BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c28137_g1_i1 len=665 path=[3:0-664]

Length=665
                                                                      Score     E

ref|XP_004304312.1|  PREDICTED: uncharacterized protein LOC101296308  68.2    2e-11   
ref|XP_010661048.1|  PREDICTED: uncharacterized protein LOC100242238  67.8    5e-11   
ref|XP_008443420.1|  PREDICTED: uncharacterized protein LOC103487011  65.1    5e-10   
gb|KGN59579.1|  hypothetical protein Csa_3G827220                     64.7    9e-10   
ref|XP_008230755.1|  PREDICTED: uncharacterized protein LOC103329993  60.1    2e-08   
ref|XP_007217820.1|  hypothetical protein PRUPE_ppa027069mg           57.0    3e-07   
gb|KDP45496.1|  hypothetical protein JCGZ_09745                       57.4    3e-07   
ref|XP_008341562.1|  PREDICTED: uncharacterized protein LOC103404432  54.3    3e-06   
ref|XP_010029296.1|  PREDICTED: uncharacterized protein LOC104419356  48.5    7e-04   



>ref|XP_004304312.1| PREDICTED: uncharacterized protein LOC101296308 [Fragaria vesca 
subsp. vesca]
Length=111

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 49/81 (60%), Gaps = 6/81 (7%)
 Frame = -3

Query  486  TDQESVGSMEEIESPRSVAAKGRKYV---EVYVHSQILRIRAEDSHIGEDTAEIFSGLKD  316
            TD +S GS EE++SPRSV  + R+       YVHSQILRIR EDSH+GE +A    G K+
Sbjct  22   TDDDSAGSSEEMDSPRSVQGRWRRSALKKVAYVHSQILRIREEDSHLGESSA---FGAKE  78

Query  315  KVVSAAGHVASTVVLIRPASP  253
            KV  A       V+L RP  P
Sbjct  79   KVAHAVASRVDVVLLARPVLP  99



>ref|XP_010661048.1| PREDICTED: uncharacterized protein LOC100242238 [Vitis vinifera]
Length=138

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 52/85 (61%), Gaps = 8/85 (9%)
 Frame = -3

Query  483  DQESVGSMEEIESPRSVAAKGR-KYVEVYVHSQILRIRAEDSHIGEDTAEIFSGLKDKVV  307
            DQES GS EE ESP+SVA  G+       VHSQ+LRIR ED H+GED  E  S  KDKV 
Sbjct  47   DQESGGSSEEFESPKSVAKVGKWTKNNACVHSQVLRIREEDLHLGEDIGEGLSA-KDKVS  105

Query  306  SAAGHVAS--TVVL----IRPASPL  250
                HV+S   VVL    I P+SPL
Sbjct  106  GPLHHVSSQMDVVLLSRPILPSSPL  130



>ref|XP_008443420.1| PREDICTED: uncharacterized protein LOC103487011 [Cucumis melo]
Length=161

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 48/69 (70%), Gaps = 4/69 (6%)
 Frame = -3

Query  495  EMDTDQESVGSMEEIESPRSVA--AKGRKYVEVYVHSQILRIRAEDSHIGEDTAEIFSGL  322
            E++TDQES+GS EE ESP+SVA  A  RK +  YVH Q+ RIR ED H+GED  E F+  
Sbjct  44   EVETDQESIGSSEETESPKSVAKVADWRKKL-AYVHYQVRRIREEDLHLGEDIGEGFNA-  101

Query  321  KDKVVSAAG  295
            K+K+ S  G
Sbjct  102  KEKINSIGG  110



>gb|KGN59579.1| hypothetical protein Csa_3G827220 [Cucumis sativus]
Length=184

 Score = 64.7 bits (156),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 48/69 (70%), Gaps = 4/69 (6%)
 Frame = -3

Query  495  EMDTDQESVGSMEEIESPRSVA--AKGRKYVEVYVHSQILRIRAEDSHIGEDTAEIFSGL  322
            E++TDQES+GS EE ESP+SVA  A  RK +  YVH Q+ RIR ED H+GED  E F+  
Sbjct  66   EVETDQESIGSSEETESPKSVAKVADWRKKL-AYVHYQVRRIREEDLHLGEDIGEGFNA-  123

