BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c28129_g1_i1 len=959 path=[1:0-958]

Length=959
                                                                      Score     E

ref|XP_009597432.1|  PREDICTED: CASP-like protein PIMP1               96.7    2e-20   
ref|XP_009795647.1|  PREDICTED: CASP-like protein PIMP1               89.4    3e-18   
ref|XP_010319256.1|  PREDICTED: CASP-like protein 4D1 isoform X1      85.1    2e-16   
ref|XP_010319257.1|  PREDICTED: CASP-like protein 4D1 isoform X2      56.6    9e-07   
sp|A1XGB4.1|PIMP1_CAPAN  RecName: Full=CASP-like protein PIMP1; A...  53.5    3e-05   Capsicum annuum
gb|ABC79684.1|  PIMP1 protein                                         53.5    3e-05   Capsicum annuum
ref|XP_002283558.1|  PREDICTED: CASP-like protein 4D1                 51.2    1e-04   Vitis vinifera
emb|CAN64094.1|  hypothetical protein VITISV_016056                   50.8    2e-04   Vitis vinifera
ref|XP_009761561.1|  PREDICTED: CASP-like protein PIMP1               50.4    2e-04   
emb|CDP00082.1|  unnamed protein product                              50.8    3e-04   



>ref|XP_009597432.1| PREDICTED: CASP-like protein PIMP1 [Nicotiana tomentosiformis]
Length=169

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 105/189 (56%), Gaps = 25/189 (13%)
 Frame = +1

Query  82   MGNWEKVNLALRILSFASLVVSIIFSLTSTSGnncdnnnnnYFPTSGdnnnncdnndnnY  261
            MG    VNL LRILS   L  SI    T++S     +                       
Sbjct  1    MGCLVIVNLLLRILSLCCLATSITILTTASSDMTVSSL----------------------  38

Query  262  YPFDFDVKIKLNFKDFYAYRYTLSVNAIGTVYSFIQFVLAIVGMKSDDDKSSDALVKANP  441
              F  DV++K  F DFYAYRY L+  A G VYS +Q V AI+ +K+  D   D L+  + 
Sbjct  39   --FHKDVEVKFGFSDFYAYRYMLACAAAGFVYSLLQTVFAIIQVKT-GDCICDKLIHFDV  95

Query  442  YLDQVMaillgtgaaagfgltlDLKHLRCGSTITRSFLNKMTVASVFCAGGFGFTAASSF  621
            Y D++M++++GTGAAAGFGLT+DL  L   + IT  FLNK  VA+ FC GGF  T  SSF
Sbjct  96   YADKIMSMIVGTGAAAGFGLTVDLNCLPNRAMITVDFLNKENVAASFCLGGFVCTMISSF  155

Query  622  VSLKIYEEE  648
            +SLKI++++
Sbjct  156  ISLKIFKDD  164



>ref|XP_009795647.1| PREDICTED: CASP-like protein PIMP1 [Nicotiana sylvestris]
Length=137

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 87/127 (69%), Gaps = 1/127 (1%)
 Frame = +1

Query  268  FDFDVKIKLNFKDFYAYRYTLSVNAIGTVYSFIQFVLAIVGMKSDDDKSSDALVKANPYL  447
            F  DV++K  F DFYAYRY L+  A G VYS +Q   AI+ +K+  D   D L+  + Y 
Sbjct  7    FHKDVEVKFGFSDFYAYRYMLACAAAGFVYSLLQTAFAIIQVKT-GDCVCDKLIHFDVYA  65

Query  448  DQVMaillgtgaaagfgltlDLKHLRCGSTITRSFLNKMTVASVFCAGGFGFTAASSFVS  627
            D++M++++GTGAAAGFGLT+DL +L   + IT  FLNK  VA+ FC GGF  T  SSF+S
Sbjct  66   DKIMSMIVGTGAAAGFGLTVDLNYLPNRAMITVDFLNKENVAASFCLGGFVCTMISSFIS  125

Query  628  LKIYEEE  648
            LKI++++
Sbjct  126  LKIFKDD  132



>ref|XP_010319256.1| PREDICTED: CASP-like protein 4D1 isoform X1 [Solanum lycopersicum]
Length=169

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 70/189 (37%), Positives = 103/189 (54%), Gaps = 25/189 (13%)
 Frame = +1

Query  82   MGNWEKVNLALRILSFASLVVSIIFSLTSTSGnncdnnnnnYFPTSGdnnnncdnndnnY  261
            MG    VNL LR++SF SL   +    TS+S  +  +                       
Sbjct  1    MGCLAIVNLLLRLVSFVSLATCVTILTTSSSNMSVASI----------------------  38

