BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c28104_g1_i1 len=1328 path=[1306:0-1327]

Length=1328
                                                                      Score     E

gb|AAP42508.1|  anionic peroxidase swpb3                                593   0.0      Ipomoea batatas [batate]
gb|ABR23054.1|  basic peroxidase swpb4                                  562   0.0      Ipomoea batatas [batate]
ref|XP_009614894.1|  PREDICTED: peroxidase P7-like                      504   7e-175   
dbj|BAA82306.1|  peroxidase                                             499   1e-172   Nicotiana tabacum [American tobacco]
ref|XP_009786874.1|  PREDICTED: peroxidase P7                           497   9e-172   
ref|XP_004240883.1|  PREDICTED: peroxidase P7-like                      496   2e-171   
ref|XP_006361306.1|  PREDICTED: peroxidase 4-like                       495   5e-171   
ref|XP_006365326.1|  PREDICTED: peroxidase 52-like                      495   5e-171   
ref|XP_011008654.1|  PREDICTED: peroxidase P7                           494   1e-170   
ref|XP_009606349.1|  PREDICTED: peroxidase P7-like                      493   3e-170   
gb|ACM47317.1|  peroxidase                                              493   4e-170   Capsicum annuum
ref|XP_008374580.1|  PREDICTED: peroxidase P7-like                      493   4e-170   
ref|XP_011076613.1|  PREDICTED: peroxidase P7                           491   2e-169   
ref|XP_004239964.1|  PREDICTED: peroxidase P7-like                      490   3e-169   
ref|XP_010256947.1|  PREDICTED: peroxidase 4-like                       489   6e-169   
ref|XP_006376028.1|  hypothetical protein POPTR_0013s08130g             486   1e-167   
ref|XP_010031113.1|  PREDICTED: peroxidase 4-like                       486   1e-167   
emb|CDP13933.1|  unnamed protein product                                485   3e-167   
ref|XP_007011229.1|  Peroxidase superfamily protein                     485   3e-167   
ref|XP_003523269.1|  PREDICTED: peroxidase 52-like isoform 1            484   9e-167   
ref|NP_001241914.1|  uncharacterized protein LOC100790279 precursor     484   1e-166   
gb|ADN96693.1|  peroxidase 6                                            482   5e-166   
ref|XP_007137608.1|  hypothetical protein PHAVU_009G140700g             481   1e-165   
gb|ACU17608.1|  unknown                                                 479   8e-165   Glycine max [soybeans]
ref|XP_002278996.1|  PREDICTED: peroxidase 4                            479   1e-164   Vitis vinifera
gb|EYU20115.1|  hypothetical protein MIMGU_mgv1a025851mg                478   3e-164   
ref|XP_009369255.1|  PREDICTED: peroxidase P7-like                      477   6e-164   
gb|KDP21681.1|  hypothetical protein JCGZ_03352                         476   1e-163   
ref|XP_008233851.1|  PREDICTED: peroxidase P7-like                      475   2e-163   
ref|XP_010264466.1|  PREDICTED: peroxidase 4-like                       473   2e-162   
gb|AAX44001.2|  putative secretory peroxidase                           472   4e-162   Catharanthus roseus [chatas]
gb|AAP76387.1|  class III peroxidase                                    473   4e-162   Gossypium hirsutum [American cotton]
ref|XP_008369321.1|  PREDICTED: peroxidase P7-like                      471   8e-162   
ref|XP_009363847.1|  PREDICTED: peroxidase P7-like                      470   2e-161   
gb|KHG18057.1|  Peroxidase 52 -like protein                             470   4e-161   
ref|XP_006486214.1|  PREDICTED: peroxidase 4-like                       469   5e-161   
ref|XP_008782624.1|  PREDICTED: peroxidase 4-like                       467   6e-160   
ref|XP_002873207.1|  hypothetical protein ARALYDRAFT_908444             464   5e-159   
ref|XP_010695731.1|  PREDICTED: peroxidase P7-like                      464   6e-159   
ref|NP_196153.1|  peroxidase 52                                         462   3e-158   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004307713.1|  PREDICTED: peroxidase 4-like                       462   3e-158   
ref|XP_003519407.1|  PREDICTED: peroxidase 4-like                       462   3e-158   
ref|XP_006470332.1|  PREDICTED: peroxidase 4-like                       461   1e-157   
gb|KFK24955.1|  hypothetical protein AALP_AA8G047500                    460   2e-157   
emb|CCJ34831.1|  horseradish peroxidase isoenzyme HRP_1350              459   5e-157   
ref|XP_010452439.1|  PREDICTED: peroxidase 52-like                      459   7e-157   
ref|XP_010423480.1|  PREDICTED: peroxidase 52                           459   7e-157   
gb|AFK41406.1|  unknown                                                 458   1e-156   
ref|XP_006595847.1|  PREDICTED: peroxidase 4-like                       458   1e-156   
emb|CAD67479.1|  peroxidase                                             458   2e-156   Asparagus officinalis
ref|XP_007141708.1|  hypothetical protein PHAVU_008G218500g             457   3e-156   
gb|KHN44724.1|  Peroxidase 4                                            456   1e-155   
ref|XP_002520835.1|  Peroxidase 52 precursor, putative                  456   1e-155   Ricinus communis
ref|XP_004502855.1|  PREDICTED: peroxidase 52-like                      455   2e-155   
ref|XP_003616748.1|  Peroxidase                                         454   6e-155   
ref|XP_010695722.1|  PREDICTED: peroxidase P7-like                      454   7e-155   
gb|ACU23245.1|  unknown                                                 454   1e-154   Glycine max [soybeans]
ref|XP_002269918.1|  PREDICTED: peroxidase 4                            453   2e-154   Vitis vinifera
ref|XP_003602463.1|  Peroxidase                                         452   5e-154   
ref|XP_006398996.1|  hypothetical protein EUTSA_v10014105mg             451   1e-153   
gb|KHN48387.1|  Peroxidase 52                                           448   1e-153   
ref|XP_010552918.1|  PREDICTED: peroxidase P7-like                      450   2e-153   
ref|XP_010921101.1|  PREDICTED: peroxidase 4-like                       449   8e-153   
ref|XP_006468162.1|  PREDICTED: peroxidase 4-like                       448   1e-152   
ref|XP_010491069.1|  PREDICTED: peroxidase 52-like                      447   3e-152   
ref|XP_008810563.1|  PREDICTED: peroxidase 4-like                       447   4e-152   
gb|KHG25850.1|  Peroxidase 4                                            446   9e-152   
ref|XP_010041552.1|  PREDICTED: peroxidase P7-like                      446   1e-151   
gb|KDP45728.1|  hypothetical protein JCGZ_17335                         445   2e-151   
ref|XP_010543687.1|  PREDICTED: peroxidase 52                           445   3e-151   
ref|XP_006843744.1|  hypothetical protein AMTR_s00007p00229000          444   3e-151   
emb|CDX70158.1|  BnaA10g25070D                                          444   4e-151   
gb|ACT35473.1|  peroxidase 52                                           443   5e-151   Brassica rapa
ref|XP_010045407.1|  PREDICTED: peroxidase 4-like                       444   6e-151   
ref|XP_009122142.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase P7      443   2e-150   
ref|XP_003602462.1|  Peroxidase                                         442   2e-150   
ref|XP_007219210.1|  hypothetical protein PRUPE_ppa017309mg             441   3e-150   
ref|XP_009125598.1|  PREDICTED: peroxidase P7                           442   3e-150   
gb|ABV24960.2|  putative secretory peroxidase                           442   3e-150   Catharanthus roseus [chatas]
gb|EPS59568.1|  hypothetical protein M569_15235                         441   4e-150   
emb|CDY04948.1|  BnaAnng01300D                                          442   5e-150   
ref|XP_006288218.1|  hypothetical protein CARUB_v10001455mg             441   6e-150   
emb|CDX98835.1|  BnaC09g50000D                                          441   1e-149   
ref|XP_003602461.1|  Peroxidase                                         440   2e-149   
ref|XP_008384729.1|  PREDICTED: peroxidase 4-like isoform X1            441   2e-149   
ref|XP_006843746.1|  hypothetical protein AMTR_s00007p00230210          440   2e-149   
gb|KHG17773.1|  Peroxidase 52 -like protein                             440   2e-149   
emb|CDY14118.1|  BnaC02g02350D                                          440   3e-149   
ref|XP_008384730.1|  PREDICTED: peroxidase 4-like isoform X2            439   3e-149   
sp|P00434.3|PERP7_BRARR  RecName: Full=Peroxidase P7; AltName: Fu...    438   4e-149   Brassica rapa subsp. rapa
ref|XP_009410536.1|  PREDICTED: peroxidase 4 {ECO:0000250|UniProt...    439   6e-149   
ref|XP_009369543.1|  PREDICTED: peroxidase 4-like                       439   6e-149   
ref|XP_004138400.1|  PREDICTED: peroxidase 52-like                      438   8e-149   
ref|XP_010067586.1|  PREDICTED: peroxidase 4-like                       438   1e-148   
ref|XP_010922691.1|  PREDICTED: peroxidase 4-like                       437   2e-148   
gb|ABO77632.1|  peroxidase                                              437   3e-148   Medicago truncatula
ref|XP_008456761.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase P7      437   3e-148   
ref|XP_002319968.2|  peroxidase family protein                          436   7e-148   Populus trichocarpa [western balsam poplar]
ref|XP_010045399.1|  PREDICTED: peroxidase 4-like                       436   9e-148   
ref|XP_009384773.1|  PREDICTED: peroxidase 4 {ECO:0000250|UniProt...    436   2e-147   
emb|CAD67478.1|  peroxidase                                             432   1e-146   Asparagus officinalis
gb|KHG09190.1|  Peroxidase 4                                            432   3e-146   
ref|XP_011021038.1|  PREDICTED: peroxidase 4-like                       432   4e-146   
ref|XP_004978554.1|  PREDICTED: peroxidase 4-like                       432   5e-146   
ref|XP_004978553.1|  PREDICTED: peroxidase 4-like                       432   5e-146   
ref|XP_007205551.1|  hypothetical protein PRUPE_ppa008607mg             431   6e-146   
emb|CAD67477.1|  peroxidase                                             430   1e-145   Asparagus officinalis
ref|XP_010685964.1|  PREDICTED: peroxidase 4-like                       429   3e-145   
ref|XP_004491048.1|  PREDICTED: peroxidase 4-like                       429   3e-145   
ref|XP_010067587.1|  PREDICTED: peroxidase 4-like                       429   3e-145   
tpe|CAH69372.1|  TPA: class III peroxidase 130 precursor                429   3e-145   
ref|XP_008354764.1|  PREDICTED: peroxidase 4-like                       429   5e-145   
ref|XP_009403860.1|  PREDICTED: peroxidase 4 {ECO:0000250|UniProt...    428   8e-145   
ref|XP_002450132.1|  hypothetical protein SORBIDRAFT_05g001000          428   2e-144   Sorghum bicolor [broomcorn]
ref|XP_004977588.1|  PREDICTED: peroxidase 4-like                       427   2e-144   
gb|EPS67864.1|  hypothetical protein M569_06908                         427   2e-144   
ref|XP_004294746.1|  PREDICTED: peroxidase 4-like                       427   2e-144   
gb|EMS66985.1|  Peroxidase 4                                            427   3e-144   
gb|EYU46002.1|  hypothetical protein MIMGU_mgv1a009759mg                427   3e-144   
ref|XP_010067589.1|  PREDICTED: peroxidase P7-like isoform X1           427   3e-144   
ref|XP_002441703.1|  hypothetical protein SORBIDRAFT_08g000990          426   6e-144   Sorghum bicolor [broomcorn]
gb|AAL93151.1|AF485265_1  class III peroxidase                          426   6e-144   Gossypium hirsutum [American cotton]
dbj|BAJ97638.1|  predicted protein                                      426   6e-144   
gb|ACN42168.1|  peroxidase 1                                            425   1e-143   Sesuvium portulacastrum [sea-purslane]
gb|EAY79693.1|  hypothetical protein OsI_34840                          425   1e-143   Oryza sativa Indica Group [Indian rice]
ref|XP_009354386.1|  PREDICTED: peroxidase 4-like                       424   3e-143   
ref|XP_010032327.1|  PREDICTED: peroxidase P7-like                      424   5e-143   
ref|NP_001065971.1|  Os12g0112000                                       423   7e-143   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004500341.1|  PREDICTED: peroxidase 4-like                       423   1e-142   
gb|AFW64595.1|  hypothetical protein ZEAMMB73_885092                    423   1e-142   
ref|XP_002450133.1|  hypothetical protein SORBIDRAFT_05g001010          423   1e-142   Sorghum bicolor [broomcorn]
ref|XP_010067590.1|  PREDICTED: peroxidase P7-like isoform X2           422   1e-142   
gb|KEH34419.1|  anionic peroxidase swpb3 protein                        422   2e-142   
gb|EPS58134.1|  anionic peroxidase swpb3                                421   6e-142   
ref|XP_010087166.1|  Peroxidase 4                                       420   2e-141   
ref|XP_010045401.1|  PREDICTED: peroxidase 4-like                       419   2e-141   
ref|XP_008244108.1|  PREDICTED: peroxidase 4                            420   2e-141   
ref|XP_008244444.1|  PREDICTED: peroxidase 4-like                       419   3e-141   
ref|XP_007017044.1|  Peroxidase 68                                      427   1e-140   
ref|XP_010067588.1|  PREDICTED: peroxidase 4-like                       417   2e-140   
ref|NP_001169614.1|  uncharacterized protein LOC100383495 precursor     417   2e-140   Zea mays [maize]
ref|XP_011080738.1|  PREDICTED: peroxidase 4-like                       417   3e-140   
emb|CDP04065.1|  unnamed protein product                                416   3e-140   
ref|XP_009402215.1|  PREDICTED: peroxidase 4 {ECO:0000250|UniProt...    416   5e-140   
emb|CAA62597.1|  korean-radish isoperoxidase                            416   6e-140   Raphanus sativus
ref|XP_010931330.1|  PREDICTED: peroxidase 4-like                       416   7e-140   
gb|AFR44628.1|  class III secretory peroxidase                          415   8e-140   
ref|NP_001151940.1|  peroxidase 52 precursor                            415   1e-139   Zea mays [maize]
ref|XP_006662662.1|  PREDICTED: peroxidase 4-like                       414   2e-139   
ref|NP_001131000.1|  uncharacterized protein LOC100192105 precursor     414   3e-139   Zea mays [maize]
gb|AAR31106.1|  peroxidase precursor                                    414   3e-139   Quercus suber [cork oak]
gb|AAR31108.1|  peroxidase precursor                                    414   5e-139   Quercus suber [cork oak]
ref|XP_006664870.1|  PREDICTED: peroxidase 4-like                       413   6e-139   
gb|ABK21858.1|  unknown                                                 412   2e-138   Picea sitchensis
gb|ACN33662.1|  unknown                                                 412   2e-138   Zea mays [maize]
ref|XP_007205544.1|  hypothetical protein PRUPE_ppa008590mg             412   3e-138   
gb|AAB48184.1|  peroxidase precursor                                    410   7e-138   Linum usitatissimum
ref|XP_002489046.1|  hypothetical protein SORBIDRAFT_0246s002010        410   9e-138   Sorghum bicolor [broomcorn]
ref|XP_008782619.1|  PREDICTED: cationic peroxidase 1-like              410   1e-137   
gb|AAD43561.1|AF155124_1  bacterial-induced peroxidase precursor        409   3e-137   Gossypium hirsutum [American cotton]
emb|CAL25300.1|  properoxidase                                          408   6e-137   Picea abies
ref|XP_009408894.1|  PREDICTED: peroxidase P7-like                      407   9e-137   
gb|ABR18139.1|  unknown                                                 408   1e-136   Picea sitchensis
ref|XP_009790966.1|  PREDICTED: peroxidase P7-like                      405   1e-135   
ref|XP_007048724.1|  Peroxidase superfamily protein                     405   1e-135   
ref|XP_003615995.1|  Peroxidase                                         405   1e-135   
ref|XP_010921098.1|  PREDICTED: cationic peroxidase 1-like              404   2e-135   
ref|XP_009593782.1|  PREDICTED: peroxidase P7-like                      404   2e-135   
ref|XP_009130879.1|  PREDICTED: peroxidase 52-like                      404   2e-135   
ref|XP_010246464.1|  PREDICTED: peroxidase P7-like                      404   3e-135   
ref|XP_003538328.1|  PREDICTED: peroxidase 4-like                       404   4e-135   
gb|KHN46282.1|  Peroxidase 4                                            404   4e-135   
ref|XP_003527340.1|  PREDICTED: peroxidase 52-like                      403   6e-135   
ref|XP_004234419.1|  PREDICTED: peroxidase P7-like                      403   7e-135   
ref|XP_003577141.1|  PREDICTED: peroxidase 4-like                       403   7e-135   
ref|XP_010653358.1|  PREDICTED: cationic peroxidase 1-like              403   9e-135   
ref|XP_002319967.2|  hypothetical protein POPTR_0013s15240g             401   3e-134   Populus trichocarpa [western balsam poplar]
ref|XP_010264472.1|  PREDICTED: cationic peroxidase 1-like              401   4e-134   
gb|ABK25962.1|  unknown                                                 400   6e-134   Picea sitchensis
emb|CDX80957.1|  BnaC03g02110D                                          400   7e-134   
ref|XP_010695716.1|  PREDICTED: peroxidase 4-like                       400   8e-134   
ref|XP_010653359.1|  PREDICTED: cationic peroxidase 1-like              400   8e-134   
ref|XP_008369411.1|  PREDICTED: peroxidase P7-like                      400   1e-133   
ref|XP_006842420.1|  hypothetical protein AMTR_s00077p00014810          399   1e-133   
ref|XP_009381203.1|  PREDICTED: peroxidase P7-like                      399   2e-133   
ref|XP_004302590.1|  PREDICTED: cationic peroxidase 1-like              399   3e-133   
ref|XP_010931328.1|  PREDICTED: cationic peroxidase 1-like              398   4e-133   
gb|ACU24215.1|  unknown                                                 398   6e-133   Glycine max [soybeans]
ref|XP_006353885.1|  PREDICTED: peroxidase 52-like                      398   7e-133   
gb|KDP21683.1|  hypothetical protein JCGZ_03354                         397   8e-133   
gb|AFV07575.1|  putative peroxidase a2                                  395   8e-133   
ref|XP_009420366.1|  PREDICTED: peroxidase P7-like                      397   1e-132   
emb|CAH10839.1|  peroxidase                                             397   2e-132   Picea abies
sp|P22195.2|PER1_ARAHY  RecName: Full=Cationic peroxidase 1; AltN...    396   2e-132   Arachis hypogaea [goober]
gb|KGN45822.1|  hypothetical protein Csa_6G013940                       394   3e-132   
ref|XP_011080818.1|  PREDICTED: uncharacterized protein LOC105163979    409   4e-132   
ref|XP_006833057.1|  hypothetical protein AMTR_s00170p00037010          395   4e-132   
ref|XP_010041557.1|  PREDICTED: cationic peroxidase 1-like              395   5e-132   
ref|XP_004490701.1|  PREDICTED: peroxidase 4-like                       396   7e-132   
ref|XP_008374568.1|  PREDICTED: peroxidase 4-like                       395   8e-132   
gb|KDO41520.1|  hypothetical protein CISIN_1g020615mg                   394   1e-131   
ref|XP_007011215.1|  Peroxidase superfamily protein isoform 1           394   1e-131   
gb|AIE12239.1|  peroxide                                                394   2e-131   
ref|XP_004500339.1|  PREDICTED: cationic peroxidase 1-like              394   2e-131   
gb|ABK23423.1|  unknown                                                 394   2e-131   Picea sitchensis
ref|XP_008795235.1|  PREDICTED: peroxidase P7-like                      394   2e-131   
ref|XP_010925616.1|  PREDICTED: peroxidase P7-like                      394   3e-131   
dbj|BAM28608.1|  putative peroxidase                                    393   4e-131   
ref|XP_004977590.1|  PREDICTED: cationic peroxidase 1-like              393   6e-131   
ref|XP_009404515.1|  PREDICTED: peroxidase P7-like                      392   6e-131   
ref|XP_009404514.1|  PREDICTED: peroxidase P7-like                      392   6e-131   
gb|ACZ51443.1|  peroxidase protein                                      393   7e-131   
ref|XP_009388702.1|  PREDICTED: peroxidase P7-like                      397   7e-131   
gb|AAB02554.1|  cationic peroxidase                                     392   9e-131   Stylosanthes humilis [alfafinha do nordeste]
ref|XP_003534655.2|  PREDICTED: cationic peroxidase 1-like              393   9e-131   
dbj|BAM28609.1|  putative peroxidase                                    392   1e-130   
ref|XP_009594465.1|  PREDICTED: cationic peroxidase 1-like              392   1e-130   
gb|AFK45898.1|  unknown                                                 392   1e-130   
pdb|1SCH|A  Chain A, Peanut Peroxidase                                  391   1e-130   
ref|XP_010689717.1|  PREDICTED: peroxidase P7-like                      392   2e-130   
ref|XP_009785653.1|  PREDICTED: cationic peroxidase 1-like              391   2e-130   
ref|XP_010263838.1|  PREDICTED: cationic peroxidase 1-like isofor...    391   2e-130   
ref|XP_010035985.1|  PREDICTED: cationic peroxidase 1-like              391   3e-130   
emb|CAH10840.1|  peroxidase                                             391   3e-130   Picea abies
dbj|BAM28607.1|  putative peroxidase                                    391   3e-130   
ref|NP_001065566.1|  Os11g0112200                                       390   4e-130   Oryza sativa Japonica Group [Japonica rice]
emb|CDY32701.1|  BnaA02g07630D                                          390   6e-130   
ref|XP_010093550.1|  Cationic peroxidase 1                              390   6e-130   
ref|XP_006349568.1|  PREDICTED: cationic peroxidase 1-like              390   6e-130   
gb|KFK27367.1|  hypothetical protein AALP_AA8G373800                    390   7e-130   
emb|CDY02820.1|  BnaC02g10690D                                          390   7e-130   
gb|ACJ11762.1|  class III peroxidase                                    390   7e-130   Gossypium hirsutum [American cotton]
ref|XP_009126754.1|  PREDICTED: peroxidase 67                           390   9e-130   
dbj|BAK06463.1|  predicted protein                                      389   1e-129   
ref|XP_010925617.1|  PREDICTED: peroxidase P7-like                      389   1e-129   
ref|XP_010256954.1|  PREDICTED: cationic peroxidase 1-like              389   2e-129   
ref|XP_006664869.1|  PREDICTED: cationic peroxidase 1-like              388   3e-129   
ref|XP_003552297.1|  PREDICTED: cationic peroxidase 1-like              388   4e-129   
ref|XP_004303193.1|  PREDICTED: peroxidase 52-like                      388   4e-129   
gb|ACI03401.1|  peroxidase 1                                            388   4e-129   Litchi chinensis [litchi]
tpe|CAH69378.1|  TPA: class III peroxidase 136 precursor                388   5e-129   
gb|ACU23223.1|  unknown                                                 388   5e-129   Glycine max [soybeans]
gb|KHN48395.1|  Peroxidase 4                                            388   5e-129   
ref|XP_008364165.1|  PREDICTED: peroxidase 4-like                       387   6e-129   
ref|XP_007033589.1|  Peroxidase superfamily protein                     388   6e-129   
gb|KDO63401.1|  hypothetical protein CISIN_1g020966mg                   387   7e-129   
ref|XP_008234083.1|  PREDICTED: peroxidase P7-like                      387   8e-129   
ref|XP_008343635.1|  PREDICTED: peroxidase 4-like                       387   9e-129   
ref|XP_011033755.1|  PREDICTED: peroxidase P7-like                      387   9e-129   
ref|XP_008374511.1|  PREDICTED: peroxidase P7-like isoform X1           387   9e-129   
ref|XP_010035872.1|  PREDICTED: peroxidase P7-like                      387   9e-129   
ref|XP_003551174.1|  PREDICTED: peroxidase 4-like                       387   1e-128   
ref|XP_006468149.1|  PREDICTED: cationic peroxidase 1-like              386   1e-128   
ref|XP_010261061.1|  PREDICTED: cationic peroxidase 1-like              387   1e-128   
gb|KHN29529.1|  Cationic peroxidase 1                                   387   1e-128   
ref|XP_006468993.1|  PREDICTED: peroxidase 52-like                      387   1e-128   
ref|XP_004242492.1|  PREDICTED: cationic peroxidase 1                   386   2e-128   
ref|XP_008369323.1|  PREDICTED: peroxidase 4-like                       387   2e-128   
ref|XP_010685963.1|  PREDICTED: cationic peroxidase 1-like              387   4e-128   
ref|XP_008792262.1|  PREDICTED: peroxidase 4-like                       395   4e-128   
ref|XP_008374539.1|  PREDICTED: peroxidase 4-like isoform X1            385   6e-128   
ref|XP_002450134.1|  hypothetical protein SORBIDRAFT_05g001030          385   9e-128   Sorghum bicolor [broomcorn]
ref|XP_007218699.1|  hypothetical protein PRUPE_ppa008820mg             384   9e-128   
ref|NP_001106040.1|  peroxidase 70 precursor                            384   1e-127   Zea mays [maize]
ref|XP_007146853.1|  hypothetical protein PHAVU_006G075600g             384   1e-127   
ref|XP_008465298.1|  PREDICTED: peroxidase 4-like                       384   1e-127   
ref|XP_008233849.1|  PREDICTED: peroxidase 4-like                       385   1e-127   
ref|XP_010041464.1|  PREDICTED: cationic peroxidase 1-like              384   1e-127   
ref|XP_006401086.1|  hypothetical protein EUTSA_v10014097mg             384   2e-127   
gb|AAX53172.1|  peroxidase                                              384   2e-127   Populus alba x Populus glandulosa
ref|XP_010915492.1|  PREDICTED: peroxidase P7-like                      384   2e-127   
ref|XP_006466288.1|  PREDICTED: peroxidase 4-like                       384   2e-127   
emb|CDY02817.1|  BnaC02g10720D                                          384   2e-127   
gb|KGN47222.1|  hypothetical protein Csa_6G216410                       383   3e-127   
ref|XP_004149366.1|  PREDICTED: peroxidase 4-like                       383   3e-127   
ref|XP_002281755.1|  PREDICTED: peroxidase P7                           383   3e-127   Vitis vinifera
ref|XP_007146856.1|  hypothetical protein PHAVU_006G075900g             384   3e-127   
ref|XP_004172441.1|  PREDICTED: peroxidase 4-like                       383   3e-127   
ref|XP_003577842.1|  PREDICTED: peroxidase 4                            384   3e-127   
ref|XP_007219390.1|  hypothetical protein PRUPE_ppa020254mg             383   4e-127   
ref|XP_008650762.1|  PREDICTED: peroxidase 70 isoform X1                383   4e-127   
ref|NP_200648.1|  peroxidase                                            383   5e-127   
ref|XP_004140410.1|  PREDICTED: lignin-forming anionic peroxidase...    382   5e-127   
ref|XP_008374518.1|  PREDICTED: peroxidase P7-like isoform X2           382   6e-127   
ref|XP_008374993.1|  PREDICTED: peroxidase 4-like                       382   7e-127   
ref|XP_002320417.1|  peroxidase family protein                          382   7e-127   
gb|KDO60611.1|  hypothetical protein CISIN_1g020951mg                   382   8e-127   
ref|XP_010263840.1|  PREDICTED: cationic peroxidase 1-like              382   8e-127   
ref|XP_009373126.1|  PREDICTED: cationic peroxidase 1-like              382   1e-126   
ref|XP_004150607.1|  PREDICTED: peroxidase 4-like                       382   1e-126   
ref|XP_003551179.1|  PREDICTED: cationic peroxidase 1-like              382   1e-126   
ref|XP_010689732.1|  PREDICTED: peroxidase P7-like                      381   2e-126   
gb|KGN47223.1|  hypothetical protein Csa_6G216420                       381   2e-126   
ref|XP_008228933.1|  PREDICTED: peroxidase P7-like                      381   2e-126   
ref|XP_008460239.1|  PREDICTED: lignin-forming anionic peroxidase...    381   2e-126   
ref|XP_008374548.1|  PREDICTED: peroxidase 4-like isoform X2            381   3e-126   
ref|XP_008463814.1|  PREDICTED: peroxidase 4-like                       381   3e-126   
ref|XP_010256951.1|  PREDICTED: peroxidase 4-like                       380   3e-126   
ref|XP_007215699.1|  hypothetical protein PRUPE_ppa008808mg             380   3e-126   
ref|XP_010066394.1|  PREDICTED: cationic peroxidase 1-like              380   4e-126   
ref|XP_003540000.1|  PREDICTED: peroxidase 52                           380   4e-126   
ref|XP_008388322.1|  PREDICTED: cationic peroxidase 1-like              380   4e-126   
ref|XP_004958680.1|  PREDICTED: peroxidase 70-like                      380   4e-126   
ref|XP_009381205.1|  PREDICTED: peroxidase P7-like                      380   5e-126   
ref|XP_008229747.1|  PREDICTED: cationic peroxidase 1-like              380   6e-126   
ref|XP_010915493.1|  PREDICTED: peroxidase P7-like                      380   6e-126   
ref|XP_008370240.1|  PREDICTED: cationic peroxidase 1-like              380   7e-126   
ref|XP_008465299.1|  PREDICTED: peroxidase 4-like                       379   1e-125   
ref|XP_008245160.1|  PREDICTED: cationic peroxidase 1-like              379   1e-125   
gb|ACU82387.2|  peroxidase 1                                            379   1e-125   
ref|XP_011021015.1|  PREDICTED: cationic peroxidase 1-like              379   1e-125   
ref|XP_007142064.1|  hypothetical protein PHAVU_008G249500g             379   1e-125   
ref|XP_002285723.1|  PREDICTED: cationic peroxidase 1 isoform X1        379   1e-125   
gb|KHN33941.1|  Peroxidase 52                                           377   2e-125   
ref|XP_010041648.1|  PREDICTED: cationic peroxidase 1-like              379   2e-125   
emb|CAH10841.1|  peroxidase                                             379   2e-125   
ref|XP_010683551.1|  PREDICTED: cationic peroxidase 1-like              379   2e-125   
ref|XP_004510041.1|  PREDICTED: peroxidase 52-like                      378   3e-125   
ref|XP_008790007.1|  PREDICTED: peroxidase P7-like                      378   3e-125   
ref|XP_009358287.1|  PREDICTED: cationic peroxidase 1-like              378   4e-125   
ref|XP_010685954.1|  PREDICTED: cationic peroxidase 1-like              378   4e-125   
ref|XP_004978383.1|  PREDICTED: peroxidase 4-like                       377   4e-125   
ref|NP_001057822.1|  Os06g0547400                                       378   4e-125   
ref|XP_007011212.1|  Peroxidase superfamily protein                     377   5e-125   
ref|XP_010650833.1|  PREDICTED: cationic peroxidase 1-like              377   5e-125   
ref|XP_010915491.1|  PREDICTED: peroxidase P7-like                      377   5e-125   
ref|XP_007205557.1|  hypothetical protein PRUPE_ppa008642mg             378   5e-125   
ref|XP_002281731.1|  PREDICTED: peroxidase P7                           377   6e-125   
ref|XP_004492538.1|  PREDICTED: cationic peroxidase 1-like              377   6e-125   
ref|XP_007132831.1|  hypothetical protein PHAVU_011G128200g             377   6e-125   
ref|XP_010685962.1|  PREDICTED: cationic peroxidase 1-like              379   6e-125   
ref|XP_009371984.1|  PREDICTED: cationic peroxidase 1-like              377   7e-125   
dbj|BAM05637.1|  peroxidase 2                                           378   7e-125   
ref|XP_004294750.1|  PREDICTED: cationic peroxidase 1-like              377   7e-125   
gb|AFK46186.1|  unknown                                                 377   8e-125   
ref|XP_009622973.1|  PREDICTED: cationic peroxidase 1-like              377   8e-125   
ref|XP_006596457.1|  PREDICTED: cationic peroxidase 1-like              376   9e-125   
ref|XP_010915490.1|  PREDICTED: peroxidase P7-like                      377   1e-124   
ref|XP_009363835.1|  PREDICTED: peroxidase 4-like                       377   1e-124   
ref|XP_007206416.1|  hypothetical protein PRUPE_ppa018664mg             376   1e-124   
ref|XP_003596720.1|  Peroxidase                                         377   1e-124   
ref|XP_010270786.1|  PREDICTED: lignin-forming anionic peroxidase...    376   1e-124   
ref|XP_004240055.1|  PREDICTED: cationic peroxidase 1-like              377   1e-124   
ref|XP_003538325.1|  PREDICTED: cationic peroxidase 1-like              377   1e-124   
ref|XP_003596719.1|  Peroxidase                                         376   1e-124   
ref|XP_011095107.1|  PREDICTED: cationic peroxidase 1-like              377   1e-124   
ref|XP_010067580.1|  PREDICTED: peroxidase 4-like                       376   2e-124   
ref|XP_009803848.1|  PREDICTED: cationic peroxidase 1-like              376   2e-124   
gb|KHN40655.1|  Cationic peroxidase 1                                   377   2e-124   
gb|EMT02760.1|  Peroxidase 4                                            375   2e-124   
ref|XP_006348978.1|  PREDICTED: peroxidase 52-like                      376   2e-124   
ref|XP_010270787.1|  PREDICTED: lignin-forming anionic peroxidase...    375   2e-124   
ref|XP_009369253.1|  PREDICTED: peroxidase 4-like                       376   3e-124   
ref|XP_004150606.1|  PREDICTED: peroxidase 4-like                       376   3e-124   
emb|CAH10842.1|  peroxidase                                             375   3e-124   
dbj|BAM05634.1|  peroxidase 2                                           376   4e-124   
gb|AHL39176.1|  class III peroxidase                                    375   4e-124   
ref|XP_010035984.1|  PREDICTED: cationic peroxidase 1-like              375   4e-124   
ref|XP_010683553.1|  PREDICTED: cationic peroxidase 1-like              375   4e-124   
ref|XP_009365290.1|  PREDICTED: peroxidase P7-like                      375   6e-124   
ref|XP_011080739.1|  PREDICTED: peroxidase 4-like                       375   6e-124   
ref|XP_006657042.1|  PREDICTED: peroxidase P7-like                      374   7e-124   
ref|XP_006387938.1|  hypothetical protein POPTR_0466s00210g             375   7e-124   
ref|XP_003571919.1|  PREDICTED: peroxidase 70-like                      375   7e-124   
ref|XP_006345521.1|  PREDICTED: cationic peroxidase 1-like              374   8e-124   
ref|XP_010664359.1|  PREDICTED: cationic peroxidase 1 isoform X3        374   8e-124   
ref|XP_004140450.1|  PREDICTED: lignin-forming anionic peroxidase...    374   9e-124   
emb|CAN81400.1|  hypothetical protein VITISV_038539                     374   1e-123   
ref|XP_009371986.1|  PREDICTED: cationic peroxidase 1-like isofor...    374   1e-123   
ref|XP_009371985.1|  PREDICTED: cationic peroxidase 1-like isofor...    374   2e-123   
ref|XP_009775239.1|  PREDICTED: cationic peroxidase 1-like              374   2e-123   
ref|XP_006378808.1|  hypothetical protein POPTR_0010s24340g             374   2e-123   
gb|KHN46100.1|  Cationic peroxidase 1                                   373   2e-123   
dbj|BAM05635.1|  peroxidase 2                                           374   2e-123   
emb|CBI22007.3|  unnamed protein product                                377   2e-123   
ref|XP_003596717.1|  Peroxidase                                         373   2e-123   
ref|XP_010066359.1|  PREDICTED: cationic peroxidase 1-like              373   2e-123   
ref|XP_003519284.1|  PREDICTED: peroxidase 4                            374   3e-123   
gb|KHG00581.1|  hypothetical protein F383_17561                         385   3e-123   
ref|XP_007142069.1|  hypothetical protein PHAVU_008G249900g             373   3e-123   
ref|XP_006848019.1|  hypothetical protein AMTR_s00029p00173440          373   3e-123   
gb|ADC42135.1|  lignin biosynthetic peroxidase                          372   4e-123   
ref|XP_010270788.1|  PREDICTED: lignin-forming anionic peroxidase...    373   5e-123   
dbj|BAD97435.1|  peroxidase                                             372   5e-123   
ref|XP_006470943.1|  PREDICTED: lignin-forming anionic peroxidase...    372   6e-123   
ref|XP_010270789.1|  PREDICTED: lignin-forming anionic peroxidase...    372   6e-123   
ref|XP_006345522.1|  PREDICTED: cationic peroxidase 1-like              372   8e-123   
ref|XP_002284007.1|  PREDICTED: cationic peroxidase 1 isoform X2        372   8e-123   
ref|XP_010246463.1|  PREDICTED: peroxidase P7-like                      372   8e-123   
gb|AFK42570.1|  unknown                                                 372   9e-123   
ref|XP_003601028.1|  Peroxidase                                         372   1e-122   
ref|XP_011082989.1|  PREDICTED: peroxidase P7-like                      371   1e-122   
emb|CAA71491.1|  peroxidase                                             372   1e-122   
ref|XP_008381199.1|  PREDICTED: peroxidase P7-like                      373   1e-122   
gb|KDP22793.1|  hypothetical protein JCGZ_00380                         370   1e-122   
ref|XP_008385017.1|  PREDICTED: cationic peroxidase 1-like              371   1e-122   
ref|XP_009410539.1|  PREDICTED: cationic peroxidase 1-like              371   2e-122   
ref|NP_001054096.1|  Os04g0651000                                       371   2e-122   
ref|XP_009395400.1|  PREDICTED: peroxidase P7-like                      371   2e-122   
ref|XP_004965567.1|  PREDICTED: peroxidase 4-like                       371   2e-122   
gb|KEH38859.1|  lignin biosynthetic peroxidase                          370   2e-122   
ref|XP_003562452.1|  PREDICTED: peroxidase 2-like                       370   3e-122   
ref|XP_009132056.1|  PREDICTED: peroxidase 68-like                      370   3e-122   
ref|XP_006470886.1|  PREDICTED: lignin-forming anionic peroxidase...    370   4e-122   
gb|EYU41993.1|  hypothetical protein MIMGU_mgv1a010225mg                370   4e-122   
dbj|BAC83101.1|  putative peroxidase precursor                          370   5e-122   
ref|XP_002461207.1|  hypothetical protein SORBIDRAFT_02g042840          370   5e-122   
ref|XP_004243276.1|  PREDICTED: peroxidase P7-like                      370   5e-122   
ref|XP_006470885.1|  PREDICTED: lignin-forming anionic peroxidase...    370   6e-122   
ref|XP_002509730.1|  Lignin-forming anionic peroxidase precursor,...    370   6e-122   
ref|XP_006470944.1|  PREDICTED: lignin-forming anionic peroxidase...    370   6e-122   
emb|CBI18066.3|  unnamed protein product                                367   7e-122   
dbj|BAJ91992.1|  predicted protein                                      370   7e-122   
ref|NP_001060626.1|  Os07g0676900                                       370   9e-122   
ref|XP_010227239.1|  PREDICTED: peroxidase P7-like                      369   9e-122   
ref|XP_004951344.1|  PREDICTED: peroxidase 70-like                      369   9e-122   
gb|EEC82680.1|  hypothetical protein OsI_27324                          369   9e-122   
gb|EYU41994.1|  hypothetical protein MIMGU_mgv1a010221mg                369   1e-121   
gb|EYU41992.1|  hypothetical protein MIMGU_mgv1a010234mg                369   1e-121   
gb|AFK46996.1|  unknown                                                 369   1e-121   
emb|CDP15947.1|  unnamed protein product                                367   1e-121   
gb|AFK49124.1|  unknown                                                 369   1e-121   
ref|XP_002319407.1|  peroxidase family protein                          369   1e-121   
ref|XP_010066274.1|  PREDICTED: cationic peroxidase 1-like              369   1e-121   
gb|KDP25488.1|  hypothetical protein JCGZ_20644                         369   1e-121   
ref|XP_003634480.1|  PREDICTED: cationic peroxidase 1                   368   2e-121   
gb|KHN08835.1|  Peroxidase 4                                            368   2e-121   
ref|XP_003544922.1|  PREDICTED: peroxidase 4                            368   3e-121   
ref|XP_003596716.1|  Peroxidase                                         368   3e-121   
ref|XP_010683552.1|  PREDICTED: cationic peroxidase 1-like              368   3e-121   
tpe|CAH69282.1|  TPA: class III peroxidase 40 precursor                 368   3e-121   
ref|XP_006279655.1|  hypothetical protein CARUB_v10026803mg             368   4e-121   
gb|AHD24479.1|  class III peroxidase 191                                368   4e-121   
gb|EMS66092.1|  Peroxidase 52                                           369   4e-121   
ref|XP_010035986.1|  PREDICTED: cationic peroxidase 1-like              367   4e-121   
gb|AGF25269.1|  peroxidase 2                                            367   4e-121   
gb|AAM61588.1|  peroxidase                                              367   5e-121   
gb|ABF95843.1|  Peroxidase 52 precursor, putative, expressed            368   5e-121   
ref|XP_002453592.1|  hypothetical protein SORBIDRAFT_04g008630          367   5e-121   
emb|CDP08160.1|  unnamed protein product                                367   5e-121   
ref|XP_004487572.1|  PREDICTED: peroxidase 4-like                       367   7e-121   
ref|XP_010654887.1|  PREDICTED: lignin-forming anionic peroxidase...    367   7e-121   
ref|XP_011013621.1|  PREDICTED: lignin-forming anionic peroxidase...    367   8e-121   
ref|XP_009408893.1|  PREDICTED: peroxidase P7-like                      367   8e-121   
ref|XP_006848018.1|  hypothetical protein AMTR_s00029p00173190          367   9e-121   
ref|XP_011024237.1|  PREDICTED: lignin-forming anionic peroxidase...    367   9e-121   
gb|AII99880.1|  peroxidase                                              366   1e-120   
emb|CDP16309.1|  unnamed protein product                                367   1e-120   
ref|NP_200647.1|  peroxidase                                            366   1e-120   
gb|ADN96692.1|  peroxidase 5                                            366   1e-120   
emb|CDP07980.1|  unnamed protein product                                366   2e-120   
ref|XP_006576455.1|  PREDICTED: cationic peroxidase 1-like              366   2e-120   
ref|XP_008455297.1|  PREDICTED: peroxidase P7-like                      366   2e-120   
emb|CAA71493.1|  peroxidase                                             365   2e-120   
ref|XP_007140134.1|  hypothetical protein PHAVU_008G086800g             366   2e-120   
gb|EMT13502.1|  Peroxidase 70                                           365   2e-120   
gb|KEH34417.1|  cationic peroxidase                                     366   2e-120   
gb|EEC75221.1|  hypothetical protein OsI_11488                          366   3e-120   
ref|XP_002299006.2|  hypothetical protein POPTR_0001s46290g             365   3e-120   
dbj|BAA77389.1|  peroxidase 3                                           365   3e-120   
ref|XP_010689720.1|  PREDICTED: peroxidase P7-like                      365   3e-120   
ref|XP_010228647.1|  PREDICTED: peroxidase 2-like                       365   3e-120   
ref|XP_009419858.1|  PREDICTED: cationic peroxidase 1-like              365   4e-120   
ref|XP_010689719.1|  PREDICTED: peroxidase 4-like                       365   4e-120   
ref|XP_006370761.1|  Peroxidase 4 precursor family protein              365   4e-120   
ref|XP_006658122.1|  PREDICTED: peroxidase 70-like                      365   5e-120   
gb|EYU46001.1|  hypothetical protein MIMGU_mgv1a018175mg                364   5e-120   
ref|XP_007131640.1|  hypothetical protein PHAVU_011G030200g             365   5e-120   
gb|ADC42134.1|  lignin biosynthetic peroxidase                          365   6e-120   
ref|XP_009381204.1|  PREDICTED: peroxidase P7-like                      364   7e-120   
tpe|CAH69351.1|  TPA: class III peroxidase 109 precursor                365   7e-120   
dbj|BAK07852.1|  predicted protein                                      364   9e-120   
ref|XP_003522112.1|  PREDICTED: cationic peroxidase 1-like              364   9e-120   
ref|XP_007045349.1|  Lignin-forming anionic peroxidase                  364   1e-119   
ref|XP_006848008.1|  hypothetical protein AMTR_s00029p00168370          364   1e-119   
ref|XP_003522108.1|  PREDICTED: cationic peroxidase 1-like              364   1e-119   
ref|XP_003545648.1|  PREDICTED: peroxidase 4                            364   1e-119   
ref|XP_010689733.1|  PREDICTED: peroxidase P7-like                      364   1e-119   
ref|XP_002283995.1|  PREDICTED: cationic peroxidase 1-like              363   1e-119   
ref|XP_010695664.1|  PREDICTED: peroxidase P7-like                      363   1e-119   
gb|KHN44723.1|  Peroxidase 4                                            363   1e-119   
ref|XP_004984445.1|  PREDICTED: peroxidase 52-like                      364   1e-119   
ref|XP_009419701.1|  PREDICTED: cationic peroxidase 1-like              364   1e-119   
ref|XP_003517003.1|  PREDICTED: cationic peroxidase 1                   363   1e-119   
ref|XP_003552299.1|  PREDICTED: cationic peroxidase 1-like              363   2e-119   
ref|XP_011024238.1|  PREDICTED: peroxidase 5-like                       365   2e-119   
ref|NP_001130666.1|  uncharacterized protein LOC100191769 precursor     363   2e-119   
ref|XP_002438530.1|  hypothetical protein SORBIDRAFT_10g021630          364   2e-119   
ref|XP_003522116.1|  PREDICTED: cationic peroxidase 1-like              363   2e-119   
ref|XP_003571907.1|  PREDICTED: peroxidase P7-like                      363   2e-119   
ref|XP_002269145.1|  PREDICTED: lignin-forming anionic peroxidase       363   2e-119   
ref|XP_010483436.1|  PREDICTED: peroxidase 67-like                      363   3e-119   
emb|CAA59487.1|  peroxidase                                             363   3e-119   
gb|KHN33217.1|  Cationic peroxidase 1                                   363   3e-119   
ref|NP_001242089.1|  uncharacterized protein LOC100815671 precursor     363   4e-119   
ref|XP_004305595.1|  PREDICTED: lignin-forming anionic peroxidase...    363   4e-119   
emb|CDX88673.1|  BnaA03g09760D                                          364   4e-119   
ref|XP_008350979.1|  PREDICTED: lignin-forming anionic peroxidase...    363   5e-119   
ref|XP_010443567.1|  PREDICTED: peroxidase 67                           362   5e-119   
ref|XP_002509738.1|  Lignin-forming anionic peroxidase precursor,...    362   5e-119   



