BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c28237_g1_i1 len=1445 path=[1423:0-1444]

Length=1445
                                                                      Score     E

ref|XP_009781146.1|  PREDICTED: cell differentiation protein RCD1...    310   2e-98   
ref|XP_009597206.1|  PREDICTED: cell differentiation protein rcd1...    310   3e-98   
ref|XP_009784510.1|  PREDICTED: cell differentiation protein rcd1...    309   7e-98   
ref|XP_009588346.1|  PREDICTED: cell differentiation protein RCD1...    307   6e-97   
ref|XP_009781145.1|  PREDICTED: cell differentiation protein RCD1...    306   7e-97   
ref|XP_009597205.1|  PREDICTED: cell differentiation protein RCD1...    290   6e-90   
ref|XP_010323843.1|  PREDICTED: cell differentiation protein rcd1...    279   4e-86   
ref|XP_002270523.1|  PREDICTED: cell differentiation protein RCD1...    260   7e-79   Vitis vinifera
ref|XP_004515427.1|  PREDICTED: cell differentiation protein RCD1...    256   2e-77   
ref|XP_009608973.1|  PREDICTED: cell differentiation protein RCD1...    256   4e-77   
ref|XP_010244465.1|  PREDICTED: cell differentiation protein RCD1...    255   5e-77   
ref|XP_009787282.1|  PREDICTED: cell differentiation protein RCD1...    255   5e-77   
ref|XP_010252482.1|  PREDICTED: cell differentiation protein RCD1...    255   5e-77   
ref|XP_002529459.1|  Cell differentiation protein rcd1, putative        256   6e-77   Ricinus communis
ref|XP_010103614.1|  hypothetical protein L484_023112                   257   9e-77   
gb|KHN12519.1|  Cell differentiation protein RCD1 like                  253   1e-76   
ref|XP_003545123.1|  PREDICTED: cell differentiation protein RCD1...    254   1e-76   
ref|XP_009762483.1|  PREDICTED: cell differentiation protein RCD1...    255   1e-76   
ref|XP_006475023.1|  PREDICTED: cell differentiation protein RCD1...    254   1e-76   
ref|XP_011008643.1|  PREDICTED: cell differentiation protein RCD1...    254   1e-76   
ref|XP_009355707.1|  PREDICTED: cell differentiation protein RCD1...    254   1e-76   
emb|CDP13803.1|  unnamed protein product                                254   2e-76   
ref|XP_007146510.1|  hypothetical protein PHAVU_006G046900g             254   2e-76   
ref|XP_008389069.1|  PREDICTED: cell differentiation protein RCD1...    254   2e-76   
ref|XP_010314088.1|  PREDICTED: cell differentiation protein RCD1...    253   3e-76   
ref|XP_003551870.1|  PREDICTED: cell differentiation protein RCD1...    253   4e-76   
ref|XP_003532138.1|  PREDICTED: cell differentiation protein RCD1...    253   4e-76   
ref|XP_008226846.1|  PREDICTED: cell differentiation protein RCD1...    253   4e-76   
gb|KDP39170.1|  hypothetical protein JCGZ_00927                         253   4e-76   
ref|XP_007211663.1|  hypothetical protein PRUPE_ppa009006mg             253   4e-76   
ref|XP_004139793.1|  PREDICTED: cell differentiation protein RCD1...    253   6e-76   
ref|XP_011095434.1|  PREDICTED: cell differentiation protein RCD1...    252   6e-76   
gb|KEH33873.1|  cell differentiation RCD1-like protein                  252   8e-76   
ref|XP_010941545.1|  PREDICTED: cell differentiation protein RCD1...    252   9e-76   
ref|XP_004144502.1|  PREDICTED: cell differentiation protein RCD1...    251   1e-75   
gb|AFK43869.1|  unknown                                                 251   1e-75   
ref|XP_011097852.1|  PREDICTED: cell differentiation protein RCD1...    251   2e-75   
gb|EEC82276.1|  hypothetical protein OsI_26499                          250   2e-75   Oryza sativa Indica Group [Indian rice]
ref|XP_009351738.1|  PREDICTED: cell differentiation protein RCD1...    251   2e-75   
ref|XP_004170382.1|  PREDICTED: cell differentiation protein RCD1...    251   2e-75   
ref|XP_002298844.1|  rcd1-like cell differentiation family protein      251   3e-75   Populus trichocarpa [western balsam poplar]
ref|XP_007142310.1|  hypothetical protein PHAVU_008G269900g             251   3e-75   
ref|XP_010267341.1|  PREDICTED: cell differentiation protein RCD1...    251   4e-75   
ref|XP_007014909.1|  Cell differentiation, Rcd1-like protein isof...    251   4e-75   
ref|XP_004294416.1|  PREDICTED: cell differentiation protein RCD1...    249   8e-75   
ref|XP_008389066.1|  PREDICTED: cell differentiation protein RCD1...    249   9e-75   
ref|NP_001053854.2|  Os04g0613400                                       250   9e-75   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008340437.1|  PREDICTED: cell differentiation protein RCD1...    249   9e-75   
ref|XP_008345037.1|  PREDICTED: cell differentiation protein RCD1...    249   2e-74   
ref|XP_009351736.1|  PREDICTED: cell differentiation protein RCD1...    248   3e-74   
ref|XP_006452432.1|  hypothetical protein CICLE_v10010530mg             248   3e-74   
gb|AAM61591.1|  putative cell differentiation protein                   248   4e-74   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB02488.1|  RCD1                                                   248   4e-74   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188716.1|  cell differentiation, Rcd1-like protein               248   4e-74   Arabidopsis thaliana [mouse-ear cress]
emb|CBI26674.3|  unnamed protein product                                246   5e-74   
ref|XP_008221073.1|  PREDICTED: cell differentiation protein RCD1...    248   5e-74   
ref|XP_006652810.1|  PREDICTED: cell differentiation protein RCD1...    248   5e-74   
ref|XP_007222827.1|  hypothetical protein PRUPE_ppa008784mg             248   5e-74   
ref|XP_007014911.1|  Cell differentiation, Rcd1-like protein isof...    248   5e-74   
ref|XP_002885405.1|  hypothetical protein ARALYDRAFT_479606             247   6e-74   
ref|XP_011008644.1|  PREDICTED: cell differentiation protein RCD1...    247   7e-74   
ref|XP_009361028.1|  PREDICTED: cell differentiation protein RCD1...    247   8e-74   
ref|XP_006344862.1|  PREDICTED: cell differentiation protein RCD1...    246   8e-74   
ref|XP_006352517.1|  PREDICTED: cell differentiation protein RCD1...    247   8e-74   
ref|XP_002278722.1|  PREDICTED: cell differentiation protein RCD1...    247   9e-74   Vitis vinifera
ref|XP_008340435.1|  PREDICTED: cell differentiation protein RCD1...    247   9e-74   
ref|XP_008667167.1|  PREDICTED: hypothetical protein isoform X2         246   9e-74   
ref|XP_008776171.1|  PREDICTED: cell differentiation protein RCD1...    247   1e-73   
ref|XP_010644487.1|  PREDICTED: cell differentiation protein RCD1...    246   1e-73   
ref|XP_010241638.1|  PREDICTED: cell differentiation protein RCD1...    247   1e-73   
ref|XP_008794445.1|  PREDICTED: cell differentiation protein RCD1...    247   1e-73   
emb|CBI28834.3|  unnamed protein product                                245   1e-73   
ref|XP_010675730.1|  PREDICTED: cell differentiation protein RCD1...    247   1e-73   
ref|NP_001131945.1|  hypothetical protein                               246   1e-73   Zea mays [maize]
ref|XP_009420695.1|  PREDICTED: cell differentiation protein RCD1...    247   1e-73   
ref|XP_004297723.1|  PREDICTED: cell differentiation protein RCD1...    246   2e-73   
ref|XP_003518528.1|  PREDICTED: cell differentiation protein RCD1...    246   2e-73   
ref|XP_008784791.1|  PREDICTED: cell differentiation protein RCD1...    246   2e-73   
ref|XP_010923683.1|  PREDICTED: cell differentiation protein RCD1...    246   3e-73   
ref|XP_002448518.1|  hypothetical protein SORBIDRAFT_06g028320          246   3e-73   Sorghum bicolor [broomcorn]
ref|XP_010907338.1|  PREDICTED: cell differentiation protein RCD1...    245   4e-73   
ref|XP_009618802.1|  PREDICTED: cell differentiation protein RCD1...    245   4e-73   
ref|XP_004976789.1|  PREDICTED: cell differentiation protein RCD1...    245   5e-73   
ref|XP_010488065.1|  PREDICTED: cell differentiation protein RCD1...    245   5e-73   
ref|XP_010509345.1|  PREDICTED: cell differentiation protein RCD1...    245   5e-73   
ref|XP_009417894.1|  PREDICTED: cell differentiation protein RCD1...    245   6e-73   
ref|XP_011047538.1|  PREDICTED: cell differentiation protein RCD1...    245   6e-73   
ref|XP_007014910.1|  Cell differentiation, Rcd1-like protein isof...    244   8e-73   
ref|XP_004248335.1|  PREDICTED: cell differentiation protein RCD1...    244   1e-72   
ref|XP_010545571.1|  PREDICTED: cell differentiation protein RCD1...    244   2e-72   
ref|XP_010544237.1|  PREDICTED: cell differentiation protein RCD1...    244   2e-72   
ref|XP_006406348.1|  hypothetical protein EUTSA_v10021160mg             242   5e-72   
ref|XP_009110170.1|  PREDICTED: cell differentiation protein RCD1...    242   5e-72   
emb|CDY27561.1|  BnaC01g32440D                                          242   5e-72   
ref|XP_009145585.1|  PREDICTED: cell differentiation protein RCD1...    242   5e-72   
ref|XP_006650687.1|  PREDICTED: cell differentiation protein RCD1...    241   5e-72   
ref|XP_010060296.1|  PREDICTED: cell differentiation protein RCD1...    242   6e-72   
ref|XP_010466285.1|  PREDICTED: cell differentiation protein RCD1...    242   6e-72   
ref|XP_005768296.1|  hypothetical protein EMIHUDRAFT_414254             241   6e-72   
gb|EYU33659.1|  hypothetical protein MIMGU_mgv1a010408mg                242   7e-72   
ref|XP_002993082.1|  hypothetical protein SELMODRAFT_236668             241   8e-72   
ref|XP_008455454.1|  PREDICTED: cell differentiation protein rcd1...    241   1e-71   
ref|XP_002975298.1|  hypothetical protein SELMODRAFT_174818             241   2e-71   
ref|XP_009131304.1|  PREDICTED: cell differentiation protein RCD1...    240   2e-71   
ref|XP_002278757.1|  PREDICTED: cell differentiation protein RCD1...    241   2e-71   Vitis vinifera
ref|XP_010644488.1|  PREDICTED: cell differentiation protein RCD1...    240   2e-71   
ref|XP_003558190.1|  PREDICTED: cell differentiation protein RCD1...    242   2e-71   
ref|XP_006298010.1|  hypothetical protein CARUB_v10014055mg             242   3e-71   
gb|KHN38259.1|  Cell differentiation protein RCD1 like                  240   3e-71   
gb|EAY92084.1|  hypothetical protein OsI_13789                          241   3e-71   Oryza sativa Indica Group [Indian rice]
emb|CDY60389.1|  BnaA01g36820D                                          242   3e-71   
gb|AAK72897.1|AC091123_16  putative cell differentiation protein        241   3e-71   Oryza sativa [red rice]
ref|XP_007014912.1|  Cell differentiation, Rcd1-like protein isof...    240   4e-71   
ref|XP_004297722.1|  PREDICTED: cell differentiation protein RCD1...    240   5e-71   
ref|XP_006352520.1|  PREDICTED: cell differentiation protein RCD1...    239   5e-71   
ref|XP_010096119.1|  hypothetical protein L484_012474                   239   8e-71   
ref|XP_010941548.1|  PREDICTED: cell differentiation protein RCD1...    238   1e-70   
emb|CDX70486.1|  BnaC03g05700D                                          238   2e-70   
ref|XP_009417900.1|  PREDICTED: cell differentiation protein RCD1...    238   2e-70   
gb|KDP30773.1|  hypothetical protein JCGZ_13716                         237   5e-70   
emb|CAE05211.3|  OSJNBa0070C17.18                                       238   6e-70   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK04786.1|  predicted protein                                      240   7e-70   
emb|CBJ25574.1|  conserved unknown protein                              238   1e-69   
dbj|BAF01487.1|  hypothetical protein                                   235   2e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001754931.1|  predicted protein                                  234   2e-69   
ref|XP_003580537.1|  PREDICTED: cell differentiation protein rcd1...    236   2e-69   
ref|XP_006399783.1|  hypothetical protein EUTSA_v10014186mg             235   2e-69   
ref|XP_002873591.1|  hypothetical protein ARALYDRAFT_909249             235   3e-69   
ref|XP_009830183.1|  hypothetical protein H257_06600                    235   3e-69   
ref|XP_010327177.1|  PREDICTED: cell differentiation protein RCD1...    235   3e-69   
ref|NP_196802.1|  Cell differentiation, Rcd1-like protein               235   3e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009417910.1|  PREDICTED: cell differentiation protein RCD1...    233   4e-69   
ref|XP_008861004.1|  hypothetical protein H310_00133                    234   4e-69   
gb|KFK25534.1|  hypothetical protein AALP_AA8G127600                    234   4e-69   
ref|XP_008794447.1|  PREDICTED: cell differentiation protein RCD1...    233   4e-69   
ref|XP_002898724.1|  cell differentiation protein rcd1                  234   5e-69   
ref|XP_005651333.1|  Rcd1-like protein                                  233   6e-69   
gb|KDO24701.1|  cell differentiation protein RCD1                       234   9e-69   
ref|XP_008898970.1|  hypothetical protein PPTG_06680                    233   1e-68   
ref|XP_006847021.1|  hypothetical protein AMTR_s00017p00162080          233   1e-68   
gb|KFM26961.1|  Cell differentiation protein RCD1-like protein          233   1e-68   
ref|XP_008605841.1|  cell differentiation protein RCD1                  233   1e-68   
dbj|BAK03539.1|  predicted protein                                      234   1e-68   
emb|CDX97215.1|  BnaC09g44100D                                          233   1e-68   
ref|XP_009527321.1|  hypothetical protein PHYSODRAFT_559218             232   2e-68   
ref|XP_007514019.1|  cell differentiation protein rcd1                  232   2e-68   
ref|XP_001780321.1|  predicted protein                                  232   3e-68   
ref|XP_010419859.1|  PREDICTED: cell differentiation protein RCD1...    232   3e-68   
ref|XP_010323844.1|  PREDICTED: cell differentiation protein RCD1...    233   3e-68   
gb|KHG04254.1|  Cell differentiation RCD1                               233   4e-68   
emb|CDY06382.1|  BnaC05g31480D                                          232   4e-68   
ref|XP_002463783.1|  hypothetical protein SORBIDRAFT_01g006090          232   5e-68   Sorghum bicolor [broomcorn]
gb|ETK95634.1|  hypothetical protein L915_01456                         231   5e-68   
ref|XP_002741589.1|  PREDICTED: cell differentiation protein RCD1...    231   6e-68   Saccoglossus kowalevskii
ref|XP_006367907.1|  PREDICTED: cell differentiation protein RCD1...    229   7e-68   
ref|XP_010923682.1|  PREDICTED: cell differentiation protein RCD1...    231   2e-67   
ref|XP_007434640.1|  PREDICTED: cell differentiation protein RCD1...    230   2e-67   
ref|XP_002591911.1|  hypothetical protein BRAFLDRAFT_284472             230   2e-67   Branchiostoma floridae
ref|XP_002508177.1|  predicted protein                                  228   2e-67   Micromonas commoda
gb|EJD74979.1|  cell differentiation protein RCD1                       229   2e-67   
ref|XP_790812.3|  PREDICTED: cell differentiation protein RCD1 ho...    230   2e-67   Strongylocentrotus purpuratus [purple urchin]
ref|XP_007070754.1|  PREDICTED: cell differentiation protein RCD1...    229   3e-67   
ref|XP_010941550.1|  PREDICTED: cell differentiation protein RCD1...    228   3e-67   
ref|XP_005279773.1|  PREDICTED: cell differentiation protein RCD1...    229   3e-67   
ref|XP_005279774.1|  PREDICTED: cell differentiation protein RCD1...    229   4e-67   
ref|XP_001694059.1|  Rcd1-like protein                                  229   4e-67   Chlamydomonas reinhardtii
ref|XP_010453350.1|  PREDICTED: cell differentiation protein RCD1...    229   4e-67   
gb|EYU27361.1|  hypothetical protein MIMGU_mgv1a010104mg                229   4e-67   
pdb|4CT6|B  Chain B, Cnot9-cnot1 Complex                                228   4e-67   
ref|NP_989024.1|  cell differentiation protein RCD1 homolog             229   4e-67   Xenopus tropicalis [western clawed frog]
pdb|2FV2|A  Chain A, Crystal Structure Analysis Of Human Rcd-1 Co...    228   5e-67   
ref|XP_009971585.1|  PREDICTED: cell differentiation protein RCD1...    228   5e-67   
ref|XP_003057708.1|  predicted protein                                  228   5e-67   
pdb|4CT7|B  Chain B, Cnot9-cnot1 Complex With Bound Tryptophan          228   6e-67   
ref|XP_005991824.1|  PREDICTED: cell differentiation protein RCD1...    228   6e-67   
ref|XP_010536031.1|  PREDICTED: cell differentiation protein RCD1...    229   6e-67   
ref|XP_010492038.1|  PREDICTED: cell differentiation protein RCD1...    229   6e-67   
gb|KFV41020.1|  Cell differentiation protein RCD1                       228   6e-67   
pdb|4CRU|B  Chain B, Complex Of Human Cnot9 And Cnot1 Including O...    228   7e-67   
ref|NP_001126453.1|  cell differentiation protein RCD1 homolog          228   9e-67   Pongo abelii [orang utan]
ref|XP_005534896.1|  cell differentiation protein rcd1                  227   1e-66   
ref|NP_067358.1|  cell differentiation protein RCD1 homolog             228   1e-66   Mus musculus [mouse]
gb|EMT16235.1|  hypothetical protein F775_52609                         229   1e-66   
ref|NP_005435.1|  cell differentiation protein RCD1 homolog isofo...    228   1e-66   Homo sapiens [man]
ref|XP_003214973.1|  PREDICTED: cell differentiation protein RCD1...    228   1e-66   
ref|XP_008143385.1|  PREDICTED: cell differentiation protein RCD1...    228   1e-66   
ref|XP_008455456.1|  PREDICTED: cell differentiation protein RCD1...    227   1e-66   
ref|XP_006112741.1|  PREDICTED: cell differentiation protein RCD1...    229   1e-66   
dbj|BAG38156.1|  unnamed protein product                                228   1e-66   Homo sapiens [man]
gb|KFO69703.1|  Cell differentiation protein RCD1                       228   1e-66   
gb|KCW66961.1|  hypothetical protein EUGRSUZ_F00722                     228   1e-66   
gb|ELK30515.1|  Cell differentiation protein RCD1 like protein          228   1e-66   
ref|XP_009687994.1|  PREDICTED: cell differentiation protein RCD1...    228   1e-66   
emb|CDP99648.1|  Protein BM-NTL-9                                       227   1e-66   
ref|XP_007908508.1|  PREDICTED: cell differentiation protein RCD1...    228   1e-66   
ref|XP_010071840.1|  PREDICTED: cell differentiation protein RCD1...    228   1e-66   
ref|XP_004883955.1|  PREDICTED: cell differentiation protein RCD1...    228   1e-66   
ref|XP_009073791.1|  PREDICTED: cell differentiation protein RCD1...    228   1e-66   
ref|XP_006269184.1|  PREDICTED: cell differentiation protein RCD1...    227   1e-66   
gb|EMP25483.1|  Cell differentiation protein RCD1 like protein          228   1e-66   
ref|XP_009323133.1|  PREDICTED: cell differentiation protein RCD1...    228   1e-66   
ref|XP_010165671.1|  PREDICTED: cell differentiation protein RCD1...    227   1e-66   
ref|XP_010114516.1|  PREDICTED: cell differentiation protein RCD1...    227   1e-66   
ref|XP_010405629.1|  PREDICTED: cell differentiation protein RCD1...    228   2e-66   
ref|XP_005234401.1|  PREDICTED: cell differentiation protein RCD1...    227   2e-66   
ref|XP_009959647.1|  PREDICTED: cell differentiation protein RCD1...    227   2e-66   
ref|XP_010009602.1|  PREDICTED: cell differentiation protein RCD1...    227   2e-66   
gb|AEE62592.1|  unknown                                                 228   2e-66   
ref|XP_005246999.1|  PREDICTED: cell differentiation protein RCD1...    228   2e-66   
ref|XP_005485333.1|  PREDICTED: cell differentiation protein RCD1...    228   2e-66   
gb|KFP86038.1|  Cell differentiation protein RCD1                       227   2e-66   
ref|XP_005498733.1|  PREDICTED: cell differentiation protein RCD1...    227   2e-66   
ref|XP_006694528.1|  putative cell differentiation protein              229   2e-66   
ref|XP_008921238.1|  PREDICTED: cell differentiation protein RCD1...    227   2e-66   
ref|XP_008495202.1|  PREDICTED: cell differentiation protein RCD1...    227   2e-66   
gb|EOB00198.1|  Cell differentiation protein RCD1-like protein          227   2e-66   
ref|XP_005184857.1|  PREDICTED: cell differentiation protein RCD1...    227   2e-66   
gb|KFV63409.1|  Cell differentiation protein RCD1                       227   2e-66   
gb|KFP30335.1|  Cell differentiation protein RCD1                       227   2e-66   
gb|KFR04483.1|  Cell differentiation protein RCD1                       227   2e-66   
ref|XP_009943625.1|  PREDICTED: cell differentiation protein RCD1...    227   2e-66   
gb|ETN79607.1|  cell differentiation family, Rcd1                       228   2e-66   
ref|XP_008643064.1|  PREDICTED: cell differentiation protein RCD1...    227   2e-66   
ref|XP_005850551.1|  hypothetical protein CHLNCDRAFT_140433             227   2e-66   
ref|XP_008940679.1|  PREDICTED: cell differentiation protein RCD1...    227   2e-66   
ref|XP_009273303.1|  PREDICTED: cell differentiation protein RCD1...    227   2e-66   
ref|XP_006364171.1|  PREDICTED: cell differentiation protein RCD1...    224   2e-66   
ref|XP_005049614.1|  PREDICTED: cell differentiation protein RCD1...    228   2e-66   
ref|XP_009882234.1|  PREDICTED: cell differentiation protein RCD1...    227   2e-66   
ref|XP_005798199.1|  PREDICTED: cell differentiation protein RCD1...    227   3e-66   
ref|XP_004807274.1|  PREDICTED: cell differentiation protein RCD1...    227   3e-66   
ref|XP_004402773.1|  PREDICTED: cell differentiation protein RCD1...    227   3e-66   
ref|XP_005279775.1|  PREDICTED: cell differentiation protein RCD1...    227   3e-66   
ref|XP_002167359.2|  PREDICTED: cell differentiation protein RCD1...    227   3e-66   
ref|XP_005676988.1|  PREDICTED: cell differentiation protein RCD1...    228   3e-66   
ref|XP_010889325.1|  PREDICTED: cell differentiation protein RCD1...    226   3e-66   
ref|XP_009909474.1|  PREDICTED: cell differentiation protein RCD1...    227   3e-66   
ref|XP_010889327.1|  PREDICTED: cell differentiation protein RCD1...    226   3e-66   
ref|XP_003765981.1|  PREDICTED: cell differentiation protein RCD1...    227   3e-66   
gb|EXV05652.1|  Rcd1-like cell differentiation family protein           229   4e-66   
gb|EFX05511.1|  cell differentiation protein                            226   4e-66   
emb|CCT64626.1|  probable rcd1 protein involved in sexual develop...    228   4e-66   
ref|XP_009994553.1|  PREDICTED: cell differentiation protein RCD1...    227   4e-66   
ref|XP_003650571.1|  hypothetical protein THITE_2110170                 228   4e-66   
ref|XP_009037094.1|  hypothetical protein AURANDRAFT_69805              226   4e-66   
ref|XP_389451.1|  hypothetical protein FG09275.1                        228   4e-66   Fusarium graminearum PH-1
ref|XP_006352518.1|  PREDICTED: cell differentiation protein RCD1...    225   4e-66   
ref|XP_002291328.1|  cell differentiation protein                       225   4e-66   Thalassiosira pseudonana CCMP1335
gb|KEY70769.1|  hypothetical protein S7711_03263                        229   4e-66   
gb|ENH82224.1|  cell differentiation protein rcd1                       225   5e-66   
gb|EXM03312.1|  hypothetical protein FOIG_06161                         228   5e-66   
gb|EWG41828.1|  hypothetical protein FVEG_03833                         228   5e-66   
gb|KFA50936.1|  hypothetical protein S40293_02434                       229   5e-66   
gb|EXK33068.1|  hypothetical protein FOMG_11854                         228   5e-66   
gb|KFA66585.1|  hypothetical protein S40285_07306                       229   5e-66   
gb|EWY95380.1|  hypothetical protein FOYG_04442                         228   5e-66   
gb|ENH69630.1|  Cell differentiation protein rcd1                       228   5e-66   
gb|KFA76266.1|  hypothetical protein S40288_03622                       229   5e-66   
ref|XP_009460451.1|  PREDICTED: cell differentiation protein RCD1...    227   5e-66   
ref|XP_010213679.1|  PREDICTED: cell differentiation protein RCD1...    227   5e-66   
ref|XP_001417448.1|  predicted protein                                  225   6e-66   Ostreococcus lucimarinus CCE9901
ref|XP_005021171.1|  PREDICTED: cell differentiation protein RCD1...    227   6e-66   
ref|XP_003664216.1|  hypothetical protein MYCTH_2306791                 228   6e-66   
gb|EPS69136.1|  hypothetical protein M569_05631                         224   7e-66   
gb|KFM65935.1|  Cell differentiation protein RCD1-like protein          226   7e-66   
ref|XP_007915381.1|  putative cell differentiation protein rcd1 p...    227   7e-66   
ref|XP_006112742.1|  PREDICTED: cell differentiation protein RCD1...    227   7e-66   
ref|XP_008455455.1|  PREDICTED: cell differentiation protein rcd1...    225   7e-66   
gb|EQL03029.1|  Cell differentiation, Rcd1-like protein                 228   8e-66   
ref|XP_007738253.1|  hypothetical protein A1O3_09972                    228   8e-66   
ref|XP_009644010.1|  PREDICTED: cell differentiation protein RCD1...    227   8e-66   
ref|XP_003046802.1|  predicted protein                                  228   8e-66   
ref|XP_004617243.1|  PREDICTED: cell differentiation protein RCD1...    227   9e-66   
ref|XP_003718384.1|  cell differentiation protein rcd1                  227   1e-65   
emb|CCA25373.1|  cell differentiation protein rcd1 putative             225   1e-65   
ref|XP_006967295.1|  predicted protein                                  227   1e-65   
ref|XP_009649666.1|  cell differentiation protein rcd1                  227   1e-65   
ref|XP_009181327.1|  PREDICTED: cell differentiation protein RCD1...    226   1e-65   
emb|CEJ94191.1|  Putative Cell differentiation protein rcd1             227   1e-65   
gb|EMS61289.1|  hypothetical protein TRIUR3_07682                       231   1e-65   
gb|EPQ18431.1|  Cell differentiation protein RCD1 like protein          227   1e-65   
ref|XP_010536028.1|  PREDICTED: cell differentiation protein RCD1...    226   1e-65   
dbj|BAE54907.1|  unnamed protein product                                224   2e-65   
ref|XP_004226444.2|  PREDICTED: cell differentiation protein RCD1...    224   2e-65   
ref|XP_008288245.1|  PREDICTED: cell differentiation protein RCD1...    224   2e-65   
ref|XP_003966448.1|  PREDICTED: cell differentiation protein RCD1...    224   2e-65   
ref|XP_009121818.1|  PREDICTED: cell differentiation protein RCD1...    224   2e-65   
ref|XP_006364168.1|  PREDICTED: cell differentiation protein RCD1...    222   2e-65   
ref|XP_010889326.1|  PREDICTED: cell differentiation protein RCD1...    224   2e-65   
emb|CDQ75509.1|  unnamed protein product                                224   2e-65   
gb|EJW84331.1|  hypothetical protein WUBG_04757                         224   2e-65   
ref|XP_007086187.1|  PREDICTED: cell differentiation protein RCD1...    226   2e-65   
ref|XP_006636691.1|  PREDICTED: cell differentiation protein RCD1...    224   2e-65   
emb|CDY68090.1|  BnaAnng26140D                                          224   2e-65   
ref|XP_008596710.1|  cell differentiation family protein                227   2e-65   
gb|EHK24991.1|  hypothetical protein TRIVIDRAFT_31342                   227   3e-65   
ref|XP_008776172.1|  PREDICTED: cell differentiation protein RCD1...    223   3e-65   
ref|XP_009913171.1|  PREDICTED: cell differentiation protein RCD1...    226   3e-65   
ref|XP_011131291.1|  cell differentiation protein rcd1                  224   3e-65   
ref|XP_010878123.1|  PREDICTED: cell differentiation protein RCD1...    224   3e-65   
gb|KGQ09726.1|  Cell differentiation protein rcd1                       227   3e-65   
emb|CAH91806.1|  hypothetical protein                                   224   3e-65   
ref|XP_960336.1|  cell differentiation protein rcd1                     226   3e-65   
ref|NP_001167262.1|  Cell differentiation protein RCD1 homolog          224   3e-65   
ref|XP_003347777.1|  hypothetical protein SMAC_03875                    226   3e-65   
gb|ERT00344.1|  cell differentiation protein rcd1                       226   3e-65   
ref|XP_003561885.1|  PREDICTED: cell differentiation protein RCD1...    224   4e-65   
gb|KHN99063.1|  cell differentiation protein rcd1                       226   4e-65   
emb|CDJ94309.1|  Cell differentiation domain containing protein         224   4e-65   
gb|ETS00360.1|  cell differentiation family protein                     227   4e-65   
gb|EHK48257.1|  hypothetical protein TRIATDRAFT_167303                  227   4e-65   
ref|XP_002191765.2|  PREDICTED: cell differentiation protein RCD1...    227   4e-65   
ref|XP_007796664.1|  putative cell differentiation protein rcd1 p...    226   4e-65   
gb|KFY23831.1|  hypothetical protein V491_02396                         225   4e-65   
ref|XP_002182375.1|  predicted protein                                  224   5e-65   
ref|XP_002151518.1|  cell differentiation protein (Rcd1), putative      226   5e-65   
gb|ELR09764.1|  CCR4-NOT transcription complex subunit 9                225   5e-65   
gb|KFY32180.1|  hypothetical protein V493_00432                         225   5e-65   
ref|XP_002365112.1|  cell differentiation protein Rcd1, putative        225   5e-65   
ref|XP_002341683.1|  cell differentiation protein (Rcd1), putative      226   5e-65   
ref|XP_008327209.1|  PREDICTED: cell differentiation protein RCD1...    223   5e-65   
gb|KFY55774.1|  hypothetical protein V497_06745                         225   6e-65   
gb|KIH91235.1|  CCR4-NOT transcription complex subunit 9                226   6e-65   
gb|KFX92641.1|  hypothetical protein V490_05278                         225   6e-65   
gb|EYC20396.1|  hypothetical protein Y032_0022g603                      223   6e-65   
ref|XP_005719411.1|  cell differentiation protein rcd1                  223   6e-65   
gb|KEZ43004.1|  putative cell differentiation protein rcd1 protein      225   6e-65   
gb|KFY53156.1|  hypothetical protein V496_07866                         225   6e-65   
ref|XP_725544.1|  hypothetical protein                                  232   6e-65   
ref|XP_003458411.1|  PREDICTED: cell differentiation protein RCD1...    223   6e-65   
gb|ETB56899.1|  hypothetical protein YYC_05262                          232   7e-65   
ref|XP_008300350.1|  PREDICTED: cell differentiation protein RCD1...    223   7e-65   
ref|XP_677861.1|  cell differentiation protein                          230   7e-65   
gb|KFY72455.1|  hypothetical protein V499_07414                         225   7e-65   
gb|ABM47320.1|  required-for-cell-differentiation 1 protein             223   7e-65   
ref|XP_007343858.1|  Rcd1-domain-containing protein                     224   7e-65   
ref|XP_004081716.1|  PREDICTED: cell differentiation protein RCD1...    223   8e-65   
gb|EYC20395.1|  hypothetical protein Y032_0022g603                      223   8e-65   
ref|XP_008883109.1|  hypothetical protein HHA_258980                    225   8e-65   
ref|XP_006665570.1|  cell differentiation protein rcd1                  226   8e-65   
ref|XP_320477.4|  AGAP012050-PA                                         223   9e-65   
ref|XP_004981524.1|  PREDICTED: cell differentiation protein RCD1...    223   9e-65   
emb|CCF37081.1|  cell differentiation family protein                    225   9e-65   
ref|XP_008624515.1|  hypothetical protein YYE_02639                     231   9e-65   
ref|XP_002955778.1|  hypothetical protein VOLCADRAFT_109328             223   1e-64   
gb|EPZ34005.1|  Cell differentiation protein rcd1                       222   1e-64   
emb|CAK43879.1|  unnamed protein product                                222   1e-64   
gb|EUD73185.1|  hypothetical protein YYG_01220                          231   1e-64   
emb|CDR13749.1|  cell differentiation protein, putative                 231   1e-64   
ref|XP_009216336.1|  cell differentiation protein rcd1                  224   1e-64   
gb|EFX69422.1|  hypothetical protein DAPPUDRAFT_300941                  223   1e-64   
gb|EFQ33473.1|  cell differentiation family protein                     224   1e-64   
gb|EYC20394.1|  hypothetical protein Y032_0022g603                      223   1e-64   
gb|ETN63258.1|  cell differentiation protein rcd1                       222   1e-64   
ref|NP_999925.1|  cell differentiation protein RCD1 homolog             222   1e-64   
ref|XP_007228993.1|  PREDICTED: cell differentiation protein RCD1...    222   1e-64   
gb|KDN69514.1|  putative cell differentiation family protein            224   1e-64   
emb|CDM36767.1|  Cell differentiation protein RCD1 homolog              225   1e-64   
ref|XP_005834151.1|  hypothetical protein GUITHDRAFT_69778              222   2e-64   
ref|XP_008721507.1|  cell differentiation protein rcd1                  224   2e-64   
ref|XP_005103744.1|  PREDICTED: cell differentiation protein RCD1...    222   2e-64   
ref|XP_751592.1|  cell differentiation protein (Rcd1)                   225   2e-64   
gb|EDP50598.1|  cell differentiation protein (Rcd1), putative           225   2e-64   
gb|EMT19024.1|  hypothetical protein F775_29476                         223   2e-64   
gb|KEQ59851.1|  Rcd1-like protein                                       222   2e-64   
gb|KIN02187.1|  hypothetical protein OIDMADRAFT_120673                  224   2e-64   
gb|EKC27371.1|  Cell differentiation protein RCD1-like protein          222   3e-64   
gb|EPE03729.1|  cell differentiation protein rcd1                       225   3e-64   
ref|XP_004347454.1|  cell differentiation protein Rcd1                  221   3e-64   
ref|XP_001212303.1|  cell differentiation protein rcd1                  224   3e-64   
ref|XP_001266797.1|  cell differentiation protein (Rcd1), putative      224   3e-64   
dbj|GAM41455.1|  RNA-binding protein                                    224   4e-64   
gb|EIT72726.1|  protein involved in cell differentiation/sexual d...    224   4e-64   
emb|CDS48134.1|  cell differentiation protein, putative                 231   4e-64   
ref|XP_002383160.1|  cell differentiation protein (Rcd1), putative      224   4e-64   
ref|XP_001816909.2|  cell differentiation protein RCD1                  224   4e-64   
ref|XP_001556451.1|  hypothetical protein BC1G_05220                    223   4e-64   
ref|XP_001272092.1|  cell differentiation protein (Rcd1), putative      224   4e-64   
ref|XP_007596613.1|  cell differentiation family protein                224   5e-64   
ref|XP_003882994.1|  hypothetical protein NCLIV_027510                  223   5e-64   
ref|XP_001613248.1|  cell differentiation protein rcd1                  229   5e-64   
emb|CEF97480.1|  Rcd1                                                   220   5e-64   
emb|CDS13557.1|  Putative Rcd1-domain-containing protein                224   6e-64   
gb|EWM30584.1|  Cell differentiation, Rcd1-like protein                 221   6e-64   
gb|ETW28109.1|  hypothetical protein PFFCH_04460                        229   6e-64   
ref|XP_002425706.1|  Cell differentiation protein rcd1, putative        221   6e-64   
gb|KHN74337.1|  Cell differentiation protein RCD1 -like protein         222   6e-64   
emb|CDH50345.1|  cell differentiation protein                           224   7e-64   
ref|XP_007293878.1|  cell differentiation family protein                223   7e-64   
ref|NP_001187747.1|  cell differentiation protein rcd1-like protein     220   8e-64   
ref|XP_661273.1|  hypothetical protein AN3669.2                         223   8e-64   
ref|XP_002139458.1|  cell differentiation protein Rcd1                  221   8e-64   
gb|KDD74956.1|  Rcd1-like cell differentiation protein                  219   8e-64   
gb|KEQ70209.1|  Rcd1-like protein                                       220   8e-64   
gb|KIJ20768.1|  hypothetical protein PAXINDRAFT_66799                   219   9e-64   
ref|XP_006867926.1|  PREDICTED: cell differentiation protein RCD1...    221   9e-64   
ref|XP_009412971.1|  PREDICTED: cell differentiation protein RCD1...    222   9e-64   
ref|XP_011121533.1|  hypothetical protein AOL_s00076g679                223   9e-64   
gb|ESZ98916.1|  cell differentiation protein rcd1                       222   1e-63   
gb|KHJ32772.1|  putative cell differentiation protein rcd1              222   1e-63   
gb|EZA62127.1|  Cell differentiation protein RCD1-like protein          220   1e-63   
gb|ELU10325.1|  hypothetical protein CAPTEDRAFT_224769                  220   1e-63   
gb|EPQ63556.1|  hypothetical protein BGT96224_A21134                    222   1e-63   
gb|KEQ87680.1|  Rcd1-like protein                                       220   1e-63   
gb|KER00356.1|  hypothetical protein AUEXF2481DRAFT_60939               220   1e-63   
ref|XP_974015.1|  PREDICTED: cell differentiation protein RCD1 ho...    220   1e-63   
ref|XP_007580662.1|  putative cell differentiation protein rcd1 p...    222   1e-63   
gb|EPY79400.1|  hypothetical protein CB1_000931039                      228   1e-63   
gb|EMC84208.1|  Cell differentiation protein RCD1 like protein          219   1e-63   
gb|EKG19485.1|  Cell differentiation Rcd1-like protein                  222   1e-63   
ref|XP_002010750.1|  GI21711                                            220   2e-63   
gb|ETW38210.1|  hypothetical protein PFTANZ_01069                       229   2e-63   
gb|KIK41224.1|  hypothetical protein CY34DRAFT_806324                   221   2e-63   
gb|ETW53569.1|  hypothetical protein PFUGPA_04585                       229   2e-63   
dbj|GAD95669.1|  cell differentiation protein (Rcd1), putative          222   2e-63   
gb|EPB90634.1|  hypothetical protein HMPREF1544_02544                   222   2e-63   
gb|EKV04782.1|  Cell differentiation protein (Rcd1), putative           222   2e-63   
ref|XP_001351634.1|  cell differentiation protein rcd1, putative        229   2e-63   
gb|ETW50870.1|  hypothetical protein PFMALIP_01028                      229   2e-63   
gb|EUR77377.1|  hypothetical protein PFBG_00953                         229   2e-63   
gb|ETW44493.1|  hypothetical protein PFNF135_01060                      229   2e-63   
gb|EGE08547.1|  cell differentiation protein rcd1                       223   2e-63   
gb|ETW20064.1|  hypothetical protein PFFVO_00964                        229   2e-63   
gb|EUT90565.1|  hypothetical protein PFAG_00921                         229   2e-63   
ref|XP_001931083.1|  cell differentiation protein rcd1                  220   2e-63   
gb|ERZ94846.1|  hypothetical protein GLOINDRAFT_341543                  221   2e-63   
gb|EZG10691.1|  cell differentiation protein rcd1                       222   2e-63   
ref|XP_003231734.1|  cell differentiation protein rcd1                  222   2e-63   
gb|EGD99872.1|  cell differentiation protein rcd1                       222   2e-63   
dbj|GAA83673.1|  cell differentiation protein                           222   2e-63   
gb|KGO37977.1|  hypothetical protein PEXP_079930                        222   2e-63   
emb|CCE30382.1|  probable rcd1 protein involved in sexual develop...    223   2e-63   
ref|XP_001389206.2|  cell differentiation protein RCD1                  222   2e-63   
ref|XP_003174446.1|  cell differentiation protein rcd1                  222   3e-63   
ref|XP_007841055.1|  Cell differentiation protein rcd1                  221   3e-63   
gb|EFW46749.2|  cell differentiation protein Rcd1                       221   3e-63   
gb|KEF52773.1|  hypothetical protein A1O9_11190                         222   3e-63   
gb|KGO78564.1|  hypothetical protein PITC_067730                        222   3e-63   
gb|EPS33539.1|  hypothetical protein PDE_08501                          222   3e-63   
emb|CDO62958.1|  cell differentiation protein rcd1, putative            228   3e-63   
gb|EMS61593.1|  hypothetical protein TRIUR3_03366                       218   3e-63   
ref|XP_504943.1|  YALI0F03344p                                          218   3e-63   
gb|KIJ55100.1|  hypothetical protein M422DRAFT_23751                    220   4e-63   
ref|XP_001625688.1|  predicted protein                                  219   4e-63   
gb|EIE78788.1|  cell differentiation protein rcd1                       221   4e-63   
ref|XP_002848520.1|  cell differentiation protein rcd1                  222   4e-63   
gb|EWM30583.1|  Cell differentiation, Rcd1-like protein                 220   4e-63   
ref|XP_011136580.1|  PREDICTED: cell differentiation protein RCD1...    219   4e-63   
ref|XP_011187275.1|  PREDICTED: cell differentiation protein RCD1...    218   4e-63   
ref|XP_003304565.1|  hypothetical protein PTT_17203                     221   4e-63   
ref|XP_001846184.1|  cell differentiation protein rcd1                  218   5e-63   
ref|XP_004525050.1|  PREDICTED: cell differentiation protein RCD1...    218   5e-63   
ref|XP_007844160.1|  cell differentiation protein rcd1                  219   6e-63   
gb|KIK80890.1|  hypothetical protein PAXRUDRAFT_833258                  219   6e-63   
ref|XP_002058288.1|  GJ15574                                            218   6e-63   
ref|XP_001652289.1|  hypothetical protein AaeL_AAEL006867               218   6e-63   
ref|XP_004525048.1|  PREDICTED: cell differentiation protein RCD1...    218   6e-63   
ref|XP_011109186.1|  hypothetical protein H072_3203                     221   6e-63   
gb|EWM30585.1|  Cell differentiation, Rcd1-like protein                 216   6e-63   
gb|KFH71029.1|  hypothetical protein MVEG_03875                         221   7e-63   
ref|XP_623701.2|  PREDICTED: cell differentiation protein RCD1 ho...    218   7e-63   
ref|XP_002100998.1|  GE15860                                            218   7e-63   
ref|XP_002564586.1|  Pc22g05530                                         220   8e-63   
ref|XP_008083077.1|  ARM repeat-containing protein                      219   8e-63   
ref|XP_001355498.1|  GA12828                                            218   8e-63   
gb|ETE60664.1|  Cell differentiation protein RCD1-like protein          218   8e-63   
ref|XP_008030432.1|  hypothetical protein SETTUDRAFT_181354             220   9e-63   
ref|XP_001977801.1|  GG19241                                            218   9e-63   
ref|XP_008547566.1|  PREDICTED: cell differentiation protein RCD1...    218   1e-62   
ref|XP_001797303.1|  hypothetical protein SNOG_06943                    219   1e-62   
gb|KDQ19601.1|  hypothetical protein BOTBODRAFT_28170                   218   1e-62   
ref|XP_002259740.1|  cell differentiation protein rcd1                  229   1e-62   
gb|EFW23214.1|  cell differentiation protein Rcd1                       220   1e-62   
ref|XP_003070206.1|  Cell differentiation protein rcd1, putative        220   1e-62   
ref|XP_001243157.1|  conserved hypothetical protein                     220   1e-62   
dbj|BAM19486.1|  required for cell differentiation 1 ortholog           218   1e-62   
ref|XP_003399915.1|  PREDICTED: cell differentiation protein RCD1...    218   1e-62   
ref|XP_009046098.1|  hypothetical protein LOTGIDRAFT_205068             218   1e-62   
ref|XP_006288291.1|  hypothetical protein CARUB_v10001534mg             217   1e-62   
ref|XP_001963466.1|  GF20275                                            217   1e-62   
gb|KHG06328.1|  Cell differentiation RCD1                               217   1e-62   
ref|XP_007725688.1|  hypothetical protein A1O1_06620                    220   2e-62   
gb|KHN11902.1|  Cell differentiation protein RCD1 like                  216   2e-62   
ref|XP_002794535.1|  cell differentiation protein rcd1                  221   2e-62   
gb|KFG85771.1|  cell differentiation protein rcd1                       220   2e-62   
ref|XP_001388443.1|  cell differentiation protein rcd1                  219   2e-62   
gb|KIJ61982.1|  hypothetical protein HYDPIDRAFT_115124                  218   2e-62   
gb|EEH17974.1|  cell differentiation protein rcd1                       220   2e-62   
ref|XP_002067353.1|  GK16372                                            217   2e-62   
ref|XP_001992536.1|  GH24151                                            217   2e-62   
gb|KDQ26955.1|  hypothetical protein PLEOSDRAFT_1089926                 218   2e-62   
ref|XP_667107.1|  cell differentiation protein rcd1                     220   2e-62   
ref|XP_010758211.1|  cell differentiation protein rcd1                  220   2e-62   
ref|XP_004663725.1|  PREDICTED: cell differentiation protein RCD1...    219   2e-62   
gb|KDB15339.1|  cell differentiation protein rcd1                       219   3e-62   
gb|EER39681.1|  cell differentiation protein rcd1                       220   3e-62   
gb|EFN62265.1|  Cell differentiation protein RCD1-like protein          216   3e-62   
gb|EEH08200.1|  cell differentiation protein rcd1                       220   3e-62   
gb|EGC43275.1|  cell differentiation protein                            220   3e-62   
ref|XP_002039444.1|  GM22976                                            216   3e-62   