Query  262  YPFDFDVKIKLNFKDFYAYRYTLSVNAIGTVYSFIQFVLAIVGMKSDDDKSSDALVKANP  441
              F  +V++K +F DFYAYRY L+ +  G +YS IQ  +AI+  K+  D  SD L   + 
Sbjct  39   --FHGEVEVKYHFTDFYAYRYMLACSGTGFIYSLIQTAIAIIQAKT-GDCISDKLTHFDV  95

Query  442  YLDQVMaillgtgaaagfgltlDLKHLRCGSTITRSFLNKMTVASVFCAGGFGFTAASSF  621
            Y D++M++++GTGAAAGFGLT+DL  L   + +T  FLNK   A+ FC  GF     SSF
Sbjct  96   YADKIMSMIVGTGAAAGFGLTVDLSRLPNHAMVTVDFLNKENAAASFCLAGFVCNMISSF  155

Query  622  VSLKIYEEE  648
            +S K+++++
Sbjct  156  ISFKLFKDD  164



>ref|XP_010319257.1| PREDICTED: CASP-like protein 4D1 isoform X2 [Solanum lycopersicum]
Length=104

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 58/124 (47%), Gaps = 25/124 (20%)
 Frame = +1

Query  82   MGNWEKVNLALRILSFASLVVSIIFSLTSTSGnncdnnnnnYFPTSGdnnnncdnndnnY  261
            MG    VNL LR++SF SL   +    TS+S  +  +                       
Sbjct  1    MGCLAIVNLLLRLVSFVSLATCVTILTTSSSNMSVASI----------------------  38

Query  262  YPFDFDVKIKLNFKDFYAYRYTLSVNAIGTVYSFIQFVLAIVGMKSDDDKSSDALVKANP  441
              F  +V++K +F DFYAYRY L+ +  G +YS IQ  +AI+  K+  D  SD L   + 
Sbjct  39   --FHGEVEVKYHFTDFYAYRYMLACSGTGFIYSLIQTAIAIIQAKT-GDCISDKLTHFDV  95

Query  442  YLDQ  453
            Y D+
Sbjct  96   YADK  99



>sp|A1XGB4.1|PIMP1_CAPAN RecName: Full=CASP-like protein PIMP1; AltName: Full=CASP-like 
protein 4D1; Short=CaCASPL4D1; AltName: Full=Pathogen-induced 
membrane protein 1; Short=CaPIMP1 [Capsicum annuum]
 gb|ABC86980.1| plasma membrane protein [Capsicum annuum]
Length=166

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 64/117 (55%), Gaps = 3/117 (3%)
 Frame = +1

Query  277  DVKIKLNFKDFYAYRYTLSVNAIGTVYSFIQFVLAIVGMKSDDDKSSDALVKANPYLDQV  456
            DVKIK  FKDFYAYRY ++   IG  Y+ +Q   +I  + + +    +  +  + Y D+ 
Sbjct  45   DVKIK--FKDFYAYRYLIATVIIGMAYTLLQIAFSISLLTTGNRIGGEGFLLFDFYGDKF  102

Query  457  MaillgtgaaagfgltlDLKHLRCGSTITRSFLNKMTVASVFCAGGFGFTAASSFVS  627
            ++  L TGAAA FG+T DLK L  GS     FLN    A+  C  GF F  ASS  S
Sbjct  103  ISYFLVTGAAASFGMTQDLKQLE-GSDNYSKFLNTSNAAASLCLIGFFFAVASSIFS  158



>gb|ABC79684.1| PIMP1 protein [Capsicum annuum]
Length=166

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 64/117 (55%), Gaps = 3/117 (3%)
 Frame = +1

Query  277  DVKIKLNFKDFYAYRYTLSVNAIGTVYSFIQFVLAIVGMKSDDDKSSDALVKANPYLDQV  456
            DVKIK  FKDFYAYRY ++   IG  Y+ +Q   +I  + + +    +  +  + Y D+ 
Sbjct  45   DVKIK--FKDFYAYRYLIATVIIGMAYTLLQIAFSISLLTTGNRIGGEGFLLFDFYGDKF  102

Query  457  MaillgtgaaagfgltlDLKHLRCGSTITRSFLNKMTVASVFCAGGFGFTAASSFVS  627
            ++  L TGAAA FG+T DLK L  GS     FLN    A+  C  GF F  ASS  S
Sbjct  103  ISYFLVTGAAASFGMTQDLKQLE-GSDNYSKFLNTSNAAASLCLIGFFFAVASSIFS  158