>gb|AAP42508.1| anionic peroxidase swpb3 [Ipomoea batatas]
Length=320

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/313 (98%), Positives = 308/313 (98%), Gaps = 2/313 (1%)
 Frame = +2

Query  104   MAVSVKDNNITAvllcvlvlvggcSAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGA  283
             MAVSVK   +TAVLLCVLVLVGGCSAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGA
Sbjct  1     MAVSVKA--LTAVLLCVLVLVGGCSAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGA  58

Query  284   SLLRLFFHDCFVNGCDGSILLDDTSSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGV  463
             SLLRLFFHDCFVNGCDGSILLDDTSSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGV
Sbjct  59    SLLRLFFHDCFVNGCDGSILLDDTSSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGV  118

Query  464   VSCADILAIASRDSTVTLGGPSWNVKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSA  643
             VSCADILAIASRDSTVTLGGPSWNVKLGRRDARTASQAAANNSIP PTSNLNRLISSFSA
Sbjct  119   VSCADILAIASRDSTVTLGGPSWNVKLGRRDARTASQAAANNSIPAPTSNLNRLISSFSA  178

Query  644   VGLSTNDMVVLSGSHTIGQARCTNFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAP  823
             VGLSTNDMVVLSGSHTIGQARCTNFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAP
Sbjct  179   VGLSTNDMVVLSGSHTIGQARCTNFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAP  238

Query  824   LDLQTPIKFDNNYYVNLVNKKGLLHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIK  1003
             LDLQTPIKFDNNYYVNLVNKKGLLHSDQQLFNGVSTDSTVRGYSTNP+KF SDFAAAMIK
Sbjct  239   LDLQTPIKFDNNYYVNLVNKKGLLHSDQQLFNGVSTDSTVRGYSTNPSKFKSDFAAAMIK  298

Query  1004  MGDIKPLTGNNGE  1042
             MGDIKPLTGNNGE
Sbjct  299   MGDIKPLTGNNGE  311



>gb|ABR23054.1| basic peroxidase swpb4 [Ipomoea batatas]
Length=320

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/313 (97%), Positives = 306/313 (98%), Gaps = 2/313 (1%)
 Frame = +2

Query  104   MAVSVKDNNITAvllcvlvlvggcSAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGA  283
             MAVSVK   ++ VLLCVLVLVGGCSAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGA
Sbjct  1     MAVSVKA--MSGVLLCVLVLVGGCSAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGA  58

Query  284   SLLRLFFHDCFVNGCDGSILLDDTSSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGV  463
             SLLRLFFHDCFVNGCDGSILLDDTSSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGV
Sbjct  59    SLLRLFFHDCFVNGCDGSILLDDTSSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGV  118

Query  464   VSCADILAIASRDSTVTLGGPSWNVKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSA  643
             VSCADILAIASRDSTVTLGGPSWNVKLGRRDAR ASQAAANNSIP PTSNLNRLISSFSA
Sbjct  119   VSCADILAIASRDSTVTLGGPSWNVKLGRRDARAASQAAANNSIPAPTSNLNRLISSFSA  178

Query  644   VGLSTNDMVVLSGSHTIGQARCTNFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAP  823
             VGLSTNDMVVLSGSHTIGQARCTNFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAP
Sbjct  179   VGLSTNDMVVLSGSHTIGQARCTNFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAP  238

Query  824   LDLQTPIKFDNNYYVNLVNKKGLLHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIK  1003
             LDLQTPIKFDNNYYVNLVNKKGLLHSDQQLFNGVSTDSTVRGYSTNP+KF SDFAAAMIK
Sbjct  239   LDLQTPIKFDNNYYVNLVNKKGLLHSDQQLFNGVSTDSTVRGYSTNPSKFRSDFAAAMIK  298

Query  1004  MGDIKPLTGNNGE  1042
             MGDIKPLTGNNGE
Sbjct  299   MGDIKPLTGNNGE  311



>ref|XP_009614894.1| PREDICTED: peroxidase P7-like [Nicotiana tomentosiformis]
Length=321

 Score =   504 bits (1299),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 243/290 (84%), Positives = 262/290 (90%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS GFYSKSCPKL+QTV S V+SAI+KE RMGASLLRLFFHDCFVNGCDGS+LLDDT
Sbjct  23    SAQLSTGFYSKSCPKLYQTVKSAVQSAIKKETRMGASLLRLFFHDCFVNGCDGSLLLDDT  82

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGEKRAAPN  SARGFEVID IKSAVEKVCPGVVSCADILA+ +RDS V LGGP+WN
Sbjct  83    SSFTGEKRAAPNVNSARGFEVIDNIKSAVEKVCPGVVSCADILAVTARDSVVILGGPNWN  142

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRDARTASQAAAN SIPPPTSNLNRLISSFSAVGLST DMV LSG+HTIGQARCT 
Sbjct  143   VKLGRRDARTASQAAANRSIPPPTSNLNRLISSFSAVGLSTKDMVALSGAHTIGQARCTT  202

Query  716   FRARIYNES-NIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             FRARIYNE+ N+D+SFA++R+ NCPR+SGSGDN+LAPLDLQTP KFDNNY+ NLVNKKGL
Sbjct  203   FRARIYNETNNLDASFARTRQSNCPRSSGSGDNSLAPLDLQTPNKFDNNYFKNLVNKKGL  262

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQQLFNG S DS V  YS NP  FSSDF  AMIKMGDI+PLTG+NGE
Sbjct  263   LHSDQQLFNGGSADSIVTSYSNNPRSFSSDFVTAMIKMGDIRPLTGSNGE  312



>dbj|BAA82306.1| peroxidase [Nicotiana tabacum]
Length=321

 Score =   499 bits (1285),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 239/290 (82%), Positives = 262/290 (90%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS GFYSKSCPKL+QTV S V+SAI KE RMGASLLRLFFHDCFVNGCDGS+LLDDT
Sbjct  23    SAQLSTGFYSKSCPKLYQTVKSAVQSAINKETRMGASLLRLFFHDCFVNGCDGSLLLDDT  82

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGEKRAAPN  SARGFEVID IKSAVEKVCPGVVSCADILA+ +RDS V LGGP+WN
Sbjct  83    SSFTGEKRAAPNVNSARGFEVIDNIKSAVEKVCPGVVSCADILAVTARDSVVILGGPNWN  142

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRD+RTASQ+AAN+ IPP TSNLNRLISSFSAVGLST DMV LSG+HTIGQARCT+
Sbjct  143   VKLGRRDSRTASQSAANSGIPPATSNLNRLISSFSAVGLSTKDMVALSGAHTIGQARCTS  202

Query  716   FRARIYNES-NIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             FRARIYNE+ N+D+SFA++R+ NCPR+SGSGDNNLAPLDLQTP KFDNNY+ NLV+KKGL
Sbjct  203   FRARIYNETNNLDASFARTRQSNCPRSSGSGDNNLAPLDLQTPNKFDNNYFKNLVDKKGL  262

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQQLFNG S DS V  YS NP+ FSSDF  AMIKMGDI+PLTG+NGE
Sbjct  263   LHSDQQLFNGGSADSIVTSYSNNPSSFSSDFVTAMIKMGDIRPLTGSNGE  312



>ref|XP_009786874.1| PREDICTED: peroxidase P7 [Nicotiana sylvestris]
Length=319

 Score =   497 bits (1279),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 235/290 (81%), Positives = 262/290 (90%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQL+ GFYSKSCPKL++TV SVV SAIQKE RMGASLLRLFFHDCFVNGCDGS+ LDDT
Sbjct  21    SAQLTTGFYSKSCPKLYETVKSVVHSAIQKETRMGASLLRLFFHDCFVNGCDGSLFLDDT  80

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             S+FTGEKRA PNF SARGFEVID IKSAVEKVCPGVVSCADILA+ +RDS V LGGP+W+
Sbjct  81    STFTGEKRAQPNFNSARGFEVIDDIKSAVEKVCPGVVSCADILAVTARDSVVILGGPNWD  140

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRDARTASQAAAN+SIPPPTSNLNRLISSFSAVGLST DMV LSG+HTIGQARCT+
Sbjct  141   VKLGRRDARTASQAAANSSIPPPTSNLNRLISSFSAVGLSTKDMVALSGAHTIGQARCTS  200

Query  716   FRARIYNES-NIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             FRARIYNE+ N+DSS A++R+ NCPR SGSGDNNLAPLDLQTP  FDN+Y++NLV+KKGL
Sbjct  201   FRARIYNETNNLDSSLAKTRQNNCPRNSGSGDNNLAPLDLQTPTYFDNHYFINLVSKKGL  260

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQQLFNG S DS V+ YS NP+ F++DF  AMIKMGDI+PLTG+ GE
Sbjct  261   LHSDQQLFNGGSADSIVKSYSDNPSIFATDFVTAMIKMGDIRPLTGSKGE  310



>ref|XP_004240883.1| PREDICTED: peroxidase P7-like [Solanum lycopersicum]
Length=319

 Score =   496 bits (1276),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 235/290 (81%), Positives = 260/290 (90%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQL+ GFYSKSCPKL+QTV SVV SAIQKE RMGASLLRLFFHDCFVNGCDGS+ LDDT
Sbjct  21    SAQLTTGFYSKSCPKLYQTVKSVVNSAIQKETRMGASLLRLFFHDCFVNGCDGSLFLDDT  80

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             S+FTGEKRA PNF SARGFEVID IKSAVEKVC GVVSCADILA+ +RDS V LGGP+W+
Sbjct  81    STFTGEKRAQPNFNSARGFEVIDNIKSAVEKVCLGVVSCADILAVTARDSVVILGGPNWD  140

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRDARTASQ AANNSIP PTSNLNRLISSF+AVGLST DMV LSG+HTIGQARCT+
Sbjct  141   VKLGRRDARTASQGAANNSIPTPTSNLNRLISSFTAVGLSTKDMVALSGAHTIGQARCTS  200

Query  716   FRARIYNES-NIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             FR RIYNE+ N+D+S A++R+ NCPRASGSGDNNLAPLDLQTP +FDN+Y++NLVNKKGL
Sbjct  201   FRGRIYNETKNMDASLARTRQNNCPRASGSGDNNLAPLDLQTPTRFDNHYFINLVNKKGL  260

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQQLFNG S DS V+ YS NP+ F SDF  AMIKMGDI+PLTG+NGE
Sbjct  261   LHSDQQLFNGGSVDSIVKSYSNNPSSFISDFVTAMIKMGDIRPLTGSNGE  310



>ref|XP_006361306.1| PREDICTED: peroxidase 4-like [Solanum tuberosum]
Length=319

 Score =   495 bits (1274),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 234/290 (81%), Positives = 260/290 (90%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQL+ GFYSKSCPKL++TV SVV SAIQKE RMGASLLRLFFHDCFVNGCDGS+ LDDT
Sbjct  21    SAQLTTGFYSKSCPKLYETVKSVVNSAIQKETRMGASLLRLFFHDCFVNGCDGSLFLDDT  80

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             S+FTGEKRA PNF SARGFEVID IKSAVEKVCPGVVSCADILA+ +RDS V LGGP+W+
Sbjct  81    STFTGEKRAQPNFNSARGFEVIDNIKSAVEKVCPGVVSCADILAVTARDSVVILGGPNWD  140

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRDARTASQ AANNSIP PTSNLNRLISSFSAVGLST DMV LSG+HTIGQARCT+
Sbjct  141   VKLGRRDARTASQGAANNSIPTPTSNLNRLISSFSAVGLSTKDMVALSGAHTIGQARCTS  200

Query  716   FRARIYNES-NIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             FR RIYNE+ N+D+S A++R+ NCPRASGSGDNNLAPLDLQTP +FDN+Y++NLVNKKGL
Sbjct  201   FRGRIYNETKNMDASLARTRQNNCPRASGSGDNNLAPLDLQTPTRFDNHYFINLVNKKGL  260

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQQLFNG S DS V+ YS NP+ F+SDF  AMIKMGD +PLTG+ GE
Sbjct  261   LHSDQQLFNGGSVDSIVKSYSNNPSSFTSDFVTAMIKMGDNRPLTGSKGE  310



>ref|XP_006365326.1| PREDICTED: peroxidase 52-like [Solanum tuberosum]
Length=322

 Score =   495 bits (1274),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 246/311 (79%), Positives = 269/311 (86%), Gaps = 1/311 (0%)
 Frame = +2

Query  113   SVKDNNITAvllcvlvlvggcSAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLL  292
             S K+N +  + L V +L+G  SAQLS  FYSKSCPKL+QTV S V+SAI+KE RMGASLL
Sbjct  3     SSKNNTMVFLFLLVTLLIGSSSAQLSTSFYSKSCPKLYQTVKSTVQSAIKKETRMGASLL  62

Query  293   RLFFHDCFVNGCDGSILLDDTSSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSC  472
             RLFFHDCFVNGCDGS+LLDDTSSFTGEKRAAPN  S RGFEVID IKSAVEK CPGVVSC
Sbjct  63    RLFFHDCFVNGCDGSLLLDDTSSFTGEKRAAPNVNSVRGFEVIDNIKSAVEKACPGVVSC  122

Query  473   ADILAIASRDSTVTLGGPSWNVKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGL  652
             ADILA+ +RDS V LGGP+WNVKLGRRDARTASQ AAN+SIP PT NLNRLISSFSAVGL
Sbjct  123   ADILAVTARDSVVILGGPNWNVKLGRRDARTASQGAANSSIPAPTFNLNRLISSFSAVGL  182

Query  653   STNDMVVLSGSHTIGQARCTNFRARIYNESN-IDSSFAQSRKGNCPRASGSGDNNLAPLD  829
             ST DMV LSGSHTIGQARCT FRARIYNE+N IDSSFA++R+ +CPR SGSGDNNLAPLD
Sbjct  183   STKDMVALSGSHTIGQARCTTFRARIYNETNSIDSSFARTRQNSCPRNSGSGDNNLAPLD  242

Query  830   LQTPIKFDNNYYVNLVNKKGLLHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMG  1009
             LQTP KFDNNY+ NLVNKKGLLHSDQQLFNG S DS VR Y  NP+ F+SDF  AMIKMG
Sbjct  243   LQTPSKFDNNYFKNLVNKKGLLHSDQQLFNGGSADSIVRSYINNPSSFNSDFVTAMIKMG  302

Query  1010  DIKPLTGNNGE  1042
             DI+PLTG+NGE
Sbjct  303   DIRPLTGSNGE  313



>ref|XP_011008654.1| PREDICTED: peroxidase P7 [Populus euphratica]
Length=322

 Score =   494 bits (1271),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 236/288 (82%), Positives = 254/288 (88%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  FYSKSCP LF TV  VV+SAI KEAR+GAS+LRLFFHDCFVNGCDGS+LLDDTS
Sbjct  26    AQLSTDFYSKSCPHLFSTVKPVVQSAINKEARIGASILRLFFHDCFVNGCDGSLLLDDTS  85

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGEK AAPN  SARGFEVID IKSAVEK CPGVVSCAD+LAIA+RDSTV LGGP WNV
Sbjct  86    SFTGEKNAAPNRNSARGFEVIDNIKSAVEKACPGVVSCADVLAIAARDSTVILGGPQWNV  145

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             KLGRRDARTASQAAANNSIPPPTSNLN+LIS F+A+GLST DMV LSGSHTIGQARCTNF
Sbjct  146   KLGRRDARTASQAAANNSIPPPTSNLNQLISRFNALGLSTRDMVALSGSHTIGQARCTNF  205

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             RARIYNE+ IDSS AQ+R+ NCPR SGSGDNNLAPLDLQTP +F+NNYY NLVN++GLLH
Sbjct  206   RARIYNETTIDSSLAQTRRSNCPRTSGSGDNNLAPLDLQTPTRFENNYYKNLVNRRGLLH  265

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQQLFNG STDS VR YS N   F SDF A MIKMGDI+PLTG+ GE
Sbjct  266   SDQQLFNGGSTDSIVRTYSYNENTFRSDFVAGMIKMGDIRPLTGSRGE  313



>ref|XP_009606349.1| PREDICTED: peroxidase P7-like [Nicotiana tomentosiformis]
Length=319

 Score =   493 bits (1269),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 232/290 (80%), Positives = 260/290 (90%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQL+ GFYSKSCPKL++TV SVV SA+QKE RMGASLLRLFFHDCFVNGCDGS+ LDD 
Sbjct  21    SAQLTTGFYSKSCPKLYETVKSVVHSAVQKETRMGASLLRLFFHDCFVNGCDGSLFLDDI  80

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             S+FTGEKRA PNF SARGFEVID IKSAVEKVCPGVVSCADILA+ +RDS V LGGP+W+
Sbjct  81    STFTGEKRAQPNFNSARGFEVIDDIKSAVEKVCPGVVSCADILAVTARDSVVILGGPNWD  140

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRDARTASQAAAN+SIPPPTSNLNRLISSF+AVGLST DMV LSG+HTIGQARCT+
Sbjct  141   VKLGRRDARTASQAAANSSIPPPTSNLNRLISSFTAVGLSTKDMVALSGAHTIGQARCTS  200

Query  716   FRARIYNES-NIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             FRARIYNE+ N+DSS A++R+ NCPR SGSGDNNLAPLDLQTP  FDN+Y++NLV+KKGL
Sbjct  201   FRARIYNETNNLDSSLAKTRQNNCPRNSGSGDNNLAPLDLQTPTYFDNHYFINLVSKKGL  260

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQQLFNG S DS V+ YS NP  F++DF  AMIKMGDI+PLTG+ GE
Sbjct  261   LHSDQQLFNGGSADSIVKSYSDNPNSFAADFVTAMIKMGDIRPLTGSKGE  310



>gb|ACM47317.1| peroxidase [Capsicum annuum]
Length=324

 Score =   493 bits (1269),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 239/290 (82%), Positives = 257/290 (89%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FYSKSCPKLFQTV S V+SAI +E RMGASLLRLFFHDCFVNGCDGS+LLDDT
Sbjct  26    SAQLSTNFYSKSCPKLFQTVKSTVQSAINRETRMGASLLRLFFHDCFVNGCDGSLLLDDT  85

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGEKRAAPN  S RGFEVID IKSAVEK CPGVVSCADILAI +RDS V LGGP+WN
Sbjct  86    SSFTGEKRAAPNVNSVRGFEVIDNIKSAVEKACPGVVSCADILAITARDSVVILGGPNWN  145

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRDARTASQ AAN+SIPPPTSNLN+LISSFSAVGLST DMV LSG+HTIGQARCT+
Sbjct  146   VKLGRRDARTASQGAANSSIPPPTSNLNQLISSFSAVGLSTTDMVALSGAHTIGQARCTS  205

Query  716   FRARIYNES-NIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             FRARIYNE+ NIDSSFA +R+ NCPR SGSGDNNLAPLDLQTP KFDNNY+ NLV+K+GL
Sbjct  206   FRARIYNETNNIDSSFATTRQRNCPRNSGSGDNNLAPLDLQTPTKFDNNYFKNLVSKRGL  265

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQQLFNG S DS V  YS NP+ FSSDF  AMIKMGD +PLTG+NGE
Sbjct  266   LHSDQQLFNGGSADSIVTSYSNNPSSFSSDFVTAMIKMGDNRPLTGSNGE  315



>ref|XP_008374580.1| PREDICTED: peroxidase P7-like [Malus domestica]
 ref|XP_008354170.1| PREDICTED: peroxidase P7-like [Malus domestica]
Length=319

 Score =   493 bits (1268),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 236/289 (82%), Positives = 257/289 (89%), Gaps = 0/289 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FYS SCP+LF TV S V+SAIQKEARMGASLLRL FHDCFVNGCDGS+LLDDT
Sbjct  22    SAQLSTNFYSSSCPRLFSTVKSTVQSAIQKEARMGASLLRLHFHDCFVNGCDGSLLLDDT  81

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGEK AAPN  SARGF+V+D IKSAVE VCPGVVSCADILAIA+RDS VTLGGPSWN
Sbjct  82    SSFTGEKNAAPNRNSARGFDVVDNIKSAVENVCPGVVSCADILAIAARDSVVTLGGPSWN  141

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRDARTASQAAANN+IPPPT NLN+LIS+FSAVGLST D+V LSGSHTIGQARCT+
Sbjct  142   VKLGRRDARTASQAAANNNIPPPTRNLNQLISTFSAVGLSTRDLVALSGSHTIGQARCTS  201

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR RIYNE+N+DSS AQ+R+ NCPR SGSGDNNLAPLDLQTP  FDNNY+ NL+  KGLL
Sbjct  202   FRPRIYNETNLDSSLAQTRRSNCPRTSGSGDNNLAPLDLQTPTSFDNNYFKNLIQNKGLL  261

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQLFNG STDS VR YS +   FSSDFA+AMIKMGDIKPLTG++GE
Sbjct  262   HSDQQLFNGGSTDSIVRAYSNSYNAFSSDFASAMIKMGDIKPLTGSSGE  310



>ref|XP_011076613.1| PREDICTED: peroxidase P7 [Sesamum indicum]
Length=321

 Score =   491 bits (1264),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 234/289 (81%), Positives = 257/289 (89%), Gaps = 0/289 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLSP FYSKSCP LF TV SVV SA+Q EARMGASLLRLFFHDCFVNGCDGSILLDDT
Sbjct  24    SAQLSPDFYSKSCPNLFATVKSVVHSAVQNEARMGASLLRLFFHDCFVNGCDGSILLDDT  83

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGEK A PN  SARGF+V+DQIKSAVEK CPGVVSCAD+LAIA+RDS V LGGP WN
Sbjct  84    SSFTGEKGAVPNRNSARGFDVVDQIKSAVEKACPGVVSCADVLAIAARDSVVILGGPDWN  143

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRDA+TAS+AAANN IPPPTSNLN LIS F+A+GLST D+V LSGSHTIGQARCT+
Sbjct  144   VKLGRRDAKTASRAAANNGIPPPTSNLNALISRFNALGLSTKDLVALSGSHTIGQARCTS  203

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FRARIYNESN+D+S AQ+RKGNCPRASG GDNNLAPLDLQTP  FDNNY+ NLV+++GLL
Sbjct  204   FRARIYNESNLDTSLAQTRKGNCPRASGVGDNNLAPLDLQTPTNFDNNYFKNLVSRRGLL  263

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQLF G +TDS VR YS +P  F SDFAAAM+KMGDI+PLTG+NGE
Sbjct  264   HSDQQLFIGGATDSIVRTYSNDPNTFKSDFAAAMLKMGDIRPLTGSNGE  312



>ref|XP_004239964.1| PREDICTED: peroxidase P7-like [Solanum lycopersicum]
Length=322

 Score =   490 bits (1262),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 235/290 (81%), Positives = 256/290 (88%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FYSKSCPKL+QT+ S V+SAI KE RMGASLLRLFFHDCFVNGCDGS+LLDDT
Sbjct  24    SAQLSTNFYSKSCPKLYQTIKSTVQSAINKETRMGASLLRLFFHDCFVNGCDGSLLLDDT  83

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGEKRAAPN  S RGFEVID IKSAVEK CPG+VSCADILA+ +RDS V LGGP+WN
Sbjct  84    SSFTGEKRAAPNVNSVRGFEVIDNIKSAVEKACPGIVSCADILAVTARDSVVILGGPNWN  143

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRDARTASQ AAN+SIP PT NLNRLISSFSAVGLST DMV LSG+HTIGQARCT 
Sbjct  144   VKLGRRDARTASQGAANSSIPAPTFNLNRLISSFSAVGLSTKDMVALSGAHTIGQARCTT  203

Query  716   FRARIYNES-NIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             FRARIYNE+ NIDS+FA++R+ +CPR SGSGDNNLAPLDLQTP KFDNNY+ NLVNKKGL
Sbjct  204   FRARIYNETNNIDSTFARTRQNSCPRNSGSGDNNLAPLDLQTPSKFDNNYFKNLVNKKGL  263

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQQLFNG S DS VR Y  NP+ F+SDF  AMIKMGDI+PLTG+NGE
Sbjct  264   LHSDQQLFNGGSADSIVRSYINNPSSFNSDFVTAMIKMGDIRPLTGSNGE  313



>ref|XP_010256947.1| PREDICTED: peroxidase 4-like [Nelumbo nucifera]
Length=321

 Score =   489 bits (1260),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 234/289 (81%), Positives = 256/289 (89%), Gaps = 0/289 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FYSK+CP +F TV S VRSAI KE+RMGASLLRLFFHDCFVNGCDGSILLDDT
Sbjct  24    SAQLSTNFYSKTCPNVFTTVKSAVRSAISKESRMGASLLRLFFHDCFVNGCDGSILLDDT  83

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGEK A PN  SARGF+V+D IKS VEKVCPGVVSCADILAIA+RDS V LGG SWN
Sbjct  84    SSFTGEKNANPNRNSARGFDVVDDIKSKVEKVCPGVVSCADILAIAARDSVVILGGTSWN  143

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRD++TASQ+AANN+IPPPTSNLN LISSF + GLST DMV LSG HTIGQARCTN
Sbjct  144   VKLGRRDSKTASQSAANNNIPPPTSNLNNLISSFQSKGLSTKDMVALSGGHTIGQARCTN  203

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FRARIYNESNI+SSFA++R+G CP +SGSGDNNLAPLDLQTP  FDNNY+ NL+N+KGLL
Sbjct  204   FRARIYNESNIESSFAKTRQGRCPSSSGSGDNNLAPLDLQTPTAFDNNYFKNLINQKGLL  263

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQLFNG STDS VR YS NP+ F+SDFAAAMIKMGDI PLTG+NGE
Sbjct  264   HSDQQLFNGGSTDSQVRTYSNNPSTFNSDFAAAMIKMGDISPLTGSNGE  312



>ref|XP_006376028.1| hypothetical protein POPTR_0013s08130g [Populus trichocarpa]
 gb|ERP53825.1| hypothetical protein POPTR_0013s08130g [Populus trichocarpa]
 gb|AHL39175.1| class III peroxidase [Populus trichocarpa]
Length=322

 Score =   486 bits (1252),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 233/288 (81%), Positives = 252/288 (88%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  FYSKSCP L  TV  VV+SAI KEARMGAS+LRLFFHDCFVNGCDGS+LLDDTS
Sbjct  26    AQLSIDFYSKSCPHLLSTVKPVVQSAINKEARMGASILRLFFHDCFVNGCDGSLLLDDTS  85

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGEK AAPN  SARGFEVID IKSAVEK CPGVVSCADILAIA+RDSTV LGGP W+V
Sbjct  86    SFTGEKNAAPNKNSARGFEVIDNIKSAVEKACPGVVSCADILAIAARDSTVILGGPEWDV  145

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             KLGRRDARTASQAAANNSIP PTSNLN+LIS F+A+GLST DMV LSGSHTIGQARCTNF
Sbjct  146   KLGRRDARTASQAAANNSIPRPTSNLNQLISRFNALGLSTRDMVALSGSHTIGQARCTNF  205

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             RARIYNE+ IDSS AQ+R+ NCPR SGSGDNNLAPLDLQTP +F+NNYY NL+N++GLLH
Sbjct  206   RARIYNETTIDSSLAQTRRSNCPRTSGSGDNNLAPLDLQTPTRFENNYYKNLINRRGLLH  265

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQQLFNG STDS V  YS+N   F SDF A MIKMGDI+PLTG+ GE
Sbjct  266   SDQQLFNGGSTDSIVSTYSSNENTFRSDFVAGMIKMGDIRPLTGSRGE  313



>ref|XP_010031113.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=331

 Score =   486 bits (1252),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 232/288 (81%), Positives = 253/288 (88%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  FYSK+CP +F TV S V++AI KEARMGASLLRLFFHDCFVNGCDGSILLDDTS
Sbjct  35    AQLSTNFYSKTCPNVFTTVKSQVQAAINKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  94

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             +FTGEK AAPN  SARGF+V+D IKSAVEKVCPGVVSCAD+LAI +RDSTV LGGPSWNV
Sbjct  95    TFTGEKNAAPNKNSARGFDVVDNIKSAVEKVCPGVVSCADLLAITARDSTVILGGPSWNV  154

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             K+GRRDARTASQAAANNSIPPPTSNLN LIS F  VGLST DMV LSGSHTIGQARCTNF
Sbjct  155   KVGRRDARTASQAAANNSIPPPTSNLNNLISFFQNVGLSTRDMVALSGSHTIGQARCTNF  214

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R RIYNE+N+DSS A++R+ NCPR  GSGDNNLAPLDLQTP KFDNNYY NL+  KGLLH
Sbjct  215   RTRIYNETNLDSSLAKTRQSNCPRTVGSGDNNLAPLDLQTPTKFDNNYYKNLLQNKGLLH  274

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQQLFNG STDS VR Y +NP+ F+SDF A MIKMGDIKPLTG++GE
Sbjct  275   SDQQLFNGGSTDSLVRTYGSNPSTFTSDFVAGMIKMGDIKPLTGSSGE  322



>emb|CDP13933.1| unnamed protein product [Coffea canephora]
Length=321

 Score =   485 bits (1249),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 234/290 (81%), Positives = 253/290 (87%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FY  SCP LF TV S V+SAI KEARMGASLLRLFFHDCFVNGCDGS+LLDDT
Sbjct  23    SAQLSTNFYYHSCPNLFSTVKSTVQSAISKEARMGASLLRLFFHDCFVNGCDGSVLLDDT  82

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSF GEKRAAPNF SARGFEV+D IKSAVE+ CPGVVSCAD+LAIA+RDS   LGGP W+
Sbjct  83    SSFRGEKRAAPNFNSARGFEVVDNIKSAVERACPGVVSCADVLAIAARDSVEILGGPRWD  142

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRDARTASQAAANNSIPPPT+NLN LIS FSAVGLS  D+V LSGSHTIG ARCTN
Sbjct  143   VKLGRRDARTASQAAANNSIPPPTTNLNALISRFSAVGLSARDLVALSGSHTIGLARCTN  202

Query  716   FRARIYNES-NIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             FRARIYNE+ N+DSS A++R+ NCP  SGSGDNNLAPLDLQTP  FDNNY+ NLVN++GL
Sbjct  203   FRARIYNETNNLDSSLARTRQSNCPSVSGSGDNNLAPLDLQTPTNFDNNYFKNLVNRRGL  262

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQQLFNG STDS VR YS NP  F+SDFAAAMIKMGDIKPLTG+NGE
Sbjct  263   LHSDQQLFNGGSTDSAVRAYSNNPGSFASDFAAAMIKMGDIKPLTGSNGE  312



>ref|XP_007011229.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY20039.1| Peroxidase superfamily protein [Theobroma cacao]
Length=321

 Score =   485 bits (1249),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 232/288 (81%), Positives = 253/288 (88%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  +YSK+CPKLF TV S V SAI KEARMGASLLRLFFHDCFVNGCDGS+LLDDTS
Sbjct  25    AQLSTNYYSKTCPKLFPTVKSTVHSAIMKEARMGASLLRLFFHDCFVNGCDGSLLLDDTS  84

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGEK AAPN  SARGF+V+D IKSAVE VCPGVVSCADIL IA+RDS   LGGP+W+V
Sbjct  85    SFTGEKNAAPNRNSARGFDVVDNIKSAVEDVCPGVVSCADILTIAARDSVAILGGPNWDV  144

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             KLGRRDARTASQAAANNSIPPPTSNLNRLIS F+A+GLST DMV LSGSHTIG ARCT+F
Sbjct  145   KLGRRDARTASQAAANNSIPPPTSNLNRLISRFNALGLSTRDMVALSGSHTIGLARCTSF  204

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R RIYNESNIDSSFAQ+R+ NCPR +GSGDNNLAPLD+QTP  FDNNY+ NL+N++GLLH
Sbjct  205   RPRIYNESNIDSSFAQTRQRNCPRTTGSGDNNLAPLDIQTPTFFDNNYFKNLINRRGLLH  264

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQQLFNG STDS VRGYS NP+ FSSDF   MIKMGDI PLTG+ GE
Sbjct  265   SDQQLFNGGSTDSIVRGYSNNPSSFSSDFVTGMIKMGDISPLTGSRGE  312



>ref|XP_003523269.1| PREDICTED: peroxidase 52-like isoform 1 [Glycine max]
Length=320

 Score =   484 bits (1246),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 234/288 (81%), Positives = 252/288 (88%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  FY  SCP LF +V S V+SAI KE RMGASLLRLFFHDCFVNGCDGSILLDDTS
Sbjct  24    AQLSTNFYYHSCPNLFSSVKSTVQSAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTS  83

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGEK A PN  SARGFEVID IKSAVEKVCPGVVSCADILAIA+RDS   LGGP+WNV
Sbjct  84    SFTGEKNANPNRNSARGFEVIDNIKSAVEKVCPGVVSCADILAIAARDSVQILGGPTWNV  143

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             KLGRRDARTASQ+AANN IP PTSNLN+LIS FSA+GLST D+V LSG HTIGQARCTNF
Sbjct  144   KLGRRDARTASQSAANNGIPAPTSNLNQLISRFSALGLSTKDLVALSGGHTIGQARCTNF  203

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             RARIYNE+NI+++FA++R+ +CPR SGSGDNNLAPLDLQTP  FDN Y+ NLV KKGLLH
Sbjct  204   RARIYNETNIETAFARTRQQSCPRTSGSGDNNLAPLDLQTPTSFDNYYFKNLVQKKGLLH  263

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQQLFNG STDS VRGYSTNP  FSSDFAAAMIKMGDI PLTG+NGE
Sbjct  264   SDQQLFNGGSTDSIVRGYSTNPGTFSSDFAAAMIKMGDISPLTGSNGE  311



>ref|NP_001241914.1| uncharacterized protein LOC100790279 precursor [Glycine max]
 gb|ACU17865.1| unknown [Glycine max]
Length=320

 Score =   484 bits (1245),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 234/288 (81%), Positives = 252/288 (88%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  FY  SCP LF TV S V+SAI KE RMGASLLR FFHDCFVNGCDGSILLDDTS
Sbjct  24    AQLSTNFYYHSCPNLFSTVKSTVQSAISKETRMGASLLRPFFHDCFVNGCDGSILLDDTS  83

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGEK A PN  SARG+EVID IKSAVEK CPGVVSCADILAIA+RDS   LGGPSWNV
Sbjct  84    SFTGEKNANPNRNSARGYEVIDNIKSAVEKACPGVVSCADILAIAARDSVQILGGPSWNV  143

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             K+GRRDARTASQ+AANN IPPPTSNLN+LIS FSA+GLST D+V LSG HTIGQARCTNF
Sbjct  144   KVGRRDARTASQSAANNGIPPPTSNLNQLISRFSALGLSTKDLVALSGGHTIGQARCTNF  203

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             RARIYNESNID++FA++R+ +CPR SGSGDNNLA LDLQTP +FDN Y+ NLV KKGLLH
Sbjct  204   RARIYNESNIDTAFARARQQSCPRTSGSGDNNLATLDLQTPTEFDNYYFKNLVQKKGLLH  263

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQQLFNG STDS VRGYSTNP+ FSSDFAAAMIKMGDI PLTG+NGE
Sbjct  264   SDQQLFNGGSTDSIVRGYSTNPSSFSSDFAAAMIKMGDISPLTGSNGE  311



>gb|ADN96693.1| peroxidase 6 [Rubia cordifolia]
Length=321

 Score =   482 bits (1241),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 227/290 (78%), Positives = 259/290 (89%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  +Y  +CPKL+ TV S V+SAI KE RMGASLLRLFFHDCFVNGCDGSILLDDT
Sbjct  23    SAQLSENYYYSACPKLYSTVKSTVQSAIAKETRMGASLLRLFFHDCFVNGCDGSILLDDT  82