>ref|XP_009781146.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X2 [Nicotiana sylvestris]
Length=312

 Score =   310 bits (795),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 164/276 (59%), Positives = 214/276 (78%), Gaps = 8/276 (3%)
 Frame = -2

Query  1153  SATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLS  974
             SAT  +L+ +LH+ NLREE +  L KKR++C ELP+LLWN+FN V+ILLQEVI++Y KLS
Sbjct  40    SATPKQLVLLLHDVNLREEVINQLTKKRDTCTELPLLLWNTFNAVFILLQEVIAVYPKLS  99

Query  973   PLRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLE---PSVNEKPLEFL  803
                I+ KESTRVCNALAL QCM  H +TR  L++AKIP Y YPFL+    + N+KPLEF+
Sbjct  100   TSMISIKESTRVCNALALFQCMGNHQETRRELIKAKIPFYFYPFLKTNGKNGNDKPLEFI  159

Query  802   RLTSLGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQ  623
             RLTSLGVIG+L K +DP   E+++F LETE+ PLCL C+DLGDEL++ VATLIVMKIL+Q
Sbjct  160   RLTSLGVIGSLTKFDDPYGGEVLYFFLETELVPLCLHCMDLGDELSRKVATLIVMKILMQ  219

Query  622   EEGLKYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAME  443
             EEGL YCCALAERF+S+VQVL R+VE+L + PC+ LLRYV++ YL LS++  P      +
Sbjct  220   EEGLSYCCALAERFYSIVQVLHRVVEKLSQKPCILLLRYVIQSYLCLSQVSRP-----SD  274

Query  442   TFRRCLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
              FR  +P +L D  F+++L DDP+T+ MLQQ +L+I
Sbjct  275   AFRSQIPCQLFDNTFMDMLRDDPETSTMLQQLYLHI  310



>ref|XP_009597206.1| PREDICTED: cell differentiation protein rcd1-like isoform X2 
[Nicotiana tomentosiformis]
Length=308

 Score =   310 bits (794),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 167/282 (59%), Positives = 213/282 (76%), Gaps = 9/282 (3%)
 Frame = -2

Query  1153  SATLDELLHMLHNPNLREEAMELLN----KKRESCAELPILLWNSFNTVYILLQEVISLY  986
             +A+ ++L+ +LH+ NLRE  +  LN    +KRE C++L +LLWNSFNTVY+LLQEV+++Y
Sbjct  30    TASPEQLIALLHDSNLREAVLSRLNIVIKEKREMCSDLALLLWNSFNTVYLLLQEVLAVY  89

Query  985   KKLSPLRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEF  806
              KLS   +T KESTRVC+AL L+QCMA+HP+TR GLV+A IP YLYPFL  S NEKPLEF
Sbjct  90    PKLSTSTLTMKESTRVCDALTLLQCMASHPETRKGLVKANIPFYLYPFLRASANEKPLEF  149

Query  805   LRLTSLGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILV  626
             LRL+SLGVIG+L K +DP  PEI++F LET++FPLCLRC+D GDEL++ VATLIVMKIL+
Sbjct  150   LRLSSLGVIGSLAKFDDPYGPEILNFFLETQLFPLCLRCMDQGDELSRKVATLIVMKILM  209

Query  625   QEEGLKYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAM  446
             QEEGL Y CA  ERF +VVQ L RLVE++   PCL+LL+YVV+CYL LS++     S   
Sbjct  210   QEEGLDYSCAFTERFLAVVQALSRLVEKISVNPCLQLLKYVVQCYLSLSQV-----SRVC  264

Query  445   ETFRRCLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTSSS  320
             +  R   PP+L D  F  +L +DP T  MLQQ F NIT+  S
Sbjct  265   DVLRYKFPPQLIDNTFHIILREDPDTLNMLQQIFFNITSRGS  306



>ref|XP_009784510.1| PREDICTED: cell differentiation protein rcd1-like [Nicotiana 
sylvestris]
Length=308

 Score =   309 bits (791),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 167/282 (59%), Positives = 213/282 (76%), Gaps = 9/282 (3%)
 Frame = -2

Query  1153  SATLDELLHMLHNPNLREEAMELLN----KKRESCAELPILLWNSFNTVYILLQEVISLY  986
             +A+ ++L+ +L + NLRE  +  LN    +KRE C++L +LLWNSFNTVYILLQEV+++Y
Sbjct  30    TASPEQLIALLRDSNLREAVLSRLNIVIKQKREMCSDLALLLWNSFNTVYILLQEVLAVY  89

Query  985   KKLSPLRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEF  806
              KLS   +T KESTRVC+AL L+QCMA+HP+TR GLV+A IP YLYPFL  S NEKPLEF
Sbjct  90    PKLSTSTLTMKESTRVCDALTLLQCMASHPETRKGLVKANIPFYLYPFLRASANEKPLEF  149

Query  805   LRLTSLGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILV  626
             +RL+SLG+IG+L K +DP  PEI++F LET++FPLCLRC+D GDEL++ VATLIVMKIL+
Sbjct  150   VRLSSLGLIGSLAKFDDPYGPEILNFFLETQLFPLCLRCMDQGDELSRKVATLIVMKILM  209

Query  625   QEEGLKYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAM  446
             QEEGL YCCA  ERF +VVQ L RLVE++   PCL+LL+YVV+CYL LS++     S   
Sbjct  210   QEEGLDYCCAFTERFLAVVQTLSRLVEKISVNPCLQLLKYVVQCYLSLSQV-----SRVC  264

Query  445   ETFRRCLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTSSS  320
             +  R   PP+L D  F  VL +DP T  MLQQ F NIT+  S
Sbjct  265   DVLRYNFPPQLIDNTFHIVLREDPYTLNMLQQVFFNITSRGS  306



>ref|XP_009588346.1| PREDICTED: cell differentiation protein RCD1 homolog [Nicotiana 
tomentosiformis]
Length=316

 Score =   307 bits (786),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 163/276 (59%), Positives = 213/276 (77%), Gaps = 5/276 (2%)
 Frame = -2

Query  1153  SATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLS  974
             SAT  +L+ +LH+ NLREE +  L KKRE+C ELP+LLWN+FN V+ILLQEVI++Y KLS
Sbjct  41    SATPKQLVLLLHDVNLREEVINQLTKKRETCTELPLLLWNTFNAVFILLQEVIAVYPKLS  100

Query  973   PLRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLE---PSVNEKPLEFL  803
                ++ KESTRVCNALAL QCM  H +TR  L++AKIP Y YPFL+    + N+KPLEF+
Sbjct  101   TSMVSIKESTRVCNALALFQCMGNHQETRRELIKAKIPFYFYPFLKTNGKNGNDKPLEFI  160

Query  802   RLTSLGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQ  623
             RLTSLGVIG+L K +DP   EI++F LETE+ PLCL C+DLGDEL++ VATLIVMKIL+Q
Sbjct  161   RLTSLGVIGSLTKFDDPYGGEILYFFLETELVPLCLHCMDLGDELSRKVATLIVMKILMQ  220

Query  622   EEGLKYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAME  443
             EEGL YCCALAERF+S+VQVL R+VE+L + PC+ LLRYV++ YL LS++   +R    +
Sbjct  221   EEGLSYCCALAERFYSIVQVLHRVVEKLSQKPCILLLRYVIQSYLCLSQVSRFVR--PSD  278

Query  442   TFRRCLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
              FR  +P +L D  F+++L DD +T+ MLQQ ++ I
Sbjct  279   AFRSQIPCQLFDNTFMDMLRDDTETSTMLQQLYVQI  314



>ref|XP_009781145.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Nicotiana sylvestris]
Length=315

 Score =   306 bits (785),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 163/276 (59%), Positives = 214/276 (78%), Gaps = 5/276 (2%)
 Frame = -2

Query  1153  SATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLS  974
             SAT  +L+ +LH+ NLREE +  L KKR++C ELP+LLWN+FN V+ILLQEVI++Y KLS
Sbjct  40    SATPKQLVLLLHDVNLREEVINQLTKKRDTCTELPLLLWNTFNAVFILLQEVIAVYPKLS  99

Query  973   PLRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLE---PSVNEKPLEFL  803
                I+ KESTRVCNALAL QCM  H +TR  L++AKIP Y YPFL+    + N+KPLEF+
Sbjct  100   TSMISIKESTRVCNALALFQCMGNHQETRRELIKAKIPFYFYPFLKTNGKNGNDKPLEFI  159

Query  802   RLTSLGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQ  623
             RLTSLGVIG+L K +DP   E+++F LETE+ PLCL C+DLGDEL++ VATLIVMKIL+Q
Sbjct  160   RLTSLGVIGSLTKFDDPYGGEVLYFFLETELVPLCLHCMDLGDELSRKVATLIVMKILMQ  219

Query  622   EEGLKYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAME  443
             EEGL YCCALAERF+S+VQVL R+VE+L + PC+ LLRYV++ YL LS++   +     +
Sbjct  220   EEGLSYCCALAERFYSIVQVLHRVVEKLSQKPCILLLRYVIQSYLCLSQVSRFVG--PSD  277

Query  442   TFRRCLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
              FR  +P +L D  F+++L DDP+T+ MLQQ +L+I
Sbjct  278   AFRSQIPCQLFDNTFMDMLRDDPETSTMLQQLYLHI  313



>ref|XP_009597205.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Nicotiana tomentosiformis]
Length=348

 Score =   290 bits (742),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 167/322 (52%), Positives = 213/322 (66%), Gaps = 49/322 (15%)
 Frame = -2

Query  1153  SATLDELLHMLHNPNLREEAMELLN----KKRESCAELPILLWNSFNTVYILLQEVISLY  986
             +A+ ++L+ +LH+ NLRE  +  LN    +KRE C++L +LLWNSFNTVY+LLQEV+++Y
Sbjct  30    TASPEQLIALLHDSNLREAVLSRLNIVIKEKREMCSDLALLLWNSFNTVYLLLQEVLAVY  89

Query  985   KKLSPLRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEF  806
              KLS   +T KESTRVC+AL L+QCMA+HP+TR GLV+A IP YLYPFL  S NEKPLEF
Sbjct  90    PKLSTSTLTMKESTRVCDALTLLQCMASHPETRKGLVKANIPFYLYPFLRASANEKPLEF  149

Query  805   LRLTSLGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILV  626
             LRL+SLGVIG+L K +DP  PEI++F LET++FPLCLRC+D GDEL++ VATLIVMKIL+
Sbjct  150   LRLSSLGVIGSLAKFDDPYGPEILNFFLETQLFPLCLRCMDQGDELSRKVATLIVMKILM  209

Query  625   QEEGLKYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAM  446
             QEEGL Y CA  ERF +VVQ L RLVE++   PCL+LL+YVV+CYL LS++     S   
Sbjct  210   QEEGLDYSCAFTERFLAVVQALSRLVEKISVNPCLQLLKYVVQCYLSLSQV-----SRVC  264

Query  445   ETFRRCLPPKLTDERFLNV----------------------------------------L  386
             +  R   PP+L D  F  +                                        L
Sbjct  265   DVLRYKFPPQLIDNTFHIILRVSPSASFLHTCKLLRSLQLMLHLHCLKLLPRPHLHNYFL  324

Query  385   HDDPQTARMLQQFFLNITTSSS  320
              +DP T  MLQQ F NIT+  S
Sbjct  325   QEDPDTLNMLQQIFFNITSRGS  346



>ref|XP_010323843.1| PREDICTED: cell differentiation protein rcd1-like [Solanum lycopersicum]
Length=317

 Score =   279 bits (714),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 154/271 (57%), Positives = 197/271 (73%), Gaps = 2/271 (1%)
 Frame = -2

Query  1147  TLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPL  968
             T ++L+ +L + NLR + M  L K R++C  L  LLWN+FN VY+LL EVIS+Y KLSP 
Sbjct  41    TPNQLVVLLLDSNLRGDVMYQLIKMRDTCEYLAPLLWNTFNAVYMLLLEVISVYWKLSPP  100

Query  967   RITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSL  788
              ++ KESTRVCNALAL Q MA +P+TR  L+ AKIP Y YPFL+PS ++KPLE+LRLTSL
Sbjct  101   TLSMKESTRVCNALALFQVMAKNPETRKELIEAKIPCYFYPFLKPSGDDKPLEYLRLTSL  160

Query  787   GVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLK  608
             GV+GAL K +DP  P+++HF LET+V P CL C+DL DEL+  VATLIVMKIL+QE+G+ 
Sbjct  161   GVLGALAKFDDPYGPKVLHFFLETKVVPSCLECMDLCDELSGKVATLIVMKILMQEKGMS  220

Query  607   YCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRC  428
             YCCA  ERFFS+VQVL R+VE+L E PCL  L YV++C L LSE+   +     E F R 
Sbjct  221   YCCATPERFFSIVQVLYRVVEKLTEKPCLLHLMYVIQCLLSLSEIQKVIG--PSEAFIRQ  278

Query  427   LPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             + PKL D  F ++L DD +TA MLQ    N+
Sbjct  279   VHPKLFDNTFKDILRDDHETAWMLQVLHFNV  309



>ref|XP_002270523.1| PREDICTED: cell differentiation protein RCD1 homolog [Vitis vinifera]
Length=323

 Score =   260 bits (665),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 138/277 (50%), Positives = 198/277 (71%), Gaps = 8/277 (3%)
 Frame = -2

Query  1153  SATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLS  974
             + ++++L+  + NP  RE A+ LL++ R   A+L  LLWNS  T+Y+LLQE+ S Y+ LS
Sbjct  38    ATSVEKLIKDIENPLTREHALFLLSRNRGIRADLAPLLWNSSGTIYLLLQEITSAYRILS  97

Query  973   PLRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLT  794
                +  + +  VCNALAL+QC+A++P+TRM L++A IP YLYPFL     EKP E+LRLT
Sbjct  98    SPELVARATNNVCNALALLQCVASNPNTRMNLIQANIPCYLYPFLGVKNKEKPYEYLRLT  157

Query  793   SLGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEG  614
             SLGVIGALVK+++    EIVHFLL++E+ PLCLRC+++G+EL++TVAT I+ KILVQ+EG
Sbjct  158   SLGVIGALVKVDN---AEIVHFLLQSEIVPLCLRCMEVGNELSKTVATFIIQKILVQDEG  214

Query  613   LKYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFR  434
             L+Y C+ AERFF++ +V+G +V+ L E P  RLL++++ CY+RLS  P      A + F+
Sbjct  215   LRYFCSFAERFFALARVMGTMVDNLVEEPSQRLLKHIIHCYVRLSGCPR-----ACDGFK  269

Query  433   RCLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTSS  323
              CLP +L D   LN++ DDP     L+Q F NI T +
Sbjct  270   ICLPIRLRDAAILNLVRDDPIALEWLRQLFFNIATGN  306



>ref|XP_004515427.1| PREDICTED: cell differentiation protein RCD1 homolog [Cicer arietinum]
Length=324

 Score =   256 bits (655),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 144/272 (53%), Positives = 189/272 (69%), Gaps = 8/272 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L NP LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  LSP
Sbjct  41    ASAEQLVLELSNPELRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYPVLSP  100

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  101   PNLTPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRLTS  160

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  161   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  217

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L E P  RLL++++RCYLRLS+ P      A +  R 
Sbjct  218   DYICTTAERFFAVGRVLGNMVAALAEQPSSRLLKHIIRCYLRLSDNPR-----ACDALRS  272

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             CLP  L D  F + LH+DP T + LQQ   N+
Sbjct  273   CLPDMLRDATFSSCLHEDPTTRKWLQQLLHNV  304



>ref|XP_009608973.1| PREDICTED: cell differentiation protein RCD1 homolog [Nicotiana 
tomentosiformis]
Length=326

 Score =   256 bits (654),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 146/277 (53%), Positives = 192/277 (69%), Gaps = 10/277 (4%)
 Frame = -2

Query  1156  QSATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKL  977
             QSA  ++L+  L NP+LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  L
Sbjct  39    QSA--EQLVLDLSNPDLRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYPVL  96

Query  976   SPLRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRL  797
             SP  ++  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRL
Sbjct  97    SPPNLSPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRL  156

Query  796   TSLGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEE  617
             TSLGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + 
Sbjct  157   TSLGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDV  213

Query  616   GLKYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETF  437
             GL Y CA A+RFF+V QVLG +V  L E P  RLL++++RCYLRLS+        A +  
Sbjct  214   GLDYICATAQRFFAVAQVLGNMVGALAEQPSSRLLKHIIRCYLRLSD-----NVRACDAL  268

Query  436   RRCLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             R CLP  L D  F + L +DP T R LQQ   N++ S
Sbjct  269   RNCLPDMLRDTTFSSCLREDPTTRRWLQQLIHNVSVS  305



>ref|XP_010244465.1| PREDICTED: cell differentiation protein RCD1 homolog [Nelumbo 
nucifera]
Length=320

 Score =   255 bits (652),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 145/276 (53%), Positives = 190/276 (69%), Gaps = 8/276 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L NP+LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  LSP
Sbjct  36    ASAEQLVLELSNPDLRENALLDLSKKREIFQDLAPLLWNSFGTIAALLQEIVSIYPVLSP  95

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T   S RVCNALAL+QC+A+HPDTR   + A IP YLYPFL  +   +P E+LRLTS
Sbjct  96    PTLTPVASNRVCNALALLQCVASHPDTRTLFLNAHIPLYLYPFLNTTSKTRPFEYLRLTS  155

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  156   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  212

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
             +Y CA AERFF+V +VLG +V  L E P  RLL++++RCYLRLS+ P      A E  R 
Sbjct  213   RYICATAERFFAVGRVLGTMVNSLAEQPSSRLLKHIIRCYLRLSDNP-----RACEALRN  267

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTSS  323
             CLP  L D  F + L +DP T R LQQ   N+   +
Sbjct  268   CLPEMLRDATFSSCLREDPTTKRWLQQLINNVAGGN  303



>ref|XP_009787282.1| PREDICTED: cell differentiation protein RCD1 homolog [Nicotiana 
sylvestris]
Length=317

 Score =   255 bits (652),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 147/277 (53%), Positives = 191/277 (69%), Gaps = 10/277 (4%)
 Frame = -2

Query  1156  QSATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKL  977
             QSA  ++L+  L NP+LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  L
Sbjct  36    QSA--EQLVLELSNPDLRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYPVL  93

Query  976   SPLRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRL  797
             SP  +T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRL
Sbjct  94    SPPNLTPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRL  153

Query  796   TSLGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEE  617
             TSLGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + 
Sbjct  154   TSLGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDV  210

Query  616   GLKYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETF  437
             GL Y C  AERFF+V +VLG +V  L E P  RLL++++RCYLRLS+ P      A +  
Sbjct  211   GLDYICTTAERFFAVGRVLGSMVGALAEQPSSRLLKHIIRCYLRLSDNPR-----ACDAL  265

Query  436   RRCLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             R CLP  L D  F + L +DP T R LQQ   N+  S
Sbjct  266   RNCLPDMLRDATFSSCLREDPTTRRWLQQLIHNVNGS  302



>ref|XP_010252482.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Nelumbo nucifera]
Length=321

 Score =   255 bits (652),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 145/276 (53%), Positives = 190/276 (69%), Gaps = 8/276 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L NP+LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  LSP
Sbjct  37    ASAEQLVLELSNPDLRENALLDLSKKREIFQDLAPLLWNSFGTIAALLQEIVSIYPVLSP  96

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T   S RVCNALAL+QC+A+HPDTR   + A IP YLYPFL  +   +P E+LRLTS
Sbjct  97    PTLTPVASNRVCNALALLQCVASHPDTRTLFLNAHIPLYLYPFLNTTSKTRPFEYLRLTS  156

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  157   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  213

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
             +Y CA AERFF+V +VLG +V  L E P  RLL++++RCYLRLS+ P      A E  R 
Sbjct  214   RYICATAERFFAVGRVLGTMVNSLAEQPSSRLLKHIIRCYLRLSDNP-----RACEALRN  268

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTSS  323
             CLP  L D  F + L +DP T R LQQ   N+   +
Sbjct  269   CLPEMLRDATFSSCLREDPTTKRWLQQLINNVAGGN  304



>ref|XP_002529459.1| Cell differentiation protein rcd1, putative [Ricinus communis]
 gb|EEF32925.1| Cell differentiation protein rcd1, putative [Ricinus communis]
Length=328

 Score =   256 bits (653),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 144/275 (52%), Positives = 189/275 (69%), Gaps = 8/275 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ + L+  L NP+LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  LSP
Sbjct  36    ASAEHLVLDLSNPDLRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYPVLSP  95

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               ++  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  96    PNLSPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRLTS  155

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  156   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  212

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L E P  RLL++++RCYLRLS+ P      A +  R 
Sbjct  213   DYICTTAERFFAVGRVLGNMVAALAEQPSSRLLKHIIRCYLRLSDNPR-----ACDALRS  267

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             CLP  L D  F + L +DP T R LQQ   N+  S
Sbjct  268   CLPDMLRDNTFSSCLREDPTTRRWLQQLLHNVGVS  302



>ref|XP_010103614.1| hypothetical protein L484_023112 [Morus notabilis]
 gb|EXB96391.1| hypothetical protein L484_023112 [Morus notabilis]
Length=380

 Score =   257 bits (656),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 143/275 (52%), Positives = 190/275 (69%), Gaps = 8/275 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L NP+LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  LSP
Sbjct  39    ASAEQLVLDLSNPDLRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYPVLSP  98

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL      +P E+LRLTS
Sbjct  99    PNLTPAQSNRVCNALALLQCVASHPDTRMLFINAHIPLYLYPFLNTGSKSRPFEYLRLTS  158

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK+++    ++++FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  159   LGVIGALVKVDE---SQVINFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDTGL  215

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V    E P  RLL++++RCYLRLS+ P      A +  R 
Sbjct  216   DYICTTAERFFAVGRVLGSMVAAQAEQPSSRLLKHIIRCYLRLSDNPK-----ACDALRS  270

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             CLP  L D  F + LH+DP T R LQQ   N+  S
Sbjct  271   CLPDMLRDSTFSSCLHEDPTTRRWLQQLLHNVGVS  305



>gb|KHN12519.1| Cell differentiation protein RCD1 like [Glycine soja]
Length=285

 Score =   253 bits (647),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 144/272 (53%), Positives = 187/272 (69%), Gaps = 8/272 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L NP LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  LSP
Sbjct  2     ASAEQLVLELSNPELRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYPVLSP  61

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  62    PNLTPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRLTS  121

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  122   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  178

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L E P  RLL++++RCYLRLS+ P      A +  R 
Sbjct  179   DYICTTAERFFAVGRVLGNMVAALAEQPSSRLLKHIIRCYLRLSDNPR-----ACDALRS  233

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             CLP  L D  F   L +DP T R LQQ   N+
Sbjct  234   CLPDMLRDATFSTCLREDPTTRRWLQQLLHNV  265



>ref|XP_003545123.1| PREDICTED: cell differentiation protein RCD1 homolog [Glycine 
max]
Length=313

 Score =   254 bits (650),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 147/273 (54%), Positives = 192/273 (70%), Gaps = 10/273 (4%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+++ L+  L+NP+LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S++  +SP
Sbjct  30    ASVEHLVLQLNNPDLRENALHELSKKRELFQDLAPLLWNSFGTMSALLQEIVSIFPVISP  89

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +STRVCNALAL QC+A+H DTRM  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  90    PNLTPAQSTRVCNALALFQCVASHLDTRMQFLHAHIPLYLYPFLNTTSKSRPFEYLRLTS  149

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    +++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ E GL
Sbjct  150   LGVIGALVKVDD---TKVISFLLSTEIIPLCLRSMEMGSELSKTVATFIVQKILLDEIGL  206

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
             KY C  AERF++V QVLG +VE L E P  RLL++++RCYLRLS+        A +  R 
Sbjct  207   KYICTTAERFYAVAQVLGNMVETLVEQPSSRLLKHIIRCYLRLSD-----NQSACKALRT  261

Query  430   CLPPKLTDERFLNVLHDDPQTARM-LQQFFLNI  335
             CLP  L D  F N L +DP TARM LQQ   NI
Sbjct  262   CLPDMLRDATFSNCLREDP-TARMWLQQLLHNI  293



>ref|XP_009762483.1| PREDICTED: cell differentiation protein RCD1 homolog [Nicotiana 
sylvestris]
Length=326

 Score =   255 bits (651),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 146/275 (53%), Positives = 191/275 (69%), Gaps = 10/275 (4%)
 Frame = -2

Query  1156  QSATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKL  977
             QSA  ++L+  L NP+LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  L
Sbjct  39    QSA--EQLVLDLSNPDLRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYPVL  96

Query  976   SPLRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRL  797
             SP  +T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRL
Sbjct  97    SPPNLTPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRL  156

Query  796   TSLGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEE  617
             TSLGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + 
Sbjct  157   TSLGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDV  213

Query  616   GLKYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETF  437
             GL Y CA AERFF+V +VLG +V  L E P  RLL++++RCYLRLS+        A +  
Sbjct  214   GLDYICATAERFFAVARVLGNMVGALAEQPSSRLLKHIIRCYLRLSD-----NVRACDAL  268

Query  436   RRCLPPKLTDERFLNVLHDDPQTARMLQQFFLNIT  332
             R CLP  L D  F + L +DP T R LQQ   N++
Sbjct  269   RNCLPDMLRDTTFSSCLREDPTTRRWLQQLIHNVS  303



>ref|XP_006475023.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Citrus sinensis]
Length=321

 Score =   254 bits (649),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 144/272 (53%), Positives = 188/272 (69%), Gaps = 8/272 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ + L+  L NP+LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  LSP
Sbjct  38    ASAEHLVLDLSNPDLRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYPVLSP  97

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  98    PNLTPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRLTS  157

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  158   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  214

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L E P  RLL++++RCYLRLS+ P      A +  R 
Sbjct  215   DYICTTAERFFAVGRVLGNMVAALAEQPSSRLLKHIIRCYLRLSDNPR-----ACDALRS  269

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             CLP  L D  F + L +DP T R LQQ   N+
Sbjct  270   CLPDMLRDATFSSCLREDPTTRRWLQQLLHNV  301



>ref|XP_011008643.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Populus euphratica]
Length=320

 Score =   254 bits (649),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 153/308 (50%), Positives = 205/308 (67%), Gaps = 8/308 (3%)
 Frame = -2

Query  1258  MENLPETLCVDptaaapplalsaappgeasssiSQSATLDELLHMLHNPNLREEAMELLN  1079
             M NLP++L ++ T   P  +  AA  G  ++   + A+ + L+  L NP+LRE A+  L+
Sbjct  1     MANLPQSLSMNTTFGGPNASNPAAAAGAPANKDRKMASAEHLVLDLSNPDLRENALLELS  60

Query  1078  KKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKESTRVCNALALIQCMAAH  899
             KKRE   +L  LLWNSF T+  LLQE++S+Y  LSP  ++  +S RVCNALAL+QC+A+H
Sbjct  61    KKRELFQDLAPLLWNSFGTIAALLQEIVSIYPVLSPPNLSPAQSNRVCNALALLQCVASH  120

Query  898   PDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVKIEDPNAPEIVHFLLE  719
             PDTRM  + A IP YLYPFL  +   +P E+LRLTSLGVIGALVK++D    E++ FLL 
Sbjct  121   PDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRLTSLGVIGALVKVDD---TEVISFLLS  177

Query  718   TEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAERFFSVVQVLGRLVERL  539
             TE+ PLCLR +++G EL++TVAT IV KIL+ + GL Y C  AERFF+V +VLG +V  L
Sbjct  178   TEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGLDYICTTAERFFAVGRVLGNMVAAL  237

Query  538   PETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDERFLNVLHDDPQTARM  359
              E P  RLL++++RCYLRLS+ P      A    R CLP  L D  F + L +DP T R 
Sbjct  238   AEQPSSRLLKHIIRCYLRLSDNPR-----ACHALRSCLPDMLRDATFSSCLREDPTTRRW  292

Query  358   LQQFFLNI  335
             LQQ   N+
Sbjct  293   LQQLLHNV  300



>ref|XP_009355707.1| PREDICTED: cell differentiation protein RCD1 homolog [Pyrus x 
bretschneideri]
Length=310

 Score =   254 bits (648),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 145/275 (53%), Positives = 188/275 (68%), Gaps = 8/275 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L NP LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  LSP
Sbjct  27    ASAEQLVLELSNPQLRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYPVLSP  86

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  87    PNLTPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRLTS  146

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  147   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  203

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L + P  RLL++++RCYLRLSE P      A +  R 
Sbjct  204   DYICTTAERFFAVGRVLGTMVASLADQPSSRLLKHIIRCYLRLSENPR-----ACDALRS  258

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             CLP  L D  F   L +DP T R LQQ   N+  S
Sbjct  259   CLPDMLRDATFSVSLREDPTTRRWLQQLLHNVGVS  293



>emb|CDP13803.1| unnamed protein product [Coffea canephora]
Length=322

 Score =   254 bits (649),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 143/269 (53%), Positives = 187/269 (70%), Gaps = 8/269 (3%)
 Frame = -2

Query  1141  DELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRI  962
             ++L+  L NP+LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  LSP  +
Sbjct  43    EQLVLELSNPDLRENALLELSKKREIFQDLAPLLWNSFGTIAALLQEIVSIYPVLSPPNL  102

Query  961   TTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGV  782
             T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRLTSLGV
Sbjct  103   TPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRLTSLGV  162

Query  781   IGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYC  602
             IGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL Y 
Sbjct  163   IGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGLDYI  219

Query  601   CALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLP  422
             C  AERFF+V +VLG +V  L E P  RLL++++RCYLRLS+ P      A +  R CLP
Sbjct  220   CTTAERFFAVGRVLGNMVAALAEQPSSRLLKHIIRCYLRLSDNPR-----ACDALRSCLP  274

Query  421   PKLTDERFLNVLHDDPQTARMLQQFFLNI  335
               L D  F + L +DP T R LQQ   N+
Sbjct  275   DMLRDATFSSCLREDPTTRRWLQQLLHNV  303



>ref|XP_007146510.1| hypothetical protein PHAVU_006G046900g [Phaseolus vulgaris]
 gb|ESW18504.1| hypothetical protein PHAVU_006G046900g [Phaseolus vulgaris]
Length=323

 Score =   254 bits (649),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 144/272 (53%), Positives = 188/272 (69%), Gaps = 8/272 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L NP LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  LSP
Sbjct  40    ASAEQLVLELSNPELRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYPVLSP  99

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  100   PNLTPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRLTS  159

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  160   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  216

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L E P  RLL++++RCYLRLS+ P      A +  R 
Sbjct  217   DYICTTAERFFAVGRVLGNMVAALAEQPSSRLLKHIIRCYLRLSDNPR-----ACDALRS  271

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             CLP  L D  F + L +DP T R LQQ   N+
Sbjct  272   CLPDMLRDATFSSCLREDPTTRRWLQQLLHNV  303



>ref|XP_008389069.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X2 [Malus domestica]
Length=319

 Score =   254 bits (648),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 145/275 (53%), Positives = 188/275 (68%), Gaps = 8/275 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ + L+  L NP+LRE A+  L+KKRE   +L  LLWNSF  +  LLQE++S+Y  LSP
Sbjct  36    ASAEHLVLDLSNPDLRENALLELSKKRELFQDLAPLLWNSFGXIAALLQEIVSIYPVLSP  95

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  96    PNLTPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKARPFEYLRLTS  155

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR ++LG EL++TVAT IV KIL+ + GL
Sbjct  156   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMELGSELSKTVATFIVQKILLDDMGL  212

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L + P  RLL++++RCYLRLS+ P      A +  R 
Sbjct  213   DYICTTAERFFAVGRVLGTMVAALADQPSSRLLKHIIRCYLRLSDNPR-----ACDALRS  267

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             CLP  L D  F N L +DP T R LQQ   N+  S
Sbjct  268   CLPDVLRDASFNNFLCEDPTTRRWLQQLLQNVGVS  302



>ref|XP_010314088.1| PREDICTED: cell differentiation protein RCD1 homolog, partial 
[Solanum lycopersicum]
Length=318

 Score =   253 bits (647),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 147/277 (53%), Positives = 189/277 (68%), Gaps = 10/277 (4%)
 Frame = -2

Query  1156  QSATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKL  977
             QSA  ++L+  L NP+LRE A+  L+KKRE   +L  LLWNSF TV  LLQE++S+Y  L
Sbjct  37    QSA--EQLVLELSNPDLRENALLELSKKRELFQDLAPLLWNSFGTVAALLQEIVSIYPVL  94

Query  976   SPLRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRL  797
             SP  +T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRL
Sbjct  95    SPPNLTPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRL  154

Query  796   TSLGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEE  617
             TSLGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + 
Sbjct  155   TSLGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDV  211

Query  616   GLKYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETF  437
             GL Y C  AERFF+V +VLG +V  L E P  RLL++++RCYLRLS+ P      A +  
Sbjct  212   GLDYICTTAERFFAVGRVLGNMVGALAEQPSSRLLKHIIRCYLRLSDNPR-----ACDAL  266

Query  436   RRCLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             R  LP  L D  F   L DDP T R LQQ   N+  +
Sbjct  267   RNGLPDMLRDNTFSTCLRDDPTTRRWLQQLINNVNGA  303



>ref|XP_003551870.1| PREDICTED: cell differentiation protein RCD1 homolog [Glycine 
max]
Length=325

 Score =   253 bits (647),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 144/272 (53%), Positives = 187/272 (69%), Gaps = 8/272 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L NP LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  LSP
Sbjct  42    ASAEQLVLELSNPELRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYPVLSP  101

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  102   PNLTPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRLTS  161

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  162   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  218

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L E P  RLL++++RCYLRLS+ P      A +  R 
Sbjct  219   DYICTTAERFFAVGRVLGNMVAALAEQPSSRLLKHIIRCYLRLSDNPR-----ACDALRS  273

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             CLP  L D  F   L +DP T R LQQ   N+
Sbjct  274   CLPDMLRDATFSTCLREDPTTRRWLQQLLHNV  305



>ref|XP_003532138.1| PREDICTED: cell differentiation protein RCD1 homolog [Glycine 
max]
 gb|KHM99533.1| Cell differentiation protein RCD1 like [Glycine soja]
Length=325

 Score =   253 bits (647),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 144/272 (53%), Positives = 187/272 (69%), Gaps = 8/272 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L NP LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  LSP
Sbjct  42    ASAEQLVLELSNPELRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYPVLSP  101

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  102   PNLTPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRLTS  161

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  162   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  218

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L E P  RLL++++RCYLRLS+ P      A +  R 
Sbjct  219   DYICTTAERFFAVGRVLGNMVAALAEQPSSRLLKHIIRCYLRLSDNPR-----ACDALRS  273

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             CLP  L D  F   L +DP T R LQQ   N+
Sbjct  274   CLPDMLRDATFSTCLREDPTTRRWLQQLLHNV  305



>ref|XP_008226846.1| PREDICTED: cell differentiation protein RCD1 homolog [Prunus 
mume]
Length=310

 Score =   253 bits (645),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 143/275 (52%), Positives = 188/275 (68%), Gaps = 8/275 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L NP+LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  LSP
Sbjct  27    ASAEQLVLELSNPDLRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYPVLSP  86

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  87    PNLTPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRLTS  146

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  147   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  203

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L E    RLL++++RCYLRLS+      + A +  R 
Sbjct  204   DYICTTAERFFAVGRVLGTMVASLAEQHSSRLLKHIIRCYLRLSD-----NARACDALRS  258

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             CLP  L D  F   L +DP T R LQQ   N+  S
Sbjct  259   CLPEALRDATFSGCLREDPTTRRWLQQLLHNVAVS  293



>gb|KDP39170.1| hypothetical protein JCGZ_00927 [Jatropha curcas]
Length=319

 Score =   253 bits (646),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 143/272 (53%), Positives = 188/272 (69%), Gaps = 8/272 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ + L+  L NP+LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  LSP
Sbjct  36    ASAEHLVLDLSNPDLRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYPVLSP  95

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               ++  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  96    PNLSPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRLTS  155

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  156   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  212

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L E P  RLL++++RCYLRLS+ P      A +  R 
Sbjct  213   DYICTTAERFFAVGRVLGNMVAALAEQPSSRLLKHIIRCYLRLSDNPR-----ACDALRS  267

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             CLP  L D  F + L +DP T R LQQ   N+
Sbjct  268   CLPDMLRDATFSSCLREDPTTRRWLQQLLHNV  299



>ref|XP_007211663.1| hypothetical protein PRUPE_ppa009006mg [Prunus persica]
 gb|EMJ12862.1| hypothetical protein PRUPE_ppa009006mg [Prunus persica]
Length=310

 Score =   253 bits (645),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 143/275 (52%), Positives = 188/275 (68%), Gaps = 8/275 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L NP+LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  LSP
Sbjct  27    ASAEQLVLELSNPDLRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYPVLSP  86

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  87    PNLTPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRLTS  146

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  147   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  203

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L E    RLL++++RCYLRLS+      + A +  R 
Sbjct  204   DYICTTAERFFAVGRVLGTMVASLAEQHSSRLLKHIIRCYLRLSD-----NARACDALRS  258

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             CLP  L D  F   L +DP T R LQQ   N+  S
Sbjct  259   CLPETLRDATFSGCLREDPTTRRWLQQLLHNVAVS  293



>ref|XP_004139793.1| PREDICTED: cell differentiation protein RCD1 homolog [Cucumis 
sativus]
 ref|XP_004165572.1| PREDICTED: cell differentiation protein RCD1 homolog [Cucumis 
sativus]
 ref|XP_008447722.1| PREDICTED: cell differentiation protein RCD1 homolog [Cucumis 
melo]
 gb|KGN44182.1| hypothetical protein Csa_7G214190 [Cucumis sativus]
Length=319

 Score =   253 bits (645),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 144/275 (52%), Positives = 189/275 (69%), Gaps = 8/275 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L NP+LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  LSP
Sbjct  36    ASSEQLVLDLSNPDLRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYPVLSP  95

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+H DTRM  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  96    PNLTPAQSNRVCNALALLQCVASHSDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRLTS  155

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  156   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  212

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L E P  RLL++++RCYLRLS+ P      A +  R 
Sbjct  213   DYICTTAERFFAVGRVLGNMVAALAEQPSSRLLKHIIRCYLRLSDNPK-----ACDALRS  267

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             CLP  L D  F + L +DP T R LQQ   N+  S
Sbjct  268   CLPDMLRDATFNSCLREDPTTRRWLQQLLHNVGMS  302



>ref|XP_011095434.1| PREDICTED: cell differentiation protein RCD1 homolog [Sesamum 
indicum]
Length=314

 Score =   252 bits (644),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 146/274 (53%), Positives = 191/274 (70%), Gaps = 10/274 (4%)
 Frame = -2

Query  1156  QSATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKL  977
             QSA  ++L+  L NP+LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  L
Sbjct  32    QSA--EQLVLDLCNPDLRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYPVL  89

Query  976   SPLRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRL  797
             SP  +T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRL
Sbjct  90    SPPNLTPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRL  149

Query  796   TSLGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEE  617
             TSLGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + 
Sbjct  150   TSLGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDV  206

Query  616   GLKYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETF  437
             GL+Y C  AERFF+V +VLG +V  L E P  RLL++++RCYLRLS+ P      A +  
Sbjct  207   GLEYICTTAERFFAVGRVLGNMVAALAEQPSSRLLKHIIRCYLRLSDNPR-----ACDAL  261

Query  436   RRCLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             R CLP  L D  F + L +DP T R LQQ   N+
Sbjct  262   RSCLPDMLRDATFSSCLREDPTTRRWLQQLLHNV  295