>ref|XP_002283558.1| PREDICTED: CASP-like protein 4D1 [Vitis vinifera]
 emb|CBI31674.3| unnamed protein product [Vitis vinifera]
Length=170

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 64/116 (55%), Gaps = 5/116 (4%)
 Frame = +1

Query  283  KIKLNFKDFYAYRYTLSVNAIGTVYSFIQFVLAI--VGMKSDDDKSSDALVKANPYLDQV  456
            ++KL FKD +AYRY L    +G  Y  +Q V  I  V M      S ++L++ + Y D+V
Sbjct  45   ELKLRFKDVHAYRYMLFALVVGLPYILLQIVFGIYHVSMGKRISSSGESLLQFDFYADKV  104

Query  457  MaillgtgaaagfgltlDLKHL--RCGSTITRSFLNKMTVASVFCAGGFGFTAASS  618
            M+ +L TG  A FG TLDLK +    GS   + F NK + A+ F    F FTA SS
Sbjct  105  MSYILATGTGAAFGATLDLKEVFSELGSNYNK-FFNKGSAAASFILFAFLFTAVSS  159



>emb|CAN64094.1| hypothetical protein VITISV_016056 [Vitis vinifera]
Length=170

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 64/116 (55%), Gaps = 5/116 (4%)
 Frame = +1

Query  283  KIKLNFKDFYAYRYTLSVNAIGTVYSFIQFVLAI--VGMKSDDDKSSDALVKANPYLDQV  456
            ++KL FKD +AYRY L    +G  Y  +Q V  I  V M      S ++L++ + Y D+V
Sbjct  45   ELKLRFKDVHAYRYMLFALVVGLPYILLQIVFGIYHVSMGKRISSSGESLLQFDFYADKV  104

Query  457  MaillgtgaaagfgltlDLKHL--RCGSTITRSFLNKMTVASVFCAGGFGFTAASS  618
            M+ +L TG  A FG TLDLK +    GS   + F NK + A+ F    F FTA SS
Sbjct  105  MSYILXTGTGAXFGATLDLKEVFSELGSNYNK-FFNKGSAAASFILFAFLFTAVSS  159



>ref|XP_009761561.1| PREDICTED: CASP-like protein PIMP1 [Nicotiana sylvestris]
Length=167

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 61/117 (52%), Gaps = 2/117 (2%)
 Frame = +1

Query  277  DVKIKLNFKDFYAYRYTLSVNAIGTVYSFIQFVLAIVGMKSDDDKSSDALVKANPYLDQV  456
            DVKIK  F DFYAYRY ++   IG  Y+ +Q   +I  + + +    +     + Y D+ 
Sbjct  45   DVKIK--FSDFYAYRYLIATVVIGMAYTLLQTAFSIFLVTTGNRLGGEGFCLFDFYGDKF  102

Query  457  MaillgtgaaagfgltlDLKHLRCGSTITRSFLNKMTVASVFCAGGFGFTAASSFVS  627
            ++  L TGAAA FG+T DLK L+ G      FL     A+  C  GF F A SS  S
Sbjct  103  ISYFLATGAAASFGMTQDLKQLQNGDDTLNKFLGIADAAASLCLLGFIFAAVSSVFS  159



>emb|CDP00082.1| unnamed protein product [Coffea canephora]
Length=209

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 68/126 (54%), Gaps = 1/126 (1%)
 Frame = +1

Query  271  DFDVKIKLNFKDFYAYRYTLSVNAIGTVYSFIQFVLAIVGMKSDDDKSSDALVKANPYLD  450
            D  ++IK++F D YAYRY LS   IG  Y+ +Q   AI  + +       AL   + Y D
Sbjct  83   DSGLEIKVDFSDLYAYRYMLSTTVIGITYTLLQTAFAIFQVSTGKRFGGAALCYLDFYGD  142

Query  451  QVMaillgtgaaagfgltlDLKHLRCGSTITRSFLNKMTVASVFCAGGFGFTAASS-FVS  627
            +V++ +L TGAAAGFG+T+D   L    T    FLNK   A+      F F+A SS F S
Sbjct  143  KVISYMLATGAAAGFGITVDFNRLLLKGTDASDFLNKANAAAGLLIVAFLFSAISSVFSS  202

Query  628  LKIYEE  645
            L + + 
Sbjct  203  LALPKR  208



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2060434175780