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGEK+AAPN  SARGFEV+D IK+AVEKVCPGVVSCADILAIA+ DS   LGGPSWN
Sbjct  83    SSFTGEKKAAPNVNSARGFEVVDDIKAAVEKVCPGVVSCADILAIAAHDSVEILGGPSWN  142

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRDARTASQAAAN +IPPPT+NLN LIS F++ GLS  D+V LSGSHTIGQARCTN
Sbjct  143   VKLGRRDARTASQAAANQTIPPPTTNLNGLISRFNSFGLSAKDLVALSGSHTIGQARCTN  202

Query  716   FRARIYNES-NIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             FRARIYNE+ N+D+S A++R+GNCPRA+GSGDNNLAPLDL+TP +FDN+Y+VNLV++KGL
Sbjct  203   FRARIYNETNNLDTSLARTRQGNCPRATGSGDNNLAPLDLETPTRFDNHYFVNLVSRKGL  262

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQQL+NG STD+ VRGYS+NP  F++DFAAAMIKMGDIKPLTG+ GE
Sbjct  263   LHSDQQLYNGGSTDTIVRGYSSNPGSFAADFAAAMIKMGDIKPLTGSKGE  312



>ref|XP_007137608.1| hypothetical protein PHAVU_009G140700g [Phaseolus vulgaris]
 gb|ESW09602.1| hypothetical protein PHAVU_009G140700g [Phaseolus vulgaris]
Length=320

 Score =   481 bits (1239),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 231/288 (80%), Positives = 252/288 (88%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  FY  SCPKL  TV S ++SAI KE R+GASLLRLFFHDCFVNGCDGSILLDDTS
Sbjct  24    AQLSTNFYYTSCPKLLSTVKSSMQSAISKETRIGASLLRLFFHDCFVNGCDGSILLDDTS  83

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGEK A PN  SARG+EVID IKSAVEKVCPGVVSCADILAIA+RDS   LGGP+W+V
Sbjct  84    SFTGEKNANPNRNSARGYEVIDSIKSAVEKVCPGVVSCADILAIAARDSVGILGGPTWDV  143

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             KLGRRDARTASQ+AAN++IPPPTSNLN+LIS FSAVGLST DMV LSG HTIGQ+RCT+F
Sbjct  144   KLGRRDARTASQSAANSAIPPPTSNLNQLISKFSAVGLSTKDMVALSGGHTIGQSRCTSF  203

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             RARIYNESNID+SFA++R+ +CPR SGSGDNNLAPLDLQTP  FDN Y+ NLV KKGLLH
Sbjct  204   RARIYNESNIDTSFARTRQSSCPRTSGSGDNNLAPLDLQTPTSFDNYYFKNLVQKKGLLH  263

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQQLFNG STDS VRGYSTNP+ FSSDF  AMIKMGDI PLTG+ GE
Sbjct  264   SDQQLFNGGSTDSIVRGYSTNPSSFSSDFVTAMIKMGDITPLTGSKGE  311



>gb|ACU17608.1| unknown [Glycine max]
Length=320

 Score =   479 bits (1233),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 232/288 (81%), Positives = 249/288 (86%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  FY  SCP LF +V S V+SAI KE RMGASLLRLFFHDCFVNGCDGSILLDDTS
Sbjct  24    AQLSTNFYYHSCPNLFSSVKSAVQSAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTS  83

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGEK A PN  SARGFEVID IKSAVEKVCPGVVSCADILAIA+RDS   LGGP+WNV
Sbjct  84    SFTGEKNANPNRNSARGFEVIDNIKSAVEKVCPGVVSCADILAIAARDSVQILGGPTWNV  143

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             KLGRRDARTASQ+AANN IP PTSNLN+LIS FSA+GLST D+V LSG HTIGQARCTNF
Sbjct  144   KLGRRDARTASQSAANNGIPAPTSNLNQLISRFSALGLSTKDLVALSGGHTIGQARCTNF  203

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             RARIYNE+NI ++FA++R+ +CPR SGSGDNNLAPLDLQTP  FDN Y+ NLV KKG LH
Sbjct  204   RARIYNETNIGTAFARTRQQSCPRTSGSGDNNLAPLDLQTPTSFDNYYFKNLVQKKGFLH  263

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQQLFNG STDS VRGYSTNP  F SDFAAAMIKMGDI PLTG+NGE
Sbjct  264   SDQQLFNGGSTDSIVRGYSTNPGTFPSDFAAAMIKMGDISPLTGSNGE  311



>ref|XP_002278996.1| PREDICTED: peroxidase 4 [Vitis vinifera]
Length=321

 Score =   479 bits (1232),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 226/289 (78%), Positives = 253/289 (88%), Gaps = 0/289 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             +AQLS  +YS+SCPKLF TV S V+SA+ KEARMGASLLRLFFHDCFVNGCDGS+LLDDT
Sbjct  24    TAQLSTDYYSQSCPKLFPTVKSAVKSAVAKEARMGASLLRLFFHDCFVNGCDGSVLLDDT  83

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSF GEK AAPN  S RGF+V+D IKS VE  CPGVVSCAD+LAIA+RDS V LGGPSWN
Sbjct  84    SSFIGEKNAAPNANSVRGFDVVDDIKSKVETACPGVVSCADVLAIAARDSVVILGGPSWN  143

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRDARTASQAAANNSIPPPTSNLN+LIS F A+GLST D+V L+GSHTIGQARCT+
Sbjct  144   VKLGRRDARTASQAAANNSIPPPTSNLNQLISRFQALGLSTRDLVALAGSHTIGQARCTS  203

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FRARIYNE+NID+SFA++R+ NCPRASGSGDNNLAPLDLQTP  F+NNYY NL+ KKGLL
Sbjct  204   FRARIYNETNIDNSFAKTRQSNCPRASGSGDNNLAPLDLQTPTAFENNYYKNLIKKKGLL  263

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQLFNG STDS VR YS + + F++ F A MIKMGDI PLTG+NGE
Sbjct  264   HSDQQLFNGGSTDSIVRKYSNSRSNFNAHFVAGMIKMGDISPLTGSNGE  312



>gb|EYU20115.1| hypothetical protein MIMGU_mgv1a025851mg [Erythranthe guttata]
Length=318

 Score =   478 bits (1229),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 228/291 (78%), Positives = 257/291 (88%), Gaps = 2/291 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  +YSKSCP LF TV +VVRSAIQ EARMGASLLRLFFHDCFVNGCDGSILLDDT
Sbjct  19    SAQLSTDYYSKSCPNLFTTVKTVVRSAIQNEARMGASLLRLFFHDCFVNGCDGSILLDDT  78

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGEK A PN  S RGF ++D IKSAVEKVCP VVSCADILA+ASRDS V LGGP W 
Sbjct  79    SSFTGEKTALPNRNSVRGFNIVDNIKSAVEKVCPNVVSCADILAVASRDSVVILGGPDWK  138

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRD+RTAS AAANNSIPPPTSNLN LISSF+++GLST D+VVLSGSHTIGQARCT+
Sbjct  139   VKLGRRDSRTASLAAANNSIPPPTSNLNTLISSFNSLGLSTKDLVVLSGSHTIGQARCTS  198

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FRARIYNE+N+D+SFAQ+R+GNCPRA+G+GDNNLAPLD+QTP  FDNNY+ NL++++GLL
Sbjct  199   FRARIYNETNLDASFAQTRRGNCPRAAGAGDNNLAPLDVQTPANFDNNYFKNLISRRGLL  258

Query  896   HSDQQLFNGVS--TDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQLF+G    TDS VR YS++   F SDFAAAMIKMGDIKP+TG+NGE
Sbjct  259   HSDQQLFSGSGGRTDSIVRSYSSDSATFRSDFAAAMIKMGDIKPVTGSNGE  309



>ref|XP_009369255.1| PREDICTED: peroxidase P7-like [Pyrus x bretschneideri]
Length=319

 Score =   477 bits (1227),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 227/288 (79%), Positives = 249/288 (86%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  FYS SCPKLF TV S VRSAIQKE R GASLLRL FHDCFVNGCDGS+LLDDTS
Sbjct  23    AQLSTKFYSSSCPKLFSTVKSTVRSAIQKETRTGASLLRLHFHDCFVNGCDGSLLLDDTS  82

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGEK A PN  SARGF V+D+IKSAVE VCPGVVSCADILAIA+RDS   LGGPSW+V
Sbjct  83    SFTGEKNAVPNKNSARGFNVVDKIKSAVENVCPGVVSCADILAIAARDSVTILGGPSWDV  142

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             KLGRRD RTASQAAANNSIPPPT NLN+LIS+F+A+GLST D+V LSGSHTIGQARCT F
Sbjct  143   KLGRRDTRTASQAAANNSIPPPTRNLNQLISTFNALGLSTRDLVALSGSHTIGQARCTTF  202

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R RIYNE+N+DSS AQ+R+ NCPR SGSGDNNLAPLDL++P  FDN+Y+ NL+ KKGLLH
Sbjct  203   RPRIYNETNLDSSLAQTRQSNCPRTSGSGDNNLAPLDLKSPTSFDNSYFKNLIQKKGLLH  262

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQQLFNG STDS VR Y  + + FSSDFA AMIKMGDIKPLTG+NGE
Sbjct  263   SDQQLFNGGSTDSIVRAYRNSYSTFSSDFAKAMIKMGDIKPLTGSNGE  310



>gb|KDP21681.1| hypothetical protein JCGZ_03352 [Jatropha curcas]
Length=325

 Score =   476 bits (1225),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 226/288 (78%), Positives = 251/288 (87%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  FYSKSCP LF T+  VV+SAI KE RMGASL+RLFFHDCFVNGCDGS+LLDDTS
Sbjct  29    AQLSTSFYSKSCPNLFSTIKPVVQSAINKEKRMGASLVRLFFHDCFVNGCDGSVLLDDTS  88

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGEK A PN  SARGFEVID IKSAVEK CPGVVSCADILA+A+RDSTV LGGP+WNV
Sbjct  89    SFTGEKTALPNRNSARGFEVIDSIKSAVEKACPGVVSCADILAVAARDSTVILGGPTWNV  148

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             KLGRRDARTAS +AANN IPPPTSNLN+LIS F+A+GLST D+V L+GSHTIGQARCT+F
Sbjct  149   KLGRRDARTASLSAANNGIPPPTSNLNQLISRFNALGLSTRDLVALTGSHTIGQARCTSF  208

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             RARIYNE+NID+SFAQ+R+ NCPR +G+GDNNLAPLDLQTP  FDNNY+ NL+N+KGLLH
Sbjct  209   RARIYNETNIDNSFAQTRRSNCPRTNGTGDNNLAPLDLQTPTSFDNNYFKNLLNQKGLLH  268

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQQLFNG STDS VR YS   + F SDF A MIKMGDI PLTG+ GE
Sbjct  269   SDQQLFNGGSTDSIVRTYSNGQSTFFSDFVAGMIKMGDISPLTGSQGE  316



>ref|XP_008233851.1| PREDICTED: peroxidase P7-like [Prunus mume]
Length=319

 Score =   475 bits (1223),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 227/289 (79%), Positives = 252/289 (87%), Gaps = 0/289 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FYS SCP++F  V S V+SAI+ EAR+GASLLRL FHDCFVNGCDGS+LLDDT
Sbjct  22    SAQLSTNFYSSSCPRVFSAVRSTVQSAIRNEARIGASLLRLHFHDCFVNGCDGSLLLDDT  81

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGEK A PN  SARGF+V+D IKSAVE VCPGVVSCADILAIA+RDS   LGGPSWN
Sbjct  82    SSFTGEKNAVPNRNSARGFDVVDNIKSAVENVCPGVVSCADILAIAARDSVAILGGPSWN  141

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRDARTASQAAANN+IPPPTSNLN+LIS F+A+GLST D+V LSGSHTIGQ+RC  
Sbjct  142   VKLGRRDARTASQAAANNNIPPPTSNLNQLISRFNALGLSTRDLVALSGSHTIGQSRCIQ  201

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR RIYNE+N+DSSFAQ+R+ NCPRASGSGDNNLAPLDLQTP  FDNNY+ NL+ KKGLL
Sbjct  202   FRPRIYNETNLDSSFAQTRRSNCPRASGSGDNNLAPLDLQTPTAFDNNYFKNLIQKKGLL  261

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQLFNG STDS VR YS +   FSSDF +A+IKMGDIKPLTG+NGE
Sbjct  262   HSDQQLFNGGSTDSIVRTYSNSYNTFSSDFVSAIIKMGDIKPLTGSNGE  310



>ref|XP_010264466.1| PREDICTED: peroxidase 4-like [Nelumbo nucifera]
Length=320

 Score =   473 bits (1217),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 229/289 (79%), Positives = 247/289 (85%), Gaps = 0/289 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FYSKSCP +F TV S V SAI KE RMGASLLRLFFHDCFVNGCDGSIL+DDT
Sbjct  23    SAQLSTNFYSKSCPNVFTTVKSAVGSAISKERRMGASLLRLFFHDCFVNGCDGSILVDDT  82

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             S+FTGEK AAPN  S RGF V+D IKS VEKVCPGVVSCADILAIA+RDS V LGGPSW 
Sbjct  83    SNFTGEKNAAPNRNSVRGFNVVDDIKSKVEKVCPGVVSCADILAIAARDSVVILGGPSWK  142

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRDARTASQAAAN SIPPPTS+L+ LISSF + GLST DMV LSGSHTIGQARCT+
Sbjct  143   VKLGRRDARTASQAAANTSIPPPTSSLSNLISSFQSKGLSTKDMVALSGSHTIGQARCTS  202

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR RIYNESNID SFA++R+  CP  SGSGDNNLAPLDLQTP  FDNNY+ NL+N KGLL
Sbjct  203   FRTRIYNESNIDGSFAKARQRKCPATSGSGDNNLAPLDLQTPTAFDNNYFKNLINNKGLL  262

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQLFNG STDS VR YS+ P+ F SDF+AAMIKMGDI PLTG+NGE
Sbjct  263   HSDQQLFNGGSTDSLVRSYSSKPSTFISDFSAAMIKMGDITPLTGSNGE  311



>gb|AAX44001.2| putative secretory peroxidase [Catharanthus roseus]
Length=318

 Score =   472 bits (1215),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 238/290 (82%), Positives = 257/290 (89%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  +YSKSCP +F TV S V SAI KEARMGASLLRLFFHDCFVNGCDGSILLDDT
Sbjct  20    SAQLSTDYYSKSCPNVFNTVKSQVHSAILKEARMGASLLRLFFHDCFVNGCDGSILLDDT  79

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGEKRAAPNF SARGFEV+D IKSAVE VCPGVVSCADILAIA+RDS   LGGPSWN
Sbjct  80    SSFTGEKRAAPNFNSARGFEVVDNIKSAVENVCPGVVSCADILAIAARDSVQILGGPSWN  139

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRDA TASQAAANNSIPPPTSNLN L+S F+A+GLSTND+V LSGSHTIGQARCTN
Sbjct  140   VKLGRRDATTASQAAANNSIPPPTSNLNALVSRFNALGLSTNDLVALSGSHTIGQARCTN  199

Query  716   FRARIYNES-NIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             FRARIYNE+ N+D++ AQ+R+ NCPR SGS DNNLAPLDLQTP  FDNNYY NLVN++GL
Sbjct  200   FRARIYNETNNLDAALAQTRRSNCPRPSGSRDNNLAPLDLQTPRAFDNNYYKNLVNRRGL  259

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQQLFNG STDS VR YS NP  F+SDFAAAMIKMGDI PLTG+NG+
Sbjct  260   LHSDQQLFNGGSTDSIVRSYSGNPASFASDFAAAMIKMGDISPLTGSNGQ  309



>gb|AAP76387.1| class III peroxidase [Gossypium hirsutum]
Length=330

 Score =   473 bits (1216),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 224/288 (78%), Positives = 250/288 (87%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  FYSKSCP L  TV S V SAI KEARMGASLLRLFFHDCFVNGCDGS+LLDDTS
Sbjct  34    AQLSTNFYSKSCPNLLSTVKSTVTSAINKEARMGASLLRLFFHDCFVNGCDGSVLLDDTS  93

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGEK A PN  S+RGF+V+D IKSAVE VCPGVVSCADILAIA+RDS   LGGP W V
Sbjct  94    SFTGEKNANPNRNSSRGFDVVDNIKSAVENVCPGVVSCADILAIAARDSVEILGGPKWAV  153

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             KLGRRDAR+ASQ+AANN IPPPTSNLNRL S F+A+GLST D+V LSG+HTIGQARCT+F
Sbjct  154   KLGRRDARSASQSAANNGIPPPTSNLNRLTSRFNALGLSTRDLVALSGAHTIGQARCTSF  213

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             RARIYNESNID+SFAQ+R+ NCPR +GSGDNNLAPLD+QTP  FDNNY+ NL++++GLLH
Sbjct  214   RARIYNESNIDASFAQTRQRNCPRTTGSGDNNLAPLDIQTPTSFDNNYFKNLISQRGLLH  273

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQQLFNG STDS VRGY  +P+ F+SDF AAMIKMGDI PLTG+ GE
Sbjct  274   SDQQLFNGGSTDSIVRGYGNSPSSFNSDFVAAMIKMGDISPLTGSRGE  321



>ref|XP_008369321.1| PREDICTED: peroxidase P7-like [Malus domestica]
Length=319

 Score =   471 bits (1213),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 224/288 (78%), Positives = 247/288 (86%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  FYS SCPKLF TV S V SAIQKE RMGASLLRL FHDCFVNGCDGS+LLDDTS
Sbjct  23    AQLSTKFYSSSCPKLFSTVKSTVHSAIQKETRMGASLLRLHFHDCFVNGCDGSLLLDDTS  82

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGEK A PN  SARGF V+D+IKSAVE  CPGVVSCADILAIA+R+S   LGGPSW+V
Sbjct  83    SFTGEKNAVPNKNSARGFNVVDKIKSAVENACPGVVSCADILAIAARESVTVLGGPSWDV  142

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             KLGRRD RTASQAAANNSIPPPT NLN+L+S+F+A+GLST D+V LSGSHTIGQARCT F
Sbjct  143   KLGRRDTRTASQAAANNSIPPPTRNLNQLVSTFNALGLSTRDLVALSGSHTIGQARCTTF  202

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R RIYNE+N+DSS AQ+R+ NCPR SGSGDNNLAPLDL++P  FDN+Y+ NL+  KGLLH
Sbjct  203   RPRIYNETNLDSSLAQTRQSNCPRTSGSGDNNLAPLDLKSPTFFDNSYFKNLIQNKGLLH  262

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQQLFNG STDS VR YS +   FSSDFA AMIKMGDIKPLTG+NGE
Sbjct  263   SDQQLFNGGSTDSIVRAYSNSYNTFSSDFAKAMIKMGDIKPLTGSNGE  310



>ref|XP_009363847.1| PREDICTED: peroxidase P7-like [Pyrus x bretschneideri]
 ref|XP_009363901.1| PREDICTED: peroxidase P7-like [Pyrus x bretschneideri]
Length=319

 Score =   470 bits (1210),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 224/288 (78%), Positives = 247/288 (86%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  FYS SCPKLF TV S VRSAIQKE RMGASLLRL FHDCFVNGCDGS+LLDDTS
Sbjct  23    AQLSTKFYSSSCPKLFSTVKSTVRSAIQKETRMGASLLRLHFHDCFVNGCDGSLLLDDTS  82

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGEK A PN  SARGF V+D+IK AVE VCPGVVSCADILAIA+RDS   LGGPSW+V
Sbjct  83    SFTGEKNAVPNKNSARGFNVVDKIKFAVENVCPGVVSCADILAIAARDSVTILGGPSWDV  142

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             KLGRRD RTASQAAANNSIPPPT NLN+LIS+F+A+GLST D+V LSGSHTIGQARCT F
Sbjct  143   KLGRRDTRTASQAAANNSIPPPTRNLNQLISTFNALGLSTRDLVALSGSHTIGQARCTTF  202

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R R+YNE+N+DSS A++R+ NCPR SGSGDNNLAPLDL++P  FDN+Y+ NL+ KKGLLH
Sbjct  203   RPRVYNETNLDSSLAKTRQSNCPRTSGSGDNNLAPLDLKSPTSFDNSYFKNLIQKKGLLH  262

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQQLFN  STDS VR YS +   FSSDFA AMIKMGDIKPLTG+ GE
Sbjct  263   SDQQLFNRGSTDSIVRAYSNSYNTFSSDFAKAMIKMGDIKPLTGSKGE  310



>gb|KHG18057.1| Peroxidase 52 -like protein [Gossypium arboreum]
Length=322

 Score =   470 bits (1209),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 223/288 (77%), Positives = 249/288 (86%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  FYSKSCPKL  TV S V SAI KEARMGASLLRLFFHDCFVNGCDGS+LLDDTS
Sbjct  26    AQLSTNFYSKSCPKLLSTVKSTVTSAINKEARMGASLLRLFFHDCFVNGCDGSVLLDDTS  85

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGEK A PN  SARGF+V+D IKSAVE VCPGVVSCADILAI +RDS   LGGP W V
Sbjct  86    SFTGEKNAIPNRNSARGFDVVDNIKSAVENVCPGVVSCADILAITARDSVEILGGPKWAV  145

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             KLGRRDAR+ASQ+AANN IP PTSNLN+L S F+A+GLST D+V LSG+HTIGQARCT+F
Sbjct  146   KLGRRDARSASQSAANNGIPAPTSNLNQLTSRFNALGLSTRDLVALSGAHTIGQARCTSF  205

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             RARIYNESNID+SFAQ+R+ NCPR +GSGDNNLAPLD+QTP  FDNNY+ NLV+++GLLH
Sbjct  206   RARIYNESNIDASFAQTRQRNCPRTTGSGDNNLAPLDIQTPTSFDNNYFKNLVSRRGLLH  265

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQQLFNG STDS VRGY  +P+ F+SDF +AMIKMGDI PLTG+ GE
Sbjct  266   SDQQLFNGGSTDSIVRGYGNSPSSFNSDFVSAMIKMGDISPLTGSRGE  313



>ref|XP_006486214.1| PREDICTED: peroxidase 4-like [Citrus sinensis]
Length=319

 Score =   469 bits (1208),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 222/288 (77%), Positives = 248/288 (86%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  FY+ +C  L  TV SVV+SA+ KEARMGASLLRLFFHDCFVNGCDGS+LLDDTS
Sbjct  23    AQLSTNFYANTCKNLLPTVKSVVQSAVSKEARMGASLLRLFFHDCFVNGCDGSVLLDDTS  82

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGEK A PN  SARGFEVID IKSAVEK CPG VSCADILAI +RDS V LGGPSW V
Sbjct  83    SFTGEKNAVPNRNSARGFEVIDNIKSAVEKACPGAVSCADILAITARDSVVLLGGPSWEV  142

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             KLGRRD+RTASQ+AAN+ IPPPTSNLN+L S F+A+GLS  D+V L+G HTIGQARCT+F
Sbjct  143   KLGRRDSRTASQSAANSGIPPPTSNLNQLTSRFNALGLSNKDLVALAGGHTIGQARCTSF  202

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             RA IYNE+NID+SFA++R+GNCPRA+G+GDNNLAPLDLQTP  FDNNY+ NLVN+KGLLH
Sbjct  203   RAHIYNETNIDASFARTRQGNCPRANGTGDNNLAPLDLQTPTSFDNNYFKNLVNRKGLLH  262

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQQLFNG STDS VR YS NP+ FSSDF A MIKMGDI PLTG+ GE
Sbjct  263   SDQQLFNGGSTDSQVRTYSNNPSTFSSDFVAGMIKMGDISPLTGSRGE  310



>ref|XP_008782624.1| PREDICTED: peroxidase 4-like [Phoenix dactylifera]
Length=320

 Score =   467 bits (1201),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 222/289 (77%), Positives = 251/289 (87%), Gaps = 0/289 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FYSK+CP LF TV  V++SAI  E RMGAS+LRLFFHDCFVNGCDGS+LLDDT
Sbjct  23    SAQLSTNFYSKTCPNLFSTVQPVIQSAISSEKRMGASILRLFFHDCFVNGCDGSLLLDDT  82

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGEK A PN  SARGF+VID+IK+AVEK CPGVVSCADILAI++RDS V LGGP+WN
Sbjct  83    SSFTGEKTANPNRNSARGFDVIDKIKAAVEKACPGVVSCADILAISARDSVVLLGGPNWN  142

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRDARTAS + ANN+IPPPTS+L+ LIS FSA GLS N+MV LSG+HTIGQARCT+
Sbjct  143   VKLGRRDARTASLSGANNNIPPPTSSLSNLISKFSAQGLSANEMVALSGAHTIGQARCTS  202

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FRARIYN++NID SFA++R+ NCP  SG+GDNNLAPLDLQTP  FDN+Y+ NLVN+KGLL
Sbjct  203   FRARIYNDTNIDGSFAKTRRSNCPSTSGNGDNNLAPLDLQTPTSFDNDYFKNLVNQKGLL  262

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQLFN  STDS V  YSTNP+KFSSDF AAMIKMGDI PLTG+ GE
Sbjct  263   HSDQQLFNKGSTDSLVSTYSTNPSKFSSDFVAAMIKMGDISPLTGSQGE  311



>ref|XP_002873207.1| hypothetical protein ARALYDRAFT_908444 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49466.1| hypothetical protein ARALYDRAFT_908444 [Arabidopsis lyrata subsp. 
lyrata]
Length=324

 Score =   464 bits (1195),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 220/288 (76%), Positives = 251/288 (87%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQL+  FYS SCP L  TV S V+SA+  EARMGAS+LRLFFHDCFVNGCDGSILLDDTS
Sbjct  28    AQLTTNFYSTSCPNLLSTVQSAVKSAVNSEARMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGE+ AAPN  SARGF VID IKSAVEK CPGVVSCADILAIA+RDS V LGGP+WNV
Sbjct  88    SFTGEQNAAPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVVLGGPNWNV  147

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             K+GRRDARTASQAAAN++IP PTS+L++LISSFSAVGLST DMV LSG+HTIGQ+RCTNF
Sbjct  148   KVGRRDARTASQAAANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNF  207

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             RARIYNE+NI+++FA +R+  CPRA+GSGD NLAPLD+ T   FDNNY+ NL+ ++GLLH
Sbjct  208   RARIYNETNINAAFATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFKNLMTQRGLLH  267

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ LFNG STDS VRGYS NP+ F+SDFAAAMIKMGDI PLTG++GE
Sbjct  268   SDQVLFNGGSTDSIVRGYSNNPSSFNSDFAAAMIKMGDISPLTGSSGE  315



>ref|XP_010695731.1| PREDICTED: peroxidase P7-like [Beta vulgaris subsp. vulgaris]
Length=322

 Score =   464 bits (1194),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 221/288 (77%), Positives = 250/288 (87%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQL+  FYSKSCP L  TVNSVV+SAI KE+RMGASLLRLFFHDCFVNGCDGSILLDDTS
Sbjct  26    AQLTTNFYSKSCPNLLTTVNSVVQSAINKESRMGASLLRLFFHDCFVNGCDGSILLDDTS  85

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGEK A PN  S RGFEVIDQIKSAVEK CPGVVSCADIL I +RDS V LGGP+WNV
Sbjct  86    SFTGEKTALPNSGSVRGFEVIDQIKSAVEKACPGVVSCADILTITARDSVVILGGPTWNV  145

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             KLGRRDARTAS+ AANN+IP P  +L++L+SSFS  GLST DMV L+G HTIGQARCT+F
Sbjct  146   KLGRRDARTASRTAANNNIPQPNFSLSQLMSSFSNQGLSTTDMVALAGGHTIGQARCTSF  205

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R RIYNESNID+SFA++R+ NCPR+S SG NNLAPLDLQTP  FDN YY NLV++KGLLH
Sbjct  206   RTRIYNESNIDASFAKTRQANCPRSSNSGSNNLAPLDLQTPNSFDNKYYKNLVSQKGLLH  265

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQQLF+G ST+S V+ Y +NP++F++DF AAMIKMGDIKPLTG+NGE
Sbjct  266   SDQQLFSGGSTNSLVQTYGSNPSRFNADFIAAMIKMGDIKPLTGSNGE  313



>ref|NP_196153.1| peroxidase 52 [Arabidopsis thaliana]
 sp|Q9FLC0.1|PER52_ARATH RecName: Full=Peroxidase 52; Short=Atperox P52; AltName: Full=ATP49; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09977.1| peroxidase [Arabidopsis thaliana]
 gb|AAL38746.1| putative peroxidase [Arabidopsis thaliana]
 gb|AED90861.1| peroxidase 52 [Arabidopsis thaliana]
Length=324

 Score =   462 bits (1190),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 219/288 (76%), Positives = 250/288 (87%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQL+  FYS SCP L  TV + V+SA+  EARMGAS+LRLFFHDCFVNGCDGSILLDDTS
Sbjct  28    AQLTTNFYSTSCPNLLSTVQTAVKSAVNSEARMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGE+ AAPN  SARGF VID IKSAVEK CPGVVSCADILAIA+RDS V LGGP+WNV
Sbjct  88    SFTGEQNAAPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVALGGPNWNV  147

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             K+GRRDARTASQAAAN++IP PTS+L++LISSFSAVGLST DMV LSG+HTIGQ+RCTNF
Sbjct  148   KVGRRDARTASQAAANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNF  207

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             RARIYNE+NI+++FA +R+  CPRASGSGD NLAPLD+ T   FDNNY+ NL+ ++GLLH
Sbjct  208   RARIYNETNINAAFATTRQRTCPRASGSGDGNLAPLDVTTAASFDNNYFKNLMTQRGLLH  267

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ LFNG STDS VRGYS NP+ F+SDF AAMIKMGDI PLTG++GE
Sbjct  268   SDQVLFNGGSTDSIVRGYSNNPSSFNSDFTAAMIKMGDISPLTGSSGE  315



>ref|XP_004307713.1| PREDICTED: peroxidase 4-like [Fragaria vesca subsp. vesca]
Length=323

 Score =   462 bits (1190),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 223/291 (77%), Positives = 251/291 (86%), Gaps = 2/291 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             +AQLS  FYSKSCP+LF  V S V+ AI+ E RMGAS+LRL FHDCFVNGCDGS+LLDDT
Sbjct  24    TAQLSSNFYSKSCPRLFSIVKSTVQPAIRNEPRMGASILRLHFHDCFVNGCDGSVLLDDT  83

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             ++FTGEK A PN  S RGF VID IKSAVE VCPGVVSCADILAI +RDS   LGGPSWN
Sbjct  84    ANFTGEKNAVPNKNSLRGFNVIDNIKSAVENVCPGVVSCADILAITARDSVAILGGPSWN  143

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRDARTASQAAANNSIPPPTSNLN+LIS F+A+GLST DMV LSGSHTIGQARCT+
Sbjct  144   VKLGRRDARTASQAAANNSIPPPTSNLNQLISRFNALGLSTKDMVALSGSHTIGQARCTS  203

Query  716   FRARIYNES-NIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             FRAR+YNE+ N+DSS AQ+R+ NCPR +GSGDNNLAPLDLQ+P  FDNNYY NL+  +GL
Sbjct  204   FRARVYNETNNLDSSLAQTRQSNCPRTTGSGDNNLAPLDLQSPTAFDNNYYNNLIKNRGL  263

Query  893   LHSDQQLF-NGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQQLF NG STDS VRGYS++ + F+SDFAAAMIKMG+I PLTG+NGE
Sbjct  264   LHSDQQLFLNGGSTDSIVRGYSSSQSTFTSDFAAAMIKMGNINPLTGSNGE  314



>ref|XP_003519407.1| PREDICTED: peroxidase 4-like [Glycine max]
 gb|KHN38568.1| Peroxidase 4 [Glycine soja]
Length=324

 Score =   462 bits (1190),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 221/286 (77%), Positives = 242/286 (85%), Gaps = 0/286 (0%)
 Frame = +2

Query  185   LSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTSSF  364
             L   FY  SCPKLF TV   V SAI KE RMGASLLRLFFHDCFVNGCDGSILLDDTSSF
Sbjct  30    LHTNFYYSSCPKLFDTVKRTVESAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTSSF  89

Query  365   TGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVKL  544
             TGEK A PN  SARGFEVIDQIKSAVEKVCPGVVSCADILAIA+RDS   LGGP+W+VKL
Sbjct  90    TGEKNAGPNRNSARGFEVIDQIKSAVEKVCPGVVSCADILAIAARDSVEILGGPTWDVKL  149

Query  545   GRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFRA  724
             GRRD+RTASQ+AANN IP PTSNLN+LIS F+A+GLST D+V LSG HTIGQARCT FRA
Sbjct  150   GRRDSRTASQSAANNDIPRPTSNLNQLISRFNALGLSTKDLVALSGGHTIGQARCTTFRA  209

Query  725   RIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHSD  904
             RIYNE+NIDSSFA+ R+  CPR SGSGDNNLAP+D  TP  FDN+Y+ NL+ KKGL+HSD
Sbjct  210   RIYNETNIDSSFARMRQSRCPRTSGSGDNNLAPIDFATPRFFDNHYFKNLIQKKGLIHSD  269

Query  905   QQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             QQLFNG STDS VR YSTNP  F +DF+AAMI+MGDI PLTG+ GE
Sbjct  270   QQLFNGGSTDSIVRTYSTNPASFFADFSAAMIRMGDISPLTGSRGE  315



>ref|XP_006470332.1| PREDICTED: peroxidase 4-like [Citrus sinensis]
Length=320

 Score =   461 bits (1185),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 221/288 (77%), Positives = 246/288 (85%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  FY+ +C  L  TV SVV+SAI KEARMGASLLRLFFHDCFVNGCDGS+LLDDTS
Sbjct  24    AQLSTNFYANTCKNLLPTVKSVVQSAISKEARMGASLLRLFFHDCFVNGCDGSVLLDDTS  83

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGEK A  N  SARGF+VID IKSAVEK CPGVVSCADILAI +RDS V LGGPSW V
Sbjct  84    SFTGEKNANANRNSARGFQVIDNIKSAVEKACPGVVSCADILAITARDSVVILGGPSWRV  143

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             KLGRRDARTAS +AAN+ IP PTSNLN+L S F+A+GLS  D+V L+G HTIGQARCT+F
Sbjct  144   KLGRRDARTASLSAANSGIPAPTSNLNQLTSRFNALGLSNKDLVALAGGHTIGQARCTSF  203

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             RA IYNE+NID+SFA++R+GNCPRA+G+GDNNLAPLDLQTP  FDNNY+ NLVN+KGLLH
Sbjct  204   RAHIYNETNIDASFARTRQGNCPRANGTGDNNLAPLDLQTPTCFDNNYFKNLVNRKGLLH  263

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQQLFNG STDS VR YS NP+ FSSDF A MIKMGDI PLTG+ GE
Sbjct  264   SDQQLFNGGSTDSQVRTYSNNPSTFSSDFVAGMIKMGDISPLTGSRGE  311



>gb|KFK24955.1| hypothetical protein AALP_AA8G047500 [Arabis alpina]
Length=324

 Score =   460 bits (1184),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 215/288 (75%), Positives = 250/288 (87%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQL+  FYS SCP L  TV + V+SA++ EARMGAS+LRLFFHDCFVNGCDGSILLDDTS
Sbjct  28    AQLTTNFYSTSCPNLLSTVQTAVKSAVKSEARMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGE+ AAPN  SARGF VID IK+AVEK CPGVVSCAD+LAIA+RDS V LGGP+WNV
Sbjct  88    SFTGEQNAAPNRNSARGFNVIDNIKAAVEKACPGVVSCADVLAIAARDSVVALGGPNWNV  147

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             K+GRRDARTASQAAAN++IP PTS+L++LISSFSAVGLST DMV LSG+HTIGQ+RCTNF
Sbjct  148   KVGRRDARTASQAAANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNF  207

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R RIYNE+NI+++FA +R+  CPRA+GSGD NLAPLD+ TP  FDNNY+ NL+ +KGLLH
Sbjct  208   RTRIYNETNINAAFATTRQRTCPRATGSGDGNLAPLDVATPASFDNNYFKNLLTQKGLLH  267

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ+LFNG STDS VRGY+ N   F+SDF AAMIKMGDI PLTG++GE
Sbjct  268   SDQELFNGGSTDSIVRGYNNNARSFNSDFTAAMIKMGDISPLTGSSGE  315



>emb|CCJ34831.1| horseradish peroxidase isoenzyme HRP_1350 [Armoracia rusticana]
Length=324

 Score =   459 bits (1182),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 216/288 (75%), Positives = 249/288 (86%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQL+P FYS SCP L  TV S V+SA+  EARMGAS++RLFFHDCFVNGCDGSILLDDTS
Sbjct  28    AQLTPNFYSTSCPNLLSTVQSAVKSAVNSEARMGASIVRLFFHDCFVNGCDGSILLDDTS  87

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGE+ A PN  SARGF VID IK+AVEK CPGVVSCADILAIA+RDS V LGGP+W V
Sbjct  88    SFTGEQNANPNRNSARGFNVIDNIKAAVEKACPGVVSCADILAIAARDSVVVLGGPNWTV  147

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             K+GRRDARTASQAAAN++IP PTS+L++LISSFSAVGLST DMV LSG+HTIGQ+RCT+F
Sbjct  148   KVGRRDARTASQAAANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTSF  207

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R RIYNE+NI+++FA +R+  CPR SGSGD NLAPLD+ T   FDNNY+ NL+ ++GLLH
Sbjct  208   RTRIYNETNINAAFATTRQRTCPRTSGSGDGNLAPLDVTTAASFDNNYFKNLMTQRGLLH  267

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ+LFNG STDS VRGYS NP+ FSSDFAAAMIKMGDI PLTG++GE
Sbjct  268   SDQELFNGGSTDSIVRGYSNNPSSFSSDFAAAMIKMGDISPLTGSSGE  315



>ref|XP_010452439.1| PREDICTED: peroxidase 52-like [Camelina sativa]
Length=324

 Score =   459 bits (1181),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 218/288 (76%), Positives = 249/288 (86%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQL+  FYS SCP L  TV + V+SA++ EARMG S+LRLFFHDCFVNGCDGSILLDDTS
Sbjct  28    AQLTTNFYSTSCPNLLSTVQTAVKSAVRSEARMGGSILRLFFHDCFVNGCDGSILLDDTS  87

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGE+ A PN  SARGF VID IKSAVEK CPGVVSCADILAIA+RDS V LGGP+WNV
Sbjct  88    SFTGEQNANPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVALGGPNWNV  147

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             K+GRRDARTASQAAAN++IP PTS+L++LISSFSAVGLST DMV LSG+HTIGQ+RCT+F
Sbjct  148   KVGRRDARTASQAAANSNIPGPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTSF  207

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             RARIYNE+NI+++FA +R+  CPRA+GSGD NLAPLD+ T   FDNNY+ NLV +KGLLH
Sbjct  208   RARIYNETNINAAFATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFKNLVAQKGLLH  267

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ LFNG STDS VRGYS NP+ FSSDF AAMIKMGDI PLTG++GE
Sbjct  268   SDQVLFNGGSTDSIVRGYSNNPSSFSSDFTAAMIKMGDISPLTGSSGE  315



>ref|XP_010423480.1| PREDICTED: peroxidase 52 [Camelina sativa]
Length=324

 Score =   459 bits (1181),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 218/288 (76%), Positives = 249/288 (86%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQL+  FYS SCP L  TV + V+SA++ EARMG S+LRLFFHDCFVNGCDGSILLDDTS
Sbjct  28    AQLTTTFYSTSCPNLLSTVQTAVKSAVRSEARMGGSILRLFFHDCFVNGCDGSILLDDTS  87

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGE+ A PN  SARGF VID IKSAVEK CPGVVSCADILAIA+RDS V LGGP+WNV
Sbjct  88    SFTGEQNANPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVALGGPNWNV  147

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             K+GRRDARTASQAAAN++IP PTS+L++LISSFSAVGLST DMV LSG+HTIGQ+RCT+F
Sbjct  148   KVGRRDARTASQAAANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTSF  207

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             RARIYNE+NI+++FA +R+  CPRA+GSGD NLAPLD+ T   FDNNY+ NLV +KGLLH
Sbjct  208   RARIYNETNINAAFATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFKNLVAQKGLLH  267

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ LFNG STDS VRGYS NP+ FSSDF AAMIKMGDI PLTG++GE
Sbjct  268   SDQVLFNGGSTDSIVRGYSNNPSSFSSDFTAAMIKMGDISPLTGSSGE  315



>gb|AFK41406.1| unknown [Lotus japonicus]
Length=322

 Score =   458 bits (1179),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 229/289 (79%), Positives = 253/289 (88%), Gaps = 1/289 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  FYS SCPKLF TV S V+SAI KEARMGASLLRLFFHDCFVNGCDGS+LLDDTS
Sbjct  25    AQLSTNFYSSSCPKLFSTVKSSVQSAISKEARMGASLLRLFFHDCFVNGCDGSVLLDDTS  84