>gb|KEH33873.1| cell differentiation RCD1-like protein [Medicago truncatula]
Length=306

 Score =   252 bits (643),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 142/269 (53%), Positives = 186/269 (69%), Gaps = 8/269 (3%)
 Frame = -2

Query  1141  DELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRI  962
             ++L+  L NP LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  LSP  +
Sbjct  26    EQLVLELSNPELRENALLELSKKREQFQDLAPLLWNSFGTIAALLQEIVSIYPVLSPPNL  85

Query  961   TTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGV  782
             T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRLTSLGV
Sbjct  86    TPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRLTSLGV  145

Query  781   IGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYC  602
             IGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL Y 
Sbjct  146   IGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGLDYI  202

Query  601   CALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLP  422
             C  AERFF+V +VLG +V  L E P  RLL++++RCYLRLS+ P      A +  R CLP
Sbjct  203   CTTAERFFAVGRVLGNMVAALAEQPSSRLLKHIIRCYLRLSDNPR-----ACDALRSCLP  257

Query  421   PKLTDERFLNVLHDDPQTARMLQQFFLNI  335
               L D  F + L +DP T + LQQ   N+
Sbjct  258   DMLRDATFSSCLREDPTTRKWLQQLIHNV  286



>ref|XP_010941545.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Elaeis guineensis]
 ref|XP_010941547.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Elaeis guineensis]
Length=313

 Score =   252 bits (643),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 140/275 (51%), Positives = 192/275 (70%), Gaps = 8/275 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L +P+LRE A+  L+KKRE   +L  LLWNS+ T+  LLQE++S+Y  LSP
Sbjct  31    ASAEQLVLDLLDPHLRENALLDLSKKREIFQDLAPLLWNSYGTIAALLQEIVSIYPYLSP  90

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               ++   S RVCNALAL+QC+A+HPDTR+  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  91    PTLSPGASNRVCNALALLQCVASHPDTRIHFLNAHIPLYLYPFLNTTSKTRPFEYLRLTS  150

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL+TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  151   LGVIGALVKVDD---TEVIGFLLQTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  207

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
             +Y CA A+RF++V QVLG +V  L E P  RLL++++RCY RLSE P      A ++ + 
Sbjct  208   RYICATADRFYAVGQVLGSMVTSLAEQPSTRLLKHIIRCYQRLSEHPR-----ACDSLKN  262

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             CLP  L D  F N L DDP T   LQQ   N++ +
Sbjct  263   CLPDMLKDGTFNNCLRDDPGTREWLQQLQDNVSGA  297



>ref|XP_004144502.1| PREDICTED: cell differentiation protein RCD1 homolog [Cucumis 
sativus]
 gb|KGN43504.1| hypothetical protein Csa_7G041980 [Cucumis sativus]
Length=305

 Score =   251 bits (642),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 133/273 (49%), Positives = 190/273 (70%), Gaps = 8/273 (3%)
 Frame = -2

Query  1153  SATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLS  974
             + ++DEL+  L++   RE A+ LL++ R     L +L+W+SF T++ LL+E++ +Y  LS
Sbjct  27    NVSVDELILALNHARTRERALHLLSQNRSMFDNLAVLIWHSFGTMFTLLKEIMDVYHMLS  86

Query  973   PLRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLT  794
                +T K+STRVCNALAL+QC+A+HP+TR+  ++AKIP YLYPFL  ++ EKP E+LRLT
Sbjct  87    KPDLTEKDSTRVCNALALLQCVASHPETRVPFMKAKIPLYLYPFLNTTIKEKPHEYLRLT  146

Query  793   SLGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEG  614
             SLGVIGALVK++D    E+++FLL+TE+ P CLRC+D+G  L++TVAT IV KIL+ EEG
Sbjct  147   SLGVIGALVKVDD---KEVIYFLLKTEIVPYCLRCMDVGKGLSKTVATFIVQKILMNEEG  203

Query  613   LKYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFR  434
             L+YCC +A+RFF++   L  ++ERL E P  RLL+++ RCYL LSE P     +      
Sbjct  204   LRYCCIIADRFFAITHALETMMERLSEEPSQRLLKHIFRCYLMLSESPRACLGLG-----  258

Query  433   RCLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             R LP  L D  F ++LHDDP      +Q    +
Sbjct  259   RLLPRMLNDSAFTDLLHDDPTVMSSFKQLLRKV  291



>gb|AFK43869.1| unknown [Medicago truncatula]
Length=306

 Score =   251 bits (642),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 142/269 (53%), Positives = 186/269 (69%), Gaps = 8/269 (3%)
 Frame = -2

Query  1141  DELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRI  962
             ++L+  L NP LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  LSP  +
Sbjct  26    EQLVLELSNPELRENALLELSKKREQFQDLAPLLWNSFGTIAALLQEIVSIYPVLSPPNL  85

Query  961   TTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGV  782
             T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRLTSLGV
Sbjct  86    TPAQSNRVCNALALLQCVASHPDTRMLFLNAYIPLYLYPFLNTTSKSRPFEYLRLTSLGV  145

Query  781   IGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYC  602
             IGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL Y 
Sbjct  146   IGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGLDYT  202

Query  601   CALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLP  422
             C  AERFF+V +VLG +V  L E P  RLL++++RCYLRLS+ P      A +  R CLP
Sbjct  203   CTTAERFFAVGRVLGNMVAALAEQPSSRLLKHIIRCYLRLSDNPR-----ACDALRSCLP  257

Query  421   PKLTDERFLNVLHDDPQTARMLQQFFLNI  335
               L D  F + L +DP T + LQQ   N+
Sbjct  258   DMLRDATFSSCLREDPTTRKWLQQLIHNV  286



>ref|XP_011097852.1| PREDICTED: cell differentiation protein RCD1 homolog [Sesamum 
indicum]
Length=320

 Score =   251 bits (642),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 147/274 (54%), Positives = 190/274 (69%), Gaps = 10/274 (4%)
 Frame = -2

Query  1156  QSATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKL  977
             QSA  + L+  L NP+LRE A+  L+KKRE   +L  LLWNSF TV  LLQE++S+Y  L
Sbjct  38    QSA--EHLVLDLCNPDLRENALLELSKKRELFQDLAPLLWNSFGTVAALLQEIVSIYPVL  95

Query  976   SPLRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRL  797
             SP  +T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRL
Sbjct  96    SPPNLTPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRL  155

Query  796   TSLGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEE  617
             TSLGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + 
Sbjct  156   TSLGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDV  212

Query  616   GLKYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETF  437
             GL+Y C  AERFF+V +VLG +V  L E P  RLL++++RCYLRLS+ P      A +  
Sbjct  213   GLEYICTTAERFFAVGRVLGNMVAALAELPSSRLLKHIIRCYLRLSDNPR-----ACDAL  267

Query  436   RRCLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             R CLP  L D  F + L +DP T R LQQ   N+
Sbjct  268   RSCLPDMLRDATFSSCLREDPTTRRWLQQLLHNV  301



>gb|EEC82276.1| hypothetical protein OsI_26499 [Oryza sativa Indica Group]
Length=284

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 143/276 (52%), Positives = 190/276 (69%), Gaps = 8/276 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L +P LRE A+  L+KKRE   +L  LLW+SF TV  LLQE++S+Y  LSP
Sbjct  2     ASAEQLVLDLCDPELRENALLELSKKREIFQDLAPLLWHSFGTVAALLQEIVSIYSALSP  61

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               ++   S RVCNALAL+QC+A+HP+TR+  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  62    PTLSPGASNRVCNALALLQCVASHPETRILFLTAHIPLYLYPFLNTTSKTRPFEYLRLTS  121

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL+TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  122   LGVIGALVKVDD---TEVISFLLQTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  178

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
             +Y CA AERFF+V  VL  +V  L E P  RLL++++RCYLRLS+      S A    + 
Sbjct  179   RYICATAERFFAVGSVLANMVVSLAEQPSTRLLKHIIRCYLRLSD-----NSRACAALQT  233

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTSS  323
             CLP  L D  F N L DDP T R LQQ  LN+T + 
Sbjct  234   CLPDMLKDGTFNNCLRDDPTTRRWLQQLLLNVTGAG  269



>ref|XP_009351738.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X2 [Pyrus x bretschneideri]
Length=319

 Score =   251 bits (641),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 144/275 (52%), Positives = 188/275 (68%), Gaps = 8/275 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ + L+  L NP+LRE A+  L+K RE   +L  +LWNSF T+  LLQE++S+Y  LSP
Sbjct  36    ASAERLVLDLSNPDLRENALLELSKTRELFQDLAPVLWNSFGTIAALLQEIVSIYPVLSP  95

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  S   +P E+LRLTS
Sbjct  96    PNLTPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTSSKARPFEYLRLTS  155

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR ++LG EL++TVAT IV KIL+ + GL
Sbjct  156   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMELGSELSKTVATFIVQKILLDDMGL  212

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L + P  RLL++++RCYLRLS+ P      A +  R 
Sbjct  213   DYICTTAERFFAVGRVLGTMVTALADQPSSRLLKHIIRCYLRLSDNPR-----ACDALRS  267

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             CLP  L +  F N L +DP T R LQQ   N+  S
Sbjct  268   CLPDVLREASFNNFLCEDPTTRRWLQQLLQNVGVS  302



>ref|XP_004170382.1| PREDICTED: cell differentiation protein RCD1 homolog [Cucumis 
sativus]
Length=305

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 133/273 (49%), Positives = 189/273 (69%), Gaps = 8/273 (3%)
 Frame = -2

Query  1153  SATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLS  974
             + ++DEL+  L++   RE A+ LL++ R     L +L+W+SF T++ LL+E++ +Y  LS
Sbjct  27    NVSVDELILALNHARTRERALHLLSQNRSMFDNLAVLIWHSFGTMFTLLKEIMDVYHMLS  86

Query  973   PLRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLT  794
                +T K STRVCNALAL+QC+A+HP+TR+  ++AKIP YLYPFL  ++ EKP E+LRLT
Sbjct  87    KPDLTEKASTRVCNALALLQCVASHPETRVPFMKAKIPLYLYPFLNTTIKEKPHEYLRLT  146

Query  793   SLGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEG  614
             SLGVIGALVK++D    E+++FLL+TE+ P CLRC+D+G  L++TVAT IV KIL+ EEG
Sbjct  147   SLGVIGALVKVDD---KEVIYFLLKTEIVPYCLRCMDVGKGLSKTVATFIVQKILMNEEG  203

Query  613   LKYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFR  434
             L+YCC +A+RFF++   L  ++ERL E P  RLL+++ RCYL LSE P     +      
Sbjct  204   LRYCCIIADRFFAITHALETMMERLSEEPSQRLLKHIFRCYLMLSESPRACLGLG-----  258

Query  433   RCLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             R LP  L D  F ++LHDDP      +Q    +
Sbjct  259   RLLPRMLNDSAFTDLLHDDPTVMSSFKQLLRKV  291



>ref|XP_002298844.1| rcd1-like cell differentiation family protein [Populus trichocarpa]
 ref|XP_011047535.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Populus euphratica]
 ref|XP_011047536.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Populus euphratica]
 gb|EEE83649.1| rcd1-like cell differentiation family protein [Populus trichocarpa]
Length=323

 Score =   251 bits (641),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 142/272 (52%), Positives = 188/272 (69%), Gaps = 8/272 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ + L+  L +P+LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  LSP
Sbjct  39    ASAEHLVLDLSSPDLRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYPVLSP  98

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               ++  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  99    PNLSPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRLTS  158

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  159   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  215

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L E P  RLL++++RCYLRLS+ P      A +  R 
Sbjct  216   DYICTTAERFFAVGRVLGNMVAALAEQPSSRLLKHIIRCYLRLSDNPR-----ACDALRS  270

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             CLP  L D  F + L +DP T R LQQ   N+
Sbjct  271   CLPDMLRDATFSSCLREDPTTRRWLQQLLHNV  302



>ref|XP_007142310.1| hypothetical protein PHAVU_008G269900g [Phaseolus vulgaris]
 gb|ESW14304.1| hypothetical protein PHAVU_008G269900g [Phaseolus vulgaris]
Length=312

 Score =   251 bits (640),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 143/272 (53%), Positives = 187/272 (69%), Gaps = 8/272 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+++ L+  L NP+LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  +SP
Sbjct  29    ASVEHLVLELSNPDLRENALHELSKKRELFQDLAPLLWNSFGTMAALLQEIVSIYPVISP  88

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+H DTRM  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  89    PNLTPAQSNRVCNALALLQCVASHLDTRMQFLNAHIPLYLYPFLNTTSKSRPFEYLRLTS  148

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ E GL
Sbjct  149   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRSMEMGSELSKTVATFIVQKILLDEIGL  205

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
             KY C  AERF++V +VLG +V  L E P  RLL++++RCYLRLS+        A E  R 
Sbjct  206   KYICTTAERFYAVGRVLGNMVATLVEQPSCRLLKHIIRCYLRLSD-----NQSACEALRT  260

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             CLP  L D  F + L +DP   R LQQ   NI
Sbjct  261   CLPDMLRDATFSSCLREDPTARRWLQQLLHNI  292



>ref|XP_010267341.1| PREDICTED: cell differentiation protein RCD1 homolog [Nelumbo 
nucifera]
Length=321

 Score =   251 bits (640),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 151/313 (48%), Positives = 205/313 (65%), Gaps = 9/313 (3%)
 Frame = -2

Query  1261  LMENLPETLCVDptaaapplalsaappgeasssiSQSATLDELLHMLHNPNLREEAMELL  1082
             +MENLP++L ++   A P  + +            + A+ ++L+  L+NP+LRE A+  L
Sbjct  1     MMENLPQSLSLNLPFANPNASSANPSAALLKKHR-KMASAEQLVIDLNNPDLRENALHEL  59

Query  1081  NKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKESTRVCNALALIQCMAA  902
             +KKRE   +L  LLWN+   +  LLQE++S+Y  LSP  +T   S RVCNALAL+QC+A+
Sbjct  60    SKKREIFQDLAPLLWNTPGAIAALLQEIVSIYTFLSPPTLTPAASNRVCNALALLQCVAS  119

Query  901   HPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVKIEDPNAPEIVHFLL  722
             HPDTR   + A IP YLYPFL  +   +P E+LRLTSLGVIGALVK++D    E++ FLL
Sbjct  120   HPDTRTLFLNAHIPLYLYPFLNTTSKTRPFEYLRLTSLGVIGALVKVDD---TEVISFLL  176

Query  721   ETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAERFFSVVQVLGRLVER  542
              TE+ PLCLR +++G EL++TVAT IV KIL+ + GL Y CA AERFF+V +VLG +V  
Sbjct  177   STEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGLHYICATAERFFAVARVLGSMVNS  236

Query  541   LPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDERFLNVLHDDPQTAR  362
             L E P  RLL+++VRCYLRL++      S A E  + CLP  L D  F + L +DP T R
Sbjct  237   LAEQPSSRLLKHIVRCYLRLTD-----NSRACEALKTCLPEILRDTTFNSCLREDPTTKR  291

Query  361   MLQQFFLNITTSS  323
              LQQ   N+T  S
Sbjct  292   WLQQLINNVTLGS  304



>ref|XP_007014909.1| Cell differentiation, Rcd1-like protein isoform 1 [Theobroma 
cacao]
 gb|EOY32528.1| Cell differentiation, Rcd1-like protein isoform 1 [Theobroma 
cacao]
Length=321

 Score =   251 bits (640),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 143/272 (53%), Positives = 186/272 (68%), Gaps = 8/272 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ + L+  L NP+LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  LSP
Sbjct  38    ASAEHLVLDLSNPDLRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYPVLSP  97

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  98    PNLTPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRLTS  157

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  158   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  214

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L E P  RLL++++RCYLRLS+ P      A +  R 
Sbjct  215   DYICTTAERFFAVGRVLGNMVAALAEQPSSRLLKHIIRCYLRLSDNPR-----ACDALRS  269

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             CLP  L D  F   L +D  T R LQQ   N+
Sbjct  270   CLPDMLRDATFSTCLREDQTTRRWLQQLLHNV  301



>ref|XP_004294416.1| PREDICTED: cell differentiation protein RCD1 homolog [Fragaria 
vesca subsp. vesca]
Length=311

 Score =   249 bits (637),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 145/275 (53%), Positives = 186/275 (68%), Gaps = 8/275 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L NP LRE A+  L+KKRE   +L  LLWNSF TV  LLQE++S+Y  LSP
Sbjct  27    ASAEQLVLELSNPELRENALLELSKKRELFQDLAPLLWNSFGTVAALLQEIVSIYPVLSP  86

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  87    PNLTPAQSNRVCNALALLQCVASHPDTRMYFLNAHIPLYLYPFLNTTSKSRPFEYLRLTS  146

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  147   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  203

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L E    RLL++++RCYLRLSE P      A +  R 
Sbjct  204   DYICTTAERFFAVGRVLGNMVASLAEQHSSRLLKHIIRCYLRLSENPR-----ACDALRS  258

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             CLP  L D  F   L +D  T R LQQ   N+  S
Sbjct  259   CLPDMLRDATFSVCLREDQTTRRWLQQLLHNVGVS  293



>ref|XP_008389066.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Malus domestica]
Length=319

 Score =   249 bits (637),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 141/275 (51%), Positives = 187/275 (68%), Gaps = 8/275 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ + L+  L NP+LRE A+  L+K +E   +L   +WNSF T+  L+QE++S+Y  LSP
Sbjct  36    ASAEHLVLDLSNPDLRENALLELSKNKELFQDLAPFVWNSFGTIAALIQEIVSIYPVLSP  95

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  96    PNLTPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKARPFEYLRLTS  155

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR ++LG EL++TVAT IV KIL+ + GL
Sbjct  156   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMELGSELSKTVATFIVQKILLDDMGL  212

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L + P  RLL++++RCYLRLS+ P      A +  R 
Sbjct  213   DYICTTAERFFAVGRVLGTMVAALADQPSSRLLKHIIRCYLRLSDNPR-----ACDALRS  267

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             CLP  L D  F N L +DP T R LQQ   N+  S
Sbjct  268   CLPDVLRDASFNNFLCEDPTTRRWLQQLLQNVGVS  302



>ref|NP_001053854.2| Os04g0613400 [Oryza sativa Japonica Group]
 gb|EEC77984.1| hypothetical protein OsI_17368 [Oryza sativa Indica Group]
 gb|EEE61670.1| hypothetical protein OsJ_16137 [Oryza sativa Japonica Group]
 gb|EEE67425.1| hypothetical protein OsJ_24766 [Oryza sativa Japonica Group]
 dbj|BAF15768.2| Os04g0613400 [Oryza sativa Japonica Group]
Length=326

 Score =   250 bits (638),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 143/276 (52%), Positives = 190/276 (69%), Gaps = 8/276 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L +P LRE A+  L+KKRE   +L  LLW+SF TV  LLQE++S+Y  LSP
Sbjct  44    ASAEQLVLDLCDPELRENALLELSKKREIFQDLAPLLWHSFGTVAALLQEIVSIYSALSP  103

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               ++   S RVCNALAL+QC+A+HP+TR+  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  104   PTLSPGASNRVCNALALLQCVASHPETRILFLTAHIPLYLYPFLNTTSKTRPFEYLRLTS  163

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL+TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  164   LGVIGALVKVDD---TEVISFLLQTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  220

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
             +Y CA AERFF+V  VL  +V  L E P  RLL++++RCYLRLS+      S A    + 
Sbjct  221   RYICATAERFFAVGSVLANMVVSLAEQPSTRLLKHIIRCYLRLSD-----NSRACAALQT  275

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTSS  323
             CLP  L D  F N L DDP T R LQQ  LN+T + 
Sbjct  276   CLPDMLKDGTFNNCLRDDPTTRRWLQQLLLNVTGAG  311



>ref|XP_008340437.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X2 [Malus domestica]
Length=319

 Score =   249 bits (637),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 143/275 (52%), Positives = 187/275 (68%), Gaps = 8/275 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ + L+  L NP+LRE  +  L+K RE   +L  +LWNSF T+  LLQE++S+Y  LSP
Sbjct  36    ASAEHLVLDLSNPDLRENTLLELSKTRELFQDLAPVLWNSFGTIAALLQEIVSIYPVLSP  95

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  S   +P E+LRLTS
Sbjct  96    PNLTPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTSSKARPFEYLRLTS  155

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR ++LG EL++TVAT IV KIL+ + GL
Sbjct  156   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMELGSELSKTVATFIVQKILLDDMGL  212

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L + P  RLL++++RCYLRLS+ P      A +  R 
Sbjct  213   DYICTTAERFFAVGRVLGTMVAALADQPSSRLLKHIIRCYLRLSDNPR-----ACDALRS  267

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             CLP  L +  F N L +DP T R LQQ   N+  S
Sbjct  268   CLPDVLREASFNNFLCEDPTTRRWLQQLLQNVGVS  302



>ref|XP_008345037.1| PREDICTED: cell differentiation protein RCD1 homolog [Malus domestica]
Length=310

 Score =   249 bits (635),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 143/275 (52%), Positives = 187/275 (68%), Gaps = 8/275 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L NP LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  LSP
Sbjct  27    ASAEQLVLELSNPQLRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYPVLSP  86

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  87    PNLTPVQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRLTS  146

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  147   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  203

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L +    RLL++++RCYLRLS+ P      A +  R 
Sbjct  204   DYICTTAERFFAVGRVLGTMVASLADQHSSRLLKHIIRCYLRLSDNPR-----ACDALRS  258

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             CLP  L D  F   L +DP T R LQQ   N+  S
Sbjct  259   CLPDMLRDATFSVSLREDPTTRRWLQQLLHNVGVS  293



>ref|XP_009351736.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009351737.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Pyrus x bretschneideri]
Length=319

 Score =   248 bits (634),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 141/275 (51%), Positives = 187/275 (68%), Gaps = 8/275 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ + L+  L NP+LRE A+  L+K +E   +L   +WNSF T+  L+QE++S+Y  LSP
Sbjct  36    ASAERLVLDLSNPDLRENALLELSKNKELFQDLAPFVWNSFGTIAALIQEIVSIYPVLSP  95

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  S   +P E+LRLTS
Sbjct  96    PNLTPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTSSKARPFEYLRLTS  155

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR ++LG EL++TVAT IV KIL+ + GL
Sbjct  156   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMELGSELSKTVATFIVQKILLDDMGL  212

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L + P  RLL++++RCYLRLS+ P      A +  R 
Sbjct  213   DYICTTAERFFAVGRVLGTMVTALADQPSSRLLKHIIRCYLRLSDNPR-----ACDALRS  267

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             CLP  L +  F N L +DP T R LQQ   N+  S
Sbjct  268   CLPDVLREASFNNFLCEDPTTRRWLQQLLQNVGVS  302



>ref|XP_006452432.1| hypothetical protein CICLE_v10010530mg [Citrus clementina]
 ref|XP_006475024.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X2 [Citrus sinensis]
 gb|ESR65672.1| hypothetical protein CICLE_v10010530mg [Citrus clementina]
 gb|KDO62093.1| hypothetical protein CISIN_1g042013mg [Citrus sinensis]
Length=321

 Score =   248 bits (633),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 139/272 (51%), Positives = 186/272 (68%), Gaps = 8/272 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ + L+  L NP+LRE A+  L+K +E   +L   +WNSF T+  L+QE++S+Y  LSP
Sbjct  38    ASAEHLVLDLSNPDLRENALLELSKNKELFQDLAPFVWNSFGTIAALIQEIVSIYPVLSP  97

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  98    PNLTPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRLTS  157

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  158   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  214

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L E P  RLL++++RCYLRLS+ P      A +  R 
Sbjct  215   DYICTTAERFFAVGRVLGNMVAALAEQPSSRLLKHIIRCYLRLSDNPR-----ACDALRS  269

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             CLP  L D  F + L +DP T R LQQ   N+
Sbjct  270   CLPDMLRDATFSSCLREDPTTRRWLQQLLHNV  301



>gb|AAM61591.1| putative cell differentiation protein [Arabidopsis thaliana]
Length=316

 Score =   248 bits (633),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 139/272 (51%), Positives = 187/272 (69%), Gaps = 8/272 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L NP LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  L+P
Sbjct  36    ASAEQLVLDLSNPELRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYSVLAP  95

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCN+LAL+QC+A+H DTRM  ++A IP YLYPFL  +   +P E+LRLTS
Sbjct  96    PNLTPAQSNRVCNSLALLQCVASHSDTRMLFLKAHIPLYLYPFLNTTSKSRPFEYLRLTS  155

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + G+
Sbjct  156   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGM  212

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V+ L E P  RLL+++ RCYLRLS+ P    ++A      
Sbjct  213   DYICTTAERFFAVGRVLGNMVQSLVEQPSPRLLKHITRCYLRLSDNPRACAALA-----S  267

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             CLP  L D  F N L +DP   R LQQ   N+
Sbjct  268   CLPDSLRDGSFSNCLREDPTARRWLQQLVHNV  299



>dbj|BAB02488.1| RCD1 [Arabidopsis thaliana]
Length=307

 Score =   248 bits (632),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 139/272 (51%), Positives = 188/272 (69%), Gaps = 8/272 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L NP LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  L+P
Sbjct  27    ASAEQLVLDLSNPELRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYSVLAP  86

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCN+LAL+QC+A+H DTRM  ++A IP YLYPFL  +   +P E+LRLTS
Sbjct  87    PNLTPAQSNRVCNSLALLQCVASHSDTRMLFLKAHIPLYLYPFLNTTSKSRPFEYLRLTS  146

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + G+
Sbjct  147   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGM  203

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V+ L E P  RLL++++RCYLRLS+ P    ++A      
Sbjct  204   DYICTTAERFFAVGRVLGNMVQSLVEQPSPRLLKHIIRCYLRLSDNPRACAALA-----S  258

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             CLP  L D  F N L +DP   R LQQ   N+
Sbjct  259   CLPDSLRDGSFSNCLREDPTARRWLQQLVHNV  290



>ref|NP_188716.1| cell differentiation, Rcd1-like protein [Arabidopsis thaliana]
 gb|AAM13902.1| putative cell differentiation protein [Arabidopsis thaliana]
 gb|AAM67486.1| putative cell differentiation protein [Arabidopsis thaliana]
 gb|AEE76424.1| cell differentiation, Rcd1-like protein [Arabidopsis thaliana]
Length=316

 Score =   248 bits (632),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 139/272 (51%), Positives = 188/272 (69%), Gaps = 8/272 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L NP LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  L+P
Sbjct  36    ASAEQLVLDLSNPELRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYSVLAP  95

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCN+LAL+QC+A+H DTRM  ++A IP YLYPFL  +   +P E+LRLTS
Sbjct  96    PNLTPAQSNRVCNSLALLQCVASHSDTRMLFLKAHIPLYLYPFLNTTSKSRPFEYLRLTS  155

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + G+
Sbjct  156   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGM  212

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V+ L E P  RLL++++RCYLRLS+ P    ++A      
Sbjct  213   DYICTTAERFFAVGRVLGNMVQSLVEQPSPRLLKHIIRCYLRLSDNPRACAALA-----S  267

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             CLP  L D  F N L +DP   R LQQ   N+
Sbjct  268   CLPDSLRDGSFSNCLREDPTARRWLQQLVHNV  299



>emb|CBI26674.3| unnamed protein product [Vitis vinifera]
Length=285

 Score =   246 bits (629),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 142/275 (52%), Positives = 187/275 (68%), Gaps = 8/275 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ + L+  L NP+LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  LSP
Sbjct  2     ASAESLVLELINPDLRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYPVLSP  61

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+H +TRM  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  62    PNLTPAQSNRVCNALALLQCVASHSETRMLFLNAHIPLYLYPFLNTNSKSRPFEYLRLTS  121

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  122   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  178

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L E    RLL++++RCYLRLS+ P      A +  R 
Sbjct  179   DYICTTAERFFAVGRVLGNMVAALAEQQSTRLLKHIIRCYLRLSDNPR-----ACDALRN  233

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             CLP  L D  F + L +DP T R LQQ   N+  S
Sbjct  234   CLPDMLKDATFSSCLREDPTTRRWLQQLLHNVGGS  268



>ref|XP_008221073.1| PREDICTED: cell differentiation protein RCD1 homolog [Prunus 
mume]
Length=319

 Score =   248 bits (632),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 139/272 (51%), Positives = 186/272 (68%), Gaps = 8/272 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ + L+  L NP+LRE A+  L+K +E   +L   +WNSF T+  L+QE++S+Y  LSP
Sbjct  36    ASAEHLVLDLSNPDLRENALLELSKNKELFQDLAPFVWNSFGTIAALIQEIVSIYPVLSP  95

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  96    PNLTAVQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSRSRPFEYLRLTS  155

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  156   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDMGL  212

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L E P  RLL++++RCYLRLS+ P      A +  R 
Sbjct  213   DYICTTAERFFAVGRVLGSMVTALAEQPSSRLLKHIIRCYLRLSDNPR-----ACDALRN  267

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             CLP  L +  F N L +DP T R LQQ   N+
Sbjct  268   CLPDTLREATFNNFLCEDPTTRRWLQQLLQNV  299



>ref|XP_006652810.1| PREDICTED: cell differentiation protein RCD1 homolog [Oryza brachyantha]
Length=328

 Score =   248 bits (633),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 142/276 (51%), Positives = 190/276 (69%), Gaps = 8/276 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L +P LRE A+  L+KKR+   +L  LLW+SF TV  LLQE++S+Y  LSP
Sbjct  46    ASAEQLVLDLCDPELRENALLELSKKRDIFQDLAPLLWHSFGTVGALLQEIVSIYPALSP  105

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               ++   S R+CNALAL+QC+A+HP+TR+  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  106   PTLSPVASNRICNALALLQCVASHPETRILFLNAHIPLYLYPFLNTTSKTRPFEYLRLTS  165

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL+TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  166   LGVIGALVKVDD---TEVISFLLQTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  222

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
             +Y CA AERFF+V  VL  +V  L E P  RLL++++RCYLRLS+ P      A    + 
Sbjct  223   RYICATAERFFAVGSVLANMVVSLAEQPSTRLLKHIIRCYLRLSDNPR-----ACAALQS  277

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTSS  323
             CLP  L D  F N L DDP T R LQQ  LN+T  S
Sbjct  278   CLPDMLKDGTFNNCLRDDPTTRRWLQQLLLNVTGGS  313



>ref|XP_007222827.1| hypothetical protein PRUPE_ppa008784mg [Prunus persica]
 ref|XP_007222828.1| hypothetical protein PRUPE_ppa008784mg [Prunus persica]
 gb|EMJ24026.1| hypothetical protein PRUPE_ppa008784mg [Prunus persica]
 gb|EMJ24027.1| hypothetical protein PRUPE_ppa008784mg [Prunus persica]
Length=319

 Score =   248 bits (632),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 139/272 (51%), Positives = 186/272 (68%), Gaps = 8/272 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ + L+  L NP+LRE A+  L+K +E   +L   +WNSF T+  L+QE++S+Y  LSP
Sbjct  36    ASAEHLVLDLSNPDLRENALLELSKNKELFQDLAPFVWNSFGTIAALIQEIVSIYPVLSP  95

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  96    PNLTAVQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSRSRPFEYLRLTS  155

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  156   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDMGL  212

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L E P  RLL++++RCYLRLS+ P      A +  R 
Sbjct  213   DYICTTAERFFAVGRVLGSMVTALAEQPSSRLLKHIIRCYLRLSDNPR-----ACDALRN  267

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             CLP  L +  F N L +DP T R LQQ   N+
Sbjct  268   CLPDTLREATFNNFLCEDPTTRRWLQQLLQNV  299



>ref|XP_007014911.1| Cell differentiation, Rcd1-like protein isoform 3 [Theobroma 
cacao]
 gb|EOY32530.1| Cell differentiation, Rcd1-like protein isoform 3 [Theobroma 
cacao]
Length=321

 Score =   248 bits (632),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 140/272 (51%), Positives = 185/272 (68%), Gaps = 8/272 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ + L+  L NP+LRE A+  L+KKRE   +L   +WNSF T+  L+QE++S+Y  LSP
Sbjct  38    ASAEHLVLDLSNPDLRENALLELSKKRELFQDLAPFVWNSFGTIAALIQEIVSIYPVLSP  97

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  98    PNLTPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRLTS  157

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  158   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  214

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L E P  RLL++++RCYLRLS+ P      A +  R 
Sbjct  215   DYICTTAERFFAVGRVLGNMVAALAEQPSSRLLKHIIRCYLRLSDNPR-----ACDALRS  269

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             CLP  L D  F   L +D  T R LQQ   N+
Sbjct  270   CLPDMLRDATFSTCLREDQTTRRWLQQLLHNV  301



>ref|XP_002885405.1| hypothetical protein ARALYDRAFT_479606 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61664.1| hypothetical protein ARALYDRAFT_479606 [Arabidopsis lyrata subsp. 
lyrata]
Length=316

 Score =   247 bits (631),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 139/272 (51%), Positives = 188/272 (69%), Gaps = 8/272 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L NP LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  L+P
Sbjct  36    ASAEQLVLDLSNPELRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYSVLAP  95

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCN+LAL+QC+A+H DTRM  ++A IP YLYPFL  +   +P E+LRLTS
Sbjct  96    PNLTPAQSNRVCNSLALLQCVASHSDTRMLFLKAHIPLYLYPFLNTTSKSRPFEYLRLTS  155

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + G+
Sbjct  156   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGM  212

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V+ L E P  RLL++++RCYLRLS+ P    ++A      
Sbjct  213   DYICTTAERFFAVGRVLGNMVQSLVEQPSPRLLKHIIRCYLRLSDNPRACAALA-----S  267

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             CLP  L D  F N L +DP   R LQQ   N+
Sbjct  268   CLPDSLRDGTFSNCLREDPTARRWLQQLVHNV  299



>ref|XP_011008644.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X2 [Populus euphratica]
Length=320

 Score =   247 bits (631),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 147/308 (48%), Positives = 203/308 (66%), Gaps = 8/308 (3%)
 Frame = -2

Query  1258  MENLPETLCVDptaaapplalsaappgeasssiSQSATLDELLHMLHNPNLREEAMELLN  1079
             M NLP++L ++ T   P  +  AA  G  ++   + A+ + L+  L NP+LRE A+  L+
Sbjct  1     MANLPQSLSMNTTFGGPNASNPAAAAGAPANKDRKMASAEHLVLDLSNPDLRENALLELS  60

Query  1078  KKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKESTRVCNALALIQCMAAH  899
             K ++   +L   +WNSF T+  L+QE++S+Y  LSP  ++  +S RVCNALAL+QC+A+H
Sbjct  61    KNKDLFQDLAPFVWNSFGTIAALIQEIVSIYPVLSPPNLSPAQSNRVCNALALLQCVASH  120

Query  898   PDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVKIEDPNAPEIVHFLLE  719
             PDTRM  + A IP YLYPFL  +   +P E+LRLTSLGVIGALVK++D    E++ FLL 
Sbjct  121   PDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRLTSLGVIGALVKVDD---TEVISFLLS  177

Query  718   TEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAERFFSVVQVLGRLVERL  539
             TE+ PLCLR +++G EL++TVAT IV KIL+ + GL Y C  AERFF+V +VLG +V  L
Sbjct  178   TEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGLDYICTTAERFFAVGRVLGNMVAAL  237

Query  538   PETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDERFLNVLHDDPQTARM  359
              E P  RLL++++RCYLRLS+ P      A    R CLP  L D  F + L +DP T R 
Sbjct  238   AEQPSSRLLKHIIRCYLRLSDNPR-----ACHALRSCLPDMLRDATFSSCLREDPTTRRW  292

Query  358   LQQFFLNI  335
             LQQ   N+
Sbjct  293   LQQLLHNV  300



>ref|XP_009361028.1| PREDICTED: cell differentiation protein RCD1 homolog [Pyrus x 
bretschneideri]
 ref|XP_009379652.1| PREDICTED: cell differentiation protein RCD1 homolog [Pyrus x 
bretschneideri]
Length=310

 Score =   247 bits (630),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 142/275 (52%), Positives = 186/275 (68%), Gaps = 8/275 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L NP LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  LSP
Sbjct  27    ASAEQLVLELSNPQLRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYPVLSP  86

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  87    PNLTPVQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRLTS  146

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  147   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  203

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L +    RLL++++RCYLRLS+        A +  R 
Sbjct  204   DYICTTAERFFAVGRVLGTMVASLADQHSSRLLKHIIRCYLRLSD-----NHRACDALRS  258

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             CLP  L D  F   L +DP T R LQQ   N+  S
Sbjct  259   CLPDMLRDTTFSVSLREDPTTRRWLQQLLHNVGVS  293



>ref|XP_006344862.1| PREDICTED: cell differentiation protein RCD1 homolog [Solanum 
tuberosum]
Length=283

 Score =   246 bits (627),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 144/277 (52%), Positives = 188/277 (68%), Gaps = 10/277 (4%)
 Frame = -2

Query  1156  QSATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKL  977
             QSA  ++L+  L NP+LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  L
Sbjct  2     QSA--EQLVLELSNPDLRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYPVL  59

Query  976   SPLRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRL  797
             SP  +T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRL
Sbjct  60    SPPNLTPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRL  119

Query  796   TSLGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEE  617
             TSLGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + 
Sbjct  120   TSLGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDV  176

Query  616   GLKYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETF  437
             GL Y C  AERFF+V +VLG +V  L E P  RLL++++RCYLRLS+ P      A +  
Sbjct  177   GLDYICTTAERFFAVGRVLGNMVGALAEQPSSRLLKHIIRCYLRLSDNPR-----ACDAL  231

Query  436   RRCLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             R  LP  L D  F   L +D  T R LQQ   N+  +
Sbjct  232   RSGLPDMLRDSTFSTCLREDLTTRRWLQQLINNVNGA  268



>ref|XP_006352517.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Solanum tuberosum]
Length=319

 Score =   247 bits (631),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 146/277 (53%), Positives = 188/277 (68%), Gaps = 10/277 (4%)
 Frame = -2

Query  1156  QSATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKL  977
             QSA  ++L+  L NP LRE A+  L+KKRE   +L  LLWNS  T+  LLQE+IS+Y  L
Sbjct  40    QSA--EQLVLDLSNPELRENALLELSKKRELFQDLAPLLWNSCATIAALLQEIISIYPVL  97

Query  976   SPLRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRL  797
             SP  +T   S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRL
Sbjct  98    SPPTLTPALSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRL  157

Query  796   TSLGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEE  617
             TSLGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + 
Sbjct  158   TSLGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDV  214

Query  616   GLKYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETF  437
             GL Y C  AERFF+V +VLG +V  L E P  RLL++++RCYLRLS+ P      A +  
Sbjct  215   GLDYICTTAERFFAVARVLGNMVGTLAEQPSSRLLKHIIRCYLRLSDNPR-----ACDAL  269

Query  436   RRCLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             R CLP  L D  F + L DDP T R LQQ   ++  +
Sbjct  270   RGCLPDILGDTTFQSCLRDDPMTRRWLQQLLHSVNGN  306



>ref|XP_002278722.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Vitis vinifera]
Length=319

 Score =   247 bits (630),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 142/275 (52%), Positives = 186/275 (68%), Gaps = 8/275 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ + L+  L NP LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  LSP
Sbjct  36    ASAENLVLELSNPELRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYPVLSP  95

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+H +TRM  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  96    PNLTPAQSNRVCNALALLQCVASHSETRMLFLNAHIPLYLYPFLNTNSKSRPFEYLRLTS  155

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  156   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  212

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L E    RLL++++RCYLRLS+ P      A +  R 
Sbjct  213   DYICTTAERFFAVGRVLGNMVAALAEQQSTRLLKHIIRCYLRLSDNPR-----ACDALRN  267

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             CLP  L D  F + L +DP T R LQQ   N+  S
Sbjct  268   CLPDMLKDATFSSCLREDPTTRRWLQQLLHNVGGS  302



>ref|XP_008340435.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Malus domestica]
 ref|XP_008340436.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Malus domestica]
Length=319

 Score =   247 bits (630),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 140/275 (51%), Positives = 186/275 (68%), Gaps = 8/275 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ + L+  L NP+LRE  +  L+K +E   +L   +WNSF T+  L+QE++S+Y  LSP
Sbjct  36    ASAEHLVLDLSNPDLRENTLLELSKNKELFQDLAPFVWNSFGTIAALIQEIVSIYPVLSP  95

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  S   +P E+LRLTS
Sbjct  96    PNLTPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTSSKARPFEYLRLTS  155

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR ++LG EL++TVAT IV KIL+ + GL
Sbjct  156   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMELGSELSKTVATFIVQKILLDDMGL  212

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L + P  RLL++++RCYLRLS+ P      A +  R 
Sbjct  213   DYICTTAERFFAVGRVLGTMVAALADQPSSRLLKHIIRCYLRLSDNPR-----ACDALRS  267

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             CLP  L +  F N L +DP T R LQQ   N+  S
Sbjct  268   CLPDVLREASFNNFLCEDPTTRRWLQQLLQNVGVS  302



>ref|XP_008667167.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
 gb|ACR34083.1| unknown [Zea mays]
 tpg|DAA36056.1| TPA: hypothetical protein ZEAMMB73_844330 [Zea mays]
Length=303

 Score =   246 bits (629),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 141/276 (51%), Positives = 188/276 (68%), Gaps = 8/276 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L +P LRE A+  L+KKRE   +L  LLW+SF T+  LLQE+IS+Y  LSP
Sbjct  20    ASAEQLVLELCDPELRENALLELSKKREIFQDLAPLLWHSFGTIAALLQEIISIYPSLSP  79

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               ++   S RVCNALAL+QC+A+HP+TR+  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  80    PTLSPGASNRVCNALALLQCVASHPETRILFLNAHIPLYLYPFLNTTSKTRPFEYLRLTS  139

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL+TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  140   LGVIGALVKVDD---TEVISFLLQTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  196

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
             +Y CA AERFF+V  VL  +V  L + P  RLL++++RCYLRLS+ P      A    + 
Sbjct  197   RYICATAERFFAVGSVLANMVVSLADQPSTRLLKHIIRCYLRLSDNPR-----ACAALQS  251

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTSS  323
             CLP  L D  F N L DDP T R LQQ   N+T   
Sbjct  252   CLPDMLKDGTFNNCLRDDPATRRWLQQLLHNVTGGG  287



>ref|XP_008776171.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Phoenix dactylifera]
Length=324

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 137/276 (50%), Positives = 190/276 (69%), Gaps = 8/276 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L +P LRE A+  L+KKRE   +L  LLWNS+ T+  LLQE++S+Y  LSP
Sbjct  42    ASAEQLVLDLCDPELRENALFDLSKKREIFQDLAPLLWNSYGTIAALLQEIVSIYPYLSP  101

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               ++   S RVCNALAL+QC+A+HPDTR+  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  102   PTLSPGASNRVCNALALLQCVASHPDTRIHFLNAHIPLYLYPFLNTTSKTRPFEYLRLTS  161

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LG IGALVK++D    E++ FLL+TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  162   LGAIGALVKVDD---TEVIGFLLQTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  218

