KCW44210.1|  hypothetical protein EUGRSUZ_L02364                     131   5e-33   
ref|XP_009369066.1|  PREDICTED: uncharacterized protein LOC103958523    131   7e-33   
ref|XP_008370526.1|  PREDICTED: uncharacterized protein LOC103433991    132   7e-33   
gb|EYU26480.1|  hypothetical protein MIMGU_mgv1a019010mg                129   8e-33   
ref|XP_004229478.1|  PREDICTED: uncharacterized protein LOC101268223    130   8e-33   
ref|XP_004969121.1|  PREDICTED: uncharacterized protein LOC101782846    133   9e-33   
ref|NP_188789.2|  DUF679 domain membrane protein 1                      131   1e-32   
ref|XP_006298556.1|  hypothetical protein CARUB_v10014640mg             131   1e-32   
ref|XP_010242558.1|  PREDICTED: uncharacterized protein LOC104586881    130   1e-32   
gb|EMT16747.1|  hypothetical protein F775_32695                         130   1e-32   
ref|XP_008438763.1|  PREDICTED: uncharacterized protein LOC103483776    131   2e-32   
ref|XP_008660813.1|  PREDICTED: uncharacterized protein LOC103639910    132   2e-32   
ref|NP_001043107.1|  Os01g0389200                                       132   2e-32   
ref|XP_004134465.1|  PREDICTED: uncharacterized protein LOC101205641    130   2e-32   
ref|XP_010228847.1|  PREDICTED: uncharacterized protein LOC104581818    130   2e-32   
gb|EAZ12012.1|  hypothetical protein OsJ_01894                          132   3e-32   
ref|XP_007035406.1|  DUF679 domain membrane protein 2                   132   3e-32   
ref|XP_010279209.1|  PREDICTED: uncharacterized protein LOC104613182    129   3e-32   
ref|XP_003609548.1|  hypothetical protein MTR_4g118470                  130   4e-32   
ref|XP_007226108.1|  hypothetical protein PRUPE_ppa010990mg             130   4e-32   
ref|XP_006365275.1|  PREDICTED: uncharacterized protein LOC102592775    129   4e-32   
ref|XP_002452084.1|  hypothetical protein SORBIDRAFT_04g019010          130   4e-32   
ref|XP_008387881.1|  PREDICTED: uncharacterized protein LOC103450329    129   4e-32   
ref|XP_008223062.1|  PREDICTED: uncharacterized protein LOC103322889    129   4e-32   
gb|KHN37536.1|  hypothetical protein glysoja_007239                     129   5e-32   
ref|XP_006433197.1|  hypothetical protein CICLE_v10003468mg             130   5e-32   
ref|XP_010524524.1|  PREDICTED: uncharacterized protein LOC104802567    129   5e-32   
gb|KGN57051.1|  hypothetical protein Csa_3G150800                       129   8e-32   
ref|XP_002516830.1|  conserved hypothetical protein                     128   8e-32   
gb|KDO43221.1|  hypothetical protein CISIN_1g0464281mg                  125   9e-32   
ref|XP_003609549.1|  hypothetical protein MTR_4g118480                  129   9e-32   
ref|XP_010510323.1|  PREDICTED: uncharacterized protein LOC104786586    129   1e-31   
ref|XP_010488166.1|  PREDICTED: uncharacterized protein LOC104766049    129   1e-31   
ref|XP_010045883.1|  PREDICTED: uncharacterized protein LOC104434702    128   1e-31   
ref|XP_003572527.1|  PREDICTED: uncharacterized protein LOC100844788    128   1e-31   
ref|XP_002982285.1|  hypothetical protein SELMODRAFT_36967              126   3e-31   
ref|XP_010466400.1|  PREDICTED: uncharacterized protein LOC104746580    127   3e-31   
ref|XP_008438760.1|  PREDICTED: uncharacterized protein LOC103483773    126   4e-31   
ref|XP_006600330.1|  PREDICTED: uncharacterized protein LOC100786973    127   4e-31   
ref|XP_004952503.1|  PREDICTED: uncharacterized protein LOC101754505    127   5e-31   
emb|CDX81135.1|  BnaC03g03890D                                          127   5e-31   
ref|XP_009131120.1|  PREDICTED: uncharacterized protein LOC103855829    127   6e-31   
ref|XP_003542907.1|  PREDICTED: uncharacterized protein LOC100819509    126   6e-31   
ref|XP_004305024.1|  PREDICTED: uncharacterized protein LOC101304990    126   7e-31   
gb|AFG43958.1|  hypothetical protein 0_10415_01                         124   8e-31   
ref|XP_002966215.1|  hypothetical protein SELMODRAFT_68639              125   9e-31   
gb|AFG43944.1|  hypothetical protein 0_10415_01                         124   9e-31   
ref|XP_008659074.1|  PREDICTED: uncharacterized protein LOC103637805    127   1e-30   
gb|AFG43948.1|  hypothetical protein 0_10415_01                         124   1e-30   
gb|EAZ11910.1|  hypothetical protein OsJ_01782                          129   1e-30   
gb|AFG43950.1|  hypothetical protein 0_10415_01                         124   1e-30   
gb|AFG43952.1|  hypothetical protein 0_10415_01                         123   2e-30   
ref|XP_006290107.1|  hypothetical protein CARUB_v10003751mg             124   3e-30   
ref|XP_002874376.1|  hypothetical protein ARALYDRAFT_910848             124   3e-30   
gb|AFG43943.1|  hypothetical protein 0_10415_01                         122   3e-30   
gb|AEW07742.1|  hypothetical protein 0_10415_01                         122   4e-30   
ref|XP_010938910.1|  PREDICTED: uncharacterized protein LOC105057890    124   6e-30   
gb|KGN57049.1|  hypothetical protein Csa_3G150780                       123   8e-30   
gb|ACU20612.1|  unknown                                                 123   1e-29   
gb|KDP34672.1|  hypothetical protein JCGZ_11020                         122   1e-29   
ref|XP_004966913.1|  PREDICTED: uncharacterized protein LOC101759331    124   2e-29   
ref|XP_009109458.1|  PREDICTED: uncharacterized protein LOC103835105    122   2e-29   



>ref|XP_009777961.1| PREDICTED: uncharacterized protein LOC104227416 [Nicotiana sylvestris]
Length=233

 Score =   280 bits (716),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 161/193 (83%), Gaps = 4/193 (2%)
 Frame = -3

Query  719  SVPEPLLPAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTL  540
            S+  PL+P     S SQRALE+TA+LANLLPTGTLLAFQLL PIFTNNG+CD ATRPMTL
Sbjct  44   SLERPLVPRL---SISQRALETTANLANLLPTGTLLAFQLLIPIFTNNGSCDTATRPMTL  100

Query  539  VLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAG  360
            +LL++LA SCF+ACFTDS +  DGQ+YYG AT  GLW+FDY  AA A     +L K+R G
Sbjct  101  ILLALLAFSCFIACFTDSFKAPDGQIYYGLATFKGLWIFDY-NAATASGVPNELNKYRVG  159

Query  359  FIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPT  180
            FID VHAVLSVLVFVA+AL+DKNVVSC YP PNHET++VLDVVPIGIG++CSLLF+VFPT
Sbjct  160  FIDLVHAVLSVLVFVAVALRDKNVVSCYYPSPNHETKQVLDVVPIGIGVICSLLFVVFPT  219

Query  179  RRHGIGFPVTSGK  141
            RRHGIGFPVT  +
Sbjct  220  RRHGIGFPVTPDR  232



>ref|XP_009596399.1| PREDICTED: uncharacterized protein LOC104092490 [Nicotiana tomentosiformis]
Length=233

 Score =   276 bits (705),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 160/193 (83%), Gaps = 4/193 (2%)
 Frame = -3

Query  719  SVPEPLLPAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTL  540
            S   PL+P     S SQRALE+TA+LANLLPTGTLLAFQLL PIFTNNG+CD ATRPMTL
Sbjct  44   SSERPLVPRL---SISQRALETTANLANLLPTGTLLAFQLLIPIFTNNGSCDTATRPMTL  100

Query  539  VLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAG  360
            +LL++LA SCF+ACFTDS +  DGQ+YYG AT  GLW+FDY  AA A    ++L K+R G
Sbjct  101  ILLALLAFSCFVACFTDSFKAPDGQIYYGLATFKGLWIFDY-NAATASGVPSELNKYRVG  159

Query  359  FIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPT  180
            FID VHA+LSVLVFVA+AL+DKNVVSC YP PN ET++VLDVVPIGIG++CSLLF+VFPT
Sbjct  160  FIDLVHAMLSVLVFVAVALRDKNVVSCYYPSPNQETKQVLDVVPIGIGVICSLLFVVFPT  219

Query  179  RRHGIGFPVTSGK  141
            RRHGIGFPVT  +
Sbjct  220  RRHGIGFPVTPDR  232



>ref|XP_006349331.1| PREDICTED: uncharacterized protein LOC102592013 [Solanum tuberosum]
Length=230

 Score =   274 bits (701),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 154/180 (86%), Gaps = 1/180 (1%)
 Frame = -3

Query  680  SFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLA  501
            S SQRALESTAHLANLLPTGTLLAFQLL PIFTNNG CD A+RPMTL+LL++LA SCFLA
Sbjct  51   SISQRALESTAHLANLLPTGTLLAFQLLIPIFTNNGTCDTASRPMTLILLALLAFSCFLA  110

Query  500  CFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLV  321
            CFTDS +  DGQ+YYG AT  GLW+FDY  AA+      +L ++R GFID+VHAVLSVLV
Sbjct  111  CFTDSYKAPDGQIYYGLATFKGLWIFDY-QAASISGVPGELNRYRVGFIDFVHAVLSVLV  169

Query  320  FVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSGK  141
            F+A+AL+DKNV +C YP P+H+T++VLDVVPIGIG++CSLLF+VFPTRRHGIGFPVT  K
Sbjct  170  FIAVALRDKNVANCFYPTPDHDTKQVLDVVPIGIGVICSLLFVVFPTRRHGIGFPVTPDK  229



>emb|CDO97610.1| unnamed protein product [Coffea canephora]
Length=223

 Score =   274 bits (700),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 159/197 (81%), Gaps = 6/197 (3%)
 Frame = -3

Query  713  PEPLLPAAKSPSFSQRALE----STAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPM  546
            P+P  P   S   SQRAL     STA+LANLLPTGTLLAFQLLTP+FTNNG+CDAATRPM
Sbjct  27   PKPQPPQRSSSPLSQRALSQALTSTANLANLLPTGTLLAFQLLTPVFTNNGSCDAATRPM  86

Query  545  TLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDY--PaaaaagisaADLGK  372
            T++LL++LAVSCFLA FTDSV+  DGQVYYGFAT  G+WLFD     A+ + +   DL K
Sbjct  87   TIILLALLAVSCFLASFTDSVKLSDGQVYYGFATFRGMWLFDARGTIASGSEVGVPDLSK  146

Query  371  FRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFL  192
            +R GFID+VH+VLSV VF A+AL+DKNVV CLYPKP+HE QEVLD+VPIGIG LC LLFL
Sbjct  147  YRLGFIDWVHSVLSVFVFAAVALRDKNVVGCLYPKPDHEVQEVLDIVPIGIGCLCGLLFL  206

Query  191  VFPTRRHGIGFPVTSGK  141
            VFPTRRHGIG+PVT G 
Sbjct  207  VFPTRRHGIGYPVTPGN  223



>ref|XP_004230455.1| PREDICTED: uncharacterized protein LOC101268616 [Solanum lycopersicum]
 ref|XP_010314524.1| PREDICTED: uncharacterized protein LOC101268616 [Solanum lycopersicum]
Length=222

 Score =   271 bits (694),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 143/219 (65%), Positives = 172/219 (79%), Gaps = 5/219 (2%)
 Frame = -3

Query  785  NLRSRTATPAAPAVDDREVETLSVP----EPLLPAAKSPSFSQRALESTAHLANLLPTGT  618
            +LR+R+ +    + D  E+  L       E   PA   PS SQRALESTAHLANLLPTGT
Sbjct  4    SLRARSTSSKQTSTDASEIPLLPTSNNDHEAERPAIPRPSISQRALESTAHLANLLPTGT  63

Query  617  LLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRG  438
            LLAFQLL PIFTNNG+CD A+RP+TLVLL++LA SCFLACFTDS +  DGQ+YYG AT  
Sbjct  64   LLAFQLLIPIFTNNGSCDTASRPLTLVLLALLAFSCFLACFTDSFKAPDGQIYYGLATFK  123

Query  437  GLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNH  258
            GLW+FDY  AA+      +L ++R GFID+VHA+LSVLVFVA+AL+DKNVV+C YP P+H
Sbjct  124  GLWIFDY-QAASISGVPGELSRYRVGFIDFVHAILSVLVFVAVALRDKNVVNCFYPTPDH  182

Query  257  ETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSGK  141
            ET++VLDVVPIGIG++CSLLF+VFPTRRHGIGFPVT  K
Sbjct  183  ETKQVLDVVPIGIGVICSLLFVVFPTRRHGIGFPVTPDK  221



>ref|XP_011087688.1| PREDICTED: uncharacterized protein LOC105169096 [Sesamum indicum]
Length=210

 Score =   268 bits (686),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 144/219 (66%), Positives = 169/219 (77%), Gaps = 9/219 (4%)
 Frame = -3

Query  797  MSSQNLRSRTATPAAPAVDDREVETLSVPEPLLPAAKSPSFSQRALESTAHLANLLPTGT  618
            MSS   RS T TP      D +V+ L  P P    ++S + SQ ALES+AHLANLLPTGT
Sbjct  1    MSSLRQRSST-TPV-----DNDVDLLPPPPPPPRPSQS-ALSQ-ALESSAHLANLLPTGT  52

Query  617  LLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRG  438
            LLAFQLL PIFTNNG CD ATRPMTL LL +LA+SCFLA FTDS++  DGQVYYGFAT  
Sbjct  53   LLAFQLLMPIFTNNGVCDMATRPMTLGLLFVLALSCFLASFTDSIKASDGQVYYGFATFR  112

Query  437  GLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNH  258
            G+WLFDY   A +    A+L K+R GFID+VHAVLSVLVF A+AL+DKNVVSCLYP P H
Sbjct  113  GMWLFDY-LNAESSGLPAELSKYRLGFIDFVHAVLSVLVFAAVALRDKNVVSCLYPSPGH  171

Query  257  ETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSGK  141
            E QEVLD+VPIGIGL+ SL+F++FPT+RHGIG+PVT  +
Sbjct  172  EVQEVLDIVPIGIGLISSLMFVIFPTKRHGIGYPVTRDR  210



>emb|CDO97608.1| unnamed protein product [Coffea canephora]
Length=221

 Score =   267 bits (683),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 155/179 (87%), Gaps = 1/179 (1%)
 Frame = -3

Query  677  FSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLAC  498
            F QRALESTAHLANLLPTGTLLAFQLLTPI TNNG+CDAATRPMTL+LL IL VSCFLAC
Sbjct  44   FYQRALESTAHLANLLPTGTLLAFQLLTPIATNNGSCDAATRPMTLILLLILGVSCFLAC  103

Query  497  FTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVF  318
            FTDS R  DGQVYYGFA+  GLW+FDYP AA+A     DL K+R  FID VHAVLSV VF
Sbjct  104  FTDSFRASDGQVYYGFASPRGLWVFDYP-AASASGIPGDLSKYRLSFIDVVHAVLSVFVF  162

Query  317  VAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSGK  141
            V++AL+DKNV+SC YP P+HET+EVLD+ PI IGL+CSLLF++FPTRRHGIG+PVTSGK
Sbjct  163  VSVALRDKNVLSCFYPSPSHETEEVLDIFPISIGLICSLLFVIFPTRRHGIGYPVTSGK  221



>ref|XP_011047931.1| PREDICTED: uncharacterized protein LOC105142131 [Populus euphratica]
Length=232

 Score =   266 bits (681),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 160/197 (81%), Gaps = 9/197 (5%)
 Frame = -3

Query  710  EPLLPAAKS--PSFSQRA----LESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRP  549
            EP  P + S  P+FSQRA    L STA+LANLLPTGTLLAFQ+LTPIFTNNGACD+AT P
Sbjct  38   EPETPKSPSRPPTFSQRAISQTLTSTANLANLLPTGTLLAFQILTPIFTNNGACDSATAP  97

Query  548  MTLVLLSILAVSCFLACFTDSVRG-RDGQVYYGFATRGGLWLFDYPaaaaagisaADLGK  372
            MT VLL++LAVSCFL  FTDSV+   DGQVYYGFAT  G++LFD P    +G+S  DL K
Sbjct  98   MTSVLLALLAVSCFLGSFTDSVKSPTDGQVYYGFATIKGMFLFDCPDPVGSGLS--DLSK  155

Query  371  FRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFL  192
             +  FID VHAVLSVLVFVA+AL+DKNV+SC YP P HETQEVLDV+P+GIGL+CSLLFL
Sbjct  156  LKLRFIDVVHAVLSVLVFVAVALRDKNVLSCFYPMPKHETQEVLDVIPVGIGLICSLLFL  215

Query  191  VFPTRRHGIGFPVTSGK  141
             FPTRRHGIG+PVT GK
Sbjct  216  AFPTRRHGIGYPVTPGK  232



>ref|XP_010030168.1| PREDICTED: uncharacterized protein LOC104419998 [Eucalyptus grandis]
 gb|KCW57114.1| hypothetical protein EUGRSUZ_I02761 [Eucalyptus grandis]
Length=225

 Score =   265 bits (677),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 137/227 (60%), Positives = 172/227 (76%), Gaps = 14/227 (6%)
 Frame = -3

Query  788  QNLRSRTAT---PAAPAVDDREVETLSVP--EPLLPAA--KSPSFSQRA----LESTAHL  642
              LR+RTA+   P+AP   +    + S    EP  P +  +  SFSQRA    L  TA+L
Sbjct  2    SELRTRTASAKRPSAPVASEASNSSGSGSDHEPETPKSLQRPSSFSQRAISQTLTGTANL  61

Query  641  ANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQV  462
            ANLLPTGTLLAFQLL P+FTNNG+CD+ATRP+T++LL +L+VSCF+A FTDSVR  DG+V
Sbjct  62   ANLLPTGTLLAFQLLMPVFTNNGSCDSATRPLTIILLVLLSVSCFVASFTDSVRSSDGRV  121

Query  461  YYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVS  282
            +YGFAT  GL++FD         S  DL K++ GFID+VHA+LS+LVF A+AL+DKNVVS
Sbjct  122  FYGFATAKGLYIFD---TTVPSTSLPDLSKYKRGFIDWVHALLSMLVFGAVALRDKNVVS  178

Query  281  CLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSGK  141
            CLYP   H+TQEVLD+VP+GIGL+CSLLF+VFPTRRHGIG+P+TS K
Sbjct  179  CLYPAAGHQTQEVLDIVPVGIGLICSLLFVVFPTRRHGIGYPITSEK  225



>ref|XP_006389536.1| hypothetical protein POPTR_0022s00700g [Populus trichocarpa]
 gb|ERP48450.1| hypothetical protein POPTR_0022s00700g [Populus trichocarpa]
Length=233

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 160/197 (81%), Gaps = 9/197 (5%)
 Frame = -3

Query  710  EPLLPAAKS--PSFSQRA----LESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRP  549
            EP  P + S  P+FSQRA    L +TA+LANLLPTGTLLAFQ+LTPIFTNNGACD+AT P
Sbjct  39   EPETPKSPSRPPTFSQRAISQTLTNTANLANLLPTGTLLAFQILTPIFTNNGACDSATAP  98

Query  548  MTLVLLSILAVSCFLACFTDSVRG-RDGQVYYGFATRGGLWLFDYPaaaaagisaADLGK  372
            MT VLL++LAVSCFL  FTDSV+   DGQVYYGFAT  G++LFD P    +G+S  DL K
Sbjct  99   MTSVLLALLAVSCFLGSFTDSVKSPTDGQVYYGFATLKGMFLFDCPDPVGSGLS--DLSK  156

Query  371  FRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFL  192
             +  FID VHAVLSVLVFVA+AL+DKNV+SC YP P HETQEVLDV+P+GIGL+CSLLF+
Sbjct  157  LKLRFIDVVHAVLSVLVFVAVALRDKNVLSCFYPMPKHETQEVLDVIPVGIGLICSLLFM  216

Query  191  VFPTRRHGIGFPVTSGK  141
             FPTRRHGIG+PVT GK
Sbjct  217  AFPTRRHGIGYPVTPGK  233



>ref|XP_011088116.1| PREDICTED: uncharacterized protein LOC105169422 [Sesamum indicum]
Length=208

 Score =   263 bits (671),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 148/180 (82%), Gaps = 1/180 (1%)
 Frame = -3

Query  680  SFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLA  501
            S   +ALES+AHLANLLPTGTLLAFQLLTP+FTNNG+CD  TR MTLVLL ILA SCFLA
Sbjct  30   SMLSQALESSAHLANLLPTGTLLAFQLLTPVFTNNGSCDMVTRNMTLVLLFILAFSCFLA  89

Query  500  CFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLV  321
             FTDS++  DGQVYYGFAT  G+WLFDYP   AA   A +L K+R   +D VHAVLSVLV
Sbjct  90   SFTDSIKASDGQVYYGFATSRGMWLFDYP-TVAASGPAIELSKYRLRLVDLVHAVLSVLV  148

Query  320  FVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSGK  141
            F A+AL+DKNVVSCLYP P HE QEVLD+VP+GIGL+ SLLF++FPT+RHGIG+P+T  +
Sbjct  149  FAAVALRDKNVVSCLYPSPGHEVQEVLDIVPMGIGLISSLLFVIFPTKRHGIGYPITRDR  208



>gb|KDP42435.1| hypothetical protein JCGZ_00232 [Jatropha curcas]
Length=226

 Score =   262 bits (670),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 134/196 (68%), Positives = 157/196 (80%), Gaps = 8/196 (4%)
 Frame = -3

Query  710  EPLLPAA--KSPSFSQRA----LESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRP  549
            EP  P +  K+P+ SQRA    L STA+LANLLPTGTLLAFQLLTP+FT NGACD+ T+ 
Sbjct  33   EPSTPKSPTKTPTLSQRAISQTLTSTANLANLLPTGTLLAFQLLTPVFTKNGACDSVTQF  92

Query  548  MTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKF  369
            +T VLLS+LAVSCFLA FTDS++  DGQVYYGFAT  G++LFD P   + G    DL K+
Sbjct  93   LTFVLLSLLAVSCFLASFTDSIKSTDGQVYYGFATFKGIFLFDCPDPESLGDQ--DLRKY  150

Query  368  RAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLV  189
            R  FID VHAVLSVLVFVA+ALKDKNV+SC +  P  ETQEVLD+VP+GIGL+CSLLF+V
Sbjct  151  RIKFIDGVHAVLSVLVFVAVALKDKNVLSCFFSMPQQETQEVLDIVPVGIGLICSLLFVV  210

Query  188  FPTRRHGIGFPVTSGK  141
            FPTRRHGIG+PVT GK
Sbjct  211  FPTRRHGIGYPVTQGK  226



>ref|XP_002526458.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35953.1| conserved hypothetical protein [Ricinus communis]
Length=230

 Score =   255 bits (651),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 142/232 (61%), Positives = 170/232 (73%), Gaps = 18/232 (8%)
 Frame = -3

Query  791  SQNLRSRTATPAAPAV------------DDR--EVETLSVPEPLLPAAKSPSFSQRALES  654
            SQ+LR+RTA+     +            DD   E ET   P    P+    + SQ  L S
Sbjct  2    SQSLRARTASTKQEPIPEVSTASSSSASDDHLHEPETPKSPSRSSPSLSQRAISQ-TLTS  60

Query  653  TAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGR  474
            TA+LANLLPTGTLLAFQLLTPIFTNNGACD+ TRPMTL LL++LA+SCFL+ FTDSV+  
Sbjct  61   TANLANLLPTGTLLAFQLLTPIFTNNGACDSVTRPMTLCLLALLAISCFLSSFTDSVKSS  120

Query  473  DG-QVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKD  297
            DG QVYYG AT  G++LFD P    AG+   DL K++  FID VH+VLSVLVF+A AL+D
Sbjct  121  DGKQVYYGIATFKGIFLFDCPDPVGAGLK--DLSKYKIRFIDGVHSVLSVLVFIAFALRD  178

Query  296  KNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSGK  141
            KNVVSC YP P HETQEVL++ P+GIGL+CSLLF+VFPTRRHGIG+PVT+GK
Sbjct  179  KNVVSCFYPMPKHETQEVLNIAPVGIGLICSLLFVVFPTRRHGIGYPVTAGK  230



>ref|XP_008218737.1| PREDICTED: uncharacterized protein LOC103319023 [Prunus mume]
Length=229

 Score =   251 bits (641),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 133/214 (62%), Positives = 161/214 (75%), Gaps = 11/214 (5%)
 Frame = -3

Query  770  TATPAAPAVDDREVETLSVPEPLLPAAKSPSFSQRA----LESTAHLANLLPTGTLLAFQ  603
            T  PA+    + E +T     P  P    P+ SQRA    L STA+LANLLPTGTLLAFQ
Sbjct  23   TNPPASTTSSESEPDT-----PKSPQLPQPTLSQRAISQTLTSTANLANLLPTGTLLAFQ  77

Query  602  LLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLF  423
            LL PIFT+NG+CD+ATRPMTL+LL + A+SCF+A  TDSV+  DGQVYYG AT  GL+LF
Sbjct  78   LLIPIFTSNGSCDSATRPMTLILLLLFALSCFVASLTDSVKASDGQVYYGLATTKGLFLF  137

Query  422  DYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEV  243
            DYP   A+     DL K++  F+D VHAVLSV VF A+AL+DKNVV C YP P HETQEV
Sbjct  138  DYP--DASCSGLPDLSKYKIRFMDLVHAVLSVFVFGAVALRDKNVVGCFYPTPGHETQEV  195

Query  242  LDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSGK  141
            L++VP+GIGL+CSLLF+VFPT+RHGIG+P+TSGK
Sbjct  196  LNIVPVGIGLICSLLFVVFPTKRHGIGYPLTSGK  229



>ref|XP_007226107.1| hypothetical protein PRUPE_ppa010943mg [Prunus persica]
 gb|EMJ27306.1| hypothetical protein PRUPE_ppa010943mg [Prunus persica]
Length=229

 Score =   250 bits (639),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 154/193 (80%), Gaps = 6/193 (3%)
 Frame = -3

Query  707  PLLPAAKSPSFSQRA----LESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTL  540
            P  P    P+ SQRA    L STA+LANLLPTGTLLAFQLLTPIFT+NG+CD+ATRPMTL
Sbjct  39   PKSPQLPQPTLSQRAISQTLTSTANLANLLPTGTLLAFQLLTPIFTSNGSCDSATRPMTL  98

Query  539  VLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAG  360
            +LL + A+SCF+A  TDSV+  DGQVYYG AT  GL+LFDYP   A+G    DL K++  
Sbjct  99   ILLLLFALSCFIASLTDSVKASDGQVYYGLATTKGLFLFDYP--DASGSGLPDLSKYKIR  156

Query  359  FIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPT  180
            F+D VHAVLSV VF A+AL+DKNVV C YP P  ETQEVLD+VP+GIGL+CSLLF+VFPT
Sbjct  157  FMDLVHAVLSVFVFGAVALRDKNVVGCFYPTPGRETQEVLDIVPVGIGLICSLLFVVFPT  216

Query  179  RRHGIGFPVTSGK  141
            +RHGIG+P+TSGK
Sbjct  217  KRHGIGYPLTSGK  229



>gb|EYU26482.1| hypothetical protein MIMGU_mgv1a026928mg [Erythranthe guttata]
Length=221

 Score =   248 bits (633),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 144/175 (82%), Gaps = 2/175 (1%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFT  492
             +ALES+AHLANLLPTGTLLAFQ+LTPIFT NG+CD+ATRPMTLVLL I  +SCFLA FT
Sbjct  43   SQALESSAHLANLLPTGTLLAFQILTPIFTKNGSCDSATRPMTLVLLVIFTLSCFLASFT  102

Query  491  DSVRGR-DGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFV  315
            DSV+   DG+VYYG  T  GLWLFD P AAAAG    +L K+R  F+D VHAVLSVLVFV
Sbjct  103  DSVKSSTDGKVYYGLVTPKGLWLFDNPGAAAAGGLP-ELSKYRLSFVDVVHAVLSVLVFV  161

Query  314  AIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            A+AL+DKN+V C YP PN E QEVLD+VPIGIG + SLLF+ FPT+RHGIG+P+T
Sbjct  162  AVALRDKNIVGCFYPMPNQEAQEVLDIVPIGIGFIASLLFVAFPTKRHGIGYPIT  216



>ref|XP_008368178.1| PREDICTED: uncharacterized protein LOC103431786 [Malus domestica]
Length=220

 Score =   247 bits (631),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 144/227 (63%), Positives = 169/227 (74%), Gaps = 15/227 (7%)
 Frame = -3

Query  797  MSSQNLRSRTATPAAP----AVDDREVETLSVPEPLLPAAKSPSFSQRA----LESTAHL  642
            MS +   + T TPAAP      D    ET   P+P       P+FSQRA    L STA+L
Sbjct  1    MSLRPRATSTITPAAPQPTSTSDTEPDETPKSPQP-----PKPTFSQRAISQTLTSTANL  55

Query  641  ANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQV  462
            ANLLPTGTLLAFQLL PIFT NG+CDAATRPMTL+LL +LA+SCFLA FTDSV+  DGQV
Sbjct  56   ANLLPTGTLLAFQLLIPIFTGNGSCDAATRPMTLILLLLLALSCFLASFTDSVKALDGQV  115

Query  461  YYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVS  282
            YYG AT  GL++FDYP   A+G    DL K++  FID VHAVLSV VF A+AL+DKNV+ 
Sbjct  116  YYGLATTKGLFVFDYP--DASGSGLPDLSKYKIRFIDLVHAVLSVFVFGAVALRDKNVLG  173

Query  281  CLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSGK  141
            C YP P+H+TQEVLD+ P+GIGL+CSLLF+VFPTRRHGIGFP+T GK
Sbjct  174  CFYPTPDHQTQEVLDIGPVGIGLICSLLFVVFPTRRHGIGFPLTPGK  220



>ref|XP_007041237.1| Uncharacterized protein TCM_006175 [Theobroma cacao]
 gb|EOX97068.1| Uncharacterized protein TCM_006175 [Theobroma cacao]
Length=221

 Score =   247 bits (630),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 156/188 (83%), Gaps = 6/188 (3%)
 Frame = -3

Query  692  AKSPSFSQRA----LESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSI  525
            ++ PS SQRA    L STA+LANLLPTGTLLAFQLL PIFTNNG+CD+ATRPMTLVLL +
Sbjct  36   SRPPSLSQRAISQTLTSTANLANLLPTGTLLAFQLLMPIFTNNGSCDSATRPMTLVLLLL  95

Query  524  LAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYV  345
            LA+SCFLACFTDSV+  DGQVYYGFAT  G++LFD+P     G +  DL K+R  FID V
Sbjct  96   LALSCFLACFTDSVKSSDGQVYYGFATFKGMFLFDFP--DPTGSTLPDLSKYRIKFIDGV  153

Query  344  HAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGI  165
            HAVLSVLVF A+AL+DKNV++C YP P HETQEVL + P+GIGL+CSLLF+VFPTRRHGI
Sbjct  154  HAVLSVLVFGAVALRDKNVLNCFYPTPKHETQEVLSIAPVGIGLICSLLFVVFPTRRHGI  213

Query  164  GFPVTSGK  141
            G+P+T GK
Sbjct  214  GYPITLGK  221



>ref|XP_009410685.1| PREDICTED: uncharacterized protein LOC103992624 [Musa acuminata 
subsp. malaccensis]
Length=218

 Score =   245 bits (626),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 147/176 (84%), Gaps = 1/176 (1%)
 Frame = -3

Query  668  RALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTD  489
            +AL STAHLANLLPTGTLLAFQLLTP+FTNNG+CD ATR MT  LL +LA SCFLACFTD
Sbjct  42   QALASTAHLANLLPTGTLLAFQLLTPVFTNNGSCDTATRLMTQALLLLLAASCFLACFTD  101

Query  488  SVR-GRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVA  312
            S+R   DG+VYYGFATR G+WLF+Y   A+   +  DL K+R   +D+VHAVLSVLVF +
Sbjct  102  SIRSAADGRVYYGFATRRGMWLFNYDYVASPSAALPDLSKYRVRAVDWVHAVLSVLVFAS  161

Query  311  IALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSG  144
            +AL+D+N VSCLYP+P+ ET+E L V+P+G+G++ SLLF+VFPTRRHGIG+PVT+G
Sbjct  162  VALRDRNAVSCLYPRPSRETEEALSVLPLGVGVISSLLFVVFPTRRHGIGYPVTNG  217



>ref|XP_009353743.1| PREDICTED: uncharacterized protein LOC103944978 [Pyrus x bretschneideri]
Length=222

 Score =   242 bits (618),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 140/229 (61%), Positives = 166/229 (72%), Gaps = 17/229 (7%)
 Frame = -3

Query  797  MSSQNLRSRTATPAAP------AVDDREVETLSVPEPLLPAAKSPSFSQRA----LESTA  648
            MS +   + T TP AP      + D    ET   P+P       P+FSQRA    L STA
Sbjct  1    MSLRPRATSTITPVAPQPTSTSSSDTEPNETPKSPQP-----PQPTFSQRAISQTLTSTA  55

Query  647  HLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDG  468
            +LANLLPTGTLLAFQLL PIFT NG+CDAATRPMTL+LL +LA+SCFLA  TDS++  DG
Sbjct  56   NLANLLPTGTLLAFQLLIPIFTGNGSCDAATRPMTLILLLLLALSCFLASLTDSIKALDG  115

Query  467  QVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNV  288
            QVYYG AT  GL++FDYP   A+G    DL K++  FID VHAVLSV VF A+AL+DKNV
Sbjct  116  QVYYGLATTKGLFVFDYP--DASGSGLPDLSKYKIRFIDLVHAVLSVFVFGAVALRDKNV  173

Query  287  VSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSGK  141
            + C YP P H+TQEVLD+ P+GIGL+C LLF+VFPTRRHGIGFP+T GK
Sbjct  174  LGCFYPTPGHQTQEVLDIAPVGIGLICGLLFVVFPTRRHGIGFPLTPGK  222



>ref|XP_006385029.1| hypothetical protein POPTR_0004s23220g [Populus trichocarpa]
 gb|ERP62826.1| hypothetical protein POPTR_0004s23220g [Populus trichocarpa]
Length=231

 Score =   238 bits (607),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 134/196 (68%), Positives = 161/196 (82%), Gaps = 7/196 (4%)
 Frame = -3

Query  713  PEPLLPAAKSPSFSQRA----LESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPM  546
            PE     ++ P+ SQRA    L STA+LANLLPTGTLLAFQLLTP FTNNGACD+ATRPM
Sbjct  38   PETPKSPSRPPTLSQRAISQTLTSTANLANLLPTGTLLAFQLLTPFFTNNGACDSATRPM  97

Query  545  TLVLLSILAVSCFLACFTDSVRG-RDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKF  369
            TL+LL++LA+SCFLA FTDSVR   DG+VYYG A+  G++LFD P  AA+G+   DL KF
Sbjct  98   TLILLALLALSCFLASFTDSVRSPTDGRVYYGLASFKGMYLFDCPDPAASGLV--DLSKF  155

Query  368  RAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLV  189
            + GFID VHAVLSVLVF+++AL++KNV+SC YP P HETQEVL +VPIG+GL+CSLLF+V
Sbjct  156  KMGFIDVVHAVLSVLVFISVALREKNVLSCFYPMPKHETQEVLSIVPIGVGLICSLLFVV  215

Query  188  FPTRRHGIGFPVTSGK  141
            FPTRRHGIG+PV  GK
Sbjct  216  FPTRRHGIGYPVVQGK  231



>ref|XP_002869724.1| hypothetical protein ARALYDRAFT_492419 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45983.1| hypothetical protein ARALYDRAFT_492419 [Arabidopsis lyrata subsp. 
lyrata]
Length=213

 Score =   237 bits (605),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 120/215 (56%), Positives = 156/215 (73%), Gaps = 10/215 (5%)
 Frame = -3

Query  794  SSQNLRSRTATPAAPAVDDREVETLSVPEPLLPAAKSPSFSQRALESTAHLANLLPTGTL  615
            SS +L  R  T +       + ++ SVP+     ++  + SQ  L S A+LANLLPTGTL
Sbjct  3    SSSSLTQRNPTSS-------QEQSESVPQLRRQTSQHAAMSQ-TLTSAANLANLLPTGTL  54

Query  614  LAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGG  435
            LAF LL P+FT+NG+CD  TR +T  LL++L++SCFL+ FTDSV+  DG VYYGFATR G
Sbjct  55   LAFTLLIPVFTSNGSCDYPTRVLTAGLLTLLSISCFLSSFTDSVKAEDGNVYYGFATRKG  114

Query  434  LWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHE  255
            +W+FDYP     G+   DL K+R   ID++HAVLSVLVF A+AL+DKN VSC YP P  E
Sbjct  115  MWIFDYP--DPDGLGLPDLSKYRIRIIDWIHAVLSVLVFGAVALRDKNAVSCFYPAPEQE  172

Query  254  TQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            T++VLD+VP+G+G++C LLFLVFP RRHGIG+PVT
Sbjct  173  TKKVLDIVPMGVGVICGLLFLVFPARRHGIGYPVT  207



>ref|XP_010674193.1| PREDICTED: uncharacterized protein LOC104890412 [Beta vulgaris 
subsp. vulgaris]
Length=223

 Score =   238 bits (606),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 127/226 (56%), Positives = 159/226 (70%), Gaps = 14/226 (6%)
 Frame = -3

Query  821  KVAKSSTRMSSQNLRSRTATPAAPAVDDREVETLSVPEPLLPAAKSPSFSQRALESTAHL  642
            ++  +S +  S    S   T      DDR+      PEP L     PS +QRAL STA+L
Sbjct  7    RLPSTSIKQPSSTSNSDHQTSNNTISDDRK------PEPPL----QPSITQRALTSTANL  56

Query  641  ANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQV  462
            ANLLPTGTLLAFQLLTPIFTN+G CD  TR +T +LL++L +SCFLA FTDS R  DG+V
Sbjct  57   ANLLPTGTLLAFQLLTPIFTNHGQCDITTRSLTTLLLALLGISCFLASFTDSFRAPDGRV  116

Query  461  YYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVS  282
            YYGFAT  G+WLFDY           DL K++  FID VHAVLS++VF  ++L+DKNVV+
Sbjct  117  YYGFATLKGIWLFDY----YTDTVEVDLAKYKLRFIDCVHAVLSIIVFGVVSLRDKNVVN  172

Query  281  CLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSG  144
            C YPKP  E QEVLD++P+G+G++CSLLF+ FPTRRHGIG+PVT+ 
Sbjct  173  CFYPKPTQEVQEVLDILPLGVGVICSLLFVAFPTRRHGIGYPVTNA  218



>ref|XP_008810912.1| PREDICTED: uncharacterized protein LOC103722217 [Phoenix dactylifera]
Length=226

 Score =   238 bits (606),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 152/197 (77%), Gaps = 3/197 (2%)
 Frame = -3

Query  734  EVETLSVPEPLLPAAK-SPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAA  558
            E E   + +PL P A  S     +A+ STAHLANLLPTGTLLAF LLTP+FT NG+CDAA
Sbjct  30   EEEESLIEKPLPPPASLSRQALAQAITSTAHLANLLPTGTLLAFHLLTPVFTKNGSCDAA  89

Query  557  TRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADL  378
            TR +T  LL +LA SCFLACFTDS R  DG++Y+GFAT  G+WLFDYP       +  DL
Sbjct  90   TRFVTRSLLLLLAASCFLACFTDSFRSPDGRLYHGFATLRGMWLFDYP--LPPSSAPPDL  147

Query  377  GKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLL  198
             K+R  F+D+VHAVLSVLVF ++AL+DKNVV C YP+P HET+EVLD++P+G+G++CSLL
Sbjct  148  SKYRLRFVDFVHAVLSVLVFASVALRDKNVVDCFYPQPKHETKEVLDILPLGVGVICSLL  207

Query  197  FLVFPTRRHGIGFPVTS  147
            F+VFPTRR GIG+PV +
Sbjct  208  FVVFPTRRRGIGYPVAN  224



>emb|CDY08933.1| BnaC08g11630D [Brassica napus]
Length=221

 Score =   237 bits (604),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 123/216 (57%), Positives = 159/216 (74%), Gaps = 4/216 (2%)
 Frame = -3

Query  791  SQNLRSRTATPAAPAVDDREVETLSVPEPLLPAAKSPSFS--QRALESTAHLANLLPTGT  618
            S +L+ R  T +     + E E    P P L   +S S     + L S A+LANLLPTGT
Sbjct  2    SSSLKQRNPTSSQADDTEAEQELSESPPPQLRRQRSTSHQAMSQTLTSAANLANLLPTGT  61

Query  617  LLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRG  438
            LLAFQLL P+FT NG+C+ ATR +TLVLL++L++SCFL+ FTDSV+  DG VYYGFATR 
Sbjct  62   LLAFQLLIPVFTTNGSCEYATRVLTLVLLTLLSISCFLSSFTDSVKAEDGNVYYGFATRK  121

Query  437  GLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNH  258
            G+W+FDYP    +G+   DL K+R  F+D++HAVLS+LVF A+A++DKN VSC YP P  
Sbjct  122  GMWVFDYP--DPSGLGLPDLSKYRIRFVDWIHAVLSMLVFGAVAMRDKNAVSCFYPAPEQ  179

Query  257  ETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            ET++VLD+VPIG+G++C LLFLVFPTRRHG G+PVT
Sbjct  180  ETKKVLDIVPIGVGVICGLLFLVFPTRRHGFGYPVT  215



>ref|XP_010256253.1| PREDICTED: uncharacterized protein LOC104596698 [Nelumbo nucifera]
Length=221

 Score =   237 bits (604),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 132/222 (59%), Positives = 155/222 (70%), Gaps = 15/222 (7%)
 Frame = -3

Query  788  QNLRSRTATP--AAPAVDDREVETLSVPEPLLPAAKSPSFSQRA----LESTAHLANLLP  627
            Q  R+   TP    P+  D E +    P     ++  PS SQRA    L STAHLANLLP
Sbjct  9    QRSRTNNETPITETPSSSDDEKK----PPIATDSSAYPSISQRAISQTLASTAHLANLLP  64

Query  626  TGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFA  447
            TGTLLAFQLL P FTNNG CD+ TRP+TL+LL +LAVSC LA FTDS +  DG+VY+G A
Sbjct  65   TGTLLAFQLLVPTFTNNGTCDSVTRPLTLILLLVLAVSCSLASFTDSFKAPDGKVYHGIA  124

Query  446  TRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPK  267
            T  G+WLFDY      G S  DL  +R   ID+VHAVLSV VF  +AL+DKN++SC YP 
Sbjct  125  TWKGMWLFDY-----TGSSVPDLRNYRLRSIDFVHAVLSVFVFGTVALRDKNILSCFYPS  179