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGEK A PN  SARGF+VID IKSAVE  CPGVVSCADILAI++RDS V+LGGP+WNV
Sbjct  85    SFTGEKNANPNRNSARGFDVIDNIKSAVEAACPGVVSCADILAISARDSVVSLGGPTWNV  144

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             K+GRRDA+TASQ+AAN  IP PTS+L++L S FSA+GLS+ D+V LSG+HTIGQARCT+F
Sbjct  145   KVGRRDAKTASQSAANTGIPAPTSSLSQLTSRFSALGLSSKDLVALSGAHTIGQARCTSF  204

Query  719   RARIYNE-SNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             RARIYNE S I+SSFA SRK NCP  SGSGDNNLAPLDLQTP  FDNNY+ NLV  KGLL
Sbjct  205   RARIYNETSTIESSFATSRKSNCPSTSGSGDNNLAPLDLQTPTSFDNNYFKNLVQNKGLL  264

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQLFNG STDSTVRGYSTNP+ FSSDFA+AM+KMGDI PLTG+NGE
Sbjct  265   HSDQQLFNGGSTDSTVRGYSTNPSSFSSDFASAMVKMGDISPLTGSNGE  313



>ref|XP_006595847.1| PREDICTED: peroxidase 4-like [Glycine max]
Length=326

 Score =   458 bits (1179),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 219/286 (77%), Positives = 240/286 (84%), Gaps = 0/286 (0%)
 Frame = +2

Query  185   LSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTSSF  364
             L   FY  SCPKLF TV   V SAI KE RMGASLLRLFFHDCFVNGCDGSILLDDTSSF
Sbjct  32    LHTNFYYSSCPKLFDTVKRTVESAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTSSF  91

Query  365   TGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVKL  544
             TGEK A PN  SARGFEVIDQIKSAVEKVCPGVVSCADILAIA+RDS   L GP+W+VKL
Sbjct  92    TGEKNAGPNRNSARGFEVIDQIKSAVEKVCPGVVSCADILAIAARDSVEILRGPTWDVKL  151

Query  545   GRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFRA  724
             GRRD+RTASQ+AANN IP PTSNLN+LIS F+ +GLST D+V LSG HTIGQARCT FRA
Sbjct  152   GRRDSRTASQSAANNGIPRPTSNLNQLISRFNTLGLSTKDLVALSGGHTIGQARCTTFRA  211

Query  725   RIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHSD  904
             RIYNESNIDSSFA+ R+  CPR SGSGDNNLAP+D  TP  FDN+Y+ NL+ KKGL+HSD
Sbjct  212   RIYNESNIDSSFARMRQSRCPRTSGSGDNNLAPIDFATPTFFDNHYFKNLIQKKGLIHSD  271

Query  905   QQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             Q+LFNG STDS VR YSTNP  F +DF+AAMI+MGDI PLTG+ GE
Sbjct  272   QELFNGGSTDSLVRTYSTNPASFFADFSAAMIRMGDISPLTGSRGE  317



>emb|CAD67479.1| peroxidase [Asparagus officinalis]
Length=320

 Score =   458 bits (1178),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 213/289 (74%), Positives = 250/289 (87%), Gaps = 0/289 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQL+P FYS SCP LF T+ SVV+SAI  E RMGASLLRLFFHDCFVNGCDGS+LLDDT
Sbjct  23    SAQLTPNFYSSSCPTLFPTIKSVVQSAISSEKRMGASLLRLFFHDCFVNGCDGSLLLDDT  82

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGEK A PN  S RGF+VID+IK+AVE+ CPGVVSCADILA+ +RDS V LGGP+WN
Sbjct  83    SSFTGEKNAIPNKGSVRGFDVIDKIKTAVEQACPGVVSCADILAVTARDSVVLLGGPTWN  142

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRD+RTASQ+ ANN+IPPPTS+L+ LIS FSA GLS  +MV L G+HTIGQARCTN
Sbjct  143   VKLGRRDSRTASQSGANNNIPPPTSSLSNLISKFSAQGLSAKEMVALVGAHTIGQARCTN  202

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FRA +YN+++ID++FA++R+ NCP  SGSGDNNLAPLDLQTP+ FDNNY+ NLV+KKGLL
Sbjct  203   FRAHVYNDTDIDATFAKTRQSNCPSTSGSGDNNLAPLDLQTPVAFDNNYFKNLVSKKGLL  262

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQ+F+G ST+S V  YST+P+ +SSDF AAMIKMGDI PLTG +GE
Sbjct  263   HSDQQVFSGGSTNSQVSTYSTSPSTWSSDFVAAMIKMGDISPLTGKSGE  311



>ref|XP_007141708.1| hypothetical protein PHAVU_008G218500g [Phaseolus vulgaris]
 gb|ESW13702.1| hypothetical protein PHAVU_008G218500g [Phaseolus vulgaris]
Length=320

 Score =   457 bits (1176),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 221/288 (77%), Positives = 243/288 (84%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             A L   FYS SCPKL  TV   V SAI KE RMGASLLRLFFHDCFVNGCDGSILLDDTS
Sbjct  24    ATLYTNFYSSSCPKLLDTVKCAVESAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTS  83

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGEK A PN  SARGF+VID+IKSAVE+VCPGVVSCADILAIA+RDS   LGGPSWNV
Sbjct  84    SFTGEKNARPNKNSARGFDVIDKIKSAVEEVCPGVVSCADILAIAARDSVHILGGPSWNV  143

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             KLGRRD+RTASQ+AANN IPPPTSN+N+LIS F+++GLS  D+V LSG+HTIGQARCT F
Sbjct  144   KLGRRDSRTASQSAANNGIPPPTSNVNQLISRFNSLGLSPKDLVALSGAHTIGQARCTTF  203

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             RARIYNE+NIDSSFA  R+  CP  SGSGDNNLAPLDL TP  FDN+Y+ NL+ KKGLLH
Sbjct  204   RARIYNETNIDSSFAHIRQSTCPPNSGSGDNNLAPLDLATPTFFDNHYFKNLIQKKGLLH  263

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQQLFNG STDS VR Y+TNP  F +DF+AAMIKMGDI PLTG+ GE
Sbjct  264   SDQQLFNGASTDSLVRTYNTNPGSFFADFSAAMIKMGDISPLTGSLGE  311



>gb|KHN44724.1| Peroxidase 4 [Glycine soja]
Length=318

 Score =   456 bits (1173),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 218/286 (76%), Positives = 240/286 (84%), Gaps = 0/286 (0%)
 Frame = +2

Query  185   LSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTSSF  364
             L   FY  SCPKLF TV   V SAI KE RMGASLLRLFFHDCFVNGCDGSILLDDTSSF
Sbjct  24    LHTNFYYSSCPKLFDTVKRTVESAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTSSF  83

Query  365   TGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVKL  544
             TGEK A PN  SARGFEVIDQIKSAVEKVCPGVVSCADILAIA+RDS   L GP+W+VKL
Sbjct  84    TGEKNAGPNRNSARGFEVIDQIKSAVEKVCPGVVSCADILAIAARDSVEILRGPTWDVKL  143

Query  545   GRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFRA  724
             GRRD+RTASQ+AANN IP PTSNLN+LIS F+ +GLST D+V LSG HTIGQARCT FRA
Sbjct  144   GRRDSRTASQSAANNGIPRPTSNLNQLISRFNTLGLSTKDLVALSGGHTIGQARCTTFRA  203

Query  725   RIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHSD  904
             RIYNESNIDSSFA+ R+  CPR SGSGDNNLAP++  TP  FDN+Y+ NL+ KKGL+HSD
Sbjct  204   RIYNESNIDSSFARMRQSRCPRTSGSGDNNLAPINFATPTFFDNHYFKNLIQKKGLIHSD  263

Query  905   QQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             Q+LFNG STDS VR YSTNP  F +DF+AAMI+MGDI PLTG+ GE
Sbjct  264   QELFNGGSTDSLVRTYSTNPASFFADFSAAMIRMGDISPLTGSRGE  309



>ref|XP_002520835.1| Peroxidase 52 precursor, putative [Ricinus communis]
 gb|EEF41544.1| Peroxidase 52 precursor, putative [Ricinus communis]
Length=318

 Score =   456 bits (1172),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 222/288 (77%), Positives = 242/288 (84%), Gaps = 2/288 (1%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  FYSKSCP LF TV  VV+SAI +E RMGASL+RLFFHDCFVNGCDGSILLDDTS
Sbjct  24    AQLSTNFYSKSCPNLFSTVKPVVQSAINQEKRMGASLVRLFFHDCFVNGCDGSILLDDTS  83

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGE+ A PN  S RGFEVID IKSAVEK CPGVVSCADILAIA+RDST  LGGPSWNV
Sbjct  84    SFTGEQTAVPNRNSVRGFEVIDSIKSAVEKACPGVVSCADILAIAARDSTAILGGPSWNV  143

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             KLGRRDARTAS +AANN IP PTSNLN+LIS FSA+GLST D+V LSG+HTIGQARCTNF
Sbjct  144   KLGRRDARTASLSAANNGIPAPTSNLNQLISRFSALGLSTRDLVALSGAHTIGQARCTNF  203

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R RIYN++NIDSSFAQ+R+ NCP  S  GDNNLAPLDLQTP  FDNNY+ NL+ +KGLLH
Sbjct  204   RTRIYNDTNIDSSFAQTRRSNCP--STGGDNNLAPLDLQTPTSFDNNYFKNLLVQKGLLH  261

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ+LFN  STDS VR YS   + F SDF A MIKMGDI PLTG+ GE
Sbjct  262   SDQELFNNGSTDSIVRTYSNGQSTFFSDFVAGMIKMGDISPLTGSQGE  309



>ref|XP_004502855.1| PREDICTED: peroxidase 52-like [Cicer arietinum]
Length=322

 Score =   455 bits (1171),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 221/288 (77%), Positives = 248/288 (86%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  FYS SC +L  TV S ++SAI KEAR+GAS+LRLFFHDCFVNGCDGSILLDDTS
Sbjct  26    AQLSENFYSSSCSQLSSTVKSTMQSAISKEARIGASILRLFFHDCFVNGCDGSILLDDTS  85

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGEK A PN  SARGFEVID IK+AVEKVCPG+VSCADILAIA++DS   LGGP+WNV
Sbjct  86    SFTGEKNANPNRNSARGFEVIDNIKTAVEKVCPGIVSCADILAIAAKDSVEILGGPTWNV  145

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             K+GRRDA+TASQ+AAN  IP P+S+L +L S FSA+GLST D+V LSG+HTIGQARCTNF
Sbjct  146   KVGRRDAKTASQSAANTGIPAPSSSLTQLTSRFSALGLSTKDLVALSGAHTIGQARCTNF  205

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             RARIYNE+NID+SFA +RK +CP  SGSGDNNLAPLDLQTP  FDNNY+ NL+ KKGLLH
Sbjct  206   RARIYNETNIDTSFATTRKSSCPSTSGSGDNNLAPLDLQTPTSFDNNYFKNLIQKKGLLH  265

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQQLFNG S DS V GYSTNPT FSS F+AAMIKMGDI PLTG+NGE
Sbjct  266   SDQQLFNGGSADSIVTGYSTNPTSFSSAFSAAMIKMGDISPLTGSNGE  313



>ref|XP_003616748.1| Peroxidase [Medicago truncatula]
 gb|AES99706.1| class III peroxidase [Medicago truncatula]
Length=325

 Score =   454 bits (1168),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 217/288 (75%), Positives = 242/288 (84%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             A LS  +Y  SCPKLF+TV   V+SAI KE RMGASLLRLFFHDCFVNGCDGSILLDDTS
Sbjct  29    ANLSKDYYYSSCPKLFETVKCEVQSAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTS  88

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGEK A PN  SARGFEVID+IKSAVEKVCPG VSCADIL I +RDS   LGGP+W+V
Sbjct  89    SFTGEKTANPNKNSARGFEVIDKIKSAVEKVCPGAVSCADILTITARDSVEILGGPTWDV  148

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             KLGRRDARTAS++AANN IP PTS+LN+LIS F+A+GLST D+V LSG HTIGQARCT F
Sbjct  149   KLGRRDARTASKSAANNDIPAPTSSLNQLISRFNALGLSTKDLVALSGGHTIGQARCTTF  208

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             RA IYN+SNID+SFA++R+  CP+ SGSGDNNLAPLDL TP  FDN+Y+ NLV+ KGLLH
Sbjct  209   RAHIYNDSNIDTSFARTRQSGCPKTSGSGDNNLAPLDLATPTSFDNHYFKNLVDSKGLLH  268

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQQLFNG STDS V  YS  P+ FSSDF  AMIKMGDI PLTG+NGE
Sbjct  269   SDQQLFNGGSTDSIVHEYSLYPSSFSSDFVTAMIKMGDISPLTGSNGE  316



>ref|XP_010695722.1| PREDICTED: peroxidase P7-like [Beta vulgaris subsp. vulgaris]
Length=323

 Score =   454 bits (1167),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 214/288 (74%), Positives = 247/288 (86%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  FYS SCP L  TV SVV+SA+  EARMGASLLRLFFHDCFVNGCDGS+LLDDTS
Sbjct  27    AQLSTNFYSSSCPNLLSTVKSVVQSAVNNEARMGASLLRLFFHDCFVNGCDGSVLLDDTS  86

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGEK A PN  S RGF+V+DQIK+AVEK CPGVVSCADILAI++RDS V LGGP+WNV
Sbjct  87    SFTGEKNAFPNAGSLRGFDVVDQIKTAVEKACPGVVSCADILAISARDSVVILGGPTWNV  146

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             KLGRRDA TASQ+AAN +IP PT++L+ LI SFS  GLST DMV LSG+HTIGQARCT F
Sbjct  147   KLGRRDATTASQSAANTNIPAPTASLSALIKSFSDQGLSTTDMVALSGAHTIGQARCTTF  206

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R RIYNESNID+SFA++R+ NCP AS SG NNLAPLD+QTP  FDN YY NLVN+KGLLH
Sbjct  207   RTRIYNESNIDASFAKTRQANCPSASTSGSNNLAPLDIQTPNTFDNKYYNNLVNQKGLLH  266

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQQLF+G ST++ V+ YS+NP++F++DF AAMI MGD+KPLTG+NG+
Sbjct  267   SDQQLFSGGSTNALVQTYSSNPSRFNTDFVAAMINMGDVKPLTGSNGQ  314



>gb|ACU23245.1| unknown [Glycine max]
Length=326

 Score =   454 bits (1167),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 217/286 (76%), Positives = 238/286 (83%), Gaps = 0/286 (0%)
 Frame = +2

Query  185   LSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTSSF  364
             L   FY  SCPKLF TV   V SAI KE RMGASLLRLFFHDCFVNGCDGSILLDDTSSF
Sbjct  32    LHTNFYYSSCPKLFDTVKRTVESAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTSSF  91

Query  365   TGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVKL  544
             TGEK A PN  SARGFEVIDQIKSAVEKVCPGVVSCADILAIA+RDS   L GP+W+VKL
Sbjct  92    TGEKNAGPNRNSARGFEVIDQIKSAVEKVCPGVVSCADILAIAARDSVEILRGPTWDVKL  151

Query  545   GRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFRA  724
             GRRD+RTASQ+AANN IP PTSNLN+LIS F+ +GLST D+V LSG HTIGQARCT FRA
Sbjct  152   GRRDSRTASQSAANNGIPRPTSNLNQLISRFNTLGLSTKDLVALSGGHTIGQARCTTFRA  211

Query  725   RIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHSD  904
             RIYNESNIDSSFA+ R+  CPR SGSGDNNLAP+D  TP  FDN+Y+ NL+ KKG +HSD
Sbjct  212   RIYNESNIDSSFARMRQSRCPRTSGSGDNNLAPIDFATPTFFDNHYFKNLIQKKGFIHSD  271

Query  905   QQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             Q+LFNG STDS V  YSTNP  F +DF+AAMI+MGDI PLTG+ GE
Sbjct  272   QELFNGGSTDSLVGTYSTNPASFFADFSAAMIRMGDISPLTGSRGE  317



>ref|XP_002269918.1| PREDICTED: peroxidase 4 [Vitis vinifera]
 sp|A7NY33.1|PER4_VITVI RecName: Full=Peroxidase 4; Flags: Precursor [Vitis vinifera]
 emb|CBI15844.3| unnamed protein product [Vitis vinifera]
Length=321

 Score =   453 bits (1165),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 215/289 (74%), Positives = 243/289 (84%), Gaps = 0/289 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FYSK+CPK+F TV S V+SA+ KE RMGASLLRLFFHDCFVNGCD S+LLDDT
Sbjct  24    SAQLSTNFYSKTCPKVFDTVKSGVQSAVSKERRMGASLLRLFFHDCFVNGCDASVLLDDT  83

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGE+ A PN  S RG  VID IKS VE VCPGVVSCADI+AIA+RDS V LGGP W+
Sbjct  84    SSFTGEQTAVPNKNSIRGLNVIDNIKSQVESVCPGVVSCADIIAIAARDSVVILGGPDWD  143

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRD++TAS + ANN+IPPPTS+L+ LIS F A GLST DMV LSG+HTIGQARCT+
Sbjct  144   VKLGRRDSKTASLSGANNNIPPPTSSLSNLISKFQAQGLSTRDMVALSGAHTIGQARCTS  203

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FRARIYNE+NIDSSFA++R+ +CP ASGSGDNNLAPLDLQTP  FDN YY NL+N+KGLL
Sbjct  204   FRARIYNETNIDSSFAKTRQASCPSASGSGDNNLAPLDLQTPTTFDNYYYKNLINQKGLL  263

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQ L+NG STDSTV+ Y  NP  F+SDF A MIKMGDI PLTG+ GE
Sbjct  264   HSDQVLYNGGSTDSTVKTYVNNPKTFTSDFVAGMIKMGDITPLTGSEGE  312



>ref|XP_003602463.1| Peroxidase [Medicago truncatula]
 gb|AES72714.1| horseradish peroxidase-like protein [Medicago truncatula]
Length=322

 Score =   452 bits (1162),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 225/288 (78%), Positives = 246/288 (85%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  FYS SCPKL  TV S V+SAI  EARMGAS+LRLFFHDCFVNGCDGSILLDDTS
Sbjct  26    AQLSTSFYSSSCPKLSSTVQSTVQSAISNEARMGASILRLFFHDCFVNGCDGSILLDDTS  85

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             +FTGEK A PN  SARGF+VID IK+AVE VCPGVVSCADILAIA+ DS   LGGP+WNV
Sbjct  86    NFTGEKNANPNRNSARGFDVIDNIKTAVENVCPGVVSCADILAIAAADSVAILGGPTWNV  145

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             KLGRRDA+TASQ+AAN +IP PTSNLN L S FSAVGLS+ D+V LSG+HTIGQARCT F
Sbjct  146   KLGRRDAKTASQSAANTAIPAPTSNLNTLTSMFSAVGLSSKDLVTLSGAHTIGQARCTTF  205

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             RARIYNE+NID+SFA +R+ NCP  SGSGDNNLAPLDLQTP  FDNNY+ NLV  KGLLH
Sbjct  206   RARIYNETNIDTSFASTRQSNCPNTSGSGDNNLAPLDLQTPTSFDNNYFKNLVQNKGLLH  265

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQQLFNG ST+S V GYSTNP+ FSSDFA AMIKMGDI PLTG+NGE
Sbjct  266   SDQQLFNGGSTNSIVSGYSTNPSSFSSDFATAMIKMGDISPLTGSNGE  313



>ref|XP_006398996.1| hypothetical protein EUTSA_v10014105mg [Eutrema salsugineum]
 gb|ESQ40449.1| hypothetical protein EUTSA_v10014105mg [Eutrema salsugineum]
Length=324

 Score =   451 bits (1160),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 213/288 (74%), Positives = 247/288 (86%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQL+  FYS SCP L  TV + V+SA+  + RMGAS+LRLFFHDCFVNGCDGSILLDDTS
Sbjct  28    AQLTTNFYSSSCPNLLSTVQTAVKSAVSSQNRMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGE+ A PN  SARGF VID IKSAVEK CPGVVSCADILAIA+RDS V LGGP+WNV
Sbjct  88    SFTGEQNANPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVILGGPNWNV  147

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             KLGRRDARTASQAAAN++IP PTS+L++LISSFSAVGLST DMV LSG+HTIGQ+RCTNF
Sbjct  148   KLGRRDARTASQAAANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNF  207

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             RAR+YNE+NI+++FA  R+ +CPR +GSGD NLAPLD+ +   FDN+Y+ NL+ ++GLLH
Sbjct  208   RARVYNETNINAAFATLRQRSCPRTAGSGDGNLAPLDVNSAASFDNSYFKNLMAQRGLLH  267

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ+LFNG STDS VRGYS  P+ FSSDFAAAMIKMGDI PLTG +GE
Sbjct  268   SDQELFNGGSTDSIVRGYSNTPSSFSSDFAAAMIKMGDISPLTGTSGE  315



>gb|KHN48387.1| Peroxidase 52 [Glycine soja]
Length=265

 Score =   448 bits (1153),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 215/256 (84%), Positives = 232/256 (91%), Gaps = 0/256 (0%)
 Frame = +2

Query  275   MGASLLRLFFHDCFVNGCDGSILLDDTSSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVC  454
             MGASLLRLFFHDCFVNGCDGSILLDDTSSFTGEK A PN  SARG+EVID IKSAVEK C
Sbjct  1     MGASLLRLFFHDCFVNGCDGSILLDDTSSFTGEKNANPNRNSARGYEVIDNIKSAVEKAC  60

Query  455   PGVVSCADILAIASRDSTVTLGGPSWNVKLGRRDARTASQAAANNSIPPPTSNLNRLISS  634
             PGVVSCADILAIA+RDS   LGGPSWNVK+GRRDARTASQ+AANN IPPPTSNLN+LIS 
Sbjct  61    PGVVSCADILAIAARDSVQILGGPSWNVKVGRRDARTASQSAANNGIPPPTSNLNQLISR  120

Query  635   FSAVGLSTNDMVVLSGSHTIGQARCTNFRARIYNESNIDSSFAQSRKGNCPRASGSGDNN  814
             FSA+GLST D+V LSG HTIGQARCTNFRARIYNESNID++FA++R+ +CPR SGSGDNN
Sbjct  121   FSALGLSTKDLVALSGGHTIGQARCTNFRARIYNESNIDTAFARTRQQSCPRTSGSGDNN  180

Query  815   LAPLDLQTPIKFDNNYYVNLVNKKGLLHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAA  994
             LAPLDLQTP +FDN Y+ NLV KKGLLHSDQQLFNG STDS VRGYSTNP+ FSSDFAAA
Sbjct  181   LAPLDLQTPTEFDNYYFKNLVQKKGLLHSDQQLFNGGSTDSIVRGYSTNPSSFSSDFAAA  240

Query  995   MIKMGDIKPLTGNNGE  1042
             MIKMGDI PLTG+NGE
Sbjct  241   MIKMGDISPLTGSNGE  256



>ref|XP_010552918.1| PREDICTED: peroxidase P7-like [Tarenaya hassleriana]
Length=319

 Score =   450 bits (1157),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 212/288 (74%), Positives = 240/288 (83%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
              QL+  FY+ SCPKL  TV SV++SA+++EAR+GAS+LRLFFHDCFVNGCDGSILLDDTS
Sbjct  23    GQLTTNFYASSCPKLIPTVRSVMQSAVKREARIGASILRLFFHDCFVNGCDGSILLDDTS  82

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGEK A PN  S RGF+VID IK+A EK CPG+VSCADILAIA+RD  V LGGPSW V
Sbjct  83    SFTGEKNAGPNRNSVRGFDVIDNIKTAAEKACPGIVSCADILAIAARDGVVLLGGPSWEV  142

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             KLGRRD+RTASQ+AAN  IP PT NL+RL+SSFS VGLS  DMV LSG HTIGQARCT F
Sbjct  143   KLGRRDSRTASQSAANRDIPAPTFNLSRLVSSFSNVGLSARDMVALSGGHTIGQARCTTF  202

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             RARIYNE NI+S+FA +R+ NCPR +GSGD NLAPLD+QTP KFDNNY+ NL+ +KGLLH
Sbjct  203   RARIYNEKNINSAFAATRQRNCPRTNGSGDGNLAPLDIQTPTKFDNNYFKNLMVQKGLLH  262

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ+LFNG STDS VR Y T P  FSSDF AAMI+MGDI PLTG  GE
Sbjct  263   SDQELFNGGSTDSIVRTYGTKPATFSSDFTAAMIRMGDISPLTGKKGE  310



>ref|XP_010921101.1| PREDICTED: peroxidase 4-like [Elaeis guineensis]
Length=320

 Score =   449 bits (1154),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 211/289 (73%), Positives = 249/289 (86%), Gaps = 0/289 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  +YSK+CP LF  V  V+ SAI  E RMGAS+LRLFFHDCFVNGCDGS+LLDDT
Sbjct  23    SAQLSTNYYSKTCPNLFSAVKPVIESAISSEKRMGASILRLFFHDCFVNGCDGSLLLDDT  82

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGEK A  N  S RGF+VID+IK+AVE+ CPGVVSCADILA+A+RDS V LGGP+W+
Sbjct  83    SSFTGEKTANANRNSVRGFDVIDKIKTAVEEACPGVVSCADILAVAARDSVVILGGPNWD  142

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRDARTAS +AANN+IPPPTS+L+ LIS FSA GLST++MV L+G+HTIGQARCT+
Sbjct  143   VKLGRRDARTASLSAANNNIPPPTSSLSNLISKFSAQGLSTDEMVALAGAHTIGQARCTS  202

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FRA IYN+++I+SSFA++R+ NCP  SG+GDNNLAPLDLQTP  FDNNYY NLV+++GLL
Sbjct  203   FRAHIYNDTDINSSFAKTRQANCPSTSGNGDNNLAPLDLQTPTVFDNNYYKNLVSQEGLL  262

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQ+L+N  STDS V  YSTNP+KFSSDF AA+IKMGDI PLTG+ GE
Sbjct  263   HSDQELYNKGSTDSLVSTYSTNPSKFSSDFVAAIIKMGDISPLTGSQGE  311



>ref|XP_006468162.1| PREDICTED: peroxidase 4-like [Citrus sinensis]
 gb|KDO41521.1| hypothetical protein CISIN_1g020615mg [Citrus sinensis]
Length=323

 Score =   448 bits (1152),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 218/290 (75%), Positives = 243/290 (84%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FYSK+CPKL  TV S V+SA+ KE RMGASLLRL FHDCFVNGCDGSILLDDT
Sbjct  25    SAQLSTNFYSKTCPKLLNTVKSAVQSAVSKERRMGASLLRLHFHDCFVNGCDGSILLDDT  84

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGEK + PN  SARGFEV+D IKS VEKVCPGVVSCADILAIA+R S   LGGPSWN
Sbjct  85    SSFTGEKTSGPNINSARGFEVVDDIKSKVEKVCPGVVSCADILAIAARHSVAILGGPSWN  144

Query  536   VKLGRRDARTASQAAANNS-IPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  712
             VKLGRRD++TAS AAAN+  IPPPTS L+ LI+ F A GLS  DMV LSG+HTIGQARC 
Sbjct  145   VKLGRRDSKTASLAAANSGVIPPPTSTLSNLINRFQAKGLSAKDMVALSGAHTIGQARCV  204

Query  713   NFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
              FR RIYNESNI+SSFA++R+GNCPRA+GSGDNNLAPLD Q+P KFDN YY +L+N+KGL
Sbjct  205   AFRNRIYNESNIESSFAKNRRGNCPRATGSGDNNLAPLDFQSPNKFDNQYYKHLLNQKGL  264

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQ LFNG STDS V  Y++N   F+SDFAAAMIKMGDI PLTG+ GE
Sbjct  265   LHSDQILFNGGSTDSLVSTYASNSKTFNSDFAAAMIKMGDISPLTGSIGE  314



>ref|XP_010491069.1| PREDICTED: peroxidase 52-like [Camelina sativa]
Length=324

 Score =   447 bits (1151),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 218/288 (76%), Positives = 250/288 (87%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQL+  FYS SCP L  TV + V+SA++ EARMG S+LRLFFHDCFVNGCDGSILLDDTS
Sbjct  28    AQLTTNFYSTSCPNLLSTVQTAVKSAVRSEARMGGSILRLFFHDCFVNGCDGSILLDDTS  87

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGE+ A PN  SARGF VID IKSAVEK CPGVVSCADILAIA+RDS V LGGP+WNV
Sbjct  88    SFTGEQNANPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVALGGPNWNV  147

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             K+GRRDARTASQAAAN++IP PTS+L++LISSFSAVGLST DMV LSG+HTIGQARCT+F
Sbjct  148   KVGRRDARTASQAAANSNIPGPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQARCTSF  207

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             RARIYNE+NI+++FA +R+  CPRA+GSGD NLAPLD+ T   FDNNY+ NLV +KGLLH
Sbjct  208   RARIYNETNINAAFATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFKNLVAQKGLLH  267

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ+LFNG STDS VRGYS +P+ FSSDF AAMIKMGDI PLTG++GE
Sbjct  268   SDQELFNGGSTDSIVRGYSNSPSSFSSDFTAAMIKMGDISPLTGSSGE  315



>ref|XP_008810563.1| PREDICTED: peroxidase 4-like [Phoenix dactylifera]
Length=319

 Score =   447 bits (1149),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 213/289 (74%), Positives = 239/289 (83%), Gaps = 0/289 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  +Y+ SCPK+F  V  VV+SAI KE RMGASLLRLFFHDCFV GCDGSILLDDT
Sbjct  22    SAQLSTNYYASSCPKVFSAVKPVVQSAIAKEKRMGASLLRLFFHDCFVQGCDGSILLDDT  81

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSF GEK A PN  S RGF+V+D IK+AVEKVCPGVVSCADILAI +RDS V LGGP+WN
Sbjct  82    SSFQGEKTATPNNNSVRGFDVVDSIKAAVEKVCPGVVSCADILAITARDSVVILGGPNWN  141

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRD+ TAS + ANN+IPPP S+L+ LIS FSA GLST DMV LSG HTIGQARCTN
Sbjct  142   VKLGRRDSTTASFSGANNNIPPPNSSLSNLISKFSAQGLSTKDMVALSGGHTIGQARCTN  201

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FRA +YN+++IDSSFA++R+ NCP  +GSGDNNLAPLDLQTP  FDNNYY NL+NKKGLL
Sbjct  202   FRAHVYNDTDIDSSFAKTRQMNCPSTAGSGDNNLAPLDLQTPTCFDNNYYKNLINKKGLL  261

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQ+LFNG STDS V  YS NP+ F+SDF   MI MGDI PLTG  GE
Sbjct  262   HSDQELFNGGSTDSQVTTYSNNPSTFNSDFVTGMINMGDINPLTGTRGE  310



>gb|KHG25850.1| Peroxidase 4 [Gossypium arboreum]
Length=323

 Score =   446 bits (1147),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 224/288 (78%), Positives = 249/288 (86%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  +YSKSCP LF TV   V SAI KEARMGASLLRLFFHDCFVNGCDGS+LLDDTS
Sbjct  27    AQLSTDYYSKSCPNLFSTVKFTVHSAIMKEARMGASLLRLFFHDCFVNGCDGSLLLDDTS  86

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGEK A PN  SARGF+VID IKSAVE VCPGVVSCADILAIA+RDS   LGGP+W+V
Sbjct  87    SFTGEKNAVPNRNSARGFDVIDDIKSAVENVCPGVVSCADILAIAARDSVKLLGGPNWDV  146

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             KLGRRDAR+AS+AAANN IP PTSNLNRLIS F+A+GLST D+V LSG+HTIGQARCT+F
Sbjct  147   KLGRRDARSASRAAANNGIPAPTSNLNRLISRFNALGLSTRDLVALSGAHTIGQARCTSF  206

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             RARIYNESNID SFA++++ NCPR+SGSGDNNLAPLD+QTP  FDN Y+ NL+ K+GLLH
Sbjct  207   RARIYNESNIDLSFAKTKQSNCPRSSGSGDNNLAPLDIQTPTYFDNKYFNNLIGKRGLLH  266

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ+LFNG STDS VR YS NP+ FSSDF  AMIKMGDI PLTG+ GE
Sbjct  267   SDQELFNGGSTDSIVRAYSKNPSSFSSDFVTAMIKMGDISPLTGSKGE  314



>ref|XP_010041552.1| PREDICTED: peroxidase P7-like [Eucalyptus grandis]
Length=322

 Score =   446 bits (1146),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 211/288 (73%), Positives = 243/288 (84%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLSP FYSKSCP  F  V S V SA+ KE  +GASLLRLFFHDCFVNGCDGS+LLDDT 
Sbjct  26    AQLSPDFYSKSCPDAFTGVKSQVESAVSKEPGIGASLLRLFFHDCFVNGCDGSVLLDDTP  85

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             +FTGEK AAPN  SARGFEVID +KSAVEKVCPGVVSCAD+LAI +RDS V LGGPSW+V
Sbjct  86    TFTGEKNAAPNRNSARGFEVIDDVKSAVEKVCPGVVSCADLLAITARDSVVLLGGPSWSV  145

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             KLGRRDARTASQAAAN+S+P P SNL  LISSF + GLST D+V LSGSH+IGQA+C NF
Sbjct  146   KLGRRDARTASQAAANSSLPSPASNLTDLISSFESAGLSTTDLVALSGSHSIGQAKCANF  205

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             RARIYNE+++D SF + R+ NCP ++G GDNNLA LDLQ+P+ +DN YY NL+  KGLLH
Sbjct  206   RARIYNETDLDRSFGEIRRKNCPSSAGPGDNNLASLDLQSPVAYDNTYYTNLLQFKGLLH  265

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQQLF+G STDS VR Y+++P+ FSSDFAAAMIKMGDI PLTG++GE
Sbjct  266   SDQQLFSGGSTDSLVRTYASSPSTFSSDFAAAMIKMGDILPLTGSDGE  313



>gb|KDP45728.1| hypothetical protein JCGZ_17335 [Jatropha curcas]
Length=328

 Score =   445 bits (1145),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 217/290 (75%), Positives = 245/290 (84%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS GFYSKSCPKLF+TV  VV  AI KE RMGASL+RLFFHDCFV GCDGSILL+DT
Sbjct  30    SAQLSTGFYSKSCPKLFETVKPVVADAISKERRMGASLVRLFFHDCFVKGCDGSILLEDT  89

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             +SFTGE+ A PN  S RGF VI+ IK+ VEKVCPGVVSCADILAIA+RDSTVTLGGP+W 
Sbjct  90    ASFTGEQTAGPNNNSVRGFNVINNIKAKVEKVCPGVVSCADILAIAARDSTVTLGGPNWA  149

Query  536   VKLGRRDARTASQAAANNS-IPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  712
             VKLGRRD++TAS +AAN+  IPPPTS L+ LI+ F A GLS  DMV LSG+HTIGQARC 
Sbjct  150   VKLGRRDSKTASFSAANSGVIPPPTSTLSNLINRFKAKGLSARDMVALSGAHTIGQARCV  209

Query  713   NFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
              FR RIYNE+NIDSSFA +R+ NCPRA+GSGDNNLAPLD+QTP  FDNNY+ NL+N+KGL
Sbjct  210   IFRNRIYNETNIDSSFASTRQRNCPRATGSGDNNLAPLDVQTPNAFDNNYFKNLLNQKGL  269

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQ LFNG STDS VR YS NP  F+SDF +AMIKMGDI PLTG++GE
Sbjct  270   LHSDQVLFNGGSTDSLVRTYSNNPKTFNSDFVSAMIKMGDIDPLTGSSGE  319



>ref|XP_010543687.1| PREDICTED: peroxidase 52 [Tarenaya hassleriana]
Length=324

 Score =   445 bits (1144),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 208/288 (72%), Positives = 245/288 (85%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQL+  FYS SCP L  TV S ++SA+ +EAR GAS+LRLFFHDCFVNGCDGSILLDDTS
Sbjct  28    AQLTTNFYSSSCPNLLSTVRSAMQSAVNREARAGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             +FTGEK A PN  SARGF+VID IK+AVE+ CPGVVSCADILA+A+RD  V LGGP+WNV
Sbjct  88    NFTGEKNANPNRNSARGFDVIDNIKTAVERACPGVVSCADILAVAARDGVVLLGGPNWNV  147

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             KLGRRDARTASQ+ AN++IP PTS+L++LISSF  VGLST DMV LSG HTIGQARCT+F
Sbjct  148   KLGRRDARTASQSGANSNIPAPTSSLSQLISSFGNVGLSTRDMVALSGGHTIGQARCTSF  207

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R RIYNE+NI+S+FA +R+  CPR +GSGD NLAPLD+QTP  F+N+Y+ NL+ ++GLLH
Sbjct  208   RTRIYNETNINSAFATTRQQTCPRTAGSGDGNLAPLDIQTPANFNNDYFKNLMAQRGLLH  267

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ+LFNG STDS VR YS+NP  F+SDF AAMIKMGDI PLTGN+GE
Sbjct  268   SDQELFNGGSTDSIVRTYSSNPATFNSDFVAAMIKMGDISPLTGNSGE  315



>ref|XP_006843744.1| hypothetical protein AMTR_s00007p00229000 [Amborella trichopoda]
 gb|ERN05419.1| hypothetical protein AMTR_s00007p00229000 [Amborella trichopoda]
Length=318

 Score =   444 bits (1143),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 210/288 (73%), Positives = 237/288 (82%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQL+P +Y+ SCPK   T+ S V+SAI  + R+GA LLRLFFHDCFVNGCDGS+LLDDTS
Sbjct  22    AQLTPHYYAYSCPKALPTIRSAVKSAISNDKRVGAQLLRLFFHDCFVNGCDGSLLLDDTS  81

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             +F GEK AAPN  SARGF ++D IKSAVEK CPGVVSCAD LA+A+RDS V LGGP W V
Sbjct  82    TFIGEKNAAPNRNSARGFNIVDNIKSAVEKACPGVVSCADTLAVAARDSVVLLGGPDWQV  141

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             KLGRRDARTASQAAANNSIPPPT NLN+LI+SF+  GLS  DMV LSG HTIG ARC N 
Sbjct  142   KLGRRDARTASQAAANNSIPPPTFNLNQLINSFANQGLSQKDMVALSGGHTIGVARCINI  201

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R RIYNE+NID SFA++R+ NCPR +GSGDNN+ PLDLQTP  FDN Y+ NL+NKKGLLH
Sbjct  202   RNRIYNETNIDPSFAKTRQSNCPRTAGSGDNNVNPLDLQTPTAFDNKYFKNLINKKGLLH  261

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQQLFNG S+DS VR YS+N   F  DF AAMIKMGDIKPLTG+NGE
Sbjct  262   SDQQLFNGGSSDSLVRSYSSNSDLFDKDFVAAMIKMGDIKPLTGSNGE  309



>emb|CDX70158.1| BnaA10g25070D [Brassica napus]
Length=325

 Score =   444 bits (1143),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 211/288 (73%), Positives = 245/288 (85%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQL+  FYS SCP L  TV S V+SA+  + R GAS+LRLFFHDCFVNGCDGSILLDDTS
Sbjct  29    AQLTTNFYSTSCPNLLSTVRSTVKSAVDSQPRTGASILRLFFHDCFVNGCDGSILLDDTS  88

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGE+ A PN  SARGF VID IK+AVE  CPGVVSCADILAIA+RDS V LGGP+WNV
Sbjct  89    SFTGEQNANPNRNSARGFNVIDNIKTAVEAACPGVVSCADILAIAARDSVVLLGGPNWNV  148

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             K+GRRDARTASQAAANN+IP PTS+L++LISSFSAVGLST DMV LSG+HTIGQ+RCTNF
Sbjct  149   KVGRRDARTASQAAANNNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNF  208

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R R+YNE+NI+++FA  R+ +CPRA+GSGD NLAPLD+ +   FDN+Y+ NLV ++GLLH
Sbjct  209   RTRVYNETNINAAFATLRQRSCPRAAGSGDGNLAPLDVNSANTFDNSYFKNLVAQRGLLH  268

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ+LFNG STDS V GYS NP+ FSSDF AAMIKMGDI PLTG++GE
Sbjct  269   SDQELFNGGSTDSIVTGYSNNPSSFSSDFTAAMIKMGDISPLTGSSGE  316



>gb|ACT35473.1| peroxidase 52, partial [Brassica rapa]
Length=306

 Score =   443 bits (1140),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 211/288 (73%), Positives = 245/288 (85%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQL+  FYS SCP L  TV S V+SA+  + R GAS+LRLFFHDCFVNGCDGSILLDDTS
Sbjct  10    AQLTTNFYSTSCPNLLSTVRSTVKSAVDSQPRTGASILRLFFHDCFVNGCDGSILLDDTS  69

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGE+ A PN  SARGF VID IK+AVE  CPGVVSCADILAIA+RDS V LGGP+WNV
Sbjct  70    SFTGEQNANPNRNSARGFNVIDNIKTAVEAACPGVVSCADILAIAARDSVVLLGGPNWNV  129

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             K+GRRDARTASQAAANN+IP PTS+L++LISSFSAVGLST DMV LSG+HTIGQ+RCTNF
Sbjct  130   KVGRRDARTASQAAANNNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNF  189