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
             ++ CA A+RF++V QVLG +V  L E P  RLL++++RCY RLSE P      A ++ + 
Sbjct  219   RHICATADRFYAVGQVLGSMVTSLAEQPSTRLLKHIIRCYQRLSEHPR-----ACDSLKN  273

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTSS  323
             CLP  L D  F N L DDP     LQQ   N++ ++
Sbjct  274   CLPDMLKDGTFNNCLRDDPAARDWLQQLLDNVSGAN  309



>ref|XP_010644487.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X3 [Vitis vinifera]
Length=314

 Score =   246 bits (629),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 142/275 (52%), Positives = 187/275 (68%), Gaps = 8/275 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ + L+  L NP+LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  LSP
Sbjct  31    ASAESLVLELINPDLRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYPVLSP  90

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+H +TRM  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  91    PNLTPAQSNRVCNALALLQCVASHSETRMLFLNAHIPLYLYPFLNTNSKSRPFEYLRLTS  150

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  151   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  207

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L E    RLL++++RCYLRLS+ P      A +  R 
Sbjct  208   DYICTTAERFFAVGRVLGNMVAALAEQQSTRLLKHIIRCYLRLSDNPR-----ACDALRN  262

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             CLP  L D  F + L +DP T R LQQ   N+  S
Sbjct  263   CLPDMLKDATFSSCLREDPTTRRWLQQLLHNVGGS  297



>ref|XP_010241638.1| PREDICTED: cell differentiation protein RCD1 homolog [Nelumbo 
nucifera]
Length=318

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 140/272 (51%), Positives = 187/272 (69%), Gaps = 8/272 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L NP+LRE A+  L+KKRE   +L  LLW++   +  LLQE++S+Y  LSP
Sbjct  34    ASAEQLVFDLSNPDLRENALHELSKKREIFQDLAPLLWSTPGAIAALLQEIVSIYPVLSP  93

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T   S RVCNALAL+QC+A+HPDTR   + A IP YLYPFL  +   +P E+LRLTS
Sbjct  94    PTLTPAASNRVCNALALLQCVASHPDTRTLFLNAHIPLYLYPFLNTTSKTRPFEYLRLTS  153

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ E GL
Sbjct  154   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDEVGL  210

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
             +Y CA AERFF+V +VLG +V  L E P  RLL++++RCYLRL++ P      A E  + 
Sbjct  211   RYICATAERFFAVARVLGAMVNSLTEQPSSRLLKHIIRCYLRLTDNP-----RACEALKT  265

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             CLP  L D  F + L +DP T R LQQ   N+
Sbjct  266   CLPEILRDATFSSCLREDPTTKRWLQQLINNV  297



>ref|XP_008794445.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Phoenix dactylifera]
Length=324

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 141/276 (51%), Positives = 188/276 (68%), Gaps = 8/276 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L +P LRE A+  L+KKRE   +L  LLWNS+ T+  LLQE++S+Y  LSP
Sbjct  41    ASAEQLVLDLCDPELRENALLDLSKKREIFQDLAPLLWNSYGTIAALLQEIVSIYPALSP  100

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               ++   S RVCNALAL+QC+A+HPDTR+  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  101   PTLSPAASNRVCNALALLQCVASHPDTRILFLNAHIPLYLYPFLNTTSKTRPFEYLRLTS  160

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL+TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  161   LGVIGALVKVDD---TEVISFLLQTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDIGL  217

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
             +Y CA AERFF+V  VL  +V  L E P  RLL++++RCYLRLS+ P      A    R 
Sbjct  218   QYICATAERFFAVGSVLANMVVSLAEQPSTRLLKHIIRCYLRLSDNPR-----ACGALRT  272

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTSS  323
             CLP  L D  F N L DD  T R LQQ   N++  +
Sbjct  273   CLPEMLRDGTFNNCLRDDAATRRWLQQLLHNVSGGN  308



>emb|CBI28834.3| unnamed protein product [Vitis vinifera]
Length=282

 Score =   245 bits (626),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/246 (52%), Positives = 179/246 (73%), Gaps = 8/246 (3%)
 Frame = -2

Query  1060  AELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKESTRVCNALALIQCMAAHPDTRMG  881
             A+L  LLWNS  T+Y+LLQE+ S Y+ LS   +  + +  VCNALAL+QC+A++P+TRM 
Sbjct  28    ADLAPLLWNSSGTIYLLLQEITSAYRILSSPELVARATNNVCNALALLQCVASNPNTRMN  87

Query  880   LVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVKIEDPNAPEIVHFLLETEVFPL  701
             L++A IP YLYPFL     EKP E+LRLTSLGVIGALVK+++    EIVHFLL++E+ PL
Sbjct  88    LIQANIPCYLYPFLGVKNKEKPYEYLRLTSLGVIGALVKVDN---AEIVHFLLQSEIVPL  144

Query  700   CLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAERFFSVVQVLGRLVERLPETPcl  521
             CLRC+++G+EL++TVAT I+ KILVQ+EGL+Y C+ AERFF++ +V+G +V+ L E P  
Sbjct  145   CLRCMEVGNELSKTVATFIIQKILVQDEGLRYFCSFAERFFALARVMGTMVDNLVEEPSQ  204

Query  520   rllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDERFLNVLHDDPQTARMLQQFFL  341
             RLL++++ CY+RLS  P      A + F+ CLP +L D   LN++ DDP     L+Q F 
Sbjct  205   RLLKHIIHCYVRLSGCPR-----ACDGFKICLPIRLRDAAILNLVRDDPIALEWLRQLFF  259

Query  340   NITTSS  323
             NI T +
Sbjct  260   NIATGN  265



>ref|XP_010675730.1| PREDICTED: cell differentiation protein RCD1 homolog [Beta vulgaris 
subsp. vulgaris]
Length=333

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 143/274 (52%), Positives = 187/274 (68%), Gaps = 10/274 (4%)
 Frame = -2

Query  1156  QSATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKL  977
             QSA L  L+  L NP+ RE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  L
Sbjct  51    QSAEL--LVLDLSNPDRRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYSVL  108

Query  976   SPLRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRL  797
             SP  ++  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRL
Sbjct  109   SPPTLSPGQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRL  168

Query  796   TSLGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEE  617
             TSLGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + 
Sbjct  169   TSLGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDV  225

Query  616   GLKYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETF  437
             GL Y C  AERFF+V +VL  +V  L E P  RLL++++RCYLRLS+ P      A +  
Sbjct  226   GLDYICTTAERFFAVGRVLANMVAALAEQPSSRLLKHIIRCYLRLSDNPR-----ACDAL  280

Query  436   RRCLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             R CLP  L D  F + L +DP T + LQQ   N+
Sbjct  281   RSCLPDMLKDATFASCLREDPTTRKWLQQLLHNV  314



>ref|NP_001131945.1| hypothetical protein [Zea mays]
 ref|XP_008667166.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF80578.1| unknown [Zea mays]
 gb|ACL53569.1| unknown [Zea mays]
 tpg|DAA36051.1| TPA: hypothetical protein ZEAMMB73_844330 [Zea mays]
 tpg|DAA36052.1| TPA: hypothetical protein ZEAMMB73_844330 [Zea mays]
 tpg|DAA36053.1| TPA: hypothetical protein ZEAMMB73_844330 [Zea mays]
 gb|AIB05320.1| Rcd1-like transcription factor, partial [Zea mays]
Length=321

 Score =   246 bits (629),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 141/276 (51%), Positives = 188/276 (68%), Gaps = 8/276 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L +P LRE A+  L+KKRE   +L  LLW+SF T+  LLQE+IS+Y  LSP
Sbjct  38    ASAEQLVLELCDPELRENALLELSKKREIFQDLAPLLWHSFGTIAALLQEIISIYPSLSP  97

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               ++   S RVCNALAL+QC+A+HP+TR+  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  98    PTLSPGASNRVCNALALLQCVASHPETRILFLNAHIPLYLYPFLNTTSKTRPFEYLRLTS  157

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL+TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  158   LGVIGALVKVDD---TEVISFLLQTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  214

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
             +Y CA AERFF+V  VL  +V  L + P  RLL++++RCYLRLS+ P      A    + 
Sbjct  215   RYICATAERFFAVGSVLANMVVSLADQPSTRLLKHIIRCYLRLSDNPR-----ACAALQS  269

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTSS  323
             CLP  L D  F N L DDP T R LQQ   N+T   
Sbjct  270   CLPDMLKDGTFNNCLRDDPATRRWLQQLLHNVTGGG  305



>ref|XP_009420695.1| PREDICTED: cell differentiation protein RCD1 homolog [Musa acuminata 
subsp. malaccensis]
Length=333

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 140/276 (51%), Positives = 188/276 (68%), Gaps = 8/276 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L +P LRE A+  L+KKR+   +L  LLW S+ T+ +LLQE++S+Y  LSP
Sbjct  50    ASAEQLVLDLCDPELRENALLDLSKKRDIFQDLAPLLWYSYGTIAVLLQEIVSIYPALSP  109

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               ++   S RVCNALAL+QC+A+HPDTR+  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  110   PTLSPGASNRVCNALALLQCVASHPDTRILFLNAHIPLYLYPFLNTTSKTRPFEYLRLTS  169

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL+TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  170   LGVIGALVKVDD---TEVISFLLQTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  226

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
             +Y CA AERFF+V  VL  +V  L E P  RLL++++RCYLRLS+ P      A    R 
Sbjct  227   RYICATAERFFAVGSVLANMVVSLAEQPSTRLLKHIIRCYLRLSDNPR-----ACGALRS  281

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTSS  323
             CLP  L D  F N L DDP T R LQQ   N+   +
Sbjct  282   CLPEMLKDGTFNNCLRDDPATRRWLQQLLHNVAGGN  317



>ref|XP_004297723.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
2 [Fragaria vesca subsp. vesca]
Length=319

 Score =   246 bits (628),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 141/275 (51%), Positives = 186/275 (68%), Gaps = 8/275 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ + L+  L NP+LRE A+  L+KKR+   +L  LLW+SF T+  LLQE++S+Y  LSP
Sbjct  36    ASAEHLVLDLSNPDLRENALLELSKKRDFFQDLAPLLWDSFGTIAALLQEIVSIYPVLSP  95

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  96    PNLTPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRLTS  155

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  156   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDMGL  212

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L E P  RLL++++RCYLRLSE P      A +  R 
Sbjct  213   DYICTTAERFFAVGRVLGNMVAALAEQPSSRLLKHIIRCYLRLSENPR-----ACDALRS  267

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             CLP  L D  F   L +D  T + LQ    N+  S
Sbjct  268   CLPDMLRDATFSTFLVEDATTRKWLQLLLQNVGGS  302



>ref|XP_003518528.1| PREDICTED: cell differentiation protein RCD1 homolog [Glycine 
max]
Length=316

 Score =   246 bits (628),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 139/272 (51%), Positives = 186/272 (68%), Gaps = 8/272 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+++ L+  L NP+LRE A+  L+KKRE   +L  LLWNS  T+  LLQE++S+Y  +SP
Sbjct  33    ASVENLVLQLSNPDLRENALHELSKKRELFQDLAPLLWNSLGTMAALLQEIVSIYPAISP  92

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+H DTRM  + A IP YLYPFL  +   +P E+LRLT+
Sbjct  93    PNLTPAQSNRVCNALALLQCVASHLDTRMPFLNAHIPLYLYPFLNTTSKSRPFEYLRLTT  152

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ E GL
Sbjct  153   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRSMEMGSELSKTVATFIVQKILLDEMGL  209

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
             KY C  AERF++V +VLG +V  L + P  RLL++++RCYLRLS+        A E  R 
Sbjct  210   KYICTTAERFYAVGRVLGNMVATLVQQPSCRLLKHIIRCYLRLSD-----NQSACEALRA  264

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             CLP  L D  F + L +DP   + LQQ   NI
Sbjct  265   CLPDMLRDATFSSCLREDPTARKWLQQLLHNI  296



>ref|XP_008784791.1| PREDICTED: cell differentiation protein RCD1 homolog [Phoenix 
dactylifera]
Length=315

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 140/276 (51%), Positives = 188/276 (68%), Gaps = 8/276 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L +P LRE A+  L+KKRE   +L  LLWNS+ T+  LLQE++S+Y  LSP
Sbjct  33    ASAEQLVLDLCDPELRENALLDLSKKREIFQDLAPLLWNSYGTIAALLQEIVSIYPALSP  92

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               ++   S RVCNALAL+QC+A+HPDTR+  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  93    PTLSPGASNRVCNALALLQCVASHPDTRILFLNAHIPLYLYPFLNTTSKTRPFEYLRLTS  152

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL+TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  153   LGVIGALVKVDD---TEVISFLLQTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  209

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
             +Y CA  ERFF+V  VL  +V  L E P  RLL++++RCYLRLS+ P      A    + 
Sbjct  210   RYICATPERFFAVGSVLANMVVSLAEQPSARLLKHIIRCYLRLSDNPR-----ACGALQT  264

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTSS  323
             CLP  L D  F N L DDP T R LQQ   N++  +
Sbjct  265   CLPEMLKDGTFNNCLRDDPATHRWLQQLLHNVSGGN  300



>ref|XP_010923683.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X2 [Elaeis guineensis]
Length=324

 Score =   246 bits (627),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 141/276 (51%), Positives = 188/276 (68%), Gaps = 8/276 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L +P LRE A+  L+KKRE   +L  LLWNS+ T+  LLQE++S+Y  LSP
Sbjct  41    ASAEQLVLDLCDPELRENALLDLSKKREIFQDLAPLLWNSYGTIAALLQEIVSIYPALSP  100

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               ++   S RVCNALAL+QC+A+HPDTR+  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  101   PTLSPAASNRVCNALALLQCVASHPDTRILFLNAHIPLYLYPFLNTTNKTRPFEYLRLTS  160

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL+TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  161   LGVIGALVKVDD---TEVIGFLLQTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDIGL  217

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
             +Y CA AERFF+V  VL  +V  L E P  RLL++++RCYLRLS+ P      A    R 
Sbjct  218   QYICATAERFFAVGSVLANMVVSLAEQPSTRLLKHIIRCYLRLSDNP-----RACGALRT  272

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTSS  323
             CLP  L D  F N L DD  T R LQQ   N++  +
Sbjct  273   CLPEMLRDGTFNNCLRDDTATRRWLQQLLHNVSGGT  308



>ref|XP_002448518.1| hypothetical protein SORBIDRAFT_06g028320 [Sorghum bicolor]
 gb|EES12846.1| hypothetical protein SORBIDRAFT_06g028320 [Sorghum bicolor]
Length=321

 Score =   246 bits (627),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 141/273 (52%), Positives = 188/273 (69%), Gaps = 8/273 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L +P LRE A+  L+KKRE   +L  LLW+SF T+  LLQE+IS+Y  LSP
Sbjct  38    ASAEQLVLELCDPELRENALLELSKKREIFQDLAPLLWHSFGTIAALLQEIISIYPSLSP  97

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               ++   S RVCNALAL+QC+A+HP+TR+  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  98    PTLSPGASNRVCNALALLQCVASHPETRILFLNAHIPLYLYPFLNTTSKTRPFEYLRLTS  157

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL+TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  158   LGVIGALVKVDD---TEVISFLLQTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  214

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
             +Y CA AERFF+V  VL  +V  L + P  RLL++++RCYLRLS+ P      A    + 
Sbjct  215   RYICATAERFFAVGSVLANMVVSLADQPSTRLLKHIIRCYLRLSDNPR-----ACAALQS  269

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNIT  332
             CLP  L D  F N L DDP T R LQQ   N+T
Sbjct  270   CLPDMLKDGTFNNCLRDDPATRRWLQQLLHNVT  302



>ref|XP_010907338.1| PREDICTED: cell differentiation protein RCD1 homolog [Elaeis 
guineensis]
Length=321

 Score =   245 bits (626),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 140/276 (51%), Positives = 188/276 (68%), Gaps = 8/276 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L +P LRE A+  L+KKRE   +L  LLWNS+ T+  LLQE++S+Y  LSP
Sbjct  39    ASAEQLVLDLCDPELRENALLDLSKKREIFQDLAPLLWNSYGTIAALLQEIVSIYPALSP  98

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               ++   S RVCNALAL+QC+A+HPDTR+  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  99    PTLSPGASNRVCNALALLQCVASHPDTRILFLNAHIPLYLYPFLNTTSKTRPFEYLRLTS  158

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL+TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  159   LGVIGALVKVDD---TEVISFLLQTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  215

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
             +Y CA  ERFF+V  VL  +V  L E P  RLL++++RCYLRLS+ P      A    + 
Sbjct  216   RYICATPERFFAVGSVLANMVVSLAEQPSTRLLKHIIRCYLRLSDNPR-----ACGALQT  270

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTSS  323
             CLP  L D  F N L DDP T R LQQ   N++  +
Sbjct  271   CLPDMLKDGTFNNCLRDDPATRRWLQQLLHNVSGGN  306



>ref|XP_009618802.1| PREDICTED: cell differentiation protein RCD1 homolog [Nicotiana 
tomentosiformis]
Length=317

 Score =   245 bits (626),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 146/277 (53%), Positives = 190/277 (69%), Gaps = 10/277 (4%)
 Frame = -2

Query  1156  QSATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKL  977
             QSA  ++L+  L NP+LRE A+  L+KK E   +L  LLWNSF T+  LLQE++S+Y  L
Sbjct  36    QSA--EQLVLELSNPDLRENALLELSKKLELFQDLAPLLWNSFGTIAALLQEIVSIYPVL  93

Query  976   SPLRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRL  797
             SP  +T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRL
Sbjct  94    SPPNLTPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRL  153

Query  796   TSLGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEE  617
             TSLGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + 
Sbjct  154   TSLGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDV  210

Query  616   GLKYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETF  437
             GL Y C  AERFF+V +VLG +V  L E P  RLL++++RCYLRLS+ P      A +  
Sbjct  211   GLDYICTTAERFFAVGRVLGSMVGALAEQPSSRLLKHIIRCYLRLSDNPR-----ACDAL  265

Query  436   RRCLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             R CLP  L D  F + L +DP T R LQQ   N+  S
Sbjct  266   RNCLPDMLRDATFSSCLREDPTTRRWLQQLIHNVNGS  302



>ref|XP_004976789.1| PREDICTED: cell differentiation protein RCD1 homolog [Setaria 
italica]
Length=327

 Score =   245 bits (626),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 140/273 (51%), Positives = 188/273 (69%), Gaps = 8/273 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L +P LRE A+  L+KKRE   +L  LLW+SF T+  LLQE++S+Y  LSP
Sbjct  44    ASAEQLVLELCDPELRENALLELSKKREIFQDLAPLLWHSFGTIAALLQEIVSIYPSLSP  103

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               ++   S RVCNALAL+QC+A+HP+TR+  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  104   PTLSPGASNRVCNALALLQCVASHPETRILFLNAHIPLYLYPFLNTTSKTRPFEYLRLTS  163

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL+TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  164   LGVIGALVKVDD---TEVISFLLQTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  220

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
             +Y CA AERFF+V  VL  +V  L + P  RLL++++RCYLRLS+ P      A    + 
Sbjct  221   RYICATAERFFAVGSVLANMVVSLADQPSTRLLKHIIRCYLRLSDNPR-----ACAALQS  275

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNIT  332
             CLP  L D  F N L DDP T R LQQ   N+T
Sbjct  276   CLPDMLKDGTFNNCLRDDPATRRWLQQLLHNVT  308



>ref|XP_010488065.1| PREDICTED: cell differentiation protein RCD1 homolog [Camelina 
sativa]
Length=316

 Score =   245 bits (625),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 139/272 (51%), Positives = 186/272 (68%), Gaps = 8/272 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L NP LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  L+P
Sbjct  36    ASAEQLVLDLSNPELRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYSVLAP  95

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCN+LAL+QC+A+H DTRM  ++A IP YLYPFL  +   +P E+LRLTS
Sbjct  96    PNLTPAQSNRVCNSLALLQCVASHSDTRMLFLKAHIPLYLYPFLNTTSKSRPFEYLRLTS  155

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + G+
Sbjct  156   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGM  212

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V+ L E P  RLL++++RCYLRLS+ P      A      
Sbjct  213   DYICTTAERFFAVGRVLGNMVQSLVEQPSPRLLKHIIRCYLRLSDNPR-----ACAALGS  267

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             CLP  L D  F N L +D    R LQQ  LN+
Sbjct  268   CLPDSLRDGTFSNCLREDQIARRWLQQLVLNV  299



>ref|XP_010509345.1| PREDICTED: cell differentiation protein RCD1 homolog [Camelina 
sativa]
Length=317

 Score =   245 bits (625),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 139/275 (51%), Positives = 186/275 (68%), Gaps = 8/275 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L NP LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  L+P
Sbjct  36    ASAEQLVLDLSNPELRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYSVLAP  95

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCN+LAL+QC+A+HPDTRM  ++A IP YLYPFL  +   +P E+LRLTS
Sbjct  96    PNLTPAQSNRVCNSLALLQCVASHPDTRMLFLKAHIPLYLYPFLNTTSKSRPFEYLRLTS  155

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + G+
Sbjct  156   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGM  212

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V+ L E P  RLL++++RCYLRLS+ P      A      
Sbjct  213   DYICTTAERFFAVGRVLGNMVQSLVEQPSPRLLKHIIRCYLRLSDNPR-----ACAALGS  267

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             CLP  L D  F N L +D    R LQQ   N+   
Sbjct  268   CLPDSLRDGTFSNCLREDQIARRWLQQLVHNVGVG  302



>ref|XP_009417894.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=320

 Score =   245 bits (625),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 141/272 (52%), Positives = 188/272 (69%), Gaps = 9/272 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L  P+LRE A+  L+KKRE   +L  LLWN++ T+  LLQE++S+Y  LSP
Sbjct  39    ASAEQLVLDLCEPDLRENALGELSKKREIFQDLAPLLWNAYGTIAALLQEIVSIYPFLSP  98

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               ++   S RVCNALAL+QC+A+HPDTR+  + A IP YLYPFL  +   KP E+LRLTS
Sbjct  99    PTLSPGASNRVCNALALLQCVASHPDTRILFLNAHIPLYLYPFLNTTSKTKPFEYLRLTS  158

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL+TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  159   LGVIGALVKVDD---TEVISFLLQTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  215

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
             +Y CA AERF++V QVLG +V  L E P  RLL++++RCYLRLSE P      A  +   
Sbjct  216   RYICATAERFYAVGQVLGSMVTSLAEQPSARLLKHIIRCYLRLSEHPR-----ACGSLNN  270

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             CLP  L D  F N + DDP T   LQQ   N+
Sbjct  271   CLPNMLKDGSFNNYI-DDPTTRHWLQQLLHNV  301



>ref|XP_011047538.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X2 [Populus euphratica]
Length=323

 Score =   245 bits (625),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 137/272 (50%), Positives = 186/272 (68%), Gaps = 8/272 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ + L+  L +P+LRE A+  L+K ++   EL   +WNSF T+  L+QE++S+Y  LSP
Sbjct  39    ASAEHLVLDLSSPDLRENALLELSKNKDLFQELAPFVWNSFGTIAALIQEIVSIYPVLSP  98

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               ++  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  99    PNLSPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRLTS  158

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  159   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  215

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L E P  RLL++++RCYLRLS+ P      A +  R 
Sbjct  216   DYICTTAERFFAVGRVLGNMVAALAEQPSSRLLKHIIRCYLRLSDNPR-----ACDALRS  270

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             CLP  L D  F + L +DP T R LQQ   N+
Sbjct  271   CLPDMLRDATFSSCLREDPTTRRWLQQLLHNV  302



>ref|XP_007014910.1| Cell differentiation, Rcd1-like protein isoform 2 [Theobroma 
cacao]
 gb|EOY32529.1| Cell differentiation, Rcd1-like protein isoform 2 [Theobroma 
cacao]
Length=321

 Score =   244 bits (624),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 138/272 (51%), Positives = 184/272 (68%), Gaps = 8/272 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ + L+  L NP+LRE A+  L+K +E   +L   +WNSF T+  L+QE++S+Y  LSP
Sbjct  38    ASAEHLVLDLSNPDLRENALLELSKNKELFQDLAPFVWNSFGTIAALIQEIVSIYPVLSP  97

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  98    PNLTPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRLTS  157

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  158   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  214

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L E P  RLL++++RCYLRLS+ P      A +  R 
Sbjct  215   DYICTTAERFFAVGRVLGNMVAALAEQPSSRLLKHIIRCYLRLSDNPR-----ACDALRS  269

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             CLP  L D  F   L +D  T R LQQ   N+
Sbjct  270   CLPDMLRDATFSTCLREDQTTRRWLQQLLHNV  301



>ref|XP_004248335.1| PREDICTED: cell differentiation protein RCD1 homolog [Solanum 
lycopersicum]
Length=327

 Score =   244 bits (623),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 145/277 (52%), Positives = 189/277 (68%), Gaps = 10/277 (4%)
 Frame = -2

Query  1156  QSATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKL  977
             QSA  ++L+  L NP LRE A+  L+KKRE   +L  LLWNS  T+  LLQE+IS+Y  L
Sbjct  48    QSA--EQLVLDLTNPELRENALLELSKKRELFQDLAPLLWNSCATIAALLQEIISIYPVL  105

Query  976   SPLRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRL  797
             SP  +T   S RVCNALAL+QC+A+HPDTRM  ++A IP YLYPFL  +   +P E+LRL
Sbjct  106   SPPTLTPALSNRVCNALALLQCVASHPDTRMLFLKAHIPLYLYPFLNTTSKSRPFEYLRL  165

Query  796   TSLGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEE  617
             TSLGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + 
Sbjct  166   TSLGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDV  222

Query  616   GLKYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETF  437
             GL Y C  AERF++V +VL  +V  L E P  RLL++++RCYLRLS+ P      A +  
Sbjct  223   GLDYICTTAERFYAVSRVLENMVGTLAEQPSSRLLKHIIRCYLRLSDNPR-----ACDAL  277

Query  436   RRCLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             R CLP  L D  F + L DDP T R LQQ   ++ T+
Sbjct  278   RGCLPDILGDTAFQSCLRDDPMTRRWLQQLLHSVNTN  314



>ref|XP_010545571.1| PREDICTED: cell differentiation protein RCD1 homolog [Tarenaya 
hassleriana]
Length=318

 Score =   244 bits (622),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 140/275 (51%), Positives = 185/275 (67%), Gaps = 8/275 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ + L+  L NP+LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  LSP
Sbjct  36    ASAEHLVLDLSNPDLRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYPVLSP  95

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCN+LAL+QC+A+HPDTRM  ++A IP YLYPFL  +   +P E+LRLTS
Sbjct  96    PNLTPAQSNRVCNSLALLQCVASHPDTRMLFLKAHIPLYLYPFLNTTSKSRPFEYLRLTS  155

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  156   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  212

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L E P  RLL++++RCYLRLS+ P      A      
Sbjct  213   DYICTTAERFFAVGRVLGNMVASLVEQPSPRLLKHIIRCYLRLSDNPR-----ACAALGS  267

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             CL   L D  F + L +D    R LQQ   N+  S
Sbjct  268   CLSDSLRDGTFSSCLREDQTARRWLQQLLHNVGVS  302



>ref|XP_010544237.1| PREDICTED: cell differentiation protein RCD1 homolog [Tarenaya 
hassleriana]
Length=322

 Score =   244 bits (622),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 141/275 (51%), Positives = 186/275 (68%), Gaps = 8/275 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L NP+LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  LSP
Sbjct  36    ASAEQLVLDLCNPDLRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYPVLSP  95

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCN+LAL+QC+A+HPDTRM  ++A IP YLYPFL+ +   +P E+LRLTS
Sbjct  96    PNLTPAQSNRVCNSLALLQCVASHPDTRMLFLKAHIPLYLYPFLDTTSKSRPFEYLRLTS  155

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL  EV  LCLR +++G EL++TVAT IV KIL+ E GL
Sbjct  156   LGVIGALVKVDD---AEVISFLLSIEVVRLCLRTMEMGSELSKTVATFIVQKILLDEVGL  212

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFFSV +VLG +V  L E P  RLL++++RCYLRLS+ P      A      
Sbjct  213   DYICTKAERFFSVGRVLGNMVASLAEQPSPRLLKHIIRCYLRLSDNPR-----ACAVLGS  267

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             CLP  L D  F++ L +D    R LQQ   N+   
Sbjct  268   CLPDSLRDGTFVSCLREDQTARRWLQQLLHNVNVG  302



>ref|XP_006406348.1| hypothetical protein EUTSA_v10021160mg [Eutrema salsugineum]
 gb|ESQ47801.1| hypothetical protein EUTSA_v10021160mg [Eutrema salsugineum]
Length=316

 Score =   242 bits (618),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 138/272 (51%), Positives = 185/272 (68%), Gaps = 8/272 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L NP LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  L+P
Sbjct  36    ASAEQLVLDLSNPELRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYSVLAP  95

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCN+LAL+QC+A+H DTRM  ++A IP YLYPFL  +   +P E+LRLTS
Sbjct  96    PNLTPAQSNRVCNSLALLQCVASHSDTRMLFLKAHIPLYLYPFLNTTSKSRPFEYLRLTS  155

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + G+
Sbjct  156   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGM  212

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V+ L E P  RLL++++RCYLRLS+ P      A      
Sbjct  213   DYICTTAERFFAVGRVLGTMVQSLVEQPSPRLLKHIIRCYLRLSDNPR-----ACAALGS  267

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             CLP  L D  F N L +D    R LQQ   N+
Sbjct  268   CLPSSLQDGTFSNCLREDQIARRWLQQLVHNV  299



>ref|XP_009110170.1| PREDICTED: cell differentiation protein RCD1 homolog [Brassica 
rapa]
Length=312

 Score =   242 bits (618),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 138/275 (50%), Positives = 185/275 (67%), Gaps = 8/275 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L NP LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  L+P
Sbjct  32    ASAEQLVLDLSNPELRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYSVLAP  91

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCN+LAL+QC+A+H DTRM  ++A IP YLYPFL  +   +P E+LRLTS
Sbjct  92    PNLTPAQSNRVCNSLALLQCVASHSDTRMLFLKAHIPLYLYPFLNTTSKSRPFEYLRLTS  151

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + G+
Sbjct  152   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGM  208

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V+ L E P  RLL++++RCYLRLS+ P      A      
Sbjct  209   DYICTTAERFFAVGRVLGNMVQSLVEQPSPRLLKHIIRCYLRLSDNPR-----ACAALGS  263

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             CLP  L D  F N L +D    R LQQ   N+   
Sbjct  264   CLPDSLRDGTFSNCLREDQIARRWLQQLVHNVGVG  298



>emb|CDY27561.1| BnaC01g32440D [Brassica napus]
Length=312

 Score =   242 bits (618),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 138/275 (50%), Positives = 185/275 (67%), Gaps = 8/275 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L NP LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  L+P
Sbjct  32    ASAEQLVLDLSNPELRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYSVLAP  91

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCN+LAL+QC+A+H DTRM  ++A IP YLYPFL  +   +P E+LRLTS
Sbjct  92    PNLTPAQSNRVCNSLALLQCVASHSDTRMLFLKAHIPLYLYPFLNTTSKSRPFEYLRLTS  151

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + G+
Sbjct  152   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGM  208

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V+ L E P  RLL++++RCYLRLS+ P      A      
Sbjct  209   DYICTTAERFFAVGRVLGNMVQSLVEQPSPRLLKHIIRCYLRLSDNPR-----ACAALGS  263

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             CLP  L D  F N L +D    R LQQ   N+   
Sbjct  264   CLPDSLRDGTFSNCLREDQIARRWLQQLVHNVGVG  298



>ref|XP_009145585.1| PREDICTED: cell differentiation protein RCD1 homolog [Brassica 
rapa]
 emb|CDY19603.1| BnaA05g20110D [Brassica napus]
Length=313

 Score =   242 bits (618),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 138/272 (51%), Positives = 185/272 (68%), Gaps = 8/272 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L NP LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  L+P
Sbjct  33    ASAEQLVLDLSNPELRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYSVLAP  92

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCN+LAL+QC+A+H DTRM  ++A IP YLYPFL  +   +P E+LRLTS
Sbjct  93    PNLTPAQSNRVCNSLALLQCVASHSDTRMLFLKAHIPLYLYPFLNTTSKSRPFEYLRLTS  152

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + G+
Sbjct  153   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGM  209

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V+ L E P  RLL++++RCYLRLS+ P      A      
Sbjct  210   DYICTTAERFFAVGRVLGNMVQSLVEQPSPRLLKHIIRCYLRLSDNPR-----ACAALGS  264

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             CLP  L D  F N L +D    R LQQ   N+
Sbjct  265   CLPDSLRDGTFSNCLREDQIARRWLQQLVHNV  296



>ref|XP_006650687.1| PREDICTED: cell differentiation protein RCD1 homolog [Oryza brachyantha]
Length=284

 Score =   241 bits (615),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 139/276 (50%), Positives = 187/276 (68%), Gaps = 8/276 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L +P LRE A+  L+KKRE   +L  LLW+S+ T+  LLQE++S+Y  LSP
Sbjct  2     ASAEQLVLDLCDPELRENALLDLSKKREIFQDLAPLLWHSYGTIAALLQEIVSIYPSLSP  61

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               ++   S RVCNALAL+QC+A+H DTR+  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  62    PTLSPGASNRVCNALALLQCVASHSDTRIPFLTAHIPLYLYPFLNTTSKTRPFEYLRLTS  121

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL+TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  122   LGVIGALVKVDD---SEVIGFLLQTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  178

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
             +Y CA AERFF+V  VL ++V+ L E P  RLL++++RCYLRLSE      S A      
Sbjct  179   RYICATAERFFAVASVLSQMVQALAEQPSPRLLKHIIRCYLRLSE-----NSRACTALNS  233

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTSS  323
             CLP  L D    N L DD  T R LQQ   N+T + 
Sbjct  234   CLPTALKDGTLNNFLQDDHVTRRWLQQLLHNMTMAG  269



>ref|XP_010060296.1| PREDICTED: cell differentiation protein RCD1 homolog [Eucalyptus 
grandis]
 gb|KCW66960.1| hypothetical protein EUGRSUZ_F00722 [Eucalyptus grandis]
Length=320

 Score =   242 bits (618),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 152/310 (49%), Positives = 204/310 (66%), Gaps = 9/310 (3%)
 Frame = -2

Query  1258  MENLPETLCVDptaaapplalsaappgeasssiSQSATLDELLHMLHNPNLREEAMELLN  1079
             M NLP++L ++    A P A +    G  +S   + A+ ++L+  L NP+LRE A+  L+
Sbjct  3     MPNLPQSLSMNAPFGAGPGATAPGAAGPPASKDRKMASAEQLVLDLCNPDLRENALLELS  62

Query  1078  KKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKESTRVCNALALIQCMAAH  899
             KKRE   +L  LLWNS  T+  LLQE+I +Y  LSP  +T  +S RVCNALAL+QC+A+H
Sbjct  63    KKRELFQDLAPLLWNSVGTIAALLQEIIFIYPVLSPPNLTPAQSNRVCNALALLQCVASH  122

Query  898   PDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVKIEDPNAPEIVHFLLE  719
             PDTRM  ++A IP YLYPFL      +P E+LRLTSLGVIGALVK++D    E++ FLL 
Sbjct  123   PDTRMLFLKAHIPLYLYPFLNTGSKTRPFEYLRLTSLGVIGALVKVDD---TEVISFLLS  179

Query  718   TEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAERFFSVVQVLGRLVERL  539
             TE+ PLCLR +++G EL++TVAT IV KIL+ + GL Y C  AERF++V +VL  +V  L
Sbjct  180   TEIIPLCLRTMEMGSELSKTVATFIVQKILLDDLGLDYICTTAERFYAVGRVLNHMVGAL  239

Query  538   PETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDERFLNVLHDDPQTARM  359
              E P  RLL++++RCYLRL++ P      A +  R CLP  L D  F + L +DP T R 
Sbjct  240   AEQPSSRLLKHIIRCYLRLADNPR-----ACDALRGCLPEMLRDGTFNSCLREDPTTRRW  294

Query  358   LQQFFLNITT  329
             LQQ  LNI  
Sbjct  295   LQQ-LLNIVA  303



>ref|XP_010466285.1| PREDICTED: cell differentiation protein RCD1 homolog [Camelina 
sativa]
Length=316

 Score =   242 bits (618),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 138/272 (51%), Positives = 185/272 (68%), Gaps = 8/272 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L NP LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  L+P
Sbjct  36    ASAEQLVLDLSNPELRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYSVLAP  95

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCN+LAL+QC+A+H DTRM  ++A IP YLYPFL  +   +P E+LRLTS
Sbjct  96    PNLTPAQSNRVCNSLALLQCVASHSDTRMLFLKAHIPLYLYPFLNTTSKSRPFEYLRLTS  155

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + G+
Sbjct  156   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGM  212

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V+ L E P  RLL++++RCYLRLS+ P      A      
Sbjct  213   DYICTTAERFFAVGRVLGNMVQSLVEQPSPRLLKHIIRCYLRLSDNPR-----ACAALGS  267

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             CLP  L D  F N L +D    R LQQ   N+
Sbjct  268   CLPDSLRDGTFSNCLREDQIARRWLQQLVHNV  299



>ref|XP_005768296.1| hypothetical protein EMIHUDRAFT_414254 [Emiliania huxleyi CCMP1516]
 ref|XP_005788958.1| hypothetical protein EMIHUDRAFT_455065 [Emiliania huxleyi CCMP1516]
 gb|EOD15867.1| hypothetical protein EMIHUDRAFT_414254 [Emiliania huxleyi CCMP1516]
 gb|EOD36529.1| hypothetical protein EMIHUDRAFT_455065 [Emiliania huxleyi CCMP1516]
Length=289

 Score =   241 bits (615),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 140/276 (51%), Positives = 187/276 (68%), Gaps = 11/276 (4%)
 Frame = -2

Query  1141  DELLHM---LHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             +++ H+   L NP  RE A+  L+K+RE+  +L  +LW+SF T+  LLQE++++Y  LSP
Sbjct  18    EKIFHLVLELTNPEQREAALLELSKRRETFIDLAPILWHSFGTISALLQEIVAIYPLLSP  77

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T + S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTS
Sbjct  78    PSLTAQASNRVCNALALLQCVASHPETRTLFLNAHIPLFLYPFLNTISKTRPFEYLRLTS  137

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D   P++++FLL TE+ PLCLR ++ G EL++TVAT IV KIL+ E GL
Sbjct  138   LGVIGALVKVDD---PDVINFLLSTEIIPLCLRIMETGSELSKTVATFIVQKILLDETGL  194

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y CA AERF++V  VLG LV  L + P  RLL+++VRCYLRLS+ P      A E  R+
Sbjct  195   AYICATAERFYAVSTVLGNLVGSLVDQPSARLLKHIVRCYLRLSDNP-----RAREALRQ  249

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTSS  323
             CLP  L D  F   L DD  T R L Q   NIT S+
Sbjct  250   CLPDVLRDATFSACLKDDVTTKRWLTQLLFNITEST  285



>gb|EYU33659.1| hypothetical protein MIMGU_mgv1a010408mg [Erythranthe guttata]
Length=313

 Score =   242 bits (617),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 136/272 (50%), Positives = 187/272 (69%), Gaps = 8/272 (3%)
 Frame = -2

Query  1141  DELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRI  962
             ++LL  L+NP+LRE A+  L+KKRE   +L   +WNSF  V  LLQE++S+Y  LSP  +
Sbjct  36    EQLLLDLYNPDLRESALLELSKKREMFQDLAPWMWNSFGIVAALLQEIVSVYPVLSPPNL  95

Query  961   TTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGV  782
             T+ +S RVCNALAL+QC+A+H +TR   ++A IP YLYPFL  +   +P E+LRLTSLGV
Sbjct  96    TSPQSNRVCNALALLQCVASHSETRGLFLKAHIPLYLYPFLNTTSKSRPFEYLRLTSLGV  155

Query  781   IGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYC  602
             IGALVK++D    E+++FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL+Y 
Sbjct  156   IGALVKVDD---TEVINFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGLEYV  212

Query  601   CALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLP  422
             C  AERFF+V +VLG +V  L E P  RLL++++RCYLRLS+ P      A +  R  LP
Sbjct  213   CNTAERFFAVGRVLGTMVAALAEQPSSRLLKHIIRCYLRLSDNPR-----AADALRNALP  267

Query  421   PKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
                 D  F++ L +DP   R LQQ   N+  +
Sbjct  268   DTFRDATFISCLREDPTARRWLQQLLHNVQGA  299



>ref|XP_002993082.1| hypothetical protein SELMODRAFT_236668 [Selaginella moellendorffii]
 gb|EFJ05830.1| hypothetical protein SELMODRAFT_236668 [Selaginella moellendorffii]
Length=293

 Score =   241 bits (615),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 140/275 (51%), Positives = 185/275 (67%), Gaps = 8/275 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             AT ++L+  L  P  RE A+  L+KKRES  EL  +LW S  T+  LLQE++S+Y  LSP
Sbjct  2     ATAEQLVLELIVPEQRENALLDLSKKRESFQELAPMLWYSCGTIAALLQEIVSIYPMLSP  61

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T   S RVCNALAL+QC+A+HP+TR   + A IP YLYPFL      +P E+LRLTS
Sbjct  62    PTLTAGASNRVCNALALLQCVASHPETRTLFLNAHIPLYLYPFLNTVSKSRPFEYLRLTS  121

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    ++++FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  122   LGVIGALVKVDD---TDVINFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  178

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y CA AERFF+V  VLG +V+ L ETP  RLL++++RCYLRLS+ P      A E  + 
Sbjct  179   AYICATAERFFAVSAVLGNMVQALAETPSSRLLKHIIRCYLRLSDNPR-----ACEALKT  233

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             CLP  L D  F N L +D  T R L Q  +N+  +
Sbjct  234   CLPEYLRDNTFSNCLREDAGTRRWLTQLLINVGVA  268



>ref|XP_008455454.1| PREDICTED: cell differentiation protein rcd1 isoform X1 [Cucumis 
melo]
Length=301

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 132/270 (49%), Positives = 187/270 (69%), Gaps = 8/270 (3%)
 Frame = -2

Query  1144  LDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLR  965
             +DEL+  L++   RE A+ LL++KR     L +L+W+SF T++ LL+E++ +Y  LS   
Sbjct  35    VDELILALNHARTRERALHLLSQKRSMFDNLAVLIWHSFGTMFTLLKEIMDVYHLLSKPE  94

Query  964   ITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLG  785
             +T K STRVCNALAL+QC+A+HP+TR+  ++A+IP YLYPFL  ++ EKP E LRLTSLG
Sbjct  95    LTEKASTRVCNALALLQCVASHPETRVPFMKAEIPLYLYPFLNTTIKEKPHECLRLTSLG  154

Query  784   VIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKY  605
             VIGALVK+ D    E+++FLL+TE+ P CLRC+D+G  L++TVAT IV KIL+ EEGL+Y
Sbjct  155   VIGALVKVND---KEVIYFLLKTEIVPYCLRCMDVGKGLSKTVATFIVQKILMNEEGLRY  211