Query  266  PNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSGK  141
            P HETQEVLD+VP+ IGL CSLLF+VFPT RHGIG+PVTSG 
Sbjct  180  PAHETQEVLDIVPLAIGLFCSLLFVVFPTTRHGIGYPVTSGN  221



>ref|XP_010277272.1| PREDICTED: uncharacterized protein LOC104611772 [Nelumbo nucifera]
Length=229

 Score =   237 bits (604),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 137/222 (62%), Positives = 168/222 (76%), Gaps = 6/222 (3%)
 Frame = -3

Query  794  SSQNLRSRTATPAAPAVDDREVETLSVPEPLLPAAKSPSFSQRA----LESTAHLANLLP  627
            +  +LR R AT   P+  + E E L +P    P++ SPS SQ A    L STAHLANLLP
Sbjct  3    TEMSLRQRLATNKQPSDAEEEEEPLIIPNTATPSSSSPSVSQEAISQTLASTAHLANLLP  62

Query  626  TGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFA  447
            TGTLLAFQLLTP FTNNG CD+ TRP TL+LL  LA SCFLACFTDS + +DG+VY+G A
Sbjct  63   TGTLLAFQLLTPTFTNNGTCDSVTRPATLILLLALAASCFLACFTDSFKAQDGKVYHGIA  122

Query  446  TRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPK  267
            TR G+WLFDY  A ++  +  DL  +R   ID+VHAVLSVLVFVA+AL+D+N+VSC YPK
Sbjct  123  TRKGMWLFDY--AGSSASAPDDLSSYRIKLIDFVHAVLSVLVFVAVALRDRNIVSCFYPK  180

Query  266  PNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSGK  141
            P HETQEVLD+VP+ +GL+CSLLF+VFPT RHGIG+ +T G+
Sbjct  181  PKHETQEVLDIVPVAVGLICSLLFVVFPTTRHGIGYHITPGQ  222



>ref|XP_010657994.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC100244061 
[Vitis vinifera]
Length=210

 Score =   236 bits (602),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 143/177 (81%), Gaps = 0/177 (0%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFT  492
             + L STA+LANLLPTGTLLAFQLLTP+FTNNGACDA TR +TL+LL +LA SCFL  FT
Sbjct  34   SQTLASTANLANLLPTGTLLAFQLLTPVFTNNGACDAVTRSLTLILLLLLAFSCFLFSFT  93

Query  491  DSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVA  312
            DS +  DG+V+YG AT  GLWLFDY   + +  S  DL K++  FID VHAVLSVLVFVA
Sbjct  94   DSFKTPDGRVFYGIATFKGLWLFDYVDESGSAASLPDLSKYKFRFIDGVHAVLSVLVFVA  153

Query  311  IALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSGK  141
            +A++DKNVVSC YP+P  E QEVLD+VP+GIGL+CSLLF+VFPT RHGIG+PVT  K
Sbjct  154  VAMRDKNVVSCFYPQPAREVQEVLDIVPVGIGLICSLLFVVFPTTRHGIGYPVTHAK  210



>ref|XP_006282893.1| hypothetical protein CARUB_v10007137mg [Capsella rubella]
 gb|EOA15791.1| hypothetical protein CARUB_v10007137mg [Capsella rubella]
Length=219

 Score =   235 bits (600),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/215 (57%), Positives = 157/215 (73%), Gaps = 4/215 (2%)
 Frame = -3

Query  794  SSQNLRSRTATPAAPAVDDREVETLSVPEPLLPAAKSPSFSQRALESTAHLANLLPTGTL  615
            SS +L  R    + P  +D +  + SVP+     + S     + L S A+LANLLPTGTL
Sbjct  3    SSSSLTQRNPITSQP--NDSQEHSESVPQLRRQRSTSQRAMSQTLTSAANLANLLPTGTL  60

Query  614  LAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGG  435
            LAF LL P+FT+NG+CD ATR +T VLL++LA+SCFL+ FTDSV+  DG VYYGFATR G
Sbjct  61   LAFTLLIPVFTSNGSCDHATRVLTTVLLTLLAISCFLSSFTDSVKAEDGNVYYGFATRKG  120

Query  434  LWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHE  255
            +W+FDYP     G+   DL K+R   +D++HAVLSVLVF A+AL+DKN VSC YP P  E
Sbjct  121  MWVFDYP--DPNGLGLPDLSKYRIRIVDWIHAVLSVLVFGAVALRDKNAVSCFYPAPEQE  178

Query  254  TQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            T++VLD+VP+G+G+LC LLFLVFP RRHGIG+PVT
Sbjct  179  TKKVLDIVPMGVGVLCGLLFLVFPARRHGIGYPVT  213



>gb|KFK28986.1| hypothetical protein AALP_AA7G073800 [Arabis alpina]
Length=212

 Score =   233 bits (595),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 143/181 (79%), Gaps = 6/181 (3%)
 Frame = -3

Query  680  SFSQRALEST----AHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVS  513
            S SQRA+  T    A+LANLLPTGTLLAFQLL P+FT+NG+CD  TR MT VLL++L++S
Sbjct  28   STSQRAMSQTLTSAANLANLLPTGTLLAFQLLMPVFTSNGSCDYPTRVMTAVLLTLLSIS  87

Query  512  CFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVL  333
            CFL+ FTDSV+  DG VYYGFATR G+W+FDYP    +G+   DL K+    +D++HAVL
Sbjct  88   CFLSSFTDSVKAEDGNVYYGFATRKGMWVFDYP--DPSGLGLPDLRKYCIRIVDWIHAVL  145

Query  332  SVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPV  153
            SVLVF A+AL+DKN V+C YP P   T++VLD+VP+G+G++C LLFLVFP RRHG+G+PV
Sbjct  146  SVLVFGAVALRDKNAVTCFYPAPEQGTKKVLDIVPMGVGVICGLLFLVFPARRHGVGYPV  205

Query  152  T  150
            T
Sbjct  206  T  206



>ref|XP_010911365.1| PREDICTED: uncharacterized protein LOC105037387 [Elaeis guineensis]
Length=267

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 145/189 (77%), Gaps = 2/189 (1%)
 Frame = -3

Query  713  PEPLLPAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVL  534
            P P  P + S     +AL STAHL NLLPTGTLLAFQLLTP+FT NG+CDA TR MT  L
Sbjct  79   PLPPPPISHSQLAIAQALTSTAHLVNLLPTGTLLAFQLLTPVFTKNGSCDAVTRLMTQSL  138

Query  533  LSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFI  354
            L +LA SCFLACFTDS R  DG++YYG AT  G+WLFDYP    A  +  +L  +R  FI
Sbjct  139  LLLLAASCFLACFTDSFRLPDGRLYYGLATLRGMWLFDYP--PPASSALPELSTYRLRFI  196

Query  353  DYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRR  174
            D+VHAVLSVLVF ++AL+DKNVV C YP+P HET+EVLD++P+G+G++C LLF+VFPTRR
Sbjct  197  DFVHAVLSVLVFASVALRDKNVVDCFYPQPKHETKEVLDILPLGVGVICGLLFVVFPTRR  256

Query  173  HGIGFPVTS  147
            HGIG+P T 
Sbjct  257  HGIGYPDTK  265



>ref|XP_006471187.1| PREDICTED: uncharacterized protein LOC102623401 [Citrus sinensis]
Length=234

 Score =   234 bits (596),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 157/194 (81%), Gaps = 7/194 (4%)
 Frame = -3

Query  704  LLPAAKSPSFSQRALE----STAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLV  537
            +LP++ S S S+RAL     STA+LANLLPTGTLLAFQLLTPIFTNNG+CDAATR +TL+
Sbjct  41   ILPSS-STSLSRRALSQTLTSTANLANLLPTGTLLAFQLLTPIFTNNGSCDAATRLLTLL  99

Query  536  LLSILAVSCFLACFTDSVRGRD-GQVYYGFATRGGLWLFDY-PaaaaagisaADLGKFRA  363
            LL +LA SCFLA FTDSV+    GQVYYGFAT  GL+LFDY     A+     DL K+R 
Sbjct  100  LLLLLAASCFLASFTDSVKSSSSGQVYYGFATFKGLFLFDYIQNPNASDHDLPDLNKYRI  159

Query  362  GFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFP  183
             FID VHAVLSVLVF A+AL+DKNV+SC +P P HETQEVLD+VP+GIGL+CSLLF++FP
Sbjct  160  RFIDGVHAVLSVLVFAAVALRDKNVLSCFFPTPKHETQEVLDIVPVGIGLICSLLFVIFP  219

Query  182  TRRHGIGFPVTSGK  141
            TRRHGIG+P+T GK
Sbjct  220  TRRHGIGYPITPGK  233



>ref|XP_011028335.1| PREDICTED: uncharacterized protein LOC105128394 [Populus euphratica]
Length=231

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 159/196 (81%), Gaps = 7/196 (4%)
 Frame = -3

Query  713  PEPLLPAAKSPSFSQRA----LESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPM  546
            PE     ++ P+ SQRA    L STA+LANLLPTGTLLAFQLLTP FTNNGACD+ATRPM
Sbjct  38   PETPKSPSRPPTLSQRAISQTLTSTANLANLLPTGTLLAFQLLTPFFTNNGACDSATRPM  97

Query  545  TLVLLSILAVSCFLACFTDSVRG-RDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKF  369
            TL+LL++LA+SCFLA FTDSVR   DG+VYYG A+  G++LFD P  AA+G+   DL KF
Sbjct  98   TLILLALLALSCFLASFTDSVRSPTDGRVYYGLASFKGMYLFDCPDPAASGLV--DLSKF  155

Query  368  RAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLV  189
            +  FID VHAVLSVLVF+++AL+DKNV+SC YP P HETQEVL +VP+G+GL+CSLLF+V
Sbjct  156  KMRFIDVVHAVLSVLVFISVALRDKNVLSCFYPMPKHETQEVLSIVPVGVGLICSLLFVV  215

Query  188  FPTRRHGIGFPVTSGK  141
            FPTRRHG G+PV  GK
Sbjct  216  FPTRRHGSGYPVVQGK  231



>ref|XP_010534186.1| PREDICTED: uncharacterized protein LOC104809807 [Tarenaya hassleriana]
Length=224

 Score =   233 bits (594),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 158/223 (71%), Gaps = 14/223 (6%)
 Frame = -3

Query  785  NLRSRTATPAAPAVDDREVETLSVPEPLLPA----AKSPSFSQRALEST----AHLANLL  630
            +LRSRT    A    D++ E +  P P   A     +  S SQRA+  T    A+LANLL
Sbjct  3    SLRSRTTNDPA----DQQQELMPEPGPNPQAQPQLKRQRSMSQRAMSQTLTMAANLANLL  58

Query  629  PTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGF  450
            PTGTLLAFQLLTP FT+NG CD  TR  T VLL++LA+SCFL  FTDSV+  DG VYYGF
Sbjct  59   PTGTLLAFQLLTPAFTSNGVCDMTTRACTAVLLALLALSCFLTSFTDSVKADDGNVYYGF  118

Query  449  ATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYP  270
             TR G+W+FDYP    +G    DL K+R   +D++HAVLSVLVF A+AL+D NV+SC YP
Sbjct  119  VTRRGMWMFDYP--DPSGAGLPDLSKYRIRAMDWIHAVLSVLVFGAVALRDNNVLSCFYP  176

Query  269  KPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSGK  141
             P  +T+EVLD+VP+G+G++CSLLF VFP++RHGIGFPVT  +
Sbjct  177  SPESQTKEVLDIVPMGVGVVCSLLFSVFPSKRHGIGFPVTGSR  219



>emb|CDY24837.1| BnaA08g14730D [Brassica napus]
Length=219

 Score =   231 bits (590),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 124/216 (57%), Positives = 163/216 (75%), Gaps = 6/216 (3%)
 Frame = -3

Query  791  SQNLRSRTATPAAPAVDDREVETLSVPEPLLPAAKSPSFS--QRALESTAHLANLLPTGT  618
            S +L+ R +T + P  +D E E    P P L   +S S     + L S A+LANLLPTGT
Sbjct  2    SSSLKQRNSTSSQP--NDTEQEPPESPPPQLRRQRSTSHQAMSQTLTSAANLANLLPTGT  59

Query  617  LLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRG  438
            LLAFQLL P+FT NG+C+ ATR +TLVLL++L++SCFL+ FTDSV+  DG VYYGFATR 
Sbjct  60   LLAFQLLIPVFTTNGSCEYATRVLTLVLLTLLSISCFLSSFTDSVKAEDGNVYYGFATRK  119

Query  437  GLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNH  258
            G+W+FDYP    +G+   DL K+R  F+D++HAVLS+LVF A+A++D N VSC YP P  
Sbjct  120  GMWVFDYP--DPSGLGLPDLSKYRIRFVDWIHAVLSMLVFGAVAMRDNNAVSCFYPAPEQ  177

Query  257  ETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            ET++VLD+VP+G+G++CSLLFLVFPTRRHG+G+PVT
Sbjct  178  ETKKVLDIVPVGVGVICSLLFLVFPTRRHGVGYPVT  213



>ref|NP_186892.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF32450.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAT68357.1| hypothetical protein At3g02430 [Arabidopsis thaliana]
 gb|AAT69203.1| hypothetical protein At3g02430 [Arabidopsis thaliana]
 gb|AEE73807.1| uncharacterized protein AT3G02430 [Arabidopsis thaliana]
Length=219

 Score =   229 bits (585),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 153/215 (71%), Gaps = 9/215 (4%)
 Frame = -3

Query  782  LRSRTATPAAPAVDDREVETLSVPEPLLPAAKSPSFSQRALEST----AHLANLLPTGTL  615
            LR R A   AP +D+   +T S    L    +  S SQRA+ +T    A+L+NLLPTGTL
Sbjct  4    LRLRNANTPAPELDELSDQTPSESRVL---KRQMSMSQRAMSNTLTSAANLSNLLPTGTL  60

Query  614  LAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGG  435
            LAFQLLTP+FT+NG CD ATR +T VLL +LA SCF++ FTDSV+  DG +Y+GF T  G
Sbjct  61   LAFQLLTPVFTSNGVCDHATRFLTAVLLFLLAASCFVSSFTDSVKADDGTIYFGFVTFKG  120

Query  434  LWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHE  255
            +W+ DYP    +G+   DL K+R  F+D++HA LSVLVF A+AL+DK +  C YP P  E
Sbjct  121  MWVVDYP--DPSGLGLPDLAKYRMRFVDWIHATLSVLVFGAVALRDKYITDCFYPSPEAE  178

Query  254  TQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            T+ VLD+VP+G+G++CSLLF+VFP RRHGIG+ VT
Sbjct  179  TKHVLDIVPVGVGVMCSLLFMVFPARRHGIGYLVT  213



>ref|XP_009109249.1| PREDICTED: uncharacterized protein LOC103834908 [Brassica rapa]
Length=219

 Score =   229 bits (584),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 121/216 (56%), Positives = 161/216 (75%), Gaps = 6/216 (3%)
 Frame = -3

Query  791  SQNLRSRTATPAAPAVDDREVETLSVPEPLLPAAKSPSFS--QRALESTAHLANLLPTGT  618
            S +L+ R   P +   +D + E    P P L   +S S     + L S A+LANLLPTGT
Sbjct  2    SSSLKQRN--PTSSQANDTDQEPPESPPPQLRRQRSTSHQAMSQTLTSAANLANLLPTGT  59

Query  617  LLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRG  438
            LLAFQLL P+FT NG+C+ ATR +TLVLL++L++SCFL+ FTDSV+  DG VYYGFATR 
Sbjct  60   LLAFQLLIPVFTTNGSCEYATRVLTLVLLTLLSISCFLSSFTDSVKAEDGNVYYGFATRK  119

Query  437  GLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNH  258
            G+W+FDYP    +G+   DL K++  F+D++HAVLS+LVF A+A++D N VSC YP P  
Sbjct  120  GMWVFDYP--DPSGLGLPDLSKYKIRFVDWIHAVLSMLVFGAVAMRDNNAVSCFYPAPEQ  177

Query  257  ETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            ET++VLD+VP+G+G++CSLLFLVFPTRRHG+G+PVT
Sbjct  178  ETKKVLDIVPVGVGVICSLLFLVFPTRRHGVGYPVT  213



>ref|XP_010439058.1| PREDICTED: uncharacterized protein LOC104722562 [Camelina sativa]
Length=219

 Score =   229 bits (583),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 119/218 (55%), Positives = 154/218 (71%), Gaps = 4/218 (2%)
 Frame = -3

Query  794  SSQNLRSRTATPAAPAVDDREVETLSVPEPLLPAAKSPSFSQRALESTAHLANLLPTGTL  615
            SS +L  R    + P       E  SVP+     + S     + L S A+LANLLPTGTL
Sbjct  3    SSSSLTQRNPITSQPNGSQEGSE--SVPKLRRLRSTSQHAMSQTLTSAANLANLLPTGTL  60

Query  614  LAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGG  435
            LAF LL P+FT+NG+CD A+R +T  LL++LA+SCFL+ FTDSV+  DG VYYGFATR G
Sbjct  61   LAFTLLIPVFTSNGSCDHASRVLTTGLLTLLAISCFLSSFTDSVKAEDGNVYYGFATRKG  120

Query  434  LWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHE  255
            +W+FDYP     G+   DL K+R   +D++HAVLSVLVF A+A +DKN VSC YP P  E
Sbjct  121  MWVFDYP--DPNGLGLPDLSKYRMRIVDWIHAVLSVLVFGAVAFRDKNAVSCFYPAPEQE  178

Query  254  TQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSGK  141
            T++VLD++P+G+G++CSLLFLVFP RRHGIG+PVT  +
Sbjct  179  TKKVLDIIPMGVGVICSLLFLVFPARRHGIGYPVTGDR  216



>ref|XP_010448580.1| PREDICTED: uncharacterized protein LOC104731025 [Camelina sativa]
Length=219

 Score =   228 bits (581),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/218 (54%), Positives = 156/218 (72%), Gaps = 4/218 (2%)
 Frame = -3

Query  794  SSQNLRSRTATPAAPAVDDREVETLSVPEPLLPAAKSPSFSQRALESTAHLANLLPTGTL  615
            SS +L  R    + P  +  +  + SVP+     + S +   + L S A+LANLLPTGTL
Sbjct  3    SSSSLTQRNPISSQP--NGLQEGSESVPKLRRLRSTSQNAMSQTLTSAANLANLLPTGTL  60

Query  614  LAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGG  435
            LAF LL P+FT+NG+CD A R +T  LL++LA+SCF + FTDSV+  DG VYYGFATR G
Sbjct  61   LAFTLLIPVFTSNGSCDHANRILTTGLLTLLAISCFFSSFTDSVKAEDGNVYYGFATRKG  120

Query  434  LWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHE  255
            +W+FDYP     G+   DL K+R   +D++HAVLSVLVF A+AL+DKN VSC YP P  E
Sbjct  121  MWVFDYP--DPNGLGLPDLSKYRMRIVDWIHAVLSVLVFGAVALRDKNAVSCFYPAPEQE  178

Query  254  TQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSGK  141
            T++VLD++P+G+G++CSLLFLVFP RRHGIG+PVT  +
Sbjct  179  TKKVLDIIPMGVGVICSLLFLVFPARRHGIGYPVTGDR  216



>ref|XP_006471188.1| PREDICTED: uncharacterized protein LOC102623701 [Citrus sinensis]
Length=217

 Score =   227 bits (578),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 145/175 (83%), Gaps = 2/175 (1%)
 Frame = -3

Query  659  ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVR  480
            +STA+LANLLPTGTLLAFQLLTPIFTNNG+CDAATR +TL+LL +LA SCFLA FTDSV+
Sbjct  42   KSTANLANLLPTGTLLAFQLLTPIFTNNGSCDAATRLLTLLLLLLLAASCFLASFTDSVK  101

Query  479  GRD-GQVYYGFATRGGLWLFDYPaaaaagisaA-DLGKFRAGFIDYVHAVLSVLVFVAIA  306
                GQVYYGFAT  GL+LFDY     A      DL K+R  FID VHAVLSVLVF A+A
Sbjct  102  SSSSGQVYYGFATFKGLFLFDYIQNPNASDHDLPDLNKYRIRFIDGVHAVLSVLVFAAVA  161

Query  305  LKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSGK  141
            L+DKNV+SC +P P HETQEVLD+VP+GIGL+CSLLF++FPTRRHGIG+P+T GK
Sbjct  162  LRDKNVLSCFFPTPKHETQEVLDIVPVGIGLICSLLFVIFPTRRHGIGYPITPGK  216



>ref|XP_006413446.1| hypothetical protein EUTSA_v10026158mg [Eutrema salsugineum]
 gb|ESQ54899.1| hypothetical protein EUTSA_v10026158mg [Eutrema salsugineum]
Length=228

 Score =   227 bits (579),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 144/179 (80%), Gaps = 3/179 (2%)
 Frame = -3

Query  683  PSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFL  504
            P+ SQ  L S A+LANLLPTGTLLAFQLL P+FT+NG+CD ATR +T VLL++L++SCFL
Sbjct  48   PAMSQ-TLTSAANLANLLPTGTLLAFQLLMPVFTSNGSCDYATRVLTAVLLTLLSISCFL  106

Query  503  ACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVL  324
            + FTDSV+  DG VYYGFATR G+W+FDYP    +G+   DL K+R   +D++HAVLSVL
Sbjct  107  SSFTDSVKAEDGNVYYGFATRKGMWVFDYP--DPSGLGLPDLSKYRVRIVDWIHAVLSVL  164

Query  323  VFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTS  147
            VF A+AL+DKN V+C YP P   T++VLD+VP+G+G+LC +LFL+FP RRHGIG+PVT 
Sbjct  165  VFGAVALRDKNAVTCFYPAPEQGTKKVLDIVPMGVGVLCGMLFLIFPARRHGIGYPVTG  223



>ref|XP_010433789.1| PREDICTED: uncharacterized protein LOC104717852 [Camelina sativa]
Length=219

 Score =   226 bits (577),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 145/190 (76%), Gaps = 2/190 (1%)
 Frame = -3

Query  719  SVPEPLLPAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTL  540
            SVP+     + S +   + L S A+LANLLPTGTLLAF LL PIFT+NG+CD A R +T 
Sbjct  26   SVPKLRRLRSTSQNAMSQTLTSAANLANLLPTGTLLAFTLLIPIFTSNGSCDHANRILTT  85

Query  539  VLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAG  360
             LL++LA+SCFL+ FTDSV+  DG VYYGFAT  G+W+FDYP     G+   DL K+R  
Sbjct  86   GLLTLLAISCFLSSFTDSVKAEDGNVYYGFATHKGMWVFDYP--DPNGLGLPDLSKYRMR  143

Query  359  FIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPT  180
             +D++HAVLSVLVF A+AL+DKN VSC YP P  ET++VLD++P+G+G++CSLLFLVFP 
Sbjct  144  IVDWIHAVLSVLVFGAVALRDKNAVSCFYPAPEQETKKVLDIIPMGVGVICSLLFLVFPA  203

Query  179  RRHGIGFPVT  150
            RRHGIG+PVT
Sbjct  204  RRHGIGYPVT  213



>ref|XP_009118017.1| PREDICTED: uncharacterized protein LOC103843066 [Brassica rapa]
Length=221

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/220 (55%), Positives = 155/220 (70%), Gaps = 8/220 (4%)
 Frame = -3

Query  782  LRSRTATPAAPAVDDREVETLSVPEPLLPAAKSPSFSQRALEST----AHLANLLPTGTL  615
            L+ R A   AP +DD   +  S  +PL+   +  S SQRA+ +T    A+L+NLLPTGTL
Sbjct  4    LKLRNANFPAPEIDDLSKQLSSDRQPLV-LKRQRSVSQRAMSNTLTSAANLSNLLPTGTL  62

Query  614  LAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGG  435
            LAFQLLTP+FT+NG CD ATR +T  LL +LA SCF++ FTDSV+  +G VYYGF T  G
Sbjct  63   LAFQLLTPVFTSNGVCDHATRFLTAGLLFLLAASCFISSFTDSVKADNGTVYYGFVTFNG  122

Query  434  LWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHE  255
            +W+ DY  A  +G+   DL K+R  F+D++HA LSVLVF A+AL+DK V  C YP P  E
Sbjct  123  MWVVDY--ADPSGLGLPDLSKYRMRFVDWIHATLSVLVFGAVALRDKYVTDCFYPSPEEE  180

Query  254  TQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSGKSD  135
            T+ VLD+VP+GIG++CSLLF VFPTRR GIG+ VT G  D
Sbjct  181  TKHVLDIVPVGIGVICSLLFTVFPTRRLGIGYLVT-GNGD  219



>ref|XP_010463647.1| PREDICTED: uncharacterized protein LOC104744317 [Camelina sativa]
Length=220

 Score =   225 bits (573),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/218 (53%), Positives = 151/218 (69%), Gaps = 9/218 (4%)
 Frame = -3

Query  791  SQNLRSRTATPAAPAVDDREVETLSVPEPLLPAAKSPSFSQRALEST----AHLANLLPT  624
            S +LR R A   AP +D+   +    P       +  S SQRA+ +T    A+L+NLLPT
Sbjct  2    SSSLRLRNANTPAPELDEFSNQP---PSETRMLRRQMSMSQRAMSNTLTSAANLSNLLPT  58

Query  623  GTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFAT  444
            GTLLAFQLLTP+FT+NG CD ATR +T VLL +LA SCF++ FTDSV+  DG +Y+GF T
Sbjct  59   GTLLAFQLLTPVFTSNGVCDHATRSLTAVLLYMLAASCFVSSFTDSVKADDGTIYFGFVT  118

Query  443  RGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKP  264
              G+W+ DYP    +G    DL K+R   +D++HA LSVLVF A+AL+DK V  C  P P
Sbjct  119  FKGMWVVDYP--DPSGFGLPDLSKYRMRVVDWIHATLSVLVFGAVALRDKYVTDCFCPSP  176

Query  263  NHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
              ET+ VLD+VP+G+G++CSLLF+VFPTRRHGIG+ VT
Sbjct  177  EAETKHVLDIVPVGVGVMCSLLFMVFPTRRHGIGYLVT  214



>gb|EMS48436.1| hypothetical protein TRIUR3_02208 [Triticum urartu]
Length=227

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 152/215 (71%), Gaps = 5/215 (2%)
 Frame = -3

Query  779  RSRTATPAAPAVDDREVETLSVPEPLLPAAKSPSFSQRALESTAHLANLLPTGTLLAFQL  600
            R RTA  A+P + D++ E     +P+ P     +  Q AL STA LANLLPTGT+LAFQL
Sbjct  13   RQRTAAAASPLLQDQQQEKHEAVDPVPPPPPRSTLYQ-ALTSTASLANLLPTGTVLAFQL  71

Query  599  LTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFD  420
            L P FT++GACDA T  +T +LL++LA+SC LA FTDS++G DG+VYYG AT  GLWL D
Sbjct  72   LAPTFTDHGACDATTALLTRILLAVLALSCLLASFTDSLKGPDGRVYYGVATLRGLWLLD  131

Query  419  YPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLY-PKPNHETQEV  243
            YP       +  D  ++R   ID VHA LSV VF  +A +DKNVV C Y P P  ET++V
Sbjct  132  YP---PGAPTPPDTSRYRLAPIDAVHAALSVAVFGVVAARDKNVVRCFYGPSPARETEQV  188

Query  242  LDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSGKS  138
            LD+VP+G+G+LCSLLF+ FPTRRHGIG+PVT+G +
Sbjct  189  LDIVPLGVGVLCSLLFVAFPTRRHGIGYPVTNGAA  223



>ref|XP_010417271.1| PREDICTED: uncharacterized protein LOC104703038 [Camelina sativa]
Length=220

 Score =   225 bits (573),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/218 (54%), Positives = 151/218 (69%), Gaps = 9/218 (4%)
 Frame = -3

Query  791  SQNLRSRTATPAAPAVDDREVETLSVPEPLLPAAKSPSFSQRALEST----AHLANLLPT  624
            S +LR R A   AP +D+   +  S    L    +  S SQRA+ +T    A+L+NLLPT
Sbjct  2    SSSLRLRNANTPAPELDEFSDQPSSETRML---KRQMSVSQRAMSNTLTSAANLSNLLPT  58

Query  623  GTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFAT  444
            GTLLAFQLLTP+FT+NG CD ATR +T VLL +LA SCF++ FTDSV+  DG  Y+GF T
Sbjct  59   GTLLAFQLLTPVFTSNGVCDHATRSLTAVLLYLLAASCFVSSFTDSVKAHDGTTYFGFVT  118

Query  443  RGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKP  264
              G+W+ DYP    +G    DL K+R   +D++HA LSVLVF A+AL+DK V  C  P P
Sbjct  119  FKGMWVVDYP--DPSGFGLPDLSKYRMRVVDWIHATLSVLVFGAVALRDKYVTDCFCPSP  176

Query  263  NHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
              ET+ VLD+VP+G+G++CSLLF+VFPTRRHGIG+ VT
Sbjct  177  EAETKHVLDIVPVGVGVMCSLLFMVFPTRRHGIGYLVT  214



>dbj|BAJ95368.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=230

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/217 (55%), Positives = 148/217 (68%), Gaps = 6/217 (3%)
 Frame = -3

Query  779  RSRTATPAAPAVDDREVETLSVPEPLLPAAKSPSFSQ--RALESTAHLANLLPTGTLLAF  606
            R RTA  A+P + D++ E                 S   +AL STA LANLLPTGT+LAF
Sbjct  13   RQRTAAAASPLLQDQQQEKHQDGAVDPVPPPPAPRSTLYQALTSTASLANLLPTGTVLAF  72

Query  605  QLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWL  426
            QLL P FTN+GACDA T  +T +LL++LA+SC LA FTDS++G DG+VYYG AT  GLWL
Sbjct  73   QLLAPAFTNHGACDATTALLTRILLAVLALSCLLASFTDSLKGPDGRVYYGVATLRGLWL  132

Query  425  FDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLY-PKPNHETQ  249
             DYP       +  D  ++R   ID VHA LSV VF  +A +DKNVV C Y P P  ET+
Sbjct  133  LDYP---PGAPTPPDTARYRLAPIDAVHAALSVAVFGVVAARDKNVVRCFYGPSPARETE  189

Query  248  EVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSGKS  138
            EVLD+VP+G+G+LCSLLF+ FPTRRHGIG+PVT+G S
Sbjct  190  EVLDIVPLGVGVLCSLLFVAFPTRRHGIGYPVTNGAS  226



>ref|XP_010497147.1| PREDICTED: uncharacterized protein LOC104774184 [Camelina sativa]
Length=222

 Score =   224 bits (572),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 117/218 (54%), Positives = 151/218 (69%), Gaps = 9/218 (4%)
 Frame = -3

Query  791  SQNLRSRTATPAAPAVDDREVETLSVPEPLLPAAKSPSFSQRALEST----AHLANLLPT  624
            S +LR R A   AP +D+   +  S    L    +  S SQRA+ +T    A+L+NLLPT
Sbjct  2    SSSLRLRNANTPAPELDEFSDQPSSETRML---KRQMSVSQRAMSNTLTSAANLSNLLPT  58

Query  623  GTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFAT  444
            GTLLAFQLLTP+FT+NG CD ATR +T VLL +LA SCF++ FTDSV+  DG  Y+GF T
Sbjct  59   GTLLAFQLLTPVFTSNGVCDHATRSLTAVLLYLLAASCFVSSFTDSVKAHDGTTYFGFVT  118

Query  443  RGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKP  264
              G+W+ DYP    +G    DL K+R   +D++HA LSVLVF A+AL+DK V  C  P P
Sbjct  119  FKGMWVVDYP--DPSGFGLPDLSKYRMRVVDWIHATLSVLVFGAVALRDKYVTDCFCPSP  176

Query  263  NHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
              ET+ VLD+VP+G+G++CSLLF+VFPTRRHGIG+ VT
Sbjct  177  EAETKHVLDIVPVGVGVMCSLLFMVFPTRRHGIGYLVT  214



>emb|CDY34728.1| BnaA01g32970D [Brassica napus]
Length=221

 Score =   224 bits (572),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 121/220 (55%), Positives = 155/220 (70%), Gaps = 8/220 (4%)
 Frame = -3

Query  782  LRSRTATPAAPAVDDREVETLSVPEPLLPAAKSPSFSQRALEST----AHLANLLPTGTL  615
            L+ R A   AP +DD   +  S  +PL+   +  S SQRA+ +T    A+L+NLLPTGTL
Sbjct  4    LKLRNANFPAPEIDDLSKQLSSDRQPLV-LKRQRSVSQRAMSNTLTSAANLSNLLPTGTL  62

Query  614  LAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGG  435
            LAFQLLTP+FT+NG CD ATR +T  LL +LA SCF++ FTDSV+  +G VYYGF T  G
Sbjct  63   LAFQLLTPVFTSNGVCDHATRFLTAGLLFLLAASCFISSFTDSVKTDNGTVYYGFVTFNG  122

Query  434  LWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHE  255
            +W+ DY  A  +G+   DL K+R  F+D++HA LSVLVF A+AL+DK V  C YP P  E
Sbjct  123  MWVVDY--ADPSGLGLPDLSKYRMRFVDWIHATLSVLVFGAVALRDKYVTDCFYPSPEEE  180

Query  254  TQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSGKSD  135
            T+ VLD+VP+GIG++CSLLF VFPTRR GIG+ VT G  D
Sbjct  181  TKHVLDIVPVGIGVICSLLFTVFPTRRLGIGYLVT-GNGD  219



>ref|XP_009137953.1| PREDICTED: uncharacterized protein LOC103861987 [Brassica rapa]
 emb|CDY34278.1| BnaA01g13810D [Brassica napus]
Length=220

 Score =   224 bits (571),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 144/184 (78%), Gaps = 6/184 (3%)
 Frame = -3

Query  689  KSPSFSQRA----LESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSIL  522
            + PS SQ A    L S A+LANLLPTGTLLAFQ L P+FT+NG+C  +TR +T VLL++L
Sbjct  33   RQPSISQHAVSQTLTSVANLANLLPTGTLLAFQFLIPVFTSNGSCKYSTRVLTAVLLTLL  92

Query  521  AVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVH  342
            ++SCFL+ FTDSV+  DG VYYGFATR G+W+FDYP    +G+   DL K+R   +D++H
Sbjct  93   SISCFLSSFTDSVKAEDGNVYYGFATRKGMWVFDYP--DPSGLGLPDLSKYRIRIVDWIH  150

Query  341  AVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIG  162
            AVLSVLVF A+AL++KN VSC YP P   T++VLD+VP+G+G++C LLFLVFP RRHGIG
Sbjct  151  AVLSVLVFGAVALREKNAVSCFYPAPEQGTKKVLDIVPMGVGVICGLLFLVFPARRHGIG  210

Query  161  FPVT  150
            +PVT
Sbjct  211  YPVT  214



>ref|XP_010485487.1| PREDICTED: uncharacterized protein LOC104763805 [Camelina sativa]
Length=220

 Score =   224 bits (570),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 118/224 (53%), Positives = 153/224 (68%), Gaps = 10/224 (4%)
 Frame = -3

Query  791  SQNLRSRTATPAAPAVDDREVETLSVPEPLLPAAKSPSFSQRALEST----AHLANLLPT  624
            S +LR R A   AP +D+   +    P       +  S SQR + +T    A+L+NLLPT
Sbjct  2    SSSLRLRNANTPAPELDEFSDQP---PSETRVLKRQMSISQRTMSNTLTSAANLSNLLPT  58

Query  623  GTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFAT  444
            GTLLAFQLLTP+FT+NG CD ATR +T VLL +LA SCF++ FTDSV+  DG  Y+GF T
Sbjct  59   GTLLAFQLLTPVFTSNGVCDHATRSLTAVLLYLLAASCFVSSFTDSVKADDGTTYFGFVT  118

Query  443  RGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKP  264
              G+W+ DYP    +G+   DL K+R   +D++HA LSVLVF A+AL+DK V  C  P P
Sbjct  119  FKGMWIVDYP--DPSGLGLPDLSKYRMRVVDWIHATLSVLVFGAVALRDKYVTDCFCPSP  176

Query  263  NHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSGKSDL  132
              ET+ VLD+VP+G+G++CSLLF+VFPTRRHGIG+ VT G  DL
Sbjct  177  EAETKHVLDIVPVGVGVMCSLLFMVFPTRRHGIGYLVT-GNVDL  219



>ref|XP_006408418.1| hypothetical protein EUTSA_v10021481mg [Eutrema salsugineum]
 gb|ESQ49871.1| hypothetical protein EUTSA_v10021481mg [Eutrema salsugineum]
Length=222

 Score =   223 bits (569),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 117/220 (53%), Positives = 150/220 (68%), Gaps = 11/220 (5%)
 Frame = -3

Query  791  SQNLRSRTATPAAPAVDDREVETLSVPEPLLPAA--KSPSFSQRALEST----AHLANLL  630
            S  LR R A   AP  DD   +   +P    PAA  +  S SQRA+ +T    A+L+NLL
Sbjct  2    SSGLRLRNAYIPAPEPDDLSEQ---LPSETQPAALKRQMSMSQRAMSNTLTSAANLSNLL  58

Query  629  PTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGF  450
            PTGTLLAFQLLTP+FT+NG CD ATR +T +LL +LA SCF++ FTDSV+  DG +Y+GF
Sbjct  59   PTGTLLAFQLLTPVFTSNGVCDHATRFLTAILLFLLAASCFVSSFTDSVKADDGTIYFGF  118

Query  449  ATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYP  270
             T  G+W+ DYP     G    DL K+R   +D++HA LSVLVF A+AL+DK V  C  P
Sbjct  119  VTFKGMWVVDYP--DITGSGLPDLAKYRMRVVDWIHATLSVLVFGAVALRDKYVTDCFCP  176

Query  269  KPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
             P  ET+ VLD+VP+G+G++C+LLF VFP RRHGIG+ VT
Sbjct  177  SPEEETKHVLDIVPVGVGVMCTLLFTVFPARRHGIGYLVT  216



>ref|NP_194162.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB45066.1| putative protein [Arabidopsis thaliana]
 emb|CAB79341.1| putative protein [Arabidopsis thaliana]
 gb|AAO44044.1| At4g24310 [Arabidopsis thaliana]
 dbj|BAF00043.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE84888.1| uncharacterized protein AT4G24310 [Arabidopsis thaliana]
Length=213

 Score =   223 bits (567),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 150/195 (77%), Gaps = 3/195 (2%)
 Frame = -3

Query  734  EVETLSVPEPLLPAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAAT  555
            + ++ SVP+     ++    SQ  L S A+LANLLPTGTLLAF LL P+FT+NG+CD  T
Sbjct  16   QEQSESVPQLRRQTSQHAVMSQ-TLTSAANLANLLPTGTLLAFTLLIPVFTSNGSCDYPT  74

Query  554  RPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLG  375
            + +T+VLL++L++SCFL+ FTDSV+  DG VYYGFATR G+W+FDYP     G+   +L 
Sbjct  75   QVLTIVLLTLLSISCFLSSFTDSVKAEDGNVYYGFATRKGMWVFDYP--DPDGLGLPNLS  132

Query  374  KFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLF  195
            K+R   ID++HAVLSVLVF A+AL+DKN VSC YP P  ET++VLD+VP+G+G++C +LF
Sbjct  133  KYRIRIIDWIHAVLSVLVFGAVALRDKNAVSCFYPAPEQETKKVLDIVPMGVGVICGMLF  192

Query  194  LVFPTRRHGIGFPVT  150
            LVFP RRHGIG+PVT
Sbjct  193  LVFPARRHGIGYPVT  207



>ref|XP_006431669.1| hypothetical protein CICLE_v10003600mg [Citrus clementina]
 gb|ESR44909.1| hypothetical protein CICLE_v10003600mg [Citrus clementina]
 gb|KDO39056.1| hypothetical protein CISIN_1g048572mg [Citrus sinensis]
Length=234

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 145/178 (81%), Gaps = 2/178 (1%)
 Frame = -3

Query  668  RALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTD  489
            + L STA+LANLLPTGTLLAFQLLTPIFTNNG+CDAAT P+TL+LL +LA SC LA FTD
Sbjct  56   QTLTSTANLANLLPTGTLLAFQLLTPIFTNNGSCDAATGPLTLLLLLLLAASCLLASFTD  115

Query  488  SVRGRD-GQVYYGFATRGGLWLFDY-PaaaaagisaADLGKFRAGFIDYVHAVLSVLVFV  315
            SV+    GQVYYGFAT  GL+LFDY     A+     DL K+R  FID VHAV SVLVF 
Sbjct  116  SVKSSSSGQVYYGFATFKGLFLFDYIQNPNASDHDLPDLIKYRIRFIDGVHAVSSVLVFA  175

Query  314  AIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSGK  141
            A+AL+DKNV+SC +P P HETQEVLD+VP+GIGL+CSLLF++FPTRRHGIG+P+T GK
Sbjct  176  AVALRDKNVLSCFFPTPKHETQEVLDIVPVGIGLICSLLFVIFPTRRHGIGYPITPGK  233



>ref|XP_002882229.1| hypothetical protein ARALYDRAFT_896211 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58488.1| hypothetical protein ARALYDRAFT_896211 [Arabidopsis lyrata subsp. 
lyrata]
Length=219

 Score =   223 bits (567),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 151/215 (70%), Gaps = 9/215 (4%)
 Frame = -3

Query  782  LRSRTATPAAPAVDDREVETLSVPEPLLPAAKSPSFSQRALEST----AHLANLLPTGTL  615
            LR R A   AP +D+   +T S    L    +  S SQRA+ +T    A+L+NLLPTGTL
Sbjct  4    LRLRNANTPAPELDEFSDQTPSDSRVL---KRQMSISQRAMSNTLTSAANLSNLLPTGTL  60

Query  614  LAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGG  435
            LAFQLLTP+FT+NG CD ATR +T VLL +LA SCF++ FTDSV+  DG +Y+GF T  G
Sbjct  61   LAFQLLTPVFTSNGVCDHATRFLTAVLLFLLAASCFVSSFTDSVKAEDGTIYFGFVTFKG  120

Query  434  LWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHE  255
            +W+ DYP    +G+   DL K+R   +D++HA LSVLVF A+AL+DK +  C  P P  E
Sbjct  121  MWVVDYP--DPSGLGLPDLAKYRMRVVDWIHATLSVLVFGAVALRDKYITDCFCPSPEAE  178

Query  254  TQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            T+ VLD+VP+G+G++CSLLF+VFP RRHGIG+ VT
Sbjct  179  TKHVLDIVPVGVGVMCSLLFMVFPARRHGIGYLVT  213



>emb|CBI29711.3| unnamed protein product [Vitis vinifera]
Length=238

 Score =   223 bits (567),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 132/181 (73%), Gaps = 22/181 (12%)
 Frame = -3

Query  671  QRALE----STAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFL  504
            QRAL     STA+LANLLPTGTLLAFQLLTP+FTNNGACDA TR                
Sbjct  76   QRALSQTLASTANLANLLPTGTLLAFQLLTPVFTNNGACDAVTR----------------  119