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R R+YNE+NI+++FA  R+ +CPRA+GSGD NLAPLD+ +   FDN+Y+ NLV ++GLLH
Sbjct  190   RTRVYNETNINAAFATLRQRSCPRAAGSGDGNLAPLDVNSANTFDNSYFKNLVAQRGLLH  249

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ+LFNG STDS V GYS NP+ FSSDF AAMIKMGDI PLTG++GE
Sbjct  250   SDQELFNGGSTDSIVTGYSNNPSSFSSDFTAAMIKMGDISPLTGSSGE  297



>ref|XP_010045407.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=323

 Score =   444 bits (1142),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 214/290 (74%), Positives = 241/290 (83%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FYSKSCP +  T  SVV+SA+ KE RMGASLLRLFFHDCFVNGCDGSILLDDT
Sbjct  25    SAQLSTNFYSKSCPNVLSTAKSVVQSAVSKERRMGASLLRLFFHDCFVNGCDGSILLDDT  84

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSF GEK A PN  S RG+ VIDQIKS VE  CPGVVSCADI+AIA+RDS V LGGPSW 
Sbjct  85    SSFQGEKTAGPNQNSVRGYNVIDQIKSKVESACPGVVSCADIVAIAARDSVVLLGGPSWE  144

Query  536   VKLGRRDARTASQAAANNS-IPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  712
             VKLGRRDARTAS + AN+  IPPPTS L+ LIS F A GLST DMV LSGSHTIGQARC 
Sbjct  145   VKLGRRDARTASLSRANSGVIPPPTSTLSNLISRFKAQGLSTRDMVALSGSHTIGQARCI  204

Query  713   NFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             +FR RIYN+SNIDSSF+++R+G CPR +GSGDNNL+PLDLQ+P  FDN Y+ NL++ KGL
Sbjct  205   SFRPRIYNDSNIDSSFSKTRQGKCPRTAGSGDNNLSPLDLQSPTAFDNAYFKNLLSNKGL  264

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQ+LFNG +TDS V+ YS NP  F+SDFA+AMIKMGDIKPLTG+ GE
Sbjct  265   LHSDQELFNGGTTDSLVKTYSNNPKTFNSDFASAMIKMGDIKPLTGSKGE  314



>ref|XP_009122142.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase P7 [Brassica rapa]
Length=325

 Score =   443 bits (1139),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 210/288 (73%), Positives = 244/288 (85%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQL+  FYS SCP L  TV S V+SA+  + R GAS+LRLFFHDCFVNGCDGSILLDDTS
Sbjct  29    AQLTTNFYSTSCPNLLSTVRSTVKSAVDSQPRTGASILRLFFHDCFVNGCDGSILLDDTS  88

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGE+ A PN  SARGF VID IK+AVE  CPGVVSCADILAIA+RDS V LGGP+WNV
Sbjct  89    SFTGEQNANPNRNSARGFNVIDNIKTAVEAACPGVVSCADILAIAARDSVVLLGGPNWNV  148

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             K+GRRDARTASQAAANN+IP PTS+L++LISSFSAVGLST DMV LSG+HTIGQ+RCTNF
Sbjct  149   KVGRRDARTASQAAANNNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNF  208

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R R+YNE+NI+++FA  R+ +CPRA+GSGD NLAPLD+ +   FDN+Y+ NLV ++GLLH
Sbjct  209   RTRVYNETNINAAFATLRQRSCPRAAGSGDGNLAPLDVNSANTFDNSYFKNLVAQRGLLH  268

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ+LFNG  TDS V GYS NP+ FSSDF AAMIKMGDI PLTG++GE
Sbjct  269   SDQELFNGGXTDSIVTGYSNNPSSFSSDFTAAMIKMGDISPLTGSSGE  316



>ref|XP_003602462.1| Peroxidase [Medicago truncatula]
 gb|AES72713.1| class III peroxidase [Medicago truncatula]
Length=322

 Score =   442 bits (1138),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 215/288 (75%), Positives = 235/288 (82%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  FYSK+CPKL   V   V+SAI KEAR+GAS+LRLFFHDCFVNGCDGSILLDDTS
Sbjct  26    AQLSTNFYSKTCPKLSSIVQRQVQSAISKEARIGASILRLFFHDCFVNGCDGSILLDDTS  85

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             +FTGEK A PN  S RGF+VID IK+AVE VCPGVVSCADILAIA+ DS   LGGP+WNV
Sbjct  86    NFTGEKNALPNKNSVRGFDVIDNIKTAVENVCPGVVSCADILAIAATDSVAILGGPTWNV  145

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             KLGRRDA TASQ+ AN +IP PTSNLN L S F  VGLST D+V LSG+HTIGQARCT F
Sbjct  146   KLGRRDATTASQSDANTAIPRPTSNLNILTSMFKNVGLSTKDLVALSGAHTIGQARCTTF  205

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R RIYNE+NID+SFA +R+ NCP+ SGSGDNNLAPLDL TP  FDN YY NLV  KGLLH
Sbjct  206   RVRIYNETNIDTSFASTRQSNCPKTSGSGDNNLAPLDLHTPTSFDNCYYRNLVQNKGLLH  265

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQQLFNG ST+S V GY  N   F SDFA AMIKMGDIKPLTG+NGE
Sbjct  266   SDQQLFNGGSTNSIVSGYFNNQNSFFSDFATAMIKMGDIKPLTGSNGE  313



>ref|XP_007219210.1| hypothetical protein PRUPE_ppa017309mg, partial [Prunus persica]
 gb|EMJ20409.1| hypothetical protein PRUPE_ppa017309mg, partial [Prunus persica]
Length=291

 Score =   441 bits (1134),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 211/269 (78%), Positives = 233/269 (87%), Gaps = 0/269 (0%)
 Frame = +2

Query  179  AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
            AQLS  FYS SCP++F TV S V+SAI+KEAR+GASLLRL FHDCFVNGCDGS+LLDDTS
Sbjct  23   AQLSTNFYSSSCPRVFSTVRSTVQSAIRKEARIGASLLRLHFHDCFVNGCDGSLLLDDTS  82

Query  359  SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
            SFTGEK A PN  SARGF+V+D IKSAVE VCPGVVSCADILAIASRDS   LGGPSWNV
Sbjct  83   SFTGEKNAVPNRNSARGFDVVDNIKSAVENVCPGVVSCADILAIASRDSVAILGGPSWNV  142

Query  539  KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
            K+GRRDARTASQAAANN IPPPTSNLN+LIS F+A+GLST D+V LSGSHTIGQ+RC  F
Sbjct  143  KVGRRDARTASQAAANNGIPPPTSNLNQLISRFNALGLSTRDLVALSGSHTIGQSRCIQF  202

Query  719  RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
            R RIYNE+N+DSSFAQ+R+ NCPRA+GSGDNNLAPLDLQTP  FDNNY+ NL+  KGLLH
Sbjct  203  RPRIYNETNLDSSFAQTRRSNCPRAAGSGDNNLAPLDLQTPTAFDNNYFKNLIQNKGLLH  262

Query  899  SDQQLFNGVSTDSTVRGYSTNPTKFSSDF  985
            SDQQLFNG STDS VR YS +   FSSDF
Sbjct  263  SDQQLFNGGSTDSIVRTYSNSYNTFSSDF  291



>ref|XP_009125598.1| PREDICTED: peroxidase P7 [Brassica rapa]
Length=324

 Score =   442 bits (1137),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 209/288 (73%), Positives = 247/288 (86%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQL+  FYS SCP L  TV S V+SA+  + RMGAS+LRLFFHDCFVNGCDGSILLDDTS
Sbjct  28    AQLTTNFYSTSCPNLLSTVKSGVKSAVSSQPRMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGE+ A PN  SARGF VID IKSAVEK CPGVVSCADILAIA+RDS V LGGP+WNV
Sbjct  88    SFTGEQNAGPNRNSARGFTVIDTIKSAVEKACPGVVSCADILAIAARDSVVQLGGPNWNV  147

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             K+GRRDA+TASQAAAN++IP P+ +L++LISSFSAVGLST DMV LSG+HTIGQ+RC NF
Sbjct  148   KVGRRDAKTASQAAANSNIPAPSMSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCVNF  207

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             RAR+YNE+NI+++FA  R+ +CPRA+GSGD NLAPLD+ +   FDN+Y+ NL+ ++GLLH
Sbjct  208   RARVYNETNINAAFATLRQRSCPRAAGSGDANLAPLDINSATSFDNSYFKNLMAQRGLLH  267

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ LFNG STDS VRGYS +P+ F+SDFAAAMIKMGDI PLTG++GE
Sbjct  268   SDQVLFNGGSTDSIVRGYSNSPSSFNSDFAAAMIKMGDISPLTGSSGE  315



>gb|ABV24960.2| putative secretory peroxidase [Catharanthus roseus]
Length=330

 Score =   442 bits (1137),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 212/289 (73%), Positives = 240/289 (83%), Gaps = 0/289 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             S QLS  FYSK+CP+++ TV   V SA+ KE RMGASLLRL FHDCFV GCDGSILLDDT
Sbjct  33    SGQLSSEFYSKTCPQVYNTVRKGVESAVSKEKRMGASLLRLHFHDCFVQGCDGSILLDDT  92

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SS  GEK A PN  S RGF+V+D IKS VEKVCPGVVSCADILAIA+RDS V LGGPSW 
Sbjct  93    SSLRGEKTAGPNVGSVRGFDVVDNIKSDVEKVCPGVVSCADILAIAARDSVVALGGPSWK  152

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VK+GRRD++TAS + AN+ IPPPTSNL  LISSF AVGLS  DMVVLSGSHTIGQARCT 
Sbjct  153   VKVGRRDSKTASLSGANSRIPPPTSNLRNLISSFQAVGLSAKDMVVLSGSHTIGQARCTV  212

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FRARIYNESNI++SFA++R+GNCP  +G+GDN+LAPLDLQ+P  FD NYY NL+NKKGLL
Sbjct  213   FRARIYNESNIETSFARTRQGNCPLPTGNGDNSLAPLDLQSPNGFDINYYKNLINKKGLL  272

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQ+L+NG ST+S V  YS +   F SDFAAAMIKMGDI PLTG+NGE
Sbjct  273   HSDQELYNGGSTNSLVEAYSKDTKAFYSDFAAAMIKMGDISPLTGSNGE  321



>gb|EPS59568.1| hypothetical protein M569_15235, partial [Genlisea aurea]
Length=314

 Score =   441 bits (1135),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 214/289 (74%), Positives = 238/289 (82%), Gaps = 0/289 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  +Y  SCP LF TV SVV SA+Q EAR+GASLLRLFFHDCFVNGCDGS+LLDDT
Sbjct  17    SAQLSVDYYCDSCPDLFATVRSVVESAVQAEARIGASLLRLFFHDCFVNGCDGSVLLDDT  76

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
              SF GEK A PN  SARGF+V+D+IKSAVE VCPGVVSCADILA+ASRDS   LGGPSW+
Sbjct  77    PSFRGEKGALPNLNSARGFDVVDRIKSAVENVCPGVVSCADILAVASRDSVGILGGPSWD  136

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRDARTAS  AAN SIPPPTSNLN LISSFS+ GLS ND+VVLSGSHTIGQARCT+
Sbjct  137   VKLGRRDARTASITAANTSIPPPTSNLNALISSFSSKGLSLNDLVVLSGSHTIGQARCTS  196

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR RIYNE+NI   FAQ R+  CPR +G GD NLAPLDLQTP +FDNNYY NL++KKGLL
Sbjct  197   FRTRIYNETNIAQDFAQLRRNGCPRPAGVGDGNLAPLDLQTPTRFDNNYYKNLLSKKGLL  256

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQ+LFNG + D  V+ Y  +   F  DFAAA+IKMGDI PLTG+ GE
Sbjct  257   HSDQELFNGGAADWIVKKYLDDKDGFFRDFAAALIKMGDISPLTGSAGE  305



>emb|CDY04948.1| BnaAnng01300D [Brassica napus]
Length=324

 Score =   442 bits (1136),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 209/288 (73%), Positives = 247/288 (86%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQL+  FYS SCP L  TV S V+SA+  + RMGAS+LRLFFHDCFVNGCDGSILLDDTS
Sbjct  28    AQLTTNFYSTSCPNLLSTVKSGVKSAVSSQPRMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGE+ A PN  SARGF VID IKSAVEK CPGVVSCADILAIA+RDS V LGGP+WNV
Sbjct  88    SFTGEQNAGPNRNSARGFTVIDTIKSAVEKACPGVVSCADILAIAARDSVVQLGGPNWNV  147

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             K+GRRDA+TASQAAAN++IP P+ +L++LISSFSAVGLST DMV LSG+HTIGQ+RC NF
Sbjct  148   KVGRRDAKTASQAAANSNIPAPSMSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCVNF  207

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             RAR+YNE+NI+++FA  R+ +CPRA+GSGD NLAPLD+ +   FDN+Y+ NL+ ++GLLH
Sbjct  208   RARVYNETNINAAFATLRQRSCPRAAGSGDANLAPLDINSATSFDNSYFKNLMAQRGLLH  267

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ LFNG STDS VRGYS +P+ F+SDFAAAMIKMGDI PLTG++GE
Sbjct  268   SDQVLFNGGSTDSIVRGYSNSPSSFNSDFAAAMIKMGDISPLTGSSGE  315



>ref|XP_006288218.1| hypothetical protein CARUB_v10001455mg [Capsella rubella]
 gb|EOA21116.1| hypothetical protein CARUB_v10001455mg [Capsella rubella]
Length=324

 Score =   441 bits (1135),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 216/288 (75%), Positives = 249/288 (86%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQL+  FY+ SCP L  TV + V+SA+  E RMGAS+LRLFFHDCFVNGCDGSILLDDTS
Sbjct  28    AQLTTNFYATSCPNLLSTVQAAVKSAVNSERRMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGE+ A PN  SARGF VID IKSAVEK CPGVVSCADILAIA+RDS V LGGP+WNV
Sbjct  88    SFTGEQNANPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVVLGGPNWNV  147

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             K+GRRDARTASQAAAN++IP PTS+L++LISSFSAVGLST DMV LSG+HTIGQ+RCT+F
Sbjct  148   KVGRRDARTASQAAANSNIPGPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTSF  207

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             RARIYNE+NI+++FA +R+  CPRA+GSGD NLAPLD+ T   FDNNY+ NLV ++GLLH
Sbjct  208   RARIYNETNINAAFATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFKNLVAQRGLLH  267

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ LFNG STDS VRGYS+NP+ FSSDF AAMIKMGDI PLTG++GE
Sbjct  268   SDQVLFNGGSTDSIVRGYSSNPSSFSSDFTAAMIKMGDISPLTGSSGE  315



>emb|CDX98835.1| BnaC09g50000D [Brassica napus]
Length=325

 Score =   441 bits (1133),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 210/288 (73%), Positives = 244/288 (85%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQL+  FYS SCP L  TV S V+SA+  + R GAS+LRLFFHDCFVNGCDGSILLDDTS
Sbjct  29    AQLTTNFYSTSCPNLLSTVRSTVKSAVDSQPRTGASILRLFFHDCFVNGCDGSILLDDTS  88

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGE+ A PN  SARGF VID IK+AVE  CPGVVSCADILAIA+RDS V LGGP+WNV
Sbjct  89    SFTGEQNANPNRNSARGFNVIDNIKTAVEAACPGVVSCADILAIAARDSVVLLGGPNWNV  148

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             K+GRRDARTASQAAAN++IP PTS+L++LISSFSAVGLST DMV LSG+HTIGQ+RCTNF
Sbjct  149   KVGRRDARTASQAAANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNF  208

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R R+YNE+NI+++FA  R+ +CPRA+GSGD NLAPLD+ +   FDN+Y+ NLV ++GLLH
Sbjct  209   RTRVYNETNINAAFATLRQRSCPRAAGSGDGNLAPLDVNSANFFDNSYFKNLVAQRGLLH  268

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ+LFNG STDS V GYS NP  FSSDF AAMIKMGDI PLTG++GE
Sbjct  269   SDQELFNGGSTDSIVTGYSNNPASFSSDFTAAMIKMGDISPLTGSSGE  316



>ref|XP_003602461.1| Peroxidase [Medicago truncatula]
 gb|AES72712.1| horseradish peroxidase-like protein [Medicago truncatula]
Length=322

 Score =   440 bits (1132),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 225/288 (78%), Positives = 253/288 (88%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  FYSK+CPKL  TV S +++AI KEARMGAS+LRLFFHDCFVNGCDGSILLDDTS
Sbjct  26    AQLSTNFYSKTCPKLSTTVKSTLQTAISKEARMGASILRLFFHDCFVNGCDGSILLDDTS  85

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGEK A PN  SARGF+VID IK+AVE VCPGVVSCADILAIA+ DS   LGGP+WNV
Sbjct  86    SFTGEKNANPNRNSARGFDVIDNIKTAVENVCPGVVSCADILAIAAADSVAILGGPTWNV  145

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             KLGRRDA+TASQ+AAN +IP PTSNLN L S FSAVGLS+ D+V LSG+HTIGQARCTNF
Sbjct  146   KLGRRDAKTASQSAANTAIPAPTSNLNTLTSMFSAVGLSSKDLVTLSGAHTIGQARCTNF  205

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             RARIYNE+NI+++FA +R+ NCP+ASGSGDNNLAPLDLQTP  FDNNY+ NLV  KGLLH
Sbjct  206   RARIYNETNINAAFASTRQSNCPKASGSGDNNLAPLDLQTPSSFDNNYFKNLVQNKGLLH  265

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQQLFNG ST+S V GYST+P+ FSSDFAAAMIKMG+IKPLTG+NGE
Sbjct  266   SDQQLFNGGSTNSIVSGYSTSPSSFSSDFAAAMIKMGNIKPLTGSNGE  313



>ref|XP_008384729.1| PREDICTED: peroxidase 4-like isoform X1 [Malus domestica]
Length=327

 Score =   441 bits (1133),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 211/290 (73%), Positives = 240/290 (83%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FYSKSCPK+F TV SVV+SA+ KE RMGASLLRL FHDCFVNGCDGS+LLDDT
Sbjct  29    SAQLSTNFYSKSCPKVFDTVKSVVKSAVSKEKRMGASLLRLHFHDCFVNGCDGSLLLDDT  88

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGEK A PN  S RGFEV+D+IKS VEK CPGVVSCADILAIASRDS   LGGPSW 
Sbjct  89    SSFTGEKTAGPNNNSVRGFEVVDKIKSQVEKACPGVVSCADILAIASRDSVQILGGPSWE  148

Query  536   VKLGRRDARTASQAAANNS-IPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  712
             VKLGRRD++TAS +AAN+  IPPPT+ LN L++ F AVGLS  D+V LSG+HTIGQARCT
Sbjct  149   VKLGRRDSKTASLSAANSGVIPPPTATLNELVTRFRAVGLSQRDLVALSGAHTIGQARCT  208

Query  713   NFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
              FRAR+YNE+NID+SFA++R+  CPR  GSGDNNLAPLD+ TP  FD  Y+ NLVN+KGL
Sbjct  209   TFRARVYNETNIDASFARTRQNTCPRTVGSGDNNLAPLDVTTPNTFDTAYFKNLVNRKGL  268

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQ LFNG +TDS V+ YS N   F++DFA AMIKMGD KPLTG+ GE
Sbjct  269   LHSDQILFNGGATDSLVKSYSGNAETFNADFAKAMIKMGDNKPLTGSKGE  318



>ref|XP_006843746.1| hypothetical protein AMTR_s00007p00230210 [Amborella trichopoda]
 gb|ERN05421.1| hypothetical protein AMTR_s00007p00230210 [Amborella trichopoda]
Length=318

 Score =   440 bits (1131),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 207/288 (72%), Positives = 236/288 (82%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQL+P +Y+ SCPK   T+ S V+SAI  + R+GA LLRLFFHDCFVNGCDGS+LLDDTS
Sbjct  22    AQLTPHYYAYSCPKALPTIRSAVKSAISNDKRVGAQLLRLFFHDCFVNGCDGSLLLDDTS  81

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             +F GEK A PN  SARGF ++D IKSAVEK CPGVVSCAD LA+A+RDS V LGGP W V
Sbjct  82    TFIGEKNAQPNRNSARGFNIVDNIKSAVEKACPGVVSCADTLAVAARDSVVLLGGPDWQV  141

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             KLGRRDARTASQAAANNSIPPPT NLN+LI+SF+  GLS  DMV LSG HT+G ARC N 
Sbjct  142   KLGRRDARTASQAAANNSIPPPTFNLNQLINSFANQGLSQKDMVALSGGHTLGVARCINI  201

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R RIYNE+NID SFA++R+ NCPR +GSGDNN+ PL+LQTP  FDN Y+ NL+NKKGLLH
Sbjct  202   RDRIYNETNIDPSFAKTRQSNCPRTAGSGDNNVNPLELQTPTAFDNKYFKNLINKKGLLH  261

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQQLFNG S DS VR YS+N   F+ DF AAMIKMGDIKPLTG+NGE
Sbjct  262   SDQQLFNGGSADSLVRSYSSNSDLFNKDFVAAMIKMGDIKPLTGSNGE  309



>gb|KHG17773.1| Peroxidase 52 -like protein [Gossypium arboreum]
Length=325

 Score =   440 bits (1131),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 215/290 (74%), Positives = 241/290 (83%), Gaps = 2/290 (1%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDD-T  355
             A+LS  FYSKSCP L  TV  +V SAI KEARMGASLLRLFFHDCFVNGCDGSILLDD  
Sbjct  27    AKLSTNFYSKSCPNLLPTVKFIVHSAIMKEARMGASLLRLFFHDCFVNGCDGSILLDDDI  86

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSF GEK AAPN  SARGF V+D IKSAVE VCPG+VSCADILAI++RDS   LGGP W+
Sbjct  87    SSFIGEKNAAPNRNSARGFNVVDDIKSAVEIVCPGLVSCADILAISARDSVTILGGPYWD  146

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRDARTASQAAANN+IP P+SNLN+LIS F+A GL+  D+V LSG HTIGQARCT 
Sbjct  147   VKLGRRDARTASQAAANNNIPSPSSNLNQLISGFNAHGLAPRDLVALSGGHTIGQARCTT  206

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FRAR+YNESNID SFA++R+ NCPR +GSGDNNLAPLD+ TP  FDN+Y+ NL++++GL 
Sbjct  207   FRARVYNESNIDPSFARTRQRNCPRETGSGDNNLAPLDIHTPTYFDNSYFKNLIDRRGLF  266

Query  896   HSDQQLFNGVS-TDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQLF G   TDS VRGYS NP  F SDFAAAMIKMGDI PLTG+ GE
Sbjct  267   HSDQQLFTGGGFTDSIVRGYSNNPRSFRSDFAAAMIKMGDISPLTGSMGE  316



>emb|CDY14118.1| BnaC02g02350D [Brassica napus]
Length=324

 Score =   440 bits (1131),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 208/288 (72%), Positives = 246/288 (85%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQL+  FYS SCP L  TV S V+SA+  + RMGAS+LRLFFHDCFVNGCDGSILLDDTS
Sbjct  28    AQLTTNFYSTSCPNLLSTVKSGVKSAVSSQPRMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGE+ A PN  SARGF VID IKSAVEK CPGVVSCADILAIA+RDS V LGGP+WNV
Sbjct  88    SFTGEQNAGPNRNSARGFTVIDNIKSAVEKACPGVVSCADILAIAARDSVVQLGGPNWNV  147

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             K+GRRDA+TASQAAAN++IP P  +L++LISSFSAVGLST DMV LSG+HTIGQ+RC NF
Sbjct  148   KVGRRDAKTASQAAANSNIPAPNMSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCVNF  207

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             RAR+YNE+NI+++FA  R+ +CPRA+GSGD NLAPLD+ +   FDN+Y+ NL+ ++GLLH
Sbjct  208   RARVYNETNINAAFATLRQRSCPRAAGSGDANLAPLDINSATSFDNSYFKNLMAQRGLLH  267

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ LFNG STDS VRGYS +P+ F+SDFA+AMIKMGDI PLTG++GE
Sbjct  268   SDQVLFNGGSTDSIVRGYSNSPSSFNSDFASAMIKMGDISPLTGSSGE  315



>ref|XP_008384730.1| PREDICTED: peroxidase 4-like isoform X2 [Malus domestica]
Length=323

 Score =   439 bits (1130),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 211/290 (73%), Positives = 240/290 (83%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FYSKSCPK+F TV SVV+SA+ KE RMGASLLRL FHDCFVNGCDGS+LLDDT
Sbjct  25    SAQLSTNFYSKSCPKVFDTVKSVVKSAVSKEKRMGASLLRLHFHDCFVNGCDGSLLLDDT  84

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGEK A PN  S RGFEV+D+IKS VEK CPGVVSCADILAIASRDS   LGGPSW 
Sbjct  85    SSFTGEKTAGPNNNSVRGFEVVDKIKSQVEKACPGVVSCADILAIASRDSVQILGGPSWE  144

Query  536   VKLGRRDARTASQAAANNS-IPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  712
             VKLGRRD++TAS +AAN+  IPPPT+ LN L++ F AVGLS  D+V LSG+HTIGQARCT
Sbjct  145   VKLGRRDSKTASLSAANSGVIPPPTATLNELVTRFRAVGLSQRDLVALSGAHTIGQARCT  204

Query  713   NFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
              FRAR+YNE+NID+SFA++R+  CPR  GSGDNNLAPLD+ TP  FD  Y+ NLVN+KGL
Sbjct  205   TFRARVYNETNIDASFARTRQNTCPRTVGSGDNNLAPLDVTTPNTFDTAYFKNLVNRKGL  264

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQ LFNG +TDS V+ YS N   F++DFA AMIKMGD KPLTG+ GE
Sbjct  265   LHSDQILFNGGATDSLVKSYSGNAETFNADFAKAMIKMGDNKPLTGSKGE  314



>sp|P00434.3|PERP7_BRARR RecName: Full=Peroxidase P7; AltName: Full=TP7 [Brassica rapa 
subsp. rapa]
Length=296

 Score =   438 bits (1126),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 207/287 (72%), Positives = 246/287 (86%), Gaps = 0/287 (0%)
 Frame = +2

Query  182   QLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTSS  361
             QL+  FYS SCP L  TV S V+SA+  + RMGAS+LRLFFHDCFVNGCDGSILLDDTSS
Sbjct  1     QLTTNFYSTSCPNLLSTVKSGVKSAVSSQPRMGASILRLFFHDCFVNGCDGSILLDDTSS  60

Query  362   FTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVK  541
             FTGE+ A PN  SARGF VI+ IKSAVEK CPGVVSCADILAIA+RDS V LGGP+WNVK
Sbjct  61    FTGEQNAGPNRNSARGFTVINDIKSAVEKACPGVVSCADILAIAARDSVVQLGGPNWNVK  120

Query  542   LGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFR  721
             +GRRDA+TASQAAAN++IP P+ +L++LISSFSAVGLST DMV LSG+HTIGQ+RC NFR
Sbjct  121   VGRRDAKTASQAAANSNIPAPSMSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCVNFR  180

Query  722   ARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHS  901
             AR+YNE+NI+++FA  R+ +CPRA+GSGD NLAPLD+ +   FDN+Y+ NL+ ++GLLHS
Sbjct  181   ARVYNETNINAAFATLRQRSCPRAAGSGDANLAPLDINSATSFDNSYFKNLMAQRGLLHS  240

Query  902   DQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             DQ LFNG STDS VRGYS +P+ F+SDFAAAMIKMGDI PLTG++GE
Sbjct  241   DQVLFNGGSTDSIVRGYSNSPSSFNSDFAAAMIKMGDISPLTGSSGE  287



>ref|XP_009410536.1| PREDICTED: peroxidase 4 {ECO:0000250|UniProtKB:Q42578}-like [Musa 
acuminata subsp. malaccensis]
Length=321

 Score =   439 bits (1128),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 208/282 (74%), Positives = 237/282 (84%), Gaps = 0/282 (0%)
 Frame = +2

Query  197   FYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTSSFTGEK  376
             +YS SCP LF TV+ VV+SAI KE RMGASLLRLFFHDCFVNGCDGSILLDDTS FTGEK
Sbjct  31    YYSSSCPDLFSTVSGVVQSAISKEKRMGASLLRLFFHDCFVNGCDGSILLDDTSGFTGEK  90

Query  377   RAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVKLGRRD  556
              A PN  S RGF+V+D IK+AVEKVCPGVVSCADILAIA+RDS  TLGG SWNVKLGRRD
Sbjct  91    TANPNQNSVRGFDVVDDIKTAVEKVCPGVVSCADILAIAARDSVATLGGRSWNVKLGRRD  150

Query  557   ARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFRARIYN  736
             + TAS +AANN+IPPP+S+L+ LIS FS  GLST D+V LSG+HTIGQARC +FRA IY 
Sbjct  151   STTASLSAANNNIPPPSSSLSNLISKFSDQGLSTKDLVALSGAHTIGQARCISFRAHIYT  210

Query  737   ESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHSDQQLF  916
             ++NIDS FA +R+ NCP  +GSGDNNLAPLDLQTP  FDNNYY NL++ KGLLHSDQ+L+
Sbjct  211   DTNIDSGFANTRQSNCPSTAGSGDNNLAPLDLQTPTTFDNNYYKNLISTKGLLHSDQELY  270

Query  917   NGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             NG STDS V+ YS +   F SDFAAAMIKMGDI PLTG++GE
Sbjct  271   NGGSTDSQVKAYSNSSGSFYSDFAAAMIKMGDISPLTGSSGE  312



>ref|XP_009369543.1| PREDICTED: peroxidase 4-like [Pyrus x bretschneideri]
Length=327

 Score =   439 bits (1129),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 212/290 (73%), Positives = 240/290 (83%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FYSKSCPK+F TV SVV+SA+ KE RMGASLLRL FHDCFVNGCDGS+LLDDT
Sbjct  29    SAQLSTNFYSKSCPKVFDTVKSVVKSAVSKEKRMGASLLRLHFHDCFVNGCDGSLLLDDT  88

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGEK A PN  SARGFEV+D+IKS VEK CPGVVSCADILAIASRDS   LGGPSW 
Sbjct  89    SSFTGEKTAGPNNNSARGFEVVDKIKSQVEKACPGVVSCADILAIASRDSVQILGGPSWE  148

Query  536   VKLGRRDARTASQAAANNS-IPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  712
             VKLGRRD++TAS +AAN+  IPPPT+ LN L++ F AVGLS  D+V LSG+HTIGQARCT
Sbjct  149   VKLGRRDSKTASLSAANSGVIPPPTATLNELVTRFRAVGLSQRDLVALSGAHTIGQARCT  208

Query  713   NFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
              FRARIYNE+NID+SFA++R+  CPR  GSGDNNLAPLD+ TP  FD  Y+ NLVN+KGL
Sbjct  209   TFRARIYNETNIDASFARTRQNTCPRTVGSGDNNLAPLDVTTPNTFDTAYFKNLVNQKGL  268

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQ LFN  +T+S V+ YS N   F+SDFA AMIKMGD KPLTG+ GE
Sbjct  269   LHSDQILFNSGATNSLVKSYSGNAETFNSDFAKAMIKMGDNKPLTGSKGE  318



>ref|XP_004138400.1| PREDICTED: peroxidase 52-like [Cucumis sativus]
 ref|XP_004160737.1| PREDICTED: peroxidase 52-like [Cucumis sativus]
Length=322

 Score =   438 bits (1127),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 215/290 (74%), Positives = 240/290 (83%), Gaps = 2/290 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             S QLS GFYS SCP L  TV S VRSA+  EARMGAS+LRLFFHDCFVNGCDGSILLDDT
Sbjct  25    SGQLSTGFYSSSCPNLLSTVKSSVRSAVSSEARMGASILRLFFHDCFVNGCDGSILLDDT  84

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGEK A PN  SARGF+VID IK+AVEK CPGVVSCADILAIA+RDS V LGGPSWN
Sbjct  85    SSFTGEKNANPNRNSARGFDVIDNIKTAVEKACPGVVSCADILAIAARDSVVLLGGPSWN  144

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRD+ TASQ+ ANN IP PTS+L++L S FSA+GLS+ D+V LSG HTIGQARCT 
Sbjct  145   VKLGRRDSTTASQSQANNDIPGPTSSLSQLSSRFSALGLSSTDLVALSGGHTIGQARCTT  204

Query  716   FRARIY-NESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             FR+RIY N SNI+SSFA++R+ NCP  SG+GDNNLAPLD  TP  FDNNYY NLV  KGL
Sbjct  205   FRSRIYSNSSNIESSFARTRQSNCPNTSGTGDNNLAPLDF-TPTSFDNNYYKNLVQNKGL  263

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             L SDQ LFNG STDS V+ Y+  P +F SDFAAAM+KMGDI PLTG+NG+
Sbjct  264   LQSDQVLFNGGSTDSVVQNYANAPARFLSDFAAAMVKMGDIAPLTGSNGQ  313



>ref|XP_010067586.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=322

 Score =   438 bits (1126),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 208/288 (72%), Positives = 238/288 (83%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  FY+K+CPKLF TV  +VR+AI  E RMGASLLRLFFHDCFVNGCDGS LLDDT 
Sbjct  26    AQLSTDFYAKTCPKLFPTVKKIVRAAIANETRMGASLLRLFFHDCFVNGCDGSNLLDDTP  85

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             +FTGEK A PN  S RGF+V+D+IKSAVEKVCP +VSCAD+LAI +RDS   LGGP W+V
Sbjct  86    TFTGEKNAMPNQNSLRGFDVVDRIKSAVEKVCPSIVSCADLLAIIARDSVGILGGPMWDV  145

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             KLGRRDARTASQAAANNSIPPPT+NL+ LISSF   GLS  D+V L G HTIGQARCTNF
Sbjct  146   KLGRRDARTASQAAANNSIPPPTNNLSALISSFQNQGLSLKDLVALYGGHTIGQARCTNF  205

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             RARIYNESN+DSSFA+  K NCPR +G GDNNLA LD Q+   FDN+YY+NL+ K+GLLH
Sbjct  206   RARIYNESNLDSSFARVAKSNCPRVTGVGDNNLAGLDFQSATSFDNSYYINLIKKRGLLH  265

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQQLFNG STDS +R Y+ + + F  DF A++IKMGDIKPLTG+NGE
Sbjct  266   SDQQLFNGGSTDSFIRTYAKSQSTFFKDFVASIIKMGDIKPLTGSNGE  313



>ref|XP_010922691.1| PREDICTED: peroxidase 4-like [Elaeis guineensis]
Length=320

 Score =   437 bits (1125),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 208/289 (72%), Positives = 239/289 (83%), Gaps = 0/289 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FY+ SCP++F  V  VV++AI KE RMGASLLRLFFHDCFV GCDGSILLDDT
Sbjct  23    SAQLSTNFYASSCPQVFSAVKPVVQAAIAKEQRMGASLLRLFFHDCFVQGCDGSILLDDT  82

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
              +F GEK A PN  S RGF+V+D IK+AVEKVCPGVVSCADILAI SRDS V LGGP+W+
Sbjct  83    PTFMGEKTAVPNNNSVRGFDVVDNIKAAVEKVCPGVVSCADILAITSRDSVVILGGPNWD  142

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRD+ TAS + ANN+IPPP S+L+ LIS F+A GLST DMV LSG HTIGQARC N
Sbjct  143   VKLGRRDSTTASFSGANNNIPPPNSSLSNLISKFAAQGLSTKDMVALSGGHTIGQARCLN  202

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FRA IYN+++IDSSFA++R+ NCP  SGSGDNNLAPLDLQTP  FDN+YY NL+NKKGLL
Sbjct  203   FRAHIYNDTDIDSSFAKTRQMNCPSTSGSGDNNLAPLDLQTPTCFDNDYYKNLINKKGLL  262

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQ+LFNG STDS V  YS NP+ F+SDF   MI MGDI PLTG++G+
Sbjct  263   HSDQELFNGGSTDSQVMTYSNNPSTFNSDFVTGMINMGDITPLTGSSGQ  311



>gb|ABO77632.1| peroxidase [Medicago truncatula]
Length=322

 Score =   437 bits (1124),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 224/288 (78%), Positives = 252/288 (88%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  FYSK+CPKL  TV S +++AI KEARMGAS+LRLFFHDCFVNGCDGSILLDDTS
Sbjct  26    AQLSTNFYSKTCPKLSTTVKSTLQTAISKEARMGASILRLFFHDCFVNGCDGSILLDDTS  85

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGEK A PN  SARGF+VID IK+AVE VCPGVVSCADILAIA+ DS   LGGP+WNV
Sbjct  86    SFTGEKNANPNRNSARGFDVIDNIKTAVENVCPGVVSCADILAIAAADSVAILGGPTWNV  145

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             KLGRRDA+TASQ+AAN +IP PTSNLN L S FSAVGLS+ D+V LSG+HTIGQARCTNF
Sbjct  146   KLGRRDAKTASQSAANTAIPAPTSNLNTLTSMFSAVGLSSKDLVTLSGAHTIGQARCTNF  205

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             RARIYNE+NI+++ A +R+ NCP+ASGSGDNNLAPLDLQTP  FDNNY+ NLV  KGLLH
Sbjct  206   RARIYNETNINAAXASTRQSNCPKASGSGDNNLAPLDLQTPSSFDNNYFKNLVQNKGLLH  265

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQQLFNG ST+S V GYST+P+ FSSDFAAAMIKMG+IKPLTG+NGE
Sbjct  266   SDQQLFNGGSTNSIVSGYSTSPSSFSSDFAAAMIKMGNIKPLTGSNGE  313



>ref|XP_008456761.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase P7 [Cucumis melo]
Length=323

 Score =   437 bits (1123),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 215/290 (74%), Positives = 238/290 (82%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS GFYS SCP L  TV S VRSA+  EARMGAS+LRL FHDCFVNGCDGSILLDDT
Sbjct  25    SAQLSTGFYSSSCPNLLSTVKSSVRSAVSSEARMGASILRLXFHDCFVNGCDGSILLDDT  84

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGEK A PN  SARGF+VID IK+AVE  CPGVVSCADILAIA+RDS V LGGPSWN
Sbjct  85    SSFTGEKSANPNRNSARGFDVIDNIKTAVENACPGVVSCADILAIAARDSVVFLGGPSWN  144

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRD+ TASQ+ ANN IP P S+L++L S FSA+GLS  D+V LSG HTIGQARCT 
Sbjct  145   VKLGRRDSTTASQSQANNDIPGPNSSLSQLSSRFSALGLSNTDLVALSGGHTIGQARCTT  204

Query  716   FRARIY-NESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             FR+RIY N SNI+S FA++R+ NCP  SGSGDNNLAPLDLQTP  FDNNY+ NLV  KGL
Sbjct  205   FRSRIYSNSSNIESLFARTRQSNCPNTSGSGDNNLAPLDLQTPNSFDNNYFKNLVQNKGL  264

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             L SDQ LFNG STDS VR Y+  P +F SDFAAAM+KMGDI PLTG+NG+
Sbjct  265   LQSDQVLFNGGSTDSVVRNYANAPARFLSDFAAAMVKMGDIAPLTGSNGQ  314



>ref|XP_002319968.2| peroxidase family protein [Populus trichocarpa]
 gb|EEE95891.2| peroxidase family protein [Populus trichocarpa]
 gb|AHL39178.1| class III peroxidase [Populus trichocarpa]
Length=325

 Score =   436 bits (1121),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 211/290 (73%), Positives = 240/290 (83%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FYSKSCPK+F  V SVV+SA+ KE RMGASL+RLFFHDCFV GCDGSILL+DT
Sbjct  27    SAQLSTNFYSKSCPKVFGAVKSVVQSAVSKERRMGASLVRLFFHDCFVRGCDGSILLEDT  86

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGE+ A PN  S RGF V+ +IKS VEKVCPG+VSCADI+AIA+RDSTV LGGP WN
Sbjct  87    SSFTGEQTAGPNNNSVRGFNVVAKIKSQVEKVCPGIVSCADIVAIAARDSTVILGGPFWN  146

Query  536   VKLGRRDARTASQAAANNS-IPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  712
             VKLGRRD++TAS +AAN+  IPPPTS L+ LI+ F++ GLS  DMV LSGSHTIGQARCT
Sbjct  147   VKLGRRDSKTASLSAANSGVIPPPTSTLSNLINRFNSKGLSVKDMVALSGSHTIGQARCT  206

Query  713   NFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             +FRARIYNE+NIDSSFA +R+ NCP     GDN LAPLD+QTP  FDN YY NL+++KGL
Sbjct  207   SFRARIYNETNIDSSFATTRQKNCPFPGPKGDNKLAPLDVQTPTSFDNKYYKNLISQKGL  266

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQ LFNG STDS VR YS+NP  FSSDF  AMIKMGDI PLTG+ GE
Sbjct  267   LHSDQVLFNGGSTDSLVRTYSSNPKTFSSDFVTAMIKMGDIDPLTGSQGE  316



>ref|XP_010045399.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=323

 Score =   436 bits (1121),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 212/290 (73%), Positives = 240/290 (83%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FYSKSCP +  TV SVVRSA+ KE RMGASLLRLFFHDCFVNGCDGSILLDDT
Sbjct  25    SAQLSTNFYSKSCPNVLSTVKSVVRSAVSKERRMGASLLRLFFHDCFVNGCDGSILLDDT  84