Query  604   CCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCL  425
             CC +A+RFF++ + L  ++E L E P  RLL+++VRCYL LSE P     +      R L
Sbjct  212   CCIIADRFFAITRALETMMETLSEEPSQRLLKHIVRCYLMLSESPRACLGLG-----RLL  266

Query  424   PPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             P  L+   F ++LHDDP      +Q    +
Sbjct  267   PRMLSHSAFTDLLHDDPTVMSSFKQLLRKV  296



>ref|XP_002975298.1| hypothetical protein SELMODRAFT_174818 [Selaginella moellendorffii]
 gb|EFJ23499.1| hypothetical protein SELMODRAFT_174818 [Selaginella moellendorffii]
Length=305

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 140/275 (51%), Positives = 185/275 (67%), Gaps = 8/275 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             AT ++L+  L  P  RE A+  L+KKRES  EL  +LW S  T+  LLQE++S+Y  LSP
Sbjct  14    ATAEQLVLELIVPEQRENALLDLSKKRESFQELAPMLWYSCGTIAGLLQEIVSIYPMLSP  73

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T   S RVCNALAL+QC+A+HP+TR   + A IP YLYPFL      +P E+LRLTS
Sbjct  74    PTLTAGASNRVCNALALLQCVASHPETRTLFLNAHIPLYLYPFLNTVSKSRPFEYLRLTS  133

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    ++++FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  134   LGVIGALVKVDD---TDVINFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  190

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y CA AERFF+V  VLG +V+ L ETP  RLL++++RCYLRLS+ P      A E  + 
Sbjct  191   AYICATAERFFAVSAVLGNMVQALAETPSSRLLKHIIRCYLRLSDNPR-----ACEALKT  245

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             CLP  L D  F N L +D  T R L Q  +N+  +
Sbjct  246   CLPEYLRDNTFSNCLREDAGTRRWLTQLLINVGVA  280



>ref|XP_009131304.1| PREDICTED: cell differentiation protein RCD1 homolog [Brassica 
rapa]
 emb|CDX78499.1| BnaA03g04110D [Brassica napus]
Length=300

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 136/272 (50%), Positives = 190/272 (70%), Gaps = 8/272 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             +T ++L+  + +PNLRE A+  L+K+RE   +L  LLW+SF T+  L QE+ S+Y+ L+P
Sbjct  22    STAEQLVLDICDPNLRENALLELSKRREIFQDLAPLLWHSFGTIAALTQEITSVYRLLTP  81

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T+ +S RVCNALAL+QC+A+HP+TRM  + A++P YLY FL  S   KP E+LRLTS
Sbjct  82    PNMTSAQSNRVCNALALLQCVASHPETRMLFLNAQMPLYLYAFLNTSSKSKPFEYLRLTS  141

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL+TE+ PLCLR +++G EL++TVAT IV K+L+ + GL
Sbjct  142   LGVIGALVKVDD---TEVIKFLLKTEIVPLCLRTMEMGSELSKTVATFIVQKVLLDDVGL  198

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
             +Y CA AERFF++ +VLG +V  L E P  RLL++++RCYLRL++        A E  R 
Sbjct  199   EYMCATAERFFALGRVLGNMVTSLAEGPSPRLLKHIIRCYLRLTD-----NQKACEALRN  253

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             CLP  L D  F + L DDP   + LQQ   NI
Sbjct  254   CLPDPLRDPSFSSCLCDDPSARQWLQQLIHNI  285



>ref|XP_002278757.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X2 [Vitis vinifera]
Length=319

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 137/275 (50%), Positives = 184/275 (67%), Gaps = 8/275 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ + L+  L NP LRE A+  L+K +E   +L   +WNSF T+  L+QE++S+Y  LSP
Sbjct  36    ASAENLVLELSNPELRENALLELSKNKELFQDLAPFVWNSFGTIAALIQEIVSIYPVLSP  95

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+H +TRM  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  96    PNLTPAQSNRVCNALALLQCVASHSETRMLFLNAHIPLYLYPFLNTNSKSRPFEYLRLTS  155

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  156   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  212

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L E    RLL++++RCYLRLS+ P      A +  R 
Sbjct  213   DYICTTAERFFAVGRVLGNMVAALAEQQSTRLLKHIIRCYLRLSDNPR-----ACDALRN  267

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             CLP  L D  F + L +DP T R LQQ   N+  S
Sbjct  268   CLPDMLKDATFSSCLREDPTTRRWLQQLLHNVGGS  302



>ref|XP_010644488.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X4 [Vitis vinifera]
Length=314

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 137/275 (50%), Positives = 185/275 (67%), Gaps = 8/275 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ + L+  L NP+LRE A+  L+K +E   +L   +WNSF T+  L+QE++S+Y  LSP
Sbjct  31    ASAESLVLELINPDLRENALLELSKNKELFQDLAPFVWNSFGTIAALIQEIVSIYPVLSP  90

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+H +TRM  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  91    PNLTPAQSNRVCNALALLQCVASHSETRMLFLNAHIPLYLYPFLNTNSKSRPFEYLRLTS  150

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  151   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  207

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L E    RLL++++RCYLRLS+ P      A +  R 
Sbjct  208   DYICTTAERFFAVGRVLGNMVAALAEQQSTRLLKHIIRCYLRLSDNPR-----ACDALRN  262

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             CLP  L D  F + L +DP T R LQQ   N+  S
Sbjct  263   CLPDMLKDATFSSCLREDPTTRRWLQQLLHNVGGS  297



>ref|XP_003558190.1| PREDICTED: cell differentiation protein RCD1 homolog [Brachypodium 
distachyon]
Length=356

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 139/278 (50%), Positives = 187/278 (67%), Gaps = 8/278 (3%)
 Frame = -2

Query  1141  DELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRI  962
             ++L+  L +P LRE A+  L+KKRE   +L  LLW+S+ T+  LLQE++S+Y  LSP  +
Sbjct  49    EQLVLDLCDPELRENALLDLSKKREIFQDLAPLLWHSYGTIAALLQEIVSIYPSLSPPTL  108

Query  961   TTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGV  782
             +   S RVCNALAL+QC+A+HPDTR+  + A IP YLYPFL  +   +P E+LRLTSLGV
Sbjct  109   SPVASNRVCNALALLQCVASHPDTRIPFLNAHIPLYLYPFLNTTSKTRPFEYLRLTSLGV  168

Query  781   IGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYC  602
             IGALVK++D    E++ FLL+TE+ PLCLR +++G EL++TVAT IV KIL+ + GL+Y 
Sbjct  169   IGALVKVDD---SEVIGFLLQTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDIGLRYI  225

Query  601   CALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLP  422
             CA AERFF+V  VL ++V+ L E P  RLL++++RCYLRL+E        A      CLP
Sbjct  226   CATAERFFAVATVLAQMVQALAEQPSARLLKHIIRCYLRLTE-----NQRACAALNSCLP  280

Query  421   PKLTDERFLNVLHDDPQTARMLQQFFLNITTSSS*RGN  308
               L D  F   L DD  T R LQQ   N+T +    GN
Sbjct  281   TVLKDGTFNTFLQDDHVTRRWLQQLLHNMTIAGMGGGN  318



>ref|XP_006298010.1| hypothetical protein CARUB_v10014055mg, partial [Capsella rubella]
 gb|EOA30908.1| hypothetical protein CARUB_v10014055mg, partial [Capsella rubella]
Length=356

 Score =   242 bits (617),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 138/272 (51%), Positives = 185/272 (68%), Gaps = 8/272 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L NP LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  L+P
Sbjct  76    ASAEQLVLDLSNPELRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYSVLAP  135

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCN+LAL+QC+A+H DTRM  ++A IP YLYPFL  +   +P E+LRLTS
Sbjct  136   PNLTPAQSNRVCNSLALLQCVASHSDTRMLFLKAHIPLYLYPFLNTTSKSRPFEYLRLTS  195

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + G+
Sbjct  196   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGM  252

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V+ L E P  RLL++++RCYLRLS+ P      A      
Sbjct  253   DYICTTAERFFAVGRVLGNMVQSLVEQPSPRLLKHIIRCYLRLSDNPR-----ACAALGS  307

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             CLP  L D  F N L +D    R LQQ   N+
Sbjct  308   CLPDSLRDGTFSNCLREDQIARRWLQQLVHNV  339



>gb|KHN38259.1| Cell differentiation protein RCD1 like [Glycine soja]
Length=316

 Score =   240 bits (613),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 137/272 (50%), Positives = 184/272 (68%), Gaps = 8/272 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+++ L+  L NP+LRE A+  L+KKRE   +L  LLWNS  T+  LLQE++S+Y  +SP
Sbjct  33    ASVEHLVLQLSNPDLRENALHELSKKRELFQDLAPLLWNSLGTMAALLQEIVSIYPAISP  92

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+H DTRM  + A IP Y YPFL  +   +P E+LRLT+
Sbjct  93    PNLTPAQSNRVCNALALLQCVASHLDTRMPFLNAHIPLYPYPFLNTTSKSRPFEYLRLTT  152

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVI ALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ E GL
Sbjct  153   LGVISALVKVDD---TEVISFLLSTEIIPLCLRSMEMGSELSKTVATFIVQKILLDEMGL  209

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
             KY C  AERF++V +VLG +V  L + P  RLL++++RCYLRLS+        A E  R 
Sbjct  210   KYICTTAERFYAVGRVLGNMVATLVQQPSCRLLKHIIRCYLRLSD-----NQSACEALRA  264

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             CLP  L D  F + L +DP   + LQQ   NI
Sbjct  265   CLPDMLRDATFSSCLREDPTARKWLQQLLHNI  296



>gb|EAY92084.1| hypothetical protein OsI_13789 [Oryza sativa Indica Group]
Length=329

 Score =   241 bits (614),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 138/276 (50%), Positives = 187/276 (68%), Gaps = 8/276 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L +P LRE A+  L+KKRE   +L  LLW+S+ T+  LLQE++S+Y  LSP
Sbjct  47    ASAEQLVLDLCDPELRENALLDLSKKREIFQDLAPLLWHSYGTIAALLQEIVSIYPSLSP  106

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               ++   S RVCNALAL+QC+A+H DTR+  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  107   PTLSPGASNRVCNALALLQCVASHSDTRIPFLNAHIPLYLYPFLNTTSKTRPFEYLRLTS  166

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL+TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  167   LGVIGALVKVDD---SEVIGFLLQTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  223

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
             +Y CA AERFF+V  VL ++V+ L + P  RLL++++RCYLRLSE      S A      
Sbjct  224   RYICATAERFFAVASVLSQMVQALADQPSPRLLKHIIRCYLRLSE-----NSRACTALNS  278

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTSS  323
             CLP  L D    N L DD  T R LQQ   N+T + 
Sbjct  279   CLPNALKDGTLNNFLQDDHVTRRWLQQLLHNMTMAG  314



>emb|CDY60389.1| BnaA01g36820D [Brassica napus]
Length=377

 Score =   242 bits (618),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 138/275 (50%), Positives = 185/275 (67%), Gaps = 8/275 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L NP LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  L+P
Sbjct  97    ASAEQLVLDLSNPELRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYSVLAP  156

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCN+LAL+QC+A+H DTRM  ++A IP YLYPFL  +   +P E+LRLTS
Sbjct  157   PNLTPAQSNRVCNSLALLQCVASHSDTRMLFLKAHIPLYLYPFLNTTSKSRPFEYLRLTS  216

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + G+
Sbjct  217   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGM  273

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V+ L E P  RLL++++RCYLRLS+ P      A      
Sbjct  274   DYICTTAERFFAVGRVLGNMVQSLVEQPSPRLLKHIIRCYLRLSDNPR-----ACAALGS  328

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             CLP  L D  F N L +D    R LQQ   N+   
Sbjct  329   CLPDSLRDGTFSNCLREDQIARRWLQQLVHNVGVG  363



>gb|AAK72897.1|AC091123_16 putative cell differentiation protein [Oryza sativa Japonica 
Group]
 gb|ABF99222.1| Cell differentiation protein rcd1, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAH00964.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE60052.1| hypothetical protein OsJ_12851 [Oryza sativa Japonica Group]
Length=330

 Score =   241 bits (614),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 138/276 (50%), Positives = 187/276 (68%), Gaps = 8/276 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L +P LRE A+  L+KKRE   +L  LLW+S+ T+  LLQE++S+Y  LSP
Sbjct  48    ASAEQLVLDLCDPELRENALLDLSKKREIFQDLAPLLWHSYGTIAALLQEIVSIYPSLSP  107

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               ++   S RVCNALAL+QC+A+H DTR+  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  108   PTLSPGASNRVCNALALLQCVASHSDTRIPFLNAHIPLYLYPFLNTTSKTRPFEYLRLTS  167

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL+TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  168   LGVIGALVKVDD---SEVIGFLLQTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  224

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
             +Y CA AERFF+V  VL ++V+ L + P  RLL++++RCYLRLSE      S A      
Sbjct  225   RYICATAERFFAVASVLSQMVQALADQPSPRLLKHIIRCYLRLSE-----NSRACTALNS  279

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTSS  323
             CLP  L D    N L DD  T R LQQ   N+T + 
Sbjct  280   CLPNALKDGTLNNFLQDDHVTRRWLQQLLHNMTMAG  315



>ref|XP_007014912.1| Cell differentiation, Rcd1-like protein isoform 4 [Theobroma 
cacao]
 gb|EOY32531.1| Cell differentiation, Rcd1-like protein isoform 4 [Theobroma 
cacao]
Length=322

 Score =   240 bits (613),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 138/273 (51%), Positives = 184/273 (67%), Gaps = 9/273 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ + L+  L NP+LRE A+  L+K +E   +L   +WNSF T+  L+QE++S+Y  LSP
Sbjct  38    ASAEHLVLDLSNPDLRENALLELSKNKELFQDLAPFVWNSFGTIAALIQEIVSIYPVLSP  97

Query  970   LRITTKESTRVCNALALIQ-CMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLT  794
               +T  +S RVCNALAL+Q C+A+HPDTRM  + A IP YLYPFL  +   +P E+LRLT
Sbjct  98    PNLTPAQSNRVCNALALLQQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRLT  157

Query  793   SLGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEG  614
             SLGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + G
Sbjct  158   SLGVIGALVKVDDT---EVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVG  214

Query  613   LKYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFR  434
             L Y C  AERFF+V +VLG +V  L E P  RLL++++RCYLRLS+ P      A +  R
Sbjct  215   LDYICTTAERFFAVGRVLGNMVAALAEQPSSRLLKHIIRCYLRLSDNPR-----ACDALR  269

Query  433   RCLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
              CLP  L D  F   L +D  T R LQQ   N+
Sbjct  270   SCLPDMLRDATFSTCLREDQTTRRWLQQLLHNV  302



>ref|XP_004297722.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
1 [Fragaria vesca subsp. vesca]
Length=319

 Score =   240 bits (612),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 137/275 (50%), Positives = 183/275 (67%), Gaps = 8/275 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ + L+  L NP+LRE A+  L+K +E   +L   +W SF T+  L+QE++S+Y  LSP
Sbjct  36    ASAEHLVLDLSNPDLRENALLELSKNKELFQDLAPFVWKSFGTIAALIQEIVSIYPVLSP  95

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  96    PNLTPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRLTS  155

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  156   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDMGL  212

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF+V +VLG +V  L E P  RLL++++RCYLRLSE P      A +  R 
Sbjct  213   DYICTTAERFFAVGRVLGNMVAALAEQPSSRLLKHIIRCYLRLSENPR-----ACDALRS  267

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             CLP  L D  F   L +D  T + LQ    N+  S
Sbjct  268   CLPDMLRDATFSTFLVEDATTRKWLQLLLQNVGGS  302



>ref|XP_006352520.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Solanum tuberosum]
Length=318

 Score =   239 bits (611),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 139/277 (50%), Positives = 189/277 (68%), Gaps = 10/277 (4%)
 Frame = -2

Query  1156  QSATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKL  977
             QSA  ++L+  L NPNLRE A+  L+KKRE   +LP LLW+SF T+ + LQE++S+Y  L
Sbjct  39    QSA--EQLVLDLCNPNLRENALLELSKKRELFQDLPPLLWHSFGTISVFLQEIVSIYPVL  96

Query  976   SPLRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRL  797
             SP  +T  +S RVCN LAL+QC+A+HPDTR+ L  A IP YLYPFL  +    P E+LRL
Sbjct  97    SPPNLTLAQSNRVCNVLALLQCVASHPDTRLLLFNAYIPLYLYPFLNTTSKSTPFEYLRL  156

Query  796   TSLGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEE  617
             TSLGVIGALVK+++    E++ FL+ TE+ P CL  +++G EL++TVAT IV KIL+ + 
Sbjct  157   TSLGVIGALVKVDN---TEVISFLVSTEIVPRCLCTMEMGSELSKTVATFIVEKILLDDV  213

Query  616   GLKYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETF  437
             GL Y C  ++RFF + QVLG +V  L E P  RLL++++RCYLRLS+ P      A +  
Sbjct  214   GLNYICTTSDRFFELAQVLGNMVGALAEQPSSRLLKHIIRCYLRLSDEPR-----ACQAL  268

Query  436   RRCLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             + CLP  L D+ F + L +DP T R LQQ  LN+  +
Sbjct  269   KICLPDMLRDDTFSSCLREDPITRRWLQQLLLNVNGN  305



>ref|XP_010096119.1| hypothetical protein L484_012474 [Morus notabilis]
 gb|EXB63284.1| hypothetical protein L484_012474 [Morus notabilis]
Length=308

 Score =   239 bits (609),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 136/255 (53%), Positives = 175/255 (69%), Gaps = 8/255 (3%)
 Frame = -2

Query  1090  ELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKESTRVCNALALIQC  911
              +L KKRE   +L  LLWNSF T+  LLQE++S+Y  LSP  +T  +S RVCNALAL+QC
Sbjct  45    SILIKKRELFQDLAPLLWNSFGTIAALLQEIVSIYPVLSPPNLTPAQSNRVCNALALLQC  104

Query  910   MAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVKIEDPNAPEIVH  731
             +A+HPDTRM  + A IP YLYPFL  +   +P E+LRLTSLGVIGALVK+++    E++ 
Sbjct  105   VASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRLTSLGVIGALVKVDE---TEVIS  161

Query  730   FLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAERFFSVVQVLGRL  551
             FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL Y C  AERFF+V +VLG +
Sbjct  162   FLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDMGLDYICTTAERFFAVGRVLGSM  221

Query  550   VERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDERFLNVLHDDPQ  371
             V  L E P  RLL++++RCYLRLS+ P      A E  R CLP  L D  F + L +DP 
Sbjct  222   VAALAEQPSSRLLKHIIRCYLRLSDNPR-----ACEALRSCLPDMLRDATFSSCLREDPT  276

Query  370   TARMLQQFFLNITTS  326
             T R LQQ   N+  S
Sbjct  277   TRRWLQQLLQNVGVS  291



>ref|XP_010941548.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X2 [Elaeis guineensis]
Length=282

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 130/251 (52%), Positives = 175/251 (70%), Gaps = 8/251 (3%)
 Frame = -2

Query  1078  KKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKESTRVCNALALIQCMAAH  899
             +KRE   +L  LLWNS+ T+  LLQE++S+Y  LSP  ++   S RVCNALAL+QC+A+H
Sbjct  24    EKREIFQDLAPLLWNSYGTIAALLQEIVSIYPYLSPPTLSPGASNRVCNALALLQCVASH  83

Query  898   PDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVKIEDPNAPEIVHFLLE  719
             PDTR+  + A IP YLYPFL  +   +P E+LRLTSLGVIGALVK++D    E++ FLL+
Sbjct  84    PDTRIHFLNAHIPLYLYPFLNTTSKTRPFEYLRLTSLGVIGALVKVDD---TEVIGFLLQ  140

Query  718   TEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAERFFSVVQVLGRLVERL  539
             TE+ PLCLR +++G EL++TVAT IV KIL+ + GL+Y CA A+RF++V QVLG +V  L
Sbjct  141   TEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGLRYICATADRFYAVGQVLGSMVTSL  200

Query  538   PETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDERFLNVLHDDPQTARM  359
              E P  RLL++++RCY RLSE P      A ++ + CLP  L D  F N L DDP T   
Sbjct  201   AEQPSTRLLKHIIRCYQRLSEHPR-----ACDSLKNCLPDMLKDGTFNNCLRDDPGTREW  255

Query  358   LQQFFLNITTS  326
             LQQ   N++ +
Sbjct  256   LQQLQDNVSGA  266



>emb|CDX70486.1| BnaC03g05700D [Brassica napus]
Length=301

 Score =   238 bits (606),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 135/271 (50%), Positives = 188/271 (69%), Gaps = 8/271 (3%)
 Frame = -2

Query  1147  TLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPL  968
             T ++L+  + +PNLRE A+  L+K+RE   +L  LLW+SF T+  L QE+ S+Y+ L+P 
Sbjct  24    TAEQLVLDICDPNLRENALLELSKRREIFQDLAPLLWHSFGTIAALTQEITSVYRLLTPP  83

Query  967   RITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSL  788
              +T+ +S RVCNALAL+QC+A+HP+TRM  + A++P YLY FL  S   KP E+LRLTSL
Sbjct  84    NMTSAQSNRVCNALALLQCVASHPETRMLFLNAQMPLYLYAFLNTSSKSKPFEYLRLTSL  143

Query  787   GVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLK  608
             GVIGALVK++D    E++ FLL+TE+ PLCLR +++G EL++TVAT IV K+L+ + GL+
Sbjct  144   GVIGALVKVDD---TEVIKFLLKTEIVPLCLRTMEMGSELSKTVATFIVQKVLLDDVGLE  200

Query  607   YCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRC  428
             Y C  AERFF++ +VLG +V  L E P  RLL++++RCYLRL++        A E  R C
Sbjct  201   YMCTTAERFFALGRVLGNMVTSLAEGPSPRLLKHIIRCYLRLTD-----NQKACEALRNC  255

Query  427   LPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             LP  L D  F + L DDP   + LQQ   NI
Sbjct  256   LPDLLRDPSFSSCLCDDPSARQWLQQLIHNI  286



>ref|XP_009417900.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=319

 Score =   238 bits (608),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 140/272 (51%), Positives = 187/272 (69%), Gaps = 10/272 (4%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L  P+LRE A+  L+K RE   +L  LLWN++ T+  LLQE++S+Y  LSP
Sbjct  39    ASAEQLVLDLCEPDLRENALGELSK-REIFQDLAPLLWNAYGTIAALLQEIVSIYPFLSP  97

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               ++   S RVCNALAL+QC+A+HPDTR+  + A IP YLYPFL  +   KP E+LRLTS
Sbjct  98    PTLSPGASNRVCNALALLQCVASHPDTRILFLNAHIPLYLYPFLNTTSKTKPFEYLRLTS  157

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL+TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  158   LGVIGALVKVDD---TEVISFLLQTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  214

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
             +Y CA AERF++V QVLG +V  L E P  RLL++++RCYLRLSE P      A  +   
Sbjct  215   RYICATAERFYAVGQVLGSMVTSLAEQPSARLLKHIIRCYLRLSEHPR-----ACGSLNN  269

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             CLP  L D  F N + DDP T   LQQ   N+
Sbjct  270   CLPNMLKDGSFNNYI-DDPTTRHWLQQLLHNV  300



>gb|KDP30773.1| hypothetical protein JCGZ_13716 [Jatropha curcas]
Length=318

 Score =   237 bits (605),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 125/277 (45%), Positives = 174/277 (63%), Gaps = 14/277 (5%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             +L+H + NP  RE A+ +L+K R    +L  LLW+SF T+  LLQE+IS+Y  LS   +T
Sbjct  28    QLIHEIQNPETRERALYILSKNRAVRGDLAPLLWHSFGTITTLLQEIISVYHLLSSPYLT  87

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
              K S +VCNAL L+Q +AAHPDT+M  ++AKIP YL  FL  +  EK  EFLRL+SLGVI
Sbjct  88    DKASNKVCNALVLLQGIAAHPDTKMLFIKAKIPLYLTAFLNNTNKEKSHEFLRLSSLGVI  147

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK++D    ++V FLL +E+ P  LRC+++G+EL++TVAT IV +IL+ +EGLKYC 
Sbjct  148   GALVKVDD---AQVVRFLLSSEILPSVLRCMEVGNELSKTVATFIVYRILLNDEGLKYCS  204

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrL------SELPTPLRSMAMETF  437
              LA+RFF++  VL +++E+L E   +   +        +      SE P      A +  
Sbjct  205   VLADRFFAIGHVLAKMIEKLAEDGRIAEDQSKRLLKHIIWCYHRLSESPR-----ACDGL  259

Query  436   RRCLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             R CLP KL D  F+NV+ DD      L Q F N+   
Sbjct  260   RCCLPMKLRDSSFINVIRDDQTAMHCLGQLFHNVAAG  296



>emb|CAE05211.3| OSJNBa0070C17.18 [Oryza sativa Japonica Group]
Length=341

 Score =   238 bits (606),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 142/291 (49%), Positives = 189/291 (65%), Gaps = 23/291 (8%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L +P LRE A+  L+KKRE   +L  LLW+SF TV  LLQE++S+Y  LSP
Sbjct  44    ASAEQLVLDLCDPELRENALLELSKKREIFQDLAPLLWHSFGTVAALLQEIVSIYSALSP  103

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRA---------------KIPAYLYPFLE  836
               ++   S RVCNALAL+QC+A+HP+TR+  +                  IP YLYPFL 
Sbjct  104   PTLSPGASNRVCNALALLQCVASHPETRILFLTVLVFETHEDEDKVGAPHIPLYLYPFLN  163

Query  835   PSVNEKPLEFLRLTSLGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTV  656
              +   +P E+LRLTSLGVIGALVK++D    E++ FLL+TE+ PLCLR +++G EL++TV
Sbjct  164   TTSKTRPFEYLRLTSLGVIGALVKVDD---TEVISFLLQTEIIPLCLRTMEMGSELSKTV  220

Query  655   ATLIVMKILVQEEGLKYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSE  476
             AT IV KIL+ + GL+Y CA AERFF+V  VL  +V  L E P  RLL++++RCYLRLS+
Sbjct  221   ATFIVQKILLDDVGLRYICATAERFFAVGSVLANMVVSLAEQPSTRLLKHIIRCYLRLSD  280

Query  475   LPTPLRSMAMETFRRCLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTSS  323
                   S A    + CLP  L D  F N L DDP T R LQQ  LN+T + 
Sbjct  281   -----NSRACAALQTCLPDMLKDGTFNNCLRDDPTTRRWLQQLLLNVTGAG  326



>dbj|BAK04786.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK05202.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=418

 Score =   240 bits (612),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 136/273 (50%), Positives = 186/273 (68%), Gaps = 8/273 (3%)
 Frame = -2

Query  1117  NPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKESTRV  938
             +P LRE+A+  L KKRE   +L  LLW+SF T+  LLQE++S+Y  LSP  ++   S RV
Sbjct  54    DPELREKALFELFKKREIFQDLAPLLWHSFGTIAALLQEIVSIYPSLSPPTLSPVASNRV  113

Query  937   CNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVKIE  758
             CNALAL+QC+A+HP+TR+  + A IP YLYPFL  +   +P E+LRLTSLGVIGALVK++
Sbjct  114   CNALALLQCVASHPETRIPFLNAHIPLYLYPFLNTTSKTRPFEYLRLTSLGVIGALVKVD  173

Query  757   DPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAERFF  578
             D    E++ FLL+TE+ PLCLR +++G EL++TVAT IV KIL+ + GL+Y CA AERFF
Sbjct  174   D---SEVIGFLLQTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDIGLRYICATAERFF  230

Query  577   SVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDERF  398
             +V  VL ++V+ L E P  RLL++++RCYLRL+E        A      CLP  L D  F
Sbjct  231   AVATVLAQMVQALAEQPSARLLKHIIRCYLRLTE-----NQRACAALNSCLPTVLKDGTF  285

Query  397   LNVLHDDPQTARMLQQFFLNITTSSS*RGNIYS  299
              + LHDD  T R LQQ   N++ +    G+ ++
Sbjct  286   NSFLHDDNVTRRWLQQLLSNMSIAGMGGGSSHA  318



>emb|CBJ25574.1| conserved unknown protein [Ectocarpus siliculosus]
Length=351

 Score =   238 bits (606),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 141/277 (51%), Positives = 191/277 (69%), Gaps = 8/277 (3%)
 Frame = -2

Query  1156  QSATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKL  977
             ++A   +L+  L NP+ RE A+  L+KKRE+  +L  +LW+S+ T+  LLQE++++Y  L
Sbjct  64    RTAEDTQLVLQLTNPDQREGALLELSKKREAFTDLAPILWHSYGTISALLQEMVAIYPLL  123

Query  976   SPLRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRL  797
             SP  +T   S RVCNALAL+QC+A+HP+TR   ++A IP YLYPFL      +P E+LRL
Sbjct  124   SPPTLTPHASNRVCNALALLQCVASHPETRALFLKAHIPLYLYPFLNTVSKNRPFEYLRL  183

Query  796   TSLGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEE  617
             TSLGVIGALVK++D    E+++FLL+TE+ PLCLR ++ G EL++TVAT IV KIL+ E 
Sbjct  184   TSLGVIGALVKMDD---AEVINFLLQTEIIPLCLRIMETGSELSKTVATFIVQKILLDEH  240

Query  616   GLKYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETF  437
             GL+Y C  AERF++V  VLG +V  L E+P +RLL++VVRCYLRLS+    LR  A E  
Sbjct  241   GLEYICQTAERFYAVSTVLGNMVAVLVESPSVRLLKHVVRCYLRLSD---NLR--AREAL  295

Query  436   RRCLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             R+CLP  L +  F NVL DD    R L     N+T S
Sbjct  296   RQCLPDALRNNTFTNVLKDDVSVKRWLTSLLFNLTES  332



>dbj|BAF01487.1| hypothetical protein [Arabidopsis thaliana]
Length=293

 Score =   235 bits (599),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 134/276 (49%), Positives = 185/276 (67%), Gaps = 8/276 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             ++ ++L+  L NP LRE A+  L+KKRE   +L  LLW+S  T+  LLQE+I++Y  LSP
Sbjct  14    SSAEQLILDLSNPELRENALHELSKKREIFQDLAPLLWHSVGTIPALLQEIIAVYPALSP  73

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+H DTRM  ++A +P YLY FL  S   +P E+LRLTS
Sbjct  74    PTMTPAQSNRVCNALALLQCVASHTDTRMLFLKAHLPLYLYAFLNTSSKSRPFEYLRLTS  133

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL+TE+ PLCLR ++ G EL++TVAT IV K+L+ + GL
Sbjct  134   LGVIGALVKVDD---TEVIRFLLQTEIVPLCLRTMENGSELSKTVATFIVQKVLLDDVGL  190

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
             +Y C  AERFF++ +VLG +V  L E P  RLL++++RCYLRL++ P      A +    
Sbjct  191   EYMCTTAERFFALGRVLGNMVTSLAEGPSARLLKHIIRCYLRLTDNPR-----ACDALGS  245

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTSS  323
             CLP  L D  F   L+DDP   + LQQ   N+    
Sbjct  246   CLPDLLRDATFSGCLYDDPPAMQWLQQLLHNVNVGG  281



>ref|XP_001754931.1| predicted protein [Physcomitrella patens]
 gb|EDQ80385.1| predicted protein [Physcomitrella patens]
Length=292

 Score =   234 bits (598),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 137/272 (50%), Positives = 184/272 (68%), Gaps = 8/272 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L  P  RE A+  L+KKRE+  +L  +LW+S  T+  LLQE++S+Y  LSP
Sbjct  2     ASAEQLVLELIVPEQRENALLDLSKKREAFPDLAPILWHSCGTIAALLQEIVSIYPMLSP  61

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T   S RVCNALAL+QC+A+HPDTR   + A IP YLYPFL      +P E+LRLTS
Sbjct  62    PTLTAGASNRVCNALALLQCVASHPDTRALFLNAHIPLYLYPFLNTVSKTRPFEYLRLTS  121

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E+++FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  122   LGVIGALVKVDD---TEVINFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  178

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y CA AERFF+V  VL  +V+ L E P +RLL++++RCYLRLS+ P      A E  + 
Sbjct  179   AYICATAERFFAVSAVLANMVQMLAEQPSVRLLKHIIRCYLRLSDNPR-----ACEALKN  233

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             CLP  L +  F N L DD  T R L Q  +N+
Sbjct  234   CLPELLQNGTFNNCLRDDLTTRRWLNQLMMNV  265



>ref|XP_003580537.1| PREDICTED: cell differentiation protein rcd1-like [Brachypodium 
distachyon]
Length=320

 Score =   236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 135/278 (49%), Positives = 188/278 (68%), Gaps = 8/278 (3%)
 Frame = -2

Query  1156  QSATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKL  977
             + A++++L+  L +  LRE  +  L+KKRE   +L +LLW+S+ T+  LLQE++S+Y  L
Sbjct  46    KQASVEQLVLDLCDRELRENTLLELSKKREVFQDLALLLWHSYGTIAALLQEIVSIYPAL  105

Query  976   SPLRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRL  797
             SP  ++   S RVCNALAL+QC+A+HPDTR+  + A IP +LYPFL      +P E+LRL
Sbjct  106   SPPTLSPGASNRVCNALALLQCVASHPDTRIHFLHAHIPLFLYPFLNTFSKTRPFEYLRL  165

Query  796   TSLGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEE  617
             TSLGVIGALVKI+D    E++ FLL+TE+ PLCLR +++G EL++TV+T IV KI++ + 
Sbjct  166   TSLGVIGALVKIDD---TEVIGFLLQTEIIPLCLRTMEMGSELSKTVSTFIVQKIMLDDI  222

Query  616   GLKYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETF  437
             GL+Y CA  ERF++V  VLG +V  L + P  RLL++++RCYLRLS+ P      A    
Sbjct  223   GLRYVCATIERFYAVSNVLGAMVVSLADLPSTRLLKHIIRCYLRLSDNPR-----ACFEL  277

Query  436   RRCLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTSS  323
             + CLP  L D  F   L DDP T R LQQ   N+T S 
Sbjct  278   QTCLPDMLKDGTFHVSLKDDPTTRRWLQQLLHNVTASG  315



>ref|XP_006399783.1| hypothetical protein EUTSA_v10014186mg [Eutrema salsugineum]
 gb|ESQ41236.1| hypothetical protein EUTSA_v10014186mg [Eutrema salsugineum]
Length=307

 Score =   235 bits (599),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 133/265 (50%), Positives = 182/265 (69%), Gaps = 8/265 (3%)
 Frame = -2

Query  1117  NPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKESTRV  938
             NP LRE A+  L+KKRE   +L  LLW+S  T+  LLQE+IS+Y  LSP  +T  +S RV
Sbjct  39    NPELRENALHELSKKREIFQDLAPLLWHSVGTIAALLQEIISVYHVLSPPTMTPAQSNRV  98

Query  937   CNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVKIE  758
             CNALAL+QC+A+HP+TRM  ++A++P YLY FL  S   +P E+LRLTSLGVIGALVK++
Sbjct  99    CNALALLQCVASHPETRMLFLKAQLPLYLYAFLNTSSKSRPFEYLRLTSLGVIGALVKVD  158

Query  757   DPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAERFF  578
             D    E++ FLL+TE+ PLCLR ++ G EL++TVAT IV K+L+ + GL+Y C  AERFF
Sbjct  159   D---TEVIRFLLKTEIVPLCLRTMENGSELSKTVATFIVQKVLLDDVGLEYMCTTAERFF  215

Query  577   SVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDERF  398
             ++ +VLG +V  L E P  RLL++++RCYLRL++ P      A +    CLP  L D  F
Sbjct  216   ALGRVLGNMVTSLAEGPSPRLLKHIIRCYLRLTDNPR-----ACDALGNCLPSLLRDATF  270

Query  397   LNVLHDDPQTARMLQQFFLNITTSS  323
              + L+DDP   + LQQ   N++   
Sbjct  271   SSCLYDDPPARQWLQQLLHNVSVGG  295



>ref|XP_002873591.1| hypothetical protein ARALYDRAFT_909249 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49850.1| hypothetical protein ARALYDRAFT_909249 [Arabidopsis lyrata subsp. 
lyrata]
Length=308

 Score =   235 bits (599),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 136/273 (50%), Positives = 183/273 (67%), Gaps = 8/273 (3%)
 Frame = -2

Query  1141  DELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRI  962
             ++L+  L NP LRE A+  L+KKRE   +L  LLW+S  T+  LLQE+IS+Y  LSP  +
Sbjct  32    EQLILDLSNPELRENALHELSKKREIFQDLAPLLWHSVGTIPALLQEIISVYPVLSPPTM  91

Query  961   TTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGV  782
             T  +S RVCNALAL+QC+A+H DTRM  ++A +P YLY FL  S   +P E+LRLTSLGV
Sbjct  92    TPAQSNRVCNALALLQCVASHTDTRMLFLKAHLPLYLYAFLNTSSKSRPFEYLRLTSLGV  151

Query  781   IGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYC  602
             IGALVK++D    E++ FLL+TE+ PLCLR ++ G EL++TVAT IV K+L+ + GL+Y 
Sbjct  152   IGALVKVDD---TEVIRFLLQTEIVPLCLRTMENGSELSKTVATFIVQKVLLDDVGLEYM  208

Query  601   CALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLP  422
             C  AERFF++ +VLG +V  L E P  RLL++++RCYLRL++ P      A +    CLP
Sbjct  209   CTTAERFFALGRVLGNMVTSLAEGPSPRLLKHIIRCYLRLTDNPR-----ACDALGSCLP  263

Query  421   PKLTDERFLNVLHDDPQTARMLQQFFLNITTSS  323
               L D  F   L+DDP   + LQQ   NI    
Sbjct  264   DLLRDATFSGCLYDDPPAMQWLQQLLHNIKVGG  296



>ref|XP_009830183.1| hypothetical protein H257_06600 [Aphanomyces astaci]
 gb|ETV80259.1| hypothetical protein H257_06600 [Aphanomyces astaci]
Length=307

 Score =   235 bits (599),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 138/282 (49%), Positives = 189/282 (67%), Gaps = 11/282 (4%)
 Frame = -2

Query  1141  DELLHM---LHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             D+L H+   L  P  RE A+  L+KKRE   EL  +LW+SF TV  LLQE+IS+Y  LSP
Sbjct  22    DQLYHLVLELSVPEQREGALLELSKKREEFPELAPILWHSFGTVAALLQEIISIYPLLSP  81

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
              ++T   S RVCNALAL+QC+A+H +TR   + A IP YLYPFL      +P E+LRLTS
Sbjct  82    PQLTAHASNRVCNALALLQCVASHAETRTHFLNAHIPLYLYPFLNTVSKNRPFEYLRLTS  141

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVKI+D    ++++FLL+TE+ PLCLR ++ G EL++TVAT IV KIL+ E GL
Sbjct  142   LGVIGALVKIDD---TDVINFLLQTEIIPLCLRIMEAGSELSKTVATFIVQKILLDEMGL  198

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C   ERF++V  VL ++V  L E P  RLL++++RCYLRLS+      + A +  R+
Sbjct  199   TYICHTPERFYAVGSVLSKMVTMLVEAPSTRLLKHIIRCYLRLSD-----NARAKDALRQ  253

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTSSS*RGNI  305
             CLP  L ++ F +VL +D  T+R L Q   N+  +S+  G++
Sbjct  254   CLPEVLQNQTFDDVLKEDMTTSRWLSQLLYNLHDTSNTSGSV  295



>ref|XP_010327177.1| PREDICTED: cell differentiation protein RCD1 homolog [Solanum 
lycopersicum]
 ref|XP_010327178.1| PREDICTED: cell differentiation protein RCD1 homolog [Solanum 
lycopersicum]
 ref|XP_010327179.1| PREDICTED: cell differentiation protein RCD1 homolog [Solanum 
lycopersicum]
 ref|XP_010327180.1| PREDICTED: cell differentiation protein RCD1 homolog [Solanum 
lycopersicum]
 ref|XP_010327181.1| PREDICTED: cell differentiation protein RCD1 homolog [Solanum 
lycopersicum]
 ref|XP_010327182.1| PREDICTED: cell differentiation protein RCD1 homolog [Solanum 
lycopersicum]
 ref|XP_010327183.1| PREDICTED: cell differentiation protein RCD1 homolog [Solanum 
lycopersicum]
 ref|XP_010327184.1| PREDICTED: cell differentiation protein RCD1 homolog [Solanum 
lycopersicum]
 ref|XP_010327185.1| PREDICTED: cell differentiation protein RCD1 homolog [Solanum 
lycopersicum]
 ref|XP_010327186.1| PREDICTED: cell differentiation protein RCD1 homolog [Solanum 
lycopersicum]
 ref|XP_010327187.1| PREDICTED: cell differentiation protein RCD1 homolog [Solanum 
lycopersicum]
Length=317

 Score =   235 bits (599),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 135/277 (49%), Positives = 185/277 (67%), Gaps = 8/277 (3%)
 Frame = -2

Query  1156  QSATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKL  977
             Q  +  +L+  + NPNLRE A+  L+K RE   +L  +LW+SF T+ + +QE+IS+Y  L
Sbjct  36    QMQSAQQLVLDICNPNLRENALLELSKMREIFEDLAPVLWHSFGTIVVFVQEIISVYPVL  95

Query  976   SPLRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRL  797
             SP  +T  +S RVCN LAL+QC+A+HPDTRM L+ A IP YLYPFL  ++   P E LRL
Sbjct  96    SPPNLTPAQSNRVCNVLALLQCVASHPDTRMLLLHAYIPLYLYPFLNTTIRSTPFEHLRL  155

Query  796   TSLGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEE  617
             TSLGVIGALVKI++    E++ FL+ TE+ P CL  +++G EL++TVAT IV KIL+ + 
Sbjct  156   TSLGVIGALVKIDN---TEVISFLVSTEIVPRCLCSMEMGSELSKTVATFIVQKILLDDV  212

Query  616   GLKYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETF  437
             GLKY C  + RFF V Q LG +V  L + P  RLL+Y++RCYLRLS+ P      A +  
Sbjct  213   GLKYICTTSNRFFEVAQALGNMVGALAQQPSSRLLKYIIRCYLRLSDEPR-----ACQAL  267

Query  436   RRCLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             + CLP +L D+ F + L +DP T   LQQ  LN+  +
Sbjct  268   KNCLPDRLRDDTFSSCLSEDPTTRTWLQQLLLNVNGN  304



>ref|NP_196802.1| Cell differentiation, Rcd1-like protein [Arabidopsis thaliana]
 emb|CAB88262.1| putative protein [Arabidopsis thaliana]
 gb|AAO25630.1| phytochrome interacting molecule 1 [Arabidopsis thaliana]
 gb|AED91837.1| Cell differentiation, Rcd1-like protein [Arabidopsis thaliana]
Length=311

 Score =   235 bits (599),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 134/276 (49%), Positives = 185/276 (67%), Gaps = 8/276 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             ++ ++L+  L NP LRE A+  L+KKRE   +L  LLW+S  T+  LLQE+I++Y  LSP
Sbjct  32    SSAEQLILDLSNPELRENALHELSKKREIFQDLAPLLWHSVGTIPALLQEIIAVYPALSP  91