Query  503  ACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVL  324
              FTDS +  DG+V+YG AT  GLWLFDY   + +  S  DL K++  FID VHAVLSVL
Sbjct  120  --FTDSFKTPDGRVFYGIATFKGLWLFDYVDESGSAASLPDLSKYKFRFIDGVHAVLSVL  177

Query  323  VFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSG  144
            VFVA+A++DKNVVSC YP+P  E QEVLD+VP+GIGL+CSLLF+VFPT RHGIG+PVT  
Sbjct  178  VFVAVAMRDKNVVSCFYPQPAREVQEVLDIVPVGIGLICSLLFVVFPTTRHGIGYPVTHA  237

Query  143  K  141
            K
Sbjct  238  K  238



>emb|CDY03457.1| BnaC01g16250D [Brassica napus]
Length=216

 Score =   221 bits (564),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 143/181 (79%), Gaps = 6/181 (3%)
 Frame = -3

Query  680  SFSQRA----LESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVS  513
            S SQ A    L S A+LANLLPTGTLLAFQ L P+FT+NG+C+ +TR +T VLL++L++S
Sbjct  32   SISQHAVSQTLTSVANLANLLPTGTLLAFQFLIPVFTSNGSCEYSTRVLTAVLLTLLSIS  91

Query  512  CFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVL  333
            CFL+ FTDSV+  DG VYYGFATR G+W+FDYP    +G+   DL K+R   +D++HAVL
Sbjct  92   CFLSSFTDSVKAEDGNVYYGFATRKGMWVFDYP--DPSGLGLPDLSKYRIRIVDWIHAVL  149

Query  332  SVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPV  153
            SVLVF A+AL++KN VSC YP P   T++VLD+VP+G+G++C LLFLVFP RRHGIG+PV
Sbjct  150  SVLVFGAVALREKNAVSCFYPAPEQGTKKVLDIVPMGVGVICGLLFLVFPARRHGIGYPV  209

Query  152  T  150
            T
Sbjct  210  T  210



>ref|XP_006851260.1| hypothetical protein AMTR_s00180p00057430 [Amborella trichopoda]
 gb|ERN12841.1| hypothetical protein AMTR_s00180p00057430 [Amborella trichopoda]
Length=221

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 154/219 (70%), Gaps = 9/219 (4%)
 Frame = -3

Query  785  NLRSRTATPAAPAV--DDREVETLSVPEPLLPAAKSPSFSQRALE----STAHLANLLPT  624
            +LR+RT  P  P    +    E     EPL+  +  PS SQRAL     STA+LA LLPT
Sbjct  2    SLRARTRNPNDPPQHHNHETQEKHKAKEPLI--SIGPSLSQRALSQALASTANLAKLLPT  59

Query  623  GTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFAT  444
            GTLLAFQLLTPIF+NNGACD+ TR +T +LL  LA SCFLA FTDS R  DGQ++YG AT
Sbjct  60   GTLLAFQLLTPIFSNNGACDSTTRSLTQLLLLFLAFSCFLASFTDSFRSNDGQLHYGLAT  119

Query  443  RGGLWLFDYPaaaa-agisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPK  267
              G+WLFD P         A +L K+R  FID+ HAV SVLVF  +AL+D+NV SCLYP 
Sbjct  120  LKGMWLFDAPLERGPTQWIAPELNKYRLRFIDFAHAVTSVLVFGVVALRDRNVRSCLYPN  179

Query  266  PNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            P+ E QEVL++VPIG+GL+CSLLF+ FPT RHGIG+PVT
Sbjct  180  PDPEEQEVLNIVPIGVGLICSLLFVAFPTTRHGIGYPVT  218



>ref|XP_006659030.1| PREDICTED: uncharacterized protein LOC102709583 [Oryza brachyantha]
Length=219

 Score =   219 bits (559),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 115/216 (53%), Positives = 140/216 (65%), Gaps = 1/216 (0%)
 Frame = -3

Query  794  SSQNLRSRTATPAAPAVDDREVETLSVPEPLLPAAKSPSFSQRALESTAHLANLLPTGTL  615
            SS  +R R A        D             P A  PS   +AL STA LANLLPTGT+
Sbjct  3    SSAVVRQRPAIGKPAGEGDSAAVAAGDGGGARPPAARPSLFSQALASTASLANLLPTGTV  62

Query  614  LAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGG  435
            +AFQLL P FTNNGACDA T  +T  LL++LA+SC LA FTDS+RG DG+VYYG AT  G
Sbjct  63   MAFQLLAPTFTNNGACDATTALLTAGLLAVLALSCVLASFTDSLRGPDGRVYYGLATPRG  122

Query  434  LWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHE  255
            LWL DY  +        D  ++R   ID VHA LS  VF  +A +DKNVV C +P P  E
Sbjct  123  LWLLDY-PSGPGAAPPPDTSRYRLRTIDAVHAALSAGVFGVVAARDKNVVGCFWPAPAKE  181

Query  254  TQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTS  147
            T+EVL +VP+G+G++CSLLF+VFPT RHGIG+PVT+
Sbjct  182  TEEVLGIVPLGVGVICSLLFVVFPTTRHGIGYPVTN  217



>ref|XP_004972417.1| PREDICTED: uncharacterized protein LOC101783676 [Setaria italica]
Length=231

 Score =   219 bits (557),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 135/177 (76%), Gaps = 2/177 (1%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFT  492
             +AL STA+LANLLPTGTLLAF LL+P FTN+GACDA T  +T  LL++LA+SC LA FT
Sbjct  57   SQALTSTANLANLLPTGTLLAFNLLSPTFTNHGACDATTALLTRGLLAVLALSCVLASFT  116

Query  491  DSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVA  312
            DS++G DG+VYYG AT  GLWL DY     A   AAD  ++R  F+D+VHA LS  VF  
Sbjct  117  DSLKGPDGRVYYGVATPRGLWLIDY--PPGAPPPAADTARYRLAFVDFVHAALSAAVFGV  174

Query  311  IALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSGK  141
            +A +DKNVV C  P P  ET+EVLD++P+G+G+LCSLLF+ FPTRRHGIG+PVT+G 
Sbjct  175  VAARDKNVVRCFCPAPARETEEVLDILPLGVGVLCSLLFVAFPTRRHGIGYPVTNGS  231



>ref|XP_006299851.1| hypothetical protein CARUB_v10016054mg [Capsella rubella]
 gb|EOA32749.1| hypothetical protein CARUB_v10016054mg [Capsella rubella]
Length=219

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 149/215 (69%), Gaps = 9/215 (4%)
 Frame = -3

Query  782  LRSRTATPAAPAVDDREVETLSVPEPLLPAAKSPSFSQRALEST----AHLANLLPTGTL  615
            +R R A   AP +D+   E    P       +  S SQRA+ +T    A+L+NLLPTGTL
Sbjct  4    VRLRNANTPAPELDEFSDEP---PSETRVLRRQMSVSQRAMSNTLTSAANLSNLLPTGTL  60

Query  614  LAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGG  435
            LAFQLLTP+FT+NG CD ATR +T VLL +LA SCF++ FTDSV+  DG +Y+GF T  G
Sbjct  61   LAFQLLTPVFTSNGVCDHATRFLTAVLLYLLAASCFVSSFTDSVKADDGTIYFGFVTFKG  120

Query  434  LWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHE  255
            +W+ DYP    +G+   DL K+R   +D++HA LSVLVF A+AL+DK V  C  P P  E
Sbjct  121  MWVVDYP--DPSGLGLPDLSKYRMRVVDWIHATLSVLVFGAVALRDKYVTDCFCPSPEAE  178

Query  254  TQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            T+ VLD+VP+G+G++ SLLF+VFPTRRHGIG+ VT
Sbjct  179  TKHVLDIVPVGVGVMSSLLFMVFPTRRHGIGYLVT  213



>ref|XP_004300087.1| PREDICTED: uncharacterized protein LOC101310319 [Fragaria vesca 
subsp. vesca]
Length=215

 Score =   217 bits (552),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 147/181 (81%), Gaps = 6/181 (3%)
 Frame = -3

Query  680  SFSQRA----LESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVS  513
            S SQRA    L  TA+LANLLPTGTLLA QLL P+FTNNG+CDAATRPMTL LL +LA+S
Sbjct  36   SMSQRAISQTLTGTANLANLLPTGTLLALQLLVPVFTNNGSCDAATRPMTLFLLLLLALS  95

Query  512  CFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVL  333
            CFLA FTDSV+  +GQV YG AT  GL+LFD   +++A  + ADL K++  FID VHA+L
Sbjct  96   CFLASFTDSVKAPNGQVCYGIATPKGLFLFDS--SSSATAAGADLTKYKLRFIDLVHALL  153

Query  332  SVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPV  153
            SVLVF A+AL+DKNVV C YP P HETQEVLD+VPIG+GLLCSLLF+VFPT RHGIG+P+
Sbjct  154  SVLVFGAVALRDKNVVGCFYPMPAHETQEVLDIVPIGVGLLCSLLFVVFPTTRHGIGYPL  213

Query  152  T  150
            +
Sbjct  214  S  214



>ref|XP_002509425.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50812.1| conserved hypothetical protein [Ricinus communis]
Length=206

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 141/189 (75%), Gaps = 8/189 (4%)
 Frame = -3

Query  701  LPAAKSPSFSQRAL----ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVL  534
            +P  +  +  Q+A+    +STAHLANLLPTGT+LAFQLL+PIF+N G CD  +R MT  L
Sbjct  21   IPNTEEKNLIQKAISQTFKSTAHLANLLPTGTVLAFQLLSPIFSNQGNCDPVSRFMTAGL  80

Query  533  LSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFI  354
            +S+  +SCFL+ FTDSVR  +G V YGFAT  GLW+ D     +  I+     K+R  FI
Sbjct  81   VSLCGLSCFLSSFTDSVRDENGNVSYGFATVHGLWIIDGSTTISPEIAT----KYRLKFI  136

Query  353  DYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRR  174
            D++HA++S+LVF AIAL D+NVV+C YP P+ ETQE+L  +P+GIG++CS+LF+VFPT+R
Sbjct  137  DFMHAIMSILVFSAIALFDQNVVACFYPTPSAETQELLTTLPVGIGMICSMLFVVFPTQR  196

Query  173  HGIGFPVTS  147
            HGIGFP+++
Sbjct  197  HGIGFPISA  205



>ref|XP_004491124.1| PREDICTED: uncharacterized protein LOC101495511 [Cicer arietinum]
Length=213

 Score =   214 bits (545),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 156/212 (74%), Gaps = 7/212 (3%)
 Frame = -3

Query  785  NLRSRTATPAAPAVDDR-EVETLSVPEPLLPAAKSPSFSQRALESTAHLANLLPTGTLLA  609
            ++R R +T  +    D     ++   E   P++ S + S R L  TA+LANLLPTGTLLA
Sbjct  2    SIRQRRSTNQSKETQDNIHDNSVEAEEKKNPSSAS-TLSGRLLTGTANLANLLPTGTLLA  60

Query  608  FQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLW  429
            FQ+LTP+FTNNGACD+ TR +TL+LL +L++SCFLA FTD+V+  DG+VY+G AT  G W
Sbjct  61   FQILTPVFTNNGACDSVTRLLTLLLLILLSLSCFLASFTDTVKASDGRVYHGIATLKGFW  120

Query  428  LFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQ  249
            LFDY     +  +  +L K++   ID+VHA+LSVLVF A+AL+D NV+ C YP+P HET+
Sbjct  121  LFDY-----SEGTLPELSKYKLRLIDFVHALLSVLVFFAVALRDNNVLMCYYPQPRHETK  175

Query  248  EVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPV  153
            EVLD+VP+G+G LCSLLFLVFPT RHG+G+P+
Sbjct  176  EVLDIVPVGVGFLCSLLFLVFPTTRHGVGYPL  207



>ref|NP_001175354.1| Os08g0106501 [Oryza sativa Japonica Group]
 dbj|BAD08943.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD09382.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAZ41248.1| hypothetical protein OsJ_25756 [Oryza sativa Japonica Group]
 dbj|BAH01702.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH94082.1| Os08g0106501 [Oryza sativa Japonica Group]
Length=224

 Score =   214 bits (545),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 138/184 (75%), Gaps = 0/184 (0%)
 Frame = -3

Query  698  PAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILA  519
            PAA+ PS   +AL STA LANLLPTGT++AFQLL P FTNNGACDA T  +T  LL++LA
Sbjct  35   PAARRPSLLSQALASTASLANLLPTGTVMAFQLLAPTFTNNGACDATTSLLTAALLALLA  94

Query  518  VSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHA  339
            +SC LA FTDSVRG DG+VYYG AT  GLWL DYP A A      D  ++R   ID VHA
Sbjct  95   LSCVLASFTDSVRGPDGRVYYGLATPRGLWLLDYPPAGAGAPPQPDTSRYRMRAIDGVHA  154

Query  338  VLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGF  159
            +LSV VF  +A +DKNVV C +P P   T+EVL +VP+G+G++CSLLF+VFPT RHGIG+
Sbjct  155  LLSVGVFGVVAARDKNVVGCFWPSPAKGTEEVLGIVPLGVGVMCSLLFVVFPTTRHGIGY  214

Query  158  PVTS  147
            PVT+
Sbjct  215  PVTN  218



>ref|XP_006467726.1| PREDICTED: uncharacterized protein LOC102608272 [Citrus sinensis]
Length=210

 Score =   213 bits (543),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 151/231 (65%), Gaps = 27/231 (12%)
 Frame = -3

Query  827  RFKVAKSSTRMSSQNLRSRTATPAAPAVDDREVETLSVPEPLLPAAKSPSFSQRAL----  660
              KV   S  +  QNL         P + D++          LP  +  +  QRA+    
Sbjct  2    EIKVEADSNHVHEQNL---------PLLQDKD----------LPEIERKTLIQRAISQTF  42

Query  659  ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVR  480
            +STAHLANLLPTGT+LAFQLL PIF+N G CD  +R MT  LL++ ++SCFL  FTDS R
Sbjct  43   QSTAHLANLLPTGTVLAFQLLAPIFSNQGNCDPVSRSMTAGLLALCSLSCFLMSFTDSFR  102

Query  479  GRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALK  300
             ++G V+YGFAT  GLW+ D  A  +   +     K+R  FID+VHA +S+LVF A+AL 
Sbjct  103  DKNGNVFYGFATIRGLWIIDGSATISPEFA----AKYRIRFIDFVHAFMSILVFAAVALF  158

Query  299  DKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTS  147
            D+NVV+C YP P+ E QEVL  +P+GIG++CS+LF+VFPT+R+GIGFP+++
Sbjct  159  DQNVVNCFYPLPSQEAQEVLTSLPVGIGVICSMLFIVFPTQRNGIGFPLSA  209



>gb|EAZ05316.1| hypothetical protein OsI_27521 [Oryza sativa Indica Group]
Length=224

 Score =   213 bits (543),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 138/184 (75%), Gaps = 0/184 (0%)
 Frame = -3

Query  698  PAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILA  519
            PAA+ PS   +AL STA LANLLPTGT++AFQLL P FTNNGACDA T  +T  LL++LA
Sbjct  35   PAARRPSLLSQALASTASLANLLPTGTVMAFQLLAPTFTNNGACDATTSLLTAALLALLA  94

Query  518  VSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHA  339
            +SC LA FTDSVRG DG+VYYG AT  GLWL DYP A A      D  ++R   ID VHA
Sbjct  95   LSCVLASFTDSVRGPDGRVYYGLATPRGLWLLDYPPAGAGAPPQPDTSRYRLRAIDGVHA  154

Query  338  VLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGF  159
            +LSV VF  +A +DKNVV C +P P   T+EVL +VP+G+G++CSLLF+VFPT RHGIG+
Sbjct  155  LLSVGVFGVVAARDKNVVGCFWPSPAKGTEEVLGIVPLGVGVMCSLLFVVFPTTRHGIGY  214

Query  158  PVTS  147
            PVT+
Sbjct  215  PVTN  218



>ref|XP_004486106.1| PREDICTED: uncharacterized protein LOC101512239 [Cicer arietinum]
Length=211

 Score =   212 bits (540),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 137/197 (70%), Gaps = 9/197 (5%)
 Frame = -3

Query  737  REVETLSVPEPLLPAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAA  558
            R VE       L+  A S +F     +STAHLANLLPTGT+LAFQLL+PIFTN G CD+ 
Sbjct  23   RNVEVPEAERTLIQKAISQTF-----QSTAHLANLLPTGTVLAFQLLSPIFTNVGNCDSV  77

Query  557  TRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADL  378
            ++ MT  LL+I  V CFL CFTDS R   G + YGFAT  GLW+ D        ++    
Sbjct  78   SKSMTSALLTICGVWCFLVCFTDSFRDSKGNICYGFATFKGLWVIDGSTKLPPQVA----  133

Query  377  GKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLL  198
            GK+    ID +HAV+S+LVF AIAL D+NVV+C +P+P+HE QE+L  +P+GIG+LCS+L
Sbjct  134  GKYCLRLIDLMHAVMSILVFAAIALFDQNVVNCFFPEPSHEIQEILTALPVGIGVLCSML  193

Query  197  FLVFPTRRHGIGFPVTS  147
            F+VFPT RHGIGFP+++
Sbjct  194  FVVFPTERHGIGFPLST  210



>ref|XP_006449412.1| hypothetical protein CICLE_v10016696mg [Citrus clementina]
 gb|ESR62652.1| hypothetical protein CICLE_v10016696mg [Citrus clementina]
Length=210

 Score =   212 bits (539),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/231 (47%), Positives = 151/231 (65%), Gaps = 27/231 (12%)
 Frame = -3

Query  827  RFKVAKSSTRMSSQNLRSRTATPAAPAVDDREVETLSVPEPLLPAAKSPSFSQRAL----  660
              KV   S  +  QNL         P + D++          LP  +  +  QRA+    
Sbjct  2    EIKVEADSNHVHEQNL---------PLLQDKD----------LPEIERKTLIQRAISQTF  42

Query  659  ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVR  480
            +STAHLANLLPTGT+LAFQLL PIF+N G CD  +R MT  LL++ ++SCFL  FTDS R
Sbjct  43   QSTAHLANLLPTGTVLAFQLLAPIFSNQGNCDPVSRSMTAGLLALCSLSCFLMSFTDSFR  102

Query  479  GRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALK  300
             ++G V+YGFA+  GLW+ D  A  +   +     K+R  FID+VHA +S+LVF A+AL 
Sbjct  103  DKNGNVFYGFASIRGLWIIDGSATISPEFA----AKYRMRFIDFVHAFMSILVFAAVALF  158

Query  299  DKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTS  147
            D+NVV+C YP P+ E QE+L  +P+GIG++CS+LF+VFPT+R+GIGFP+++
Sbjct  159  DQNVVNCFYPLPSQEAQEILTSLPVGIGVICSMLFIVFPTQRNGIGFPLSA  209



>ref|XP_010087431.1| hypothetical protein L484_018458 [Morus notabilis]
 gb|EXB29041.1| hypothetical protein L484_018458 [Morus notabilis]
Length=203

 Score =   210 bits (535),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 152/219 (69%), Gaps = 21/219 (10%)
 Frame = -3

Query  785  NLRSRTATPAAPAVDDREVETLSVPEPLLPAAKSPSFSQRA----LESTAHLANLLPTGT  618
            +LRSR  T  + +     VE + VP+        P+FSQR     L S A+LANLLPTGT
Sbjct  2    SLRSRPTTQPSTS----GVELVKVPKST--QQGQPTFSQRGISQTLTSAANLANLLPTGT  55

Query  617  LLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRG  438
            LLAFQLLTPIFTNNGACD  TR ++ +LL +L+ SCFLA FTDS++  DGQ         
Sbjct  56   LLAFQLLTPIFTNNGACDPVTRTLSFLLLLLLSFSCFLASFTDSMKASDGQRAV------  109

Query  437  GLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNH  258
               LFDYP    + +   DL KFR  FID+VHAVLSVLVF  +AL+DKNVV C YP+P H
Sbjct  110  ---LFDYPDPTGSDLP--DLSKFRIRFIDWVHAVLSVLVFGVVALRDKNVVGCFYPQPGH  164

Query  257  ETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSGK  141
              QEVLD+VP+G+GL+CSLLF+VFPTRRHGIG+PVT GK
Sbjct  165  TVQEVLDIVPVGVGLVCSLLFVVFPTRRHGIGYPVTPGK  203



>ref|XP_002265414.1| PREDICTED: uncharacterized protein LOC100244781 [Vitis vinifera]
 emb|CBI35259.3| unnamed protein product [Vitis vinifera]
Length=211

 Score =   209 bits (533),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 139/189 (74%), Gaps = 8/189 (4%)
 Frame = -3

Query  701  LPAAKSPSFSQRAL----ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVL  534
            +P A+  +  Q+A+    +STAHLANLLPTGT+LAFQ+L+PIF+N G CD  +R MT  L
Sbjct  26   MPRAEEKTLIQKAISQTFQSTAHLANLLPTGTVLAFQILSPIFSNQGDCDPVSRFMTAAL  85

Query  533  LSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFI  354
            +++  VSCFLACFTDS+R +D  V YG AT  GLW+ D  A     ++     K++  FI
Sbjct  86   VALCGVSCFLACFTDSIRDKDRNVCYGLATFRGLWVIDGSATITPELA----AKYQLRFI  141

Query  353  DYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRR  174
            D++HA +S+LVF AI L D+NVV C YP P+ ET+E+L  +P+GIG++CS+LF+VFPT+R
Sbjct  142  DFMHAFMSILVFAAITLFDENVVQCFYPTPSDETKELLAALPVGIGVICSMLFVVFPTQR  201

Query  173  HGIGFPVTS  147
            HGIGFP+++
Sbjct  202  HGIGFPLSA  210



>gb|ABR16877.1| unknown [Picea sitchensis]
Length=219

 Score =   209 bits (532),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 131/175 (75%), Gaps = 5/175 (3%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFT  492
             ++L STAHLANLLPTGT+LAFQ+L PIF+N+G CD  +  MT  LL + A+SCF   FT
Sbjct  48   NQSLASTAHLANLLPTGTVLAFQILCPIFSNSGHCDQVSAFMTECLLVLCALSCFFISFT  107

Query  491  DSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVA  312
            DS +G DG+++YG AT  GLW F+         +  D G+++   +D+VHA LSVLVF A
Sbjct  108  DSFQGSDGKLHYGLATPKGLWTFE-----NLSEAIPDAGRYQVRILDFVHAFLSVLVFAA  162

Query  311  IALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTS  147
            IAL + NVV CLYP P+++T+EVLDV+P+GIG+ CSLLF+VFPT RHGIG+PV+S
Sbjct  163  IALLNDNVVKCLYPAPDYQTKEVLDVLPVGIGVFCSLLFVVFPTTRHGIGYPVSS  217



>gb|ABR17763.1| unknown [Picea sitchensis]
Length=219

 Score =   209 bits (531),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 131/175 (75%), Gaps = 5/175 (3%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFT  492
             ++L STAHLANLLPTGT+LAFQ+L PIF+N+G CD  +  M   LL + A+SCF   FT
Sbjct  48   NQSLASTAHLANLLPTGTVLAFQILCPIFSNSGHCDQVSAFMIECLLVLCALSCFFISFT  107

Query  491  DSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVA  312
            DS +G DG+++YG AT  GLW F+         +  D G+++  F+D+VHA LSVLVF A
Sbjct  108  DSFQGSDGKLHYGLATPKGLWTFE-----NLSEAIPDAGRYQVRFLDFVHAFLSVLVFAA  162

Query  311  IALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTS  147
            IAL + NVV CLYP P+++T+EVLDV+P+G+G+ CSLLF+VFPT RHGIG+PV+S
Sbjct  163  IALLNDNVVKCLYPAPDYQTKEVLDVLPVGMGVFCSLLFVVFPTTRHGIGYPVSS  217



>ref|XP_007025538.1| Uncharacterized protein TCM_029803 [Theobroma cacao]
 gb|EOY28160.1| Uncharacterized protein TCM_029803 [Theobroma cacao]
Length=211

 Score =   206 bits (524),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 136/193 (70%), Gaps = 7/193 (4%)
 Frame = -3

Query  725  TLSVPEPLLPAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPM  546
            T+S  E   P  K+ S   +  +STAHLANLLPTGT+LAFQLL+PIFTN G CD+ +R M
Sbjct  25   TVSETEKKNPVQKAIS---QTFQSTAHLANLLPTGTVLAFQLLSPIFTNQGNCDSVSRSM  81

Query  545  TLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFR  366
            T  L+ +  +SCFL  FTDS R ++G V YGFAT  GLW+ D        ++     K+R
Sbjct  82   TAGLILLCGLSCFLMSFTDSFRDKNGTVCYGFATFYGLWVIDGSITLPPELA----AKYR  137

Query  365  AGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVF  186
              FID++HA +S+LVF A+AL D NVVSC YP P+ + QE+L  +P+GIG+LCS+LF+VF
Sbjct  138  LHFIDFMHAFMSILVFAAVALFDHNVVSCFYPTPSDQAQEILTALPVGIGVLCSMLFVVF  197

Query  185  PTRRHGIGFPVTS  147
            PT RHGIGFP+++
Sbjct  198  PTTRHGIGFPLSA  210



>ref|XP_006364305.1| PREDICTED: uncharacterized protein LOC102579399 [Solanum tuberosum]
Length=209

 Score =   206 bits (523),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 142/202 (70%), Gaps = 11/202 (5%)
 Frame = -3

Query  755  APAVDDREVETLSVPEPLLPAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNN  576
            AP +++ E+    V + L+  A S +F     +STAHLANLLPTG++LAFQ L+PIFTN 
Sbjct  18   APLLENSELP--EVEKNLIQQAISQTF-----KSTAHLANLLPTGSVLAFQFLSPIFTNQ  70

Query  575  GACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaag  396
            G CD   R +T  L+++  +SCFL  FTDS + + G V YGFAT  GLW+ D  A     
Sbjct  71   GQCDVVGRSLTAALVALCGLSCFLLSFTDSFKDQKGNVCYGFATTCGLWIIDGSATLPLE  130

Query  395  isaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIG  216
             +     K++  FID++HA++S+LVF A+AL D+NVV+C YP P++ETQE+L  +P+ IG
Sbjct  131  AA----AKYKLKFIDFMHAIMSILVFAAVALFDQNVVNCFYPTPSYETQELLTALPVAIG  186

Query  215  LLCSLLFLVFPTRRHGIGFPVT  150
            ++CS+LF+VFPT+RHGIGFP+T
Sbjct  187  VICSMLFVVFPTQRHGIGFPLT  208



>ref|XP_010686399.1| PREDICTED: uncharacterized protein LOC104900624 [Beta vulgaris 
subsp. vulgaris]
Length=232

 Score =   206 bits (524),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 128/175 (73%), Gaps = 4/175 (2%)
 Frame = -3

Query  668  RALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTD  489
            +  +STAHLA LLPTGT++AFQLL PIFTN G CD+ ++ MT +L+++  +S FL  FTD
Sbjct  62   QTFQSTAHLAKLLPTGTVMAFQLLAPIFTNQGECDSVSQTMTSILIALCGLSSFLLSFTD  121

Query  488  SVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAI  309
              +  DG++YYGFAT  GLW+ D  A     ++     K+R  FID++HA +SV VF AI
Sbjct  122  CFKDDDGKIYYGFATFKGLWVIDGLATLPPELA----AKYRLRFIDFLHAFMSVFVFAAI  177

Query  308  ALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSG  144
            AL DKN V CLYP P+ ETQE+L  +PIGIG+L S+LF+VFPT+RHGIGFP+TS 
Sbjct  178  ALFDKNTVQCLYPTPSKETQEILTALPIGIGVLSSMLFVVFPTQRHGIGFPLTSN  232



>ref|XP_004505097.1| PREDICTED: uncharacterized protein LOC101491785 [Cicer arietinum]
Length=211

 Score =   205 bits (522),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 130/176 (74%), Gaps = 4/176 (2%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFT  492
             +  +STAHLANLLPTGT+L+FQLL+PIFTN G CD  ++ MTL LLS+   SCFL CFT
Sbjct  40   NQTCKSTAHLANLLPTGTVLSFQLLSPIFTNKGECDQVSKFMTLSLLSLCGASCFLLCFT  99

Query  491  DSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVA  312
            DS+R   G + YGFAT  GLW+ D  A  +  I      K++  FID++HAV+S+LVF A
Sbjct  100  DSLRDNKGNICYGFATFKGLWVIDGSATLSPEID----AKYKLRFIDFMHAVMSILVFSA  155

Query  311  IALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSG  144
            IA+ D+NVV C +P P++E +E+L  +P+GIG+ CS+LF+ FPT+RHGIGFP+++ 
Sbjct  156  IAMFDQNVVKCFFPSPSYEFREILTALPVGIGVFCSMLFVAFPTQRHGIGFPLSTN  211



>emb|CDO99489.1| unnamed protein product [Coffea canephora]
Length=207

 Score =   205 bits (521),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 138/191 (72%), Gaps = 8/191 (4%)
 Frame = -3

Query  707  PLLPAAKSPSFSQRAL----ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTL  540
            PLL      +  Q+A+    +STAHLANLLPTG++LAFQLL+PIFTN G CDA +R MT 
Sbjct  20   PLLVPEVEKTLVQKAISQTFQSTAHLANLLPTGSVLAFQLLSPIFTNQGECDAVSRSMTA  79

Query  539  VLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAG  360
            VL+++  +SCFL  FTDS + + G + YGFAT  GLW+ D  A     ++      +R  
Sbjct  80   VLIALCGLSCFLFSFTDSFKDQKGNLCYGFATLHGLWVIDGSATIPPELA----ATYRLK  135

Query  359  FIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPT  180
            FID++HA +S+LVF A+AL ++NVV+C YP P+ E +E+L  +P+GIG++CS+LF+VFPT
Sbjct  136  FIDFMHAFMSILVFAAVALFNQNVVNCFYPMPSDEAKELLTAMPVGIGVICSMLFVVFPT  195

Query  179  RRHGIGFPVTS  147
            +RHGIGFP+T+
Sbjct  196  KRHGIGFPLTA  206



>ref|XP_003593648.1| hypothetical protein MTR_2g014550 [Medicago truncatula]
 gb|ABN08714.1| Protein of unknown function DUF679 [Medicago truncatula]
 gb|AES63899.1| transmembrane protein, putative [Medicago truncatula]
Length=210

 Score =   205 bits (522),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 142/207 (69%), Gaps = 14/207 (7%)
 Frame = -3

Query  743  DDREVETLSVPEPLLPAAKSP----SFSQRAL----ESTAHLANLLPTGTLLAFQLLTPI  588
            DD + +   VP  LL  A+ P    S  Q+A+    +STAHLANLLPTGT+LAFQLL+PI
Sbjct  9    DDSKNDEQKVP--LLRNAEVPEAERSLVQKAISSTFQSTAHLANLLPTGTVLAFQLLSPI  66

Query  587  FTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaa  408
            FTN G CD+  + MT VL+++   SCFL  FTDS+R   G + YGFAT  GLW+ D    
Sbjct  67   FTNVGNCDSVCKSMTSVLVTLCGASCFLLNFTDSIRDSKGNICYGFATFKGLWVIDGSTK  126

Query  407  aaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVP  228
                ++     K+R  FID++HA++S+LVF AIAL D+NVV+C +P+P+ E QE+L  +P
Sbjct  127  LPPQVA----AKYRIKFIDFMHAMMSILVFAAIALFDQNVVNCFFPEPSKEIQEILTALP  182

Query  227  IGIGLLCSLLFLVFPTRRHGIGFPVTS  147
            + IG+ CS+LF+ FPT RHGIGFP+++
Sbjct  183  VAIGVFCSMLFVAFPTERHGIGFPLST  209



>ref|XP_002278769.1| PREDICTED: uncharacterized protein LOC100262407 [Vitis vinifera]
Length=211

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 129/174 (74%), Gaps = 4/174 (2%)
 Frame = -3

Query  668  RALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTD  489
            +  +STAHLANLLPTGT+LAFQ L+P+ TN G CD  +R MT  LL++  +SCFL CFTD
Sbjct  41   QTFQSTAHLANLLPTGTVLAFQFLSPVLTNKGECDPVSRFMTSSLLALCGMSCFLQCFTD  100

Query  488  SVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAI  309
            S R  +G VY GFAT  GLW+ D  A     ++     +++  FID++HA +S+LVF AI
Sbjct  101  SFRDNNGNVYSGFATFQGLWIIDGSATLPPELA----AEYQLRFIDFIHAFMSILVFAAI  156

Query  308  ALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTS  147
            AL D+NVV+C YP P+ ET+E+L  +P+GIG+ CS+LF+VFPTRRHGIGFP+++
Sbjct  157  ALFDENVVNCFYPTPSDETKELLTSLPVGIGVFCSMLFVVFPTRRHGIGFPLSA  210



>ref|XP_009775864.1| PREDICTED: uncharacterized protein LOC104225708 [Nicotiana sylvestris]
Length=211

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 139/201 (69%), Gaps = 7/201 (3%)
 Frame = -3

Query  740  DREVETLSVPEPLLPAAKSPSFSQ---RALESTAHLANLLPTGTLLAFQLLTPIFTNNGA  570
            D E   L +    LP  +     Q   +  +STAHLANLLPTG++LAFQLL+PIFTN G 
Sbjct  14   DEEKAPLLLENSALPEVEKNMIQQAISKTFKSTAHLANLLPTGSVLAFQLLSPIFTNQGE  73

Query  569  CDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagis  390
            CD   R +T  L+++  +SCFL  FTDS + + G V YGFAT  GLW+ D  AA    I+
Sbjct  74   CDVIGRSLTAALVALCGLSCFLLSFTDSFKDQKGNVCYGFATLRGLWIIDGSAAPPPEIA  133

Query  389  aADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLL  210
                  ++  FID++HA++S+LVF A+AL D+NVV+C YP P+++TQE+L  +P+ IG++
Sbjct  134  ----ANYKLKFIDFMHAIMSILVFAAVALFDQNVVNCFYPTPSYQTQELLTALPVAIGVI  189

Query  209  CSLLFLVFPTRRHGIGFPVTS  147
            CS+LF+VFPT+RHGIGFP+TS
Sbjct  190  CSMLFVVFPTQRHGIGFPLTS  210



>gb|KDP21013.1| hypothetical protein JCGZ_21484 [Jatropha curcas]
Length=210

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 141/189 (75%), Gaps = 8/189 (4%)
 Frame = -3

Query  701  LPAAKSPSFSQRAL----ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVL  534
            +P  +  S  Q+A+    +STAHLANLLPTGT+LAF LL+P+F+N G CD+ +R MT  +
Sbjct  25   IPNPEGKSLIQKAISETFKSTAHLANLLPTGTVLAFNLLSPVFSNQGNCDSVSRFMTAAV  84

Query  533  LSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFI  354
            +++  +SCFL+ FTDS R ++G V YGFAT  GLW+ D  A  +  ++     K+R  FI
Sbjct  85   VTLCGLSCFLSSFTDSFRDKNGNVCYGFATFRGLWIIDGSATLSPELA----DKYRLRFI  140

Query  353  DYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRR  174
            D++HA++S+LVF A+AL D+NVV+C YPKP+ E  EVL  +P+GIG++CS+LF+VFPT+R
Sbjct  141  DFIHALMSILVFGAVALFDQNVVACFYPKPSTEALEVLTALPVGIGVICSMLFVVFPTQR  200

Query  173  HGIGFPVTS  147
            HGIGFP+++
Sbjct  201  HGIGFPLSA  209



>ref|XP_008383697.1| PREDICTED: uncharacterized protein LOC103446381 [Malus domestica]
Length=214

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 136/197 (69%), Gaps = 14/197 (7%)
 Frame = -3

Query  707  PLLPAA-KSPSFSQRAL---------ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAA  558
            PLL  A KS +  QR L         +S AHLANLLPTGT+LAFQLL PIFTN G CD+ 
Sbjct  21   PLLQDAPKSVTEEQRTLIQKAIRQTFQSMAHLANLLPTGTVLAFQLLAPIFTNQGNCDSV  80

Query  557  TRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADL  378
            +R MT  L+++   SCFL  FTDS+R   G V YGFAT  GLW+ D  A  +  ++    
Sbjct  81   SRSMTAGLVALCGASCFLLSFTDSLRDNKGNVCYGFATFKGLWIIDGSANISTEVA----  136

Query  377  GKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLL  198
              F   FID++HA +S+LVF A+AL D+NVV+C YP P+ E QEVL  +P+GIG++CS+L
Sbjct  137  ANFHLQFIDFLHAFMSILVFTAVALFDQNVVNCFYPMPSDEAQEVLTALPVGIGVICSML  196

Query  197  FLVFPTRRHGIGFPVTS  147
            F+VFPT+RHG+GFP+++
Sbjct  197  FVVFPTKRHGMGFPLSA  213



>ref|XP_008371416.1| PREDICTED: uncharacterized protein LOC103434834 [Malus domestica]
Length=214

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 142/213 (67%), Gaps = 17/213 (8%)
 Frame = -3

Query  746  VDDREVETLSVPEPLLP----AAKSPSFSQRAL---------ESTAHLANLLPTGTLLAF  606
            V+  E   L   E  LP    A KS +  +R L         +STAHLANLLPTGT+LAF
Sbjct  5    VEAEESRHLHDGEQKLPLLQDAPKSATEEERTLIQKAIRQTFQSTAHLANLLPTGTVLAF  64

Query  605  QLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWL  426
            QLL PIFTN G CD+ +R MT  L+++   S FL  FTDS R ++G V YGFAT  GLW+
Sbjct  65   QLLAPIFTNLGNCDSVSRSMTAGLVALCGASSFLLSFTDSFRDKNGNVCYGFATFKGLWI  124

Query  425  FDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQE  246
             D  A  +  ++      FR  FID++HA +S+LVF A+AL D+NVV+C YP P+ E QE
Sbjct  125  IDGSANISPEVA----ANFRLQFIDFLHAFMSILVFAAVALFDQNVVNCFYPTPSDEAQE  180

Query  245  VLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTS  147
            VL  +P+GIG++CS+LF+VFPT+RHGIGFP+++
Sbjct  181  VLTALPVGIGVICSMLFVVFPTKRHGIGFPLSA  213



>ref|XP_009344263.1| PREDICTED: uncharacterized protein LOC103936119 [Pyrus x bretschneideri]
Length=214

 Score =   204 bits (518),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 138/197 (70%), Gaps = 14/197 (7%)
 Frame = -3

Query  707  PLLP-AAKSPSFSQRAL---------ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAA  558
            PLL  A KS +  +R L         +STAHLANLLPTGT+LAFQLL PIFTN G CD+ 
Sbjct  21   PLLQDATKSVTEEERTLIQKAIRQTFQSTAHLANLLPTGTVLAFQLLAPIFTNLGNCDSV  80

Query  557  TRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADL  378
            +R MT  L+++   S FL  FTDSVR ++G V YG AT  GLW+ D  A  +  ++    
Sbjct  81   SRSMTAGLVALCGASSFLLSFTDSVRDKNGNVCYGLATFKGLWIIDGSANISPEVA----  136

Query  377  GKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLL  198
              FR  FID++HA +S+LVF A+AL D+NVV+C YP P+ E QEVL  +P+GIG++CS+L
Sbjct  137  ANFRLQFIDFLHAFMSILVFAAVALFDQNVVNCFYPTPSDEAQEVLTALPVGIGVICSML  196

Query  197  FLVFPTRRHGIGFPVTS  147
            F+VFPT+RHGIGFP+++
Sbjct  197  FVVFPTKRHGIGFPLSA  213



>ref|XP_004233838.1| PREDICTED: uncharacterized protein LOC101249147 [Solanum lycopersicum]
Length=209

 Score =   203 bits (517),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 139/202 (69%), Gaps = 9/202 (4%)
 Frame = -3

Query  746  VDDREVETLSVPEPLLPAAKSPSFSQ---RALESTAHLANLLPTGTLLAFQLLTPIFTNN  576
            +DD +V  L   E  LP  +     Q      +STAHLANLLPTG++LAFQ L+PIFTN 
Sbjct  13   LDDEKVPLLESSE--LPEVEKNLIQQAISHTFKSTAHLANLLPTGSVLAFQFLSPIFTNQ  70

Query  575  GACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaag  396
            G CD   R +T  L+++  +SCFL  FTDS + + G + YGFAT  GLW+ D  A     
Sbjct  71   GQCDVVGRSLTAGLVALCGLSCFLLNFTDSFKDQKGNICYGFATTRGLWIIDGSATPPLE  130

Query  395  isaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIG  216
            ++     K++  FID++HA++S+LVF A+AL D+NVVSC YP P++ETQE+L  +P+ IG
Sbjct  131  VA----AKYKLKFIDFMHAIMSILVFAAVALFDQNVVSCFYPTPSYETQELLTALPVAIG  186

Query  215  LLCSLLFLVFPTRRHGIGFPVT  150
            ++CS+LF+VFPT+RHGIGFP+T
Sbjct  187  VICSMLFVVFPTQRHGIGFPLT  208



>emb|CBI30614.3| unnamed protein product [Vitis vinifera]
Length=275

 Score =   205 bits (522),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 114/258 (44%), Positives = 155/258 (60%), Gaps = 17/258 (7%)
 Frame = -3

Query  887  FHPSYSSYTKLQNRHNRDLNRFKVAKSSTRMSSQNLRSRTATPAAPAVDDREVETLSVPE  708
            F P+      L  +++  L+  K      R   +N R R        V+D E   L+  +
Sbjct  25   FSPTQKHLFPLLIKYSSFLHGIKSPTGIERKKEENKRFRAM---EFKVEDEESWHLNDQK  81

Query  707  -PLLPAAKSPSFSQRA---------LESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAA  558
              LL     P   QR           +STAHLANLLPTGT+LAFQ L+P+ TN G CD  
Sbjct  82   VALLQDMPRPQTGQRTPIQMAISQTFQSTAHLANLLPTGTVLAFQFLSPVLTNKGECDPV  141

Query  557  TRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADL  378
            +R MT  LL++  +SCFL CFTDS R  +G VY GFAT  GLW+ D  A     ++    
Sbjct  142  SRFMTSSLLALCGMSCFLQCFTDSFRDNNGNVYSGFATFQGLWIIDGSATLPPELA----  197

Query  377  GKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLL  198
             +++  FID++HA +S+LVF AIAL D+NVV+C YP P+ ET+E+L  +P+GIG+ CS+L
Sbjct  198  AEYQLRFIDFIHAFMSILVFAAIALFDENVVNCFYPTPSDETKELLTSLPVGIGVFCSML  257

Query  197  FLVFPTRRHGIGFPVTSG  144
            F+VFPTRRHGIGFP+++ 
Sbjct  258  FVVFPTRRHGIGFPLSAN  275



>gb|AFK44846.1| unknown [Lotus japonicus]
Length=212

 Score =   203 bits (517),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 140/194 (72%), Gaps = 12/194 (6%)
 Frame = -3