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSF GEK A PN +S RG+ VID+IKS VE  CPGVVSCADI+AIA+RDS V LGGPSW 
Sbjct  85    SSFQGEKTAGPNNKSLRGYNVIDRIKSKVESACPGVVSCADIVAIAARDSVVLLGGPSWE  144

Query  536   VKLGRRDARTASQAAANN-SIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  712
             VKLGRRDARTAS + AN+ ++PPPTS L+ L S F A GLST DMV LSGSHTIGQARC 
Sbjct  145   VKLGRRDARTASFSLANSGALPPPTSTLSNLTSLFQAQGLSTRDMVALSGSHTIGQARCI  204

Query  713   NFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             +FR+RIYN+SNIDSSF+++R+  CP   GSGD NLAPLDLQ+P  FDN Y+ NL++ KGL
Sbjct  205   SFRSRIYNDSNIDSSFSKTRQRKCPSTVGSGDQNLAPLDLQSPTAFDNAYFKNLLSNKGL  264

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQ+LFNG STDS V+ YS NP  F+SDFA+AMIKMGDIKPLTG+ GE
Sbjct  265   LHSDQELFNGGSTDSLVKTYSNNPKTFNSDFASAMIKMGDIKPLTGSKGE  314



>ref|XP_009384773.1| PREDICTED: peroxidase 4 {ECO:0000250|UniProtKB:Q42578} [Musa 
acuminata subsp. malaccensis]
Length=356

 Score =   436 bits (1121),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 213/290 (73%), Positives = 239/290 (82%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FYS SCPKLF TV  VV+SAI KE R+GAS+LRLFFHDCFV GCDGS+LLDDT
Sbjct  58    SAQLSTSFYSSSCPKLFSTVKPVVQSAISKEKRLGASVLRLFFHDCFVLGCDGSVLLDDT  117

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
              +FTGEK A PN  S RGFEVIDQIK+AVEK CPGVVSCADILA+A+RDS V LGGP+W+
Sbjct  118   PTFTGEKTAKPNNNSIRGFEVIDQIKTAVEKACPGVVSCADILAVAARDSVVILGGPNWD  177

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRD+R AS + AN  IPPPTS+L+ LIS FSA GLST DMV LSGSHTIG ARCT+
Sbjct  178   VKLGRRDSRRASISKANKQIPPPTSSLSNLISKFSAKGLSTKDMVALSGSHTIGLARCTS  237

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR  IYN++NID+SFA+ R+ NCP ASGSGDNNLAPLDLQTP  FDNNYY NLV  KGLL
Sbjct  238   FRGHIYNDTNIDASFAKKRQANCPSASGSGDNNLAPLDLQTPTAFDNNYYKNLVRFKGLL  297

Query  896   HSDQQLFN-GVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQL+N   STDS V+ Y ++   F SDF + MIKMGDIKPLTG+NGE
Sbjct  298   HSDQQLYNVSDSTDSLVKAYISSTGTFFSDFVSGMIKMGDIKPLTGSNGE  347



>emb|CAD67478.1| peroxidase [Asparagus officinalis]
Length=301

 Score =   432 bits (1110),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 205/289 (71%), Positives = 236/289 (82%), Gaps = 0/289 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SA LS  FYS SCPK+F T+  V++SAI KE RMGAS+LRLFFHDCFVNGCDGSILL DT
Sbjct  4     SAHLSTNFYSSSCPKVFSTIKPVLQSAIAKEKRMGASILRLFFHDCFVNGCDGSILLADT  63

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             ++F GE+ A PN  S RGF+VID+IK+AVE  CPGVVSCADILA+A+RDS V LGGP W 
Sbjct  64    ANFRGEQHAGPNNGSVRGFKVIDKIKTAVENACPGVVSCADILAVAARDSVVILGGPDWK  123

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRDARTAS   ANN+IPPPTS+L+ LIS F+A GLST DMV LSG+HTIGQARCT+
Sbjct  124   VKLGRRDARTASATLANNNIPPPTSSLSNLISKFAAQGLSTKDMVALSGAHTIGQARCTS  183

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR  IYN+++ID+SFA  R+  CPR SGSGD NLAPLDLQTP  FDNNYY NL+NKKGLL
Sbjct  184   FRGHIYNDADIDASFASLRQKICPRKSGSGDTNLAPLDLQTPTAFDNNYYKNLINKKGLL  243

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQ+LFN  +TDS V+ YS +   F+SDF  AMIKMGDI PLTG+ GE
Sbjct  244   HSDQELFNNGATDSLVKSYSNSEGSFNSDFVKAMIKMGDISPLTGSKGE  292



>gb|KHG09190.1| Peroxidase 4 [Gossypium arboreum]
Length=322

 Score =   432 bits (1111),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 209/289 (72%), Positives = 239/289 (83%), Gaps = 1/289 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  FYSKSCPK+  TV SVV+SA+ KE RMGASL+RLFFHDCFV GCDGSILLDDTS
Sbjct  25    AQLSTSFYSKSCPKVLSTVESVVKSAVSKEKRMGASLVRLFFHDCFVKGCDGSILLDDTS  84

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SF GEK AAPN  S RGF V+D IK+ VEKVCPGVVSCADILA+A+RDS V LGGP W+V
Sbjct  85    SFRGEKTAAPNNNSVRGFNVVDDIKAKVEKVCPGVVSCADILALAARDSVVILGGPGWDV  144

Query  539   KLGRRDARTASQAAANNS-IPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             KLGRRD++TAS AAAN+  IPPPT+ L++LI+ F A GLS  DMV LSG+HTIG+ARC  
Sbjct  145   KLGRRDSKTASFAAANSGVIPPPTATLSQLINRFQARGLSAKDMVALSGAHTIGKARCVL  204

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR RIYNE+NID+SFA++R+ +CPR SGSGDNNLAPLD+ TP  FD  Y+ NL+NKKGLL
Sbjct  205   FRDRIYNETNIDASFAKARQSSCPRTSGSGDNNLAPLDVATPNSFDLKYFNNLLNKKGLL  264

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQ LFNG STDS V+ YS+N  KF SDF  AMIKMGDI PLTG+NGE
Sbjct  265   HSDQILFNGGSTDSLVKTYSSNTKKFYSDFVTAMIKMGDITPLTGSNGE  313



>ref|XP_011021038.1| PREDICTED: peroxidase 4-like [Populus euphratica]
Length=325

 Score =   432 bits (1110),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 210/290 (72%), Positives = 237/290 (82%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SA+LS  FYSKSCPK+F  V SVV+SA+ KE RMGASL+RLFFHDCFV GCDGSILL+DT
Sbjct  27    SAKLSTNFYSKSCPKVFGVVKSVVQSAVSKERRMGASLVRLFFHDCFVKGCDGSILLEDT  86

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGE+ A PN  S RGF V+ +IKS VEKVCPGVVSCADI+AIA+RDSTV LGGP WN
Sbjct  87    SSFTGEQTARPNNNSVRGFNVVAKIKSRVEKVCPGVVSCADIVAIAARDSTVILGGPFWN  146

Query  536   VKLGRRDARTASQAAANNS-IPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  712
             VKLGRRD++TAS +AAN+  IPPPTS L+ LI+ F + GLS  DMV LSGSHTIGQARCT
Sbjct  147   VKLGRRDSKTASLSAANSGVIPPPTSTLSNLINRFKSKGLSVKDMVALSGSHTIGQARCT  206

Query  713   NFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             +FRARIYNE+NIDSSFA +R+ NCP     GDN LAPLD+QTP  FDN YY NL+++KGL
Sbjct  207   SFRARIYNETNIDSSFATTRQKNCPFPGPKGDNKLAPLDVQTPTAFDNKYYKNLISQKGL  266

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQ LFNG STDS VR YS NP  F SDF  AMIKMGDI PLTG+ GE
Sbjct  267   LHSDQVLFNGGSTDSLVRTYSRNPKTFRSDFVTAMIKMGDIDPLTGSQGE  316



>ref|XP_004978554.1| PREDICTED: peroxidase 4-like [Setaria italica]
Length=331

 Score =   432 bits (1110),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 205/289 (71%), Positives = 237/289 (82%), Gaps = 0/289 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS GFYS SCP ++  V SVV++AI +E RMGAS+LRLFFHDCFV GCD S+LLDDT
Sbjct  34    SAQLSTGFYSYSCPGVYDAVKSVVQAAIAREQRMGASILRLFFHDCFVQGCDASLLLDDT  93

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSF GEK A PN  S RGFEVID IKSAVEKVCPGVVSCADILAIA+RDS V LGGP+W+
Sbjct  94    SSFQGEKMATPNNGSVRGFEVIDAIKSAVEKVCPGVVSCADILAIAARDSVVILGGPNWD  153

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VK+GRRD+ TAS + ANN+IPPPTS L  L S F+A GLS  DMV LSG+HTIGQARCTN
Sbjct  154   VKVGRRDSTTASFSGANNNIPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQARCTN  213

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FRA +YN++NID +FA++R+  CPR SGSGDNNLAPLDLQTP  F+NNYY NLV KKGLL
Sbjct  214   FRAHVYNDTNIDGAFARTRQSACPRTSGSGDNNLAPLDLQTPTAFENNYYKNLVCKKGLL  273

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQ+LFNG STD+ V+ Y ++ + F +DF   MIKMG I PLTG+NGE
Sbjct  274   HSDQELFNGGSTDAQVQSYVSSQSAFFADFVTGMIKMGGITPLTGSNGE  322



>ref|XP_004978553.1| PREDICTED: peroxidase 4-like [Setaria italica]
Length=355

 Score =   432 bits (1112),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 205/289 (71%), Positives = 236/289 (82%), Gaps = 0/289 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS GFYS SCP ++  V SVV+SAI KE RMGAS++RLFFHDCFV GCDGS+LLDDT
Sbjct  58    SAQLSTGFYSSSCPGVYSAVKSVVQSAIDKEKRMGASIVRLFFHDCFVQGCDGSLLLDDT  117

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
              SF GEK A PN  S RGFEVID IKSAVEKVCPGVVSCADILAIA+RDS V LGGP+WN
Sbjct  118   PSFQGEKMATPNNGSVRGFEVIDAIKSAVEKVCPGVVSCADILAIAARDSVVILGGPNWN  177

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VK+GRRD+ TAS + ANNSIPPPTS L  L S F+A GLS  DMV LSG+HTIG ARCTN
Sbjct  178   VKVGRRDSMTASFSGANNSIPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGLARCTN  237

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FRA +YNE+NID + A++R+  CP  SG+GDNNLAPLDLQTP  F+NNYY NLV+KKGLL
Sbjct  238   FRAHVYNETNIDGALARTRQSGCPSTSGTGDNNLAPLDLQTPTVFENNYYKNLVSKKGLL  297

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQ+LFNG +TD+ V+ Y ++ + F +DF   MIKMGDI PLTG+NGE
Sbjct  298   HSDQELFNGGATDAQVQSYVSSQSAFFADFVTGMIKMGDITPLTGSNGE  346



>ref|XP_007205551.1| hypothetical protein PRUPE_ppa008607mg [Prunus persica]
 gb|EMJ06750.1| hypothetical protein PRUPE_ppa008607mg [Prunus persica]
Length=325

 Score =   431 bits (1109),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 212/291 (73%), Positives = 241/291 (83%), Gaps = 2/291 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FYSKSCPK+F  V SVV+SA+ KE RMGASLLRL FHDCFVNGCDGSILLDDT
Sbjct  26    SAQLSTNFYSKSCPKVFDAVKSVVQSAVNKEKRMGASLLRLHFHDCFVNGCDGSILLDDT  85

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGEK A PN  S RGFEV+D IKS VEK CPGVVSCADILAIA+RDS   LGGPSWN
Sbjct  86    SSFTGEKTARPNNNSVRGFEVVDNIKSQVEKTCPGVVSCADILAIAARDSVKILGGPSWN  145

Query  536   VKLGRRDARTASQAAANNS-IPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  712
             VKLGRRD++TAS AAAN+  IPPPTS L++L + F AVGL+  D+V LSG+HTIGQARCT
Sbjct  146   VKLGRRDSKTASLAAANSGVIPPPTSTLSQLKTRFQAVGLNERDLVALSGAHTIGQARCT  205

Query  713   NFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             +FRARIYNE+NID+SFA++R+  CP   GSGDNNLAPLD+QTP  FD  Y+ NL+N+KGL
Sbjct  206   SFRARIYNETNIDASFAKARQSKCPSTVGSGDNNLAPLDVQTPNTFDTAYFKNLINQKGL  265

Query  893   LHSDQQLF-NGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQ L+ NG STDS V+ YS +   F+SDFA AMIKMGD KPLTG+NGE
Sbjct  266   LHSDQILYNNGGSTDSLVKTYSGSANTFNSDFAKAMIKMGDNKPLTGSNGE  316



>emb|CAD67477.1| peroxidase [Asparagus officinalis]
Length=315

 Score =   430 bits (1105),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 205/288 (71%), Positives = 235/288 (82%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  FYS SCP +F T+  V++ AI+KE RMGAS+LRLFFHDCFVNGCDGSILL DT 
Sbjct  19    AQLSTTFYSNSCPNVFTTIKPVLQHAIEKEKRMGASILRLFFHDCFVNGCDGSILLADTP  78

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
              F GE+ A PN +SARGF+VID+IK+AVEK CPGVVSCADILAIA+RDS V LGGP+W+V
Sbjct  79    HFVGEQHANPNNRSARGFKVIDRIKTAVEKACPGVVSCADILAIAARDSVVILGGPNWDV  138

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             KLGRRD+RTA++ AANN IPPPTS+L  L S F+A GLST DMV LSG+HTIGQARCT+F
Sbjct  139   KLGRRDSRTANKTAANNEIPPPTSSLANLTSLFAAKGLSTKDMVALSGAHTIGQARCTSF  198

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R+ IYN+S+ID SFA  RK NCP+ SGSGD NLAPLDLQTP  FDNNYY NLV KKGL+H
Sbjct  199   RSHIYNDSDIDPSFATLRKSNCPKQSGSGDMNLAPLDLQTPTTFDNNYYRNLVVKKGLMH  258

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ+LFNG STDS V+ YS    KF S F   MIKMGD+ PL G+NGE
Sbjct  259   SDQELFNGGSTDSLVKSYSDGTGKFYSAFVEGMIKMGDVSPLVGSNGE  306



>ref|XP_010685964.1| PREDICTED: peroxidase 4-like [Beta vulgaris subsp. vulgaris]
Length=319

 Score =   429 bits (1104),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 218/290 (75%), Positives = 243/290 (84%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLSP FYSKSCPKLF TV SVVRSA+ KE+RMGASLLRLFFHDCFVNGCDGSILLDDT
Sbjct  21    SAQLSPNFYSKSCPKLFGTVKSVVRSAVAKESRMGASLLRLFFHDCFVNGCDGSILLDDT  80

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSF GEK AAPN  SARGF VID IKS VE+VCPGVVSCADILAI +RDS   LGGP+WN
Sbjct  81    SSFRGEKSAAPNLNSARGFNVIDAIKSKVEQVCPGVVSCADILAITARDSVAILGGPNWN  140

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRD++TA+QAAANN IPPP+S+L+ LIS F A GLS  DMV LSG+HTIGQARC  
Sbjct  141   VKLGRRDSKTANQAAANNGIPPPSSSLSSLISRFQAHGLSAKDMVALSGAHTIGQARCIT  200

Query  716   FRARIYNE-SNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             FR+ +YNE S ID+SFA +R+ NCPR +G GDNNLAPLD QTP  FDN Y+ +LV+K+GL
Sbjct  201   FRSHVYNETSTIDASFASTRQRNCPRTNGQGDNNLAPLDSQTPTTFDNKYFKDLVSKRGL  260

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQQLFNG STDS V+ +S NP  F SDFA AMIKMGDI PLTG+ GE
Sbjct  261   LHSDQQLFNGGSTDSIVQSFSNNPGYFRSDFATAMIKMGDISPLTGSQGE  310



>ref|XP_004491048.1| PREDICTED: peroxidase 4-like [Cicer arietinum]
Length=323

 Score =   429 bits (1104),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 214/288 (74%), Positives = 238/288 (83%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             A LS  +Y  SCPKL  TV   V SAI KE RMGASLLRLFFHDCFVNGCDGSILLDDTS
Sbjct  26    ATLSKDYYYSSCPKLLDTVKCTVESAISKEPRMGASLLRLFFHDCFVNGCDGSILLDDTS  85

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             +F GEK A PN  SARGFEVID+IKSAVE+VCPGV+SCADI+ IA+RDS   LGGPSW+V
Sbjct  86    NFFGEKNAIPNKNSARGFEVIDKIKSAVEEVCPGVISCADIVTIAARDSVEILGGPSWDV  145

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             KLGRRD+RTAS++AANN IP PTSNLN+LIS FSA+GLST D+V L GSHTIGQARCT F
Sbjct  146   KLGRRDSRTASRSAANNGIPAPTSNLNQLISRFSALGLSTKDLVALFGSHTIGQARCTTF  205

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R  IYNESNID+SFA +R+  CP++ GSGDNNLAPLDL T   FDN+Y+ NLV  KGLLH
Sbjct  206   RGHIYNESNIDTSFANTRQTECPKSRGSGDNNLAPLDLTTSTSFDNHYFKNLVENKGLLH  265

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQQLFNG STDS V GYS N + F SDFA+AMIKMGDI PLTG+NGE
Sbjct  266   SDQQLFNGGSTDSIVSGYSMNSSSFFSDFASAMIKMGDISPLTGSNGE  313



>ref|XP_010067587.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=322

 Score =   429 bits (1104),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 205/289 (71%), Positives = 235/289 (81%), Gaps = 0/289 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS   Y+++CP+L  TV S+V++ I KEARMGASLLRLFFHDCFVNGCDGS LLDDT
Sbjct  25    SAQLSIYHYAETCPQLCPTVKSIVQAEIAKEARMGASLLRLFFHDCFVNGCDGSNLLDDT  84

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
              +FTGEK AAPN  S RGFEV+D+IK+AVE VCPGVVSCAD+LAI SRD+   LGGP W+
Sbjct  85    PTFTGEKNAAPNRNSLRGFEVVDKIKAAVENVCPGVVSCADLLAIISRDAVEILGGPGWD  144

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRDARTASQAAANNSIPPPT +LN LIS F   GLS  D+V L G+HT+GQARCTN
Sbjct  145   VKLGRRDARTASQAAANNSIPPPTDSLNALISGFQNHGLSQKDLVALYGAHTVGQARCTN  204

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FRARIYNESNIDSSFA++ K NCP  +G GDNNL  LD Q+   FDN YY+NL+ K+GLL
Sbjct  205   FRARIYNESNIDSSFAEAMKSNCPSVAGVGDNNLDGLDFQSATSFDNTYYINLMRKRGLL  264

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQLFNG STDS +R Y+ +   F  DF A+MI MGDIKPLTG+NGE
Sbjct  265   HSDQQLFNGGSTDSLIRTYAQSQETFFKDFVASMINMGDIKPLTGSNGE  313



>tpe|CAH69372.1| TPA: class III peroxidase 130 precursor [Oryza sativa Japonica 
Group]
 gb|ABA91159.1| Peroxidase 52 precursor, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ00524.1| hypothetical protein OsI_22542 [Oryza sativa Indica Group]
 gb|EAZ17186.1| hypothetical protein OsJ_32693 [Oryza sativa Japonica Group]
 dbj|BAH01350.1| unnamed protein product [Oryza sativa Japonica Group]
Length=324

 Score =   429 bits (1104),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 206/289 (71%), Positives = 235/289 (81%), Gaps = 0/289 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLSP FYS SCP +F  V   ++SAI  E R+GAS++RLFFHDCFV GCD S+LLDDT
Sbjct  27    SAQLSPSFYSYSCPGVFDAVKCGMQSAIANEKRIGASIVRLFFHDCFVQGCDASLLLDDT  86

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             +SFTGEK A PN  S RGFEVID IKSAVE +CPGVVSCADILAIA+RDS   LGGPSW+
Sbjct  87    ASFTGEKMANPNNGSVRGFEVIDAIKSAVETICPGVVSCADILAIAARDSVAILGGPSWD  146

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VK+GRRD+RTAS + ANN+IPPPTS L  L S F+A GLS  DMV LSGSHTIGQARCTN
Sbjct  147   VKVGRRDSRTASLSGANNNIPPPTSGLANLTSLFAAQGLSQKDMVALSGSHTIGQARCTN  206

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FRA IYNE+NIDS FA SR+  CPR+SGSGDNNLAPLDLQTP  F+NNYY NLV KKGLL
Sbjct  207   FRAHIYNETNIDSGFAMSRQSGCPRSSGSGDNNLAPLDLQTPTVFENNYYKNLVVKKGLL  266

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQ+LFNG +TD+ V+ Y ++ + F +DF   MIKMGDI PLTG+NGE
Sbjct  267   HSDQELFNGGATDALVQSYISSQSTFFADFVTGMIKMGDITPLTGSNGE  315



>ref|XP_008354764.1| PREDICTED: peroxidase 4-like [Malus domestica]
Length=327

 Score =   429 bits (1103),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 206/290 (71%), Positives = 237/290 (82%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FYSKSCP++F  V SVV+SA+ KE RMGASLLRL FHDCFVNGCDGS+LLDDT
Sbjct  29    SAQLSTNFYSKSCPQVFDAVKSVVKSAVSKEKRMGASLLRLHFHDCFVNGCDGSLLLDDT  88

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGEK A PN  S RGFEV+D+IKS VEK CPGVVSCADILAIASRDS   LGGPSW 
Sbjct  89    SSFTGEKTALPNNNSXRGFEVVDKIKSQVEKACPGVVSCADILAIASRDSVQILGGPSWE  148

Query  536   VKLGRRDARTASQAAANNSI-PPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  712
             VKLGRRD++TAS +AAN+ + PPPT+ LN L + F AVGLS  D+V LSG+HTIGQARCT
Sbjct  149   VKLGRRDSKTASLSAANSGVLPPPTATLNELTTRFRAVGLSQRDLVALSGAHTIGQARCT  208

Query  713   NFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
              FRARIYNE+NID+SFA++R+  CPR +GSGD+NLAP D+ TP  FD  Y+ NLVN+KGL
Sbjct  209   TFRARIYNETNIDASFARTRQNTCPRTAGSGDDNLAPFDITTPNTFDTAYFKNLVNQKGL  268

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQ LFNG  TDS V+ YS +   F++DFA AMIKMGD KPLTG+ GE
Sbjct  269   LHSDQILFNGGPTDSLVKSYSGSANTFNADFAKAMIKMGDNKPLTGSKGE  318



>ref|XP_009403860.1| PREDICTED: peroxidase 4 {ECO:0000250|UniProtKB:Q42578}-like [Musa 
acuminata subsp. malaccensis]
Length=316

 Score =   428 bits (1100),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 210/289 (73%), Positives = 241/289 (83%), Gaps = 0/289 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS GFYS SCP L  TV  VV SAI  E RMGASLLRLFFHDCFVNGCD S+LLDDT
Sbjct  19    SAQLSTGFYSSSCPSLSSTVKPVVHSAISSEQRMGASLLRLFFHDCFVNGCDASLLLDDT  78

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             S+FTGEK A PN  S RGF+VID+IK+AVEK CPGVVSCADILAI +RD+   LGGP+W+
Sbjct  79    SNFTGEKTATPNQNSVRGFDVIDKIKTAVEKACPGVVSCADILAITARDAVAILGGPNWD  138

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRDA+TAS + ANN+IPPP+S+L+ LIS FSA GLS  DMV L+G+HTIGQARC +
Sbjct  139   VKLGRRDAKTASLSGANNNIPPPSSSLSNLISKFSAQGLSRQDMVALAGAHTIGQARCIS  198

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR+RIYN++NIDSS A +R+ NCP  SGSGD NLAPLDLQTP  FDN+Y+ NLVN KGLL
Sbjct  199   FRSRIYNDTNIDSSLATTRQSNCPSTSGSGDGNLAPLDLQTPTTFDNDYFKNLVNLKGLL  258

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQLF+  STDS V+ YS +P+KF+SDFAAAMIKMGDI PLTG+ GE
Sbjct  259   HSDQQLFSNGSTDSLVKTYSASPSKFASDFAAAMIKMGDISPLTGSQGE  307



>ref|XP_002450132.1| hypothetical protein SORBIDRAFT_05g001000 [Sorghum bicolor]
 gb|EES09120.1| hypothetical protein SORBIDRAFT_05g001000 [Sorghum bicolor]
Length=331

 Score =   428 bits (1100),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 201/289 (70%), Positives = 236/289 (82%), Gaps = 0/289 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FYS SCP ++ +V S ++SAI  E RMGAS++RLFFHDCFV GCD S+LLDDT
Sbjct  34    SAQLSTSFYSSSCPGVYDSVKSAIQSAIATEQRMGASIVRLFFHDCFVQGCDASLLLDDT  93

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             +SF GEK A PN  S RGFEVID +KSAVEKVCPGVVSCADILAIA+RDS V LGGPSW+
Sbjct  94    ASFQGEKMATPNNGSVRGFEVIDAVKSAVEKVCPGVVSCADILAIAARDSVVILGGPSWD  153

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VK+GRRD+ TAS + ANN+IPPPTS L  L S F+A GLS  DMV LSG+HTIGQARCTN
Sbjct  154   VKVGRRDSTTASFSGANNNIPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQARCTN  213

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FRA +YN++NID +FA++R+  CPR SGSGDNNLAPLDLQTP  F+NNYY NLV KKGLL
Sbjct  214   FRAHVYNDTNIDGTFARTRQSGCPRTSGSGDNNLAPLDLQTPTVFENNYYKNLVCKKGLL  273

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQ+LFNG +TD+ V+ Y ++ + F SDF   MIKMGDI PLTG+NG+
Sbjct  274   HSDQELFNGGATDAQVQSYISSQSTFFSDFVTGMIKMGDITPLTGSNGQ  322



>ref|XP_004977588.1| PREDICTED: peroxidase 4-like [Setaria italica]
Length=321

 Score =   427 bits (1098),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 204/289 (71%), Positives = 235/289 (81%), Gaps = 0/289 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS GFYS SCP +   V SVV+SAI KE RMGAS++RLFFHDCFV GCD S+LLDDT
Sbjct  24    SAQLSTGFYSSSCPGVSSAVKSVVQSAIDKEKRMGASIVRLFFHDCFVQGCDASLLLDDT  83

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
              SF GEK A PN  S RGFEVID IKSAVEKVCPGVVSCADILAIA+RDS V LGGP+WN
Sbjct  84    PSFQGEKMATPNNGSVRGFEVIDAIKSAVEKVCPGVVSCADILAIAARDSVVILGGPNWN  143

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VK+GRRD+ TAS + ANN+IPPPTS L  L S F+A GLS  DMV LSG+HTIG ARCTN
Sbjct  144   VKVGRRDSTTASFSGANNNIPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGLARCTN  203

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FRA +YNE+NID +FA++R+  CP  SG+GDNNLAPLDLQTP  F+NNYY NLV+KKGLL
Sbjct  204   FRAHVYNETNIDGAFARTRQSGCPSTSGTGDNNLAPLDLQTPTVFENNYYRNLVSKKGLL  263

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQ+LFNG +TD+ V+ Y ++ + F +DF   MIKMGDI PLTG+NGE
Sbjct  264   HSDQELFNGGATDAQVQSYVSSQSAFFADFVTGMIKMGDITPLTGSNGE  312



>gb|EPS67864.1| hypothetical protein M569_06908, partial [Genlisea aurea]
Length=312

 Score =   427 bits (1097),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 201/291 (69%), Positives = 242/291 (83%), Gaps = 2/291 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FYS SCPKL+ TV SVV SAIQ EARMGASLLRLFFHDCFVNGCDGSILLD T
Sbjct  13    SAQLSTDFYSNSCPKLYSTVRSVVDSAIQAEARMGASLLRLFFHDCFVNGCDGSILLDST  72

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             ++ TGEK A PN  S RGF+V+D+IKSAVE VCPGVVSCAD+LAI +RDS   LGGPSWN
Sbjct  73    ATITGEKGALPNANSVRGFDVVDRIKSAVESVCPGVVSCADVLAITARDSVEILGGPSWN  132

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VK+GRRD++TAS +AANN IPPPTS+L  L+S ++A+GLS  D+V LSG+HTIGQARCT 
Sbjct  133   VKVGRRDSKTASLSAANNGIPPPTSSLATLVSRYNALGLSQKDLVALSGAHTIGQARCTT  192

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FRARIYNE+++++SFAQ R+  CPR++G GDNNLAPLD+QTP +FDN+Y+ NL++++GLL
Sbjct  193   FRARIYNETDVEASFAQLRRNGCPRSAGVGDNNLAPLDVQTPTRFDNDYFRNLLSQRGLL  252

Query  896   HSDQQLFNG--VSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQ+L+ G   ST S VR Y+ +   F  DF AAMI+MGDI PLTG+NGE
Sbjct  253   HSDQELYAGGSASTASDVRTYAADSNAFGRDFVAAMIRMGDISPLTGSNGE  303



>ref|XP_004294746.1| PREDICTED: peroxidase 4-like [Fragaria vesca subsp. vesca]
Length=327

 Score =   427 bits (1099),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 207/290 (71%), Positives = 239/290 (82%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FYS SCPKLF TV SVV+SAI  E R+GASLLRL FHDCFVNGCDGS+LLDDT
Sbjct  29    SAQLSTNFYSGSCPKLFTTVKSVVQSAISNENRIGASLLRLHFHDCFVNGCDGSVLLDDT  88

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGEK A PN  S RGF+V+D+IK+ VEK CPGVVSCADI+ IA+RDS V LGGPSW+
Sbjct  89    SSFTGEKTAGPNNNSLRGFDVVDKIKTKVEKACPGVVSCADIVTIAARDSVVILGGPSWS  148

Query  536   VKLGRRDARTASQAAANNS-IPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  712
             VKLGRRDA+T + AAAN+  IP PT++L+ LI+ F A GLST DMV LSG+HTIG+ARCT
Sbjct  149   VKLGRRDAKTTTLAAANSGVIPAPTNDLSDLITKFQAQGLSTTDMVALSGAHTIGKARCT  208

Query  713   NFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
              FR RIYNE+NID+SFA++R+ NCP  SGSGDNNLAPLD QT   FD  Y+ NL+NKKGL
Sbjct  209   VFRDRIYNETNIDASFAKTRQNNCPSTSGSGDNNLAPLDTQTTNAFDPKYFQNLINKKGL  268

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQ+LFNG STDS V+ YS +   F++DFA AMIKMGDIKPLTG+ GE
Sbjct  269   LHSDQELFNGGSTDSLVKKYSASAKNFNADFAKAMIKMGDIKPLTGSQGE  318



>gb|EMS66985.1| Peroxidase 4 [Triticum urartu]
Length=321

 Score =   427 bits (1097),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 206/289 (71%), Positives = 232/289 (80%), Gaps = 0/289 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS GFYS SCP     V SVV+SA+ KE RMGAS+LRLFFHDCFV GCDGS+LLDDT
Sbjct  24    SAQLSTGFYSSSCPGALGAVASVVQSAVAKEPRMGASILRLFFHDCFVQGCDGSLLLDDT  83

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
              SF GEK A PN  S RGFEVID IK AVE +CPGVVSCAD+LAIA+RDS V LGGP+W 
Sbjct  84    PSFQGEKTAMPNNGSVRGFEVIDAIKVAVENICPGVVSCADVLAIAARDSVVALGGPNWA  143

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VK+GRRD+ TAS + ANN+IPPPTS L  L S F+A GLS  DMV LSGSHTIGQARCTN
Sbjct  144   VKVGRRDSTTASFSGANNNIPPPTSGLANLTSLFAAQGLSQKDMVALSGSHTIGQARCTN  203

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FRA IYNE++IDS FA +R+  CP  SGSGDNNLAPLDLQTPI F+NNYY NLV KKGLL
Sbjct  204   FRAHIYNETDIDSGFAGTRQSGCPPNSGSGDNNLAPLDLQTPIAFENNYYKNLVAKKGLL  263

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQ+LFNG +TD  V+ Y+++ + F +DF A MIKMGDI PL GNNGE
Sbjct  264   HSDQELFNGGATDPLVQYYASSQSAFFADFVAGMIKMGDISPLIGNNGE  312



>gb|EYU46002.1| hypothetical protein MIMGU_mgv1a009759mg [Erythranthe guttata]
Length=332

 Score =   427 bits (1098),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 202/290 (70%), Positives = 234/290 (81%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQL+  +Y K+CPK+F TV S V+SAI+KE RMGASL+RL FHDCFV GCD S+LLDDT
Sbjct  34    SAQLTEDYYKKTCPKVFDTVESAVKSAIKKEKRMGASLIRLHFHDCFVQGCDASVLLDDT  93

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGEK AAPN  S RGF V+D IKS VE VCPGVVSCADILAIA+RDS   LGGP W+
Sbjct  94    SSFTGEKTAAPNNNSIRGFNVVDDIKSKVESVCPGVVSCADILAIAARDSVSILGGPEWD  153

Query  536   VKLGRRDARTASQAAANNS-IPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  712
             VK+GRRD++TAS AAAN+  IPPPTS LN L++ F A GLST DMV LSG+HTIGQARC+
Sbjct  154   VKVGRRDSKTASLAAANSGVIPPPTSTLNNLVNRFQARGLSTKDMVALSGAHTIGQARCS  213

Query  713   NFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
              FR RIYNE+NID+SFA+ R+ NCPR +GSGDNNLA LD+++P  FDN YY NL+ KKGL
Sbjct  214   LFRTRIYNETNIDASFARKRQDNCPRTTGSGDNNLASLDVKSPTFFDNAYYKNLIKKKGL  273

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQ L+NG STDS +  YS  P  F+ DF  AMIKMGDI PLTG+NGE
Sbjct  274   LHSDQILYNGGSTDSLIETYSKKPETFNDDFVTAMIKMGDISPLTGSNGE  323



>ref|XP_010067589.1| PREDICTED: peroxidase P7-like isoform X1 [Eucalyptus grandis]
Length=326

 Score =   427 bits (1098),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 204/289 (71%), Positives = 235/289 (81%), Gaps = 0/289 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  +YS+SCP LF TV  +V +AI +EARMGASLLRLFFHDCFVNGCDGS+LLDDT
Sbjct  29    SAQLSLDYYSRSCPVLFPTVRLIVGAAIAREARMGASLLRLFFHDCFVNGCDGSLLLDDT  88

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
              +FTGEK AAPN  SARGFEV+DQ+KSAVE VCPG+VSCAD+LAI +RDS V LGGP W 
Sbjct  89    PTFTGEKNAAPNVNSARGFEVVDQVKSAVEGVCPGIVSCADLLAIIARDSVVILGGPWWP  148

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRDAR+ASQAAAN SIP PTS+LN LISSF  VGL+  D+V L+G HTIG +RCTN
Sbjct  149   VKLGRRDARSASQAAANESIPRPTSDLNELISSFRNVGLNIRDLVALAGGHTIGLSRCTN  208

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR R+YNE+NID   AQ+RK  CP   G  D+NLAPLD QTPI FD++YY NLV ++GLL
Sbjct  209   FRDRVYNETNIDVLLAQTRKFGCPGIDGVDDDNLAPLDFQTPITFDHSYYSNLVQRRGLL  268

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQLFNG  TDS VR YS +P  F  DF A++ +MGDIKPLTG+NGE
Sbjct  269   HSDQQLFNGGPTDSFVRLYSRSPLAFQGDFVASITRMGDIKPLTGSNGE  317



>ref|XP_002441703.1| hypothetical protein SORBIDRAFT_08g000990 [Sorghum bicolor]
 gb|EES15541.1| hypothetical protein SORBIDRAFT_08g000990 [Sorghum bicolor]
Length=328

 Score =   426 bits (1096),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 205/289 (71%), Positives = 236/289 (82%), Gaps = 0/289 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQL   FYS SCP ++  V SV+++AI +E RMGAS+LRLFFHDCFV GCD S+LLDDT
Sbjct  31    SAQLCTSFYSHSCPGVYDAVRSVLQAAIAREQRMGASILRLFFHDCFVQGCDASLLLDDT  90

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
              SF GEK A PN  SARGFEVID IKSAV+KVCPGVVSCADILAIA+RDS V LGGPSW+
Sbjct  91    PSFQGEKMANPNNGSARGFEVIDAIKSAVDKVCPGVVSCADILAIAARDSVVILGGPSWD  150

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VK+GRRD+RTAS + ANN+IPPPTS L  L S F+A GLS  DMV LSG+HTIG ARCTN
Sbjct  151   VKVGRRDSRTASFSGANNNIPPPTSGLVNLTSLFAAQGLSQKDMVALSGAHTIGLARCTN  210

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FRA IYN++NID SFA+SR+  CPR SGSGDNNLAPLDLQTP  F+NNYY NLV KKG+L
Sbjct  211   FRAHIYNDTNIDGSFARSRQSVCPRTSGSGDNNLAPLDLQTPTVFENNYYKNLVYKKGIL  270

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQ+LFNG STD+ V+ Y ++ + F +DF   MIKMGDI PLTG+NGE
Sbjct  271   HSDQELFNGGSTDAQVQSYVSSQSAFFADFVTGMIKMGDIMPLTGSNGE  319



>gb|AAL93151.1|AF485265_1 class III peroxidase [Gossypium hirsutum]
Length=320

 Score =   426 bits (1095),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 205/289 (71%), Positives = 241/289 (83%), Gaps = 1/289 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  FYSKSCPK+  TV  VV +A+ KE R+GASLLRLFFHDCFVNGCDGS+LLDDTS
Sbjct  23    AQLSTNFYSKSCPKVLSTVELVVETAVSKEQRLGASLLRLFFHDCFVNGCDGSVLLDDTS  82

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGE+ A PN  S RGFEV+D+IK+ VEKVCPGVVSCADILAIA+RDS V LGGP W+V
Sbjct  83    SFTGEQTATPNNGSLRGFEVVDEIKAKVEKVCPGVVSCADILAIAARDSVVILGGPDWDV  142

Query  539   KLGRRDARTASQAAANNSI-PPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             KLGRRD++TAS + AN+ + P  ++NL++LIS F A GLST DMV LSG+HTIG+ARC  
Sbjct  143   KLGRRDSKTASFSDANSGVLPLGSANLSQLISLFQAQGLSTKDMVALSGAHTIGKARCLV  202

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR RIYN++ ID+SFA++R+ +CPR  GSGDNNLAPLDL TP  FD+ Y+ NL+NKKGLL
Sbjct  203   FRNRIYNDTIIDTSFAKTRRSSCPRTRGSGDNNLAPLDLATPNSFDSKYFENLLNKKGLL  262

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQ+LFNG STDS V+ YS+N  KF SDF AAMIKMGDIKPLTG+NGE
Sbjct  263   HSDQELFNGGSTDSLVKTYSSNVKKFYSDFIAAMIKMGDIKPLTGSNGE  311



>dbj|BAJ97638.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=320

 Score =   426 bits (1095),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 204/289 (71%), Positives = 231/289 (80%), Gaps = 0/289 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS GFYS SCP     V SVV+SA+  E RMGAS+LRLFFHDCFV GCDGS+LLDDT
Sbjct  23    SAQLSTGFYSSSCPGALGAVASVVQSAVANEPRMGASILRLFFHDCFVQGCDGSLLLDDT  82

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             +SF GEK A PN  S RGFEVID IK AVEK+CPGVVSCAD+LAIA+RDS V LGGP+W 
Sbjct  83    ASFQGEKMATPNNGSVRGFEVIDAIKVAVEKICPGVVSCADVLAIAARDSVVALGGPNWA  142

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VK+GRRD+ TAS + ANN+IPPPTS L  L S F+A GLS  DMV LSGSHTIGQARCTN
Sbjct  143   VKVGRRDSTTASFSGANNNIPPPTSGLANLTSLFAAQGLSQKDMVALSGSHTIGQARCTN  202

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FRA +YNE+NIDS FA +R+  CP  SGSGDNNLAPLDLQTP  F+NNYY NLV KKGL+
Sbjct  203   FRAHVYNETNIDSGFAGTRRSGCPPNSGSGDNNLAPLDLQTPTAFENNYYKNLVAKKGLM  262

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQ+LFNG +TD  V+ Y ++ + F +DF   MIKMGDI PLTGNNGE
Sbjct  263   HSDQELFNGGATDPLVQYYVSSQSAFFADFVEGMIKMGDISPLTGNNGE  311



>gb|ACN42168.1| peroxidase 1 [Sesuvium portulacastrum]
Length=318

 Score =   425 bits (1093),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 212/289 (73%), Positives = 245/289 (85%), Gaps = 0/289 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQL+  FY KSCP LF  V  VV+SAI+KEARMGASLLRL FHDCFVNGCDGS LLDDT
Sbjct  21    SAQLTTNFYEKSCPHLFPVVRDVVQSAIRKEARMGASLLRLHFHDCFVNGCDGSNLLDDT  80