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+H DTRM  ++A +P YLY FL  S   +P E+LRLTS
Sbjct  92    PTMTPAQSNRVCNALALLQCVASHTDTRMLFLKAHLPLYLYAFLNTSSKSRPFEYLRLTS  151

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL+TE+ PLCLR ++ G EL++TVAT IV K+L+ + GL
Sbjct  152   LGVIGALVKVDD---TEVIRFLLQTEIVPLCLRTMENGSELSKTVATFIVQKVLLDDVGL  208

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
             +Y C  AERFF++ +VLG +V  L E P  RLL++++RCYLRL++ P      A +    
Sbjct  209   EYMCTTAERFFALGRVLGNMVTSLAEGPSARLLKHIIRCYLRLTDNPR-----ACDALGS  263

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTSS  323
             CLP  L D  F   L+DDP   + LQQ   N+    
Sbjct  264   CLPDLLRDATFSGCLYDDPPAMQWLQQLLHNVNVGG  299



>ref|XP_009417910.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=259

 Score =   233 bits (594),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 132/248 (53%), Positives = 172/248 (69%), Gaps = 9/248 (4%)
 Frame = -2

Query  1078  KKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKESTRVCNALALIQCMAAH  899
             KKRE   +L  LLWN++ T+  LLQE++S+Y  LSP  ++   S RVCNALAL+QC+A+H
Sbjct  2     KKREIFQDLAPLLWNAYGTIAALLQEIVSIYPFLSPPTLSPGASNRVCNALALLQCVASH  61

Query  898   PDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVKIEDPNAPEIVHFLLE  719
             PDTR+  + A IP YLYPFL  +   KP E+LRLTSLGVIGALVK++D    E++ FLL+
Sbjct  62    PDTRILFLNAHIPLYLYPFLNTTSKTKPFEYLRLTSLGVIGALVKVDD---TEVISFLLQ  118

Query  718   TEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAERFFSVVQVLGRLVERL  539
             TE+ PLCLR +++G EL++TVAT IV KIL+ + GL+Y CA AERF++V QVLG +V  L
Sbjct  119   TEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGLRYICATAERFYAVGQVLGSMVTSL  178

Query  538   PETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDERFLNVLHDDPQTARM  359
              E P  RLL++++RCYLRLSE P      A  +   CLP  L D  F N + DDP T   
Sbjct  179   AEQPSARLLKHIIRCYLRLSEHPR-----ACGSLNNCLPNMLKDGSFNNYI-DDPTTRHW  232

Query  358   LQQFFLNI  335
             LQQ   N+
Sbjct  233   LQQLLHNV  240



>ref|XP_008861004.1| hypothetical protein H310_00133 [Aphanomyces invadans]
 gb|ETW09593.1| hypothetical protein H310_00133 [Aphanomyces invadans]
Length=313

 Score =   234 bits (598),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 139/282 (49%), Positives = 189/282 (67%), Gaps = 11/282 (4%)
 Frame = -2

Query  1141  DELLHM---LHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             D+L H+   L  P  RE A+  L+KKRE   EL  +LW+SF TV  LLQE+IS+Y  LSP
Sbjct  25    DQLYHLVLELSVPEQREGALLELSKKREEFPELAPILWHSFGTVAALLQEIISIYPLLSP  84

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
              ++T   S RVCNALAL+QC+A+H +TR   + A IP YLYPFL      +P E+LRLTS
Sbjct  85    PQLTAHASNRVCNALALLQCVASHAETRTHFLNAHIPLYLYPFLNTVSKNRPFEYLRLTS  144

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVKI+D    ++++FLL+TE+ PLCLR ++ G EL++TVAT IV KIL+ E GL
Sbjct  145   LGVIGALVKIDD---TDVINFLLQTEIIPLCLRIMEAGSELSKTVATFIVQKILLDEMGL  201

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C   ERF++V  VL ++V  L E P  RLL++++RCYLRLS+      + A +  R+
Sbjct  202   TYICHTPERFYAVGSVLSKMVTMLVEAPSTRLLKHIIRCYLRLSD-----NARAKDALRQ  256

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTSSS*RGNI  305
             CLP  L ++ F +VL +D  T+R L Q   N+  +S+  G+I
Sbjct  257   CLPEVLQNQTFDDVLKEDLTTSRWLSQLLYNLHDTSNTSGSI  298



>gb|KFK25534.1| hypothetical protein AALP_AA8G127600 [Arabis alpina]
Length=304

 Score =   234 bits (597),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 125/272 (46%), Positives = 178/272 (65%), Gaps = 3/272 (1%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             +L++ L NP LRE+A+  L+KKR+   +L  LLW+S  T+ +LLQEVI++Y  LSP  +T
Sbjct  33    QLINDLINPELREQALSDLSKKRDLFNDLAPLLWHSPCTIPVLLQEVIAVYPALSPPTMT  92

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+H +TR   ++A+IP YLY FL  S + KP E+LRLTSLGVI
Sbjct  93    AVQSNRVCNALALLQCVASHTETRALFIKAQIPLYLYAFLNTSSSSKPFEYLRLTSLGVI  152

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK++D   P+++ FLL+TE+ PLCLR ++ G+EL++TVAT IV K+L+ + GL+Y C
Sbjct  153   GALVKVDD---PDVIRFLLQTEIVPLCLRTMENGNELSKTVATFIVQKVLLDDIGLEYMC  209

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
             A AERFF++ +VLG ++  L ETP        +  ++    L       A +    CLP 
Sbjct  210   ATAERFFALSRVLGNMIATLVETPSPTSTTSRLLKHIIRCFLRLTDNHRACDALVNCLPE  269

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNITTSS  323
              L D  F   L+DD      LQQ   N+  ++
Sbjct  270   LLKDPNFSRCLYDDQHAKLWLQQLIHNVNVAA  301



>ref|XP_008794447.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X3 [Phoenix dactylifera]
Length=275

 Score =   233 bits (595),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 132/255 (52%), Positives = 174/255 (68%), Gaps = 8/255 (3%)
 Frame = -2

Query  1087  LLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKESTRVCNALALIQCM  908
             L+ +KRE   +L  LLWNS+ T+  LLQE++S+Y  LSP  ++   S RVCNALAL+QC+
Sbjct  13    LVWQKREIFQDLAPLLWNSYGTIAALLQEIVSIYPALSPPTLSPAASNRVCNALALLQCV  72

Query  907   AAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVKIEDPNAPEIVHF  728
             A+HPDTR+  + A IP YLYPFL  +   +P E+LRLTSLGVIGALVK++D    E++ F
Sbjct  73    ASHPDTRILFLNAHIPLYLYPFLNTTSKTRPFEYLRLTSLGVIGALVKVDD---TEVISF  129

Query  727   LLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAERFFSVVQVLGRLV  548
             LL+TE+ PLCLR +++G EL++TVAT IV KIL+ + GL+Y CA AERFF+V  VL  +V
Sbjct  130   LLQTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDIGLQYICATAERFFAVGSVLANMV  189

Query  547   ERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDERFLNVLHDDPQT  368
               L E P  RLL++++RCYLRLS+ P      A    R CLP  L D  F N L DD  T
Sbjct  190   VSLAEQPSTRLLKHIIRCYLRLSDNPR-----ACGALRTCLPEMLRDGTFNNCLRDDAAT  244

Query  367   ARMLQQFFLNITTSS  323
              R LQQ   N++  +
Sbjct  245   RRWLQQLLHNVSGGN  259



>ref|XP_002898724.1| cell differentiation protein rcd1 [Phytophthora infestans T30-4]
 gb|EEY62849.1| cell differentiation protein rcd1 [Phytophthora infestans T30-4]
Length=312

 Score =   234 bits (597),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 135/268 (50%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1123  LHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKEST  944
             L +P  RE A+  L+KKRE   EL  +LW+SF TV  LLQE++++Y  LSP ++T   S 
Sbjct  40    LSSPEQRESALLELSKKREEFPELAPILWHSFGTVAALLQEIVAIYPLLSPPQLTAHASN  99

Query  943   RVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVK  764
             RVCNALAL+QC+A+H +TR   + A IP YLYPFL      +P E+LRLTSLGVIGALVK
Sbjct  100   RVCNALALLQCVASHSETRTHFLNAHIPLYLYPFLNTVSKNRPFEYLRLTSLGVIGALVK  159

Query  763   IEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAER  584
             I+D    ++++FLL+TE+ PLCLR ++ G EL++TVAT IV KIL+ + GL Y C   ER
Sbjct  160   IDD---SDVINFLLQTEIIPLCLRIMEAGSELSKTVATFIVQKILLDDMGLTYICHTPER  216

Query  583   FFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDE  404
             F++V  VL ++V  L E P  RLL++++RCYLRLS+ P      A E  R+CLP  L + 
Sbjct  217   FYAVGTVLSKMVATLVEVPAPRLLKHIIRCYLRLSDNPR-----AKEALRQCLPEALRNH  271

Query  403   RFLNVLHDDPQTARMLQQFFLNITTSSS  320
              F   L DD  T+R L Q   NI+T +S
Sbjct  272   TFDEALKDDATTSRWLAQLLYNISTDAS  299



>ref|XP_005651333.1| Rcd1-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE26789.1| Rcd1-like protein [Coccomyxa subellipsoidea C-169]
Length=282

 Score =   233 bits (594),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 136/275 (49%), Positives = 186/275 (68%), Gaps = 8/275 (3%)
 Frame = -2

Query  1144  LDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLR  965
             +++L+  L NP  RE A+  L+K+RES  EL  +LW+SF TV  L+QEV+S+Y  LSP  
Sbjct  1     MEQLVLDLINPGTRENALLELSKRRESFPELAPVLWHSFGTVAALIQEVVSIYPVLSPPV  60

Query  964   ITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLG  785
             ++   S RVCNALAL+QC+A+H DTR   ++A +P +LYPFL  +   +P E+LRLTSLG
Sbjct  61    LSAHASNRVCNALALLQCLASHQDTRSLFLKAHVPLFLYPFLNTTSKTRPFEYLRLTSLG  120

Query  784   VIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKY  605
             VIGA+VK++D    EI++FLL TE+ PLCL+ +++G EL++TVAT IV KIL+   GL Y
Sbjct  121   VIGAIVKVDD---TEIINFLLTTEIIPLCLKTMEMGSELSKTVATFIVQKILLDNVGLGY  177

Query  604   CCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCL  425
                 AERFF+V  VL  +V  LPE P +RLL++++RCYLRLS+      S A E  R+CL
Sbjct  178   VVQTAERFFAVSAVLNNMVLALPEQPSVRLLKHIIRCYLRLSD-----NSRAREALRQCL  232

Query  424   PPKLTDERFLNVLHDDPQTARMLQQFFLNITTSSS  320
             P  LTD+ F   L +D QT   L Q  +N+    S
Sbjct  233   PKLLTDQTFTICLAEDGQTRGWLAQLLVNVGHGHS  267



>gb|KDO24701.1| cell differentiation protein RCD1 [Saprolegnia parasitica CBS 
223.65]
Length=311

 Score =   234 bits (596),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 139/280 (50%), Positives = 188/280 (67%), Gaps = 11/280 (4%)
 Frame = -2

Query  1141  DELLHM---LHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             ++L H+   L  P  RE A+  L+KKRE   EL  +LW+SF TV  LLQE+IS+Y  LSP
Sbjct  29    EQLYHLVLELSVPEQRESALLELSKKREEFPELAPILWHSFGTVAALLQEIISIYPLLSP  88

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
              ++T   S RVCNALAL+QC+A+H +TR   + A IP YLYPFL      +P E+LRLTS
Sbjct  89    PQLTAHASNRVCNALALLQCVASHAETRTHFLNAHIPLYLYPFLNTVSKNRPFEYLRLTS  148

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVKI+D    ++++FLL+TE+ PLCLR ++ G EL++TVAT IV KIL+ E GL
Sbjct  149   LGVIGALVKIDD---TDVINFLLQTEIIPLCLRIMEAGSELSKTVATFIVQKILLDEMGL  205

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C   ERF++V  VL ++V  L ETP  RLL++++RCYLRLS+      + A E  R+
Sbjct  206   TYICHTPERFYAVGSVLSKMVTTLVETPSTRLLKHIIRCYLRLSD-----NARAKEALRQ  260

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTSSS*RG  311
             CLP  L +  F +VL +D  T+R L Q   N++ +S+  G
Sbjct  261   CLPEVLQNHTFDDVLKEDLTTSRWLAQLLYNLSDNSNPVG  300



>ref|XP_008898970.1| hypothetical protein PPTG_06680 [Phytophthora parasitica INRA-310]
 gb|ETI55838.1| hypothetical protein F443_01526 [Phytophthora parasitica P1569]
 gb|ETM02060.1| hypothetical protein L917_01411 [Phytophthora parasitica]
 gb|ETM55319.1| hypothetical protein L914_01442 [Phytophthora parasitica]
 gb|ETN15406.1| hypothetical protein PPTG_06680 [Phytophthora parasitica INRA-310]
 gb|ETO84583.1| hypothetical protein F444_01528 [Phytophthora parasitica P1976]
 gb|ETP53659.1| hypothetical protein F442_01476 [Phytophthora parasitica P10297]
Length=286

 Score =   233 bits (593),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 134/268 (50%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1123  LHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKEST  944
             L +P  RE A+  L+KKRE   EL  +LW+SF TV  LLQE++++Y  LSP ++T   S 
Sbjct  14    LSSPEQRESALLELSKKREDFPELAPILWHSFGTVAALLQEIVAIYPLLSPPQLTAHASN  73

Query  943   RVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVK  764
             RVCNALAL+QC+A+H +TR   + A IP YLYPFL      +P E+LRLTSLGVIGALVK
Sbjct  74    RVCNALALLQCVASHSETRTHFLNAHIPLYLYPFLNTVSKNRPFEYLRLTSLGVIGALVK  133

Query  763   IEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAER  584
             I+D +   +++FLL+TE+ PLCLR ++ G EL++TVAT IV KIL+ + GL Y C   ER
Sbjct  134   IDDSD---VINFLLQTEIIPLCLRIMEAGSELSKTVATFIVQKILLDDMGLTYICHTPER  190

Query  583   FFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDE  404
             F++V  VL ++V  L E P  RLL++++RCYLRLS+ P      A E  R+CLP  L + 
Sbjct  191   FYAVGTVLSKMVATLVEAPAPRLLKHIIRCYLRLSDNPR-----AKEALRQCLPEALRNH  245

Query  403   RFLNVLHDDPQTARMLQQFFLNITTSSS  320
              F   L +D  T+R L Q   NI+T +S
Sbjct  246   TFDEALKEDATTSRWLAQLLYNISTDAS  273



>ref|XP_006847021.1| hypothetical protein AMTR_s00017p00162080 [Amborella trichopoda]
 gb|ERN08602.1| hypothetical protein AMTR_s00017p00162080 [Amborella trichopoda]
Length=311

 Score =   233 bits (595),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 133/265 (50%), Positives = 180/265 (68%), Gaps = 8/265 (3%)
 Frame = -2

Query  1114  PNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKESTRVC  935
             P  RE A+  L+KKRE   +L  +LW+SF T+  LLQE++S+Y  LSP  +T   S RVC
Sbjct  39    PEQRENALLELSKKRELFQDLAPMLWHSFGTIAALLQEIVSIYPVLSPPTLTPAASNRVC  98

Query  934   NALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVKIED  755
             NALAL+QC+A+HP+TR   + A IP YLYPFL  +   +P E+LRLTSLGVIGALVK++D
Sbjct  99    NALALLQCVASHPETRTLFLSAHIPLYLYPFLNTTSKTRPFEYLRLTSLGVIGALVKVDD  158

Query  754   PNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAERFFS  575
                 ++++FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL Y CA AERF++
Sbjct  159   ---TDVINFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGLAYICATAERFYA  215

Query  574   VVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDERFL  395
             V +VLG +V  L E P +RLL++++RCYLRLS+        A E  + CLP  L D  F 
Sbjct  216   VGRVLGTMVASLAEQPSVRLLKHIIRCYLRLSD-----NQRACEALKNCLPTMLRDTTFH  270

Query  394   NVLHDDPQTARMLQQFFLNITTSSS  320
              VL DD  T R L Q   N++ + +
Sbjct  271   AVLRDDQTTKRWLVQLIHNVSNAGN  295



>gb|KFM26961.1| Cell differentiation protein RCD1-like protein [Auxenochlorella 
protothecoides]
Length=302

 Score =   233 bits (594),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 140/272 (51%), Positives = 180/272 (66%), Gaps = 8/272 (3%)
 Frame = -2

Query  1153  SATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLS  974
             S  LD+L+  L NP  +E A+  L+KKRES  EL   LW+SF TV  LLQE++ +Y  L 
Sbjct  16    SLRLDQLVLDLTNPVKKETALLELSKKRESFPELAPYLWHSFGTVAALLQEIVVIYPLLQ  75

Query  973   PLRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLT  794
             P ++T+  S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL  +   +P E+LRLT
Sbjct  76    PPQLTSSGSNRVCNALALLQCVASHPETRTLFLEANIPLFLYPFLNSTSKARPFEYLRLT  135

Query  793   SLGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEG  614
             SLGVIGALVK++D   P ++ FLL TE+ PLCLR ++ G EL++TVAT IV KIL+ EEG
Sbjct  136   SLGVIGALVKVDD---PAVISFLLNTEIIPLCLRTMETGSELSKTVATFIVQKILLDEEG  192

Query  613   LKYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFR  434
             L Y CA AERFF+V  VL  +VE L E P +RLL+++VRCYLRLS+        A +  R
Sbjct  193   LAYICATAERFFAVGTVLSSMVEGLVEAPSVRLLKHIVRCYLRLSD-----NRCARDALR  247

Query  433   RCLPPKLTDERFLNVLHDDPQTARMLQQFFLN  338
              C P  L    F   L DD  T R L Q  +N
Sbjct  248   ACTPEPLRSPAFTACLRDDAVTCRWLAQLLVN  279



>ref|XP_008605841.1| cell differentiation protein RCD1 [Saprolegnia diclina VS20]
 gb|EQC40997.1| cell differentiation protein RCD1 [Saprolegnia diclina VS20]
Length=311

 Score =   233 bits (595),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 139/280 (50%), Positives = 187/280 (67%), Gaps = 11/280 (4%)
 Frame = -2

Query  1141  DELLHM---LHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             ++L H+   L  P  RE A+  L+KKRE   EL  +LW+SF TV  LLQE+IS+Y  LSP
Sbjct  29    EQLYHLVLELSVPEQRESALLELSKKREEFPELAPILWHSFGTVAALLQEIISIYPLLSP  88

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
              ++T   S RVCNALAL+QC+A+H +TR   + A IP YLYPFL      +P E+LRLTS
Sbjct  89    PQLTAHASNRVCNALALLQCVASHAETRTHFLNAHIPLYLYPFLNTVSKNRPFEYLRLTS  148

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVKI+D    ++++FLL+TE+ PLCLR ++ G EL++TVAT IV KIL+ E GL
Sbjct  149   LGVIGALVKIDD---TDVINFLLQTEIIPLCLRIMEAGSELSKTVATFIVQKILLDEMGL  205

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C   ERF++V  VL ++V  L ETP  RLL++++RCYLRLS+      + A E  R+
Sbjct  206   TYICHTPERFYAVGSVLSKMVTTLVETPSTRLLKHIIRCYLRLSD-----NARAKEALRQ  260

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTSSS*RG  311
             CLP  L +  F +VL +D  T+R L Q   N+  +S+  G
Sbjct  261   CLPEVLQNHTFDDVLKEDLTTSRWLAQLLYNLNDNSNPVG  300



>dbj|BAK03539.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=331

 Score =   234 bits (596),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 136/273 (50%), Positives = 184/273 (67%), Gaps = 8/273 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L +  LRE A+  L+KKRE   +L  LLW+SF T+  LLQE++S+Y  LSP
Sbjct  44    ASAEQLVLDLCDRELRENALLELSKKREIFQDLAPLLWHSFGTIAALLQEIVSIYPALSP  103

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               ++   S RVCNALAL+QC+A+HPDTR+  + A +P +LYPFL      +P E+LRLTS
Sbjct  104   PTLSPGASNRVCNALALLQCVASHPDTRIPFLNAHVPLFLYPFLNTFSKTRPFEYLRLTS  163

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    +++ FLL+TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  164   LGVIGALVKVDD---TDVISFLLQTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDIGL  220

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y CA AERF++V  VLG +V  L + P  RLL++++RCYLRLS+ P      A      
Sbjct  221   HYVCATAERFYAVGSVLGNMVISLADQPSTRLLKHIIRCYLRLSDNPR-----ACVALHN  275

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNIT  332
             CLP  L D  F   L DDP T R LQQ   N+T
Sbjct  276   CLPDMLKDGTFNISLRDDPATRRWLQQLLHNVT  308



>emb|CDX97215.1| BnaC09g44100D [Brassica napus]
Length=294

 Score =   233 bits (593),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 137/270 (51%), Positives = 185/270 (69%), Gaps = 8/270 (3%)
 Frame = -2

Query  1144  LDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLR  965
             +++L+  + +P LRE A+  L+KKRE   EL  LLW+S  T   LLQE+IS+Y  LSP  
Sbjct  25    VEQLVLDICDPELRENALHQLSKKREIFHELAPLLWHSVGTTAALLQEIISIYPFLSPPT  84

Query  964   ITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLG  785
             +T  +S RVCNALAL QC+AAHP+T+M  +RA++P YLY FL+ S  E+P E+LRLTSLG
Sbjct  85    LTVAQSNRVCNALALCQCVAAHPETKMPFLRAQMPLYLYAFLKTSSKERPFEYLRLTSLG  144

Query  784   VIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKY  605
             VIGALVK+ED    E++ FLLETE+ PLCLR ++ G EL++TVAT I+ KIL+  EGL+Y
Sbjct  145   VIGALVKVED---TEVIKFLLETEIIPLCLRTMESGSELSKTVATFIIQKILLDNEGLRY  201

Query  604   CCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCL  425
              C   +RFF++ +VLG +V  L E P  RLL+++VRCYLRL++        A    R  L
Sbjct  202   MCVCVDRFFALSRVLGNMVTSLAEAPSPRLLKHIVRCYLRLTD-----NIRACLALRDYL  256

Query  424   PPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             P  L+D  F + L+D+P   + LQQ   NI
Sbjct  257   PDLLSDTTFTSCLYDEPAAVQWLQQMHHNI  286



>ref|XP_009527321.1| hypothetical protein PHYSODRAFT_559218 [Phytophthora sojae]
 gb|EGZ18263.1| hypothetical protein PHYSODRAFT_559218 [Phytophthora sojae]
Length=284

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 134/268 (50%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1123  LHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKEST  944
             L +P  RE A+  L+KKRE   EL  +LW+SF TV  LLQE++++Y  LSP ++T   S 
Sbjct  12    LSSPEQRESALLELSKKREEFPELAPILWHSFGTVAALLQEIVAIYPLLSPPQLTAHASN  71

Query  943   RVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVK  764
             RVCNALAL+QC+A+H +TR   + A IP YLYPFL      +P E+LRLTSLGVIGALVK
Sbjct  72    RVCNALALLQCVASHSETRTHFLNAHIPLYLYPFLNTVSKNRPFEYLRLTSLGVIGALVK  131

Query  763   IEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAER  584
             I+D +   +++FLL+TE+ PLCLR ++ G EL++TVAT IV KIL+ + GL Y C   ER
Sbjct  132   IDDSD---VINFLLQTEIIPLCLRIMEAGSELSKTVATFIVQKILLDDMGLTYICHTPER  188

Query  583   FFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDE  404
             F++V  VL ++V  L E P  RLL++++RCYLRLS+ P      A E  R+CLP  L + 
Sbjct  189   FYAVGTVLSKMVAVLVEAPAPRLLKHIIRCYLRLSDNPR-----AKEALRQCLPEALRNH  243

Query  403   RFLNVLHDDPQTARMLQQFFLNITTSSS  320
              F   L +D  T+R L Q   NI+T +S
Sbjct  244   TFDEALKEDATTSRWLAQLLYNISTDAS  271



>ref|XP_007514019.1| cell differentiation protein rcd1 [Bathycoccus prasinos]
 emb|CCO15456.1| cell differentiation protein rcd1 [Bathycoccus prasinos]
Length=294

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 134/277 (48%), Positives = 182/277 (66%), Gaps = 8/277 (3%)
 Frame = -2

Query  1156  QSATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKL  977
             Q+  ++ L+  L +P  RE A+  ++K+R+   +L  +LW+S+  V  LLQE++S+Y  L
Sbjct  25    QALKMEHLVASLQDPETRENALLDISKRRDLFVDLAPVLWHSYGVVPALLQEIVSIYPLL  84

Query  976   SPLRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRL  797
             SP  +T   S RVCNALAL+QC+A+HPDTR   + A +P +LYPFL      +P E+LRL
Sbjct  85    SPPSLTNHASNRVCNALALLQCVASHPDTRAQFLNAHVPLFLYPFLNTVSKTRPFEYLRL  144

Query  796   TSLGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEE  617
             TSLGVIGALVK++D    E+++FLL TE+ PLCLR ++LG EL++TVAT IV KIL  E 
Sbjct  145   TSLGVIGALVKVDD---TEVINFLLSTEIIPLCLRTMELGSELSKTVATFIVQKILSDEV  201

Query  616   GLKYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETF  437
             GL Y CA AER ++V  VLG +V +L E P  RLL+++VRCYLRLS+ P      A E  
Sbjct  202   GLAYTCATAERCYAVGSVLGGMVAQLAEQPSARLLKHIVRCYLRLSDNPR-----AAECL  256

Query  436   RRCLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             RRC P +L D  F   L DD  T + L Q  + +  S
Sbjct  257   RRCFPDQLRDPAFTAHLKDDAATQKWLGQLLVQLGYS  293



>ref|XP_001780321.1| predicted protein [Physcomitrella patens]
 gb|EDQ54880.1| predicted protein [Physcomitrella patens]
Length=289

 Score =   232 bits (591),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 138/272 (51%), Positives = 185/272 (68%), Gaps = 8/272 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L  P  RE A+  L+KKRE+  +L  +LW+S  T+  LLQE++S+Y  LSP
Sbjct  2     ASAEQLVLELIVPEQRENALLDLSKKREAFPDLAPILWHSCGTIAALLQEIVSIYPMLSP  61

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T   S RVCNALAL+QC+A+HPDTR   + A IP YLYPFL      +P E+LRLTS
Sbjct  62    PTLTAGASNRVCNALALLQCVASHPDTRALFLNAHIPLYLYPFLNTVSKTRPFEYLRLTS  121

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E+++FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  122   LGVIGALVKVDD---TEVINFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  178

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y CA AERFF+V  VL  +V+ L E P +RLL++++RCYLRLS+    LR  A E  + 
Sbjct  179   AYICATAERFFAVSAVLANMVQMLAEQPSVRLLKHIIRCYLRLSD---NLR--ACEALKN  233

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             CLP  L +  F N L DD  T R L Q  +N+
Sbjct  234   CLPELLQNGTFNNCLRDDLTTRRWLGQLMVNV  265



>ref|XP_010419859.1| PREDICTED: cell differentiation protein RCD1 homolog [Camelina 
sativa]
Length=308

 Score =   232 bits (592),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 136/275 (49%), Positives = 184/275 (67%), Gaps = 8/275 (3%)
 Frame = -2

Query  1147  TLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPL  968
             + ++L+  L N  LRE A+  L+KKRE+  EL  LLW+S  T+  LLQE+IS+Y  LSP 
Sbjct  30    SAEQLILNLSNLELRENALHELSKKRENFHELAPLLWHSVGTIPALLQEIISVYPVLSPP  89

Query  967   RITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSL  788
              +T  +S RVCNALAL+QC+A+H DTRM  ++A +P YLY FL  S   +P E+LRLTSL
Sbjct  90    TMTPAQSNRVCNALALLQCVASHADTRMLFLKAHLPLYLYAFLNTSSKSRPFEYLRLTSL  149

Query  787   GVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLK  608
             GVIGALVK++D    E++ FLL+TE+ PLCLR ++ G EL++TVAT IV K+L+ E GL+
Sbjct  150   GVIGALVKVDD---SEVIRFLLQTEIVPLCLRTMENGSELSKTVATFIVQKVLLDEVGLE  206

Query  607   YCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRC  428
             Y C  AERFF++ +VLG +V  L E P  RLL+++VRCYLRL++ P      A +    C
Sbjct  207   YMCTTAERFFALGRVLGNMVASLAEGPSPRLLKHIVRCYLRLTDNPR-----ACDALGSC  261

Query  427   LPPKLTDERFLNVLHDDPQTARMLQQFFLNITTSS  323
             LP  L D  F   L+DDP   + L++   NI    
Sbjct  262   LPDLLRDANFSRCLYDDPPAGQWLEKLLQNINIGG  296



>ref|XP_010323844.1| PREDICTED: cell differentiation protein RCD1 homolog [Solanum 
lycopersicum]
Length=340

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 131/272 (48%), Positives = 189/272 (69%), Gaps = 4/272 (1%)
 Frame = -2

Query  1147  TLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPL  968
             T ++L+ ++ + +LR E M  L +K++SC  L +LLWN+FNTVY+LL EV+S+YKK SP 
Sbjct  33    TPNQLVLLIDDDSLRGEVMHHLYEKKDSCKNLALLLWNNFNTVYMLLLEVLSVYKKFSPS  92

Query  967   RITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSL  788
              ++ +E+TRVC A+AL Q MA + +TR GL++A+IP Y YPFL+P  ++K LE +R T+L
Sbjct  93    TLSIREATRVCCAIALFQVMANNTETRRGLIKAEIPCYFYPFLKPCGDDKHLECVRTTTL  152

Query  787   GVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLK  608
             G +  L K +DP+  + + F L++EV PLCL+C+D+ DE +Q +ATLIVM IL QE GL 
Sbjct  153   GFLSDLTKFDDPHGSDALRFFLKSEVVPLCLKCMDVCDEKSQKLATLIVMNILKQESGLT  212

Query  607   YCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMA-METFRR  431
             YC A  ERFF++VQVL R+VE+L   PCL  L YV++CY+ LS++    RS+   + F R
Sbjct  213   YCSATPERFFAIVQVLRRVVEKLSLKPCLLHLEYVIQCYVCLSKI---YRSIGPGDEFIR  269

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
              +P +L D  F   L  + + +RMLQ   LNI
Sbjct  270   QIPSQLFDNTFRRTLLHNNEASRMLQVLHLNI  301



>gb|KHG04254.1| Cell differentiation RCD1 [Gossypium arboreum]
Length=355

 Score =   233 bits (595),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 144/306 (47%), Positives = 187/306 (61%), Gaps = 42/306 (14%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             AT + L+  L NP+LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  LSP
Sbjct  38    ATAEHLVLDLSNPDLRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYPVLSP  97

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +T  +S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  98    PNLTPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRLTS  157

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQT----------------  659
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++T                
Sbjct  158   LGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVEFRLFSFVEPVGLEF  214

Query  658   ------------------VATLIVMKILVQEEGLKYCCALAERFFSVVQVLGRLVERLPE  533
                               VAT IV KIL+ + GL Y C  AERFF+V +VLG +V  L E
Sbjct  215   GWPFGSAWLLLLDAECCRVATFIVQKILLDDVGLDYICTTAERFFAVGRVLGNMVAALAE  274

Query  532   TPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDERFLNVLHDDPQTARMLQ  353
              P  RLL++++RCYLRLS+ P      A +  R CLP  L D  F + L +D  T R LQ
Sbjct  275   QPSSRLLKHIIRCYLRLSDNPR-----ACDALRSCLPDMLRDVTFSSCLREDQTTRRWLQ  329

Query  352   QFFLNI  335
             Q   N+
Sbjct  330   QLLHNV  335



>emb|CDY06382.1| BnaC05g31480D [Brassica napus]
Length=327

 Score =   232 bits (592),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 139/290 (48%), Positives = 186/290 (64%), Gaps = 23/290 (8%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L NP LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++S+Y  L+P
Sbjct  32    ASAEQLVLDLSNPELRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYSVLAP  91

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRM----GLVR-----------AKIPAYLYPFLE  836
               +T  +S RVCN+LAL+QC+A+H DTRM    G +R           + IP YLYPFL 
Sbjct  92    PNLTPAQSNRVCNSLALLQCVASHSDTRMLFLKGNIRFILSDELVVMSSHIPLYLYPFLN  151

Query  835   PSVNEKPLEFLRLTSLGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTV  656
              +   +P E+LRLTSLGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TV
Sbjct  152   TTSKSRPFEYLRLTSLGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTV  208

Query  655   ATLIVMKILVQEEGLKYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSE  476
             AT IV KIL+ + G+ Y C  AERFF+V +VLG +V+ L E P  RLL++++RCYLRLS+
Sbjct  209   ATFIVQKILLDDVGMDYICTTAERFFAVGRVLGNMVQSLVEQPSPRLLKHIIRCYLRLSD  268

Query  475   LPTPLRSMAMETFRRCLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
              P      A      CLP  L D  F N L +D    R LQQ   N+   
Sbjct  269   NPR-----ACAALGSCLPDSLRDGTFSNCLREDQIARRWLQQLVHNVGVG  313



>ref|XP_002463783.1| hypothetical protein SORBIDRAFT_01g006090 [Sorghum bicolor]
 gb|EER90781.1| hypothetical protein SORBIDRAFT_01g006090 [Sorghum bicolor]
Length=313

 Score =   232 bits (591),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 133/269 (49%), Positives = 180/269 (67%), Gaps = 8/269 (3%)
 Frame = -2

Query  1114  PNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKESTRVC  935
             P LRE+A+  L+KKRE C +L +LLW+S+ T+  LLQE++S Y+ LSP ++++ +STRVC
Sbjct  42    PELREKALFFLSKKREKCEDLALLLWHSYGTMAALLQEIVSTYRSLSPPKLSSDQSTRVC  101

Query  934   NALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVKIED  755
             NALAL+QC+A+HPDTR+  V A +P YLYPFL  +   +  EFLRLTSLGVIGALVK +D
Sbjct  102   NALALLQCVASHPDTRIPFVNALVPLYLYPFLNTTYKTREYEFLRLTSLGVIGALVKFDD  161

Query  754   PNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAERFFS  575
                 E+V FLL +E+ PLCLR ID+G EL++TVAT I+ KI++ + GL Y CA  ERF +
Sbjct  162   ---REVVAFLLTSEIIPLCLRAIDMGSELSKTVATFIIQKIMLDDAGLVYVCASLERFCA  218

Query  574   VVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDERFL  395
             V  VLG++VE L E P  RLL++++RCYLRL++        A    R  LP  L D  F 
Sbjct  219   VASVLGQMVEELVEQPSPRLLKHIIRCYLRLTD-----DRRACNALRSSLPTALRDGTFN  273

Query  394   NVLHDDPQTARMLQQFFLNITTSSS*RGN  308
             +++  D      L Q   NI   S+  G 
Sbjct  274   DLIEVDLTARLWLHQLLHNIMMMSNGGGG  302



>gb|ETK95634.1| hypothetical protein L915_01456 [Phytophthora parasitica]
 gb|ETL49025.1| hypothetical protein L916_01430 [Phytophthora parasitica]
 gb|ETP25641.1| hypothetical protein F441_01501 [Phytophthora parasitica CJ01A1]
Length=286

 Score =   231 bits (588),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 133/268 (50%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1123  LHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKEST  944
             L +P  RE A+  L+KKRE   EL  +LW+SF TV  LLQE++++Y  LSP ++T   S 
Sbjct  14    LSSPEQRESALLELSKKREDFPELAPILWHSFGTVAALLQEIVAIYPLLSPPQLTAHASN  73

Query  943   RVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVK  764
             RVCNALAL+QC+A+H +TR   + A IP YLYPFL      +P E+LRLTSLGVIGALVK
Sbjct  74    RVCNALALLQCVASHSETRTHFLNAHIPLYLYPFLNTVSKNRPFEYLRLTSLGVIGALVK  133

Query  763   IEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAER  584
             I+D +   +++FLL+TE+ PLCLR ++ G EL++TVAT IV KIL+ + GL Y C   ER
Sbjct  134   IDDSD---VINFLLQTEIIPLCLRIMEAGSELSKTVATFIVQKILLDDMGLTYICHTPER  190

Query  583   FFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDE  404
             F++V  VL ++V  L E P  RLL++++RCYLRLS+ P      A E  R+CLP  L + 
Sbjct  191   FYAVGTVLSKMVATLVEAPAPRLLKHIIRCYLRLSDNPR-----AKEALRQCLPEALRNH  245

Query  403   RFLNVLHDDPQTARMLQQFFLNITTSSS  320
              F   L +D  T+R L +   NI+T +S
Sbjct  246   TFDEALKEDATTSRWLARLLYNISTDAS  273



>ref|XP_002741589.1| PREDICTED: cell differentiation protein RCD1 homolog [Saccoglossus 
kowalevskii]
Length=308

 Score =   231 bits (590),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 134/266 (50%), Positives = 179/266 (67%), Gaps = 8/266 (3%)
 Frame = -2

Query  1123  LHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKEST  944
             L NP  RE A+  L+KKRE   +L  +LW+SF TV  LLQE++++Y  ++P  +T  +S 
Sbjct  39    LTNPETRENALLELSKKREVVPDLAPMLWHSFGTVAALLQEIVNIYPYINPPHLTAHQSN  98

Query  943   RVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVK  764
             RVCNALAL+QC+A+HP+TR   ++A IP +LYPFL      +P E+LRLTSLGVIGALVK
Sbjct  99    RVCNALALLQCVASHPETRSAFLQAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVIGALVK  158

Query  763   IEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAER  584
              ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ E GL Y C   ER
Sbjct  159   TDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDETGLSYICQTYER  215

Query  583   FFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDE  404
             F  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP +L D 
Sbjct  216   FSHVAMILGKMVIQLGKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPDQLKDT  270

Query  403   RFLNVLHDDPQTARMLQQFFLNITTS  326
              F  VL DD  T R L Q   N+T S
Sbjct  271   TFAAVLKDDNSTKRWLAQLIKNLTDS  296



>ref|XP_006367907.1| PREDICTED: cell differentiation protein RCD1 homolog [Solanum 
tuberosum]
Length=241

 Score =   229 bits (584),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 150/198 (76%), Gaps = 1/198 (1%)
 Frame = -2

Query  1147  TLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPL  968
             T ++L+ ++H+ +LREE M  L KK++SC  L +LLWN+FNTVY+LL EV S Y+K SP 
Sbjct  33    TPNQLVLLIHDASLREEVMHHLCKKKDSCRVLALLLWNNFNTVYMLLLEVTSAYRKFSPS  92

Query  967   RITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVN-EKPLEFLRLTS  791
              ++ +E+TRVC ALAL Q +A +P+TR GL++AKIP Y YPFL+P  + ++PLE +R+T+
Sbjct  93    MLSMREATRVCCALALFQVLANNPETRRGLIKAKIPCYFYPFLKPCEDHDEPLEHVRITT  152

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGV+G L K +DP     +H  LE+EV PLCL+C+D  DE+++ +ATLIVMKIL QE GL
Sbjct  153   LGVLGDLTKFDDPYGSHALHLFLESEVVPLCLKCMDACDEMSRKLATLIVMKILTQERGL  212

Query  610   KYCCALAERFFSVVQVLG  557
              YCCA  ERFF++VQV G
Sbjct  213   TYCCATPERFFAIVQVHG  230



>ref|XP_010923682.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Elaeis guineensis]
Length=349

 Score =   231 bits (590),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 141/301 (47%), Positives = 188/301 (62%), Gaps = 33/301 (11%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L +P LRE A+  L+KKRE   +L  LLWNS+ T+  LLQE++S+Y  LSP
Sbjct  41    ASAEQLVLDLCDPELRENALLDLSKKREIFQDLAPLLWNSYGTIAALLQEIVSIYPALSP  100

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               ++   S RVCNALAL+QC+A+HPDTR+  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  101   PTLSPAASNRVCNALALLQCVASHPDTRILFLNAHIPLYLYPFLNTTNKTRPFEYLRLTS  160

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQT----------------  659
             LGVIGALVK++D    E++ FLL+TE+ PLCLR +++G EL++T                
Sbjct  161   LGVIGALVKVDD---TEVIGFLLQTEIIPLCLRTMEMGSELSKTKKQIWIWICWYPIRIR  217

Query  658   ---------VATLIVMKILVQEEGLKYCCALAERFFSVVQVLGRLVERLPETPclrllry  506
                      VAT IV KIL+ + GL+Y CA AERFF+V  VL  +V  L E P  RLL++
Sbjct  218   SDFNSTWMVVATFIVQKILLDDIGLQYICATAERFFAVGSVLANMVVSLAEQPSTRLLKH  277

Query  505   vvrcylrLSELPTPLRSMAMETFRRCLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             ++RCYLRLS+ P      A    R CLP  L D  F N L DD  T R LQQ   N++  
Sbjct  278   IIRCYLRLSDNP-----RACGALRTCLPEMLRDGTFNNCLRDDTATRRWLQQLLHNVSGG  332

Query  325   S  323
             +
Sbjct  333   T  333



>ref|XP_007434640.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Python bivittatus]
Length=301

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 131/268 (49%), Positives = 181/268 (68%), Gaps = 6/268 (2%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  24    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  83

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  84    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  143

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  144   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  200

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P   R  A E  R+CLP 
Sbjct  201   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP---RCRAREALRQCLPD  257

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  258   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  285



>ref|XP_002591911.1| hypothetical protein BRAFLDRAFT_284472 [Branchiostoma floridae]
 gb|EEN47922.1| hypothetical protein BRAFLDRAFT_284472 [Branchiostoma floridae]
Length=304

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 133/271 (49%), Positives = 180/271 (66%), Gaps = 8/271 (3%)
 Frame = -2

Query  1123  LHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKEST  944
             L NP  RE A+  L+KKRE  ++L  +LW+SF TV  LLQE++++Y  ++P  +T  +S 
Sbjct  36    LSNPETRENALLELSKKREVVSDLAPMLWHSFGTVAALLQEIVNIYPAINPPHLTAHQSN  95

Query  943   RVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVK  764
             RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVIGALVK
Sbjct  96    RVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVIGALVK  155

Query  763   IEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAER  584
              ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ E GL Y C   ER
Sbjct  156   TDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDETGLSYICQTYER  212

Query  583   FFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDE  404
             F  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP +L D 
Sbjct  213   FSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPDQLKDT  267

Query  403   RFLNVLHDDPQTARMLQQFFLNITTSSS*RG  311
              F  VL DD  T R L Q   N+  + +  G
Sbjct  268   TFAAVLKDDNSTKRWLAQLVKNLQEAPTPTG  298



>ref|XP_002508177.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69435.1| predicted protein [Micromonas sp. RCC299]
Length=267

 Score =   228 bits (582),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 131/274 (48%), Positives = 182/274 (66%), Gaps = 8/274 (3%)
 Frame = -2

Query  1147  TLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPL  968
             +++ L+  L +P  RE A+  L+KKR+   +L  +LW+SF  +  L+QE++S+Y  LSP 
Sbjct  2     SMEALVAALQDPETRENALLDLSKKRDMFTDLAPILWHSFGVIPALVQEIVSIYPLLSPP  61