Query  707  PLLPAAKSP----SFSQRAL----ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATR  552
            PLL  A+ P    +  Q+A+    +STA LANLLPTGT+LAFQLL+PIF+N G CD+ +R
Sbjct  19   PLLRNAEVPEAERNLVQKAISQTFQSTAQLANLLPTGTVLAFQLLSPIFSNVGNCDSVSR  78

Query  551  PMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGK  372
             MT  L++I   +CFL CFTDS R   G + +GFAT  GLW+ D     +  ++     K
Sbjct  79   LMTASLVAICGAACFLLCFTDSFRDSKGNICHGFATFRGLWVIDGSNTLSPELA----AK  134

Query  371  FRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFL  192
            +R  FID++HAV+SVLVF AIAL D+NVV+C +P+P+ +TQE+L  +P+GIG+LCS+LF+
Sbjct  135  YRLRFIDFLHAVMSVLVFAAIALFDQNVVNCFFPEPSKKTQEILTALPVGIGVLCSMLFV  194

Query  191  VFPTRRHGIGFPVT  150
            VFPT+RHGIGF ++
Sbjct  195  VFPTQRHGIGFSLS  208



>ref|XP_011027771.1| PREDICTED: uncharacterized protein LOC105127982 [Populus euphratica]
Length=234

 Score =   203 bits (517),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 135/189 (71%), Gaps = 8/189 (4%)
 Frame = -3

Query  701  LPAAKSPSFSQRAL----ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVL  534
            +P     +  Q+A+    +STAHLANLLPTGT+LAFQLL PIF+N G CD+ +R MT  L
Sbjct  49   MPNEDEQNLIQKAISQTFKSTAHLANLLPTGTILAFQLLLPIFSNQGNCDSVSRSMTAGL  108

Query  533  LSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFI  354
            +++  +SCFL+ FTDS R ++G V YGFAT  GLW+ D  A     ++      +R  FI
Sbjct  109  VALCGLSCFLSSFTDSFRDKNGNVCYGFATFRGLWVIDGSATIPPEVA----ANYRLQFI  164

Query  353  DYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRR  174
            D++HA++S+LVF AIAL D+NVV C YP P+ + QEVL  +P+GIG+  S+LFLVFPTRR
Sbjct  165  DFMHALMSILVFAAIALFDQNVVDCFYPSPSTKAQEVLTALPVGIGVFTSMLFLVFPTRR  224

Query  173  HGIGFPVTS  147
            HGIGFP+++
Sbjct  225  HGIGFPLSA  233



>gb|KHN08488.1| hypothetical protein glysoja_014253 [Glycine soja]
Length=211

 Score =   202 bits (514),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/207 (49%), Positives = 140/207 (68%), Gaps = 12/207 (6%)
 Frame = -3

Query  743  DDREVETLSVPEPLLPAAKSP----SFSQRAL----ESTAHLANLLPTGTLLAFQLLTPI  588
            DD + E      PLL  ++ P    +  Q+A+    +STAHL NLLPTGT+LAFQLL+PI
Sbjct  8    DDSQNEENEERLPLLRNSEVPEAERNLIQKAISQTFQSTAHLGNLLPTGTVLAFQLLSPI  67

Query  587  FTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaa  408
            FTN G CD+ ++ MT  L+S+   SCF++C TDS R   G + YGFAT  GLW+ D    
Sbjct  68   FTNVGNCDSVSKAMTAALVSLCGASCFMSCLTDSFRDSKGSICYGFATLRGLWVIDGSTT  127

Query  407  aaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVP  228
                ++     K+R   ID++HAV+SVLVF AIAL D+NVV+C +P P+ ETQE+L  +P
Sbjct  128  LPPQLA----AKYRLKLIDFMHAVMSVLVFAAIALFDQNVVNCFFPAPSTETQEILTALP  183

Query  227  IGIGLLCSLLFLVFPTRRHGIGFPVTS  147
            +GIG+L S+ F+ FPT+RHGIGFP+++
Sbjct  184  VGIGVLGSMFFVAFPTQRHGIGFPLST  210



>ref|XP_010260334.1| PREDICTED: uncharacterized protein LOC104599477 [Nelumbo nucifera]
Length=223

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/207 (49%), Positives = 142/207 (69%), Gaps = 10/207 (5%)
 Frame = -3

Query  752  PAVDDREVETLSVPEP--LLPAAKSPSFSQRAL----ESTAHLANLLPTGTLLAFQLLTP  591
            P ++D +V  ++  E    +P  +  +  Q+AL    +STAHLANLLPTGT+LAFQLL P
Sbjct  19   PLLEDTKVTDVTDTEQNREIPQMEQETVIQKALSQTFKSTAHLANLLPTGTVLAFQLLAP  78

Query  590  IFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPa  411
            IFTN G CD  +R MT   L++  +SCFL  FTDS+R   G+V YG AT  GLW+ D   
Sbjct  79   IFTNQGQCDTISRSMTACFLALCGLSCFLLSFTDSIRDGRGKVRYGIATFRGLWVIDGSC  138

Query  410  aaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVV  231
              ++ ++     ++R  FID++HA +S+LVF A+AL D+NVV+C YP P+ E +E+L  +
Sbjct  139  TVSSELA----ARYRIKFIDFIHAFMSILVFAAVALFDQNVVNCFYPAPSKEMKELLIKL  194

Query  230  PIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            P+GIG +CS+LF+VFPT RHGIGFP++
Sbjct  195  PVGIGAICSMLFVVFPTTRHGIGFPLS  221



>ref|XP_008225153.1| PREDICTED: uncharacterized protein LOC103324819 [Prunus mume]
Length=214

 Score =   202 bits (513),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 128/174 (74%), Gaps = 4/174 (2%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFT  492
            ++  +STAHLANLLPTGT+LAFQLL PIF+N G CD+ +R MT  L+++   SCFL  FT
Sbjct  43   RQTFQSTAHLANLLPTGTVLAFQLLAPIFSNQGNCDSVSRSMTAGLVALCGASCFLLSFT  102

Query  491  DSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVA  312
            DS R ++G V YGFAT  GLW+ D     +  +       F+  FID++HA +S+LVF A
Sbjct  103  DSYRDKNGNVCYGFATFRGLWIIDGSTTLSPEVD----ANFQLRFIDFLHAFMSILVFAA  158

Query  311  IALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            +AL D+NVV+C YP P+ + QE+L  +P+GIG++CS+LF+VFPT+RHGIGFP++
Sbjct  159  VALFDQNVVNCFYPTPSDKAQEILTALPVGIGVICSMLFVVFPTKRHGIGFPLS  212



>ref|XP_007212044.1| hypothetical protein PRUPE_ppa011352mg [Prunus persica]
 gb|EMJ13243.1| hypothetical protein PRUPE_ppa011352mg [Prunus persica]
Length=214

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 128/174 (74%), Gaps = 4/174 (2%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFT  492
            ++  +STAHLANLLPTGT+LAFQLL PIF+N G CD+ +R MT  L+++   SCFL  FT
Sbjct  43   RQTFQSTAHLANLLPTGTVLAFQLLAPIFSNQGNCDSVSRSMTAGLVALCGASCFLLSFT  102

Query  491  DSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVA  312
            DS R ++G V YGFAT  GLW+ D     +  +       F+  FID++HA +S+LVF A
Sbjct  103  DSYRDKNGNVCYGFATFRGLWIIDGSTTLSPEVD----ANFQLRFIDFLHAFMSILVFAA  158

Query  311  IALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            +AL D+NVV+C YP P+ + QE+L  +P+GIG++CS+LF+VFPT+RHGIGFP++
Sbjct  159  VALFDQNVVNCFYPTPSDKAQEILTALPVGIGVICSMLFVVFPTKRHGIGFPLS  212



>ref|XP_010111173.1| hypothetical protein L484_015056 [Morus notabilis]
 gb|EXC30564.1| hypothetical protein L484_015056 [Morus notabilis]
Length=224

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/232 (47%), Positives = 144/232 (62%), Gaps = 13/232 (6%)
 Frame = -3

Query  827  RFKVAKSSTRMSSQNLRSRTATPAAPAVDDREVETLSVPEPLLPAAKSPSFSQRAL----  660
              KV  S +++  QN      T     + D  V     P+         +  Q+A+    
Sbjct  2    EIKVESSKSQIHRQNHVKEQNTKIPLLIKDDHV-----PKEQSEPVDQKTLVQKAISQTF  56

Query  659  ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVR  480
            +STAHLANLLPTGT+LAFQLL PIF+N G CD  +R MT  L+ +   S FL  FTDS R
Sbjct  57   QSTAHLANLLPTGTVLAFQLLAPIFSNLGQCDPVSRLMTAGLVVLCGASAFLVSFTDSFR  116

Query  479  GRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALK  300
             ++G V YG AT  GLW+ D     +A +   +  K+R  FID VHA +SV +F+AIAL 
Sbjct  117  DKNGNVCYGVATLTGLWVID----GSAKLPNEEADKYRLRFIDLVHAFMSVFLFLAIALF  172

Query  299  DKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSG  144
            D+NVVSC YP P+ E QEVL  +P+GIG++CSLLF+VFPT+RHGIGFP+++ 
Sbjct  173  DQNVVSCFYPTPSDEAQEVLTALPVGIGVMCSLLFVVFPTKRHGIGFPLSAN  224



>ref|XP_007159369.1| hypothetical protein PHAVU_002G232400g [Phaseolus vulgaris]
 gb|ESW31363.1| hypothetical protein PHAVU_002G232400g [Phaseolus vulgaris]
Length=214

 Score =   201 bits (512),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 135/199 (68%), Gaps = 16/199 (8%)
 Frame = -3

Query  731  VETLSVPEPLLPAAKSPSFSQRAL----ESTAHLANLLPTGTLLAFQLLTPIFTNNGACD  564
            +  + VPEP        S  QRA+    +STAHLANLLPTGT+L+FQLL+PI TN G CD
Sbjct  25   LHNMEVPEP------DRSLIQRAISQTFQSTAHLANLLPTGTVLSFQLLSPIVTNQGNCD  78

Query  563  AATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaA  384
            +  + MT  L+++   SCF  CFTDS R   G V YG AT  GLW+ D      +     
Sbjct  79   SVCKFMTATLVALCGASCFFQCFTDSFRDDKGNVCYGLATFKGLWVID-----GSTSLPP  133

Query  383  DLG-KFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLC  207
            +LG KFR  FID++HAV+S+LVF A+AL D+NVV+C +P P+ E +E+L V+P+ IG+ C
Sbjct  134  ELGAKFRMRFIDFIHAVMSILVFAAVALFDQNVVNCFFPSPSTEAREILTVLPVAIGIFC  193

Query  206  SLLFLVFPTRRHGIGFPVT  150
            S+LF+ FPT+RHGIGFP++
Sbjct  194  SMLFVAFPTQRHGIGFPLS  212



>ref|XP_011096362.1| PREDICTED: uncharacterized protein LOC105175576 [Sesamum indicum]
Length=238

 Score =   202 bits (514),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 128/174 (74%), Gaps = 4/174 (2%)
 Frame = -3

Query  668  RALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTD  489
            +  ESTAHLANLLPTG++LAFQLL+PIFTN G CD  +R +T  L+++  +SC L  FTD
Sbjct  68   QTFESTAHLANLLPTGSVLAFQLLSPIFTNQGECDTVSRSLTAGLVALCGLSCILLSFTD  127

Query  488  SVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAI  309
            S + + G + YGFAT  GLW+ D        I+     K++  FID+VHA++S+LVF AI
Sbjct  128  SFKDQKGNICYGFATFRGLWIIDGSVTLPPEIA----AKYKLKFIDFVHALMSILVFAAI  183

Query  308  ALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTS  147
            AL D+NVV+C YP P+  T+EVL  +P+GIG+ CS+LF+VFPT+RHGIGFPVT+
Sbjct  184  ALFDENVVNCFYPAPSAGTKEVLTALPVGIGVACSMLFVVFPTKRHGIGFPVTN  237



>gb|KHN15494.1| hypothetical protein glysoja_038165 [Glycine soja]
Length=219

 Score =   201 bits (512),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 138/198 (70%), Gaps = 16/198 (8%)
 Frame = -3

Query  707  PLLPAAKSP------SFSQRAL----ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAA  558
            PLL   + P      S  QRA+    +STAHLANLLPTGT+L+FQLL+PI TN G CD+ 
Sbjct  26   PLLHIMEVPDDDAQRSLIQRAMSQTFQSTAHLANLLPTGTVLSFQLLSPIVTNQGICDSV  85

Query  557  TRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADL  378
             + MT  L+++  VSCFL CFTDS R   G V YG AT  G+W+ D      +     +L
Sbjct  86   CKFMTSTLVALCGVSCFLQCFTDSFRDDKGNVCYGLATFRGMWVID-----GSTTIPPEL  140

Query  377  G-KFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSL  201
            G K+R   ID++HAV+S+LVF A+AL D+NVVSC +P P++ET+E+L V+P+ IG+ CS+
Sbjct  141  GAKYRLRLIDFLHAVMSILVFAAVALFDQNVVSCFFPSPSNETREILTVLPVAIGIFCSM  200

Query  200  LFLVFPTRRHGIGFPVTS  147
            LF+ FPT+RHGIGFP+++
Sbjct  201  LFVAFPTQRHGIGFPLST  218



>ref|XP_002305111.2| hypothetical protein POPTR_0004s04870g [Populus trichocarpa]
 gb|EEE85622.2| hypothetical protein POPTR_0004s04870g [Populus trichocarpa]
Length=234

 Score =   202 bits (513),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 135/189 (71%), Gaps = 8/189 (4%)
 Frame = -3

Query  701  LPAAKSPSFSQRAL----ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVL  534
            +P     +  Q+A+    +STAHLANLLPTGT+LAFQLL PIF+N G CD+ +R MT  L
Sbjct  49   MPNEDEQNLIQKAISQTFKSTAHLANLLPTGTILAFQLLLPIFSNQGNCDSVSRSMTAGL  108

Query  533  LSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFI  354
            +++  +SCFL+ FTDS R ++G V YGFAT  GLW+ D  A     ++      +R  FI
Sbjct  109  VALCGLSCFLSSFTDSFRDKNGNVCYGFATFRGLWVIDGSATIPPEVA----ANYRLQFI  164

Query  353  DYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRR  174
            D++HA++S+LVF AIAL D+NVV C YP P+ + +EVL  +P+GIG+  S+LFLVFPTRR
Sbjct  165  DFMHALMSILVFAAIALFDQNVVDCFYPSPSTKEEEVLTALPVGIGVFTSMLFLVFPTRR  224

Query  173  HGIGFPVTS  147
            HGIGFP+++
Sbjct  225  HGIGFPLSA  233



>ref|XP_007148117.1| hypothetical protein PHAVU_006G181900g [Phaseolus vulgaris]
 gb|ESW20111.1| hypothetical protein PHAVU_006G181900g [Phaseolus vulgaris]
Length=211

 Score =   200 bits (509),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 107/222 (48%), Positives = 143/222 (64%), Gaps = 17/222 (8%)
 Frame = -3

Query  800  RMSSQNLRSRTATPAAPAVDDREVETLSVPEP---LLPAAKSPSFSQRALESTAHLANLL  630
            ++ S + R+       P + + EV     PE    L+  A S +F     +STAHLANLL
Sbjct  4    KIESDDSRNEEDEERVPLMRNSEV-----PEAERNLIQKAISQTF-----QSTAHLANLL  53

Query  629  PTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGF  450
            PTGT+LAFQLL+PIFTN G CD+ T+ MT  L+S+ A SCFL C TDS R   G + YGF
Sbjct  54   PTGTVLAFQLLSPIFTNVGNCDSVTKAMTAALVSLCAASCFLLCLTDSFRDNKGNICYGF  113

Query  449  ATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYP  270
            AT  GLW+ D        ++     K+   FID +HAV+SVLVF AIAL D+NVV+C +P
Sbjct  114  ATLRGLWVIDGSTTLPPQLA----AKYCLKFIDILHAVMSVLVFAAIALFDQNVVNCFFP  169

Query  269  KPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSG  144
             P+ E QE+L  +P+GIG+L S+ F+ FPT+RHGIGFP+++ 
Sbjct  170  APSTEIQEILTALPVGIGVLGSMFFVAFPTQRHGIGFPLSTN  211



>gb|ACU15779.1| unknown [Glycine max]
Length=226

 Score =   200 bits (509),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 137/204 (67%), Gaps = 12/204 (6%)
 Frame = -3

Query  743  DDREVETLSVPEPLLPAAKSP----SFSQRAL----ESTAHLANLLPTGTLLAFQLLTPI  588
            DD + E      PLL  ++ P    +  Q+A+    +STAHL NLLPTGT+LAFQLL+PI
Sbjct  8    DDSQNEENEERIPLLRNSEVPEAERNLIQKAISQTFQSTAHLGNLLPTGTVLAFQLLSPI  67

Query  587  FTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaa  408
            FTN G CD+ ++ MT  L+S+   SCF++C TDS R   G + YGFAT  GLW+ D    
Sbjct  68   FTNVGNCDSVSKAMTAALVSLCGASCFMSCLTDSFRDSKGSICYGFATLRGLWVIDGSTT  127

Query  407  aaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVP  228
                ++     K+R   ID++HAV+SVLVF AIAL D+NVV+C +P P+ ETQE+L  +P
Sbjct  128  LPPQLA----AKYRLKLIDFMHAVMSVLVFAAIALFDRNVVNCFFPAPSTETQEILTALP  183

Query  227  IGIGLLCSLLFLVFPTRRHGIGFP  156
            +GIG+L S+ F+ FPT+RHGIGFP
Sbjct  184  VGIGVLGSMFFVAFPTQRHGIGFP  207



>gb|KEH30980.1| transmembrane protein, putative [Medicago truncatula]
Length=206

 Score =   199 bits (507),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 127/176 (72%), Gaps = 4/176 (2%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFT  492
             +  +STAHLANLLPTGT+L+FQLL+PIFTN G CD  T+ MTL LL++   SCFL CFT
Sbjct  35   NQTCKSTAHLANLLPTGTVLSFQLLSPIFTNQGKCDHVTQLMTLSLLTLCGASCFLLCFT  94

Query  491  DSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVA  312
            DS +   G + YGFAT  GLW+ D  A     +      K++  FID++HA++S+LVF A
Sbjct  95   DSFKDNKGNICYGFATFKGLWIIDGSATLPHELD----AKYQLRFIDFMHAIMSILVFSA  150

Query  311  IALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSG  144
            IA+ D NVV+C +P P++E +++L  +P+GIG+ CS+LF+ FPT RHGIGFP+++ 
Sbjct  151  IAMFDHNVVNCFFPSPSYEMRQILTALPVGIGVFCSMLFVAFPTHRHGIGFPLSTN  206



>ref|XP_010057364.1| PREDICTED: uncharacterized protein LOC104445239 [Eucalyptus grandis]
Length=205

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 127/175 (73%), Gaps = 4/175 (2%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFT  492
            ++  ESTAHLANLLPTGT+LAFQLL+PIF+N G CD A+R MT  L+ +  +S FL  FT
Sbjct  34   RQTFESTAHLANLLPTGTVLAFQLLSPIFSNQGHCDPASRAMTAGLVLLCGLSSFLLSFT  93

Query  491  DSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVA  312
            DS R   G V YGFAT  GLW+ D        +      ++R  FID+ HA++SVLVF A
Sbjct  94   DSFRDEKGDVCYGFATPHGLWVIDGLDTLPPELK----DQYRLRFIDFAHAIMSVLVFGA  149

Query  311  IALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTS  147
            +AL D+NVVSC YP P+ ET+EVL  +P+GIG +C++LF+VFPT+RHGIGFP++S
Sbjct  150  VALFDENVVSCFYPAPSDETREVLTALPVGIGAICTMLFVVFPTKRHGIGFPLSS  204



>ref|XP_004293868.1| PREDICTED: uncharacterized protein LOC101295896 [Fragaria vesca 
subsp. vesca]
Length=212

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/198 (53%), Positives = 132/198 (67%), Gaps = 14/198 (7%)
 Frame = -3

Query  710  EPLLPAAKSPSFS------QRAL----ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDA  561
             PLL    SP         QRA+    +STAHLANLLPTGT+LAFQLL PIFTN G CD+
Sbjct  18   HPLLHDTLSPEIEEKRTLIQRAMNQTFQSTAHLANLLPTGTVLAFQLLAPIFTNQGVCDS  77

Query  560  ATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaAD  381
             +R MT  L+ +   SCFL  FTDS R   G V YGFAT  GLW+ D   A A  ++   
Sbjct  78   VSRVMTAGLVGLCGASCFLLSFTDSYRDNKGNVCYGFATFKGLWIIDGSTALAPEVA---  134

Query  380  LGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSL  201
               FR  FID++HA +S+LVF AIAL D+NVV+C  P P+ + QEVL  +P+ IG+ CS+
Sbjct  135  -ANFRLKFIDFLHAFMSILVFAAIALYDQNVVNCFDPAPSDKAQEVLTSLPVAIGVFCSM  193

Query  200  LFLVFPTRRHGIGFPVTS  147
            LF+VFPT+RHGIGFP+++
Sbjct  194  LFVVFPTKRHGIGFPLSA  211



>ref|XP_006361068.1| PREDICTED: uncharacterized protein LOC102594723 [Solanum tuberosum]
Length=205

 Score =   198 bits (504),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 129/174 (74%), Gaps = 4/174 (2%)
 Frame = -3

Query  668  RALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTD  489
            +  +ST+HLANLLPTG++LAFQLL+PIFTN G CD   + +T+ L+++  +SCF+  FTD
Sbjct  35   QTFQSTSHLANLLPTGSVLAFQLLSPIFTNQGNCDKICKILTISLVTLCGLSCFILSFTD  94

Query  488  SVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAI  309
            S + + G++ YGFAT  GLW+ D        I+     K++  FID++H  +S+LVF AI
Sbjct  95   SFKDKKGKIIYGFATIRGLWIIDGSIRIPNQIAR----KYKLKFIDFLHGFMSMLVFAAI  150

Query  308  ALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTS  147
            AL D+NVV+C YPKP+ E +E+L  +PIG+G++CS+ F+VFPT+RHGIGFP+TS
Sbjct  151  ALFDQNVVNCFYPKPSDEIEELLVALPIGVGVICSMFFVVFPTKRHGIGFPLTS  204



>gb|EPS66984.1| hypothetical protein M569_07790, partial [Genlisea aurea]
Length=196

 Score =   198 bits (503),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 128/175 (73%), Gaps = 4/175 (2%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFT  492
             R   STAHLANLLPTG++LAFQLL PIF+N G CD   R MT  ++++  +SCFL CFT
Sbjct  25   SRTFRSTAHLANLLPTGSVLAFQLLVPIFSNEGRCDRVGRFMTAAVVALCGLSCFLLCFT  84

Query  491  DSVRG-RDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFV  315
            DSVRG RDG   YGFAT  GLW+ D       G +A    ++R  F+D+VHA +S+ VF 
Sbjct  85   DSVRGGRDGNPCYGFATPRGLWMIDGSPPPPPGAAAE---RYRLRFVDFVHAFMSIAVFA  141

Query  314  AIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            A+A+ D++ V+C +P+P+ E +EV+  +P+GIG++CS++F+VFPT+RHGIGFPVT
Sbjct  142  AVAMFDRDTVACFWPEPSGEAREVIAALPVGIGVVCSMMFVVFPTKRHGIGFPVT  196



>ref|XP_006377414.1| hypothetical protein POPTR_0011s05700g [Populus trichocarpa]
 gb|ERP55211.1| hypothetical protein POPTR_0011s05700g [Populus trichocarpa]
Length=233

 Score =   199 bits (505),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 136/195 (70%), Gaps = 12/195 (6%)
 Frame = -3

Query  707  PLLPAAKSPS----FSQRAL----ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATR  552
            PLL     P+      Q+A+    +STA+LANLLPTGT+LAFQLL+PIF+N G CD+ TR
Sbjct  42   PLLKGVAMPNEDTNLVQKAISQTFKSTAYLANLLPTGTVLAFQLLSPIFSNQGNCDSVTR  101

Query  551  PMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGK  372
             MT  L+ +  +SCFL+ F+DS R + G V YG AT  GLW+ D  A     ++      
Sbjct  102  SMTAGLVVLCGLSCFLSSFSDSFRDKKGNVCYGLATFRGLWVIDGSATIPPEVA----AN  157

Query  371  FRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFL  192
            +R  FID++HA++S+LVF AIAL D+NVV C YP P+ + QEVL  +P+GIG LCS+LF+
Sbjct  158  YRLRFIDFMHALMSILVFAAIALFDQNVVDCFYPSPSTKAQEVLTALPVGIGALCSMLFI  217

Query  191  VFPTRRHGIGFPVTS  147
            VFPT+RHGIGFP+++
Sbjct  218  VFPTKRHGIGFPLSA  232



>gb|EYU28015.1| hypothetical protein MIMGU_mgv1a013603mg [Erythranthe guttata]
Length=215

 Score =   198 bits (503),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 105/227 (46%), Positives = 147/227 (65%), Gaps = 14/227 (6%)
 Frame = -3

Query  827  RFKVAKSSTRMSSQNLRSRTATPAAPAVDDREVETLSVPEPLLPAAKSPSFSQRALESTA  648
            + KV   +   SSQ +      P        EV+   + +     A S +F+     STA
Sbjct  2    QIKVENENANGSSQEICEEEEVPLLAYKGIPEVQRNPIQQ-----AISETFA-----STA  51

Query  647  HLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDG  468
            HLANLLPTG++LAFQLL+PIF+N G CD+ +R +T  L+++  +SC L  FTDS   + G
Sbjct  52   HLANLLPTGSVLAFQLLSPIFSNQGQCDSVSRFLTGGLVALCGLSCILLSFTDSFNDQKG  111

Query  467  QVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNV  288
             +YYGFAT  GLW+ D  A     +S     K++  FID+VH+++S+LVF AIAL D+NV
Sbjct  112  NIYYGFATFRGLWIIDGSATLPPEVS----AKYKLKFIDFVHSLMSILVFAAIALFDENV  167

Query  287  VSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTS  147
            V+C YP+P+   +EVL  +P+GIG+ CS+LF+VFPT+RHGIGFPVT+
Sbjct  168  VNCFYPEPSTGVKEVLTAMPVGIGVTCSMLFVVFPTKRHGIGFPVTA  214



>ref|XP_009614893.1| PREDICTED: uncharacterized protein LOC104107719 [Nicotiana tomentosiformis]
Length=211

 Score =   197 bits (502),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 100/219 (46%), Positives = 147/219 (67%), Gaps = 20/219 (9%)
 Frame = -3

Query  794  SSQNLRSRTATPAAPAVDDREVETLSVPE---PLLPAAKSPSFSQRALESTAHLANLLPT  624
            +SQNL +   +P         +E L++PE    L+  A + +F     +STAHLANLLPT
Sbjct  9    TSQNLDNEEKSPL--------LENLALPEVQKNLIQKAITQTF-----QSTAHLANLLPT  55

Query  623  GTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFAT  444
            G++LAFQLL+PIFTN G CD   + +T+ L+++  +SCF+  FTDS   + G++ YGFAT
Sbjct  56   GSVLAFQLLSPIFTNQGECDKIGKSLTVALVTLCGLSCFILSFTDSFTDKKGKICYGFAT  115

Query  443  RGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKP  264
              GLW+ D  A     I+     K+R  FID++HA +S+LVF A+A  D+NVV+C YP+P
Sbjct  116  IRGLWIIDGSAKIPHQIAR----KYRLRFIDFMHAFMSILVFAAVAFFDQNVVNCFYPRP  171

Query  263  NHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTS  147
            + + +E+L  +P+ IG++CS+ F+VFPT+RHGIGFP+ S
Sbjct  172  SDQIEELLTALPVAIGVICSMFFVVFPTQRHGIGFPLIS  210



>ref|XP_011001224.1| PREDICTED: uncharacterized protein LOC105108575 [Populus euphratica]
Length=233

 Score =   198 bits (504),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 142/209 (68%), Gaps = 15/209 (7%)
 Frame = -3

Query  740  DREVETLSVPE---PLLPAAKSPS----FSQRAL----ESTAHLANLLPTGTLLAFQLLT  594
            D   ++L+  E   PLL     P+      Q+A+    +STAHLANLLPTGT+LAFQLL+
Sbjct  28   DSHHDSLNADEEKLPLLKGVAMPNEDTNLVQKAISQTFKSTAHLANLLPTGTVLAFQLLS  87

Query  593  PIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYP  414
            PIF+N G CD+ TR MT  L+ +  +SCFL+ F+DS R + G V YG AT  GLW+ D  
Sbjct  88   PIFSNQGNCDSVTRSMTAGLVLLCGLSCFLSSFSDSFRDKKGNVCYGLATFRGLWVIDGS  147

Query  413  aaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDV  234
            A     I+      +R  FID++HA++S+LVF AI+L D+N+V C YP P+ + QEVL  
Sbjct  148  ATIPPEIA----ANYRLRFIDFMHALMSILVFAAISLFDQNLVDCFYPSPSTKAQEVLTA  203

Query  233  VPIGIGLLCSLLFLVFPTRRHGIGFPVTS  147
            +P+GIG LCS+LF+VFPT+RHGIGFP+++
Sbjct  204  LPVGIGALCSMLFVVFPTKRHGIGFPLSA  232



>ref|XP_003593647.1| hypothetical protein MTR_2g014520 [Medicago truncatula]
 gb|ABN08709.1| Protein of unknown function DUF679 [Medicago truncatula]
 gb|AES63898.1| transmembrane protein, putative [Medicago truncatula]
Length=207

 Score =   197 bits (501),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 124/172 (72%), Gaps = 4/172 (2%)
 Frame = -3

Query  662  LESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSV  483
             +STAHLANLLPTGT+LA QLL+PIFTN G+CD+ ++ MT  L+++   SCFL  FTDS 
Sbjct  39   FQSTAHLANLLPTGTVLALQLLSPIFTNIGSCDSVSKWMTAALVTLCGASCFLLSFTDSF  98

Query  482  RGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIAL  303
            R   G + YGFAT  GLW+ D        ++     K+R  FID++HAV+S+LVF AIAL
Sbjct  99   RDSKGNIIYGFATFKGLWVIDGSTKLPPQVA----AKYRIRFIDFMHAVMSILVFAAIAL  154

Query  302  KDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTS  147
             D+NVV+C +P+P+ E QE+L  +P+ IG  CS+LF+ FPT RHGIGFP+++
Sbjct  155  FDRNVVNCFFPEPSKEIQEILTALPVAIGDFCSMLFVTFPTERHGIGFPLST  206



>ref|XP_009624698.1| PREDICTED: uncharacterized protein LOC104115715 [Nicotiana tomentosiformis]
Length=211

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 136/202 (67%), Gaps = 7/202 (3%)
 Frame = -3

Query  740  DREVETLSVPEPLLPAAKSPSFSQ---RALESTAHLANLLPTGTLLAFQLLTPIFTNNGA  570
            D E   L +    LP  +     Q   +  +STAHLANLLPTG++LAFQLL+PIFTN G 
Sbjct  14   DEEKAPLLLENSPLPEVEKNLIQQAISQTFKSTAHLANLLPTGSVLAFQLLSPIFTNQGE  73

Query  569  CDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagis  390
            CD   R +T  L+++  +SCFL  FTDS + + G V YG AT  GLW+ D  A     I+
Sbjct  74   CDVVGRSLTAALVALCGLSCFLLSFTDSFKDQKGNVCYGIATLRGLWIIDGSATPPPEIA  133

Query  389  aADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLL  210
                  ++   ID++HA++S+LVF A+AL D+NVV+C YP P+++TQE+L  +P+ IG++
Sbjct  134  ----ANYKLKLIDFMHAIMSILVFAAVALFDQNVVNCFYPTPSYQTQELLTALPVAIGVI  189

Query  209  CSLLFLVFPTRRHGIGFPVTSG  144
            CS+LF+VFPT+RHGIGFP+T+ 
Sbjct  190  CSMLFVVFPTQRHGIGFPLTAN  211



>ref|XP_008439807.1| PREDICTED: uncharacterized protein LOC103484494 [Cucumis melo]
Length=212

 Score =   197 bits (500),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 139/210 (66%), Gaps = 14/210 (7%)
 Frame = -3

Query  743  DDREVETLSVPEPLL------PAAKSPSFSQRAL----ESTAHLANLLPTGTLLAFQLLT  594
            D+     +   +PLL      P+    +  Q+A+     STA+LANLLPTGT+LAFQLL+
Sbjct  7    DEETQSRIDQKQPLLRETTFIPSRDEKTLIQKAISQTFRSTANLANLLPTGTVLAFQLLS  66

Query  593  PIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYP  414
            PIFTN G CD+ +R +T  L+++  +SCFL  FTDS R   G V YGFAT  GLW+ D  
Sbjct  67   PIFTNQGNCDSISRYLTAGLVALCGLSCFLQSFTDSFRDSQGNVSYGFATFRGLWVIDGS  126

Query  413  aaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDV  234
                  ++     K+R  FID++HA +S+LVF A+AL D+NVV+C YP P+ + +E+L  
Sbjct  127  VELPPTVA----AKYRLRFIDFLHAFMSILVFSAVALFDENVVNCFYPTPSDQAEEILTS  182

Query  233  VPIGIGLLCSLLFLVFPTRRHGIGFPVTSG  144
            +P+ IG+ CS+LF+VFPT+RHGIGFPV++ 
Sbjct  183  LPVAIGVFCSMLFVVFPTKRHGIGFPVSAN  212



>ref|XP_004248460.1| PREDICTED: uncharacterized protein LOC101254947 [Solanum lycopersicum]
Length=205

 Score =   196 bits (499),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 137/198 (69%), Gaps = 9/198 (5%)
 Frame = -3

Query  740  DREVETLSVPEPLLPAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDA  561
            +  +E   V + ++  A S +F     +ST+HLANLLPTG++LAFQLL+PIFTN G CD 
Sbjct  16   EENLELPQVEKNIIQKAISQTF-----QSTSHLANLLPTGSVLAFQLLSPIFTNQGNCDK  70

Query  560  ATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaAD  381
              + +T+ L+++  +SCF+  FTDS + + G++ YGFAT  GLW+ D        I+   
Sbjct  71   ICKILTIALVTLCGLSCFILSFTDSFKDKKGKISYGFATIRGLWIIDGSIRIPNQIAR--  128

Query  380  LGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSL  201
              +++  FID++H  +S+LVF  IAL D+NVV C YPKP+ E +E+L  +PIG+G++CS+
Sbjct  129  --RYKLKFIDFLHGFMSMLVFATIALFDQNVVKCFYPKPSDEIEELLVALPIGVGVICSI  186

Query  200  LFLVFPTRRHGIGFPVTS  147
             F+VFPT+RHGIGFP+TS
Sbjct  187  FFVVFPTKRHGIGFPLTS  204



>ref|NP_001144303.1| hypothetical protein [Zea mays]
 gb|ACG39406.1| hypothetical protein [Zea mays]
 gb|ACN28415.1| unknown [Zea mays]
 gb|AFW74215.1| hypothetical protein ZEAMMB73_018283 [Zea mays]
Length=235

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 119/214 (56%), Positives = 151/214 (71%), Gaps = 8/214 (4%)
 Frame = -3

Query  782  LRSRTATPAAPAVDDREVETLSVPEPLLP-AAKSPSFS--QRALESTAHLANLLPTGTLL  612
            LR R A  AA A  D++ E   + + LLP    SP+ S   +AL STA+LANLLPTGTLL
Sbjct  11   LRQRPA--AAAATPDQQHEPPRLEDGLLPNQGGSPATSALSQALSSTANLANLLPTGTLL  68

Query  611  AFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRG-RDGQVYYGFATRGG  435
            AF LL P FTN+GACDA T  +T  LL++LA++  LACFTDS++   DG+VYYG ATR G
Sbjct  69   AFNLLAPTFTNHGACDATTSLLTRGLLALLALASALACFTDSLKSPHDGRVYYGVATRTG  128

Query  434  LWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLY-PKPNH  258
            LWL DYP  A      A  G++R  FID+VHA LS  VF  +A +D++VV CLY P P+ 
Sbjct  129  LWLIDYPPGAPPLPEGA-TGRYRLAFIDFVHAALSAAVFGVVAARDRDVVVCLYGPTPDR  187

Query  257  ETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFP  156
             TQ++LDV+P+G+G+LCSLLF+ FPT RHGIG+P
Sbjct  188  ATQDLLDVLPLGVGVLCSLLFVAFPTTRHGIGYP  221



>ref|XP_003541524.1| PREDICTED: uncharacterized protein LOC100784415 [Glycine max]
 gb|KHN09964.1| hypothetical protein glysoja_026864 [Glycine soja]
Length=217

 Score =   194 bits (492),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 131/190 (69%), Gaps = 10/190 (5%)
 Frame = -3

Query  701  LPAAKSPSFSQRAL----ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVL  534
            +P     S  QRA+    +STAHLANLLPTGT+L+FQ L+PI TN G CD   + MT +L
Sbjct  32   VPDDAKRSLIQRAMSQAFQSTAHLANLLPTGTVLSFQFLSPIVTNQGNCDLVCKFMTSML  91

Query  533  LSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLG-KFRAGF  357
            +++   SCFL CFTDS R   G V YG AT  G+W+ D      +   + +LG K+R   
Sbjct  92   VALCGASCFLQCFTDSFRDDKGNVCYGLATFRGMWVID-----GSTTISPELGAKYRLKP  146

Query  356  IDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTR  177
            ID+VHAV+S+LVF A+ L D+NVVSC +P P++E +E+L V+P+ IG  CS+LF+ FPT+
Sbjct  147  IDFVHAVMSILVFAAVVLFDQNVVSCFFPSPSNEAREILTVLPVAIGAFCSMLFVAFPTQ  206

Query  176  RHGIGFPVTS  147
            RHGIGFP+++
Sbjct  207  RHGIGFPLST  216



>ref|XP_008798336.1| PREDICTED: uncharacterized protein LOC103713249 [Phoenix dactylifera]
Length=208

 Score =   194 bits (492),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 137/201 (68%), Gaps = 6/201 (3%)
 Frame = -3

Query  743  DDREVETLSVPEPLLPAAKSPSFS--QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGA  570
              ++ E L +P+      K+P     ++  +STAHLANLLPTGT+LAFQLL+PIFTN G 
Sbjct  11   QQQQEEPLLIPKSSNSDRKTPKRKAIRKTFKSTAHLANLLPTGTVLAFQLLSPIFTNQGR  70

Query  569  CDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagis  390
            C+A +  MT  L+++  +SCF+  FTDS R   G+V +G AT  GLW+ D  A     ++
Sbjct  71   CNAKSWNMTAGLVALCGLSCFILSFTDSFRDESGKVRHGLATFRGLWVIDGTAPLPPQVA  130

Query  389  aADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLL  210
                  +R   ID+VHA +S+LVFVA++L D+NVVSCLYP P+ E ++VL  +PIGIG+ 
Sbjct  131  V----NYRIKLIDFVHAFMSILVFVAVSLLDRNVVSCLYPTPSEEMKQVLASLPIGIGIF  186

Query  209  CSLLFLVFPTRRHGIGFPVTS  147
             S+LF+ FPTRRHGIGFP++S
Sbjct  187  GSMLFVAFPTRRHGIGFPLSS  207



>ref|XP_009800282.1| PREDICTED: uncharacterized protein LOC104246213 [Nicotiana sylvestris]
Length=211

 Score =   193 bits (491),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 140/199 (70%), Gaps = 12/199 (6%)
 Frame = -3

Query  731  VETLSVPE---PLLPAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDA  561
            +E L++PE    L+  A + +F     +STAHLANLLPTG++LAFQLL+PIFTN G CD 
Sbjct  22   LENLALPEVEKNLIQKAITQTF-----QSTAHLANLLPTGSVLAFQLLSPIFTNQGECDK  76

Query  560  ATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaAD  381
              + +T+ L+++  +SCF+  FTDS   + G++ YGFAT  GLW+ D  A     I+   
Sbjct  77   IGKSLTVALVTLCGLSCFILSFTDSFTDKKGKICYGFATIRGLWIIDGSAKIPHQIAR--  134

Query  380  LGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSL  201
              K++  FID++HA +S+LVF A+A  D+NVV+C YP+P+ + +E+++ +P+ IG++CS+
Sbjct  135  --KYKLKFIDFMHAFMSMLVFAAVAFFDQNVVNCFYPRPSDQIEELVNALPVAIGVICSM  192

Query  200  LFLVFPTRRHGIGFPVTSG  144
             F+VFPT+RHGIGFP+ S 
Sbjct  193  FFVVFPTQRHGIGFPLISN  211



>ref|XP_010245585.1| PREDICTED: uncharacterized protein LOC104589093 [Nelumbo nucifera]
Length=224

 Score =   193 bits (490),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 100/226 (44%), Positives = 137/226 (61%), Gaps = 5/226 (2%)
 Frame = -3

Query  827  RFKVAKSSTRMSSQNLRSRTATPAAPAVDDREVETLSVPEPLLPAAKSPSFSQRALESTA  648
              K+ K+      +           PA  + E  + + P+         + SQ   +STA
Sbjct  2    EIKIEKAEPEYLDEQRHPLLKDTTVPAGSESEQNSKTTPDNEQKTLIQKAISQ-TFKSTA  60

Query  647  HLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDG  468
            HLANLLPTGT+LAFQLL PI TN G CD   R MT  L+++   SC L  FTDS R  +G
Sbjct  61   HLANLLPTGTVLAFQLLAPILTNQGQCDIVGRYMTSSLVALCGFSCLLLSFTDSFRDGNG  120

Query  467  QVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNV  288
             V YG AT  GLW+ D     +  ++      +R  FID++HA +S+LVF A+AL D+NV
Sbjct  121  DVRYGIATFRGLWVIDGSCTISPEMA----AGYRIKFIDFMHAFMSILVFAAVALFDQNV  176

Query  287  VSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            V C YP P+ ET+E+L V+P+ IG++CS+LF+VFPT+RHGIGFP++
Sbjct  177  VDCFYPAPSDETKELLTVLPVEIGVICSMLFVVFPTKRHGIGFPLS  222



>ref|XP_010518775.1| PREDICTED: uncharacterized protein LOC104798405 [Tarenaya hassleriana]
Length=213

 Score =   192 bits (488),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 98/217 (45%), Positives = 139/217 (64%), Gaps = 10/217 (5%)
 Frame = -3

Query  785  NLRSRTATPAAPAVDDREVETLSVPEPLLPAAKSPSFSQRAL----ESTAHLANLLPTGT  618
             ++     P AP VD++ V  L   +  LP  +  ++ Q+A+    ++TAHLANLLPTGT
Sbjct  2    EIKVEVGNPDAPQVDEQRVPLLQDRD--LPEIERKNWVQKAISQTFQTTAHLANLLPTGT  59

Query  617  LLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRG  438
            +LAFQLL+PIFTN G CD  +R MT  L++I   SCF+  FTDS R ++G V YGFAT  
Sbjct  60   VLAFQLLSPIFTNGGNCDGVSRIMTASLVAICGFSCFILSFTDSFRDKNGNVCYGFATIR  119