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSF GEK A+PNFQSARGFEVIDQIK+AVE+VCPGVVSCADILA+ +RDS V LGGP+W+
Sbjct  81    SSFKGEKSASPNFQSARGFEVIDQIKAAVERVCPGVVSCADILAVTARDSVVGLGGPTWD  140

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRDARTA+QAAAN+SIPP +S+L+RLISSF   GL+  D+V L G H+IGQARCTN
Sbjct  141   VKLGRRDARTANQAAANSSIPPASSSLSRLISSFQNQGLTIKDLVALYGGHSIGQARCTN  200

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FRA IYN+S+I++SFA+S K NCP  +G+GDNNLAPLD QTP KFD+ Y+  LVNKK  L
Sbjct  201   FRAHIYNDSDINASFAKSLKANCPPKNGTGDNNLAPLDPQTPNKFDHIYFQGLVNKKAPL  260

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQ+L NG ST S ++ YSTNP+ FSSDF  +MIKMGDIKPLTG+NGE
Sbjct  261   HSDQELTNGASTSSWIQKYSTNPSLFSSDFGTSMIKMGDIKPLTGSNGE  309



>gb|EAY79693.1| hypothetical protein OsI_34840 [Oryza sativa Indica Group]
Length=329

 Score =   425 bits (1093),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 204/288 (71%), Positives = 233/288 (81%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLSP FYS SCP +F  V   ++SAI +E R+GAS++RLFFHDCFV GCD S+LLDDT+
Sbjct  33    AQLSPSFYSFSCPGVFNAVKRGMQSAIAREKRIGASIVRLFFHDCFVQGCDASLLLDDTA  92

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGEK A PN  S RGFEVID IKSAVE +CPGVVSCADILAIA+RDS   LGGPSW+V
Sbjct  93    SFTGEKTANPNNGSVRGFEVIDAIKSAVETICPGVVSCADILAIAARDSVAILGGPSWDV  152

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             K+GRRD+RTAS + ANN+IPPPTS L  L S F+A GLS  DMV LSGSHTIGQARCTNF
Sbjct  153   KVGRRDSRTASLSGANNNIPPPTSGLANLTSLFAAQGLSQKDMVALSGSHTIGQARCTNF  212

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             RA IYNE+NIDS FA  R+  CPR SGSGDNNLAPLDLQTP  F+NNYY NLV KKGLLH
Sbjct  213   RAHIYNETNIDSGFAMRRQSGCPRNSGSGDNNLAPLDLQTPTVFENNYYKNLVVKKGLLH  272

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ+LFNG +TD+ V+ Y ++ + F +DF   MIKMGDI PLTG+NGE
Sbjct  273   SDQELFNGGATDALVQSYISSQSTFFADFVTGMIKMGDITPLTGSNGE  320



>ref|XP_009354386.1| PREDICTED: peroxidase 4-like [Pyrus x bretschneideri]
Length=327

 Score =   424 bits (1091),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 204/289 (71%), Positives = 236/289 (82%), Gaps = 1/289 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             A+LS  FYSKSCP++F  V SVV+SA+ K+ RMGASLLRL FHDCFVNGCDGS+LLDDTS
Sbjct  30    AKLSTNFYSKSCPQVFDAVKSVVKSAVSKDKRMGASLLRLHFHDCFVNGCDGSLLLDDTS  89

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGEK A PN  S RGFEV+D+IKS VEK CPGVVSCADILAIASRDS   LGGPSW V
Sbjct  90    SFTGEKTALPNNNSLRGFEVVDKIKSQVEKACPGVVSCADILAIASRDSVQILGGPSWEV  149

Query  539   KLGRRDARTASQAAANNS-IPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             KLGRRD++TAS +AAN+  IPPPT+ LN L + F AVGLS  D+V LSG+HTIGQARCT 
Sbjct  150   KLGRRDSKTASLSAANSGVIPPPTATLNELTTRFRAVGLSQRDLVALSGAHTIGQARCTT  209

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FRARIYNE+NID+SFA++R+  CPR +G GD+NLAPLD+ TP  FD  Y+ NLVN+KGLL
Sbjct  210   FRARIYNETNIDASFARTRQNTCPRTAGHGDDNLAPLDITTPNTFDTAYFKNLVNQKGLL  269

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQ LFNG  TDS V+ YS +   F++DFA AMIKMGD KPLTG+ GE
Sbjct  270   HSDQILFNGGPTDSLVKSYSGSANTFNADFAKAMIKMGDNKPLTGSKGE  318



>ref|XP_010032327.1| PREDICTED: peroxidase P7-like [Eucalyptus grandis]
Length=322

 Score =   424 bits (1089),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 210/288 (73%), Positives = 244/288 (85%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLSP FYSKSCP +F  V S V SA+ KE  +GASLLRLFFHDCFVNGCDGS+LLDDT 
Sbjct  26    AQLSPDFYSKSCPDVFTGVKSQVESAVSKEPGIGASLLRLFFHDCFVNGCDGSVLLDDTP  85

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             +FTGEK AAPN  SARGFEVID +KSAVEKVCPGVVSCAD+LAI +RDS V LGGPSW+V
Sbjct  86    TFTGEKNAAPNRNSARGFEVIDDVKSAVEKVCPGVVSCADLLAITARDSVVLLGGPSWSV  145

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             KLGRRDAR+ASQAAAN+S+P P SNL  LISSF + GLST D+V LSGSH+IGQA+C NF
Sbjct  146   KLGRRDARSASQAAANSSLPSPASNLTDLISSFESAGLSTTDLVALSGSHSIGQAKCENF  205

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             RARIYNE+++D SF + R+ NCP ++G GDNNLAPLD+Q+ + FDN YY NL+  KGLLH
Sbjct  206   RARIYNETDLDRSFGEIRRKNCPSSAGPGDNNLAPLDVQSSVAFDNTYYTNLLQFKGLLH  265

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQQLF+G STDS VR Y+++P+ FSSDFAAAMIKMGDI PLTG++GE
Sbjct  266   SDQQLFSGGSTDSLVRTYASSPSTFSSDFAAAMIKMGDILPLTGSDGE  313



>ref|NP_001065971.1| Os12g0112000 [Oryza sativa Japonica Group]
 tpe|CAH69377.1| TPA: class III peroxidase 135 precursor [Oryza sativa Japonica 
Group]
 gb|ABA96259.1| Peroxidase 52 precursor, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28990.1| Os12g0112000 [Oryza sativa Japonica Group]
 gb|EAZ19424.1| hypothetical protein OsJ_34981 [Oryza sativa Japonica Group]
 dbj|BAG91443.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AEK99332.1| peroxidase [Oryza sativa Japonica Group]
Length=327

 Score =   423 bits (1088),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 203/288 (70%), Positives = 232/288 (81%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLSP FYS SCP +F  V   ++SAI +E R+GAS++RLFFHDCFV GCD S+LLDDT+
Sbjct  31    AQLSPSFYSYSCPGVFNAVKRGMQSAIAREKRIGASIVRLFFHDCFVQGCDASLLLDDTA  90

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGEK A PN  S RGFEVID IKSAVE +CPGVVSCADILAIA+RDS   LGGPSW+V
Sbjct  91    SFTGEKTANPNNGSVRGFEVIDAIKSAVETICPGVVSCADILAIAARDSVAILGGPSWDV  150

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             K+GRRD+RTAS + ANN+IPPPTS L  L S F+A  LS  DMV LSGSHTIGQARCTNF
Sbjct  151   KVGRRDSRTASLSGANNNIPPPTSGLANLTSLFAAQALSQKDMVALSGSHTIGQARCTNF  210

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             RA IYNE+NIDS FA  R+  CPR SGSGDNNLAPLDLQTP  F+NNYY NLV KKGLLH
Sbjct  211   RAHIYNETNIDSGFAMRRQSGCPRNSGSGDNNLAPLDLQTPTVFENNYYKNLVVKKGLLH  270

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ+LFNG +TD+ V+ Y ++ + F +DF   MIKMGDI PLTG+NGE
Sbjct  271   SDQELFNGGATDALVQSYISSQSTFFADFVTGMIKMGDITPLTGSNGE  318



>ref|XP_004500341.1| PREDICTED: peroxidase 4-like [Cicer arietinum]
Length=326

 Score =   423 bits (1087),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 205/290 (71%), Positives = 232/290 (80%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQL   FY K CP +F TV +VV+SA+ KE R+GASLLRLFFHDCFV+GCDGSILLDDT
Sbjct  28    SAQLDENFYCKKCPNVFDTVETVVKSAVSKEQRIGASLLRLFFHDCFVDGCDGSILLDDT  87

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSF GEK AAPN  SARGFEVID IKS +E +CPGVVSCADILAIASRDS V LGGP WN
Sbjct  88    SSFKGEKTAAPNNNSARGFEVIDAIKSKLEAICPGVVSCADILAIASRDSVVILGGPFWN  147

Query  536   VKLGRRDARTASQAAANNSI-PPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  712
             VK+GRRD+RTA+  AAN  + P P SNL +LIS+F A GLS  DMV LSG+HTIG+ARCT
Sbjct  148   VKVGRRDSRTANFIAANTGVLPSPASNLTKLISTFKAQGLSVKDMVALSGAHTIGEARCT  207

Query  713   NFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             +FR  IYNE+NIDS+FA+ R+  CP   G+GDNNLA LDLQTP  FDNNYY NL+ KKGL
Sbjct  208   SFRNHIYNENNIDSTFAKIRQRKCPSTVGTGDNNLANLDLQTPTHFDNNYYKNLIIKKGL  267

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQ+LFNG STDS V+ Y+ N   F SDF AAMIKMG+ KPLTG  GE
Sbjct  268   LHSDQELFNGGSTDSLVQTYTQNEKAFDSDFVAAMIKMGNNKPLTGGQGE  317



>gb|AFW64595.1| hypothetical protein ZEAMMB73_885092 [Zea mays]
Length=333

 Score =   423 bits (1088),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 201/290 (69%), Positives = 237/290 (82%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS GFYS SCP ++  V SVV+SA+  E RMGAS++RLFFHDCFV GCD S+LLDDT
Sbjct  35    SAQLSTGFYSSSCPGVYDAVKSVVQSAVASEQRMGASIVRLFFHDCFVQGCDASLLLDDT  94

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
              SF GEK A PN  S RGFEVID +KSAVEKVCPGVVSCADILAIA+RDS V LGGP+W+
Sbjct  95    PSFQGEKMANPNNGSVRGFEVIDAVKSAVEKVCPGVVSCADILAIAARDSVVILGGPTWD  154

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VK+GRRD+ TAS + ANN+IPPPTS L  L S F+A GLS  DMV LSG+HTIGQARCTN
Sbjct  155   VKVGRRDSTTASFSGANNNIPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQARCTN  214

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASG-SGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             FRA +YN++NID SFA++R+  CPR+SG SGDNNLAPLDLQTP  F+NNYY NLV KKGL
Sbjct  215   FRAHVYNDTNIDGSFARTRQSGCPRSSGSSGDNNLAPLDLQTPTVFENNYYKNLVCKKGL  274

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQ+LFNG +TD+ V+ Y++  ++F SDF   M+KMGDI PLTG+ G+
Sbjct  275   LHSDQELFNGGATDALVQSYASGQSEFFSDFVTGMVKMGDITPLTGSGGQ  324



>ref|XP_002450133.1| hypothetical protein SORBIDRAFT_05g001010 [Sorghum bicolor]
 gb|EES09121.1| hypothetical protein SORBIDRAFT_05g001010 [Sorghum bicolor]
Length=328

 Score =   423 bits (1087),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/289 (69%), Positives = 237/289 (82%), Gaps = 0/289 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS GFYS SCP ++  V SV++SAI  E RMGAS++RLFFHDCFV GCD S+LLDDT
Sbjct  31    SAQLSTGFYSYSCPGVYGAVKSVMKSAIANEKRMGASIVRLFFHDCFVQGCDASLLLDDT  90

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             ++F GEK A PN  S RGFEVID +KSAVEKVCPGVVSCADILAIA+RDS V LGGPSW+
Sbjct  91    ATFQGEKMATPNNGSVRGFEVIDAVKSAVEKVCPGVVSCADILAIAARDSVVILGGPSWD  150

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VK+GRRD+ TAS + ANN+IPPPTS L  L S F+A GLS  DMV LSG+HTIGQARCTN
Sbjct  151   VKVGRRDSTTASFSGANNNIPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQARCTN  210

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FRA IYN+++I+S+FA++R+  CP  SG+GDNNLAPLDLQTP  F+NNYY NL++KKGLL
Sbjct  211   FRAHIYNDTDINSAFAKTRQSGCPSTSGAGDNNLAPLDLQTPTVFENNYYKNLLSKKGLL  270

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQ+LFNG +TD+ V+ Y  + + F +DF   MIKMGDI PLTG+NG+
Sbjct  271   HSDQELFNGGATDTLVQSYVGSQSTFFTDFVTGMIKMGDITPLTGSNGQ  319



>ref|XP_010067590.1| PREDICTED: peroxidase P7-like isoform X2 [Eucalyptus grandis]
Length=325

 Score =   422 bits (1086),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 204/289 (71%), Positives = 235/289 (81%), Gaps = 1/289 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  +YS+SCP LF TV  +V +AI +EARMGASLLRLFFHDCFVNGCDGS+LLDDT
Sbjct  29    SAQLSLDYYSRSCPVLFPTVRLIVGAAIAREARMGASLLRLFFHDCFVNGCDGSLLLDDT  88

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
              +FTGEK AAPN  SARGFEV+DQ+KSAVE VCPG+VSCAD+LAI +RDS V LGGP W 
Sbjct  89    PTFTGEKNAAPNVNSARGFEVVDQVKSAVEGVCPGIVSCADLLAIIARDSVVILGGPWWP  148

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRDAR+ASQAAAN SIP PTS+LN LISSF  VGL+  D+V L+G HTIG +RCTN
Sbjct  149   VKLGRRDARSASQAAANESIPRPTSDLNELISSFRNVGLNIRDLVALAG-HTIGLSRCTN  207

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR R+YNE+NID   AQ+RK  CP   G  D+NLAPLD QTPI FD++YY NLV ++GLL
Sbjct  208   FRDRVYNETNIDVLLAQTRKFGCPGIDGVDDDNLAPLDFQTPITFDHSYYSNLVQRRGLL  267

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQLFNG  TDS VR YS +P  F  DF A++ +MGDIKPLTG+NGE
Sbjct  268   HSDQQLFNGGPTDSFVRLYSRSPLAFQGDFVASITRMGDIKPLTGSNGE  316



>gb|KEH34419.1| anionic peroxidase swpb3 protein [Medicago truncatula]
Length=320

 Score =   422 bits (1085),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 204/290 (70%), Positives = 233/290 (80%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FYSK CPK+F+TV SVV++A+ KE R+GASLLRL FHDCFV+GCDGSILLDDT
Sbjct  22    SAQLSENFYSKKCPKVFKTVQSVVKTAVAKENRIGASLLRLHFHDCFVDGCDGSILLDDT  81

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSF GEK A PN  S RG+EVID IKS VE +CPGVVSCADI+AI +RDS V LGGP W 
Sbjct  82    SSFKGEKTAGPNNNSVRGYEVIDAIKSKVEAICPGVVSCADIVAITARDSVVILGGPFWK  141

Query  536   VKLGRRDARTASQAAANNS-IPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  712
             VK+GRRD++TA+  AAN   IP PTSNL  LIS+F A GLS  DMV LSG+HTIG+ARCT
Sbjct  142   VKVGRRDSKTANFTAANTGVIPAPTSNLTTLISTFKAQGLSVKDMVALSGAHTIGRARCT  201

Query  713   NFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             +FR  IYN+SNIDS+FA+ R+ NCPR +GSGDNNLA LDL+TP  FDNNYY NL+ K+GL
Sbjct  202   SFRGHIYNDSNIDSTFAKIRQKNCPRTTGSGDNNLANLDLRTPTHFDNNYYKNLIIKRGL  261

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQ LFNG +TDS V+ YS N   F SDF AAMIKMGD KPLTG  GE
Sbjct  262   LHSDQVLFNGGTTDSLVKTYSQNGKVFDSDFVAAMIKMGDNKPLTGKQGE  311



>gb|EPS58134.1| anionic peroxidase swpb3, partial [Genlisea aurea]
Length=315

 Score =   421 bits (1081),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 206/290 (71%), Positives = 235/290 (81%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  +Y  SCP LF TV SVVRSAIQ E R+GAS+LRLFFHDCFVNGCDGSILLDD 
Sbjct  17    SAQLSYDYYWDSCPDLFPTVRSVVRSAIQAEPRIGASILRLFFHDCFVNGCDGSILLDDG  76

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
              +F GEK A PN  SARGFEV+D+IK+AVE VCPGVVSCADILA+ASRDS   LGGP W+
Sbjct  77    PNFVGEKGATPNRNSARGFEVVDRIKAAVEYVCPGVVSCADILAVASRDSVEILGGPGWD  136

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRDA+TAS AAAN++IPPP SNL  L++SF++ GLS  D+VVLSGSHTIGQARCT+
Sbjct  137   VKLGRRDAKTASLAAANSNIPPPRSNLTALVTSFASHGLSVRDLVVLSGSHTIGQARCTS  196

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR RIYNE+NI+   A+ RK NCP  +G+GDNNLAPLD QTP +FDN Y+ NLV+K GLL
Sbjct  197   FRPRIYNETNIEPYLARIRKYNCPEINGTGDNNLAPLDPQTPTRFDNFYFRNLVDKAGLL  256

Query  896   HSDQQLFN-GVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQ+LFN G STD  VR Y+ NP  F  DF  AMI+MGDIKPLTG  GE
Sbjct  257   HSDQELFNGGGSTDWLVRYYAENPYAFLRDFPTAMIRMGDIKPLTGFAGE  306



>ref|XP_010087166.1| Peroxidase 4 [Morus notabilis]
 gb|EXB28405.1| Peroxidase 4 [Morus notabilis]
Length=326

 Score =   420 bits (1079),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 205/290 (71%), Positives = 236/290 (81%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQL PGFY KSCPK+F TV SVV++AI KE R+GASLLRL FHDCFVNGCDGSILLDDT
Sbjct  28    SAQLYPGFYHKSCPKVFATVKSVVKTAISKENRIGASLLRLHFHDCFVNGCDGSILLDDT  87

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSF GEK A PN  SARGF V+D+IK+ VE+VCPGVVSCADILAIA+RDS   LGGP + 
Sbjct  88    SSFRGEKTAGPNNNSARGFGVVDKIKAEVEQVCPGVVSCADILAIAARDSVAILGGPYYE  147

Query  536   VKLGRRDARTASQAAANNS-IPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  712
             VK+GRRD++TAS +AAN+  IPPPTS L+ LI+ F   GLS  DMV LSG HTIG+ARC 
Sbjct  148   VKVGRRDSKTASFSAANSGVIPPPTSTLSNLINRFKNRGLSALDMVALSGGHTIGKARCR  207

Query  713   NFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
              FR RIYNE+NIDSSFA++R+  CPR + SGDNN+A LD+ TP  FDN+Y+VNLVNKKGL
Sbjct  208   VFRKRIYNETNIDSSFAKARQSKCPRNAPSGDNNVADLDVATPNSFDNHYFVNLVNKKGL  267

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQ LFNG STDS V+ Y+ NP KF SDF  A+IKMGDI PLTG+ GE
Sbjct  268   LHSDQILFNGGSTDSLVKHYNENPKKFHSDFVTAIIKMGDIDPLTGSKGE  317



>ref|XP_010045401.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=321

 Score =   419 bits (1078),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 209/290 (72%), Positives = 237/290 (82%), Gaps = 3/290 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FYSKSCP    TV SVV+SA+ KE RMGASLLRLFFHDCFVNGCDGSILLDDT
Sbjct  25    SAQLSTNFYSKSCPNGLSTVKSVVQSAVSKERRMGASLLRLFFHDCFVNGCDGSILLDDT  84

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSF GEK A PN +S RG+ VID+IKS VE  CPGVVSCADI+AIA+RDS V LGGPSW 
Sbjct  85    SSFQGEKTARPNNKSLRGYNVIDRIKSKVESACPGVVSCADIVAIAARDSVVLLGGPSWE  144

Query  536   VKLGRRDARTASQAAANN-SIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  712
             VKLGRRDARTAS + AN+ ++PPPTS L+ LIS F A GLST DMV LSGSHTIGQARCT
Sbjct  145   VKLGRRDARTASFSLANSGALPPPTSTLSNLISLFQAQGLSTRDMVALSGSHTIGQARCT  204

Query  713   NFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             +FR  IYN+SNIDS+F ++R+G CP   GSGDNN APLDL++P  FDN Y+ NL++ KGL
Sbjct  205   SFRPHIYNDSNIDSAFRKTRQGQCP--FGSGDNNPAPLDLRSPTAFDNAYFKNLLSNKGL  262

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             L SDQ+LFNG STDS V+ YS NP  F+SDFA+AMIKMGDIKPL G+ GE
Sbjct  263   LRSDQELFNGGSTDSLVKTYSNNPKTFNSDFASAMIKMGDIKPLKGSQGE  312



>ref|XP_008244108.1| PREDICTED: peroxidase 4 [Prunus mume]
Length=325

 Score =   420 bits (1079),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 204/291 (70%), Positives = 237/291 (81%), Gaps = 2/291 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FYSKSCPK+F  V SVV+SA+ +E RMGASLLRL FHDCFVNGCDGSILLDDT
Sbjct  26    SAQLSTNFYSKSCPKVFHAVKSVVQSAVNREKRMGASLLRLHFHDCFVNGCDGSILLDDT  85

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSF GEK A PN +S RGFEV+D+IKS VEK CPG+VSCADILAI +RDS   LGG SWN
Sbjct  86    SSFKGEKTAGPNNKSVRGFEVVDKIKSQVEKTCPGIVSCADILAITARDSVKILGGSSWN  145

Query  536   VKLGRRDARTASQAAANNSI-PPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  712
             VKLGRRD++TAS  AAN+ + PPPTS L+ L + F AVGL+  D+V LSG+HTIG+ARCT
Sbjct  146   VKLGRRDSKTASFTAANSGVLPPPTSTLSNLKTRFQAVGLNERDLVALSGAHTIGKARCT  205

Query  713   NFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             +FR RIYNE+NID+SFA+ R+  CP  +GSGDNNLAPLD+QTP  FD  Y+ NL+N+KGL
Sbjct  206   SFRLRIYNETNIDASFAKVRQSKCPSTAGSGDNNLAPLDVQTPDTFDTAYFKNLINQKGL  265

Query  893   LHSDQQLF-NGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQ LF NG STDS V+ YS +   F+SDFA AMIKMGD KPLTG+NGE
Sbjct  266   LHSDQILFNNGGSTDSLVKTYSGSANTFNSDFAKAMIKMGDNKPLTGSNGE  316



>ref|XP_008244444.1| PREDICTED: peroxidase 4-like [Prunus mume]
Length=322

 Score =   419 bits (1077),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 203/290 (70%), Positives = 240/290 (83%), Gaps = 3/290 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FYSKSCPK+F  V SVVRSA++KE R+GASLLRL FHDCFV GCDGS+LLDDT
Sbjct  26    SAQLSTNFYSKSCPKVFHAVKSVVRSAVKKEKRIGASLLRLHFHDCFVKGCDGSVLLDDT  85

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGEK AAPN  S RGF+V+D+IKS VEK CPGVVSCADILAIA+RDS   LGGPSW 
Sbjct  86    SSFTGEKTAAPNNNSLRGFKVVDKIKSKVEKRCPGVVSCADILAIAARDSVKILGGPSWK  145

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRD++TAS AAAN S+P PTS L++L + F AVGL+  D+V LSG+HTIG+A+CT+
Sbjct  146   VKLGRRDSKTASLAAANRSLPAPTSTLSQLKTGFRAVGLNERDLVALSGAHTIGKAKCTS  205

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR RIYNE+NID+SFA++R+  CPR   +GDNNLAPLD+QTP  FD  Y+ NL+N+KGLL
Sbjct  206   FRVRIYNETNIDASFAKARQRKCPRT--AGDNNLAPLDVQTPHTFDTAYFKNLINQKGLL  263

Query  896   HSDQQLF-NGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQ L+ NG ST+S V+ YS +   F+SDFA AMIKMGD KPLTG+NGE
Sbjct  264   HSDQILYNNGGSTNSLVKKYSGSAHTFNSDFAKAMIKMGDNKPLTGSNGE  313



>ref|XP_007017044.1| Peroxidase 68 [Theobroma cacao]
 gb|EOY34663.1| Peroxidase 68 [Theobroma cacao]
Length=592

 Score =   427 bits (1099),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 207/288 (72%), Positives = 238/288 (83%), Gaps = 1/288 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FYSKSCPK+F TV S V+SA+ KE RMGASL+RLFFHDCFVNGCDGSILLDDT
Sbjct  28    SAQLSTNFYSKSCPKVFSTVKSAVQSAVSKERRMGASLVRLFFHDCFVNGCDGSILLDDT  87

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSF GEK A PN  S RGF V+D IK+ VEKVCPGVVSCADI+AIA+RDS V LGGP W+
Sbjct  88    SSFKGEKTAGPNNNSVRGFNVVDDIKAKVEKVCPGVVSCADIVAIAARDSVVILGGPDWD  147

Query  536   VKLGRRDARTASQAAANNS-IPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  712
             VKLGRRD++TAS +AAN+  IPPPTS L++LI+ F A GLS  DMV LSG+HTIG+ARC 
Sbjct  148   VKLGRRDSKTASFSAANSGVIPPPTSTLSQLINRFQARGLSAKDMVALSGAHTIGKARCI  207

Query  713   NFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
              FRARIYNE+NIDSSFA++R+ +CPR SGSGDNNLAPLD+ TP  FD NY+ NL+N+KGL
Sbjct  208   LFRARIYNETNIDSSFAKARRSSCPRTSGSGDNNLAPLDIGTPDSFDTNYFQNLLNQKGL  267

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNN  1036
             LHSDQ LFNG STDS V+ YS+    F SDF  AMIKMGDI PLTG++
Sbjct  268   LHSDQILFNGGSTDSLVKTYSSRTKTFYSDFVTAMIKMGDITPLTGSS  315


 Score =   397 bits (1020),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 192/270 (71%), Positives = 222/270 (82%), Gaps = 2/270 (1%)
 Frame = +2

Query  239   SVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTSSFTGEKRAAPNFQSARGFEV  418
             S V+SA+ KE RMGASL+RLFFHDCFVNGCDGSILLDDTSSF GEK AAPN  S RGF V
Sbjct  314   SSVKSAVSKEPRMGASLVRLFFHDCFVNGCDGSILLDDTSSFIGEKTAAPNNNSVRGFHV  373

Query  419   IDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVKLGRRDARTASQAAANNS--  592
             +D IKS VEKVCPG+VSCADILAIA+RDS V LGGP W VKLGRRD++TA+  AA N   
Sbjct  374   VDDIKSEVEKVCPGIVSCADILAIAARDSVVLLGGPGWEVKLGRRDSKTANFTAAKNGGF  433

Query  593   IPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFRARIYNESNIDSSFAQSR  772
             IP PTSNL+ LISSF   GLS  DMV LSG+HTIG+ARCT FR+RIYNE+NIDSSFA++R
Sbjct  434   IPSPTSNLSALISSFRVQGLSAKDMVALSGAHTIGKARCTVFRSRIYNEANIDSSFAETR  493

Query  773   KGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHSDQQLFNGVSTDSTVRGY  952
             + NCP ASGSGD+NLAPLD++TP  FD  Y+ NL+NK+GLLHSDQ LFNG STDS V+ Y
Sbjct  494   RRNCPSASGSGDDNLAPLDVRTPDCFDKKYFQNLMNKQGLLHSDQVLFNGGSTDSLVKKY  553

Query  953   STNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
              ++   F+SDF  A+IKMGD+KPLTG+ GE
Sbjct  554   GSSTKAFNSDFVTAIIKMGDVKPLTGSRGE  583



>ref|XP_010067588.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=321

 Score =   417 bits (1073),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 204/292 (70%), Positives = 233/292 (80%), Gaps = 7/292 (2%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  +Y+++CP LF TV S+V+ AI KEARMGASLLRLFFHDCFVNGCDGS LLDDT
Sbjct  25    SAQLSIFYYTETCPDLFPTVQSIVQEAIAKEARMGASLLRLFFHDCFVNGCDGSNLLDDT  84

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
              +FTGEK AAPN  S RGF+V+DQIKSAVE+VCP +VSCAD+LAI SRD+   LGGP W+
Sbjct  85    PTFTGEKNAAPNRNSLRGFDVVDQIKSAVEEVCPSIVSCADLLAIISRDAVEILGGPGWD  144

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFS---AVGLSTNDMVVLSGSHTIGQAR  706
             VKLGRRDART    AAN SIPPPT+NL+ LIS F      GLS  D+V L G+HT+GQAR
Sbjct  145   VKLGRRDART----AANVSIPPPTNNLSALISGFQNHGLYGLSQQDLVALYGAHTVGQAR  200

Query  707   CTNFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKK  886
             CTNFRARIYNESNIDSSFAQ+ K NCP  +G GDNNL  LD Q+   FDN YYVNL+ K+
Sbjct  201   CTNFRARIYNESNIDSSFAQAMKSNCPSVTGVGDNNLDGLDYQSATSFDNTYYVNLMRKR  260

Query  887   GLLHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             GLLHSDQQLFNG STDS +R Y+ +   F  DFAA+MI MGDIKPLTG+NGE
Sbjct  261   GLLHSDQQLFNGGSTDSLIRTYAQSQDTFFKDFAASMINMGDIKPLTGSNGE  312



>ref|NP_001169614.1| uncharacterized protein LOC100383495 precursor [Zea mays]
 gb|ACN34270.1| unknown [Zea mays]
Length=332

 Score =   417 bits (1073),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 199/292 (68%), Positives = 237/292 (81%), Gaps = 3/292 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS GFYS SCP +   V SV+++AI +E RMGAS+LRLFFHDCFV GCD S+LLDDT
Sbjct  32    SAQLSTGFYSHSCPGVHDAVRSVLQAAIAREQRMGASILRLFFHDCFVQGCDASLLLDDT  91

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
              SF GEK A PN  S RGFEVID IKSAV+K CPGVVSCADILAIA+RDS VTLGGP+W+
Sbjct  92    PSFQGEKMAKPNNGSVRGFEVIDAIKSAVDKACPGVVSCADILAIAARDSVVTLGGPNWD  151

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRD+RTAS + ANN+IPPPTS L  L S F+A GLS  DMV LSG+HTIGQARCTN
Sbjct  152   VKLGRRDSRTASFSGANNNIPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQARCTN  211

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGS---GDNNLAPLDLQTPIKFDNNYYVNLVNKK  886
             FRA +YN++NID +FA++R+  CP A+ S   GDNNLAPLDLQTP  F+N+YY NLV +K
Sbjct  212   FRAHVYNDTNIDGAFARARRSVCPAAASSGSGGDNNLAPLDLQTPTVFENDYYRNLVCRK  271

Query  887   GLLHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             GLLHSDQ+LFNG +TD+ V+ Y ++ + F +DF A M+KMGDI PLTG++GE
Sbjct  272   GLLHSDQELFNGAATDAQVQAYVSSQSAFFADFVAGMVKMGDISPLTGSSGE  323



>ref|XP_011080738.1| PREDICTED: peroxidase 4-like [Sesamum indicum]
Length=329

 Score =   417 bits (1072),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 212/291 (73%), Positives = 238/291 (82%), Gaps = 2/291 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FY KSCP +F  VNSVV+SA+QKE RMGASLLRL FHDCFV GCDGSILLDDT
Sbjct  30    SAQLSTDFYEKSCPNVFSVVNSVVKSAVQKEKRMGASLLRLHFHDCFVQGCDGSILLDDT  89

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGEK A PN  S RG+EVID IKS VE  CPGV+SCADI+AIA+RDS V LGGP+W 
Sbjct  90    SSFTGEKTAGPNINSVRGYEVIDSIKSKVEATCPGVISCADIVAIAARDSVVLLGGPTWE  149

Query  536   VKLGRRDARTASQAAANN-SIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  712
             VK+GRRD++TAS +AANN  +PPPTS L  LI+ F A GLST DMVVLSG+H+IGQARCT
Sbjct  150   VKVGRRDSKTASLSAANNGQLPPPTSTLTNLINRFQAKGLSTKDMVVLSGAHSIGQARCT  209

Query  713   NFRARIYNE-SNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKG  889
              FR RIYNE SNIDSSFA+ R+GNCPR +GSGDNNLAPLDL+TP  FDN Y+ NL+ KKG
Sbjct  210   VFRDRIYNETSNIDSSFAKLRQGNCPRTNGSGDNNLAPLDLKTPTFFDNAYFKNLIAKKG  269

Query  890   LLHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LLHSDQ L+NG STDS V  YS NP  F+ DF AAMI+MGDI PLTG+ GE
Sbjct  270   LLHSDQVLYNGGSTDSLVESYSKNPQSFNGDFVAAMIRMGDITPLTGSKGE  320



>emb|CDP04065.1| unnamed protein product [Coffea canephora]
Length=316

 Score =   416 bits (1070),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 201/290 (69%), Positives = 227/290 (78%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FYSKSCPK+  T+ S V+SA+ KE RMGASL+RLFFHDCFV GCD SILLDDT
Sbjct  18    SAQLSTSFYSKSCPKVLGTIRSEVQSAVSKERRMGASLVRLFFHDCFVQGCDASILLDDT  77

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSF GEK A PN  S RGF VID IK  VEKVCPGVVSCADI+AIA+RDS V LGGPSW+
Sbjct  78    SSFKGEKTAFPNINSVRGFGVIDNIKEKVEKVCPGVVSCADIVAIAARDSIVILGGPSWD  137

Query  536   VKLGRRDARTASQAAANNS-IPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  712
             VKLGRRD++TAS + AN+  +P P S L  LI+ F AVGLS  DMV LSG+HTIGQARCT
Sbjct  138   VKLGRRDSKTASLSQANSGRLPGPASTLANLINRFQAVGLSAKDMVALSGAHTIGQARCT  197

Query  713   NFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             NFR RIYNE+ ID+SFA++R+  CP   G GDNNLAPLDLQTP  FD  Y+ NL+NKKGL
Sbjct  198   NFRTRIYNETKIDTSFAKTRRSQCPATVGRGDNNLAPLDLQTPTGFDTKYFQNLINKKGL  257

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQ L+NG STDS V  YS +   F+SDF  AMIKMGDI PLT + GE
Sbjct  258   LHSDQVLYNGGSTDSLVEKYSKDSKTFNSDFVKAMIKMGDINPLTRSQGE  307



>ref|XP_009402215.1| PREDICTED: peroxidase 4 {ECO:0000250|UniProtKB:Q42578}-like [Musa 
acuminata subsp. malaccensis]
Length=320

 Score =   416 bits (1069),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 200/291 (69%), Positives = 235/291 (81%), Gaps = 3/291 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             +A+LS  FYS SCP+L  TV SVVRSAI KE R+GAS+LRLFFHDCFV GCD S+LLDDT
Sbjct  22    AAELSTSFYSSSCPRLSSTVKSVVRSAISKEKRLGASILRLFFHDCFVLGCDASVLLDDT  81

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
              +F GEK A PN  S RGFEVIDQIK+AVEK CPGVVSCADILA+ASRDS V LGGP W+
Sbjct  82    PTFQGEKTAKPNNNSLRGFEVIDQIKNAVEKACPGVVSCADILAVASRDSVVILGGPYWD  141

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRD+R AS + AN  IPPPT +L++LIS FSA GLST DMV LSG+HTIGQARCT+
Sbjct  142   VKLGRRDSRKASFSKANKDIPPPTLSLSKLISKFSAKGLSTKDMVALSGAHTIGQARCTS  201

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR  IYN++NID SFA++R+ NCPR +GSGDNNLAPLDL+TP  FDN+YY NL+N +GLL
Sbjct  202   FRGHIYNDTNIDVSFAKTRRSNCPRTTGSGDNNLAPLDLRTPTHFDNSYYNNLINFQGLL  261

Query  896   HSDQQLFNGVS--TDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             H+DQQL+N +S    S V+ YS +   F SDF + MI MGDI+PLTG+ GE
Sbjct  262   HTDQQLYN-ISGFISSVVKAYSGSTHTFFSDFVSGMINMGDIRPLTGSEGE  311



>emb|CAA62597.1| korean-radish isoperoxidase [Raphanus sativus]
Length=315

 Score =   416 bits (1068),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 202/288 (70%), Positives = 239/288 (83%), Gaps = 2/288 (1%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQL+  FYS SCP L  TV S V+SA+  + RMGAS+LRLFFHDCFVNGCDGSILLDDTS
Sbjct  21    AQLTTNFYSTSCPNLLSTVKSGVKSAVSSQPRMGASILRLFFHDCFVNGCDGSILLDDTS  80

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
              FTGE+ A PN  SARGF VID IKSAVEK CPGVVSCADILAIA+RDS V LGGP+WNV
Sbjct  81    -FTGEQNAGPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVQLGGPNWNV  139

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             K+GRRDA+TASQAAAN++IP P+ +L++LISSF AVGLST DMV LSG+HTIGQ+RCTNF
Sbjct  140   KVGRRDAKTASQAAANSNIPAPSMSLSQLISSFRAVGLSTRDMVALSGAHTIGQSRCTNF  199

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R RIYNE+NI+++FA  R+ +CPRA+        PLD+ +P  FDN+Y+ NL+ ++GLLH
Sbjct  200   RTRIYNETNINAAFATLRQKSCPRAAFR-RRKPQPLDINSPTSFDNSYFKNLMAQRGLLH  258

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ LFNG STDS VRGYS +P+ F+SDFAAAMIKMGDI PLTG++GE
Sbjct  259   SDQVLFNGGSTDSIVRGYSNSPSSFNSDFAAAMIKMGDISPLTGSSGE  306



>ref|XP_010931330.1| PREDICTED: peroxidase 4-like [Elaeis guineensis]
Length=319

 Score =   416 bits (1068),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 195/287 (68%), Positives = 231/287 (80%), Gaps = 0/287 (0%)
 Frame = +2

Query  182   QLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTSS  361
              L+P FY+KSCPKLF TV  VV++AI KE RMGASLLRL FHDCFV GCD SILLDDT +
Sbjct  24    HLTPDFYAKSCPKLFSTVKPVVQAAIAKEKRMGASLLRLVFHDCFVQGCDASILLDDTPT  83

Query  362   FTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVK  541
             F GEK AAPN  S RGF+VID+IK+AVEKVCPGVVSCADIL I +RDS V LGGP W VK
Sbjct  84    FRGEKTAAPNNNSVRGFDVIDKIKAAVEKVCPGVVSCADILEITARDSVVILGGPFWEVK  143

Query  542   LGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFR  721
             LGRRD+ TAS + AN +IPPPTS+L+ LI+ F+A GLST DMV LSG+HTIG+ARC NFR
Sbjct  144   LGRRDSTTASFSLANQNIPPPTSSLSNLINKFAAQGLSTKDMVALSGAHTIGKARCINFR  203

Query  722   ARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHS  901
              RIYNE++I+S+FA+ R+ NCP+ +GSGDNNLAPLD+QTP  FDN+YY NL++K+GLLHS
Sbjct  204   NRIYNETDINSAFAKKRQANCPKTAGSGDNNLAPLDVQTPTYFDNDYYQNLIHKEGLLHS  263

Query  902   DQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             DQ L+NG STD  V+ YS +P  F  DF   MI + DI PLTG+ GE
Sbjct  264   DQVLYNGGSTDFQVKTYSISPGSFYHDFVVGMINIADINPLTGSKGE  310



>gb|AFR44628.1| class III secretory peroxidase [Ginkgo biloba]
 gb|AGN03453.1| class III peroxidase [Ginkgo biloba]
Length=316

 Score =   415 bits (1067),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 200/287 (70%), Positives = 231/287 (80%), Gaps = 2/287 (1%)
 Frame = +2

Query  182   QLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTSS  361
             QLSP FY+KSCP +  TV S V+ A+ KEARMGASLLRL FHDCFVNGCDGSILLDD+S+
Sbjct  23    QLSPTFYAKSCPNVLSTVKSAVKQAVAKEARMGASLLRLHFHDCFVNGCDGSILLDDSST  82

Query  362   FTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVK  541
              TGEK A PN  SARGF+VID IKS VE VC GVVSCADIL IA+RDS V LGGPSW V 
Sbjct  83    LTGEKTAVPNANSARGFDVIDNIKSQVEAVCSGVVSCADILTIAARDSVVELGGPSWAVP  142

Query  542   LGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFR  721
             LGRRD+RTAS + ANN+IPPPTS+L  L+S F A GLST DMV L+G HTIGQARCT+FR
Sbjct  143   LGRRDSRTASLSGANNNIPPPTSSLANLMSKFQAQGLSTKDMVALAGGHTIGQARCTSFR  202

Query  722   ARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHS  901
             A IYN++NID+++A S K  CPR +GS DNN++PLD+ TP  FDNNY+ NL  KKGLLHS
Sbjct  203   AHIYNDTNIDTTYANSLKAKCPR-TGS-DNNISPLDVVTPTSFDNNYFKNLRAKKGLLHS  260