Query  967   RITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSL  788
              +T   S RVCNALAL+QC+A+HPDTR   + A IP +LYPFL      +P E+LRLTSL
Sbjct  62    SLTNHASNRVCNALALLQCVASHPDTRAFFLNAHIPLFLYPFLNTVSKTRPFEYLRLTSL  121

Query  787   GVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLK  608
             GVIGALVK++D    ++++FLL TE+ PLCLR ++LG EL++TVAT IV KIL  E GL 
Sbjct  122   GVIGALVKVDD---TDVINFLLSTEIIPLCLRTMELGSELSKTVATFIVQKILSDEVGLN  178

Query  607   YCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRC  428
             Y CA AER ++V  VLG +V  L E P +RLL++++RCYLRLS+ P      A E  R+C
Sbjct  179   YICATAERCYAVGTVLGGMVTMLAEQPSVRLLKHIIRCYLRLSDNPR-----ARECLRQC  233

Query  427   LPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
              P +L D  F   L DD  T + L Q  + + ++
Sbjct  234   FPDQLRDPNFTACLKDDVATQKWLMQLLMQLGSN  267



>gb|EJD74979.1| cell differentiation protein RCD1 [Loa loa]
Length=288

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 132/268 (49%), Positives = 179/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1123  LHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKEST  944
             L + N RE+A+  L+KKRE+  +LP+ LW SF ++  LLQEVIS+Y  + P  +T  +S 
Sbjct  28    LSDSNKREQALLELSKKRETVPDLPLWLWYSFGSMASLLQEVISIYPAIMPPTLTAGQSN  87

Query  943   RVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVK  764
             RVCNALAL+QC+A+H +TR   ++A IP +LYPFL  +   +P E+LRLTSLGVIGALVK
Sbjct  88    RVCNALALMQCVASHKETRSPFLQAHIPLFLYPFLHTTKTSRPFEYLRLTSLGVIGALVK  147

Query  763   IEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAER  584
              ++    E++ FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C   ER
Sbjct  148   TDE---QEVIQFLLSTEIIPLCLRIMENGTELSKTVATFILQKILLDDTGLAYICQTYER  204

Query  583   FFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDE  404
             F  V  +LG++V  L + P  RLL++VVRCY RLS+ P      A++  R+CLP +L DE
Sbjct  205   FSHVAMILGKMVLHLAKEPSQRLLKHVVRCYSRLSDNPR-----ALQALRQCLPDQLRDE  259

Query  403   RFLNVLHDDPQTARMLQQFFLNITTSSS  320
              F  VL DD  T   L+Q   NI  S S
Sbjct  260   TFTRVLADDKSTKHWLKQLLKNIGFSVS  287



>ref|XP_790812.3| PREDICTED: cell differentiation protein RCD1 homolog [Strongylocentrotus 
purpuratus]
Length=312

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 131/268 (49%), Positives = 181/268 (68%), Gaps = 8/268 (3%)
 Frame = -2

Query  1123  LHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKEST  944
             L +P+ RE A+  L+KKRE   +L  +LW+SF TV  LLQE++++Y  ++P  +T  +S 
Sbjct  42    LASPDTRENALHELSKKREVVPDLAPMLWHSFGTVAALLQEIVNIYPYINPPALTAHQSN  101

Query  943   RVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVK  764
             RVCNALAL+QC+A+HP+TR   ++A IP +LYPFL      +P E+LRLTSLGVIGALVK
Sbjct  102   RVCNALALLQCIASHPETRSAFLQAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVIGALVK  161

Query  763   IEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAER  584
              ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ E GL Y C   ER
Sbjct  162   TDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDETGLSYICQTYER  218

Query  583   FFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDE  404
             F  V  +LG++V  L + P  RLL++VVRCYLRLS+        A    R+CLP +L D+
Sbjct  219   FSHVAMILGKMVIALAKEPSARLLKHVVRCYLRLSD-----NQRARGALRQCLPDQLKDQ  273

Query  403   RFLNVLHDDPQTARMLQQFFLNITTSSS  320
              F+ VL DD  T R L Q   N+T +S+
Sbjct  274   TFMAVLKDDNSTKRWLAQLIKNLTETSA  301



>ref|XP_007070754.1| PREDICTED: cell differentiation protein RCD1 homolog [Chelonia 
mydas]
Length=304

 Score =   229 bits (585),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 131/268 (49%), Positives = 181/268 (68%), Gaps = 6/268 (2%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  27    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  86

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  87    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  146

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  147   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  203

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P   R  A E  R+CLP 
Sbjct  204   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP---RCRAREALRQCLPD  260

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  261   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  288



>ref|XP_010941550.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X4 [Elaeis guineensis]
Length=270

 Score =   228 bits (582),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 112/208 (54%), Positives = 154/208 (74%), Gaps = 3/208 (1%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L +P+LRE A+  L+KKRE   +L  LLWNS+ T+  LLQE++S+Y  LSP
Sbjct  31    ASAEQLVLDLLDPHLRENALLDLSKKREIFQDLAPLLWNSYGTIAALLQEIVSIYPYLSP  90

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               ++   S RVCNALAL+QC+A+HPDTR+  + A IP YLYPFL  +   +P E+LRLTS
Sbjct  91    PTLSPGASNRVCNALALLQCVASHPDTRIHFLNAHIPLYLYPFLNTTSKTRPFEYLRLTS  150

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL+TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  151   LGVIGALVKVDD---TEVIGFLLQTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGL  207

Query  610   KYCCALAERFFSVVQVLGRLVERLPETP  527
             +Y CA A+RF++V QVLG +V  L E P
Sbjct  208   RYICATADRFYAVGQVLGSMVTSLAEQP  235



>ref|XP_005279773.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Chrysemys picta bellii]
Length=304

 Score =   229 bits (584),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 131/268 (49%), Positives = 181/268 (68%), Gaps = 6/268 (2%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  27    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  86

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  87    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  146

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  147   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  203

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P   R  A E  R+CLP 
Sbjct  204   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP---RCRAREALRQCLPD  260

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  261   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  288



>ref|XP_005279774.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X2 [Chrysemys picta bellii]
Length=303

 Score =   229 bits (584),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 131/268 (49%), Positives = 181/268 (68%), Gaps = 7/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  27    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  86

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  87    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  146

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  147   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  203

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P    S A E  R+CLP 
Sbjct  204   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP----SRAREALRQCLPD  259

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  260   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  287



>ref|XP_001694059.1| Rcd1-like protein [Chlamydomonas reinhardtii]
 gb|EDP02995.1| Rcd1-like protein [Chlamydomonas reinhardtii]
Length=299

 Score =   229 bits (584),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 133/278 (48%), Positives = 185/278 (67%), Gaps = 11/278 (4%)
 Frame = -2

Query  1144  LDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLR  965
             ++  +H L NP  RE A+  L+KKRE+  EL   LW+SF  +  LLQE++++Y  LSP  
Sbjct  12    VESFVHQLINPATRENALLELSKKRENFPELAPYLWHSFGAIAALLQEIVAIYPLLSPPS  71

Query  964   ITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLG  785
             +T   S RVCNALAL+QC+A+H +TR   ++A IP +LYPFL+     +P E+LRLTSLG
Sbjct  72    LTAHASNRVCNALALLQCVASHNETRALFLQAHIPLFLYPFLQTMSKTRPFEYLRLTSLG  131

Query  784   VIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKY  605
             VIGALVK++D    ++++FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL Y
Sbjct  132   VIGALVKVDD---TDVINFLLSTEIIPLCLRTMEIGTELSKTVATFIVQKILLDDVGLNY  188

Query  604   CCALAERFFSVVQVLGRLV---ERLPETPclrllryvvrcylrLSELPTPLRSMAMETFR  434
              CA AERFF+V  VLG +V    ++ + P  RLL++++RCYLRLS+ P      A E  R
Sbjct  189   ICATAERFFAVGAVLGNMVVAQAQMVDQPSQRLLKHIIRCYLRLSDNPR-----AREALR  243

Query  433   RCLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTSSS  320
              CLP  L + +F   L +D  T R L Q  +N+  S S
Sbjct  244   SCLPELLRNTQFTACLKNDDTTRRWLAQLLMNVGFSDS  281



>ref|XP_010453350.1| PREDICTED: cell differentiation protein RCD1 homolog [Camelina 
sativa]
Length=311

 Score =   229 bits (585),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 135/275 (49%), Positives = 184/275 (67%), Gaps = 8/275 (3%)
 Frame = -2

Query  1147  TLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPL  968
             + ++L+  L N   RE A+  L+KKRE+  EL  LLW+S  T+  LLQE+IS+Y  LSP 
Sbjct  33    SAEQLILNLSNLERRENALHELSKKRENFHELAPLLWHSVGTIPALLQEIISVYPVLSPP  92

Query  967   RITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSL  788
              +T  +S RVCNALAL+QC+A+H DTRM  ++A +P YLY FL  S   +P E+LRLTSL
Sbjct  93    TMTPAQSNRVCNALALLQCVASHADTRMLFLKAHLPLYLYAFLNTSSKSRPFEYLRLTSL  152

Query  787   GVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLK  608
             GVIGALVK++D    E++ FLL+TE+ PLCLR ++ G EL++TVAT I+ K+L+ E GL+
Sbjct  153   GVIGALVKVDD---SEVIRFLLQTEIVPLCLRTMENGSELSKTVATFILQKVLLDEVGLE  209

Query  607   YCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRC  428
             Y C  AERFF++ +VLG +V  L E P  RLL+++VRCYLRL++ P      A +    C
Sbjct  210   YMCTTAERFFALGRVLGNMVASLAEGPSPRLLKHIVRCYLRLTDNPR-----ACDALGSC  264

Query  427   LPPKLTDERFLNVLHDDPQTARMLQQFFLNITTSS  323
             LP  L D  F   L+DDP  A+ L++   NI    
Sbjct  265   LPDLLRDATFSRCLYDDPPAAQWLEKLLQNINIGG  299



>gb|EYU27361.1| hypothetical protein MIMGU_mgv1a010104mg [Erythranthe guttata]
Length=322

 Score =   229 bits (585),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 122/281 (43%), Positives = 175/281 (62%), Gaps = 9/281 (3%)
 Frame = -2

Query  1147  TLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPL  968
             ++++L+  L++P+LRE+A+  L+KKRE   +L  ++WNS+  + ILLQE++++Y  LSP 
Sbjct  30    SVEQLIVDLYDPDLREKALNELSKKREMFQDLAPIMWNSYGIMAILLQEIVAVYPVLSPP  89

Query  967   RITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSL  788
              +++ +S RVCNALAL+QC+A+HPDTR   + A IP YLY FL  +   +  E+LRLTSL
Sbjct  90    NLSSTQSNRVCNALALLQCVASHPDTRKSFLNAHIPLYLYHFLNTTCKNRSFEYLRLTSL  149

Query  787   GVIGALVKI------EDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILV  626
             GVIGALVK+         +  E+++FLL TE+ PLCLR ++LG EL++TVAT IV KIL+
Sbjct  150   GVIGALVKVCGSDFGSQSDDMEVINFLLSTEIIPLCLRTMELGSELSKTVATFIVQKILL  209

Query  625   QEEGLKYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAM  446
              + GL+Y C  AERFF++ +VL  +V  L + P              L     P    A 
Sbjct  210   DDIGLEYMCVSAERFFALSRVLTIMVNSLADHPSTSTRLLKHIVRCYLRLSDNP---RAC  266

Query  445   ETFRRCLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTSS  323
             +  R  +P KL D  F    H+DP   R LQQ F+NI    
Sbjct  267   DVLRNNVPEKLKDTTFNVCFHEDPTIRRWLQQLFVNINQGG  307



>pdb|4CT6|B Chain B, Cnot9-cnot1 Complex
Length=270

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  9     QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  68

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  69    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  128

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  129   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  185

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  186   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  240

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  241   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  268



>ref|NP_989024.1| cell differentiation protein RCD1 homolog [Xenopus (Silurana) 
tropicalis]
 ref|NP_001085150.1| cell differentiation protein RCD1 homolog [Xenopus laevis]
 sp|Q6IP65.1|RCD1_XENLA RecName: Full=Cell differentiation protein RCD1 homolog; Short=Rcd-1 
[Xenopus laevis]
 sp|Q6P819.1|RCD1_XENTR RecName: Full=Cell differentiation protein RCD1 homolog; Short=Rcd-1 
[Xenopus (Silurana) tropicalis]
 gb|AAH61412.1| Cell differentiation protein RCD1 homolog [Xenopus (Silurana) 
tropicalis]
 gb|AAH72053.1| Rqcd1 protein [Xenopus laevis]
 emb|CAJ82430.1| RCD1 required for cell different [Xenopus (Silurana) tropicalis]
Length=299

 Score =   229 bits (583),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 181/268 (68%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P+ RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  24    QWINELSSPDTRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  83

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  84    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  143

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  144   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  200

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  201   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  255

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  256   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  283



>pdb|2FV2|A Chain A, Crystal Structure Analysis Of Human Rcd-1 Conserved 
Region
 pdb|2FV2|B Chain B, Crystal Structure Analysis Of Human Rcd-1 Conserved 
Region
 pdb|2FV2|C Chain C, Crystal Structure Analysis Of Human Rcd-1 Conserved 
Region
 pdb|2FV2|D Chain D, Crystal Structure Analysis Of Human Rcd-1 Conserved 
Region
Length=268

 Score =   228 bits (580),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  7     QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  66

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  67    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  126

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  127   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  183

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  184   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  238

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  239   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  266



>ref|XP_009971585.1| PREDICTED: cell differentiation protein RCD1 homolog, partial 
[Tyto alba]
Length=280

 Score =   228 bits (581),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  16    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  75

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  76    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  135

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  136   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  192

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  193   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  247

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  248   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  275



>ref|XP_003057708.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57659.1| predicted protein [Micromonas pusilla CCMP1545]
Length=267

 Score =   228 bits (580),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 132/275 (48%), Positives = 181/275 (66%), Gaps = 8/275 (3%)
 Frame = -2

Query  1144  LDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLR  965
             ++ L+  L +P  RE A+  L+KKR+   +L  +LW+SF  +  LLQE++S+Y  LSP  
Sbjct  1     MEALVAALQDPETRENALLDLSKKRDMFTDLAPILWHSFGVIPALLQEIVSIYPLLSPPS  60

Query  964   ITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLG  785
             +T   S RVCNALAL+QC+A+HPDTR   + A IP +LYPFL      +P E+LRLTSLG
Sbjct  61    LTNHASNRVCNALALLQCVASHPDTRALFLNAHIPLFLYPFLNTVSKTRPFEYLRLTSLG  120

Query  784   VIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKY  605
             VIGALVK++D    ++++FLL TE+ PLCLR ++LG EL++TVAT IV KIL  E GL Y
Sbjct  121   VIGALVKVDD---TDVINFLLSTEIIPLCLRTMELGSELSKTVATFIVQKILSDEVGLSY  177

Query  604   CCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCL  425
              CA AER ++V  VLG +V  L E P +RLL++++RCYLRLS+ P      A E  R+C 
Sbjct  178   ICATAERCYAVGTVLGGMVTMLTEQPSVRLLKHIIRCYLRLSDNPR-----ARECLRQCF  232

Query  424   PPKLTDERFLNVLHDDPQTARMLQQFFLNITTSSS  320
             P +L D  F   L DD  T + L Q  + +  ++ 
Sbjct  233   PDQLRDPNFTACLKDDIATQKWLVQLLMQLGYTNG  267



>pdb|4CT7|B Chain B, Cnot9-cnot1 Complex With Bound Tryptophan
Length=270

 Score =   228 bits (580),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  9     QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  68

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  69    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  128

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  129   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  185

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  186   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  240

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  241   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  268



>ref|XP_005991824.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Latimeria chalumnae]
 ref|XP_005991825.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X2 [Latimeria chalumnae]
 ref|XP_005991826.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X3 [Latimeria chalumnae]
Length=299

 Score =   228 bits (582),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  24    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  83

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  84    AHQSNRVCNALALLQCVASHPETRSAFLSAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  143

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  144   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  200

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  201   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  255

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  256   QLKDSTFAQVLKDDTTTKRWLAQLVKNL  283



>ref|XP_010536031.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X3 [Tarenaya hassleriana]
Length=325

 Score =   229 bits (585),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 134/275 (49%), Positives = 183/275 (67%), Gaps = 8/275 (3%)
 Frame = -2

Query  1150  ATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSP  971
             A+ ++L+  L +P LRE A+  L+KKRE   +L  LLWNSF T+  LLQE++++Y  LSP
Sbjct  43    ASAEQLVLDLSSPELRENALLELSKKREIFQDLAPLLWNSFGTIAALLQEIVAVYPVLSP  102

Query  970   LRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTS  791
               +   +S RVCNALAL+QC+A+H +TRM  ++A IP YLYPFL  +   +P E+LRLTS
Sbjct  103   PTLNPAQSNRVCNALALLQCVASHVETRMLFLKAHIPLYLYPFLNTTSKSRPFEYLRLTS  162

Query  790   LGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGL  611
             LGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + GL
Sbjct  163   LGVIGALVKVDD---TEVIRFLLSTEIIPLCLRTMEMGSELSRTVATFIVQKILLDDVGL  219

Query  610   KYCCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRR  431
              Y C  AERFF++ +VL  +V  L E P  RLL++++RCYLRL++ P      A E    
Sbjct  220   DYMCTTAERFFALGRVLASMVASLAEQPSPRLLKHIIRCYLRLTDNPR-----ACEALGS  274

Query  430   CLPPKLTDERFLNVLHDDPQTARMLQQFFLNITTS  326
             CLP  L D  F + L DD      LQQ   +I+  
Sbjct  275   CLPDLLRDASFSSCLFDDQVATSWLQQLLHSISVG  309



>ref|XP_010492038.1| PREDICTED: cell differentiation protein RCD1 homolog [Camelina 
sativa]
Length=336

 Score =   229 bits (585),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 138/289 (48%), Positives = 189/289 (65%), Gaps = 8/289 (3%)
 Frame = -2

Query  1141  DELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRI  962
             ++L+  L N  L E A+  L+KKRE+  EL  LLW+S  T+  LLQE+IS+Y  LSP  +
Sbjct  38    EQLILNLSNLELHENALHELSKKRENFHELAPLLWHSVGTIPALLQEIISVYPVLSPPTM  97

Query  961   TTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGV  782
             T  +S RVCNALAL+QC+A+H DTRM  ++A +P YLY FL  S   +P E+LRLTSLGV
Sbjct  98    TPAQSNRVCNALALLQCVASHADTRMLFLKAHLPLYLYAFLNTSSKSRPFEYLRLTSLGV  157

Query  781   IGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYC  602
             IGALVK++D    E++ FLL+TE+ PLCLR ++ G EL++TVAT IV K+L+ E GL+Y 
Sbjct  158   IGALVKVDD---SEVIRFLLQTEIVPLCLRTMENGSELSKTVATFIVQKVLLDEVGLEYM  214

Query  601   CALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLP  422
             C  AERFF++ +VLG +V  L E P  RLL+++VRCYLRL++ P      A +    CLP
Sbjct  215   CTTAERFFALGRVLGNMVASLAEGPSPRLLKHIVRCYLRLTDNPR-----ACDALGSCLP  269

Query  421   PKLTDERFLNVLHDDPQTARMLQQFFLNITTSSS*RGNIYSLCLMEGEP  275
               L D  F   L+DDP   + L++   NI+        +  + + E EP
Sbjct  270   DLLRDATFSRCLYDDPPAGQWLEKLLQNISIGGRAPQGLAHMFVNEIEP  318



>gb|KFV41020.1| Cell differentiation protein RCD1, partial [Tyto alba]
Length=286

 Score =   228 bits (581),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  21    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  80

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  81    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  140

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  141   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  197

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  198   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  252

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  253   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  280



>pdb|4CRU|B Chain B, Complex Of Human Cnot9 And Cnot1 Including One Tryptophan
 pdb|4CRV|B Chain B, Complex Of Human Cnot9 And Cnot1 Including Two Tryptophans
Length=273

 Score =   228 bits (580),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  12    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  71

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  72    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  131

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  132   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  188

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  189   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  243

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  244   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  271



>ref|NP_001126453.1| cell differentiation protein RCD1 homolog [Pongo abelii]
 emb|CAH92464.1| hypothetical protein [Pongo abelii]
Length=299

 Score =   228 bits (581),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 130/270 (48%), Positives = 181/270 (67%), Gaps = 8/270 (3%)
 Frame = -2

Query  1144  LDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLR  965
             + + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  
Sbjct  22    IHQWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPT  81

Query  964   ITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLG  785
             +T  +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLG
Sbjct  82    LTAHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLG  141

Query  784   VIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKY  605
             VIGALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y
Sbjct  142   VIGALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAY  198

Query  604   CCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCL  425
              C   ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CL
Sbjct  199   ICQTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCL  253

Query  424   PPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
             P +L D  F  VL DD  T R L Q   N+
Sbjct  254   PDQLKDTTFAQVLKDDTTTKRWLAQLVKNL  283



>ref|XP_005534896.1| cell differentiation protein rcd1 [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM80289.1| cell differentiation protein rcd1 [Cyanidioschyzon merolae strain 
10D]
Length=276

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 130/265 (49%), Positives = 176/265 (66%), Gaps = 8/265 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             +L+H L   + R+ A+  L+KKRES + L ++LW++  TV +LLQE+I++Y  LSP  +T
Sbjct  10    QLVHNLKEVDHRDAALLELSKKRESVSNLALILWHTPGTVAVLLQEIIAIYPLLSPPALT  69

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
                S RVCNALAL+QC+A+HP+TR   + A +P YLYPFL      +P E+LRLTSLGVI
Sbjct  70    GHASNRVCNALALLQCVASHPETRGPFLAAHLPLYLYPFLNTVSKTRPFEYLRLTSLGVI  129

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GAL K++D   PE+  FLL TE+ PLCLR ++ G EL++TVAT IV KIL+ + GL Y C
Sbjct  130   GALAKVDD---PEVTSFLLSTEIIPLCLRIMETGSELSKTVATFIVQKILLDDSGLNYVC  186

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
               AERF++V  VL  +V  L E P  RLL++++RCYLRLS+ P      A E  R+CLP 
Sbjct  187   QTAERFYAVSTVLANMVNSLIEQPSGRLLKHIIRCYLRLSDNP-----RAREALRQCLPQ  241

Query  418   KLTDERFLNVLHDDPQTARMLQQFF  344
              L D  F  +L++D  T R L    
Sbjct  242   SLRDTTFAQLLNEDQSTRRWLASLI  266



>ref|NP_067358.1| cell differentiation protein RCD1 homolog [Mus musculus]
 ref|NP_001009357.1| cell differentiation protein RCD1 homolog [Rattus norvegicus]
 ref|NP_001094637.1| cell differentiation protein RCD1 homolog [Bos taurus]
 ref|NP_001270704.1| cell differentiation protein RCD1 homolog [Macaca fascicularis]
 ref|NP_001288195.1| RCD1 required for cell differentiation1 homolog [Equus caballus]
 ref|XP_001363406.1| PREDICTED: cell differentiation protein RCD1 homolog [Monodelphis 
domestica]
 ref|XP_002712522.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Oryctolagus cuniculus]
 ref|XP_002749832.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Callithrix jacchus]
 ref|XP_002913711.1| PREDICTED: cell differentiation protein RCD1 homolog [Ailuropoda 
melanoleuca]
 ref|XP_001925255.2| PREDICTED: cell differentiation protein RCD1 homolog [Sus scrofa]
 ref|XP_853052.2| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X4 [Canis lupus familiaris]
 ref|XP_003464061.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Cavia porcellus]
 ref|XP_003507659.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Cricetulus griseus]
 ref|XP_003785004.1| PREDICTED: cell differentiation protein RCD1 homolog [Otolemur 
garnettii]
 ref|XP_003908006.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X2 [Papio anubis]
 ref|XP_004004975.1| PREDICTED: cell differentiation protein RCD1 homolog [Ovis aries]
 ref|XP_004262767.1| PREDICTED: cell differentiation protein RCD1 homolog [Orcinus 
orca]
 ref|XP_004321173.1| PREDICTED: cell differentiation protein RCD1 homolog [Tursiops 
truncatus]
 ref|XP_004376375.1| PREDICTED: cell differentiation protein RCD1 homolog [Trichechus 
manatus latirostris]
 ref|XP_004402774.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
2 [Odobenus rosmarus divergens]
 ref|XP_004427611.1| PREDICTED: cell differentiation protein RCD1 homolog [Ceratotherium 
simum simum]
 ref|XP_004469629.1| PREDICTED: cell differentiation protein RCD1 homolog [Dasypus 
novemcinctus]
 ref|XP_004576884.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Ochotona princeps]
 ref|XP_004662989.1| PREDICTED: cell differentiation protein RCD1 homolog [Jaculus 
jaculus]
 ref|XP_004638274.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Octodon degus]
 ref|XP_004674349.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X2 [Condylura cristata]
 ref|XP_004762817.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Mustela putorius furo]
 ref|XP_004807275.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X2 [Mustela putorius furo]
 ref|XP_004864640.1| PREDICTED: cell differentiation protein RCD1 homolog [Heterocephalus 
glaber]
 ref|XP_005153895.1| PREDICTED: cell differentiation protein RCD1 homolog [Melopsittacus 
undulatus]
 ref|XP_005361690.1| PREDICTED: cell differentiation protein RCD1 homolog [Microtus 
ochrogaster]
 ref|XP_005330527.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Ictidomys tridecemlineatus]
 ref|XP_005395699.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Chinchilla lanigera]
 ref|XP_005519754.1| PREDICTED: cell differentiation protein RCD1 homolog [Pseudopodoces 
humilis]
 ref|XP_005883488.1| PREDICTED: cell differentiation protein RCD1 homolog [Myotis 
brandtii]
 ref|XP_005889716.1| PREDICTED: cell differentiation protein RCD1 homolog [Bos mutus]
 ref|XP_005969282.1| PREDICTED: cell differentiation protein RCD1 homolog [Pantholops 
hodgsonii]
 ref|XP_006082578.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Myotis lucifugus]
 ref|XP_006186898.1| PREDICTED: cell differentiation protein RCD1 homolog [Camelus 
ferus]
 ref|XP_006207321.1| PREDICTED: cell differentiation protein RCD1 homolog [Vicugna 
pacos]
 ref|XP_006168729.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Tupaia chinensis]
 ref|XP_006763397.1| PREDICTED: cell differentiation protein RCD1 homolog [Myotis 
davidii]
 ref|XP_006891958.1| PREDICTED: cell differentiation protein RCD1 homolog [Elephantulus 
edwardii]
 ref|XP_006906782.1| PREDICTED: cell differentiation protein RCD1 homolog [Pteropus 
alecto]
 ref|XP_006972255.1| PREDICTED: cell differentiation protein RCD1 homolog [Peromyscus 
maniculatus bairdii]
 ref|XP_007086189.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X3 [Panthera tigris altaica]
 ref|XP_007121508.1| PREDICTED: cell differentiation protein RCD1 homolog [Physeter 
catodon]
 ref|XP_006048216.1| PREDICTED: cell differentiation protein RCD1 homolog [Bubalus 
bubalis]
 ref|XP_007187978.1| PREDICTED: cell differentiation protein RCD1 homolog [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007434641.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X2 [Python bivittatus]
 ref|XP_007614277.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X2 [Cricetulus griseus]
 ref|XP_007957724.1| PREDICTED: cell differentiation protein RCD1 homolog [Orycteropus 
afer afer]
 ref|XP_007964470.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Chlorocebus sabaeus]
 ref|XP_008057039.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Tarsius syrichta]
 ref|XP_008535048.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Equus przewalskii]
 ref|XP_008568968.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Galeopterus variegatus]
 ref|XP_008688692.1| PREDICTED: cell differentiation protein RCD1 homolog [Ursus maritimus]
 ref|XP_008823937.1| PREDICTED: cell differentiation protein RCD1 homolog [Nannospalax 
galili]
 ref|XP_009086137.1| PREDICTED: cell differentiation protein RCD1 homolog [Serinus 
canaria]
 ref|XP_009555898.1| PREDICTED: cell differentiation protein RCD1 homolog [Cuculus 
canorus]
 ref|XP_010358537.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X2 [Rhinopithecus roxellana]
 ref|XP_010334623.1| PREDICTED: cell differentiation protein RCD1 homolog [Saimiri 
boliviensis boliviensis]
 ref|XP_010610212.1| PREDICTED: cell differentiation protein RCD1 homolog [Fukomys 
damarensis]
 ref|XP_010600302.1| PREDICTED: cell differentiation protein RCD1 homolog [Loxodonta 
africana]
 ref|XP_010859491.1| PREDICTED: cell differentiation protein RCD1 homolog [Bison bison 
bison]
 ref|XP_010947073.1| PREDICTED: cell differentiation protein RCD1 homolog [Camelus 
bactrianus]
 ref|XP_010986629.1| PREDICTED: cell differentiation protein RCD1 homolog [Camelus 
dromedarius]
 sp|Q4R347.1|RCD1_MACFA RecName: Full=Cell differentiation protein RCD1 homolog; Short=Rcd-1; 
AltName: Full=CCR4-NOT transcription complex subunit 
9 [Macaca fascicularis]
 sp|Q5PQL2.1|RCD1_RAT RecName: Full=Cell differentiation protein RCD1 homolog; Short=Rcd-1; 
AltName: Full=CCR4-NOT transcription complex subunit 
9 [Rattus norvegicus]
 sp|Q9JKY0.1|RCD1_MOUSE RecName: Full=Cell differentiation protein RCD1 homolog; Short=Rcd-1; 
AltName: Full=CCR4-NOT transcription complex subunit 
9; AltName: Full=EPO-induced protein FL10 [Mus musculus]
 sp|A7MB47.1|RCD1_BOVIN RecName: Full=Cell differentiation protein RCD1 homolog; Short=Rcd-1; 
AltName: Full=CCR4-NOT transcription complex subunit 
9 [Bos taurus]
 gb|AAF61701.1|AF221849_1 FL10 [Mus musculus]
 dbj|BAB23752.1| unnamed protein product [Mus musculus]
 gb|AAH50898.1| Rcd1 (required for cell differentiation) homolog 1 (S. pombe) 
[Mus musculus]
 gb|AAH51948.1| Rcd1 (required for cell differentiation) homolog 1 (S. pombe) 
[Mus musculus]
 gb|AAH87134.1| Rcd1 (required for cell differentiation) homolog 1 (S. pombe) 
[Rattus norvegicus]
 dbj|BAE02472.1| unnamed protein product [Macaca fascicularis]
 gb|EDL00329.1| rcd1 (required for cell differentiation) homolog 1 (S. pombe), 
isoform CRA_a [Mus musculus]
 gb|EDL75357.1| rcd1 (required for cell differentiation) homolog 1 (S. pombe) 
[Rattus norvegicus]
 gb|AAI51335.1| RQCD1 protein [Bos taurus]
 tpg|DAA32417.1| TPA: cell differentiation protein RCD1 homolog [Bos taurus]
 gb|EGW11888.1| Cell differentiation protein RCD1-like [Cricetulus griseus]
 gb|EHH21673.1| hypothetical protein EGK_04796 [Macaca mulatta]
 gb|EHH55168.1| hypothetical protein EGM_04320 [Macaca fascicularis]
 gb|ELK17210.1| Cell differentiation protein RCD1 like protein [Pteropus alecto]
 gb|ERE86613.1| putative cell differentiation protein RCD1 like protein [Cricetulus 
griseus]
 gb|KFO20179.1| Cell differentiation protein RCD1 like protein [Fukomys damarensis]
Length=299

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  24    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  83

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  84    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  143

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  144   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  200

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  201   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  255

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  256   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  283



>gb|EMT16235.1| hypothetical protein F775_52609 [Aegilops tauschii]
Length=325

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 131/259 (51%), Positives = 175/259 (68%), Gaps = 8/259 (3%)
 Frame = -2

Query  1075  KRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKESTRVCNALALIQCMAAHP  896
             KRE   +L  LLW+SF TV  LLQE++S+Y  LSP  ++   S RVCNALAL+QC+A+HP
Sbjct  2     KREIFQDLAPLLWHSFGTVAALLQEIVSIYPSLSPPTLSPVASNRVCNALALLQCVASHP  61

Query  895   DTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVKIEDPNAPEIVHFLLET  716
             DTR+  + A IP YLYPFL  +   +P E+LRLTSLGVIGALVK++D    E++ FLL+T
Sbjct  62    DTRIPFLNAHIPLYLYPFLNTTSKTRPFEYLRLTSLGVIGALVKVDD---SEVIGFLLQT  118

Query  715   EVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAERFFSVVQVLGRLVERLP  536
             E+ PLCLR +++G EL++TVAT IV KIL+ + GL+Y CA AERFF+V  VL ++V+ L 
Sbjct  119   EIIPLCLRTMEMGSELSKTVATFIVQKILLDDIGLRYICATAERFFAVATVLAQMVQALA  178

Query  535   ETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDERFLNVLHDDPQTARML  356
             E P  RLL++++RCYLRL+E        A      CLP  L D  F N L DD  T R L
Sbjct  179   EQPSARLLKHIIRCYLRLTE-----NQRACAALNSCLPTVLKDGTFNNFLLDDNVTRRWL  233

Query  355   QQFFLNITTSSS*RGNIYS  299
             QQ   N++ +    G+ ++
Sbjct  234   QQLLSNMSIAGLGGGSSHT  252



>ref|NP_005435.1| cell differentiation protein RCD1 homolog isoform 2 [Homo sapiens]
 ref|NP_001233377.1| cell differentiation protein RCD1 homolog [Pan troglodytes]
 ref|XP_003272411.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
1 [Nomascus leucogenys]
 ref|XP_003818668.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Pan paniscus]
 ref|XP_004033254.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
1 [Gorilla gorilla gorilla]
 ref|XP_005070554.1| PREDICTED: cell differentiation protein RCD1 homolog [Mesocricetus 
auratus]
 sp|Q92600.1|RCD1_HUMAN RecName: Full=Cell differentiation protein RCD1 homolog; Short=Rcd-1; 
AltName: Full=CCR4-NOT transcription complex subunit 
9 [Homo sapiens]
 sp|Q5R6Z6.2|RCD1_PONAB RecName: Full=Cell differentiation protein RCD1 homolog; Short=Rcd-1; 
AltName: Full=CCR4-NOT transcription complex subunit 
9 [Pongo abelii]
 dbj|BAA13508.1| unnamed protein product [Homo sapiens]
 gb|EAW70625.1| RCD1 required for cell differentiation1 homolog (S. pombe), isoform 
CRA_b [Homo sapiens]
 gb|AAI37457.1| RCD1 required for cell differentiation1 homolog (S. pombe) [Homo 
sapiens]
 gb|AAI37456.1| RCD1 required for cell differentiation1 homolog (S. pombe) [Homo 
sapiens]
 dbj|BAJ07307.1| RQCD1 [Homo sapiens]
 dbj|BAK63181.1| RCD1 required for cell differentiation1 homolog [Pan troglodytes]
Length=299

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  24    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  83

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  84    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  143

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  144   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  200

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  201   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  255

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  256   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  283



>ref|XP_003214973.1| PREDICTED: cell differentiation protein RCD1 homolog [Anolis 
carolinensis]
Length=299

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  24    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  83

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  84    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  143

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  144   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  200

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  201   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  255

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  256   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  283



>ref|XP_008143385.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Eptesicus fuscus]
Length=299

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  24    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  83

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  84    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  143

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  144   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  200

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  201   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  255

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  256   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  283



>ref|XP_008455456.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X3 [Cucumis melo]
Length=277

 Score =   227 bits (578),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 123/243 (51%), Positives = 171/243 (70%), Gaps = 8/243 (3%)
 Frame = -2

Query  1078  KKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKESTRVCNALALIQCMAAH  899
             +KR     L +L+W+SF T++ LL+E++ +Y  LS   +T K STRVCNALAL+QC+A+H
Sbjct  33    QKRSMFDNLAVLIWHSFGTMFTLLKEIMDVYHLLSKPELTEKASTRVCNALALLQCVASH  92

Query  898   PDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVKIEDPNAPEIVHFLLE  719
             P+TR+  ++A+IP YLYPFL  ++ EKP E LRLTSLGVIGALVK+ D    E+++FLL+
Sbjct  93    PETRVPFMKAEIPLYLYPFLNTTIKEKPHECLRLTSLGVIGALVKVND---KEVIYFLLK  149

Query  718   TEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAERFFSVVQVLGRLVERL  539
             TE+ P CLRC+D+G  L++TVAT IV KIL+ EEGL+YCC +A+RFF++ + L  ++E L
Sbjct  150   TEIVPYCLRCMDVGKGLSKTVATFIVQKILMNEEGLRYCCIIADRFFAITRALETMMETL  209

Query  538   PETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDERFLNVLHDDPQTARM  359
              E P  RLL+++VRCYL LSE P     +      R LP  L+   F ++LHDDP     
Sbjct  210   SEEPSQRLLKHIVRCYLMLSESPRACLGLG-----RLLPRMLSHSAFTDLLHDDPTVMSS  264

Query  358   LQQ  350
              +Q
Sbjct  265   FKQ  267



>ref|XP_006112741.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Pelodiscus sinensis]
Length=347

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 181/268 (68%), Gaps = 7/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  17    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  76

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  77    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  136

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  137   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  193

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL+++VRCYLRLS+ P    S A E  R+CLP 
Sbjct  194   QTYERFSHVAMILGKMVLQLSKEPSARLLKHMVRCYLRLSDNP----SRAREALRQCLPD  249

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  250   QLKDTTFAQVLKDDTTTKRWLAQLIKNL  277



>dbj|BAG38156.1| unnamed protein product [Homo sapiens]
Length=299

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  24    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  83

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  84    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  143

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  144   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  200

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  201   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  255

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  256   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  283



>gb|KFO69703.1| Cell differentiation protein RCD1, partial [Cuculus canorus]
 gb|KFQ04943.1| Cell differentiation protein RCD1, partial [Leptosomus discolor]
Length=296

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  21    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  80

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  81    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  140

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  141   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  197

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  198   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  252

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  253   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  280



>gb|KCW66961.1| hypothetical protein EUGRSUZ_F00722 [Eucalyptus grandis]
Length=300

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 141/287 (49%), Positives = 191/287 (67%), Gaps = 8/287 (3%)
 Frame = -2

Query  1258  MENLPETLCVDptaaapplalsaappgeasssiSQSATLDELLHMLHNPNLREEAMELLN  1079
             M NLP++L ++    A P A +    G  +S   + A+ ++L+  L NP+LRE A+  L+
Sbjct  3     MPNLPQSLSMNAPFGAGPGATAPGAAGPPASKDRKMASAEQLVLDLCNPDLRENALLELS  62

Query  1078  KKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKESTRVCNALALIQCMAAH  899
             KKRE   +L  LLWNS  T+  LLQE+I +Y  LSP  +T  +S RVCNALAL+QC+A+H
Sbjct  63    KKRELFQDLAPLLWNSVGTIAALLQEIIFIYPVLSPPNLTPAQSNRVCNALALLQCVASH  122

Query  898   PDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVKIEDPNAPEIVHFLLE  719
             PDTRM  ++A IP YLYPFL      +P E+LRLTSLGVIGALVK++D    E++ FLL 
Sbjct  123   PDTRMLFLKAHIPLYLYPFLNTGSKTRPFEYLRLTSLGVIGALVKVDD---TEVISFLLS  179

Query  718   TEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAERFFSVVQVLGRLVERL  539
             TE+ PLCLR +++G EL++TVAT IV KIL+ + GL Y C  AERF++V +VL  +V  L
Sbjct  180   TEIIPLCLRTMEMGSELSKTVATFIVQKILLDDLGLDYICTTAERFYAVGRVLNHMVGAL  239

Query  538   PETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDERF  398
              E P  RLL++++RCYLRL++ P      A +  R CLP  L D  F
Sbjct  240   AEQPSSRLLKHIIRCYLRLADNPR-----ACDALRGCLPEMLRDGTF  281



>gb|ELK30515.1| Cell differentiation protein RCD1 like protein [Myotis davidii]
Length=295

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  20    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  79

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  80    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  139

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  140   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  196

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  197   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  251

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  252   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  279



>ref|XP_009687994.1| PREDICTED: cell differentiation protein RCD1 homolog, partial 
[Struthio camelus australis]
Length=314

 Score =   228 bits (581),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  39    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  98

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  99    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  158

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  159   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  215

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  216   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  270

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  271   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  298



>emb|CDP99648.1| Protein BM-NTL-9 [Brugia malayi]
Length=288

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 131/268 (49%), Positives = 179/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1123  LHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKEST  944
             L + + RE+A+  L+KKRE+  +LP+ LW SF ++  LLQEVIS+Y  + P  +T  +S 
Sbjct  28    LSDSSKREQALLELSKKRETVPDLPLWLWYSFGSMASLLQEVISIYPAIMPPTLTAGQSN  87

Query  943   RVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVK  764
             RVCNALAL+QC+A+H +TR   ++A IP +LYPFL  +   +P E+LRLTSLGVIGALVK
Sbjct  88    RVCNALALMQCVASHKETRSPFLQAHIPLFLYPFLHTTKTSRPFEYLRLTSLGVIGALVK  147

Query  763   IEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAER  584
              ++    E++ FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C   ER
Sbjct  148   TDE---QEVIQFLLSTEIIPLCLRIMENGTELSKTVATFILQKILLDDTGLAYICQTYER  204

Query  583   FFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDE  404
             F  V  +LG++V  L + P  RLL++VVRCY RLS+ P      A++  R+CLP +L DE
Sbjct  205   FSHVAMILGKMVLHLAKEPSQRLLKHVVRCYSRLSDNPR-----ALQALRQCLPDQLRDE  259

Query  403   RFLNVLHDDPQTARMLQQFFLNITTSSS  320
              F  VL DD  T   L+Q   NI  S S
Sbjct  260   TFTRVLADDKSTKHWLKQLLKNIGFSVS  287



>ref|XP_007908508.1| PREDICTED: cell differentiation protein RCD1 homolog [Callorhinchus 
milii]
Length=298

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  23    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  82

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  83    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  142

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  143   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  199

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  200   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  254

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  255   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  282



>ref|XP_010071840.1| PREDICTED: cell differentiation protein RCD1 homolog [Pterocles 
gutturalis]
Length=301

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  26    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  85

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  86    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  145

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  146   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  202

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  203   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  257

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  258   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  285



>ref|XP_004883955.1| PREDICTED: cell differentiation protein RCD1 homolog [Heterocephalus 
glaber]
Length=305

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  35    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  94

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  95    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  154

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  155   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  211

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  212   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  266

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  267   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  294



>ref|XP_009073791.1| PREDICTED: cell differentiation protein RCD1 homolog, partial 
[Acanthisitta chloris]
 gb|KFP80780.1| Cell differentiation protein RCD1, partial [Acanthisitta chloris]
Length=297

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  22    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  81

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  82    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  141

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  142   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  198

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  199   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  253

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  254   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  281