Query  437  GLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNH  258
            GLW+ D        +S     ++    +D+ HA++SVLVF ++ L D+NVV+C +P P+ 
Sbjct  120  GLWIIDGSGTLPPEVSK----RYSLRCMDFTHAIMSVLVFGSVVLFDQNVVNCFFPAPST  175

Query  257  ETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTS  147
            E  EVL  +P+  G+ CS+LF  FPT RHGIGFP+++
Sbjct  176  EAMEVLTALPVATGVFCSMLFATFPTTRHGIGFPLSA  212



>ref|XP_004134946.1| PREDICTED: uncharacterized protein LOC101202820 [Cucumis sativus]
 gb|KGN49258.1| hypothetical protein Csa_6G518135 [Cucumis sativus]
Length=212

 Score =   191 bits (485),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 131/191 (69%), Gaps = 8/191 (4%)
 Frame = -3

Query  704  LLPAAKSPSFSQRAL----ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLV  537
            ++P+    +  Q+A+     STA+LANLLPTGT+LAFQLL+PIFTN G CD+ +R +T  
Sbjct  26   IIPSRDEKTLIQKAISQTFRSTANLANLLPTGTVLAFQLLSPIFTNQGNCDSISRYLTAG  85

Query  536  LLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGF  357
            L+++  +SCF   FTDS R   G V YGFAT  GLW+ D        ++      +R  F
Sbjct  86   LVALCGLSCFFQSFTDSFRDSQGNVSYGFATFRGLWVIDGSVELPPTVA----ASYRLRF  141

Query  356  IDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTR  177
            ID++HA +S+LVF A+AL D++VV+C YP P+ + +E+L  +P+ IG+ CS+LF+ FPTR
Sbjct  142  IDFLHAFMSILVFSAVALFDEDVVNCFYPTPSDQAEEILTSLPVAIGVFCSMLFVAFPTR  201

Query  176  RHGIGFPVTSG  144
            RHGIGFPV++ 
Sbjct  202  RHGIGFPVSAN  212



>ref|XP_002444870.1| hypothetical protein SORBIDRAFT_07g000680 [Sorghum bicolor]
 gb|EES14365.1| hypothetical protein SORBIDRAFT_07g000680 [Sorghum bicolor]
Length=250

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 131/175 (75%), Gaps = 2/175 (1%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFT  492
             +AL STA+LANLLPTGTLLAF LL P FTN+GACDA T  +T  LL++LA++  LACFT
Sbjct  65   SQALASTANLANLLPTGTLLAFNLLAPTFTNHGACDATTSLLTRCLLAVLALASALACFT  124

Query  491  DSVRG-RDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFV  315
            DS++   DG VYYG ATR GLWL DYP  A    +     ++R  FID+VHA LS  VF 
Sbjct  125  DSLKSPHDGHVYYGVATRTGLWLIDYPPDAPPLPTTTASCRYRLAFIDFVHAALSAAVFG  184

Query  314  AIALKDKNVVSCLY-PKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPV  153
             +A +D++VV+CL  P P  ET+E++DV+P+G+G+LCSLLF+ FPTRRHGIG+PV
Sbjct  185  VVAARDRDVVACLCGPTPRRETKELIDVLPLGVGVLCSLLFVAFPTRRHGIGYPV  239



>gb|EYU22091.1| hypothetical protein MIMGU_mgv1a013831mg [Erythranthe guttata]
Length=209

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 133/184 (72%), Gaps = 4/184 (2%)
 Frame = -3

Query  698  PAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDA-ATRPMTLVLLSIL  522
            PA K+    ++A + TAHL+NL PTG++L FQ+L+P+FT+ G C +  ++  TL LL + 
Sbjct  27   PAQKA---VRKAFKGTAHLSNLPPTGSVLTFQILSPVFTHEGKCKSFVSQSTTLFLLGLC  83

Query  521  AVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVH  342
            +VSCFL CFTDS R   G+V YG AT  GLW+ D    AA  ++  +  K+R GF D+ H
Sbjct  84   SVSCFLLCFTDSFRDERGKVRYGLATFRGLWIIDGGGPAAPAMAPEEAAKYRLGFGDFFH  143

Query  341  AVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIG  162
            A++SV+VF A+A+ D+NV++C YP+P+ E  E+L  +P+ +G++CS+LF++FPTRRHGIG
Sbjct  144  ALMSVMVFAAVAMFDQNVINCFYPEPSEEALEILTALPVTVGVICSILFVIFPTRRHGIG  203

Query  161  FPVT  150
            FP++
Sbjct  204  FPLS  207



>ref|XP_010919356.1| PREDICTED: uncharacterized protein LOC105043490 [Elaeis guineensis]
Length=234

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 108/246 (44%), Positives = 150/246 (61%), Gaps = 24/246 (10%)
 Frame = -3

Query  866  YTKLQNRHNRDLNRFKVAKSSTRMSSQNLRSRTATPAA------PAVDDREVETLSVPEP  705
            YT+  +   RD  + ++  ++++M+ +  + +             A DDR +        
Sbjct  6    YTQHTSNVVRDFQK-RIVMTASKMADEEAQLQQKQQQQPLLIPKSADDDRRI--------  56

Query  704  LLPAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSI  525
            L+  A S +F      STAHLANLLPTGT+LAFQLL+PIFTN G CD  +R MT  L+++
Sbjct  57   LIQKAISQTF-----RSTAHLANLLPTGTVLAFQLLSPIFTNEGHCDPMSRFMTTALVAL  111

Query  524  LAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYV  345
              +SCF   FTDS R   G+V YG AT  GLW+ D  A     I+      +R  FID+V
Sbjct  112  CGLSCFFQSFTDSFRDGSGEVRYGLATFRGLWVIDGTAPLPPEIAI----NYRIKFIDFV  167

Query  344  HAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGI  165
            HA +S+LVF A+AL D++VVSC YP P+ E ++VL  +PIGIG+  S+LF+ FPT RHGI
Sbjct  168  HAFMSILVFGAVALFDQSVVSCFYPTPSEEMKQVLTSLPIGIGVFGSMLFVTFPTTRHGI  227

Query  164  GFPVTS  147
            GFP++S
Sbjct  228  GFPLSS  233



>ref|XP_004168540.1| PREDICTED: uncharacterized protein LOC101230301, partial [Cucumis 
sativus]
Length=178

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 123/174 (71%), Gaps = 4/174 (2%)
 Frame = -3

Query  668  RALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTD  489
            +   STA+LANLLPTGT+LAFQLL+PIFTN G CD+ +R +T  L+++  +SCF   FTD
Sbjct  8    QTFRSTANLANLLPTGTVLAFQLLSPIFTNQGNCDSISRYLTAGLVALCGLSCFFQSFTD  67

Query  488  SVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAI  309
            S R   G V YGFAT  GLW+ D        ++      +R  FID++HA +S+LVF A+
Sbjct  68   SFRDSQGNVSYGFATFRGLWVIDGSVELPPTVA----ASYRLRFIDFLHAFMSILVFSAV  123

Query  308  ALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTS  147
            AL D++VV+C YP P+ + +E+L  +P+ IG+ CS+LF+ FPTRRHGIGFPV++
Sbjct  124  ALFDEDVVNCFYPTPSDQAEEILTSLPVAIGVFCSMLFVAFPTRRHGIGFPVSA  177



>ref|XP_006844888.1| hypothetical protein AMTR_s00058p00125960 [Amborella trichopoda]
 gb|ERN06563.1| hypothetical protein AMTR_s00058p00125960 [Amborella trichopoda]
Length=281

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 129/180 (72%), Gaps = 10/180 (6%)
 Frame = -3

Query  671  QRALE----STAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFL  504
            QRA++    STAHLANLLPTGT+L FQLL P+FT  G CD + R +T VL+   A+SC++
Sbjct  106  QRAIDQTFKSTAHLANLLPTGTVLTFQLLAPVFTGPGECDQSARFLTAVLVVGCALSCYV  165

Query  503  ACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGK-FRAGFIDYVHAVLSV  327
             CFTDS R  +G++ YG AT+ GLW+ D          A+D GK ++  F+D+VHA  SV
Sbjct  166  LCFTDSFRTSNGRICYGVATKNGLWVID-----GTVSEASDGGKEYKLRFVDFVHAFGSV  220

Query  326  LVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTS  147
            LVF+ IAL ++++V C YP P+ E  E+L  VP+GIG+LCS+LF+ FPT+RHGIGFP++S
Sbjct  221  LVFMTIALLNEDIVRCFYPSPSKEMAEMLTRVPVGIGVLCSMLFVAFPTKRHGIGFPLSS  280



>ref|XP_010924438.1| PREDICTED: uncharacterized protein LOC105047277 [Elaeis guineensis]
Length=210

 Score =   187 bits (476),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 125/175 (71%), Gaps = 4/175 (2%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFT  492
            ++  + TAHLANLLPTGT+LAFQLL+PIFTN G C+A    MT  L+++  +SCF+  FT
Sbjct  39   RKTFKKTAHLANLLPTGTVLAFQLLSPIFTNQGHCNAMNWYMTAGLVALCGLSCFIQSFT  98

Query  491  DSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVA  312
            DS R   G+V +G AT  GLW+ D  A     ++      +R  FID+VHA++S+LVFVA
Sbjct  99   DSFRDESGKVRHGLATFRGLWVIDGTAPLPPEVAI----NYRIKFIDFVHALMSILVFVA  154

Query  311  IALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTS  147
            +AL D+NVVSCLYP P+ E + VL  +PIGIG++ S+ F+ FP+ RHGIGFP++S
Sbjct  155  VALLDQNVVSCLYPTPSEEMKRVLTSLPIGIGVISSMFFVAFPSTRHGIGFPLSS  209



>ref|XP_009371494.1| PREDICTED: uncharacterized protein LOC103960740 [Pyrus x bretschneideri]
Length=220

 Score =   188 bits (477),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 129/189 (68%), Gaps = 4/189 (2%)
 Frame = -3

Query  713  PEPLLPAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAA-TRPMTLV  537
            P+P  P   +    ++  + TAHL+NLLPTGT+L FQ+ +P FT  G C A   + MT++
Sbjct  33   PKPKQPKTPARKAIRKTFKGTAHLSNLLPTGTVLVFQMFSPAFTRQGKCPAVLNQTMTVL  92

Query  536  LLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGF  357
            LL+  +++CFL  FTDS+R   G+V YG AT  GLW+ D    +   ++  +  K+R  F
Sbjct  93   LLTFCSLTCFLMRFTDSLRDERGKVQYGLATSKGLWILD---GSKITLAPEEADKYRVKF  149

Query  356  IDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTR  177
             D+ HA +SVLVF A+A+ DKNVV+C YPKP+ E +++L   P+G+G+ CSLLFL+FP+R
Sbjct  150  RDFFHAFMSVLVFAAVAMFDKNVVNCFYPKPSEEARQLLVAFPVGMGIACSLLFLLFPSR  209

Query  176  RHGIGFPVT  150
            RHGIGFP++
Sbjct  210  RHGIGFPLS  218



>ref|XP_011100240.1| PREDICTED: uncharacterized protein LOC105178468 [Sesamum indicum]
Length=223

 Score =   187 bits (475),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 125/175 (71%), Gaps = 4/175 (2%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDA-ATRPMTLVLLSILAVSCFLACF  495
            ++A + TAHL+NLLPTG++LAFQ+L+P+FT+ G C +  +R  TL LL   A SCF  CF
Sbjct  50   RKAFKGTAHLSNLLPTGSVLAFQVLSPVFTHEGKCKSIVSRSTTLGLLGFCAASCFFLCF  109

Query  494  TDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFV  315
            TDS R   G+V YG AT  GLW+ D    ++  +   +  KFR  F+D+ HA+LS++VF 
Sbjct  110  TDSFRDERGKVRYGLATFRGLWVID---GSSCALPPQEAEKFRLRFVDFFHALLSIVVFA  166

Query  314  AIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            A+A+ DKNV+ C YP P+ ET E+L  +P+ +G++CSL FL+FPT+RHG+GFP++
Sbjct  167  AVAMLDKNVMHCFYPSPSDETLEILTTLPVAVGVICSLFFLLFPTKRHGVGFPLS  221



>ref|XP_006471189.1| PREDICTED: uncharacterized protein LOC102623995 [Citrus sinensis]
Length=674

 Score =   197 bits (502),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 145/210 (69%), Gaps = 19/210 (9%)
 Frame = -3

Query  758  AAPAVDDREVETLSVPEPLLPAAKSPSFSQRALESTAHLANLLPTGT--LLAFQLLTPIF  585
            AA A+ D+ V +   P P                 T  + +++P G   +LAFQLLTPIF
Sbjct  479  AAAALRDKNVLSCFFPTPK--------------HETQEVLDIVPVGIGLILAFQLLTPIF  524

Query  584  TNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQV-YYGFATRGGLWLFDY-Pa  411
            TNNG+CDAATRP TL+LL ILA SCFLA FTDSV+    +  YYGFAT  GL+LFDY   
Sbjct  525  TNNGSCDAATRP-TLLLLLILAASCFLASFTDSVKSSSSKQVYYGFATFKGLFLFDYIQN  583

Query  410  aaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVV  231
              A+     DL K+R  FID VHAVLSV+VF A AL+DKNV+SC +P P HETQEVLD+V
Sbjct  584  PNASDHDLPDLRKYRIRFIDGVHAVLSVIVFAAAALRDKNVLSCFFPTPKHETQEVLDIV  643

Query  230  PIGIGLLCSLLFLVFPTRRHGIGFPVTSGK  141
            P+GIGL+CSLLF++FPTRRHGIG+ +T GK
Sbjct  644  PVGIGLICSLLFVIFPTRRHGIGYLITPGK  673


 Score =   180 bits (456),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 130/176 (74%), Gaps = 7/176 (4%)
 Frame = -3

Query  701  LPAAKSPSFSQRALE----STAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVL  534
             PA  + S S+RAL     STA+LAN LPTGTLLAFQLLTPIFTNNG+CDAATRP TL+L
Sbjct  346  FPAYANLSVSRRALSQTLTSTANLANPLPTGTLLAFQLLTPIFTNNGSCDAATRP-TLLL  404

Query  533  LSILAVSCFLACFTDSVRGRDGQV-YYGFATRGGLWLFDY-PaaaaagisaADLGKFRAG  360
            L ILA SCFLA FTDSV+    +  YYGFAT  GL+LFDY     A+     DL K+R  
Sbjct  405  LLILAASCFLASFTDSVKSSSSKQVYYGFATFKGLFLFDYIQNPNASDHDLPDLRKYRIR  464

Query  359  FIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFL  192
            FID VHAVLSV+VF A AL+DKNV+SC +P P HETQEVLD+VP+GIGL+ +   L
Sbjct  465  FIDGVHAVLSVIVFAAAALRDKNVLSCFFPTPKHETQEVLDIVPVGIGLILAFQLL  520



>emb|CDX76524.1| BnaA08g08760D [Brassica napus]
Length=214

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 138/214 (64%), Gaps = 17/214 (8%)
 Frame = -3

Query  746  VDDREVETLS-VPEPLL------PAAKSPSFSQRAL----ESTAHLANLLPTGTLLAFQL  600
            V+D ++ T   + +PLL      P  +  ++ Q+A+    ++TAHLANLLPTGT+LAFQL
Sbjct  6    VEDHQLSTKEDIEKPLLEENKGFPDVERTTWIQKAIGQTFQTTAHLANLLPTGTVLAFQL  65

Query  599  LTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFD  420
            L+PIF+N G CD A + MT  L++I   SCF+  FTDS + ++G + YGFAT  G W+ D
Sbjct  66   LSPIFSNGGQCDLACKIMTSSLVAICGFSCFILSFTDSYKDKNGTICYGFATIHGFWIID  125

Query  419  YPaaaaagisaADLGK-FRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEV  243
                  +     +L K ++  FID+ HA +S+LVF A+ L D+N V+C YP P+ E  EV
Sbjct  126  -----GSATLPQELAKNYKLRFIDFAHAFMSLLVFGAVVLFDRNTVNCFYPAPSAEELEV  180

Query  242  LDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSGK  141
            L  +P+G+G+ CS+LF  FPT R+GIGFPV   K
Sbjct  181  LTALPVGVGVFCSMLFATFPTTRNGIGFPVPGNK  214



>emb|CDY55785.1| BnaC03g76810D [Brassica napus]
 emb|CDX76523.1| BnaA08g08770D [Brassica napus]
Length=214

 Score =   185 bits (470),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 137/214 (64%), Gaps = 17/214 (8%)
 Frame = -3

Query  746  VDDREVETLS-VPEPLL------PAAKSPSFSQRAL----ESTAHLANLLPTGTLLAFQL  600
            V+D ++ T   +  PLL      P  +  ++ Q+A+    ++TAHLANLLPTGT+LAFQL
Sbjct  6    VEDHQLSTKEDIETPLLEENKDFPDVERTTWIQKAIGQTFQTTAHLANLLPTGTVLAFQL  65

Query  599  LTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFD  420
            L+PIF+N G CD A + MT  L++I   SCF+  FTDS + ++G + YGFAT  G W+ D
Sbjct  66   LSPIFSNGGQCDLACKIMTSSLVAICGFSCFILSFTDSYKDKNGTICYGFATIHGFWIID  125

Query  419  YPaaaaagisaADLGK-FRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEV  243
                  +     +L K ++  FID+ HA +S+LVF A+ L D+N V+C YP P+ E  EV
Sbjct  126  -----GSATLPQELAKNYKLRFIDFAHAFMSLLVFGAVVLFDRNTVNCFYPAPSAEELEV  180

Query  242  LDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSGK  141
            L  +P+G+G+ CS+LF  FPT R+GIGFPV   K
Sbjct  181  LTALPVGVGVFCSMLFATFPTTRNGIGFPVPGNK  214



>ref|XP_006414104.1| hypothetical protein EUTSA_v10027225mg [Eutrema salsugineum]
 gb|ESQ55557.1| hypothetical protein EUTSA_v10027225mg [Eutrema salsugineum]
Length=214

 Score =   185 bits (470),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 137/209 (66%), Gaps = 16/209 (8%)
 Frame = -3

Query  740  DREVETLSVPEPLL------PAAKSPSFSQRAL----ESTAHLANLLPTGTLLAFQLLTP  591
            D+      + +PLL      P  +  ++ Q+A+    ++TAHLANLLPTGT+LAFQLL+P
Sbjct  10   DQRSTKEEIEKPLLGEDKDFPDIERTTWIQKAIGQTFQTTAHLANLLPTGTVLAFQLLSP  69

Query  590  IFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPa  411
            IF+N G CD A++ MT +L++I   SCF+  FTDS + ++G + YGFAT  G W+ D   
Sbjct  70   IFSNGGQCDLASKIMTSILVAICGFSCFILSFTDSYKDKNGTICYGFATFHGFWIID---  126

Query  410  aaaagisaADLGK-FRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDV  234
               +     +L K ++  FID+ HA +S+LVF A+ L D+N V+C +P P+ E  EVL  
Sbjct  127  --GSTTLPQELSKRYKLRFIDFAHAFMSLLVFGAVVLFDRNAVNCFFPAPSAEALEVLTA  184

Query  233  VPIGIGLLCSLLFLVFPTRRHGIGFPVTS  147
            +P+G+G+ CS+LF  FPT R+GIGFP++S
Sbjct  185  LPVGVGVFCSMLFATFPTTRNGIGFPLSS  213



>ref|XP_008225181.1| PREDICTED: uncharacterized protein LOC103324847 [Prunus mume]
Length=227

 Score =   186 bits (471),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 137/209 (66%), Gaps = 9/209 (4%)
 Frame = -3

Query  758  AAPAVDDREVETL-----SVPEPLLPAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLT  594
            AAPA+ +   + L     +  EP  P   +    ++  + TAHL+NLLPTGT+L FQ+ +
Sbjct  20   AAPALQETYEQPLLENNAASIEPKPPKTPAQKAIRKTFKGTAHLSNLLPTGTVLVFQMFS  79

Query  593  PIFTNNGACDAA-TRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDY  417
            P FT  G C     + MTL LL + +++CFL CFTDS+R   G+V YG A+  GLW+ D 
Sbjct  80   PGFTRQGQCPTPINKTMTLGLLIVCSLTCFLLCFTDSLRDERGKVRYGLASFKGLWVID-  138

Query  416  PaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLD  237
               +   I+  ++ K+R  FID+ HA++S+ VF A+AL D+NVV C YPKP+ E +++L 
Sbjct  139  --GSKVAIAPEEVAKYRLRFIDFFHALMSIFVFAALALVDQNVVKCFYPKPSEEGKQLLA  196

Query  236  VVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
              P+GI ++CSLLF++FPT+RHGIGFP++
Sbjct  197  AFPVGIAVVCSLLFVLFPTKRHGIGFPLS  225



>ref|XP_003526262.1| PREDICTED: uncharacterized protein LOC100796945 [Glycine max]
 gb|KHN01096.1| hypothetical protein glysoja_040285 [Glycine soja]
Length=207

 Score =   184 bits (468),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 133/194 (69%), Gaps = 10/194 (5%)
 Frame = -3

Query  713  PEPLLPAAKSPSF-----SQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAAT-R  552
            P PLL   K+P        ++A + T+HLA LLPTGT+L FQ L+P+FT+ G C   T +
Sbjct  16   PTPLLLPQKTPKTPTQRTMRKAFKGTSHLAKLLPTGTVLIFQTLSPLFTHQGQCQTLTSK  75

Query  551  PMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGK  372
             MT  LL++ ++SCFL  FTDS R   G+V YG A+  GLW+ D    A+  +   +  K
Sbjct  76   TMTTCLLTLCSISCFLLSFTDSFRDERGKVRYGVASLKGLWVLD----ASIRVPVDEAEK  131

Query  371  FRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFL  192
            +R  FID+ HA +S+LVF+A+AL D +VVSC +PKP+ E +E+L  +PIGIG++CS+LF+
Sbjct  132  YRLRFIDFFHAFMSILVFLAVALLDGSVVSCFFPKPSEEAKELLVTLPIGIGIVCSVLFV  191

Query  191  VFPTRRHGIGFPVT  150
             FP++RHGIGFP++
Sbjct  192  AFPSQRHGIGFPLS  205



>ref|XP_009131711.1| PREDICTED: uncharacterized protein LOC103856352 [Brassica rapa]
Length=224

 Score =   185 bits (469),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 133/203 (66%), Gaps = 14/203 (7%)
 Frame = -3

Query  719  SVPEPLL------PAAKSPSFSQRAL----ESTAHLANLLPTGTLLAFQLLTPIFTNNGA  570
             + +PLL      P  +  ++ Q+A+    ++TAHLANLLPTGT+LAFQLL+PIF+N G 
Sbjct  26   EIEKPLLEEDKDFPDIERTTWIQKAIGQTFQTTAHLANLLPTGTVLAFQLLSPIFSNGGQ  85

Query  569  CDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagis  390
            CD  ++ MT VL+++   SCF+  FTDS + ++G + YGFAT  G W+ D  A     +S
Sbjct  86   CDVVSKIMTSVLVAVCGFSCFILSFTDSYKDKNGTICYGFATIHGFWIIDGSATLPQELS  145

Query  389  aADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLL  210
                 K++  FID+ HA +S+LVF A+ L D+N V+C +P P+ E  EVL  +P+G+G+ 
Sbjct  146  K----KYKLRFIDFAHAFMSLLVFGAVGLFDRNTVNCFFPAPSAEALEVLTALPVGVGVF  201

Query  209  CSLLFLVFPTRRHGIGFPVTSGK  141
            CS+LF  FPT R+GIGFPV   K
Sbjct  202  CSMLFATFPTTRNGIGFPVPGNK  224



>ref|XP_004252030.1| PREDICTED: uncharacterized protein LOC101254876 [Solanum lycopersicum]
Length=225

 Score =   185 bits (469),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 93/232 (40%), Positives = 148/232 (64%), Gaps = 13/232 (6%)
 Frame = -3

Query  842  NRDLNRFKVAKSSTRMSSQNLRSRTATPAAPAVDDREVETLSVPEPLLPAAKSPSFSQRA  663
            +++ N   VA ++ ++ ++++ +       P ++D +V      +P   AA+     ++ 
Sbjct  4    SKNSNSDSVAINTEKLETKSVVTSENQLEIPLLEDLQV----ADKPQKTAAQK--VIRKT  57

Query  662  LESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAA-TRPMTLVLLSILAVSCFLACFTDS  486
             + TA L+NLLP+G++LAFQ+L+P+ T+ G C +  +  MTL+LL I A+SCF  CFTDS
Sbjct  58   FKKTAVLSNLLPSGSVLAFQILSPVITHEGQCRSTISHSMTLILLGICAISCFFLCFTDS  117

Query  485  VRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIA  306
             R   G+V YG AT  GLW+ D            D+ K++  FID+ HA LS+LVF A+A
Sbjct  118  FRDERGKVRYGLATFRGLWIID------GSSPPEDVEKYKLKFIDFFHAFLSILVFCAVA  171

Query  305  LKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
              D+NV+ CLYP P+ + QE+L ++P+ +G++C+ LF+VFPT RHGIGFP++
Sbjct  172  AFDQNVMKCLYPSPSLDAQEILAILPMVVGVICTFLFVVFPTTRHGIGFPLS  223



>ref|XP_006398291.1| hypothetical protein EUTSA_v10001025mg [Eutrema salsugineum]
 gb|ESQ39744.1| hypothetical protein EUTSA_v10001025mg [Eutrema salsugineum]
Length=210

 Score =   184 bits (468),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 94/207 (45%), Positives = 129/207 (62%), Gaps = 13/207 (6%)
 Frame = -3

Query  740  DREVETLSVPEPLLPAAKSPSFSQRAL---------ESTAHLANLLPTGTLLAFQLLTPI  588
            D E        PLL A + P   +  L         ++TAHLANLLPTGT+LA+Q+L+PI
Sbjct  6    DEEAGIKEEKVPLLKAQEFPDIERNTLIHKVIGQTFKTTAHLANLLPTGTVLAYQVLSPI  65

Query  587  FTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaa  408
            FTN G CD A+R MT +L+ I   SCF+  FTDS +  +G V YGFAT  G W+ D  A 
Sbjct  66   FTNGGRCDLASRFMTEMLVFICGFSCFILSFTDSYKDLNGNVCYGFATTNGFWIIDGKAD  125

Query  407  aaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVP  228
                 S      +R  FID+ HA++S LVF A+ L D+NVV+C +P P+ E  E++  +P
Sbjct  126  LPRESSK----SYRLRFIDFAHAIMSFLVFGAVVLFDQNVVNCFFPNPSAEVSELVTSLP  181

Query  227  IGIGLLCSLLFLVFPTRRHGIGFPVTS  147
            + +G+ CSL+F  FPT+RHGIGFP+++
Sbjct  182  VAVGVFCSLMFATFPTKRHGIGFPLSA  208



>emb|CDX78854.1| BnaA01g09210D [Brassica napus]
Length=224

 Score =   185 bits (469),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 133/203 (66%), Gaps = 14/203 (7%)
 Frame = -3

Query  719  SVPEPLL------PAAKSPSFSQRAL----ESTAHLANLLPTGTLLAFQLLTPIFTNNGA  570
             + +PLL      P  +  ++ Q+A+    ++TAHLANLLPTGT+LAFQLL+PIF+N G 
Sbjct  26   EIEKPLLEEDKDFPDIERTTWIQKAIGQTFQTTAHLANLLPTGTVLAFQLLSPIFSNGGQ  85

Query  569  CDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagis  390
            CD  ++ MT VL+++   SCF+  FTDS + ++G + YGFAT  G W+ D  A     +S
Sbjct  86   CDVVSKIMTSVLVAVCGFSCFILSFTDSYKDKNGTICYGFATIHGFWIIDGSATLPQELS  145

Query  389  aADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLL  210
                 K++  FID+ HA +S+LVF A+ L D+N V+C +P P+ E  EVL  +P+G+G+ 
Sbjct  146  K----KYKLRFIDFAHAFMSLLVFGAVVLFDRNTVNCFFPAPSAEALEVLTALPVGVGVF  201

Query  209  CSLLFLVFPTRRHGIGFPVTSGK  141
            CS+LF  FPT R+GIGFPV   K
Sbjct  202  CSMLFATFPTTRNGIGFPVPGNK  224



>ref|XP_007213542.1| hypothetical protein PRUPE_ppa019527mg [Prunus persica]
 gb|EMJ14741.1| hypothetical protein PRUPE_ppa019527mg [Prunus persica]
Length=209

 Score =   184 bits (467),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 93/212 (44%), Positives = 139/212 (66%), Gaps = 15/212 (7%)
 Frame = -3

Query  758  AAPAVDD--------REVETLSVPEPLLPAAKSPSFSQRALESTAHLANLLPTGTLLAFQ  603
            AAPA+ +            +++   P  PA K+    ++  + TAHL+NLLPTGT+L FQ
Sbjct  2    AAPALQETYEQPLLENNAASIAPKPPKTPAQKA---IRKTFKGTAHLSNLLPTGTVLVFQ  58

Query  602  LLTPIFTNNGACDAA-TRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWL  426
            + +P FT  G C     + MTL LL + +++CFL CFTDS+R   G+V YG AT  GLW+
Sbjct  59   MFSPGFTRQGQCPTPINKTMTLGLLIVCSLTCFLLCFTDSLRDERGKVRYGLATFKGLWV  118

Query  425  FDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQE  246
             D    +   I+  ++ K+R  FID+ HA++S+ VF A+AL D+N+V+C YPKP+ E ++
Sbjct  119  ID---GSKVPIAPEEVAKYRLRFIDFFHALMSIFVFAALALVDQNIVNCFYPKPSEEGKQ  175

Query  245  VLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            +L   P+GI ++CSLLF++FPT+RHGIGFP++
Sbjct  176  LLAAFPVGIAVVCSLLFVLFPTKRHGIGFPLS  207



>ref|XP_009394826.1| PREDICTED: uncharacterized protein LOC103980228 [Musa acuminata 
subsp. malaccensis]
Length=211

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 123/178 (69%), Gaps = 8/178 (4%)
 Frame = -3

Query  671  QRALE----STAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFL  504
            QRA+     STAHLA LLPTGT+LAFQLL+PIFT+ G C AA R MT  L ++ A+SCF+
Sbjct  36   QRAISQTFRSTAHLAKLLPTGTVLAFQLLSPIFTDGGHCMAANRLMTACLAALCALSCFV  95

Query  503  ACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVL  324
              FTDS R  +  V YG AT  GLW+ D  A     I+      +R  FID+VHA +S L
Sbjct  96   LSFTDSFRDGNSTVRYGLATFKGLWVIDGTAPLPPTIAI----GYRIKFIDFVHAFMSFL  151

Query  323  VFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            VF A+AL D+NV SC YP P+ ET++VL  +P+ IG++CS+LF+ FPT RHGIGFP++
Sbjct  152  VFAAVALFDQNVASCFYPIPSEETKQVLTCLPVAIGVICSMLFVTFPTTRHGIGFPLS  209



>emb|CDY60883.1| BnaC01g40900D [Brassica napus]
Length=224

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 132/203 (65%), Gaps = 14/203 (7%)
 Frame = -3

Query  719  SVPEPLL------PAAKSPSFSQRAL----ESTAHLANLLPTGTLLAFQLLTPIFTNNGA  570
             + +PLL      P  +  ++ Q+A+    ++TAHLANLLPTGT+LAFQLL+PIF+N G 
Sbjct  26   EIEKPLLEEDKDFPDIERTTWIQKAIGQTFQTTAHLANLLPTGTVLAFQLLSPIFSNGGQ  85

Query  569  CDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagis  390
            CD  +  MT VL++I   SCF+  FTDS + ++G + YGFAT  G W+ D  A     +S
Sbjct  86   CDLVSEIMTSVLVAICGFSCFILSFTDSYKDKNGTICYGFATVHGFWIIDGSATLPQELS  145

Query  389  aADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLL  210
                 K++  FID+ HA +S+LVF A+ L D+N V+C +P P+ E  EVL  +P+G+G+ 
Sbjct  146  K----KYKLRFIDFAHAFMSLLVFGAVVLFDRNTVNCFFPAPSAEALEVLTALPVGVGVF  201

Query  209  CSLLFLVFPTRRHGIGFPVTSGK  141
            CS+LF  FPT R+GIGFPV   K
Sbjct  202  CSMLFASFPTTRNGIGFPVPGNK  224



>ref|XP_009395997.1| PREDICTED: uncharacterized protein LOC103981121 [Musa acuminata 
subsp. malaccensis]
Length=208

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 136/210 (65%), Gaps = 13/210 (6%)
 Frame = -3

Query  755  APAVDDREVETLSVPEPLLP----AAKSPSFSQRAL----ESTAHLANLLPTGTLLAFQL  600
            AP + D E +     +PLL          +  Q+A+    +STAHLA LLPTGT+LAFQL
Sbjct  2    APKMTDVEAQQQQ-KQPLLAPDSAGDDQATLVQKAISQTFKSTAHLAKLLPTGTVLAFQL  60

Query  599  LTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFD  420
            L+PIFT+ G C A  R MT  L++I  +SCF+  FTDS R  +G V YG AT  GLW+ D
Sbjct  61   LSPIFTDGGHCMAVNRLMTECLVAICGLSCFVLSFTDSFRDGNGTVRYGLATFRGLWVID  120

Query  419  YPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVL  240
                    I+     ++R  FID  HA++SVLVF A+AL D+NVVSC +P P+ ET++VL
Sbjct  121  GTKPLPPAIA----ARYRIKFIDLAHALVSVLVFAAVALFDQNVVSCFFPMPSEETKQVL  176

Query  239  DVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
              +P+GIG++ S+LF+ FPT RHGIGFP++
Sbjct  177  TCLPVGIGVIGSILFVTFPTTRHGIGFPLS  206



>ref|XP_004305429.1| PREDICTED: uncharacterized protein LOC101293416 [Fragaria vesca 
subsp. vesca]
Length=174

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 124/175 (71%), Gaps = 5/175 (3%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGAC-DAATRPMTLVLLSILAVSCFLACF  495
            ++  + TAHLANLLPTGT+L FQ+ +P FT  G C   A   MT+ LL   +VS FL CF
Sbjct  2    RKTFKGTAHLANLLPTGTVLTFQMFSPAFTYQGKCPTVANHTMTISLLIFCSVSSFLLCF  61

Query  494  TDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFV  315
            TDS+R   G+V YG AT  GL++ D     +  I   D+ K++  FID+ HA +SVLVF 
Sbjct  62   TDSIRDERGKVRYGLATFKGLFVLD----GSYKIRVEDVAKYKLTFIDFFHAFMSVLVFG  117

Query  314  AIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            A+AL D+N+V+C YP+P+ E +++L  VP+G+G++CS+LF++FPTRRHGIGFP++
Sbjct  118  AVALFDQNIVNCFYPQPSEEGKQLLFAVPVGVGVVCSILFVLFPTRRHGIGFPLS  172



>ref|XP_008455952.1| PREDICTED: uncharacterized protein LOC103496014 [Cucumis melo]
Length=219

 Score =   183 bits (464),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 124/175 (71%), Gaps = 5/175 (3%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDA-ATRPMTLVLLSILAVSCFLACF  495
            ++  + TAHLANLLPTGT+L FQ+L+PIFT+ G C+   ++  TL L+ + A SCF   F
Sbjct  47   RKTFKGTAHLANLLPTGTVLGFQILSPIFTHQGHCNTHVSQTTTLGLVLVCAFSCFFLLF  106

Query  494  TDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFV  315
            TDS R   G+V YG AT  GLW+ D     +  +   +  K+R  FID+ HA  S+LVF+
Sbjct  107  TDSFRDGRGKVRYGVATFQGLWVID----GSVTLPKEEAAKYRLRFIDFFHAFASLLVFI  162

Query  314  AIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            A+AL D+NVV CLYP P+ E +E+L V+P+GIG+LCS LF+VFPT+RHG+GFP++
Sbjct  163  AVALFDENVVKCLYPTPSDELRELLVVLPVGIGVLCSCLFIVFPTKRHGVGFPLS  217



>ref|XP_009108361.1| PREDICTED: uncharacterized protein LOC103834060 [Brassica rapa]
Length=214

 Score =   182 bits (462),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 96/214 (45%), Positives = 135/214 (63%), Gaps = 17/214 (8%)
 Frame = -3

Query  746  VDDREVETLS-VPEPLL------PAAKSPSFSQRAL----ESTAHLANLLPTGTLLAFQL  600
            V+D ++ T   + +PLL      P  +  ++ Q+A+    ++TAHLANLLPTGT+LAFQL
Sbjct  6    VEDHQLSTKEDIEKPLLEENKGFPDVERTTWIQKAIGQTFQTTAHLANLLPTGTVLAFQL  65

Query  599  LTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFD  420
            L+PIF+N G CD A + MT  L++I   SCF+  FTDS + ++G   YGFAT  G W+ D
Sbjct  66   LSPIFSNGGQCDLACKIMTSSLVAICGFSCFILSFTDSYKDKNGTFCYGFATIHGFWIID  125

Query  419  YPaaaaagisaADLGK-FRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEV  243
                  +     +L K ++  FID+ HA +S LVF A+ L D+N V+C YP P+ E  E 
Sbjct  126  -----GSATLPQELAKNYKLRFIDFAHAFMSFLVFGAVVLFDRNTVNCFYPAPSAEELEF  180

Query  242  LDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSGK  141
            L  +P+G+G+ CS+LF  FPT R+GIGFPV   K
Sbjct  181  LTALPVGVGVFCSMLFATFPTTRNGIGFPVPGNK  214



>ref|XP_006284515.1| hypothetical protein CARUB_v10005715mg [Capsella rubella]
 gb|EOA17413.1| hypothetical protein CARUB_v10005715mg [Capsella rubella]
Length=214

 Score =   182 bits (462),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 91/208 (44%), Positives = 134/208 (64%), Gaps = 16/208 (8%)
 Frame = -3

Query  737  REVETLSVPEPLL------PAAKSPSFSQRAL----ESTAHLANLLPTGTLLAFQLLTPI  588
            +  +   + +PLL      P  +  ++ Q+A+    ++TAHLANLLPTGT+LAFQLL+PI
Sbjct  11   KSTKEEEIKKPLLEQDKDFPDIERTTWIQKAIGQTFQTTAHLANLLPTGTVLAFQLLSPI  70

Query  587  FTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaa  408
            F+N G CD  ++ MT  L++I   SCF+  FTDS + ++G + YGFAT  G W+ D    
Sbjct  71   FSNGGQCDLVSKIMTSTLVAICGFSCFIYSFTDSYKDKNGTICYGFATFHGFWIID----  126

Query  407  aaagisaADLGK-FRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVV  231
              +     +L K ++  FID+VHA +S  VF A+ L D+N V+C +P P+ E  EVL  +
Sbjct  127  -GSTTLPQELSKRYKLRFIDFVHAFMSFFVFGAVVLFDRNAVNCFFPAPSAEALEVLTAL  185

Query  230  PIGIGLLCSLLFLVFPTRRHGIGFPVTS  147
            P+G+G+ CS+LF  FPT R+GIGFP++S
Sbjct  186  PVGVGVFCSMLFATFPTTRNGIGFPLSS  213



>ref|XP_008359069.1| PREDICTED: uncharacterized protein LOC103422787 [Malus domestica]
Length=218

 Score =   182 bits (462),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 127/189 (67%), Gaps = 4/189 (2%)
 Frame = -3

Query  713  PEPLLPAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAA-TRPMTLV  537
            P P  P   +    ++  + T HL+NLLPTGT+L FQ+ +P FT  G C A   + MT++
Sbjct  31   PXPKQPKTPARKAIRKTFKGTXHLSNLLPTGTVLVFQMFSPAFTRQGKCPAVLNQTMTVL  90

Query  536  LLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGF  357
            LL+  +++CFL  FTDS+R   G+V YG AT  GLW+ D    +   ++  +  K+R  F
Sbjct  91   LLTFCSLTCFLMRFTDSLRDERGKVRYGLATSKGLWILD---GSKITLAPEEADKYRVKF  147

Query  356  IDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTR  177
             D+ HA +SVLVF A+A+ D+NVV+C YPKP+ E +++L   P+G+G+ CSLLF++FP+R
Sbjct  148  RDFFHAFMSVLVFAAVAMFDQNVVNCFYPKPSEEARQLLVAFPVGMGIACSLLFVLFPSR  207

Query  176  RHGIGFPVT  150
            RHGIGFP++
Sbjct  208  RHGIGFPLS  216



>ref|XP_006655587.1| PREDICTED: uncharacterized protein LOC102706010 [Oryza brachyantha]
Length=231

 Score =   182 bits (463),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 123/179 (69%), Gaps = 9/179 (5%)
 Frame = -3

Query  671  QRAL----ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFL  504
            QRA+    +STAHLA LLPTGT+LAFQLL+PI TN G C  A R M   L+++ A+SCF+
Sbjct  55   QRAISQTYQSTAHLAKLLPTGTVLAFQLLSPIVTNQGHCVQANRAMAATLIALCALSCFV  114

Query  503  ACFTDSVR-GRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSV  327
              FTDS R G  G V YGFAT GGLW+ D  A      +      FR   +D VHAV+SV
Sbjct  115  LSFTDSFRDGATGAVRYGFATLGGLWVIDGGAPLDPQAA----AGFRIRLLDLVHAVMSV  170

Query  326  LVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            +VF A+AL D+NVVSC YP P+  T++VL  +PI IG++ S+LF+ FPT RHGIGFP++
Sbjct  171  MVFAAVALFDQNVVSCFYPVPSEGTRQVLTALPIAIGVVGSMLFVSFPTTRHGIGFPLS  229



>ref|XP_007132680.1| hypothetical protein PHAVU_011G115500g [Phaseolus vulgaris]
 gb|ESW04674.1| hypothetical protein PHAVU_011G115500g [Phaseolus vulgaris]
Length=202

 Score =   181 bits (460),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 140/203 (69%), Gaps = 10/203 (5%)
 Frame = -3

Query  740  DREVETLS-VPEPLLPAAKSPSFSQR----ALESTAHLANLLPTGTLLAFQLLTPIFTNN  576
            D +V TL  + E +LP   + + +Q+    A + TAHL+ LLPTGT+L FQ L+P+ T+ 
Sbjct  2    DFDVSTLQPLLENVLPHKTTKTPAQKTMRKAFKGTAHLSKLLPTGTVLIFQTLSPLLTHQ  61

Query  575  GACDAAT-RPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaa  399
            G C   T + MT+ LL++ ++SCFL  FTDS R   G+V YG A+  G+W+ D    A+ 
Sbjct  62   GQCQTITNKAMTIGLLTLCSISCFLLSFTDSFRDERGKVRYGVASMNGIWVMD----ASV  117

Query  398  gisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGI  219
             + A +  K+R  FID++HA +S+LVF+AIAL D +VVSC  PKP+ + +E+L V+P+GI
Sbjct  118  RLPADEAEKYRLRFIDFIHAFMSILVFMAIALFDGSVVSCFVPKPSEDAKELLMVLPVGI  177

Query  218  GLLCSLLFLVFPTRRHGIGFPVT  150
            GL+CSLLF+ FP +RHGIGFP++
Sbjct  178  GLVCSLLFVAFPGQRHGIGFPLS  200



>emb|CDY33452.1| BnaA06g36210D [Brassica napus]
Length=217

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 126/196 (64%), Gaps = 13/196 (7%)
 Frame = -3