Query  321  KDKVVSAAG  295
            K+K+ S  G
Sbjct  124  KEKINSIGG  132



>ref|XP_008230755.1| PREDICTED: uncharacterized protein LOC103329993 [Prunus mume]
Length=130

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 51/87 (59%), Gaps = 10/87 (11%)
 Frame = -3

Query  489  DTDQESVGSMEEIESPRSVAAKGRKYVEV-YVHSQILRIRAEDSHIGEDTAEIFSGLKDK  313
            + +Q+S GS EE+ESPRSV    RK      VHSQILRIR ED+H+GE T+    G KD 
Sbjct  39   EMEQDSAGSSEEMESPRSVGRWRRKAKRAGCVHSQILRIREEDAHLGESTS---FGAKDN  95

Query  312  VVSAAGHVAS--TVVL----IRPASPL  250
                A  VAS   VVL    I P SPL
Sbjct  96   HHKVAHAVASGMDVVLFARPILPCSPL  122



>ref|XP_007217820.1| hypothetical protein PRUPE_ppa027069mg [Prunus persica]
 gb|EMJ19019.1| hypothetical protein PRUPE_ppa027069mg [Prunus persica]
Length=130

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 51/87 (59%), Gaps = 10/87 (11%)
 Frame = -3

Query  489  DTDQESVGSMEEIESPRSVAAKGRKYVEV-YVHSQILRIRAEDSHIGEDTAEIFSGLKDK  313
            + +Q+S GS EE+ESPRSV    R+      VHSQILRIR ED+H+GE T+    G KD 
Sbjct  39   EMEQDSGGSSEEMESPRSVGRWRRRAKRAGCVHSQILRIREEDAHLGESTS---FGSKDN  95

Query  312  VVSAAGHVAS--TVVL----IRPASPL  250
                A  VAS   VVL    I P SPL
Sbjct  96   HHKVAHAVASGMDVVLFARPILPCSPL  122



>gb|KDP45496.1| hypothetical protein JCGZ_09745 [Jatropha curcas]
Length=152

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 58/98 (59%), Gaps = 17/98 (17%)
 Frame = -3

Query  495  EMDTDQESVGSMEEIE-SPRSVAAKGRKYVEV-YVHSQILRIRAEDSHIGEDTAEIFSGL  322
            E + D+ES GS E++E SP+SV  K R   ++ +VHSQ+L+IR EDSH+GED  E  S  
Sbjct  48   ESEMDRESGGSSEDVEDSPKSVG-KWRNMEKLGFVHSQVLKIREEDSHLGEDFVEGLSA-  105

Query  321  KDKVVSAA-------GHVASTVVL------IRPASPLG  247
            KDKV++           VAS V +      + P SPLG
Sbjct  106  KDKVINGGFGQNIQFRRVASAVDVVFFTRPVLPCSPLG  143



>ref|XP_008341562.1| PREDICTED: uncharacterized protein LOC103404432 [Malus domestica]
Length=132

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 47/85 (55%), Gaps = 7/85 (8%)
 Frame = -3

Query  489  DTDQESVGSMEEIESPRSVAAKGRKYVE--VYVHSQILRIRAEDSHIGEDTAEIFSGLKD  316
            + +++S GS EE+ESPRSV    R+  +    +HSQ+LRIR EDSH+GE T  I  G   
Sbjct  44   EREEDSAGSSEEMESPRSVGRWRRRTTKEGCVMHSQVLRIREEDSHLGESTVPI--GAAA  101

Query  315  KVVSAAGHVASTVVLIR---PASPL  250
                   H    V+  R   P+SPL
Sbjct  102  AAAGKDYHGMDVVLFSRPILPSSPL  126



>ref|XP_010029296.1| PREDICTED: uncharacterized protein LOC104419356 [Eucalyptus grandis]
 gb|KCW56187.1| hypothetical protein EUGRSUZ_I01937 [Eucalyptus grandis]
Length=167

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 32/49 (65%), Gaps = 3/49 (6%)
 Frame = -3

Query  474  SVGSMEEIESPRSVAAKGRKYVE---VYVHSQILRIRAEDSHIGEDTAE  337
            S GS  E+ESPRS+A K  +  E     +HSQ+LRIR ED H+GED  E
Sbjct  65   SGGSPVEVESPRSLAGKWMRRAEKELARLHSQVLRIREEDLHLGEDIGE  113



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 995496856302