>ref|XP_006269184.1| PREDICTED: cell differentiation protein RCD1 homolog, partial 
[Alligator mississippiensis]
 ref|XP_007445918.1| PREDICTED: cell differentiation protein RCD1 homolog, partial 
[Lipotes vexillifer]
 ref|XP_009813273.1| PREDICTED: cell differentiation protein RCD1 homolog, partial 
[Gavia stellata]
 ref|XP_009864805.1| PREDICTED: cell differentiation protein RCD1 homolog, partial 
[Apaloderma vittatum]
 ref|XP_010140899.1| PREDICTED: cell differentiation protein RCD1 homolog, partial 
[Buceros rhinoceros silvestris]
 ref|XP_010196712.1| PREDICTED: cell differentiation protein RCD1 homolog, partial 
[Colius striatus]
 ref|XP_010288041.1| PREDICTED: cell differentiation protein RCD1 homolog, partial 
[Phaethon lepturus]
 gb|EFB15812.1| hypothetical protein PANDA_001550 [Ailuropoda melanoleuca]
 gb|ELR60755.1| Cell differentiation protein RCD1-like protein, partial [Bos 
mutus]
 gb|KFO93760.1| Cell differentiation protein RCD1, partial [Buceros rhinoceros 
silvestris]
 gb|KFV74755.1| Cell differentiation protein RCD1, partial [Struthio camelus 
australis]
 gb|KGL77754.1| Cell differentiation protein RCD1, partial [Tinamus guttatus]
Length=291

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  16    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  75

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  76    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  135

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  136   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  192

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  193   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  247

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  248   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  275



>gb|EMP25483.1| Cell differentiation protein RCD1 like protein [Chelonia mydas]
Length=302

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  27    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  86

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  87    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  146

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  147   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  203

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  204   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  258

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  259   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  286



>ref|XP_009323133.1| PREDICTED: cell differentiation protein RCD1 homolog [Pygoscelis 
adeliae]
Length=302

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  27    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  86

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  87    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  146

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  147   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  203

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  204   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  258

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  259   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  286



>ref|XP_010165671.1| PREDICTED: cell differentiation protein RCD1 homolog, partial 
[Caprimulgus carolinensis]
Length=278

 Score =   227 bits (578),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 129/264 (49%), Positives = 178/264 (67%), Gaps = 8/264 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  22    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  81

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  82    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  141

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  142   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  198

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  199   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  253

Query  418   KLTDERFLNVLHDDPQTARMLQQF  347
             +L D  F  VL DD  T R L Q 
Sbjct  254   QLKDTTFAQVLKDDTTTKRWLAQL  277



>ref|XP_010114516.1| PREDICTED: cell differentiation protein RCD1 homolog, partial 
[Chlamydotis macqueenii]
Length=297

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  22    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  81

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  82    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  141

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  142   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  198

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  199   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  253

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  254   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  281



>ref|XP_010405629.1| PREDICTED: cell differentiation protein RCD1 homolog, partial 
[Corvus cornix cornix]
Length=301

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  26    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  85

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  86    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  145

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  146   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  202

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  203   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  257

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  258   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  285



>ref|XP_005234401.1| PREDICTED: cell differentiation protein RCD1 homolog [Falco peregrinus]
 ref|XP_005443013.1| PREDICTED: cell differentiation protein RCD1 homolog [Falco cherrug]
Length=294

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  19    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  78

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  79    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  138

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  139   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  195

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  196   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  250

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  251   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  278



>ref|XP_009959647.1| PREDICTED: cell differentiation protein RCD1 homolog, partial 
[Leptosomus discolor]
Length=297

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  22    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  81

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  82    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  141

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  142   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  198

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  199   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  253

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  254   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  281



>ref|XP_010009602.1| PREDICTED: cell differentiation protein RCD1 homolog, partial 
[Nestor notabilis]
Length=294

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  19    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  78

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  79    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  138

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  139   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  195

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  196   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  250

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  251   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  278



>gb|AEE62592.1| unknown [Dendroctonus ponderosae]
Length=303

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 131/268 (49%), Positives = 178/268 (66%), Gaps = 8/268 (3%)
 Frame = -2

Query  1123  LHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKEST  944
             L +P  RE A+  L+KKRE  A+L  +LWNSF T+  LLQE++ +Y  ++P  +T  ES 
Sbjct  30    LTSPETRENALFELSKKREIVADLAPMLWNSFGTIAALLQEILIIYPAINPPTLTAHESN  89

Query  943   RVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVK  764
             RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVIGALVK
Sbjct  90    RVCNALALLQCVASHPETRSNFLVAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVIGALVK  149

Query  763   IEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAER  584
              ++    E++ FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ E GL Y C   +R
Sbjct  150   TDE---QEVITFLLTTEIIPLCLRIMETGSELSKTVATFILQKILLDESGLSYICQTYDR  206

Query  583   FFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDE  404
             F  V  +LG++V  L + P  RLL++VVRCYLRLS+ P      A E  R+CLP +L D 
Sbjct  207   FSHVAMILGKMVLSLAKDPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPDQLRDS  261

Query  403   RFLNVLHDDPQTARMLQQFFLNITTSSS  320
              F N L +D  T   LQQ   N+ ++++
Sbjct  262   TFNNCLQEDKSTKHWLQQLIRNLDSTAA  289



>ref|XP_005246999.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Homo sapiens]
Length=301

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  26    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  85

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  86    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  145

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  146   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  202

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  203   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  257

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  258   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  285



>ref|XP_005485333.1| PREDICTED: cell differentiation protein RCD1 homolog [Zonotrichia 
albicollis]
 ref|XP_005416112.1| PREDICTED: cell differentiation protein RCD1 homolog [Geospiza 
fortis]
Length=305

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  30    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  89

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  90    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  149

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  150   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  206

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  207   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  261

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  262   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  289



>gb|KFP86038.1| Cell differentiation protein RCD1, partial [Apaloderma vittatum]
Length=296

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  21    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  80

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  81    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  140

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  141   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  197

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  198   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  252

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  253   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  280



>ref|XP_005498733.1| PREDICTED: cell differentiation protein RCD1 homolog [Columba 
livia]
Length=301

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  26    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  85

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  86    AHQSNRVCNALALLQCVASHPETRYAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  145

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  146   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  202

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  203   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  257

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  258   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  285



>ref|XP_006694528.1| putative cell differentiation protein [Chaetomium thermophilum 
var. thermophilum DSM 1495]
 gb|EGS19643.1| putative cell differentiation protein [Chaetomium thermophilum 
var. thermophilum DSM 1495]
Length=356

 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 132/266 (50%), Positives = 178/266 (67%), Gaps = 8/266 (3%)
 Frame = -2

Query  1117  NPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKESTRV  938
             N N RE A+  L+KKRE   EL ++LW+SF  +  LLQE+IS+Y  LSP ++T   S RV
Sbjct  88    NENTREAALLELSKKREQVPELALILWHSFGVMTSLLQEIISVYSLLSPSQLTAAASNRV  147

Query  937   CNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVKIE  758
             CNALAL+QC+A+H +TR   + A IP +LYPFL  +   +P E+LRLTSLGVIGALVK  
Sbjct  148   CNALALLQCVASHNETRTLFLNAHIPLFLYPFLNTTSKSRPFEYLRLTSLGVIGALVK--  205

Query  757   DPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAERFF  578
               ++ E+++FLL TE+ PLCLR ++ G EL++TVA  IV KIL+ + GL Y CA  ERF+
Sbjct  206   -NDSSEVINFLLTTEIIPLCLRIMETGSELSKTVAIFIVQKILLDDNGLNYICATYERFY  264

Query  577   SVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDERF  398
             +V  VL  +V +L E    RLL++VVRC+LRLS+      + A E  R+CLP  L D  F
Sbjct  265   AVGTVLSNMVAQLVEQQTARLLKHVVRCFLRLSD-----NARAREALRQCLPEPLRDHTF  319

Query  397   LNVLHDDPQTARMLQQFFLNITTSSS  320
              NVL DD  T R L Q  +N++ + +
Sbjct  320   SNVLRDDAATKRCLAQLLINLSDNGN  345



>ref|XP_008921238.1| PREDICTED: cell differentiation protein RCD1 homolog [Manacus 
vitellinus]
Length=302

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  27    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  86

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  87    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  146

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  147   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  203

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  204   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  258

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  259   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  286



>ref|XP_008495202.1| PREDICTED: cell differentiation protein RCD1 homolog, partial 
[Calypte anna]
Length=302

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  27    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  86

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  87    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  146

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  147   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  203

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  204   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  258

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  259   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  286



>gb|EOB00198.1| Cell differentiation protein RCD1-like protein, partial [Anas 
platyrhynchos]
 gb|KFM04637.1| Cell differentiation protein RCD1, partial [Aptenodytes forsteri]
 gb|KFO06842.1| Cell differentiation protein RCD1, partial [Balearica regulorum 
gibbericeps]
 gb|KFO55053.1| Cell differentiation protein RCD1, partial [Corvus brachyrhynchos]
 gb|KFP03320.1| Cell differentiation protein RCD1, partial [Calypte anna]
 gb|KFP21623.1| Cell differentiation protein RCD1, partial [Egretta garzetta]
 gb|KFP35392.1| Cell differentiation protein RCD1, partial [Chlamydotis macqueenii]
 gb|KFP68056.1| Cell differentiation protein RCD1, partial [Cariama cristata]
 gb|KFQ00853.1| Cell differentiation protein RCD1, partial [Haliaeetus albicilla]
 gb|KFQ22562.1| Cell differentiation protein RCD1, partial [Merops nubicus]
 gb|KFQ40759.1| Cell differentiation protein RCD1, partial [Mesitornis unicolor]
 gb|KFQ46922.1| Cell differentiation protein RCD1, partial [Nestor notabilis]
 gb|KFQ66114.1| Cell differentiation protein RCD1, partial [Pelecanus crispus]
 gb|KFQ77619.1| Cell differentiation protein RCD1, partial [Phaethon lepturus]
 gb|KFQ86096.1| Cell differentiation protein RCD1, partial [Phoenicopterus ruber 
ruber]
 gb|KFQ94719.1| Cell differentiation protein RCD1, partial [Nipponia nippon]
 gb|KFU88475.1| Cell differentiation protein RCD1, partial [Chaetura pelagica]
 gb|KFU97803.1| Cell differentiation protein RCD1, partial [Pterocles gutturalis]
 gb|KFV10166.1| Cell differentiation protein RCD1, partial [Tauraco erythrolophus]
 gb|KFV55937.1| Cell differentiation protein RCD1, partial [Gavia stellata]
 gb|KFW05247.1| Cell differentiation protein RCD1, partial [Eurypyga helias]
 gb|KFW12335.1| Cell differentiation protein RCD1, partial [Fulmarus glacialis]
 gb|KFW67652.1| Cell differentiation protein RCD1, partial [Pygoscelis adeliae]
 gb|KFW80157.1| Cell differentiation protein RCD1, partial [Manacus vitellinus]
 gb|KFZ66823.1| Cell differentiation protein RCD1, partial [Podiceps cristatus]
 gb|KGL86403.1| Cell differentiation protein RCD1, partial [Charadrius vociferus]
Length=296

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  21    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  80

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  81    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  140

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  141   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  197

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  198   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  252

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  253   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  280



>ref|XP_005184857.1| PREDICTED: cell differentiation protein RCD1 homolog, partial 
[Musca domestica]
Length=282

 Score =   227 bits (578),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 129/268 (48%), Positives = 181/268 (68%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRE+  +L  +LW+SF T+  LLQE+I++Y  ++P  +T
Sbjct  3     QWINELAHPETREAALLELSKKRETVTDLAPMLWHSFGTIAALLQEIINIYPSINPATLT  62

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HPDTR   ++A+IP +LYPFL+ +   +P E+LRLTSLGVI
Sbjct  63    AHQSNRVCNALALLQCVASHPDTRTVFLQAQIPLFLYPFLQTTSKTRPFEYLRLTSLGVI  122

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E++ FLL +E+ PLCLR ++ G EL++TVAT I+ KIL+ E GL Y C
Sbjct  123   GALVKTDE---QEVITFLLTSEIIPLCLRIMEFGSELSKTVATFILQKILLDESGLSYVC  179

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  180   QTYERFSHVAIILGKMVIQLAKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  234

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F   L DD  T   LQ    N+
Sbjct  235   QLRDATFSVCLQDDKSTKHWLQLLIKNL  262



>gb|KFV63409.1| Cell differentiation protein RCD1, partial [Picoides pubescens]
Length=296

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  21    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  80

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  81    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  140

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  141   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  197

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  198   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  252

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  253   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  280



>gb|KFP30335.1| Cell differentiation protein RCD1, partial [Colius striatus]
Length=296

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  21    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  80

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  81    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  140

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  141   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  197

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  198   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  252

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  253   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  280



>gb|KFR04483.1| Cell differentiation protein RCD1, partial [Opisthocomus hoazin]
Length=296

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  21    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  80

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  81    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  140

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  141   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  197

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  198   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  252

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  253   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  280



>ref|XP_009943625.1| PREDICTED: cell differentiation protein RCD1 homolog [Opisthocomus 
hoazin]
Length=295

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  20    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  79

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  80    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  139

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  140   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  196

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  197   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  251

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  252   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  279



>gb|ETN79607.1| cell differentiation family, Rcd1 [Necator americanus]
Length=307

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 129/263 (49%), Positives = 175/263 (67%), Gaps = 4/263 (2%)
 Frame = -2

Query  1123  LHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKEST  944
             L + N RE A+  L+KKR+S  ELPI LW SF T+  LLQEVI++Y  + P  +T  +S 
Sbjct  48    LKDCNKRENALLELSKKRDSVPELPIWLWYSFGTMAALLQEVIAIYPAIMPANLTASQSN  107

Query  943   RVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVK  764
             RVCNALAL+QC+A+H DTR   ++A IP YLYPFL  +   +  E+LRLTSLGVIGALVK
Sbjct  108   RVCNALALMQCVASHKDTRGPFLQAHIPLYLYPFLHTTKTSRSFEYLRLTSLGVIGALVK  167

Query  763   IEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAER  584
              ++    E++ FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C   ER
Sbjct  168   TDE---KEVISFLLSTEIIPLCLRIMEQGTELSKTVATFILQKILLDDTGLSYICQTYER  224

Query  583   FFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDE  404
             F  V  +LG++V +L   P  RLL++V+RCY RLS+ P  L   A +  R+CLP +L DE
Sbjct  225   FSHVAMILGKMVMKLSRDPSSRLLKHVIRCYSRLSDNPR-LYCSAQQALRQCLPDQLKDE  283

Query  403   RFLNVLHDDPQTARMLQQFFLNI  335
              F N+L +D  +   L+    N+
Sbjct  284   TFKNILDEDKSSRHWLRSLMNNL  306



>ref|XP_008643064.1| PREDICTED: cell differentiation protein RCD1 homolog [Corvus 
brachyrhynchos]
Length=305

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  30    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  89

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  90    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  149

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  150   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  206

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  207   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  261

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  262   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  289



>ref|XP_005850551.1| hypothetical protein CHLNCDRAFT_140433 [Chlorella variabilis]
 gb|EFN58449.1| hypothetical protein CHLNCDRAFT_140433 [Chlorella variabilis]
Length=287

 Score =   227 bits (578),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 133/260 (51%), Positives = 175/260 (67%), Gaps = 8/260 (3%)
 Frame = -2

Query  1114  PNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKESTRVC  935
             P  +E A+  L+KKRES  EL   LW+SF T+  LLQE++S+Y  L P  +T   S RVC
Sbjct  12    PAAKETALLELSKKRESFPELAPYLWHSFGTMAALLQEIVSIYPMLQPPSLTAHASNRVC  71

Query  934   NALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVKIED  755
             NALAL+QC+A+HP+TR   ++A IP +LYPFL      +P E+LRLTSLGVIGALVK++D
Sbjct  72    NALALLQCVASHPETRSLFLQAHIPLFLYPFLNTISKTRPFEYLRLTSLGVIGALVKVDD  131

Query  754   PNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAERFFS  575
                 E+++FLL TE+ PLCLR ++ G EL++TVAT IV KIL+   GL Y CA AERFF+
Sbjct  132   ---TEVINFLLSTEIIPLCLRTMETGSELSKTVATFIVQKILLDGVGLSYICATAERFFA  188

Query  574   VVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDERFL  395
             V  VL  +V  L E P +RLL++++RCYLRLS+ P      A E  R+CLP  L + +F 
Sbjct  189   VGAVLSSMVTGLAEQPSVRLLKHIIRCYLRLSDNP-----RAREALRQCLPDLLRNPQFT  243

Query  394   NVLHDDPQTARMLQQFFLNI  335
               L DD  T R L Q  +N+
Sbjct  244   ACLKDDVTTRRWLAQLLVNV  263



>ref|XP_008940679.1| PREDICTED: cell differentiation protein RCD1 homolog, partial 
[Merops nubicus]
 ref|XP_009489188.1| PREDICTED: cell differentiation protein RCD1 homolog, partial 
[Pelecanus crispus]
 ref|XP_009584294.1| PREDICTED: cell differentiation protein RCD1 homolog, partial 
[Fulmarus glacialis]
 ref|XP_009704591.1| PREDICTED: cell differentiation protein RCD1 homolog, partial 
[Cariama cristata]
 ref|XP_009977300.1| PREDICTED: cell differentiation protein RCD1 homolog, partial 
[Tauraco erythrolophus]
 ref|XP_010149944.1| PREDICTED: cell differentiation protein RCD1 homolog, partial 
[Eurypyga helias]
 ref|XP_010190854.1| PREDICTED: cell differentiation protein RCD1 homolog, partial 
[Mesitornis unicolor]
 ref|XP_010296189.1| PREDICTED: cell differentiation protein RCD1 homolog, partial 
[Balearica regulorum gibbericeps]
Length=297

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  22    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  81

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  82    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  141

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  142   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  198

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  199   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  253

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  254   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  281



>ref|XP_009273303.1| PREDICTED: cell differentiation protein RCD1 homolog [Aptenodytes 
forsteri]
Length=299

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  24    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  83

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  84    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  143

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  144   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  200

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  201   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  255

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  256   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  283



>ref|XP_006364171.1| PREDICTED: cell differentiation protein RCD1 homolog [Solanum 
tuberosum]
Length=217

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 157/210 (75%), Gaps = 2/210 (1%)
 Frame = -2

Query  964  ITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLG  785
            I+ KESTR CNALAL Q MA +P+TR  L+ AKIP Y YPFL+PS ++KPLE+LRLTSLG
Sbjct  2    ISMKESTRACNALALFQVMAKNPETRKELIEAKIPCYFYPFLKPSGDDKPLEYLRLTSLG  61

Query  784  VIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKY  605
            V+GAL K +DPN P+++HF LET V P CL C+DL DEL++ VATLIVMKIL+QE+G+ Y
Sbjct  62   VLGALAKFDDPNGPKVLHFFLETGVVPSCLECMDLCDELSRKVATLIVMKILMQEKGMSY  121

Query  604  CCALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCL  425
            CCA  E F+S+VQVL RLV+++ E PCL  L YV++C+L LSE+   +     E F R +
Sbjct  122  CCATPECFYSIVQVLYRLVQKITEKPCLLHLMYVIQCFLSLSEVFKFIG--PSEAFIRQV  179

Query  424  PPKLTDERFLNVLHDDPQTARMLQQFFLNI  335
            PP+L D  F ++L DD +TA MLQ  + N+
Sbjct  180  PPQLFDNTFKDILRDDHETAWMLQVLYFNV  209



>ref|XP_005049614.1| PREDICTED: cell differentiation protein RCD1 homolog [Ficedula 
albicollis]
Length=315

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  40    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  99

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  100   AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  159

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  160   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  216

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  217   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  271

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  272   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  299



>ref|XP_009882234.1| PREDICTED: cell differentiation protein RCD1 homolog [Charadrius 
vociferus]
Length=302

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  27    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  86

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  87    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  146

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  147   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  203

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  204   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  258

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  259   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  286



>ref|XP_005798199.1| PREDICTED: cell differentiation protein RCD1 homolog [Xiphophorus 
maculatus]
 ref|XP_007552295.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X2 [Poecilia formosa]
 ref|XP_008402436.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Poecilia reticulata]
Length=299

 Score =   227 bits (578),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 131/268 (49%), Positives = 181/268 (68%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  24    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  83

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  84    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  143

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  144   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  200

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+    LR  A E  R+CLP 
Sbjct  201   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSD---NLR--AREALRQCLPD  255

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  256   QLKDSTFAQVLKDDTTTKRWLAQLVKNL  283



>ref|XP_004807274.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Mustela putorius furo]
Length=304

 Score =   227 bits (578),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  29    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  88

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  89    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  148

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  149   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  205

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  206   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  260

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  261   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  288



>ref|XP_004402773.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
1 [Odobenus rosmarus divergens]
Length=304

 Score =   227 bits (578),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  29    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  88

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  89    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  148

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  149   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  205

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  206   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  260

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  261   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  288



>ref|XP_005279775.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X3 [Chrysemys picta bellii]
Length=302

 Score =   227 bits (578),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  27    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  86

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  87    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  146

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  147   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  203

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  204   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  258

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  259   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  286



>ref|XP_002167359.2| PREDICTED: cell differentiation protein RCD1 homolog [Hydra vulgaris]
Length=308

 Score =   227 bits (578),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 176/263 (67%), Gaps = 8/263 (3%)
 Frame = -2

Query  1123  LHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKEST  944
             L +P  RE A+  L+KKRE  A+L  +LW+SF T+  LLQE++++Y  ++P  +T  +S 
Sbjct  36    LASPETREHALLELSKKREVVADLAPMLWHSFGTIAALLQEIVNIYPMVNPPSLTAHQSN  95

Query  943   RVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVK  764
             RVCNALAL+QC+A+H +TR   ++A+IP +LYPFL  +   +P E+LRLTSLGV+GALVK
Sbjct  96    RVCNALALLQCVASHQETRSPFLQAQIPLFLYPFLHTTSKTRPFEYLRLTSLGVVGALVK  155

Query  763   IEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAER  584
              +D    E++ FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ E GL Y C   ER
Sbjct  156   TDD---QEVITFLLSTEIIPLCLRIMEAGSELSKTVATFILQKILLDETGLSYICQTYER  212

Query  583   FFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDE  404
             F  V  +LG++V  L + P  RLL++VVRCYLRLS+ P      A E  R+CLP  L D 
Sbjct  213   FSHVAMILGKMVIALAKEPSTRLLKHVVRCYLRLSDNP-----RAREALRQCLPEYLKDN  267

Query  403   RFLNVLHDDPQTARMLQQFFLNI  335
              F N L DD  T R L Q   N+
Sbjct  268   TFANCLKDDTSTKRWLSQLMKNL  290



>ref|XP_005676988.1| PREDICTED: cell differentiation protein RCD1 homolog [Capra hircus]
Length=333

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  58    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  117

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  118   AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  177

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  178   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  234

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  235   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  289

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  290   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  317



>ref|XP_010889325.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X1 [Esox lucius]
Length=301

 Score =   226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 129/268 (48%), Positives = 181/268 (68%), Gaps = 4/268 (1%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+S  T+  LLQE++++Y  ++P  +T
Sbjct  22    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSCGTIAALLQEIVNIYPSINPPTLT  81

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  82    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  141

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  142   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  198

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+  +P  + A E  R+CLP 
Sbjct  199   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNSSP-HTRAREALRQCLPD  257

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  258   QLKDTTFAQVLKDDTTTKRWLTQLVKNL  285



>ref|XP_009909474.1| PREDICTED: cell differentiation protein RCD1 homolog [Picoides 
pubescens]
Length=308

 Score =   227 bits (578),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  33    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  92

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  93    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  152

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  153   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  209

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  210   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  264

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  265   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  292



>ref|XP_010889327.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X3 [Esox lucius]
Length=296

 Score =   226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 129/268 (48%), Positives = 181/268 (68%), Gaps = 4/268 (1%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+S  T+  LLQE++++Y  ++P  +T
Sbjct  17    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSCGTIAALLQEIVNIYPSINPPTLT  76

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  77    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  136

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  137   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  193

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+  +P  + A E  R+CLP 
Sbjct  194   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNSSP-HTRAREALRQCLPD  252

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  253   QLKDTTFAQVLKDDTTTKRWLTQLVKNL  280



>ref|XP_003765981.1| PREDICTED: cell differentiation protein RCD1 homolog [Sarcophilus 
harrisii]
Length=309

 Score =   227 bits (578),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  34    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  93

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  94    AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  153

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  154   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  210

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  211   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  265

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  266   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  293



>gb|EXV05652.1| Rcd1-like cell differentiation family protein [Metarhizium robertsii]
Length=378

 Score =   229 bits (584),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 130/262 (50%), Positives = 177/262 (68%), Gaps = 8/262 (3%)
 Frame = -2

Query  1117  NPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKESTRV  938
             N N RE A+  L+KKRE   EL ++LW+SF  +  LLQE+IS+Y  L+P ++T   S RV
Sbjct  112   NENTREAALLELSKKREQVPELALILWHSFGVMTSLLQEIISVYTLLNPSQLTAAASNRV  171

Query  937   CNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVKIE  758
             CNALAL+QC+A+H DTR   + A IP +LYPFL  +   +P E+LRLTSLGVIGALVK  
Sbjct  172   CNALALLQCVASHNDTRTLFLNAHIPLFLYPFLNTTSKSRPFEYLRLTSLGVIGALVK--  229

Query  757   DPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAERFF  578
               ++ ++++FLL TE+ PLCLR ++ G EL++TVA  IV KIL+ + GL Y CA  ERF+
Sbjct  230   -NDSSDVINFLLTTEIIPLCLRIMETGSELSKTVAIFIVQKILLDDNGLNYICATYERFY  288

Query  577   SVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDERF  398
             +V  VL  +V +L E+   RLL++VVRC+LRLS+      + A E  R+CLP  L D  F
Sbjct  289   AVGTVLSNMVAQLVESQTARLLKHVVRCFLRLSD-----NARAREALRQCLPEPLRDATF  343

Query  397   LNVLHDDPQTARMLQQFFLNIT  332
              +VL DD  T R L Q  +N++
Sbjct  344   SSVLRDDAATKRCLAQLLINLS  365



>gb|EFX05511.1| cell differentiation protein [Grosmannia clavigera kw1407]
Length=275

 Score =   226 bits (575),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 131/264 (50%), Positives = 177/264 (67%), Gaps = 8/264 (3%)
 Frame = -2

Query  1123  LHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKEST  944
             L N N RE A+  L+KKRE   EL ++LW+SF  +  LLQE+IS+Y  L+P ++T   S 
Sbjct  7     LLNENTREAALLELSKKREQVPELALILWHSFGVMTSLLQEIISVYSLLNPSQLTAAASN  66

Query  943   RVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVK  764
             RVCNALAL+QC+A+H +TR   + A IP +LYPFL  +   +P E+LRLTSLGVIGALVK
Sbjct  67    RVCNALALLQCVASHNETRTLFLSAHIPLFLYPFLNTTSKSRPFEYLRLTSLGVIGALVK  126

Query  763   IEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAER  584
                 ++ E+++FLL TE+ PLCLR ++ G EL++TVA  IV KIL+ + GL Y CA  ER
Sbjct  127   ---NDSSEVINFLLTTEIIPLCLRIMETGSELSKTVAIFIVQKILLDDNGLNYICATYER  183

Query  583   FFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDE  404
             F++V  VL  +V +L E    RLL++VVRC+LRLS+      + A E  R+CLP  L D 
Sbjct  184   FYAVGTVLSNMVAQLVEQQTARLLKHVVRCFLRLSD-----NARAREALRQCLPEPLRDA  238

Query  403   RFLNVLHDDPQTARMLQQFFLNIT  332
              F +VL DD  T R L Q  +N++
Sbjct  239   TFSSVLRDDAATKRCLAQLLINLS  262



>emb|CCT64626.1| probable rcd1 protein involved in sexual development [Fusarium 
fujikuroi IMI 58289]
Length=363

 Score =   228 bits (582),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 131/262 (50%), Positives = 177/262 (68%), Gaps = 8/262 (3%)
 Frame = -2

Query  1117  NPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKESTRV  938
             N N RE A+  L+KKRE   EL ++LW+SF  +  LLQE+IS+Y  L+P ++T   S RV
Sbjct  96    NENTREAALLELSKKREQVPELALILWHSFGVMTSLLQEIISVYTLLNPSQLTAAASNRV  155

Query  937   CNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVKIE  758
             CNALAL+QC+A+H DTR   + A IP +LYPFL  +   +P E+LRLTSLGVIGALVK  
Sbjct  156   CNALALLQCVASHNDTRTLFLNAHIPLFLYPFLNTTSKSRPFEYLRLTSLGVIGALVK--  213

Query  757   DPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAERFF  578
               ++ E+++FLL TE+ PLCLR ++ G EL++TVA  IV KIL+ + GL Y CA  ERF+
Sbjct  214   -NDSSEVINFLLTTEIIPLCLRIMETGSELSKTVAIFIVQKILLDDNGLNYICATYERFY  272

Query  577   SVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDERF  398
             +V  VL  +V +L E+   RLL++VVRC+LRLS+      + A E  R+CLP  L D  F
Sbjct  273   AVGTVLSNMVAQLVESQTARLLKHVVRCFLRLSD-----NARAREALRQCLPEPLRDATF  327

Query  397   LNVLHDDPQTARMLQQFFLNIT  332
              +VL DD  T R L Q  +N++
Sbjct  328   SSVLRDDAATKRCLAQLLINLS  349



>ref|XP_009994553.1| PREDICTED: cell differentiation protein RCD1 homolog [Chaetura 
pelagica]
Length=322

 Score =   227 bits (579),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 180/268 (67%), Gaps = 8/268 (3%)
 Frame = -2

Query  1138  ELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRIT  959
             + ++ L +P  RE A+  L+KKRES  +L  +LW+SF T+  LLQE++++Y  ++P  +T
Sbjct  47    QWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLT  106

Query  958   TKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVI  779
               +S RVCNALAL+QC+A+HP+TR   + A IP +LYPFL      +P E+LRLTSLGVI
Sbjct  107   AHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVI  166

Query  778   GALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCC  599
             GALVK ++    E+++FLL TE+ PLCLR ++ G EL++TVAT I+ KIL+ + GL Y C
Sbjct  167   GALVKTDE---QEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC  223

Query  598   ALAERFFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPP  419
                ERF  V  +LG++V +L + P  RLL++VVRCYLRLS+ P      A E  R+CLP 
Sbjct  224   QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNP-----RAREALRQCLPD  278

Query  418   KLTDERFLNVLHDDPQTARMLQQFFLNI  335
             +L D  F  VL DD  T R L Q   N+
Sbjct  279   QLKDTTFAQVLKDDTTTKRWLAQLVKNL  306



>ref|XP_003650571.1| hypothetical protein THITE_2110170 [Thielavia terrestris NRRL 
8126]
 gb|AEO64235.1| hypothetical protein THITE_2110170 [Thielavia terrestris NRRL 
8126]
Length=355

 Score =   228 bits (581),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 132/265 (50%), Positives = 177/265 (67%), Gaps = 8/265 (3%)
 Frame = -2

Query  1117  NPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKESTRV  938
             N N RE A+  L+KKRE   EL ++LW+SF  +  LLQE+IS+Y  LSP ++T   S RV
Sbjct  89    NENTREAALLELSKKREQVPELALILWHSFGVMTSLLQEIISVYSLLSPSQLTAAASNRV  148

Query  937   CNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVKIE  758
             CNALAL+QC+A+H +TR   + A IP YLYPFL  +   +P E+LRLTSLGVIGALVK  
Sbjct  149   CNALALLQCVASHNETRTLFLNAHIPLYLYPFLNTTSKSRPFEYLRLTSLGVIGALVK--  206

Query  757   DPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAERFF  578
               ++ E+++FLL TE+ PLCLR ++ G EL++TVA  IV KIL+ + GL Y CA  ERF+
Sbjct  207   -NDSSEVINFLLTTEIIPLCLRIMETGSELSKTVAIFIVQKILLDDNGLNYICATYERFY  265

Query  577   SVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDERF  398
             +V  VL  +V +L E    RLL++VVRC+LRLS+      + A E  R+CLP  L D  F
Sbjct  266   AVGTVLSNMVAQLVEQQTARLLKHVVRCFLRLSD-----NARAREALRQCLPEPLRDHTF  320

Query  397   LNVLHDDPQTARMLQQFFLNITTSS  323
               VL DD  T R L Q  +N++ ++
Sbjct  321   SAVLRDDAATKRCLTQLLINLSENT  345



>ref|XP_009037094.1| hypothetical protein AURANDRAFT_69805 [Aureococcus anophagefferens]
 gb|EGB08375.1| hypothetical protein AURANDRAFT_69805 [Aureococcus anophagefferens]
Length=296

 Score =   226 bits (576),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 131/262 (50%), Positives = 177/262 (68%), Gaps = 8/262 (3%)
 Frame = -2

Query  1117  NPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKESTRV  938
             +P  RE A+  L+KKRE+  +L  +LW+SF T+  LLQE++S+Y  LSP  +T   S RV
Sbjct  21    SPEHRESALLELSKKRETFTDLAPILWHSFGTMGTLLQEIVSIYPMLSPPNLTAHASNRV  80

Query  937   CNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVKIE  758
             CNALAL+QC+A+HP+TR   + A +P YLYPFL      +P E+LRLTSLGV+GALVK++
Sbjct  81    CNALALLQCVASHPETRGLFLNAHVPLYLYPFLNTVSKNRPFEYLRLTSLGVVGALVKMD  140

Query  757   DPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAERFF  578
             D    ++++FLL+TE+ PLCLR ++ G EL++TVAT IV KIL+ + GL Y CA AERF+
Sbjct  141   D---SDVINFLLQTEIIPLCLRIMETGSELSKTVATFIVQKILLDDMGLNYVCATAERFY  197

Query  577   SVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDERF  398
             +V  VL  +V  L E P +RLL+++VRCYLRLS+    LR  A E  R+CLP  L D  F
Sbjct  198   AVSTVLANMVLTLVEQPSIRLLKHIVRCYLRLSD---NLR--AREALRQCLPESLRDHTF  252

Query  397   LNVLHDDPQTARMLQQFFLNIT  332
                + DD    R L     NI+
Sbjct  253   AGHIKDDLTVKRWLSSLLYNIS  274



>ref|XP_389451.1| hypothetical protein FG09275.1 [Fusarium graminearum PH-1]
 ref|XP_009261059.1| hypothetical protein FPSE_09667 [Fusarium pseudograminearum CS3096]
 gb|EKJ70141.1| hypothetical protein FPSE_09667 [Fusarium pseudograminearum CS3096]
 gb|ESU15824.1| cell differentiation protein rcd1 [Fusarium graminearum PH-1]
 gb|EYB28308.1| hypothetical protein FG05_09275 [Fusarium graminearum]
 emb|CEF84173.1| unnamed protein product [Fusarium graminearum]
Length=360

 Score =   228 bits (582),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 131/262 (50%), Positives = 177/262 (68%), Gaps = 8/262 (3%)
 Frame = -2

Query  1117  NPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKESTRV  938
             N N RE A+  L+KKRE   EL ++LW+SF  +  LLQE+IS+Y  L+P ++T   S RV
Sbjct  93    NENTREAALLELSKKREQVPELALILWHSFGVMTSLLQEIISVYTLLNPSQLTAAASNRV  152

Query  937   CNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVKIE  758
             CNALAL+QC+A+H DTR   + A IP +LYPFL  +   +P E+LRLTSLGVIGALVK  
Sbjct  153   CNALALLQCVASHNDTRTLFLNAHIPLFLYPFLNTTSKSRPFEYLRLTSLGVIGALVK--  210

Query  757   DPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAERFF  578
               ++ E+++FLL TE+ PLCLR ++ G EL++TVA  IV KIL+ + GL Y CA  ERF+
Sbjct  211   -NDSSEVINFLLTTEIIPLCLRIMETGSELSKTVAIFIVQKILLDDNGLNYICATYERFY  269

Query  577   SVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDERF  398
             +V  VL  +V +L E+   RLL++VVRC+LRLS+      + A E  R+CLP  L D  F
Sbjct  270   AVGTVLSNMVAQLVESQTARLLKHVVRCFLRLSD-----NARAREALRQCLPEPLRDATF  324

Query  397   LNVLHDDPQTARMLQQFFLNIT  332
              +VL DD  T R L Q  +N++
Sbjct  325   SSVLRDDAATKRCLAQLLINLS  346



>ref|XP_006352518.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 
X2 [Solanum tuberosum]
Length=269

 Score =   225 bits (574),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 150/210 (71%), Gaps = 5/210 (2%)
 Frame = -2

Query  1156  QSATLDELLHMLHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKL  977
             QSA  ++L+  L NP LRE A+  L+KKRE   +L  LLWNS  T+  LLQE+IS+Y  L
Sbjct  40    QSA--EQLVLDLSNPELRENALLELSKKRELFQDLAPLLWNSCATIAALLQEIISIYPVL  97

Query  976   SPLRITTKESTRVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRL  797
             SP  +T   S RVCNALAL+QC+A+HPDTRM  + A IP YLYPFL  +   +P E+LRL
Sbjct  98    SPPTLTPALSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRL  157

Query  796   TSLGVIGALVKIEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEE  617
             TSLGVIGALVK++D    E++ FLL TE+ PLCLR +++G EL++TVAT IV KIL+ + 
Sbjct  158   TSLGVIGALVKVDD---TEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDV  214

Query  616   GLKYCCALAERFFSVVQVLGRLVERLPETP  527
             GL Y C  AERFF+V +VLG +V  L E P
Sbjct  215   GLDYICTTAERFFAVARVLGNMVGTLAEQP  244



>ref|XP_002291328.1| cell differentiation protein [Thalassiosira pseudonana CCMP1335]
 gb|EED91435.1| cell differentiation protein, partial [Thalassiosira pseudonana 
CCMP1335]
Length=261

 Score =   225 bits (573),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 127/258 (49%), Positives = 176/258 (68%), Gaps = 8/258 (3%)
 Frame = -2

Query  1117  NPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKESTRV  938
             NP+ RE  +  L+KKRES  +L  +LW+++ TV  LLQE++S+Y  L+P  +T   S RV
Sbjct  12    NPDQREGVLLELSKKRESFPDLAPILWHTYGTVAALLQEIVSIYPLLTPPTLTAHASNRV  71

Query  937   CNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVKIE  758
             CNALAL+QC+A+HPDTR   + A +P YLYPFL      +P E+LRLTSLGVIGALVK++
Sbjct  72    CNALALLQCVASHPDTRGLFLSAHVPLYLYPFLNTQSKSRPFEYLRLTSLGVIGALVKMD  131

Query  757   DPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAERFF  578
             D    ++++FLL+TE+ PLCLR ++ G EL++TVAT IV KIL+ E GL Y CA AERF+
Sbjct  132   D---ADVINFLLQTEIIPLCLRIMEAGSELSKTVATFIVQKILLDEIGLSYVCATAERFY  188

Query  577   SVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDERF  398
             +V  VL  ++  L  +P +RLL+++VRCYLRLS+      + A +  R+ LP  L D+ F
Sbjct  189   AVSTVLNNMIGCLVLSPSVRLLKHIVRCYLRLSD-----NARARDALRQALPSSLRDDTF  243

Query  397   LNVLHDDPQTARMLQQFF  344
             +N L DD    + L Q  
Sbjct  244   VNALRDDVTVKKWLSQLL  261



>gb|KEY70769.1| hypothetical protein S7711_03263 [Stachybotrys chartarum IBT 
7711]
Length=378

 Score =   229 bits (583),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 131/262 (50%), Positives = 177/262 (68%), Gaps = 8/262 (3%)
 Frame = -2

Query  1117  NPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKESTRV  938
             N N RE A+  L+KKRE   EL ++LW+SF  +  LLQE+IS+Y  L+P ++T   S RV
Sbjct  111   NENTREAALLELSKKREQVPELALILWHSFGVMTSLLQEIISVYTLLNPSQLTAAASNRV  170

Query  937   CNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVKIE  758
             CNALAL+QC+A+H DTR   + A IP +LYPFL  +   +P E+LRLTSLGVIGALVK  
Sbjct  171   CNALALLQCVASHNDTRTLFLNAHIPLFLYPFLNTTSKSRPFEYLRLTSLGVIGALVK--  228

Query  757   DPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAERFF  578
               ++ E+++FLL TE+ PLCLR ++ G EL++TVA  IV KIL+ + GL Y CA  ERF+
Sbjct  229   -NDSSEVINFLLTTEIIPLCLRIMETGSELSKTVAIFIVQKILLDDNGLNYICATYERFY  287

Query  577   SVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDERF  398
             +V  VL  +V +L E+   RLL++VVRC+LRLS+      + A E  R+CLP  L D  F
Sbjct  288   AVGTVLSNMVAQLVESQTARLLKHVVRCFLRLSD-----NARAREALRQCLPEPLRDATF  342

Query  397   LNVLHDDPQTARMLQQFFLNIT  332
              +VL DD  T R L Q  +N++
Sbjct  343   SSVLRDDAATKRCLAQLLINLS  364



>gb|ENH82224.1| cell differentiation protein rcd1, partial [Colletotrichum orbiculare 
MAFF 240422]
Length=275

 Score =   225 bits (574),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 131/264 (50%), Positives = 177/264 (67%), Gaps = 8/264 (3%)
 Frame = -2

Query  1123  LHNPNLREEAMELLNKKRESCAELPILLWNSFNTVYILLQEVISLYKKLSPLRITTKEST  944
             L N + RE A+  L+KKRE   EL ++LW+SF  +  LLQE+IS+Y  L+P ++T   S 
Sbjct  7     LLNESTREAALLELSKKREQVPELALILWHSFGVMTSLLQEIISVYTLLNPSQLTAAASN  66

Query  943   RVCNALALIQCMAAHPDTRMGLVRAKIPAYLYPFLEPSVNEKPLEFLRLTSLGVIGALVK  764
             RVCNALAL+QC+A+H DTR   + A IP +LYPFL  +   +P E+LRLTSLGVIGALVK
Sbjct  67    RVCNALALLQCVASHNDTRTLFLNAHIPLFLYPFLNTTSKSRPFEYLRLTSLGVIGALVK  126

Query  763   IEDPNAPEIVHFLLETEVFPLCLRCIDLGDELTQTVATLIVMKILVQEEGLKYCCALAER  584
                 ++ E+++FLL TE+ PLCLR ++ G EL++TVA  IV KIL+ + GL Y CA  ER
Sbjct  127   ---NDSSEVINFLLTTEIIPLCLRIMETGSELSKTVAIFIVQKILLDDNGLNYICATYER  183

Query  583   FFSVVQVLGRLVERLPETPclrllryvvrcylrLSELPTPLRSMAMETFRRCLPPKLTDE  404
             F++V  VL  +V +L E    RLL++VVRC+LRLS+      + A E  R+CLP  L D 
Sbjct  184   FYAVGTVLSNMVAQLVEQQTARLLKHVVRCFLRLSD-----NARAREALRQCLPEPLRDA  238

Query  403   RFLNVLHDDPQTARMLQQFFLNIT  332
              F +VL DD  T R L Q  +N++
Sbjct  239   TFSSVLRDDAATKRCLAQLLINLS  262



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3991127976472