Query  707  PLLPAAKSPSFSQ---------RALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAAT  555
            PLL A + P   +         +  ++TAHLAN LPTGT LA+Q+L+P+ TN G CD A+
Sbjct  24   PLLKAQEFPEVERNNWIHKAIGQTFQTTAHLANHLPTGTALAYQVLSPVLTNGGRCDFAS  83

Query  554  RPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLG  375
            R MT +L+SI A +CF+  FTDS R  +G V YGFAT  GLW+ D  A      S     
Sbjct  84   RYMTEMLVSICAFTCFILSFTDSYRDLNGTVCYGFATTNGLWIIDGKAVLPKERSK----  139

Query  374  KFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLF  195
             +R  FID+ HA +++LVF A+ + D NVVSC +PKP+ E  E+L  +P+ IG+ CS++F
Sbjct  140  SYRLQFIDFAHAFMTLLVFGAVVMFDHNVVSCFFPKPSAEVAELLTALPVAIGVFCSMMF  199

Query  194  LVFPTRRHGIGFPVTS  147
              FPT RHGIGFP+++
Sbjct  200  ATFPTTRHGIGFPLSA  215



>ref|XP_010517535.1| PREDICTED: uncharacterized protein LOC104792959 [Camelina sativa]
 ref|XP_010434538.1| PREDICTED: uncharacterized protein LOC104718476 [Camelina sativa]
Length=213

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/210 (44%), Positives = 134/210 (64%), Gaps = 16/210 (8%)
 Frame = -3

Query  743  DDREVETLSVPEPLL------PAAKSPSFSQRAL----ESTAHLANLLPTGTLLAFQLLT  594
            D +      + +PLL      P  +  ++ Q+A+    ++TAHLANLLPTGT+LAFQLL+
Sbjct  8    DHQRSTKEDIKKPLLEQDKDFPDIERTTWIQKAIGQTFQTTAHLANLLPTGTVLAFQLLS  67

Query  593  PIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYP  414
            PIF+N G CD  ++ MT  L++I   SCF+  FTDS + ++G + YGFAT  G W+ D  
Sbjct  68   PIFSNGGQCDLVSKIMTSTLVAICGFSCFILSFTDSYKDKNGTICYGFATFHGFWIID--  125

Query  413  aaaaagisaADLGK-FRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLD  237
                +     +L K ++  FID+VHA +S  VF A+ L D+N V+C +P P+ E  EVL 
Sbjct  126  ---GSTTLPQELSKRYKLRFIDFVHAFMSFFVFGAVVLFDRNAVNCFFPAPSAEALEVLT  182

Query  236  VVPIGIGLLCSLLFLVFPTRRHGIGFPVTS  147
             +P+G+G+ CS+LF  FPT R+GIGFP++S
Sbjct  183  ALPVGVGVFCSMLFATFPTTRNGIGFPLSS  212



>gb|KFK28517.1| hypothetical protein AALP_AA7G006800 [Arabis alpina]
Length=218

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/216 (44%), Positives = 137/216 (63%), Gaps = 20/216 (9%)
 Frame = -3

Query  746  VDDREVET------LSVPEPLL------PAAKSPSFSQRALE----STAHLANLLPTGTL  615
            V+D +  T        + +PLL      P  +  ++ Q+A+     +TAHLANLLPTGT+
Sbjct  6    VEDHQTSTTKEEEEEEIKKPLLGQDKDFPDIERNTWIQKAIGQTFVTTAHLANLLPTGTV  65

Query  614  LAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGG  435
            LAFQLL+PIF+N G CD A++ MT +L+SI    CF+  FTDS +  +G + YGFAT  G
Sbjct  66   LAFQLLSPIFSNGGQCDLASKIMTSMLVSICGFFCFILSFTDSYKDNNGTICYGFATFNG  125

Query  434  LWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHE  255
             W+ D  A     +S     K++  FID+ HA +S+LVF A+ L D+N V+C +P P+ E
Sbjct  126  FWIIDGSATLPQELSK----KYKLKFIDFAHAFMSLLVFGAVVLFDRNAVNCFFPVPSAE  181

Query  254  TQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTS  147
              EVL  +P+G+G+ CS+LF  FPT R+GIGFP++S
Sbjct  182  ALEVLTALPVGVGVFCSMLFATFPTTRNGIGFPLSS  217



>ref|XP_008344773.1| PREDICTED: uncharacterized protein LOC103407659 [Malus domestica]
 ref|XP_008363407.1| PREDICTED: uncharacterized protein LOC103427114 [Malus domestica]
Length=215

 Score =   181 bits (460),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/191 (46%), Positives = 130/191 (68%), Gaps = 4/191 (2%)
 Frame = -3

Query  719  SVPEPLLPAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAA-TRPMT  543
            + P+P  P   +    ++  ++TAHL+NLLPTGT+L FQ+ +P FT  G C A   + +T
Sbjct  26   TAPKPKQPKTPAQKAIRKTFKATAHLSNLLPTGTVLVFQMXSPAFTCQGKCPAILNQTVT  85

Query  542  LVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRA  363
            L+LL+  +++CFL C TDS+R   G+V YG AT  GLW+ D    +   +S  +  K+R 
Sbjct  86   LLLLTFCSLTCFLLCLTDSLRDERGKVRYGLATFKGLWILD---GSKITLSPEEAAKYRL  142

Query  362  GFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFP  183
             FID+ HA +S+LVF A+A+ DKNVV+C YPK + E +++L    +G G++CSLLF++FP
Sbjct  143  KFIDFFHAFMSILVFAAVAMLDKNVVNCFYPKLSEEARQLLVAFHVGTGIVCSLLFVLFP  202

Query  182  TRRHGIGFPVT  150
            +RRHGIGFP++
Sbjct  203  SRRHGIGFPLS  213



>gb|KGN63201.1| hypothetical protein Csa_2G408960 [Cucumis sativus]
Length=219

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 124/175 (71%), Gaps = 5/175 (3%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDA-ATRPMTLVLLSILAVSCFLACF  495
            ++A + TAHLANLLPTGT+L FQ+L+PIFT+ G C+   ++  TL L+ + A+SCF   F
Sbjct  47   RKAFKGTAHLANLLPTGTVLGFQILSPIFTHQGHCNTHVSQTTTLGLVLLCALSCFFLLF  106

Query  494  TDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFV  315
            TDS R   G+V YG  T  GLW+ D     +  +   +  K+R  FID+ HA  S+LVF+
Sbjct  107  TDSFRDSRGKVRYGVVTFQGLWVID----GSITLPKEEAAKYRLRFIDFFHAFTSLLVFI  162

Query  314  AIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            A+AL D+NVV C YP P+ E +E+L V+P+GIG+LCS LF+VFPT+RHG+GFP++
Sbjct  163  AVALFDENVVKCFYPTPSDELRELLVVLPVGIGVLCSGLFIVFPTKRHGVGFPLS  217



>ref|XP_006352030.1| PREDICTED: uncharacterized protein LOC102584291 [Solanum tuberosum]
Length=223

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 121/175 (69%), Gaps = 7/175 (4%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAA-TRPMTLVLLSILAVSCFLACF  495
            ++  + TA L+NLLP+G++LAFQ+L+P+ T+ G C ++ +  MTL+LL I A+SCF  CF
Sbjct  53   RKTFKKTAILSNLLPSGSVLAFQILSPVITHEGQCHSSISHSMTLILLGICAISCFFLCF  112

Query  494  TDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFV  315
            TDS R   G+V YG AT  GLW+ D            D   ++  FID+ HA LS+LVF 
Sbjct  113  TDSFRDERGKVRYGLATFRGLWIID------GSSPPEDAAIYKMKFIDFFHAFLSILVFC  166

Query  314  AIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            A+A  D+NV+ CLYP P+ + QE+L ++P+ +G++C+ LF+VFPT RHGIGFP++
Sbjct  167  AVAAFDQNVMKCLYPSPSPDAQEILAILPMAVGVICTFLFVVFPTTRHGIGFPLS  221



>ref|XP_009101545.1| PREDICTED: uncharacterized protein LOC103827755 [Brassica rapa]
Length=217

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 126/196 (64%), Gaps = 13/196 (7%)
 Frame = -3

Query  707  PLLPAAKSPSFSQ---------RALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAAT  555
            PLL A + P   +         +  ++TAHLAN LPTGT LA+Q+L+P+ TN G CD A+
Sbjct  24   PLLKAQEFPEVERNNWIHKAIGQTFQTTAHLANHLPTGTALAYQVLSPVLTNGGRCDFAS  83

Query  554  RPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLG  375
            R MT +L+SI A +CF+  FTDS R  +G V YGFAT  GLW+ D  A      S     
Sbjct  84   RYMTEMLVSICAFTCFILSFTDSYRDLNGTVCYGFATTNGLWIIDGKAVLPKERSK----  139

Query  374  KFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLF  195
             +R  FID+ HA +++LVF A+ + D NVV+C +PKP+ E  E+L  +P+ IG+ CS++F
Sbjct  140  SYRLQFIDFAHAFMTLLVFGAVVMFDHNVVNCFFPKPSAEVAELLTALPVAIGVFCSMMF  199

Query  194  LVFPTRRHGIGFPVTS  147
              FPT RHGIGFP+++
Sbjct  200  ATFPTTRHGIGFPLSA  215



>ref|XP_002867993.1| hypothetical protein ARALYDRAFT_914840 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44252.1| hypothetical protein ARALYDRAFT_914840 [Arabidopsis lyrata subsp. 
lyrata]
Length=213

 Score =   179 bits (455),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 134/210 (64%), Gaps = 16/210 (8%)
 Frame = -3

Query  743  DDREVETLSVPEPLL------PAAKSPSFSQRAL----ESTAHLANLLPTGTLLAFQLLT  594
            D ++     +  PLL      P  +  ++ Q+A+    ++TAHLANLLPTGT+LAFQLL+
Sbjct  8    DHQKSTKEDITRPLLEEDKNFPDIERTTWIQKAIGQTFQTTAHLANLLPTGTVLAFQLLS  67

Query  593  PIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYP  414
            PIF+N G CD  ++ MT  L++I   SCF+  FTDS + ++G + YG AT  G W+ D  
Sbjct  68   PIFSNGGQCDLVSKIMTSTLVAICGFSCFILSFTDSYKDKNGTICYGLATIHGFWIID--  125

Query  413  aaaaagisaADLGK-FRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLD  237
                +     +L K ++  FID+VHA +S+ VF A+ L D+N V+C +P P+ E  EVL 
Sbjct  126  ---GSTTLPQELSKRYKLRFIDFVHAFMSLFVFGAVVLFDRNAVNCFFPAPSAEALEVLT  182

Query  236  VVPIGIGLLCSLLFLVFPTRRHGIGFPVTS  147
             +P+G+G+ CS+LF  FPT R+GIGFP++S
Sbjct  183  ALPVGVGVFCSMLFATFPTTRNGIGFPLSS  212



>ref|NP_199421.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB08254.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED95336.1| uncharacterized protein AT5G46090 [Arabidopsis thaliana]
Length=214

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 129/190 (68%), Gaps = 10/190 (5%)
 Frame = -3

Query  701  LPAAKSPSFSQRAL----ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVL  534
            LP  +  +  Q+A+    ++TA+LANLLPTGT+LAFQ+L+PI TN G CD  +R MT +L
Sbjct  29   LPDIERNTMMQKAIGKTFQTTANLANLLPTGTVLAFQILSPICTNVGRCDLTSRFMTALL  88

Query  533  LSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGK-FRAGF  357
            +SI   SCF+  FTDS +  +G V YGFAT  G W+ D      +     +L K ++  F
Sbjct  89   VSICGFSCFILSFTDSYKDLNGSVCYGFATIHGFWIID-----GSATLPQELSKSYKLRF  143

Query  356  IDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTR  177
            ID+VHA++S LVF A+ L D+NVV+C YP+P+ E  E+L  +P+ +G+ CS++F  FPT 
Sbjct  144  IDFVHAIMSFLVFGAVVLFDQNVVNCFYPEPSAEVVELLTTLPVAVGVFCSMVFAKFPTT  203

Query  176  RHGIGFPVTS  147
            RHGIGFP+++
Sbjct  204  RHGIGFPLSA  213



>ref|XP_006281752.1| hypothetical protein CARUB_v10027911mg [Capsella rubella]
 gb|EOA14650.1| hypothetical protein CARUB_v10027911mg [Capsella rubella]
Length=224

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/214 (43%), Positives = 134/214 (63%), Gaps = 14/214 (7%)
 Frame = -3

Query  758  AAPAVDDREVETLSVPEPL------LPAAKSPSFSQRAL----ESTAHLANLLPTGTLLA  609
            A   +++  V  L   +P+       P  +  ++ Q+A+    ++TAHLANLLPTGT+LA
Sbjct  14   AHSMINEETVPLLEDEDPVQVLNRDFPDIERNTWIQKAIGQTFQTTAHLANLLPTGTVLA  73

Query  608  FQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLW  429
            +Q+L+PIFTN G C  A+R MT  L+SI   SCF+  FTDS +  +G V YGFAT  G W
Sbjct  74   YQILSPIFTNAGNCSLASRIMTASLVSICGFSCFILNFTDSYKDLNGNVCYGFATINGFW  133

Query  428  LFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQ  249
            + D  A      S      ++  FID++HA++S LVF A+ L D+N V C +P+P+ E  
Sbjct  134  IIDGSATLPQERSK----SYKLRFIDFLHAIMSFLVFGAVVLFDQNAVKCFFPEPSAEAA  189

Query  248  EVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTS  147
            E+L  +P+ +G+ CS+LF  FPT RHGIGFP+++
Sbjct  190  ELLTALPVAVGVFCSMLFATFPTTRHGIGFPLSA  223



>ref|XP_002865206.1| hypothetical protein ARALYDRAFT_916829 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41465.1| hypothetical protein ARALYDRAFT_916829 [Arabidopsis lyrata subsp. 
lyrata]
Length=219

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/231 (41%), Positives = 140/231 (61%), Gaps = 18/231 (8%)
 Frame = -3

Query  827  RFKVAKSSTRMSSQNLRSRTATPAAPAVDDREVETLSVPEPLLPAAKSPSFSQRAL----  660
              KV + +  + ++ ++  T     P +DDR            P  +  +  Q+A+    
Sbjct  2    EIKVDEEAGTIGARRIKEETV----PLLDDRN------RNRDFPDIERNTMMQKAIGKTF  51

Query  659  ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVR  480
            ++TA+LANLLPTGT+LAFQ+L+PI TN G CD A+R MT +L+SI   SCF+  FTDS +
Sbjct  52   QTTANLANLLPTGTVLAFQILSPICTNAGQCDLASRVMTALLVSICGFSCFILSFTDSYK  111

Query  479  GRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALK  300
              +G V YGFAT  G W+ D  A      S      ++  FID+VHA++S LVF A+ L 
Sbjct  112  DLNGNVCYGFATIHGFWIIDGSATLPQERSK----SYKVRFIDFVHAIMSFLVFGAVVLF  167

Query  299  DKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTS  147
            D+N V C +P+P+ E  ++L  +P+ +G+ CS++F  FPT RHGIGFP+++
Sbjct  168  DQNAVKCFFPEPSAEVADLLTTLPVAVGVFCSMVFATFPTTRHGIGFPLSA  218



>emb|CDY34571.1| BnaC03g56710D [Brassica napus]
Length=217

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/196 (46%), Positives = 125/196 (64%), Gaps = 13/196 (7%)
 Frame = -3

Query  707  PLLPAAKSPSFSQ---------RALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAAT  555
            PLL A + P   +         +  ++TAHLAN LPTGT LA+Q+L+P+ TN G CD A+
Sbjct  24   PLLKAQEFPEVERNNWIHKAIGQTFKTTAHLANHLPTGTALAYQVLSPVLTNGGRCDFAS  83

Query  554  RPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLG  375
            R MT +L+SI A +CF+  F+DS R  +G V YGFA   GLW+ D  A      S     
Sbjct  84   RYMTEMLVSICAFTCFILSFSDSYRDLNGTVCYGFAMTNGLWIIDGKAVLPKERSK----  139

Query  374  KFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLF  195
             +R  FID+ HA +++LVF A+ + D NVVSC +PKP+ E  E+L  +P+ IG+ CS++F
Sbjct  140  SYRLQFIDFAHAFMTLLVFGAVVMFDHNVVSCFFPKPSAEVAELLTALPVAIGVFCSMMF  199

Query  194  LVFPTRRHGIGFPVTS  147
              FPT RHGIGFP+++
Sbjct  200  ATFPTTRHGIGFPLSA  215



>ref|XP_004505628.1| PREDICTED: uncharacterized protein LOC101497875 [Cicer arietinum]
Length=201

 Score =   177 bits (450),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 125/185 (68%), Gaps = 5/185 (3%)
 Frame = -3

Query  701  LPAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAAT-RPMTLVLLSI  525
            +P   +    ++  + TA+LANLLPTGT+L FQ L+P  T+ G C   T + MT+ LL+ 
Sbjct  19   IPKTTTQKTIRKTFKGTAYLANLLPTGTVLIFQTLSPALTHKGQCHTITSKIMTIGLLTF  78

Query  524  LAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYV  345
             ++SCFL  FTDS+R   G+V YG AT  G+W+ D     +  +   +  K++  F+D  
Sbjct  79   CSISCFLLSFTDSIRDERGKVRYGVATLNGIWVMD----GSIKLQGEEANKYKLRFLDLF  134

Query  344  HAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGI  165
            HA  S+LVF AIAL D++VV+CL P P+ E +E+L VVPIGIG+LCS+LFL FPT+RHGI
Sbjct  135  HACGSILVFGAIALFDQSVVTCLAPNPSEEAKELLAVVPIGIGILCSVLFLAFPTQRHGI  194

Query  164  GFPVT  150
            GFP++
Sbjct  195  GFPLS  199



>ref|XP_009101549.1| PREDICTED: uncharacterized protein LOC103827757 [Brassica rapa]
Length=241

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/228 (40%), Positives = 137/228 (60%), Gaps = 11/228 (5%)
 Frame = -3

Query  821  KVAKSSTRMSSQNLRSRTATPAAPAVDDREVETLSVPEPLLPAAKSPSFSQRAL----ES  654
            +  K   R+ ++ LR        P ++D   + + +     PA +  ++ Q+A+    ++
Sbjct  19   EAEKVRRRIEAEKLRRVIQEEKVPLLED---DKILIQTREFPAIERNTWIQKAIGQTFQT  75

Query  653  TAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGR  474
            T+HLANLLPTGT+LA+Q+L+PIFTN G+C  A+R MT  L+ I   SCF+  FTDS +  
Sbjct  76   TSHLANLLPTGTVLAYQILSPIFTNAGSCSLASRFMTATLVFICGFSCFILSFTDSYKDL  135

Query  473  DGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDK  294
            +G   YGFAT  G W+ D  A      +      ++  FID+ HA++S LVF A+ + D+
Sbjct  136  NGNSCYGFATFNGFWIIDGSATLPPERART----YKLRFIDFAHAIMSFLVFGAVVMFDQ  191

Query  293  NVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            N V C  P P+ E  E+L  +P+GIG+ CS+LF +FPT RHGIGF ++
Sbjct  192  NAVKCFIPVPSAEEAEILTALPVGIGVFCSMLFAIFPTTRHGIGFSLS  239



>ref|XP_010441629.1| PREDICTED: uncharacterized protein LOC104724778 [Camelina sativa]
Length=224

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/189 (47%), Positives = 123/189 (65%), Gaps = 8/189 (4%)
 Frame = -3

Query  701  LPAAKSPSFSQRAL----ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVL  534
             P  +  ++ Q+A+    ++TAHLANLLPTGT+LAFQ+L+PIFTN G C  A+R MT  L
Sbjct  39   FPDIERNTWIQKAIGQTFQTTAHLANLLPTGTVLAFQILSPIFTNAGHCSLASRIMTASL  98

Query  533  LSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFI  354
            +SI   SC +  FTDS +  +G V YGFAT  G W+ D  A      S      ++  FI
Sbjct  99   VSICGFSCLILSFTDSYKDLNGNVCYGFATINGFWIIDGSATLPQERSK----SYKLRFI  154

Query  353  DYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRR  174
            D+ HA++S LVF A+ L D+N V C +P+P+ E  E+L  +P+ +G+ CS+LF  FPT R
Sbjct  155  DFAHAIMSFLVFGAVVLFDQNAVKCFFPEPSAEAAELLTALPVAVGVFCSMLFATFPTTR  214

Query  173  HGIGFPVTS  147
            HGIGFP+++
Sbjct  215  HGIGFPLSA  223



>emb|CDX77629.1| BnaC07g18830D [Brassica napus]
Length=241

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/228 (40%), Positives = 136/228 (60%), Gaps = 11/228 (5%)
 Frame = -3

Query  821  KVAKSSTRMSSQNLRSRTATPAAPAVDDREVETLSVPEPLLPAAKSPSFSQRAL----ES  654
            +  K   R+ ++ LR        P ++D   + + +     PA +  ++ Q+A+    ++
Sbjct  19   EAEKVRRRIEAEKLRRMIQEEKVPLLED---DKILIQTREFPAIERNTWIQKAIGQTFQT  75

Query  653  TAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGR  474
            T+HLANLLPTGT+LA+Q+L+PIFTN G+C  A+R MT  L+ I   SCF+  FTDS +  
Sbjct  76   TSHLANLLPTGTVLAYQILSPIFTNAGSCSLASRFMTATLVFICGFSCFILSFTDSYKDL  135

Query  473  DGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDK  294
            +G   YGFAT  G W+ D  A      +      ++  FID+ HA++S LVF A+ + D+
Sbjct  136  NGNSCYGFATFNGFWIIDGSATLPPERATT----YKLRFIDFAHAIMSFLVFGAVVMFDQ  191

Query  293  NVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            N V C  P P+ E  E+L  +P+GIG+ CS+LF  FPT RHGIGF ++
Sbjct  192  NAVKCFIPVPSAEEAEILTALPVGIGVFCSMLFATFPTTRHGIGFSLS  239



>ref|XP_008811089.1| PREDICTED: uncharacterized protein LOC103722318 [Phoenix dactylifera]
 ref|XP_008811201.1| PREDICTED: uncharacterized protein LOC103722398 [Phoenix dactylifera]
Length=206

 Score =   177 bits (449),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 117/173 (68%), Gaps = 4/173 (2%)
 Frame = -3

Query  668  RALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTD  489
            +  +S AHLANLLPTGT+LAFQ+L+PI TN G C  A R MT  L+ +  +SCF+  FTD
Sbjct  36   QTFKSVAHLANLLPTGTVLAFQVLSPILTNLGRCTDANRTMTACLVVLCGLSCFVLSFTD  95

Query  488  SVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAI  309
            S + + G++ YG AT GG+W+ D        I+      +   F+D+VHA +SVL+F A+
Sbjct  96   SFQDKTGKIRYGLATFGGMWIIDGAKPLPPEIA----ANYSVKFVDFVHAFMSVLIFAAV  151

Query  308  ALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            AL DKNVVSC YP P+ + ++VL  +P+ IG+  S +F+ FPT RHGIGFPV+
Sbjct  152  ALFDKNVVSCFYPVPSEDMEQVLTALPVAIGVFGSAVFVTFPTTRHGIGFPVS  204



>emb|CDY70034.1| BnaAnng32400D [Brassica napus]
Length=241

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 90/228 (39%), Positives = 137/228 (60%), Gaps = 11/228 (5%)
 Frame = -3

Query  821  KVAKSSTRMSSQNLRSRTATPAAPAVDDREVETLSVPEPLLPAAKSPSFSQRAL----ES  654
            +  K   R+ ++ +R        P ++D   + + +     PA +  ++ Q+A+    ++
Sbjct  19   EAKKVRRRIEAEKVRRMIQEEKVPLLED---DKILIQTREFPAIERNTWIQKAIGQTFQT  75

Query  653  TAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGR  474
            T+HLANLLPTGT+LA+Q+L+PIFTN G+C  A+R MT  L+ I   SCF+  FTDS +  
Sbjct  76   TSHLANLLPTGTVLAYQILSPIFTNAGSCSLASRFMTATLVFICGFSCFILSFTDSYKDL  135

Query  473  DGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDK  294
            +G   YGFAT  G W+ D  A      +      ++  FID+ HA++S LVF A+ + D+
Sbjct  136  NGNSCYGFATFNGFWIIDGSATLPPERART----YKLRFIDFAHAIMSFLVFGAVVMFDQ  191

Query  293  NVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            N V C  P P+ E  E+L  +P+GIG+ CS+LF +FPT RHGIGF ++
Sbjct  192  NAVKCFIPVPSAEEAEILTALPVGIGVFCSMLFAIFPTTRHGIGFSLS  239



>emb|CDX77630.1| BnaC07g18840D [Brassica napus]
Length=217

 Score =   177 bits (449),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 89/196 (45%), Positives = 125/196 (64%), Gaps = 13/196 (7%)
 Frame = -3

Query  707  PLLPAAKSPSFSQ---------RALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAAT  555
            PLL A + P   +         +  ++TAHLAN LPTGT LA+Q+L+P+ TN G CD A+
Sbjct  24   PLLKAQEFPEVERNNWIHKAIGQTFKTTAHLANHLPTGTALAYQVLSPVLTNGGRCDFAS  83

Query  554  RPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLG  375
            R MT +L+SI A +CF+  F+DS R  +G V YGFA   GLW+ D  A      S     
Sbjct  84   RYMTEMLVSICAFTCFILSFSDSYRDLNGTVCYGFAMTNGLWIIDGKAVLPKERSK----  139

Query  374  KFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLF  195
             +R  FID+ HA +++LVF A+ + D NVV+C +PKP+ E  E+L  +P+ IG+ CS++F
Sbjct  140  SYRLQFIDFAHAFMTLLVFGAVVMFDHNVVNCFFPKPSAEVAELLSALPVAIGVFCSMMF  199

Query  194  LVFPTRRHGIGFPVTS  147
              FPT RHGIGFP+++
Sbjct  200  ATFPTTRHGIGFPLSA  215



>ref|XP_003566981.1| PREDICTED: uncharacterized protein LOC100827369 [Brachypodium 
distachyon]
Length=208

 Score =   177 bits (448),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 120/174 (69%), Gaps = 4/174 (2%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFT  492
            +R  +ST HL+ LLPTGT+LAFQLL PIF  +G C  A + MT  L+ + A+SC +  FT
Sbjct  37   RRTYQSTEHLSKLLPTGTVLAFQLLAPIFAKHGHCSNANQMMTGGLVVLCALSCVVLSFT  96

Query  491  DSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVA  312
            DS R   G+V YGFAT  GLW+ D  A+     +     +++  F+D+VHA +S ++FVA
Sbjct  97   DSFRDEQGKVRYGFATFKGLWVIDGGASLDPNAAV----EYKIQFLDFVHATVSAMIFVA  152

Query  311  IALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            IAL D+NV SC YP P+ +T++VL  +PI IG++ S+LF+ FPT RHGIGFPV+
Sbjct  153  IALFDQNVASCFYPIPSEDTKQVLKTLPIAIGVIGSMLFVTFPTTRHGIGFPVS  206



>emb|CDP12432.1| unnamed protein product [Coffea canephora]
Length=222

 Score =   177 bits (448),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 100/221 (45%), Positives = 137/221 (62%), Gaps = 23/221 (10%)
 Frame = -3

Query  773  RTATPAAPAVDDREVETLSVPEPLLPAAKSPSFS-----QRAL---------ESTAHLAN  636
            +   PA  + ++ + +T     PLL + KSPS +     Q +L         + TA+LA 
Sbjct  4    KVEIPAPQSTNNGDAKT-----PLLASQKSPSTTTPQTDQNSLIAQAISSTFKGTAYLAC  58

Query  635  LLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYY  456
             LPTGT+LAFQLL+PI +N G CD A + MT +LLS+ AVSCF+  FTDS +   G+V++
Sbjct  59   RLPTGTVLAFQLLSPILSNQGVCDVAFKTMTAILLSLCAVSCFILSFTDSFKDEKGKVFF  118

Query  455  GFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCL  276
            GFAT  G     YP      IS A+  K + G  D++ A LS+LVF  IAL DKN+V C 
Sbjct  119  GFATFKGF----YPIDRTVTISPAEAAKKKIGPFDFLQAFLSMLVFATIALLDKNIVDCF  174

Query  275  YPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPV  153
            Y  P+ E +EVL V+P+  G++CS+LF+ FPT+RHGIGF V
Sbjct  175  YATPSVEIKEVLSVLPVANGVVCSMLFVAFPTQRHGIGFGV  215



>ref|XP_009785080.1| PREDICTED: uncharacterized protein LOC104233393 [Nicotiana sylvestris]
Length=216

 Score =   176 bits (446),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/224 (42%), Positives = 145/224 (65%), Gaps = 14/224 (6%)
 Frame = -3

Query  812  KSSTRMSSQNLRSRTATPAAPAVDDREVETLSVPEPLLPAAKSPS--FSQRALESTAHLA  639
            +++ ++ ++N+ +       P ++D     L V +P     K+P+    ++  + TA LA
Sbjct  2    EATNKLGTENVVASENQLEIPLLEDE----LIVEKP----KKTPAQKVIRKTFKKTAILA  53

Query  638  NLLPTGTLLAFQLLTPIFTNNGACDAA-TRPMTLVLLSILAVSCFLACFTDSVRGRDGQV  462
            NLLP+G++LAFQ+L+P+ T+ G C ++ +  MTL LL+  A+SCF   FTDS R   G+V
Sbjct  54   NLLPSGSVLAFQILSPVITHEGQCHSSISHSMTLGLLAFCAISCFFLNFTDSFRDERGKV  113

Query  461  YYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVS  282
             YG AT  GLW+ D    +   I   +  K++  F+D  HA+LS+LVF A+A  D+NV+ 
Sbjct  114  RYGLATFRGLWIID---GSNIIIPPEEATKYKLRFLDVFHALLSILVFGAVAAFDQNVIK  170

Query  281  CLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            CLYP P+ ETQEVL ++P+ +G++C+LLF+ FPT RHGIGFP++
Sbjct  171  CLYPSPSPETQEVLAILPMAVGVICTLLFVAFPTTRHGIGFPLS  214



>ref|XP_010494774.1| PREDICTED: uncharacterized protein LOC104771868 [Camelina sativa]
Length=224

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 122/189 (65%), Gaps = 8/189 (4%)
 Frame = -3

Query  701  LPAAKSPSFSQRAL----ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVL  534
             P  +  ++ Q+A+    ++TAHLANLLPTGT+LAFQ+L+PIFTN G C   +R MT  L
Sbjct  39   FPDIERNTWIQKAIGQTFQTTAHLANLLPTGTVLAFQILSPIFTNAGHCSLTSRIMTASL  98

Query  533  LSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFI  354
            +SI   SC +  FTDS +  +G V YGFAT  G W+ D  A      S      ++  FI
Sbjct  99   VSICGFSCLILSFTDSYKDLNGNVCYGFATINGFWIIDGSATLPQERSK----SYKLRFI  154

Query  353  DYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRR  174
            D+ HA++S LVF A+ L D+N V C +P+P+ E  E+L  +P+ +G+ CS+LF  FPT R
Sbjct  155  DFAHAIMSFLVFGAVVLFDQNAVKCFFPEPSAEAAELLTALPVAVGVFCSMLFATFPTTR  214

Query  173  HGIGFPVTS  147
            HGIGFP+++
Sbjct  215  HGIGFPLSA  223



>ref|XP_002275299.1| PREDICTED: uncharacterized protein LOC100245474 [Vitis vinifera]
 emb|CBI21903.3| unnamed protein product [Vitis vinifera]
Length=214

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 128/194 (66%), Gaps = 10/194 (5%)
 Frame = -3

Query  716  VPEPLLPAAKSP--SFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGAC-DAATRPM  546
            +PE L+   K+P   F ++  + TAHL+NLLPTGT+L FQ+ +PI TN G C  +AT  +
Sbjct  28   IPEKLM---KTPLQRFIRKTFKGTAHLSNLLPTGTVLGFQMFSPILTNKGHCLTSATHSL  84

Query  545  TLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFR  366
            TL LL+    SCF+  FTDS R   G+V YG AT  GLW+ D     A  ++      +R
Sbjct  85   TLGLLAACCASCFILSFTDSFRDAKGKVRYGLATSRGLWVIDGSVTLAPDVA----AGYR  140

Query  365  AGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVF  186
              FID+VHA +S++VF A+AL D+N+V C  P P+ ET+++L  VP+  G++C L F+VF
Sbjct  141  LKFIDFVHAFMSIVVFAAVALFDQNIVKCFCPMPSEETKKLLVAVPLWTGVVCCLFFVVF  200

Query  185  PTRRHGIGFPVTSG  144
            P++RHGIGFP++ G
Sbjct  201  PSKRHGIGFPLSRG  214



>ref|XP_010481500.1| PREDICTED: uncharacterized protein LOC104760291 [Camelina sativa]
Length=224

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 122/189 (65%), Gaps = 8/189 (4%)
 Frame = -3

Query  701  LPAAKSPSFSQRAL----ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVL  534
             P  +  ++ Q+A+    ++TAHLANLLPTGT+L FQ+L+PIFTN G C  A+R MT  L
Sbjct  39   FPDIERNTWIQKAIGQTFQTTAHLANLLPTGTVLTFQILSPIFTNAGHCSLASRIMTASL  98

Query  533  LSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFI  354
            +SI   SC +  FTDS +  +G V YGFAT  G W+ D  A      S      ++  FI
Sbjct  99   VSICGFSCLILSFTDSYKDLNGNVCYGFATINGFWIIDGSATLPQERSK----SYKLRFI  154

Query  353  DYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRR  174
            D+ HA++S LVF A+ L D+N V C +P+P+ E  E+L  +P+ +G+ CS+LF  FPT R
Sbjct  155  DFAHAIMSFLVFGAVVLFDQNAVKCFFPEPSAEAAELLTALPVAVGVFCSMLFATFPTTR  214

Query  173  HGIGFPVTS  147
            HGIGFP+++
Sbjct  215  HGIGFPLSA  223



>ref|XP_003607515.1| hypothetical protein MTR_4g078870 [Medicago truncatula]
 gb|AES89712.1| DUF679 domain membrane protein [Medicago truncatula]
Length=205

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 126/185 (68%), Gaps = 5/185 (3%)
 Frame = -3

Query  701  LPAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAAT-RPMTLVLLSI  525
            +P   +    ++A + TA+LANLLPTGT+L FQ L+P  T+ G C   T + MT++ L+ 
Sbjct  23   IPKTTTQKTIRKAFKGTAYLANLLPTGTVLIFQTLSPALTHRGNCHTQTSKIMTMIFLTF  82

Query  524  LAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYV  345
             ++SCFL  FTDS R   G+V YG AT  G+W+ D        I A +  K++  FID  
Sbjct  83   CSLSCFLLSFTDSFRDERGKVRYGVATLNGIWIMD----GRIRIPAEEGVKYKLRFIDLF  138

Query  344  HAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGI  165
            HA  S+LVF AIA+ D++VVSCL PKP+ E +E+L  +PIGIG+LCS+LFL+FPT+RHGI
Sbjct  139  HACGSILVFGAIAMFDQSVVSCLAPKPSEEAKELLVALPIGIGILCSVLFLLFPTQRHGI  198

Query  164  GFPVT  150
            GFP++
Sbjct  199  GFPLS  203



>ref|NP_567556.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM66991.1| unknown [Arabidopsis thaliana]
 dbj|BAF00698.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE84044.1| uncharacterized protein AT4G18425 [Arabidopsis thaliana]
Length=213

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 126/190 (66%), Gaps = 10/190 (5%)
 Frame = -3

Query  701  LPAAKSPSFSQRAL----ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVL  534
             P  +  ++ Q+A+    ++TAHLANLLPTGT+LAFQLL+PIF+N G CD  ++ MT  L
Sbjct  28   FPDIERTTWIQKAIGQTFQTTAHLANLLPTGTVLAFQLLSPIFSNGGQCDLVSKIMTSTL  87

Query  533  LSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGK-FRAGF  357
            ++I   SCF+  FTDS + ++G + YG AT  G W+ D      +     +L K ++  F
Sbjct  88   VAICGFSCFILSFTDSYKDKNGTICYGLATIHGFWIID-----GSTTLPQELSKRYKLRF  142

Query  356  IDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTR  177
            ID+VHA +S+ VF A+ L D+N V+C +P P+ E  EVL  +P+G+G+  S+LF  FPT 
Sbjct  143  IDFVHAFMSLFVFGAVVLFDRNAVNCFFPSPSAEALEVLTALPVGVGVFSSMLFATFPTT  202

Query  176  RHGIGFPVTS  147
            R+GIGFP++S
Sbjct  203  RNGIGFPLSS  212



>ref|XP_003567905.1| PREDICTED: uncharacterized protein LOC100824681 [Brachypodium 
distachyon]
Length=229

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 122/175 (70%), Gaps = 9/175 (5%)
 Frame = -3

Query  659  ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVR  480
            +STAHLA LLPTGT+LAFQLL+P+ TN G C  + R M   L+S+ A+SCF+  FTDS R
Sbjct  57   QSTAHLATLLPTGTVLAFQLLSPLVTNQGDCLPSNRAMAGALVSLCALSCFVLSFTDSFR  116

Query  479  -----GRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFV  315
                 G +G V YGFAT  GLW+ D      A + A+   K+R  F+D VHAV+SV+VF 
Sbjct  117  DDKQTGNNGAVRYGFATLRGLWVID----GGAPLEASQAAKYRVRFLDLVHAVVSVMVFA  172

Query  314  AIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            A+AL D+NVV C  P P+ + ++VL V+PI IG++ S+LF+ FPT RHGIGFP++
Sbjct  173  AVALFDQNVVGCFCPVPSQDARQVLTVLPIAIGVVGSMLFVAFPTTRHGIGFPLS  227



>ref|XP_009589871.1| PREDICTED: uncharacterized protein LOC104087172 [Nicotiana tomentosiformis]
Length=216

 Score =   175 bits (444),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/224 (41%), Positives = 143/224 (64%), Gaps = 14/224 (6%)
 Frame = -3

Query  812  KSSTRMSSQNLRSRTATPAAPAVDDREVETLSVPEPLLPAAKSPS--FSQRALESTAHLA  639
            +++ ++ ++N+ +       P ++D E+    V +P     K+P+    ++  + TA LA
Sbjct  2    EATKKLGTENVVASENQLEIPLLEDEEI----VEKP----KKTPAQKVIRKTFKKTAILA  53

Query  638  NLLPTGTLLAFQLLTPIFTNNGACDAA-TRPMTLVLLSILAVSCFLACFTDSVRGRDGQV  462
            NLLP+G++LAFQ+L+P+ T+ G C ++ +  MTL LL   A+SCF   FTDS R   G+V
Sbjct  54   NLLPSGSVLAFQILSPVITHEGQCHSSISHSMTLGLLVFCAISCFFLNFTDSFRDERGKV  113

Query  461  YYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVS  282
             YG AT  GLW+ D    +   I   +  K++  F+D  HA+LS+LVF A+A  D+NV+ 
Sbjct  114  RYGLATFRGLWIID---GSNITIPPEEATKYKLKFLDVFHALLSILVFGAVAAFDQNVIK  170

Query  281  CLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            CLYP P  ETQE+L  +P+ +G++C+LLF+ FPT RHGIGFP++
Sbjct  171  CLYPSPPPETQEILATLPMAVGVICTLLFVAFPTTRHGIGFPLS  214



>ref|XP_010093959.1| hypothetical protein L484_010525 [Morus notabilis]
 gb|EXB54946.1| hypothetical protein L484_010525 [Morus notabilis]
Length=226

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 125/186 (67%), Gaps = 9/186 (5%)
 Frame = -3

Query  692  AKSPSFSQRAL----ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDA-ATRPMTLVLLS  528
            AK+P+  Q+A+    + TAHLANLLPTG++LAFQ+L+P FT+ G C +  ++  T  LL+
Sbjct  43   AKTPA--QKAMRKTFKGTAHLANLLPTGSVLAFQILSPAFTHQGQCRSRVSQATTFGLLA  100

Query  527  ILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDY  348
              A SCFL CFTDS R   G+V YG AT  GLW+ D  A A      A+   +R   ID+
Sbjct  101  CCAASCFLLCFTDSFRDARGKVRYGVATFRGLWIVDGSAGAVIAAEEAE--NYRLMVIDF  158

Query  347  VHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHG  168
             HA+ S+LVF A+   D+NVV C  P P+ E +E+L  VP+G+G+LCSL F+ FPTRRHG
Sbjct  159  FHALASLLVFAAVVAFDENVVRCFCPAPSEEVKELLVAVPVGVGVLCSLFFVAFPTRRHG  218

Query  167  IGFPVT  150
            IGFP++
Sbjct  219  IGFPLS  224



>ref|XP_011043659.1| PREDICTED: uncharacterized protein LOC105139057 [Populus euphratica]
Length=207

 Score =   175 bits (443),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 121/175 (69%), Gaps = 5/175 (3%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAAT-RPMTLVLLSILAVSCFLACF  495
            ++  + TAHLA LLPTG++L FQ+L+PI T+ G C + T + +T  LL++  ++CFL CF
Sbjct  35   RKTFKGTAHLARLLPTGSVLTFQILSPILTHEGQCRSVTSQTLTSGLLAVCGLACFLLCF  94

Query  494  TDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFV  315
            TDS R   G+V YG  T  GLW+ D    A   +S  +  K++  FID +HA +S+LVF 
Sbjct  95   TDSFRDARGKVRYGMVTFKGLWIID----ATVELSPEEAAKYKLKFIDVLHAFMSILVFA  150

Query  314  AIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            A++L DKNVV C +P P  E +++L VVP  IG+LCS+LFL FP++RHGIGFP++
Sbjct  151  AVSLFDKNVVKCFFPAPTDEAKDLLIVVPATIGVLCSILFLAFPSKRHGIGFPLS  205



>ref|XP_010904899.1| PREDICTED: uncharacterized protein LOC105032218 [Elaeis guineensis]
Length=211

 Score =   175 bits (443),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/173 (49%), Positives = 115/173 (66%), Gaps = 3/173 (2%)
 Frame = -3

Query  668  RALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTD  489
            +  +S AHLANLLPTGT+LAFQ+L+PI TN G C  A R MT  L+++  +SCF+ CFTD
Sbjct  40   QTFKSAAHLANLLPTGTVLAFQVLSPILTNLGRCTDANRIMTACLVALCGLSCFILCFTD  99

Query  488  SVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAI  309
            +     G++ YG AT  G+W+ D               ++R  FID+VHA +SVL+F A+
Sbjct  100  TFHDAAGKIRYGLATFRGIWIID---GTGPLPPEIPAARYRIKFIDFVHAFMSVLIFAAV  156

Query  308  ALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            AL DKNVVSC YP P+ + ++VL  +P+ IG+  S +F+ FPT R GIGFPV+
Sbjct  157  ALFDKNVVSCFYPVPSEDVEQVLTALPVAIGVFGSSVFVAFPTTRQGIGFPVS  209



>emb|CAN65382.1| hypothetical protein VITISV_028557 [Vitis vinifera]
Length=265

 Score =   176 bits (447),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 115/166 (69%), Gaps = 4/166 (2%)
 Frame = -3

Query  668  RALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTD  489
            +  +STAHLANLLPTGT+LAFQ L+P+ TN G CD  +R MT  LL++  +SCFL CFTD
Sbjct  41   QTFQSTAHLANLLPTGTVLAFQFLSPVLTNKGECDPVSRFMTSSLLALCGMSCFLQCFTD  100

Query  488  SVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAI  309
            S R  +G VYYGFAT  GLW+ D  A     ++     +++  FID++HA +S+LVF AI
Sbjct  101  SFRDNNGNVYYGFATFRGLWIIDGSATLPPELA----AEYQLRFIDFIHAFMSILVFAAI  156

Query  308  ALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRH  171
            AL D+NVV+C YP P+ ET+E+L  +P+GIG+ CS   L   + RH
Sbjct  157  ALFDENVVNCFYPTPSDETKELLTSLPVGIGVFCSYHCLNRTSTRH  202



>ref|XP_008783285.1| PREDICTED: uncharacterized protein LOC103702573 [Phoenix dactylifera]
Length=187

 Score =   173 bits (438),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 118/177 (67%), Gaps = 6/177 (3%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFT  492
             R  ESTA+LANLLPTGT+LAFQ+L+P  TN G C  A R MT  L+++  +SCF+  FT
Sbjct  7    HRTFESTANLANLLPTGTVLAFQILSPTCTNLGRCTGANRAMTASLVALCGLSCFILNFT  66

Query  491  DSVRGRD---GQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLV  321
            DS    D   G+V YG AT  GLW+FD PA+         + K+R  F D+VHA  SVLV
Sbjct  67   DSFHSGDDAEGKVRYGLATFRGLWVFDDPASLPPPEM---MAKYRIRFRDFVHAFTSVLV  123

Query  320  FVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            F+ + L DKNVVSC YP P+   ++VL  +P+ IG+L S LF+V PT RHGIGFP++
Sbjct  124  FMGVVLCDKNVVSCFYPIPSENMEQVLAALPLAIGVLGSALFVVLPTTRHGIGFPLS  180



>ref|XP_002876900.1| hypothetical protein ARALYDRAFT_484296 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53159.1| hypothetical protein ARALYDRAFT_484296 [Arabidopsis lyrata subsp. 
lyrata]
Length=211

 Score =   174 bits (440),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 99/232 (43%), Positives = 132/232 (57%), Gaps = 51/232 (22%)
 Frame = -3

Query  782  LRSRTATPAAPAVDDREVETLSVPEPLLPAAKSPSFSQRALEST----AHLANLLPTGTL  615
            LR R A   AP +D+              + + PS S+RA+ +T    A+L+NLLPTGTL
Sbjct  4    LRLRNANTPAPELDEF-------------SDQIPSESRRAMSNTLTSAANLSNLLPTGTL  50

Query  614  LAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGG  435
            LAFQLLT +FT+NG CD AT                   FTDSV+  D  +Y+ F T  G
Sbjct  51   LAFQLLTLVFTSNGVCDLAT-----------------PSFTDSVKAEDVTIYFDFVTFKG  93

Query  434  LWLFDYPaaaaagi-----------------saADLGKFRAGFIDYVHAVLSVLVFVAIA  306
            +W+ DYP  +  G+                    DL K+R   +D++HA LSVLVF A+A
Sbjct  94   MWVVDYPDLSGLGLPDETVKIRKLNRLPVYPITPDLAKYRMWVVDWIHATLSVLVFGAVA  153

Query  305  LKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            L+DK +  C  P P  ET+ VLD+VP+G+G++CSLLF+VFP RRHGIG+ VT
Sbjct  154  LRDKYITDCFCPSPEAETKHVLDIVPVGVGVMCSLLFMVFPARRHGIGYLVT  205



>gb|AAU10653.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG93162.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79697.1| hypothetical protein OsI_20986 [Oryza sativa Indica Group]
Length=238

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 122/181 (67%), Gaps = 11/181 (6%)
 Frame = -3

Query  671  QRAL----ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDA-ATRPMTLVLLSILAVSCF  507
            QRA+    +STAHLA LLPTGT+LAFQLL+PI TN G CD  A R M   L+++ A+SCF
Sbjct  60   QRAISQTYQSTAHLAKLLPTGTVLAFQLLSPIVTNQGHCDVEANRAMAGALIALCALSCF  119

Query  506  LACFTDSVR--GRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVL  333
            +  FTDS R     G V YGFAT  GLW+ D  A      +      +R   +D VHAV+
Sbjct  120  VLSFTDSFRDAATGGAVRYGFATPAGLWVIDGGAPLDPQAA----AAYRLRLLDLVHAVV  175

Query  332  SVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPV  153
            SV+VF A+AL D+NVVSC YP P+  T++VL  +PI IG++ S+LF+ FPT RHGIGFP+
Sbjct  176  SVMVFAAVALFDQNVVSCFYPVPSEGTRQVLTALPIAIGVVGSMLFVSFPTTRHGIGFPL  235

Query  152  T  150
            +
Sbjct  236  S  236



>ref|XP_004961228.1| PREDICTED: uncharacterized protein LOC101778359 [Setaria italica]
Length=226

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 125/178 (70%), Gaps = 7/178 (4%)
 Frame = -3

Query  671  QRAL----ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFL  504
            QRA+    +STAHLA LLPTGT+LAFQLL+PI T+ G C  A R M   LL++ A+SCF+
Sbjct  50   QRAISQTYQSTAHLATLLPTGTVLAFQLLSPIVTDQGHCVRANRAMAGALLALCALSCFV  109

Query  503  ACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVL  324
              FTDS R   G V YGFAT  GLW+ D  A      +A     +R  F+D+VHAV+SV+
Sbjct  110  LSFTDSFRDATGAVRYGFATLRGLWVIDGGAPLEDPRAA---AAYRVRFLDWVHAVVSVM  166

Query  323  VFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            +F A+AL D+NVVSC YP P+ + ++VL V+PI IG++ S+LF+ FPT RHGIGFP++
Sbjct  167  IFAAVALFDQNVVSCFYPVPSEDARQVLTVLPIAIGVVGSMLFVTFPTTRHGIGFPLS  224



>emb|CDY38387.1| BnaC01g09960D [Brassica napus]
Length=200

 Score =   171 bits (434),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 86/192 (45%), Positives = 131/192 (68%), Gaps = 6/192 (3%)
 Frame = -3

Query  719  SVPE-PLLPAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDA-ATRPM  546
            S+PE P  P +K    +++A + TAHL+NLLPTG+++ FQ++ P+ ++ G C   A+R +
Sbjct  11   SLPEAPRKPKSKVQKMARKAFKGTAHLSNLLPTGSVMGFQIMCPVLSHQGQCPTIASRWL  70

Query  545  TLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFR  366
            T  L+ + AVSCFL  FTDS R   G+V YG ATR GL + +     +  ++  +  K++
Sbjct  71   TCFLVFVCAVSCFLLSFTDSFRDPRGKVRYGLATRSGLSVME----GSITLTDEEKEKYK  126

Query  365  AGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVF  186
              F+D+VHA +S+LVF AI++ D+NV+ CL+P P+ + +E+L  +PI IG++C   FLVF
Sbjct  127  LRFLDFVHAFMSMLVFFAISMIDQNVIRCLFPVPSEDIKELLTSLPIIIGVICGGFFLVF  186

Query  185  PTRRHGIGFPVT  150
            PTRRHGIG P+T
Sbjct  187  PTRRHGIGSPLT  198



>ref|XP_006446706.1| hypothetical protein CICLE_v10017623mg [Citrus clementina]
 gb|ESR59946.1| hypothetical protein CICLE_v10017623mg [Citrus clementina]
Length=204

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 126/186 (68%), Gaps = 7/186 (4%)
 Frame = -3

Query  695  AAKSPSFS--QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDA-ATRPMTLVLLSI  525
            A K+P+    ++  + TAHLA LLPTG++L FQ+L+PI T+ G C   A+R +TL LL++
Sbjct  22   AQKTPAQKAIRKTFKGTAHLARLLPTGSVLTFQILSPILTHQGRCPTHASRVITLGLLAL  81

Query  524  LAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYV  345
              VSCF+   TDS R   G+V YG AT  GLW+ D     +  ++  +  +++  FID  
Sbjct  82   CGVSCFILRLTDSFRDERGKVRYGLATFRGLWVID----TSLKLAPEEKAQYQLKFIDLF  137

Query  344  HAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGI  165
            HA  S+LVF  IAL DKNVV+C +P P+ ET+E+L  VPIGIG+ CS+LF++FP++RHGI
Sbjct  138  HAFASILVFATIALFDKNVVNCFFPTPSEETKELLIRVPIGIGIACSILFVLFPSKRHGI  197

Query  164  GFPVTS  147
            G P++ 
Sbjct  198  GCPLSK  203



>emb|CDX92877.1| BnaC07g41350D [Brassica napus]
Length=200

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 130/193 (67%), Gaps = 6/193 (3%)
 Frame = -3

Query  719  SVPE-PLLPAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDA-ATRPM  546
            S+PE P  P +K    +++A + TAHL+NLLPTG+++ FQ++ P+ T+ G C   A+R +
Sbjct  11   SLPEAPRKPKSKVQKVARKAFKGTAHLSNLLPTGSVMGFQIMCPVLTHQGQCPTIASRWL  70

Query  545  TLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFR  366
            T  L+ + AVSCFL  FTDS R   G+V YG AT  GL + D        ++  +  K++
Sbjct  71   TCFLVFVCAVSCFLLSFTDSFRDPRGKVRYGLATPSGLMVMD----GTITLTEEEKEKYK  126

Query  365  AGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVF  186
              F+D++HA++S+LVF AI++ D+NV+ CL+P P+ +T+E+L  +P  IG++C   FLVF
Sbjct  127  LRFLDFMHAIMSMLVFFAISMFDQNVIRCLFPVPSEDTKELLTGLPFIIGVVCGGFFLVF  186

Query  185  PTRRHGIGFPVTS  147
            PTRRHGIG P+T 
Sbjct  187  PTRRHGIGSPLTK  199



>ref|XP_002867447.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43706.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=200

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 125/187 (67%), Gaps = 5/187 (3%)
 Frame = -3

Query  707  PLLPAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAAT-RPMTLVLL  531
            P  P +K     ++  + TAHL+NLLPTG++++FQ++ P+ T+ G C   T R +T  L+
Sbjct  16   PRKPKSKVERVVRKTFKGTAHLSNLLPTGSVMSFQIMCPVLTHQGQCPTITSRWLTCFLV  75

Query  530  SILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFID  351
            S+ A+SCFL  FTDS+R  +G+V YG AT  GL + D     +  ++  +  K++   +D
Sbjct  76   SLCAISCFLFSFTDSIRDPNGKVRYGLATWSGLCVID----GSITLTEEEREKYKLKILD  131

Query  350  YVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRH  171
            +VHA++S+LVF A+++ D+NV  CL+P P+ ET+E+L  +P  IG++C   FL FPTRRH
Sbjct  132  FVHAIMSMLVFFAVSMFDQNVTRCLFPVPSEETKEILTSLPFIIGIICGAFFLAFPTRRH  191

Query  170  GIGFPVT  150
            GIG P+T
Sbjct  192  GIGSPLT  198



>emb|CDY29909.1| BnaA03g49300D [Brassica napus]
Length=200

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 129/193 (67%), Gaps = 6/193 (3%)
 Frame = -3

Query  719  SVPE-PLLPAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDA-ATRPM  546
            S+PE P  P +K    +++A + TAHL+NLLPTG+++ FQ++ P+ T+ G C   A+R +
Sbjct  11   SLPEAPRKPKSKVQKVARKAFKGTAHLSNLLPTGSVMGFQIMCPVLTHQGQCPTIASRWL  70

Query  545  TLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFR  366
            T  L+ + A SCFL  FTDS R   G+V YG AT  GL + D        ++  +  K++
Sbjct  71   TCFLVFVCAASCFLLSFTDSFRDPRGKVRYGLATPSGLMVMD----GTITLTEEEKEKYK  126

Query  365  AGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVF  186
              FID++HA++S+LVF AI++ D+NV+ CL+P P+ +T+E+L  +P  IG++C   FLVF
Sbjct  127  LRFIDFMHAIMSMLVFFAISMFDQNVIRCLFPVPSEDTKELLTGLPFIIGVVCGGFFLVF  186

Query  185  PTRRHGIGFPVTS  147
            PTRRHGIG P+T 
Sbjct  187  PTRRHGIGSPLTK  199



>ref|XP_009413807.1| PREDICTED: uncharacterized protein LOC103995042 [Musa acuminata 
subsp. malaccensis]
Length=204

 Score =   169 bits (428),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 95/207 (46%), Positives = 127/207 (61%), Gaps = 18/207 (9%)
 Frame = -3

Query  749  AVDDREVETL------SVPEPLLPAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPI  588
            A DD+E + L      SV +P       P+  Q+A  STA LAN LPTGT LAFQ+L+P+
Sbjct  6    AEDDQEKQPLIKYEESSVDDP-------PNLIQKAYRSTADLANHLPTGTALAFQVLSPV  58

Query  587  FTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGR-DGQVYYGFATRGGLWLFDYPa  411
             TN G C  A R M   LL++ A+SC+L  FTDS R    G+V YG AT  GLW+ D   
Sbjct  59   LTNQGRCTDANRVMASCLLALCALSCWLLSFTDSFRDEATGRVRYGLATLKGLWVIDGLK  118

Query  410  aaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVV  231
                 ++      +R   +D +HA  S+LVF A+AL DKNV SC YP P+ +T++VL  +
Sbjct  119  PLPPELA----AGYRLRLVDLLHAFTSLLVFAAVALLDKNVASCFYPTPSEDTRQVLSAL  174

Query  230  PIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            P+GIG++ S L + FPT RHGIGFP++
Sbjct  175  PVGIGVIGSTLLVAFPTSRHGIGFPLS  201



>ref|XP_006372758.1| hypothetical protein POPTR_0017s04770g [Populus trichocarpa]
 gb|ERP50555.1| hypothetical protein POPTR_0017s04770g [Populus trichocarpa]
Length=207

 Score =   169 bits (427),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 121/175 (69%), Gaps = 5/175 (3%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAAT-RPMTLVLLSILAVSCFLACF  495
            ++  + TAHLA LLPTG++L FQ+L+PI T+ G C + T + +T  LL++  ++CFL CF
Sbjct  35   RKTFKGTAHLARLLPTGSVLTFQILSPILTHEGQCRSVTSQTLTSSLLAVCGLACFLLCF  94

Query  494  TDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFV  315
            TDS R   G+V YG  T  GLW+ D    A A +S  +  K++  FID +HA +S+LVF 
Sbjct  95   TDSFRDARGKVRYGMVTFKGLWIID----ATAELSPEEAAKYKLKFIDVLHAFMSILVFG  150

Query  314  AIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            A++L DKNV  C +P P+ E +++L VVP  IG++CS+LFL FP++RHGIG P++
Sbjct  151  AVSLFDKNVAKCFFPAPSDEAKDLLIVVPATIGVICSILFLAFPSKRHGIGCPLS  205



>ref|XP_010555098.1| PREDICTED: uncharacterized protein LOC104824685 [Tarenaya hassleriana]
Length=199

 Score =   168 bits (426),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 127/199 (64%), Gaps = 6/199 (3%)
 Frame = -3

Query  740  DREVETLSVPEPLLPAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGAC-D  564
             R +E L +  P  P +K+    ++  + T  L+ LLPTG++L FQ+L P+ T+ G C  
Sbjct  5    QRLIEMLPL-APRKPKSKAQKVVRKTFKGTTQLSKLLPTGSVLTFQILCPVLTHQGQCPT  63

Query  563  AATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaA  384
             A+R +TL L+ + A SCFL  FTDS R + G+V YG AT  GLW+ D     +  ++ A
Sbjct  64   QASRSLTLFLVFLCAFSCFLLSFTDSCRDQFGKVRYGLATATGLWVMD----GSVELAGA  119

Query  383  DLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCS  204
            +  K+R  F+D+ HA +S+LVF A+ + DKNVV CL+P P+ E +E+L  +PI +G +C 
Sbjct  120  EAEKYRLRFLDFAHATMSMLVFGAVTMFDKNVVRCLFPVPSEEVKELLMRLPIMVGFICV  179

Query  203  LLFLVFPTRRHGIGFPVTS  147
              FLVFPTRRHGIG P++ 
Sbjct  180  AFFLVFPTRRHGIGSPLSK  198



>ref|XP_009129595.1| PREDICTED: uncharacterized protein LOC103854413 [Brassica rapa]
Length=200

 Score =   168 bits (426),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 129/193 (67%), Gaps = 6/193 (3%)
 Frame = -3

Query  719  SVPE-PLLPAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGAC-DAATRPM  546
            S+PE P  P +K    +++A + TAHL+NLLPTG+++ FQ++ P+ ++ G C   A+R +
Sbjct  11   SLPEAPRKPKSKVQKMARKAFKGTAHLSNLLPTGSVMGFQIMCPVLSHQGQCPTVASRWL  70

Query  545  TLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFR  366
            T  L+ + AVSCFL  FTDS R   G+V YG ATR GL + +        ++  +  K++
Sbjct  71   TCFLVFVRAVSCFLLSFTDSFRDPRGKVRYGLATRSGLSVME----GTITLTDEEKEKYK  126

Query  365  AGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVF  186
              F+D+VHA +S+LVF AI++ D+NV+ CL+P P+ + +E+L  +PI IG++C   FLV 
Sbjct  127  LRFLDFVHAFMSMLVFFAISMIDQNVIRCLFPVPSEDIKELLTSLPIIIGVICGGFFLVC  186

Query  185  PTRRHGIGFPVTS  147
            PTRRHGIG P+T 
Sbjct  187  PTRRHGIGSPLTK  199



>emb|CDY35189.1| BnaA01g08420D [Brassica napus]
Length=200

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 129/193 (67%), Gaps = 6/193 (3%)
 Frame = -3

Query  719  SVPE-PLLPAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDA-ATRPM  546
            S+PE P  P +K    +++A + TAHL+NLLPTG+++ FQ++ P+ ++ G C   A+R +
Sbjct  11   SLPEAPRKPKSKVQKMARKAFKGTAHLSNLLPTGSVMGFQIMCPVLSHQGQCPTIASRWL  70

Query  545  TLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFR  366
            T  L+ + AVSCFL  FTDS R   G+V YG ATR GL + +        ++  +  K++
Sbjct  71   TCFLVFVCAVSCFLLSFTDSFRDPRGKVRYGLATRSGLSVME----GTITLTDEEKEKYK  126

Query  365  AGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVF  186
              F+D+VHA +S+LVF AI++ D+NV+ CL+P P+ + +E+L  +PI IG++C   FLV 
Sbjct  127  LRFLDFVHAFMSMLVFFAISMIDQNVIRCLFPVPSEDIKELLTSLPIIIGVICGGFFLVC  186

Query  185  PTRRHGIGFPVTS  147
            PTRRHGIG P+T 
Sbjct  187  PTRRHGIGSPLTK  199



>emb|CDP18222.1| unnamed protein product [Coffea canephora]
Length=223

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/219 (42%), Positives = 132/219 (60%), Gaps = 23/219 (11%)
 Frame = -3

Query  773  RTATPAAPAVDDREVETLSVPEPLLPAAKSPSFSQ--------------RALESTAHLAN  636
            +  TPA+P     + +T     PLL + K  S +                  + TA+LA+
Sbjct  4    KVETPASPPTSGGDAKT-----PLLASQKPDSTTTPQTNQNTSIRQAICSTFKGTAYLAS  58

Query  635  LLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYY  456
             LP GT+LAF+LL+PI +N G CD A + MT VLL++ A+SCF+  FTDS +   G V++
Sbjct  59   RLPAGTVLAFRLLSPILSNQGDCDVAFKTMTAVLLALCALSCFILSFTDSFKDGKGNVFF  118

Query  455  GFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCL  276
            GFAT  G     YP      IS  +  K + G +D++H  LS+LVF +IAL DKN+V C 
Sbjct  119  GFATFKGF----YPIDRTVTISPEEAAKKKIGPLDFLHGFLSLLVFASIALLDKNIVDCF  174

Query  275  YPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGF  159
            YP P+ E +E++ V+P+  G++CS+LF+ FPT+RHGIGF
Sbjct  175  YPTPSVEIKEIISVLPVANGVVCSILFVAFPTQRHGIGF  213



>gb|EMS59461.1| hypothetical protein TRIUR3_20370 [Triticum urartu]
Length=218

 Score =   166 bits (421),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 114/174 (66%), Gaps = 4/174 (2%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFT  492
            ++A +ST HLA LLP+GT+LAFQLL P     G C    R M   L+ + A+SCF+  FT
Sbjct  37   RQAYQSTGHLAKLLPSGTVLAFQLLAPTMAKQGHCGDLDRMMMGGLVVLCALSCFVVTFT  96

Query  491  DSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVA  312
            DS R  +G+V YGFAT  GLW+ D         +     +++  F+D+ HA +S ++FVA
Sbjct  97   DSFRDENGKVQYGFATFKGLWVIDGGVTLDPHAAV----EYKMTFLDFFHAAVSAVIFVA  152

Query  311  IALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            IAL D+NV SC YP P+ +T++VL  +P+ IG++ S+LF+ FPT RHG GFPV+
Sbjct  153  IALFDQNVASCFYPIPSEDTKQVLTTLPVAIGVIGSMLFVSFPTTRHGFGFPVS  206



>ref|XP_010070119.1| PREDICTED: uncharacterized protein LOC104456912 [Eucalyptus grandis]
 gb|KCW89577.1| hypothetical protein EUGRSUZ_A01860 [Eucalyptus grandis]
Length=197

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/194 (46%), Positives = 124/194 (64%), Gaps = 10/194 (5%)
 Frame = -3

Query  704  LLPAAKSPSFS-----QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDA-ATRPMT  543
            LLP  K P        ++ L+ TA L+NLLPTGT   F LL+P+FTN G C +  T  +T
Sbjct  8    LLPVQKEPKTRSQKTLRKTLKGTATLSNLLPTGTTFVFSLLSPVFTNKGQCTSFLTHILT  67

Query  542  LVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRA  363
            + LL++ A +C L CFTDSVR   G+V YGFAT  GLW+     AA+  +S AD  K++ 
Sbjct  68   ICLLAVCATACSLLCFTDSVRDAKGKVRYGFATTKGLWVI----AASLKLSQADADKYKL  123

Query  362  GFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFP  183
              IDY HA +S LVF+A+A  D+NV+ C +P  +   + +L+ VP+ +G +CS+ FL+ P
Sbjct  124  KAIDYWHAFMSALVFMAVAFFDQNVIKCFFPVESELAKGLLEAVPLAVGGVCSIFFLLCP  183

Query  182  TRRHGIGFPVTSGK  141
            T RHGIGFP++  K
Sbjct  184  TTRHGIGFPLSREK  197



>ref|XP_010686483.1| PREDICTED: uncharacterized protein LOC104900690 [Beta vulgaris 
subsp. vulgaris]
Length=218

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/197 (45%), Positives = 119/197 (60%), Gaps = 7/197 (4%)
 Frame = -3

Query  752  PAVDDREVETLSVPEPLLPAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNG  573
            P + D+E     +P+ ++   +      + L+ST  LANLLPTGT+L FQLL P FTN G
Sbjct  23   PFLQDKEE---PLPDTVITRNEGHEILSQTLQSTRSLANLLPTGTILTFQLLAPAFTNQG  79

Query  572  ACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagi  393
             C+   R M   LL++   + FL  FTDS + R G V YGFAT  GLWL D   A    +
Sbjct  80   DCNHVNRVMITTLLALCTSAVFLLNFTDSFKDRCGNVSYGFATFNGLWLVDCSVALPQRL  139

Query  392  saADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGL  213
            +     K+R   +D+VH   SVLVF AIAL + N V C YP P+ + Q++L  +P+GIG+
Sbjct  140  A----SKYRLRALDFVHGFTSVLVFTAIALSENNTVRCYYPSPSRDLQQILIALPVGIGV  195

Query  212  LCSLLFLVFPTRRHGIG  162
              S LF++FPT+RHGIG
Sbjct  196  ASSFLFVLFPTQRHGIG  212



>ref|XP_010433212.1| PREDICTED: uncharacterized protein LOC104717355 isoform X1 [Camelina 
sativa]
Length=200

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 125/187 (67%), Gaps = 5/187 (3%)
 Frame = -3

Query  707  PLLPAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAAT-RPMTLVLL  531
            P  P +K+    ++  + TA L+NLLPTG++++FQ++ P+ T+ G C   T R +T  L+
Sbjct  16   PRKPKSKAQKVVRKTFKGTAQLSNLLPTGSVMSFQIMCPVLTHQGQCPTITSRWLTCFLV  75

Query  530  SILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFID  351
             + A+SCF+  FTDS+R  +G+V YG AT  GL++ D     +  ++  +  K++   +D
Sbjct  76   FVCAISCFIFSFTDSIRDPNGKVRYGLATWTGLYVVD----GSITLTEDEKEKYKLKILD  131

Query  350  YVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRH  171
            +VHA++S+LVF AI++ D+NV  CL+P P+ ET+E+L  +P  IG++C   FL FPTRRH
Sbjct  132  FVHAIMSMLVFFAISMFDQNVTRCLFPVPSAETREILTSLPFVIGVICGGFFLAFPTRRH  191

Query  170  GIGFPVT  150
            GIG P+T
Sbjct  192  GIGSPLT  198



>ref|XP_010686397.1| PREDICTED: uncharacterized protein LOC104900622 [Beta vulgaris 
subsp. vulgaris]
Length=213

 Score =   164 bits (416),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/203 (42%), Positives = 121/203 (60%), Gaps = 13/203 (6%)
 Frame = -3

Query  740  DREVETLSVPEPLLPAAK---------SPSFSQRALESTAHLANLLPTGTLLAFQLLTPI  588
            +++ E +S  EP L   +         S  F  + L+ST +LANLLPTG +L F LL P 
Sbjct  10   NQDQEEVSNEEPFLQDEEQDIVLKRNGSHEFLSQTLQSTTNLANLLPTGAILTFHLLVPA  69

Query  587  FTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaa  408
            FT+ G CD     MT  LL++ A + F+  FTDS + R G V YGFAT  GLWL D   +
Sbjct  70   FTDQGDCDYVNHLMTTTLLALCASAVFILNFTDSFKDRCGNVSYGFATFNGLWLVDSSTS  129

Query  407  aaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVP  228
                ++     ++R   +D+VH   SVLVF AIAL + N V C +P P+ + Q++L  +P
Sbjct  130  LPPRLA----SRYRLRVLDFVHGFTSVLVFTAIALSENNTVKCYFPAPSRDLQQILTALP  185

Query  227  IGIGLLCSLLFLVFPTRRHGIGF  159
            +GIG+  S LF++FPT+RHGIG+
Sbjct  186  VGIGVASSFLFVLFPTQRHGIGY  208



>ref|XP_010666457.1| PREDICTED: uncharacterized protein LOC104883611 [Beta vulgaris 
subsp. vulgaris]
Length=213

 Score =   164 bits (416),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 124/185 (67%), Gaps = 5/185 (3%)
 Frame = -3

Query  698  PAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDA-ATRPMTLVLLSIL  522
            P  ++    ++  + T+HL++LLP+G++L F++ +P+ TN G C+   T+ +TL L++ +
Sbjct  32   PKTRTQKAIRKTFKGTSHLSSLLPSGSVLIFEMFSPVLTNQGQCETFQTQLITLCLITFV  91

Query  521  AVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVH  342
             +SCF+ CFTDSVR   G+V YG AT  G+W+ D     +  +S     K+R   +D++H
Sbjct  92   GLSCFIMCFTDSVRDERGKVRYGLATFKGIWIID----GSVTLSPEQAAKYRIRVLDFLH  147

Query  341  AVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIG  162
            A + + VFVA+AL D+NVV C +P P+ +T+E L + P+G+G++C LLF+ FP++R+GI 
Sbjct  148  AFMGIFVFVAVALLDQNVVKCFFPMPSEKTKERLVMFPVGVGIICGLLFVCFPSKRNGIV  207

Query  161  FPVTS  147
             P++ 
Sbjct  208  SPLSK  212



>ref|XP_010916779.1| PREDICTED: uncharacterized protein LOC105041523 [Elaeis guineensis]
Length=179

 Score =   163 bits (412),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 115/175 (66%), Gaps = 10/175 (6%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFT  492
            QR  +STA+LANLLPTGT+L FQ+L+P  TN G C    R  T  L+++  +SCF+  FT
Sbjct  7    QRTFKSTANLANLLPTGTVLTFQVLSPTCTNLGRCTGVNRTATACLVALCGLSCFILNFT  66

Query  491  DSV---RGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLV  321
            DS       +G+V+YG AT  GLW+FD            +  KFR GF D+VHA +SVLV
Sbjct  67   DSFHDPEAAEGKVHYGLATFRGLWVFD-------DAVPREPDKFRIGFRDFVHAFMSVLV  119

Query  320  FVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFP  156
            F+A+ L +K+VVSC YP  +   +++L ++P+ IG+L S LF+V PT RHGIGFP
Sbjct  120  FMAVVLCEKSVVSCFYPFRSENMEQLLAMLPVAIGVLGSALFVVLPTTRHGIGFP  174



>gb|AAU44525.1| hypothetical protein AT4G28485 [Arabidopsis thaliana]
Length=200

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 125/187 (67%), Gaps = 5/187 (3%)
 Frame = -3

Query  707  PLLPAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAAT-RPMTLVLL  531
            P  P +K     ++  + TAHL+NLLPTG++++FQ++ P+ T+ G C   T R +T  L+
Sbjct  16   PRKPKSKVERVVRKTFKGTAHLSNLLPTGSVMSFQIMCPVLTHQGQCPTITSRWLTCFLV  75

Query  530  SILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFID  351
            S+ A+SCFL  FTDS+R  +G+V YG AT  GL + D     +  ++  +  K++   +D
Sbjct  76   SLCAISCFLFSFTDSIRDPNGKVRYGLATWSGLLVMD----GSITLTEEEKEKYKLKILD  131

Query  350  YVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRH  171
            ++HA++S+LVF A+++ D+NV  CL+P P+ ET+E+L  +P  IG++C   FL FPTRRH
Sbjct  132  FIHAIMSMLVFFAVSMFDQNVTRCLFPVPSEETKEILTSLPFVIGVICGAFFLAFPTRRH  191

Query  170  GIGFPVT  150
            GIG P+T
Sbjct  192  GIGSPLT  198



>gb|AAY78804.1| hypothetical protein At4g28485 [Arabidopsis thaliana]
Length=200

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 125/187 (67%), Gaps = 5/187 (3%)
 Frame = -3

Query  707  PLLPAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAAT-RPMTLVLL  531
            P  P +K     ++  + TAHL+NLLPTG++++FQ++ P+ T+ G C   T R +T  L+
Sbjct  16   PRKPKSKVERVVRKTFKGTAHLSNLLPTGSVMSFQIMCPVLTHQGQCPTITSRWLTCFLV  75

Query  530  SILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFID  351
            S+ A+SCFL  FTDS+R  +G+V YG AT  GL + D     +  ++  +  K++   +D
Sbjct  76   SLCAISCFLFSFTDSIRDPNGKVRYGLATWSGLLVMD----GSITLTEEEKEKYKLKILD  131

Query  350  YVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRH  171
            ++HA++S+LVF A+++ D+NV  CL+P P+ ET+E+L  +P  IG++C   FL FPTRRH
Sbjct  132  FIHAIMSMLVFFAVSMFDQNVTRCLFPVPSEETKEILTSLPFVIGVICGAFFLAFPTRRH  191

Query  170  GIGFPVT  150
            GIG P+T
Sbjct  192  GIGSPLT  198



>dbj|BAJ97707.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=251

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 122/178 (69%), Gaps = 8/178 (4%)
 Frame = -3

Query  671  QRAL----ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFL  504
            QRA+    +STAHLA LLPTGT+LAFQLL+PI T+ G C  A R M   L+++  +SCF 
Sbjct  76   QRAISQTYQSTAHLATLLPTGTVLAFQLLSPIVTDQGHCVRANRAMAAALVALCGISCFA  135

Query  503  ACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVL  324
              FTDS R   G V YGFATR GLW+ D  A      +      +R  FID+VHAV++V+
Sbjct  136  LSFTDSFRDAKGAVRYGFATRRGLWVIDGGAPIDPQAA----ATYRLRFIDFVHAVVTVM  191

Query  323  VFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            VFVA+AL D NVVSC YP P+ +  +VL V+PI IG++ S+LF+ FPT RHGIGFP++
Sbjct  192  VFVAVALFDHNVVSCFYPVPSEDAAQVLTVLPIAIGVVGSMLFVTFPTTRHGIGFPLS  249



>ref|XP_010914345.1| PREDICTED: uncharacterized protein LOC105039777 [Elaeis guineensis]
Length=221

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 117/178 (66%), Gaps = 2/178 (1%)
 Frame = -3

Query  692  AKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVS  513
            +++P    + L S A+LA LLPTGT+LAFQ L+P F+N+G C  + R +TLVLL +  +S
Sbjct  38   SQTPPVMDKTLSSVANLAQLLPTGTVLAFQALSPSFSNHGICYTSNRCITLVLLILCTIS  97

Query  512  CFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVL  333
            C    FTDS +G +G++YYG AT  G  +F+Y    + G    +L +FR  ++DYVHA+ 
Sbjct  98   CIFFSFTDSFKGTNGKLYYGMATPKGFIVFNY--QPSDGKVFTNLWRFRIRWLDYVHAMF  155

Query  332  SVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGF  159
            SV+VF+ +A  D N+  C +P     T+++L  +P+G G L S++FL+FPT R GIG+
Sbjct  156  SVVVFLTLAFSDTNIQHCFFPNSGANTKQILQNLPLGAGFLSSMVFLIFPTTRKGIGY  213



>ref|XP_007043697.1| Galactose-1-phosphate uridylyltransferase, putative [Theobroma 
cacao]
 gb|EOX99528.1| Galactose-1-phosphate uridylyltransferase, putative [Theobroma 
cacao]
Length=240

 Score =   162 bits (411),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 116/184 (63%), Gaps = 5/184 (3%)
 Frame = -3

Query  698  PAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDA-ATRPMTLVLLSIL  522
            P  +     ++  + TA L+ LLPTG+ L FQLL+P  TN G C    +  +TL L+   
Sbjct  59   PKTRKQKVMRKTFKGTAVLSKLLPTGSALTFQLLSPALTNQGQCKTEVSHYLTLGLVGFC  118

Query  521  AVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVH  342
            AV CF   FTDS R   G+V YG AT  GLW+ D P   +A     +  K+R  FID+ H
Sbjct  119  AVLCFFLSFTDSFRDERGKVRYGVATFKGLWVMDGPVKLSAE----EADKYRLKFIDFFH  174

Query  341  AVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIG  162
            A++S+++F ++AL D+NVV C YP P+ ET+E+L V+P  IG + S+LF+ FPT+R+GIG
Sbjct  175  ALVSIMIFTSLALFDQNVVKCFYPTPSEETKELLTVLPASIGAIGSVLFVSFPTKRNGIG  234

Query  161  FPVT  150
             P++
Sbjct  235  NPLS  238



>ref|XP_008656733.1| PREDICTED: uncharacterized protein LOC103636163 [Zea mays]
Length=213

 Score =   161 bits (407),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 115/171 (67%), Gaps = 4/171 (2%)
 Frame = -3

Query  659  ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVR  480
            +STAHLA LLP+GT+L+FQ+L P     G C    R MT  L+ + A+SC +  FTDS R
Sbjct  46   QSTAHLAKLLPSGTVLSFQILAPTLAKQGHCSDMNRMMTGGLVVLCALSCCVLSFTDSFR  105

Query  479  GRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALK  300
              +G+V +GFAT  GLW+ D      A +       FR  F+D+VHA++S ++FVAIAL 
Sbjct  106  DEEGKVRFGFATPRGLWVID----GGAPLDPLGAAGFRMRFLDFVHAIVSAMIFVAIALF  161

Query  299  DKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTS  147
            D++VVSC YP P+ +T+++L  +P+GIG++ S+LF+ FPT RH IG  ++S
Sbjct  162  DQHVVSCFYPTPSEDTKQLLTALPVGIGIIGSMLFVSFPTTRHSIGSTLSS  212



>ref|XP_008776531.1| PREDICTED: uncharacterized protein LOC103696625 [Phoenix dactylifera]
Length=224

 Score =   161 bits (407),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 91/219 (42%), Positives = 128/219 (58%), Gaps = 9/219 (4%)
 Frame = -3

Query  770  TATPAAPAVDDREVETLSVPEPLLPAAKSPSF-SQR------ALESTAHLANLLPTGTLL  612
            +A P A +  D E   L    PL     S S  SQR       L + A+LA LLPTGT+L
Sbjct  6    SAIPIANS-QDSEPRELDRSTPLRGTTPSQSLTSQRPLVIDKTLSTAANLAQLLPTGTVL  64

Query  611  AFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGL  432
            AFQ L+P F+N+G C A+ + +TL LL I  +SC    FTDS +G +G++YYG AT    
Sbjct  65   AFQALSPSFSNHGICYASNKYITLSLLLICTISCIFFSFTDSFKGTNGKLYYGMATCKSF  124

Query  431  WLFDY-PaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHE  255
             +F+Y P+         DL +FR  ++DYVHA  SVLVF+A+   D N+  C +P     
Sbjct  125  IVFNYQPSDGDRSKVLEDLLRFRIRWLDYVHAFFSVLVFLALTFSDTNIQHCFFPDSGSN  184

Query  254  TQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTSGKS  138
            ++++L  +P+G G L S++FL+FPT R GIG+  T+  S
Sbjct  185  SKQILQNLPLGAGFLSSMVFLIFPTTRQGIGYSDTTPHS  223



>gb|AFW83516.1| hypothetical protein ZEAMMB73_128939 [Zea mays]
Length=208

 Score =   160 bits (406),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 115/171 (67%), Gaps = 4/171 (2%)
 Frame = -3

Query  659  ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVR  480
            +STAHLA LLP+GT+L+FQ+L P     G C    R MT  L+ + A+SC +  FTDS R
Sbjct  41   QSTAHLAKLLPSGTVLSFQILAPTLAKQGHCSDMNRMMTGGLVVLCALSCCVLSFTDSFR  100

Query  479  GRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALK  300
              +G+V +GFAT  GLW+ D      A +       FR  F+D+VHA++S ++FVAIAL 
Sbjct  101  DEEGKVRFGFATPRGLWVID----GGAPLDPLGAAGFRMRFLDFVHAIVSAMIFVAIALF  156

Query  299  DKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTS  147
            D++VVSC YP P+ +T+++L  +P+GIG++ S+LF+ FPT RH IG  ++S
Sbjct  157  DQHVVSCFYPTPSEDTKQLLTALPVGIGIIGSMLFVSFPTTRHSIGSTLSS  207



>ref|XP_010038679.1| PREDICTED: uncharacterized protein LOC104427259 [Eucalyptus grandis]
 gb|KCW47262.1| hypothetical protein EUGRSUZ_K01059 [Eucalyptus grandis]
Length=209

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 125/188 (66%), Gaps = 8/188 (4%)
 Frame = -3

Query  710  EPLLPAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAA-TRPMTLVL  534
            +P  PA K+    ++  + TAHLANLLPTGT+LAFQ+++P+ T+ G C  +    +TL L
Sbjct  27   QPKTPAQKA---VRKTFKLTAHLANLLPTGTVLAFQVVSPVLTHQGKCPTSLNHTLTLAL  83

Query  533  LSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFI  354
            L++ A SCF   FTDS+R   G+V +G AT  GL + D     +  +S  +  ++R   +
Sbjct  84   LALCAASCFFLSFTDSIRDECGKVRHGIATFKGLLVLD----GSVRLSPEEADRYRIRLL  139

Query  353  DYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRR  174
            D +H V+SVLVF AIAL D NVV C YP P+ E + +L  VPIG+G+ CSL+FL FPT+R
Sbjct  140  DLLHGVMSVLVFAAIALFDPNVVRCFYPSPSEEARRLLMAVPIGVGVACSLVFLAFPTKR  199

Query  173  HGIGFPVT  150
            HGIGFP+T
Sbjct  200  HGIGFPLT  207



>ref|XP_008656036.1| PREDICTED: uncharacterized protein LOC103635334 [Zea mays]
 gb|AFW81116.1| hypothetical protein ZEAMMB73_341777 [Zea mays]
Length=236

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 121/179 (68%), Gaps = 8/179 (4%)
 Frame = -3

Query  671  QRAL----ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFL  504
            QRA+    +STAHLA LLPTGT+LAFQLL+P+ T  G C  A R M   LL++ A+SCF 
Sbjct  59   QRAISQTYQSTAHLAKLLPTGTVLAFQLLSPVVTAQGHCVRANRAMAGALLALCALSCFA  118

Query  503  ACFTDSVR-GRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSV  327
              FTDS R    G V YGFAT  G+W  D  A      +A     +R  F+D VHAV+SV
Sbjct  119  LSFTDSFRDAATGAVRYGFATPWGIWAIDGGAPPDDPRAA---AAYRVRFLDLVHAVVSV  175

Query  326  LVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            L+F A+AL D+N+V+C YP P+ + ++VL V+P+ IG++ S+LF+ FPT RHGIGFP++
Sbjct  176  LIFAAVALLDQNLVACFYPVPSEDAKQVLTVLPVAIGVVGSMLFVTFPTTRHGIGFPLS  234



>ref|XP_002312247.1| hypothetical protein POPTR_0008s08670g [Populus trichocarpa]
 gb|EEE89614.1| hypothetical protein POPTR_0008s08670g [Populus trichocarpa]
Length=234

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 110/173 (64%), Gaps = 10/173 (6%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFT  492
            Q+ +  T+ L N LPTGTLL F++L P  + NG C   T  M  VLL + +VSCFL  FT
Sbjct  65   QKTISKTSMLVNFLPTGTLLTFEMLLPSISRNGVCTPVTALMIHVLLGLCSVSCFLFHFT  124

Query  491  DSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGK---FRAGFIDYVHAVLSVLV  321
            DS +G D ++YYGF T  GL +F+            D+ K   ++ GF D+VHA++SV+V
Sbjct  125  DSFKGPDDKIYYGFVTTKGLAVFN-------PGLTVDVPKDERYKIGFTDFVHAMMSVMV  177

Query  320  FVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIG  162
            F+AIAL D  V  CL+P+   E  EV++  P+ +G++CS LFLVFPT RHGIG
Sbjct  178  FMAIALSDHRVTDCLFPRHVKEMDEVMESFPLMVGVICSGLFLVFPTSRHGIG  230



>ref|XP_011017214.1| PREDICTED: uncharacterized protein LOC105120630 [Populus euphratica]
Length=260

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/216 (41%), Positives = 121/216 (56%), Gaps = 32/216 (15%)
 Frame = -3

Query  758  AAPAVDDREVETLSVPEPLLPAAKSPSFS-----------QRALESTAHLANLLPTGTLL  612
             +P  D+R       P+PL    K+P              Q+ +  T+ L N LPTGTLL
Sbjct  56   GSPQNDERRA-----PKPLCNLTKAPKEPGNKRRAVAKGMQKTISKTSLLINFLPTGTLL  110

Query  611  AFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGL  432
             F++L P  + NG C   T  M  VLL + +VSCFL  FTDS +G D ++YYGF T  GL
Sbjct  111  TFEMLLPSISRNGVCTPVTALMIHVLLGLCSVSCFLFHFTDSFKGPDDKIYYGFVTTKGL  170

Query  431  WLF------DYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYP  270
             +F      D P             +++ GF D+VHA++SV+VF+AIAL D  V  CL+P
Sbjct  171  AVFKPGLTVDVPKDE----------RYKIGFTDFVHAMMSVMVFMAIALSDHRVTDCLFP  220

Query  269  KPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIG  162
            +   E  EV++  P+ +G++CS LFLVFPT RHGIG
Sbjct  221  RHVKEMDEVMESFPLMVGVICSGLFLVFPTSRHGIG  256



>ref|XP_004969493.1| PREDICTED: uncharacterized protein LOC101760980 [Setaria italica]
Length=207

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 111/166 (67%), Gaps = 4/166 (2%)
 Frame = -3

Query  659  ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVR  480
            +ST HLA LLP+GT+L+FQLL P     G C    R MT  L+ + A+SCF+  FTDS R
Sbjct  40   QSTGHLAKLLPSGTVLSFQLLVPTLAKQGHCGDMNRVMTGGLVVLCALSCFVLSFTDSFR  99

Query  479  GRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALK  300
              +G+V YGFAT  GLW+ D  A      +     ++R  F+D+VHA++S ++FVAIAL 
Sbjct  100  DVEGKVRYGFATFKGLWVIDGGAPLEPLAA----AEYRMRFLDFVHAIVSAMIFVAIALF  155

Query  299  DKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIG  162
            D+NVVSC YP P+ + +++L  +P+ IG++ S+LF+ FPT RH IG
Sbjct  156  DQNVVSCFYPIPSEDAKQLLTALPVVIGVIGSMLFVSFPTTRHSIG  201



>ref|XP_010088151.1| hypothetical protein L484_013595 [Morus notabilis]
 gb|EXB31963.1| hypothetical protein L484_013595 [Morus notabilis]
Length=228

 Score =   159 bits (402),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 106/170 (62%), Gaps = 4/170 (2%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFT  492
            Q+ L  T+ LAN LPTGTLL F+++ P    NG C A T  M  VLL + ++SCF   FT
Sbjct  59   QKTLSKTSMLANFLPTGTLLTFEMVLPAIYRNGGCSAVTTAMVHVLLGLCSLSCFFFHFT  118

Query  491  DSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVA  312
            DS RG DG+VYYGF T  GL +F  P             +++ G  D+VHAV+SV+VFVA
Sbjct  119  DSFRGPDGKVYYGFVTPKGLAVFK-PGLDVEVPKDE---RYKLGLTDFVHAVMSVMVFVA  174

Query  311  IALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIG  162
            IA  D  V  CL+P    +  E+++  P+ +G++CS LFLVFPT R+GIG
Sbjct  175  IAFSDHRVTDCLFPGHQKDMDEIMESFPLMVGIVCSGLFLVFPTTRYGIG  224



>gb|EMS57393.1| hypothetical protein TRIUR3_27181 [Triticum urartu]
Length=200

 Score =   157 bits (397),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 121/179 (68%), Gaps = 8/179 (4%)
 Frame = -3

Query  671  QRAL----ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFL  504
            QRA+    +STAHLA LLPTGT++AFQLL+PI T+ G C  A R M   L+++  +SCF 
Sbjct  25   QRAISQTYQSTAHLATLLPTGTVMAFQLLSPIVTDQGHCVRANRAMAGALVALCGLSCFA  84

Query  503  ACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVL  324
              FTDS R   G V YGFATR GLW+ D  A      +      +R  F+D VHAV++V+
Sbjct  85   LSFTDSFRDAKGAVRYGFATRRGLWVIDGGAPLDPQAA----AAYRLRFLDLVHAVVTVM  140

Query  323  VFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVTS  147
            VFVA+AL D NVVSC YP P+ +  +VL V+PI IG++ S+LF+ FPT RHGIGFP++ 
Sbjct  141  VFVAVALFDHNVVSCFYPVPSEDAVQVLTVLPIAIGVVGSMLFVTFPTTRHGIGFPLSQ  199



>ref|XP_003614085.1| hypothetical protein MTR_5g044580 [Medicago truncatula]
 gb|AES97043.1| DUF679 domain membrane protein [Medicago truncatula]
Length=218

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 105/170 (62%), Gaps = 4/170 (2%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFT  492
            Q+ L  T+ L N LPTGTL+ F+++ P    NG C      M   LL + A+SCF   FT
Sbjct  49   QKTLSKTSLLGNFLPTGTLITFEMVLPSIYRNGQCTHVHTIMIHFLLIMCALSCFFFHFT  108

Query  491  DSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVA  312
            DS  G DG VYYGFATR GL +F         +   +  K++ GF D+VHAV+SV+VFVA
Sbjct  109  DSFHGADGNVYYGFATRNGLSVFK----PGLTVLVPNDDKYKVGFQDFVHAVMSVMVFVA  164

Query  311  IALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIG  162
            IA  D  V +CL+P    E  +V++  P+ +G++CS LFL+FPT RHGIG
Sbjct  165  IAFSDYRVTNCLFPGHEKEMDQVMESFPLMVGIICSGLFLIFPTSRHGIG  214



>ref|XP_004306141.1| PREDICTED: uncharacterized protein LOC101296994 [Fragaria vesca 
subsp. vesca]
Length=242

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 105/170 (62%), Gaps = 4/170 (2%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFT  492
            Q+ +  T+ L N LPTGTLL F+++ P    NG C   T  MT VLL I A+SCF   FT
Sbjct  73   QKTISKTSMLVNFLPTGTLLTFEMVLPAIYRNGECTTVTTLMTHVLLGICALSCFFFHFT  132

Query  491  DSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVA  312
            DS +G D +VYYGF T  GL +F  P             ++R G  D+VHA++SV+VF+A
Sbjct  133  DSFKGPDDKVYYGFVTPRGLAVFK-PGLTVEVPKDE---RYRVGLTDFVHAIMSVMVFMA  188

Query  311  IALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIG  162
            IA  D+ V  C++P    E  EV++  P+ +G++CS LFLVFPT RHGIG
Sbjct  189  IAFSDRRVTECMFPGHEKEMDEVMESFPLMVGIVCSGLFLVFPTSRHGIG  238



>ref|NP_001145367.1| hypothetical protein [Zea mays]
 gb|ACG47050.1| hypothetical protein [Zea mays]
 gb|AFW86774.1| hypothetical protein ZEAMMB73_868098 [Zea mays]
Length=254

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 108/172 (63%), Gaps = 4/172 (2%)
 Frame = -3

Query  668  RALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTD  489
            +A  STA LA  LPTG +LAF++L+P+FTN G CD   R MT  L+ + A +CF  CFTD
Sbjct  84   QAFRSTAELAKHLPTGAVLAFEVLSPVFTNGGKCDDVNRVMTSWLVGLCAAACFFLCFTD  143

Query  488  SVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAI  309
            S     G V Y  ATR GLW+ D            +  + R  FID+ HA LSV+VF+++
Sbjct  144  SFHDAKGTVRYAVATRRGLWVID----GTPAPPPVEAAEKRIKFIDFFHAFLSVIVFMSV  199

Query  308  ALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPV  153
            A+ D NV +C  P  +++T++VL  VP+  GL+ +LLF  FP+ RHGIGFP+
Sbjct  200  AMFDGNVGACFNPVMSYDTRQVLTAVPLAGGLVGTLLFATFPSTRHGIGFPI  251



>ref|XP_002441515.1| hypothetical protein SORBIDRAFT_09g028420 [Sorghum bicolor]
 gb|EES19945.1| hypothetical protein SORBIDRAFT_09g028420 [Sorghum bicolor]
Length=239

 Score =   157 bits (398),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 123/179 (69%), Gaps = 8/179 (4%)
 Frame = -3

Query  671  QRAL----ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFL  504
            QRA+    +STAHLA LLPTGT+LAFQLL+P+ T  G C  A R M   LL++ A+SCF+
Sbjct  62   QRAISQTYQSTAHLAKLLPTGTVLAFQLLSPVVTAEGHCARANRAMAAALLALCALSCFV  121

Query  503  ACFTDSVR-GRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSV  327
              FTDS R    G V YGFAT  GLW+ D  A      +A     +R  F+D VHAV+SV
Sbjct  122  LSFTDSFRDAATGAVRYGFATSRGLWVIDGGAPLDDPRAA---AAYRIRFLDLVHAVVSV  178

Query  326  LVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            ++F A+AL D+NVV+C YP P+ + ++VL V+PI IG++ S+LF+ FPT RHGIGFP++
Sbjct  179  MIFAAVALLDQNVVTCFYPVPSEDARQVLTVLPIAIGVVGSMLFVTFPTTRHGIGFPLS  237



>ref|XP_002315049.1| hypothetical protein POPTR_0010s17550g [Populus trichocarpa]
 gb|EEF01220.1| hypothetical protein POPTR_0010s17550g [Populus trichocarpa]
Length=234

 Score =   157 bits (396),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 105/176 (60%), Gaps = 16/176 (9%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFT  492
            Q+ +  T+ L N LPTGTLL F++L P  + NG C   T  M   LL + ++SCF   FT
Sbjct  65   QKTISKTSMLVNFLPTGTLLTFEMLLPSISKNGVCTPVTALMIYALLGLCSLSCFFFHFT  124

Query  491  DSVRGRDGQVYYGFATRGGLWLF------DYPaaaaagisaADLGKFRAGFIDYVHAVLS  330
            DS +G D ++YYGF T  GL +F      D P             ++R GF D VHAV+S
Sbjct  125  DSFKGPDDKIYYGFVTTKGLAVFKPGLTVDVPKDE----------RYRVGFTDLVHAVMS  174

Query  329  VLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIG  162
            V+VF+AIAL D  V  CL+P    E  EV++  P+ +G++CS LFLVFPT RHGIG
Sbjct  175  VMVFMAIALSDHRVTGCLFPGHVKEMGEVMESFPLMVGVICSGLFLVFPTSRHGIG  230



>ref|XP_010912092.1| PREDICTED: uncharacterized protein LOC105038102 [Elaeis guineensis]
Length=203

 Score =   155 bits (392),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 106/181 (59%), Gaps = 5/181 (3%)
 Frame = -3

Query  692  AKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVS  513
            + + +   RA +  A L  LLPTGT+  FQ L P+ TN G C    + ++  LL+I   S
Sbjct  21   SNAETMGDRAFKGIADLIKLLPTGTVFLFQFLNPLLTNTGHCHTINKYLSGALLTICGFS  80

Query  512  CFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVL  333
            C  + FTDS  G DG+VYYG  T+ GLW F  P       S+ DL K++  F D+VHA L
Sbjct  81   CCFSSFTDSYIGGDGRVYYGVVTKDGLWSFSDP-----NASSKDLSKYKLRFGDFVHAFL  135

Query  332  SVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPV  153
            S++VF  IAL D N VSC YP    E + +L V+P  +G L S +F+VFP  RHGIG+  
Sbjct  136  SLIVFAVIALLDDNTVSCFYPSFKFEEKTLLMVLPTVVGGLASFVFMVFPNNRHGIGYAP  195

Query  152  T  150
            T
Sbjct  196  T  196



>ref|NP_001057588.1| Os06g0352200 [Oryza sativa Japonica Group]
 dbj|BAD36000.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF19502.1| Os06g0352200 [Oryza sativa Japonica Group]
 gb|EAZ00868.1| hypothetical protein OsI_22894 [Oryza sativa Indica Group]
 dbj|BAG92668.1| unnamed protein product [Oryza sativa Japonica Group]
Length=253

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 110/172 (64%), Gaps = 4/172 (2%)
 Frame = -3

Query  668  RALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTD  489
            RA  STA LA  LPTG +L F++L+P+FTN G C    R MT  L+ + A +CF  CFTD
Sbjct  83   RAFRSTAELAKHLPTGAVLVFEVLSPVFTNGGKCQDVNRVMTAWLVGLCAAACFFLCFTD  142

Query  488  SVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAI  309
            S     G V Y  ATR GLW+ D  A     ++      +R  FID+ HAVLS++VF+++
Sbjct  143  SFHDGKGTVRYVVATRAGLWVIDGTAPPPPDVA----ATYRLRFIDFFHAVLSLIVFLSV  198

Query  308  ALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPV  153
            A+ D NV +C YP  +++T++VL  VP+  GL+ ++LF  FP+ RHGIGFPV
Sbjct  199  AMFDHNVGACFYPVMSYDTRQVLTDVPLAGGLVGTMLFATFPSTRHGIGFPV  250



>ref|XP_011013354.1| PREDICTED: uncharacterized protein LOC105117400 [Populus euphratica]
 ref|XP_011013362.1| PREDICTED: uncharacterized protein LOC105117400 [Populus euphratica]
 ref|XP_011013368.1| PREDICTED: uncharacterized protein LOC105117400 [Populus euphratica]
 ref|XP_011013377.1| PREDICTED: uncharacterized protein LOC105117400 [Populus euphratica]
Length=234

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 104/176 (59%), Gaps = 16/176 (9%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFT  492
            Q+ +  T+ L N LPTGTLL F++L P  + NG C      M  VLL +  +SCF   FT
Sbjct  65   QKTISKTSMLVNFLPTGTLLTFEMLLPSISKNGVCTPVASLMIHVLLGLCTLSCFFFHFT  124

Query  491  DSVRGRDGQVYYGFATRGGLWLF------DYPaaaaagisaADLGKFRAGFIDYVHAVLS  330
            DS +G D ++YYGF T  GL +F      D P             ++R GF D VHA++S
Sbjct  125  DSFKGPDDKIYYGFVTTKGLAVFKPGLTVDVPKDE----------RYRVGFTDLVHAMMS  174

Query  329  VLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIG  162
            V+VF+AIAL D  V  CL+P    E  EV++  P+ +G++CS LFLVFPT RHGIG
Sbjct  175  VMVFMAIALSDHRVTECLFPGHVKEMGEVMESFPLMVGVICSSLFLVFPTSRHGIG  230



>ref|XP_010447973.1| PREDICTED: uncharacterized protein LOC104730496 [Camelina sativa]
Length=200

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 127/191 (66%), Gaps = 11/191 (6%)
 Frame = -3

Query  701  LPAA--KSPSFSQRAL----ESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAAT-RPMT  543
            LPAA  K  S +QR +    + T  L+NLLPTG++++FQ++ P+ T+ G C   T R +T
Sbjct  12   LPAAPRKHKSKAQRVVRKTFKGTTQLSNLLPTGSVMSFQIMCPVLTHQGQCPTITSRWLT  71

Query  542  LVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRA  363
              L+ + A+SCF+  FTDS+R  +G+V YG AT  GL++ D     +  ++  +  K++ 
Sbjct  72   CFLVFVCAISCFIFSFTDSIRDPNGKVRYGLATWTGLYVVD----GSITLTEEEKEKYKL  127

Query  362  GFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFP  183
              +D+VHA++S+LVF AI++ D+NV  CL+P P+ ET+E+L  +P  IG++C   FL FP
Sbjct  128  KILDFVHAIMSMLVFFAISMFDQNVTRCLFPVPSAETREILTSLPFVIGVICGGFFLAFP  187

Query  182  TRRHGIGFPVT  150
            TRRHGIG P+T
Sbjct  188  TRRHGIGSPLT  198



>ref|XP_008379358.1| PREDICTED: uncharacterized protein LOC103442357 [Malus domestica]
 ref|XP_008357763.1| PREDICTED: uncharacterized protein LOC103421500 [Malus domestica]
Length=235

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 106/170 (62%), Gaps = 4/170 (2%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFT  492
            Q+ L  T+ LAN LPTGTLL F+++ P     G C   T  MTLVLL +  +SCF   FT
Sbjct  66   QKTLSKTSMLANFLPTGTLLTFEMVLPAIYRTGECTGVTTMMTLVLLGMCTLSCFFFHFT  125

Query  491  DSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVA  312
            DS RG DG++YYGF T  GL +F  P             +++ G  D+VHA++SV+VFVA
Sbjct  126  DSFRGPDGKLYYGFVTPKGLAVFK-PGLGVEVPKEE---RYKLGLSDFVHAIMSVMVFVA  181

Query  311  IALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIG  162
            IA  D+ V  CL+P    +  EV++  P+ +G++CS LFLVFP+ R+GIG
Sbjct  182  IAFSDRRVTDCLFPGHEKDMDEVMESFPLMVGIVCSGLFLVFPSTRYGIG  231



>ref|XP_009380594.1| PREDICTED: uncharacterized protein LOC103968949 [Musa acuminata 
subsp. malaccensis]
Length=233

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 103/230 (45%), Positives = 129/230 (56%), Gaps = 15/230 (7%)
 Frame = -3

Query  809  SSTRMSSQNLRSRTATPAAPAVDDREVETLSVPE--PLL--PAAKSPSFSQRAL----ES  654
            SS    S   RSR   PA    +         PE  PLL   A    +  Q+ +    + 
Sbjct  6    SSETGESSKERSRRTKPATGVQEMENPGREGDPEAQPLLNHEAGDRITAIQQVISQTYQG  65

Query  653  TAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGR  474
            TAHLAN LPTGT+LAFQ L+P FT  G C  ++R MT  LL++ A+SCFL  FTDS    
Sbjct  66   TAHLANHLPTGTVLAFQFLSPAFTTFGRCTESSRFMTACLLALCALSCFLLSFTDSFYDE  125

Query  473  DGQ-VYYGFATRGGLWLFDYPaaaaagisaADLG-KFRAGFIDYVHAVLSVLVFVAIALK  300
              + V YG AT  GLW+ D          A +L    R G +D++HA  S++VF A+AL 
Sbjct  126  ATRRVRYGVATFRGLWVID-----GLQPVAPELAVSHRLGPLDFLHAFTSLVVFAAVALL  180

Query  299  DKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPVT  150
            DKNVVSC YP P     +VL  +P+GIG+L S L + FPT RHGIGFPVT
Sbjct  181  DKNVVSCYYPMPTDIELQVLTALPVGIGVLGSALLVTFPTIRHGIGFPVT  230



>ref|XP_007139565.1| hypothetical protein PHAVU_008G040400g [Phaseolus vulgaris]
 gb|ESW11559.1| hypothetical protein PHAVU_008G040400g [Phaseolus vulgaris]
Length=212

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 121/211 (57%), Gaps = 6/211 (3%)
 Frame = -3

Query  794  SSQNLRSRTATPAAPAVDDREVETLSVPEPLLPAAKSPSFSQRALESTAHLANLLPTGTL  615
            S Q +  +    AAP    +E  T   P+     A      Q+ L  T+ L N LPTGTL
Sbjct  4    SEQEMGIKVYNAAAPP---QEGGTSKNPQQNKRRAMVAKGVQKTLSKTSLLGNFLPTGTL  60

Query  614  LAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGG  435
            L+F+++ P    NG C      M   LL + A+SCF   FTDS  G DG +YYGF T  G
Sbjct  61   LSFEMVLPSIYKNGQCTHMHTLMINFLLLVCALSCFFFHFTDSFHGPDGTLYYGFVTTRG  120

Query  434  LWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHE  255
            L +F  P+  A  +   D  KF+ GF D+VHAV+SV++FVAIA+ D  V +CL+P    +
Sbjct  121  LSVFK-PSLPAVPVPRDD--KFKVGFTDFVHAVMSVMIFVAIAVSDHRVTNCLFPGREKD  177

Query  254  TQEVLDVVPIGIGLLCSLLFLVFPTRRHGIG  162
             ++V +  P+ +GL+CS LFLVFPT RHGIG
Sbjct  178  LEQVRESFPLMVGLVCSGLFLVFPTSRHGIG  208



>ref|XP_004491811.1| PREDICTED: uncharacterized protein LOC101510550 [Cicer arietinum]
Length=217

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 104/170 (61%), Gaps = 4/170 (2%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFT  492
            Q+ L  T+ L N LPTGTL+ F+++ P    NG C      M   LL + A+SCF   FT
Sbjct  48   QKTLSKTSLLGNFLPTGTLITFEMVLPSIYRNGQCTHVHIIMMHFLLIMCALSCFFFHFT  107

Query  491  DSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVA  312
            DS  G DG VYYGF T+ GL +F         +   +  K++ GF D+VHAV+SV+VFVA
Sbjct  108  DSFHGADGNVYYGFVTQKGLSVFK----PGLAVLVPNDEKYKVGFQDFVHAVMSVMVFVA  163

Query  311  IALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIG  162
            IA  D  V +CL+P    E  +V++  P+ +G++CS LFL+FPT RHGIG
Sbjct  164  IAFSDYRVTNCLFPGHEREMDQVMESFPLMVGIICSGLFLIFPTSRHGIG  213



>ref|XP_002517851.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44369.1| conserved hypothetical protein [Ricinus communis]
Length=221

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 123/184 (67%), Gaps = 8/184 (4%)
 Frame = -3

Query  698  PAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATR-PMTLVLLSIL  522
            PA K+    ++  + T HLA LLPTG++LAFQ+L+PI T+ G C   T   +TL LL+  
Sbjct  43   PAQKA---IRKTFKGTGHLAKLLPTGSVLAFQILSPILTHQGQCRTTTSMSLTLALLTTC  99

Query  521  AVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVH  342
            A+SCFL C TDS R   G+V YG AT  GLW+ D     +  +SA +   ++  FID++H
Sbjct  100  ALSCFLLCLTDSFRDERGKVRYGLATFRGLWVLD----GSLKLSAEEAESYKLRFIDFLH  155

Query  341  AVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIG  162
            A +S LVF A+A  DKNVV+C    P+ E +++L  VP+G+G++CS+LFL FPT+RHGIG
Sbjct  156  AFMSALVFGAVAFFDKNVVNCFCSNPSEEVKDLLVAVPVGVGVVCSILFLRFPTKRHGIG  215

Query  161  FPVT  150
             P++
Sbjct  216  TPLS  219



>ref|XP_009376318.1| PREDICTED: uncharacterized protein LOC103965024 [Pyrus x bretschneideri]
Length=235

 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 106/170 (62%), Gaps = 4/170 (2%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFT  492
            Q+ L  T+ LAN LPTGTLL F+++ P     G C   T  MTLVLL +  +SCF   FT
Sbjct  66   QKTLSKTSLLANFLPTGTLLTFEMVLPAIYRTGECTGVTTMMTLVLLGMCTLSCFFFHFT  125

Query  491  DSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVA  312
            DS RG DG++YYGF T  GL +F  P             +++ G  D+VHA++SV+VFVA
Sbjct  126  DSFRGPDGKLYYGFVTPKGLAVFK-PGLGVEVPKEE---RYKLGLSDFVHAIMSVMVFVA  181

Query  311  IALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIG  162
            IA  D+ V  CL+P    +  EV++  P+ +G++CS LFLVFP+ R+GIG
Sbjct  182  IAFSDRRVTDCLFPGHEKDMDEVMESFPLMVGIVCSGLFLVFPSTRYGIG  231



>ref|XP_007139518.1| hypothetical protein PHAVU_008G036500g [Phaseolus vulgaris]
 gb|ESW11512.1| hypothetical protein PHAVU_008G036500g [Phaseolus vulgaris]
Length=212

 Score =   153 bits (387),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 108/170 (64%), Gaps = 3/170 (2%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFT  492
            Q+ L  T+ L N LPTGTLL+F+++ P    NG C      M   LL + A+SCF   FT
Sbjct  42   QKTLSKTSLLGNFLPTGTLLSFEMVLPSIYKNGQCTHMNTLMINFLLLLCALSCFFFHFT  101

Query  491  DSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVA  312
            DS  G DG +YYGF T  GL +F  P+  A  +   D  KF+ GF D+VHAV+SV++FVA
Sbjct  102  DSFHGPDGTLYYGFVTTRGLSVFK-PSLPAVPVPRDD--KFKVGFTDFVHAVMSVMIFVA  158

Query  311  IALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIG  162
            IA+ D  V +CL+P    + ++V +  P+ +GL+CS LFLVFPT RHGIG
Sbjct  159  IAVSDHRVTNCLFPGREKDLEQVRESFPLMVGLVCSGLFLVFPTSRHGIG  208



>ref|XP_009360650.1| PREDICTED: uncharacterized protein LOC103951099 [Pyrus x bretschneideri]
Length=263

 Score =   154 bits (390),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 107/170 (63%), Gaps = 4/170 (2%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFT  492
            Q+ L  T+ LAN LPTGTLL F+++ P+    G C   +  MT  LL + A+SCF   FT
Sbjct  94   QKTLSKTSMLANFLPTGTLLTFEMVLPVIYRTGECTRVSTMMTYGLLGMCALSCFFFHFT  153

Query  491  DSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVA  312
            DS RG DG++YYGF T+ GL +F  P             +++ G  D+VHA++SV+VFVA
Sbjct  154  DSFRGPDGKLYYGFVTQKGLAVFK-PGLMVEVPKEE---RYKLGLSDFVHAIMSVMVFVA  209

Query  311  IALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIG  162
            IA  D+ V  CL+P    +  EV++  P+ +G++CS LFLVFP+ R+GIG
Sbjct  210  IAFSDRRVTDCLFPGHEKDMDEVMESFPLMVGIVCSGLFLVFPSTRYGIG  259



>ref|XP_008657262.1| PREDICTED: uncharacterized protein LOC103636687 [Zea mays]
 gb|AFW79531.1| hypothetical protein ZEAMMB73_395130 [Zea mays]
Length=227

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 110/172 (64%), Gaps = 3/172 (2%)
 Frame = -3

Query  665  ALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDS  486
            AL S + L  LLPTGT+LAFQ L P F+N+G C AA R + L L+   AVSC L  FTDS
Sbjct  48   ALSSASDLMKLLPTGTVLAFQALAPSFSNHGVCHAANRYLVLSLIGACAVSCVLLSFTDS  107

Query  485  VRGRDGQVYYGFATRGGLWLFDYPaaaaagisa---ADLGKFRAGFIDYVHAVLSVLVFV  315
            + GRDG++Y+G AT  G + F+Y        +A    DL +FR   +D+VHA  S LVF+
Sbjct  108  LVGRDGKLYHGAATFWGFYPFNYTGTREQREAAFDDEDLSRFRVTALDFVHAFFSALVFL  167

Query  314  AIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGF  159
            A+AL D ++  CL+P    + +E+L  +P+G G L S++F++FPT R  IG+
Sbjct  168  AVALADASIQGCLFPDAGPDVRELLVNLPLGAGFLSSMVFMIFPTTRKSIGY  219



>ref|XP_010674991.1| PREDICTED: uncharacterized protein LOC104891047 [Beta vulgaris 
subsp. vulgaris]
Length=217

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/196 (43%), Positives = 120/196 (61%), Gaps = 8/196 (4%)
 Frame = -3

Query  722  LSVPEPLL--PAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRP  549
            L +  PLL  P  + P    + L S A+LANLLPT T+LAFQ L P F++NG C    + 
Sbjct  16   LPLEGPLLDPPKTRGPGSVHKTLASAANLANLLPTSTVLAFQALVPPFSHNGLCHLVNKY  75

Query  548  MTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDY----PaaaaagisaAD  381
            +T+ L+++ A+ CFL+ FTDS  G +G++YYG ATR GL++F+          +   A D
Sbjct  76   LTISLITVFALICFLSSFTDSFIGSNGKLYYGIATRKGLYVFNVLKWEEEERESSGDAKD  135

Query  380  LGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLY--PKPNHETQEVLDVVPIGIGLLC  207
            L K+R  FID+VHA +S++VF+  AL D +V+ C       N     +L  +P+G+G L 
Sbjct  136  LSKYRIMFIDFVHAFVSLVVFLVFALGDAHVLKCFLGDSADNDWVNSLLLNLPLGVGALS  195

Query  206  SLLFLVFPTRRHGIGF  159
            S LFL+FPT R GIG+
Sbjct  196  SFLFLLFPTNRRGIGY  211



>ref|XP_010244772.1| PREDICTED: uncharacterized protein LOC104588512 [Nelumbo nucifera]
Length=213

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 101/170 (59%), Gaps = 4/170 (2%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFT  492
            Q+ L  T+ L N LPTGTLL F++L P  + +G C      M  VL+ +  +SCF   FT
Sbjct  44   QKTLSKTSMLVNFLPTGTLLTFEMLLPSVSGDGQCSPVNTMMIEVLMGLCVLSCFFFHFT  103

Query  491  DSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVA  312
            DS RG DG+VYYGF T  GL LF                +F+ GF D+VHA++SV+VFVA
Sbjct  104  DSFRGPDGKVYYGFVTPSGLSLFKSGLGVEVPKDD----RFKVGFTDFVHAIMSVMVFVA  159

Query  311  IALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIG  162
            IA  D  V  CL+     E  EV++  P+ +G++CS LFLVFP  R+GIG
Sbjct  160  IAFSDHRVTDCLFRGHVKEMDEVMESFPLMVGVICSSLFLVFPNTRYGIG  209



>gb|EMT12942.1| hypothetical protein F775_20176 [Aegilops tauschii]
Length=215

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 112/174 (64%), Gaps = 2/174 (1%)
 Frame = -3

Query  674  SQRALESTAHLANLLPTGTLLAFQLLTPIFT-NNGACDAATRPMTLVLLSILAVSCFLAC  498
            + + L S + L  LLPTGT+LAFQ L P F+ N+G C AA R + L L+   A SC L  
Sbjct  34   ADKTLSSASDLLKLLPTGTVLAFQALAPSFSSNHGVCHAANRCLVLALIGGCAASCVLLS  93

Query  497  FTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisa-ADLGKFRAGFIDYVHAVLSVLV  321
            FTDS+ GRDG++YYG AT GG + F++    A   +A  DL +FR   +D VHAV+S LV
Sbjct  94   FTDSLVGRDGRLYYGAATLGGFYPFNFTGTRAERDAAFKDLSRFRVTPMDLVHAVVSALV  153

Query  320  FVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGF  159
            F+A+A  D  + SCL+P    ET+E+L  +P+  G L S++F++FPT R  IG+
Sbjct  154  FLAVAFADAGIQSCLFPDAGTETRELLVNLPVAAGFLASMVFMIFPTTRKSIGY  207



>ref|XP_008230772.1| PREDICTED: uncharacterized protein LOC103330011 [Prunus mume]
Length=232

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 105/170 (62%), Gaps = 4/170 (2%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFT  492
            Q+ L  T+ LAN LPTGTLL F+++ P    +G C   T  MT VLL + A+SCF    T
Sbjct  63   QKTLSKTSMLANFLPTGTLLTFEMVLPAIYRSGECTRVTNMMTHVLLGLCAMSCFFFHLT  122

Query  491  DSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVA  312
            DS RG DG++YYGF T  GL +F  P  A          +++ G  D+VHA +SV+VF A
Sbjct  123  DSFRGPDGKLYYGFVTLKGLAVFK-PGLAVEVPKDE---RYKLGLTDFVHAAMSVMVFAA  178

Query  311  IALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIG  162
            IA  D+ V  CL+P    E  EV++  P+ +G++CS LFLVFPT R+GIG
Sbjct  179  IAFSDRRVTDCLFPGHEKEMDEVMESFPLMVGIVCSGLFLVFPTTRYGIG  228



>ref|XP_007216891.1| hypothetical protein PRUPE_ppa020648mg [Prunus persica]
 gb|EMJ18090.1| hypothetical protein PRUPE_ppa020648mg [Prunus persica]
Length=232

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 105/170 (62%), Gaps = 4/170 (2%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFT  492
            Q+ L  T+ LAN LPTGTLL F+++ P    +G C   T  MT VLL + A+SCF   FT
Sbjct  63   QKTLSKTSMLANFLPTGTLLTFEMVLPAIYRSGECTRVTNMMTHVLLGLCAMSCFFFHFT  122

Query  491  DSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVA  312
            DS RG DG+++YGF T  GL +F  P             +++ G  D+VHA +SV+VF A
Sbjct  123  DSFRGPDGKLFYGFVTPKGLAVFK-PGLPVEVPKDE---RYKLGLTDFVHAAMSVMVFAA  178

Query  311  IALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIG  162
            IA  D+ V  CL+P    E  EV++  P+ +G++CS LFLVFPT R+GIG
Sbjct  179  IAFSDRRVTDCLFPGHEKEMDEVMESFPLMVGIVCSGLFLVFPTTRYGIG  228



>ref|XP_008353425.1| PREDICTED: uncharacterized protein LOC103416995 [Malus domestica]
Length=239

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 106/170 (62%), Gaps = 4/170 (2%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFT  492
            Q+ L  T+ LAN LPTGTLL F+++ P     G C   T  MT  +L + A+SCF   FT
Sbjct  66   QKTLSKTSMLANFLPTGTLLTFEMVLPAIYTTGECTRVTTMMTYGILGMCALSCFFFHFT  125

Query  491  DSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVA  312
            DS RG DG++YYGF T+ GL +F  P             +++ G  D+VHA++SV+VFVA
Sbjct  126  DSFRGPDGKLYYGFVTQKGLAVFK-PGLMVEVPKEE---RYKLGLSDFVHAIMSVMVFVA  181

Query  311  IALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIG  162
            IA  D+ V  CL+P    +  EV++  P+ +G++CS LFLVFP+ R+GIG
Sbjct  182  IAFSDRRVTDCLFPGHEKDMDEVMESFPLMVGIVCSGLFLVFPSTRYGIG  231



>ref|XP_009381725.1| PREDICTED: uncharacterized protein LOC103969806 [Musa acuminata 
subsp. malaccensis]
Length=209

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 106/176 (60%), Gaps = 16/176 (9%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFT  492
            Q+ L  T+ L N LPTGTLL F+LL P  + +G+C   +  M   LL + A+SCF   FT
Sbjct  40   QKTLSKTSMLVNFLPTGTLLTFELLLPSASGDGSCSPVSTLMIETLLGLCALSCFFFHFT  99

Query  491  DSVRGRDGQVYYGFATRGGLWLF------DYPaaaaagisaADLGKFRAGFIDYVHAVLS  330
            DS RG DG+VYYGF T  GL +F      D P             +FR GF+D VHA+++
Sbjct  100  DSFRGPDGKVYYGFVTPRGLAVFKSGLGVDVPQDE----------RFRMGFVDLVHALMA  149

Query  329  VLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIG  162
             +VF AIAL D  V +CL+P    E  EV++  P+ +G++CS LFLVFP  R+GIG
Sbjct  150  AMVFAAIALSDHRVTNCLFPGHAKEMDEVMESFPLMVGVVCSGLFLVFPNTRYGIG  205



>ref|XP_004971846.1| PREDICTED: uncharacterized protein LOC101769380 [Setaria italica]
Length=220

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 110/170 (65%), Gaps = 1/170 (1%)
 Frame = -3

Query  665  ALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDS  486
            AL S + L  LLPTGT+LAFQ L P F+N+GAC AA R + L L+    VSC L  FTDS
Sbjct  43   ALSSASDLLKLLPTGTVLAFQALAPSFSNHGACHAANRYLVLSLIGTCTVSCVLLSFTDS  102

Query  485  VRGRDGQVYYGFATRGGLWLFDYPaaaaagisa-ADLGKFRAGFIDYVHAVLSVLVFVAI  309
            + GRDG++Y+G AT GG + F++        +A  DL + R   +D+VHA  S LVF+A+
Sbjct  103  LVGRDGKLYHGAATFGGFYPFNFAGTREEREAAFRDLSRLRITALDFVHAFFSALVFLAV  162

Query  308  ALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGF  159
            AL D ++  CL+P    + +E+L  +P+G G L S++F++FPT R  IG+
Sbjct  163  ALADASIQGCLFPDAGPDVRELLVNLPLGAGFLSSMVFIIFPTTRKSIGY  212



>ref|XP_010024460.1| PREDICTED: uncharacterized protein LOC104414940 [Eucalyptus grandis]
 gb|KCW60909.1| hypothetical protein EUGRSUZ_H03644 [Eucalyptus grandis]
Length=203

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 106/187 (57%), Gaps = 5/187 (3%)
 Frame = -3

Query  695  AAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAV  516
            A+K    S     S  +L  LLPTGT+  FQ L P+ TNNG C    + ++ +L+   A 
Sbjct  13   ASKPRGISGTTFASLGNLIKLLPTGTVFMFQFLNPVLTNNGQCHTFNKYLSGLLVGACAF  72

Query  515  SCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAV  336
            SC  +CFTDS  G DG ++YG AT  GLW      ++       DL K++    D+VHA+
Sbjct  73   SCAFSCFTDSFTGADGMIHYGIATAKGLW-----PSSTEYSRTVDLSKYKLRVGDFVHAL  127

Query  335  LSVLVFVAIALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFP  156
            LS  VF A+ L D N V C YP    E + +L  +P  IG + S +F+VFP+ RHGIG+P
Sbjct  128  LSTTVFAAVTLLDPNTVECFYPSFKSEQKVLLQALPPVIGAISSAVFMVFPSNRHGIGYP  187

Query  155  VTSGKSD  135
             +S +SD
Sbjct  188  FSSDESD  194



>ref|XP_002437096.1| hypothetical protein SORBIDRAFT_10g021060 [Sorghum bicolor]
 gb|EER88463.1| hypothetical protein SORBIDRAFT_10g021060 [Sorghum bicolor]
Length=278

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 107/172 (62%), Gaps = 4/172 (2%)
 Frame = -3

Query  668  RALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTD  489
            +A  STA LA  LPTG +L F++L+P+FTN G CD   R MT  L+ + A  CF  CFTD
Sbjct  108  KAFRSTAELAKHLPTGAVLVFEVLSPVFTNGGKCDDVNRVMTAWLVGLCAAGCFFLCFTD  167

Query  488  SVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAI  309
            S     G V Y  ATR G+W+ D         S     + R  FID+ HA +S++VF+++
Sbjct  168  SFHDAKGTVRYVVATRRGVWVID----GTPPPSPEKAAEKRVKFIDFFHAFMSLVVFMSV  223

Query  308  ALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIGFPV  153
            A+ D+NV +C  P  +++T++VL  VP+  GL+ +LLF  FP+ RHGIGFPV
Sbjct  224  AMFDRNVGACFNPVMSYDTRQVLTAVPLAGGLVGTLLFATFPSTRHGIGFPV  275



>ref|XP_010024463.1| PREDICTED: uncharacterized protein LOC104414942 [Eucalyptus grandis]
 gb|KCW60911.1| hypothetical protein EUGRSUZ_H03646 [Eucalyptus grandis]
Length=202

 Score =   151 bits (381),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 106/189 (56%), Gaps = 8/189 (4%)
 Frame = -3

Query  719  SVPEPLLPAAKSPSFSQRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTL  540
            S P+P + A+K   F   A  S  +   LLPTGT+  FQ L P+ TNNG CD     ++ 
Sbjct  5    SSPKPKIDASKLKGFRDAAFSSVGNFIKLLPTGTVFTFQFLNPLLTNNGHCDDPNELLSR  64

Query  539  VLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAG  360
            +L+   A SC  +CFTDS  G DG V+YGFAT  GLW        +      DL K++  
Sbjct  65   LLIIAGAFSCAFSCFTDSYTGSDGNVHYGFATAKGLW-------PSPASELVDLSKYKLK  117

Query  359  FIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEV-LDVVPIGIGLLCSLLFLVFP  183
              D+VHA+LS +VF+  AL D N V CLY     +  +V L  VP  IG + S +F+ FP
Sbjct  118  GSDFVHALLSTIVFMVTALLDPNTVECLYSSSYKKDHKVLLKAVPAVIGAISSAVFMAFP  177

Query  182  TRRHGIGFP  156
            + RHGIG+P
Sbjct  178  SNRHGIGYP  186



>ref|XP_011075510.1| PREDICTED: uncharacterized protein LOC105159971 [Sesamum indicum]
Length=221

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 104/170 (61%), Gaps = 4/170 (2%)
 Frame = -3

Query  671  QRALESTAHLANLLPTGTLLAFQLLTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFT  492
            Q+ L  T+ LAN LPTGTLL F+++ P    NG C + T  M   LL +  +SCF   FT
Sbjct  52   QKTLSKTSLLANFLPTGTLLTFEMVLPSVYANGECSSVTTHMIYSLLGLCTLSCFFFHFT  111

Query  491  DSVRGRDGQVYYGFATRGGLWLFDYPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVA  312
            DS RG DG+VYYGF T  GL +F        G+      +++ G  D+VHA++SVLVFVA
Sbjct  112  DSFRGPDGKVYYGFVTLSGLAVFK----TGLGVEVPKDDRYKVGLSDFVHALMSVLVFVA  167

Query  311  IALKDKNVVSCLYPKPNHETQEVLDVVPIGIGLLCSLLFLVFPTRRHGIG  162
            IA  D  V  C++P    E  EV+   P+ +G++CS LFLVFPT R+GIG
Sbjct  168  IAFSDHRVTGCVFPGHAAELDEVMQSFPLMVGIICSGLFLVFPTTRYGIG  217



>ref|XP_008781019.1| PREDICTED: uncharacterized protein LOC103700896 [Phoenix dactylifera]
Length=207

 Score =   151 bits (381),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/206 (41%), Positives = 118/206 (57%), Gaps = 17/206 (8%)
 Frame = -3

Query  740  DREVETLSVPEPLLPAAKSPSFS-------------QRALESTAHLANLLPTGTLLAFQL  600
            D+ VET+     L P++  P+ +             Q+ L  T+ LA  LPTGTLL F++
Sbjct  2    DQPVETVVDQPSLFPSSPRPTPATTSRKRKVVAKSLQKTLSKTSMLARFLPTGTLLTFEM  61

Query  599  LTPIFTNNGACDAATRPMTLVLLSILAVSCFLACFTDSVRGRDGQVYYGFATRGGLWLFD  420
            L P  + +G+C  A+  M  VLL +  +SCF   FTDS  G DG+VYYGF T  GL +F 
Sbjct  62   LLPPVSGDGSCSPASTTMMHVLLGLCTISCFFFHFTDSFHGPDGKVYYGFVTPRGLAVFK  121

Query  419  YPaaaaagisaADLGKFRAGFIDYVHAVLSVLVFVAIALKDKNVVSCLYPKPNHETQEVL  240
                   G+      ++R GF+D VHA ++V+VF AIAL D  V +CL+P    E  EV+
Sbjct  122  ----PGLGVEVPKDDRYRMGFVDLVHAAMAVMVFSAIALSDHRVTNCLFPGRAKEMDEVM  177

Query  239  DVVPIGIGLLCSLLFLVFPTRRHGIG  162
            +  P+ +G++CS LFLVFP  R G+G
Sbjct  178  ESFPLMVGVVCSGLFLVFPATRSGVG  203



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2278597794392