Query  902   DQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             DQ+LFNG STDS V  Y T+P  F +DFA +M+KMG+IKPLTG NGE
Sbjct  261   DQELFNGGSTDSQVTSYVTSPITFRNDFATSMVKMGNIKPLTGTNGE  307



>ref|NP_001151940.1| peroxidase 52 precursor [Zea mays]
 gb|ACG45093.1| peroxidase 52 precursor [Zea mays]
Length=334

 Score =   415 bits (1067),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 200/291 (69%), Positives = 235/291 (81%), Gaps = 2/291 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS GFYS SCP ++  V SVV+SA+  E RMGAS++RLFFHDCFV GCD S+LLDDT
Sbjct  35    SAQLSTGFYSSSCPGVYDAVKSVVQSAVASEQRMGASIVRLFFHDCFVQGCDASLLLDDT  94

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
              SF GEK A PN  S RGFEVID +KSAVEKVCPGVVSCADILAIA+RDS V LGGP+W+
Sbjct  95    PSFQGEKMANPNNGSVRGFEVIDAVKSAVEKVCPGVVSCADILAIAARDSVVILGGPTWD  154

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VK+GRRD+ TAS + ANN+IPPPTS L  L S F+A GLS  DMV LSG+HTIGQARCTN
Sbjct  155   VKVGRRDSTTASFSGANNNIPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQARCTN  214

Query  716   FRARIYNESNIDSSFAQSRKGNCPR--ASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKG  889
             FRA +YN++NID SFA++R+  CPR  +  SGDNNLAPLDLQTP  FDNNYY NLV KKG
Sbjct  215   FRAHVYNDTNIDGSFARTRQSGCPRSSSGSSGDNNLAPLDLQTPTVFDNNYYKNLVCKKG  274

Query  890   LLHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LLHSDQ+LFNG +TD+ V+ Y++  ++F SDF   M+KMGDI PLTG+ G+
Sbjct  275   LLHSDQELFNGGATDALVQSYASGQSEFFSDFVTGMVKMGDITPLTGSGGQ  325



>ref|XP_006662662.1| PREDICTED: peroxidase 4-like [Oryza brachyantha]
Length=324

 Score =   414 bits (1065),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 199/289 (69%), Positives = 227/289 (79%), Gaps = 0/289 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             S QLS  FYS SCP +F  V   ++SAI +E R+GAS++RLFFHDCFV GCD S+LLDDT
Sbjct  27    SVQLSESFYSYSCPGVFDAVKGGMQSAIAQEKRIGASIVRLFFHDCFVQGCDASLLLDDT  86

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
              SF GEK A PN  S RGFEVID IKSAVE +CP VVSCADILAIA+RDS   LGGPSW+
Sbjct  87    PSFQGEKTATPNNGSVRGFEVIDAIKSAVETICPAVVSCADILAIAARDSVAILGGPSWD  146

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRD+RTAS + ANN+IPPPTS L  L S F+A GLS  DMV LSGSHTIGQARCTN
Sbjct  147   VKLGRRDSRTASFSGANNNIPPPTSGLANLTSFFAAQGLSQTDMVALSGSHTIGQARCTN  206

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FRA IYNE+NID  FA  R+  CP  SGSGD+NLAPLDLQTP  F+NNYY NLV +KGLL
Sbjct  207   FRAHIYNETNIDVGFAMMRQSGCPSTSGSGDSNLAPLDLQTPTVFENNYYKNLVVQKGLL  266

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQ+LFNG +TDS V+ Y ++ + F +DF   MIKMGDI PLTG+NGE
Sbjct  267   HSDQELFNGGATDSLVQTYISSQSTFFADFVTGMIKMGDISPLTGSNGE  315



>ref|NP_001131000.1| uncharacterized protein LOC100192105 precursor [Zea mays]
 gb|ACF79421.1| unknown [Zea mays]
 gb|ACL53914.1| unknown [Zea mays]
Length=320

 Score =   414 bits (1064),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 200/291 (69%), Positives = 237/291 (81%), Gaps = 2/291 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS GFYS SCP ++  V SV++SAI +E RMGAS+LRLFFHDCFV GCD S+LLDDT
Sbjct  21    SAQLSTGFYSYSCPGVYGAVKSVMQSAIAREKRMGASILRLFFHDCFVQGCDASLLLDDT  80

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
              SF GEK A PN  S RGFEVID +KSAVEK+CPGVVSCADILAIA+RDS V LGGP+W+
Sbjct  81    PSFQGEKMANPNNGSVRGFEVIDAVKSAVEKLCPGVVSCADILAIAARDSVVILGGPTWD  140

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VK+GRRD+ TAS + ANN+IPPPTS L  L S F+A GLS  DMV LSG+HTIGQARCTN
Sbjct  141   VKVGRRDSTTASFSGANNNIPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQARCTN  200

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGS-GDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             FRA IYN+++ID++FA++R+  CP  SG+ GDNNLAPLDLQTP  F+NNYY NL+ KKGL
Sbjct  201   FRAHIYNDTDIDAAFARTRQSGCPSTSGAGGDNNLAPLDLQTPTVFENNYYRNLLAKKGL  260

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTG-NNGE  1042
             LHSDQ+LFNG +TD+ V+ Y  + + F +DF A MIKMGDI PLTG NNG+
Sbjct  261   LHSDQELFNGGATDALVQSYVGSQSAFFADFVAGMIKMGDITPLTGSNNGQ  311



>gb|AAR31106.1| peroxidase precursor [Quercus suber]
Length=330

 Score =   414 bits (1065),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 202/291 (69%), Positives = 231/291 (79%), Gaps = 2/291 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SA+LS  FY KSCPK+F TV SVV SAI K+ R GASLLRL FHDCFVNGCDGS+LLDDT
Sbjct  30    SAKLSTNFYYKSCPKVFSTVQSVVHSAISKQPRQGASLLRLHFHDCFVNGCDGSVLLDDT  89

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
              +FTGEK A PN  S RGFE +D+IKS VEK CPGVVSCADILAIA+RDS   LGGP W+
Sbjct  90    PTFTGEKTAGPNKGSIRGFEFVDEIKSKVEKECPGVVSCADILAIAARDSVKILGGPKWD  149

Query  536   VKLGRRDARTASQAAANNS-IPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  712
             VKLGRRD++TAS  AAN+  IPPPTS L+ LI+ F A GLST DMV LSG+HTIGQARCT
Sbjct  150   VKLGRRDSKTASLKAANSGVIPPPTSTLSNLINRFKAKGLSTKDMVALSGAHTIGQARCT  209

Query  713   NFRARIYNESNIDSSFAQSRKGNCPRASG-SGDNNLAPLDLQTPIKFDNNYYVNLVNKKG  889
              FR RIY + NIDSSFA++R+  CP+ +G  GDN +APLDLQTP  FDN YY NL+ +KG
Sbjct  210   VFRDRIYKDKNIDSSFAKTRQNTCPKTTGLPGDNKIAPLDLQTPTAFDNYYYKNLIKQKG  269

Query  890   LLHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LL SDQQLFNG STDS V+ YS +   F SDF  AMIKMGDI+PLTG++GE
Sbjct  270   LLRSDQQLFNGGSTDSLVKKYSQDTKSFYSDFVNAMIKMGDIQPLTGSSGE  320



>gb|AAR31108.1| peroxidase precursor [Quercus suber]
Length=330

 Score =   414 bits (1064),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 202/291 (69%), Positives = 232/291 (80%), Gaps = 2/291 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SA+LS  FYSKSCPK+F TV SVV SA+ K+ R GASLLRL FHDCFVNGCDGSILLDDT
Sbjct  30    SAKLSTNFYSKSCPKVFSTVQSVVHSAVSKQPRQGASLLRLHFHDCFVNGCDGSILLDDT  89

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
              +FTGEK A PN  S R FEV+D+IKS VEK CPGVVSCADILAIA+RDS   LGGP W+
Sbjct  90    PTFTGEKTARPNNGSIRAFEVVDEIKSKVEKECPGVVSCADILAIAARDSVKILGGPKWD  149

Query  536   VKLGRRDARTASQAAANNS-IPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  712
             VKLGRRD++TAS +AAN+  IPPPTS L  LI+ F A GLST DMV LSG+HT+GQARCT
Sbjct  150   VKLGRRDSKTASFSAANSGVIPPPTSTLGNLINRFKAKGLSTKDMVALSGAHTVGQARCT  209

Query  713   NFRARIYNESNIDSSFAQSRKGNCPRASG-SGDNNLAPLDLQTPIKFDNNYYVNLVNKKG  889
              FR RIY + NIDSSFA++R+  CP+ +G  GDN +APLDLQTP  FDN YY NL+ +KG
Sbjct  210   VFRDRIYKDKNIDSSFAKTRQNKCPKTTGLPGDNKIAPLDLQTPTAFDNYYYKNLIKEKG  269

Query  890   LLHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LL SDQQLFNG STDS V+ YS +   F SDF  AMIKMGDI+PLTG++GE
Sbjct  270   LLRSDQQLFNGGSTDSLVKKYSQDTKTFYSDFVNAMIKMGDIQPLTGSSGE  320



>ref|XP_006664870.1| PREDICTED: peroxidase 4-like [Oryza brachyantha]
Length=323

 Score =   413 bits (1062),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 199/289 (69%), Positives = 227/289 (79%), Gaps = 0/289 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FYS SCP +   V   ++SAI +E R+GAS++RLFFHDCFV GCD S+LLDDT
Sbjct  26    SAQLSASFYSYSCPGVLDVVKGGMQSAIAQEKRIGASIVRLFFHDCFVQGCDASLLLDDT  85

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
              SF GEK A PN  S RGFEVID IKSAVE +CP VVSCADILAIA+RDS   LGGPSW+
Sbjct  86    PSFQGEKTATPNNGSVRGFEVIDAIKSAVETICPAVVSCADILAIAARDSVAILGGPSWD  145

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRD+RTAS + ANN+IPPPTS L  L S F+A GLS  DMV LSGSHTIGQARCTN
Sbjct  146   VKLGRRDSRTASFSGANNNIPPPTSGLANLTSFFAAQGLSQTDMVALSGSHTIGQARCTN  205

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FRA IYNE+NID  FA  R+  CP  SGSGD+NLAPLDLQTP  F+NNYY NLV +KGLL
Sbjct  206   FRAHIYNETNIDGGFAMMRQSGCPSTSGSGDSNLAPLDLQTPTVFENNYYKNLVVQKGLL  265

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQ+LFNG +TDS V+ Y ++ + F +DF   MIKMGDI PLTG+NGE
Sbjct  266   HSDQELFNGGATDSLVQTYISSQSTFFADFVTGMIKMGDISPLTGSNGE  314



>gb|ABK21858.1| unknown [Picea sitchensis]
Length=326

 Score =   412 bits (1059),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 201/287 (70%), Positives = 228/287 (79%), Gaps = 2/287 (1%)
 Frame = +2

Query  182   QLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTSS  361
             QL P FY  SCP  F  VNSVV  A+ KE RMGASLLRL FHDCFVNGCDGSILLDDTS+
Sbjct  33    QLCPRFYDISCPSAFSIVNSVVTQAVAKEKRMGASLLRLHFHDCFVNGCDGSILLDDTST  92

Query  362   FTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVK  541
             F GEK A PN  S RGFEVID IK+ VE  CPGVVSCADI+AIA+RD+ V LGGP+W V 
Sbjct  93    FQGEKTAVPNKNSVRGFEVIDAIKTQVEAACPGVVSCADIVAIAARDAVVQLGGPTWLVL  152

Query  542   LGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFR  721
             LGRRD+ TAS +AAN+++PPP SNL+ LISSF + GLS  D+V LSGSHTIGQARCTNFR
Sbjct  153   LGRRDSTTASLSAANSNLPPPASNLSALISSFQSHGLSIRDLVALSGSHTIGQARCTNFR  212

Query  722   ARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHS  901
              RI++ESNID SFA++R+ NCP  S  GD+NLAPLDL TP  FDNNYY NL  ++GLLHS
Sbjct  213   NRIHSESNIDLSFARARQANCP--STGGDDNLAPLDLLTPTTFDNNYYKNLERRRGLLHS  270

Query  902   DQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             DQQLFNG STD+ V  Y+T P  FS DFA AM+KMG I+PLTGNNGE
Sbjct  271   DQQLFNGGSTDNLVSFYTTYPIAFSIDFAVAMVKMGSIEPLTGNNGE  317



>gb|ACN33662.1| unknown [Zea mays]
Length=320

 Score =   412 bits (1058),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 199/291 (68%), Positives = 237/291 (81%), Gaps = 2/291 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS GFYS SCP ++  V SV++SAI +E RMGAS+LRLFFHDCFV GCD S+LLDDT
Sbjct  21    SAQLSTGFYSYSCPGVYGAVKSVMQSAIAREKRMGASILRLFFHDCFVQGCDASLLLDDT  80

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
              SF GEK A PN  S RGFEVID +KSAVEK+CPGVVSCADILAIA+RDS V LGGP+W+
Sbjct  81    PSFQGEKMANPNNGSVRGFEVIDAVKSAVEKLCPGVVSCADILAIAARDSVVILGGPTWD  140

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VK+GRRD+ TAS + ANN+IPPPTS L  L S F+A GLS  DMV LSG+HTIGQARCTN
Sbjct  141   VKVGRRDSTTASFSGANNNIPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQARCTN  200

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGS-GDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             FRA IYN+++ID++FA++R+  CP  SG+ GD+NLAPLDLQTP  F+NNYY NL+ KKGL
Sbjct  201   FRAHIYNDTDIDAAFARTRQSGCPSTSGAGGDSNLAPLDLQTPTVFENNYYRNLLAKKGL  260

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTG-NNGE  1042
             LHSDQ+LFNG +TD+ V+ Y  + + F +DF A MIKMGDI PLTG NNG+
Sbjct  261   LHSDQELFNGGATDALVQSYVGSQSAFFADFVAGMIKMGDITPLTGSNNGQ  311



>ref|XP_007205544.1| hypothetical protein PRUPE_ppa008590mg [Prunus persica]
 gb|EMJ06743.1| hypothetical protein PRUPE_ppa008590mg [Prunus persica]
Length=326

 Score =   412 bits (1058),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 200/292 (68%), Positives = 241/292 (83%), Gaps = 3/292 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SA+LS  FYSKSCPK+F  V SVV+SA+ KE RMGASLLRL FHDCFV+GCDGS+LLDDT
Sbjct  26    SAKLSTKFYSKSCPKVFNAVKSVVQSAVHKEKRMGASLLRLHFHDCFVHGCDGSLLLDDT  85

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGEK A+PN  S RGF+V+D+IKS VEK CPGVVSCADILAIA+RDS   LGGPSW+
Sbjct  86    SSFTGEKTASPNNNSLRGFKVVDKIKSQVEKTCPGVVSCADILAIAARDSVKILGGPSWH  145

Query  536   VKLGRRDARTASQAAANNS--IPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARC  709
             VKLGRRD++TAS  AAN S  +P PTS L++L + F AVGL+  D+V LSG+HTIG+A+C
Sbjct  146   VKLGRRDSKTASFFAANRSGVLPSPTSTLSQLKTRFQAVGLNERDLVALSGAHTIGKAQC  205

Query  710   TNFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKG  889
             ++FR RIYN++NID+SFA++R+  CP   GSGDN+LAPLD+QTP  FD  Y+ NL+N+KG
Sbjct  206   SSFRDRIYNDTNIDASFAKARQRKCPSTVGSGDNHLAPLDVQTPNTFDTAYFKNLINQKG  265

Query  890   LLHSDQQLF-NGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LLHSDQ L+ NG STDS V+ YS +   F+SDFA AMIKMGDIKPLTG+NGE
Sbjct  266   LLHSDQVLYNNGGSTDSLVKTYSGSANAFNSDFAKAMIKMGDIKPLTGSNGE  317



>gb|AAB48184.1| peroxidase precursor [Linum usitatissimum]
Length=323

 Score =   410 bits (1055),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 201/289 (70%), Positives = 230/289 (80%), Gaps = 1/289 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
              QLS  FYS+SCP L  TV   V SA+ KE R+ ASLLRL FHDCFVNGCDGSILL+DT 
Sbjct  26    GQLSTDFYSESCPMLMDTVRCEVESAVDKETRIAASLLRLHFHDCFVNGCDGSILLEDTD  85

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGE+ AAPN  S RG+ VI+ IKS VE+VCPGVVSCADI+AIA+RDSTV  GG SW V
Sbjct  86    SFTGEQTAAPNNGSVRGYYVIEDIKSKVEQVCPGVVSCADIVAIAARDSTVIAGGQSWEV  145

Query  539   KLGRRDARTASQAAANNSI-PPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             K+GRRD++TAS  AAN+ + P PTS+LN LI SF   GLS NDMVVLSGSHTIG ARC +
Sbjct  146   KVGRRDSKTASFNAANSGVLPAPTSSLNELIKSFGDQGLSANDMVVLSGSHTIGVARCVS  205

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR RIYNE+NID SFA   + NCP A  SGD+NLAPLDL+TP  FDNNYY NL+ +KGLL
Sbjct  206   FRDRIYNETNIDPSFASQSEENCPLAPNSGDDNLAPLDLKTPTSFDNNYYNNLIEQKGLL  265

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQ LFNG STDS VR YS +P +F++DFAAAM+KMGDIKPLTG+ GE
Sbjct  266   HSDQVLFNGGSTDSLVRSYSQSPKRFAADFAAAMVKMGDIKPLTGSQGE  314



>ref|XP_002489046.1| hypothetical protein SORBIDRAFT_0246s002010 [Sorghum bicolor]
 gb|EES20431.1| hypothetical protein SORBIDRAFT_0246s002010 [Sorghum bicolor]
Length=320

 Score =   410 bits (1054),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 193/288 (67%), Positives = 229/288 (80%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS GFYS SCP L+  V  VV+SAI  E R+GAS++RLFFHDCFV GCD S+LLDDT+
Sbjct  24    AQLSTGFYSSSCPGLYSAVKPVVQSAIDSEKRVGASIVRLFFHDCFVQGCDASLLLDDTA  83

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             +F GEK A PN  S RGFEVID  KSAVE VCPGVVSCADILAIA+RDS V LGGPSW+V
Sbjct  84    TFQGEKMATPNNGSVRGFEVIDAAKSAVENVCPGVVSCADILAIAARDSVVILGGPSWDV  143

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             K+GRRD+ TAS + ANN+IPPPTS L  L S F+A GLS  DMV LSG+HTIGQARCTNF
Sbjct  144   KVGRRDSTTASFSGANNNIPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQARCTNF  203

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R  IYN++N+D +FA++R+  CP  SG+GDNNLAPLDLQTP  F+N+YY NLV+  GLLH
Sbjct  204   RDHIYNDTNVDGAFARTRQSGCPSTSGTGDNNLAPLDLQTPTVFENDYYKNLVSNMGLLH  263

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ+LFNG +TD+ V+ Y ++ + F +DF   MIKMGDI PLTG+ GE
Sbjct  264   SDQELFNGGATDALVQSYVSSQSAFFADFVTGMIKMGDITPLTGSAGE  311



>ref|XP_008782619.1| PREDICTED: cationic peroxidase 1-like [Phoenix dactylifera]
Length=320

 Score =   410 bits (1054),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 203/290 (70%), Positives = 232/290 (80%), Gaps = 3/290 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLSP FY  SCPK   T+ S V++A+ KE RMGASLLRL FHDCFV GCDGS+LLDDT
Sbjct  24    SAQLSPTFYDTSCPKALSTIQSAVKAAVAKERRMGASLLRLHFHDCFVQGCDGSVLLDDT  83

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             S+FTGEK A PN  S RGF+VID IKS VE VC   VSCADILA+A+RDS V LGGPSW 
Sbjct  84    STFTGEKTAGPNNNSIRGFDVIDTIKSRVEAVCKQTVSCADILAVAARDSVVALGGPSWT  143

Query  536   VKLGRRDARTASQAAANNSIPPP-TSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  712
             V+LGRRD+ TAS + AN+ IP P TS+L+ LIS+FS  GL+T+DMV LSG+HTIGQARCT
Sbjct  144   VQLGRRDSTTASLSLANSDIPSPITSDLSALISAFSKKGLATSDMVALSGAHTIGQARCT  203

Query  713   NFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             +FR RIYNE+NIDSSFA S + NCP  SG GD+NLAPLD+ TP  FDN YY NL+NKKGL
Sbjct  204   SFRNRIYNETNIDSSFATSLQSNCP-VSG-GDSNLAPLDVSTPTIFDNFYYRNLLNKKGL  261

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQQLFNG STDS V  YSTN  KF SDFA+AM+ MG+I PLTG +GE
Sbjct  262   LHSDQQLFNGGSTDSQVSSYSTNSAKFFSDFASAMVNMGNISPLTGTSGE  311



>gb|AAD43561.1|AF155124_1 bacterial-induced peroxidase precursor [Gossypium hirsutum]
Length=316

 Score =   409 bits (1050),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 194/288 (67%), Positives = 228/288 (79%), Gaps = 2/288 (1%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLSP FY+ SCP L   V + +  A+ +E R+GAS+LRLFFHDCFVNGCDGSILLDDT+
Sbjct  22    AQLSPNFYASSCPNLQTIVRNAMSRAVNRETRIGASILRLFFHDCFVNGCDGSILLDDTA  81

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             +FTGEK A PN  SARGFEVID IK+ VE  C   VSCADILA+A+RD    LGGP+W V
Sbjct  82    TFTGEKNAVPNRNSARGFEVIDTIKTNVEAACSATVSCADILALAARDGVALLGGPTWQV  141

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
              LGRRDARTASQ+AANN IP P +NL  L SSF+A GLST D+  LSG HTIG ARCT F
Sbjct  142   PLGRRDARTASQSAANNQIPSPFANLATLTSSFAAKGLSTRDLTALSGGHTIGLARCTTF  201

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R RIYN++NID++FA +R+ NCP ASG GDNNLAPLD+QTP +FDN+Y+ NLV ++GLLH
Sbjct  202   RGRIYNDTNIDANFAATRRANCP-ASG-GDNNLAPLDIQTPTRFDNDYFRNLVARRGLLH  259

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ+LFNG S D+ VR YS NP  FS+DFAAAM+KMG+I PLTG  GE
Sbjct  260   SDQELFNGGSQDALVRTYSNNPATFSADFAAAMVKMGNISPLTGTQGE  307



>emb|CAL25300.1| properoxidase [Picea abies]
Length=310

 Score =   408 bits (1048),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 194/288 (67%), Positives = 226/288 (78%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
              QLS  FY++SCP     V + VR A+  E RMGASLLRL FHDCFVNGCDGS+LLDD+S
Sbjct  14    GQLSSTFYAQSCPTALSVVKAAVRQAVANEKRMGASLLRLHFHDCFVNGCDGSVLLDDSS  73

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             + TGEK A PN  SARGF+VID IKS VEK C GVVSCADILAI++RDS V LGGPSW V
Sbjct  74    TITGEKTANPNANSARGFDVIDTIKSNVEKACSGVVSCADILAISARDSVVELGGPSWTV  133

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
              LGRRD+ TAS+  ANN+IPPPTS+L+ LIS F A GLST +MV LSG HTIGQARC NF
Sbjct  134   MLGRRDSTTASKNGANNNIPPPTSSLSNLISLFQAQGLSTKEMVALSGGHTIGQARCVNF  193

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             RA IYNE+NIDS+++ S +  CP  +GSGD+NL+PLD  TP  FD NYY NL +KKGLLH
Sbjct  194   RAHIYNETNIDSTYSTSLQSKCPSTAGSGDSNLSPLDYVTPTAFDKNYYSNLKSKKGLLH  253

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ+LFNG STDS V  Y++N   F SDFAAAM+KMG+IKPLTG +G+
Sbjct  254   SDQELFNGGSTDSQVTTYASNQNSFFSDFAAAMVKMGNIKPLTGTSGQ  301



>ref|XP_009408894.1| PREDICTED: peroxidase P7-like [Musa acuminata subsp. malaccensis]
Length=318

 Score =   407 bits (1047),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 196/287 (68%), Positives = 227/287 (79%), Gaps = 2/287 (1%)
 Frame = +2

Query  182   QLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTSS  361
             QLSP FY  +CP L   V S +R A+ KE RMGAS+LRLFFHDCFVNGCDGSILLDDTSS
Sbjct  25    QLSPTFYGSTCPNLQSIVRSAMRQAVNKEPRMGASILRLFFHDCFVNGCDGSILLDDTSS  84

Query  362   FTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVK  541
             FTGEK A PN  SARGFEVID IKS VE  C   VSCADILA+A+RD  V LGGP+W V+
Sbjct  85    FTGEKSAGPNANSARGFEVIDTIKSNVEAACKATVSCADILALAARDGVVLLGGPTWTVQ  144

Query  542   LGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFR  721
             LGRRDA TASQ+AAN+++P P S+L++LISSF+A GLS  DM  LSG+HTIGQARCT+FR
Sbjct  145   LGRRDATTASQSAANSNLPGPGSSLSQLISSFAAKGLSARDMTALSGAHTIGQARCTSFR  204

Query  722   ARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHS  901
             + IYN++N+++SFA  RK NCP  S  GD NLAPLDLQTP  FDN YY NLV +KGLLHS
Sbjct  205   SHIYNDANVNASFAALRKQNCP--SSGGDGNLAPLDLQTPTTFDNKYYQNLVVRKGLLHS  262

Query  902   DQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             DQ+LFNG S DS V+ YSTNP  F+ DF AAM+KMG+I PLTG  G+
Sbjct  263   DQELFNGGSQDSLVQQYSTNPAVFNGDFTAAMVKMGNISPLTGTKGQ  309



>gb|ABR18139.1| unknown [Picea sitchensis]
Length=327

 Score =   408 bits (1048),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 202/288 (70%), Positives = 225/288 (78%), Gaps = 2/288 (1%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
              QL P FY KSCP +   VNSVV  A+ KE RMGASLLRL FHDCFVNGCDGSILLDDTS
Sbjct  33    GQLCPDFYDKSCPNVLSIVNSVVMQAVAKEKRMGASLLRLHFHDCFVNGCDGSILLDDTS  92

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             +FTGEK A PN  S RGF+VID IK+ VE  C GVVSCADI+AIA+RDS V LGGP+W V
Sbjct  93    TFTGEKTANPNNNSVRGFDVIDTIKTQVEATCSGVVSCADIVAIAARDSVVQLGGPTWTV  152

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
              LGRRD+ +AS++AANN+IPPPTSNL+ LIS F A GL+T DMV LSGSHTIGQARCTNF
Sbjct  153   MLGRRDSTSASKSAANNNIPPPTSNLSALISFFQAQGLTTEDMVALSGSHTIGQARCTNF  212

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R RIYNESNI   FA  RK NCP     GDNNLAPLDL TP  FDN+YY NL  + GLLH
Sbjct  213   RNRIYNESNIALLFAGLRKANCPVT--GGDNNLAPLDLFTPTAFDNSYYNNLQFQNGLLH  270

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQQLF G STD+ V  Y+ +P  F +DFAAAM+KMG+IKPLT NNGE
Sbjct  271   SDQQLFKGGSTDNRVSFYAVHPDAFFNDFAAAMVKMGNIKPLTVNNGE  318



>ref|XP_009790966.1| PREDICTED: peroxidase P7-like [Nicotiana sylvestris]
Length=319

 Score =   405 bits (1040),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 193/288 (67%), Positives = 225/288 (78%), Gaps = 2/288 (1%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  FY  SC  L   V+S +R A+ +E R+GAS+LRLFFHDCFVNGCD SILLDDT+
Sbjct  25    AQLSANFYGTSCRNLQTIVSSAMRQAVNREPRLGASILRLFFHDCFVNGCDASILLDDTA  84

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             +FTGEK A PN  SARGFEVID IK+ VE  CP  VSCADILA+A+R+  V LGGPSW V
Sbjct  85    TFTGEKNANPNRNSARGFEVIDTIKTQVEAACPNAVSCADILALAAREGVVLLGGPSWAV  144

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
              LGRRDARTASQ+AAN  IP PTS+L+ L+S FSA GL+  DM  LSG HTIGQARCT F
Sbjct  145   PLGRRDARTASQSAANTQIPAPTSSLSTLLSMFSAKGLNARDMTALSGGHTIGQARCTTF  204

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R RIYN++NID+ FA +R+  CP  S SGD NLAPLD+QTP +FDN+YY NLV ++GLLH
Sbjct  205   RTRIYNDTNIDAQFAATRRATCP--SSSGDANLAPLDIQTPNRFDNDYYQNLVARRGLLH  262

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ+LFNG S D+ VR YSTN   F SDFAAAM++MG+I PLTG NGE
Sbjct  263   SDQELFNGGSQDALVRSYSTNDAAFRSDFAAAMVRMGNISPLTGTNGE  310



>ref|XP_007048724.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOX92881.1| Peroxidase superfamily protein [Theobroma cacao]
Length=320

 Score =   405 bits (1040),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 195/288 (68%), Positives = 228/288 (79%), Gaps = 2/288 (1%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLSP FY+ SCP L   V + +  A+ +E R+GAS+LRLFFHDCFVNGCD SILLDDT+
Sbjct  26    AQLSPKFYANSCPNLQTIVRNAMTQAVNRETRIGASILRLFFHDCFVNGCDASILLDDTA  85

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             +FTGEK AAPN  SARGFEVID IK++VE  C   VSCADILA+A+RD  V L GPSW V
Sbjct  86    TFTGEKNAAPNRNSARGFEVIDTIKTSVEAACSATVSCADILALAARDGVVLLKGPSWQV  145

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
              LGRRDARTASQ+AANN +P P SNL+ L SSF+A GLS  D+  LSG HTIG ARCT F
Sbjct  146   PLGRRDARTASQSAANNQLPSPFSNLSALTSSFAAKGLSARDLTALSGGHTIGLARCTTF  205

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R RIYN++NID +FA +R+ NCP ASG GDNNLAPLD+QTP +FDN Y+ NLV ++GLLH
Sbjct  206   RGRIYNDTNIDPNFAANRRANCP-ASG-GDNNLAPLDIQTPTRFDNYYFRNLVAQRGLLH  263

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ+LFNG S D+ VR YSTNP  FSSDFAAAM++MG+I PLTG  GE
Sbjct  264   SDQELFNGGSQDALVRTYSTNPEVFSSDFAAAMVRMGNISPLTGTRGE  311



>ref|XP_003615995.1| Peroxidase [Medicago truncatula]
 gb|AES98953.1| class III peroxidase [Medicago truncatula]
Length=326

 Score =   405 bits (1040),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 201/290 (69%), Positives = 229/290 (79%), Gaps = 2/290 (1%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             +QLS  FY+K CP +F+ VNSVV SA+ +E RMG SLLRL FHDCFVNGCDGS+LLDDT 
Sbjct  28    SQLSENFYAKKCPNVFKAVNSVVHSAVAREPRMGGSLLRLHFHDCFVNGCDGSVLLDDTP  87

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             S  GEK A PN  S RGFEVID IKS VE VCPGVVSCADI+AIA+RDS V LGGP W V
Sbjct  88    SNKGEKTALPNKDSLRGFEVIDAIKSKVESVCPGVVSCADIVAIAARDSVVNLGGPFWKV  147

Query  539   KLGRRDARTASQAAANNS-IPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             KLGRRD++TAS   AN+  IPPP S LN LI+ F A GLST DMV LSG+HTIG+ARCT 
Sbjct  148   KLGRRDSKTASLNDANSGVIPPPFSTLNNLINRFKAQGLSTKDMVALSGAHTIGKARCTV  207

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGS-GDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             +R RIYN++NIDS FA+SR+ NCPR SG+  DNN+A LD +TP  FDN YY NL+NKKGL
Sbjct  208   YRDRIYNDTNIDSLFAKSRQRNCPRKSGTIKDNNVAVLDFKTPNHFDNLYYKNLINKKGL  267

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQ+LFNG STDS V+ YS N   F SDFA AMIKMG+ KPLTG+NGE
Sbjct  268   LHSDQELFNGGSTDSLVKSYSNNQNAFESDFAIAMIKMGNNKPLTGSNGE  317



>ref|XP_010921098.1| PREDICTED: cationic peroxidase 1-like [Elaeis guineensis]
Length=319

 Score =   404 bits (1039),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 205/289 (71%), Positives = 233/289 (81%), Gaps = 2/289 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FY  SCP    T+ S V++A+ KEARMGASLLRL FHDCFV GCDGS+LLDDT
Sbjct  24    SAQLSSTFYDTSCPNALSTIQSAVKAAVAKEARMGASLLRLHFHDCFVQGCDGSVLLDDT  83

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             S+FTGEK A PN  S RGF+VID IKS VE VC   VSCADILA+A+RDS V LGGPSW 
Sbjct  84    STFTGEKTAKPNINSIRGFDVIDTIKSQVEAVCNQTVSCADILAVAARDSVVALGGPSWT  143

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             V LGRRD+ TAS + AN+ IPPPTS+L+ LIS+FS  GLST+DMV LSGSHTIGQARCT+
Sbjct  144   VLLGRRDSTTASLSLANSDIPPPTSDLSALISAFSKKGLSTSDMVALSGSHTIGQARCTS  203

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FRARIYNE+NIDSS+A S + NCP  SG GDNNL+PLD+ TP  FDN YY NLVNKKGLL
Sbjct  204   FRARIYNETNIDSSYATSLQSNCP-VSG-GDNNLSPLDVSTPTTFDNFYYRNLVNKKGLL  261

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQL+NG STDS V  Y+TN   F SDFAAAM+KMG+I PLTG++GE
Sbjct  262   HSDQQLYNGGSTDSQVSSYNTNSATFFSDFAAAMVKMGNISPLTGSSGE  310



>ref|XP_009593782.1| PREDICTED: peroxidase P7-like [Nicotiana tomentosiformis]
Length=319

 Score =   404 bits (1038),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 192/288 (67%), Positives = 225/288 (78%), Gaps = 2/288 (1%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  FY  SC  L   V+S +R A+ +E+R+GAS+LRLFFHDCFVNGCD SILLDDT+
Sbjct  25    AQLSANFYGTSCRNLQTIVSSAMRQAVNRESRLGASILRLFFHDCFVNGCDASILLDDTA  84

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             +FTGEK A PN  SARGFEVID IK+ VE  CP  VSCADILA+A+R+  V LGGPSW V
Sbjct  85    TFTGEKNANPNRNSARGFEVIDTIKTQVEAACPNAVSCADILALAAREGVVLLGGPSWAV  144

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
              LGRRDARTASQ+AAN  IP PTS+L+ L+S FSA GL+  DM  LSG HTIGQARCT F
Sbjct  145   PLGRRDARTASQSAANTQIPAPTSSLSTLLSMFSAKGLNARDMTALSGGHTIGQARCTTF  204

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R RIYN++NID+ FA +R+  CP  S  GD NLAPLD+QTP +FDN+YY NLV ++GLLH
Sbjct  205   RTRIYNDTNIDAQFATTRRATCP--SSGGDANLAPLDIQTPNRFDNDYYQNLVARRGLLH  262

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ+LFNG S D+ VR YSTN   F SDFAAAM++MG+I PLTG NGE
Sbjct  263   SDQELFNGGSQDALVRSYSTNGAAFRSDFAAAMVRMGNISPLTGTNGE  310



>ref|XP_009130879.1| PREDICTED: peroxidase 52-like [Brassica rapa]
 emb|CDY52147.1| BnaA03g55260D [Brassica napus]
Length=324

 Score =   404 bits (1039),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 197/288 (68%), Positives = 230/288 (80%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS GFYS SCP L   V + V SA+  + RMGASLLRLF+ DCFVNGCD SILLDDTS
Sbjct  28    AQLSQGFYSSSCPLLLPIVRTAVTSAVAFDPRMGASLLRLFYLDCFVNGCDASILLDDTS  87

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGE+ AA N  SARGF VID IKSAVE+VCPGVVSCADILAIA+RDS VTLGGP W +
Sbjct  88    SFTGEQNAASNHNSARGFNVIDNIKSAVERVCPGVVSCADILAIAARDSVVTLGGPRWRL  147

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
              LGRRDARTASQAAAN+SIP PTS+L++LI+SF+ +G +  +MV LSG+HTIGQA+C NF
Sbjct  148   NLGRRDARTASQAAANSSIPAPTSSLSQLITSFANLGFTAREMVALSGAHTIGQAQCRNF  207

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R RIY E+NID +FA +R+ NCP  SGSGD NLA LD  TP  FDN+Y+ NL++++GLLH
Sbjct  208   RTRIYQETNIDPTFAATRQQNCPITSGSGDGNLALLDSLTPFVFDNSYFRNLMSQRGLLH  267

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
              DQ LFNG STDS VR YS N   F +DFAAAM+KM  I PLTG++GE
Sbjct  268   FDQVLFNGGSTDSIVREYSQNARVFRNDFAAAMLKMSQISPLTGSDGE  315



>ref|XP_010246464.1| PREDICTED: peroxidase P7-like [Nelumbo nucifera]
Length=319

 Score =   404 bits (1037),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 193/288 (67%), Positives = 231/288 (80%), Gaps = 2/288 (1%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  FY+ +CP L   V + +R A+ +E R+GAS+LRLFFHDCFVNGCD SILLDDT+
Sbjct  25    AQLSTNFYANTCPNLPTIVRNGMRQAVNRERRLGASILRLFFHDCFVNGCDASILLDDTA  84

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             +FTGEK AAPN  SARGFEVID IKS VE  C   VSCADILA+A+RD  V LGGP+WNV
Sbjct  85    TFTGEKNAAPNRNSARGFEVIDSIKSQVEASCNATVSCADILALAARDGVVLLGGPTWNV  144

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
              LGRRDARTASQ+ AN+ IP P+ NL+ LIS F+A GLS  DM VLSG+HTIGQA+C  F
Sbjct  145   PLGRRDARTASQSGANSQIPGPSENLSSLISKFAAKGLSARDMTVLSGAHTIGQAQCRTF  204

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R RIYN++NID++FA +R+ NCP A+G GD NLAPLD+QTP +FDNNYY NLV ++GLLH
Sbjct  205   RNRIYNDTNIDANFAATRRANCP-ATG-GDANLAPLDIQTPARFDNNYYGNLVARRGLLH  262

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ+LFNG S DS VR YST+ T F+ DF+AAM++MG+I PLTG NGE
Sbjct  263   SDQELFNGGSQDSLVRSYSTDGTSFARDFSAAMVRMGNISPLTGTNGE  310



>ref|XP_003538328.1| PREDICTED: peroxidase 4-like [Glycine max]
Length=329

 Score =   404 bits (1037),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 196/290 (68%), Positives = 229/290 (79%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SA LS  FYSK+CP +F TV SVV+SA+ KE R+GAS++RLFFHDCFV GCDGSILLDDT
Sbjct  31    SATLSKNFYSKTCPNVFNTVKSVVKSAVAKEPRIGASIVRLFFHDCFVQGCDGSILLDDT  90

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
              +F GEK AA N  S RG+E+ID IKS VEK+CPGVVSCADIL IASRDS V LGGP WN
Sbjct  91    PTFQGEKTAAANNNSVRGYELIDDIKSKVEKICPGVVSCADILDIASRDSVVLLGGPFWN  150

Query  536   VKLGRRDARTASQAAANNS-IPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  712
             V+LGRRD+R+A+  AAN   IPPPTSNL  LI+ F   GLS  DMV LSG+HT G+ARCT
Sbjct  151   VRLGRRDSRSANFTAANTGVIPPPTSNLTNLITRFQDQGLSARDMVALSGAHTFGKARCT  210

Query  713   NFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             +FR RIYN++NID +FA +R+  CPR +G+GDNNLA LD +TP  FDNNY+ NL+ K+GL
Sbjct  211   SFRDRIYNQTNIDRTFALARQRRCPRTNGTGDNNLANLDFRTPNHFDNNYFKNLLIKRGL  270

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             L+SDQ LFNG STDS VR YS N   F SDF  AMI+MGDIKPLTG+ GE
Sbjct  271   LNSDQVLFNGGSTDSLVRTYSQNNKAFDSDFVKAMIRMGDIKPLTGSQGE  320



>gb|KHN46282.1| Peroxidase 4 [Glycine soja]
Length=330

 Score =   404 bits (1037),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 196/290 (68%), Positives = 229/290 (79%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SA LS  FYSK+CP +F TV SVV+SA+ KE R+GAS++RLFFHDCFV GCDGSILLDDT
Sbjct  32    SATLSKNFYSKTCPNVFNTVKSVVKSAVAKEPRIGASIVRLFFHDCFVQGCDGSILLDDT  91

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
              +F GEK AA N  S RG+E+ID IKS VEK+CPGVVSCADIL IASRDS V LGGP WN
Sbjct  92    PTFQGEKTAAANNNSVRGYELIDDIKSKVEKICPGVVSCADILDIASRDSVVLLGGPFWN  151

Query  536   VKLGRRDARTASQAAANNS-IPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  712
             V+LGRRD+R+A+  AAN   IPPPTSNL  LI+ F   GLS  DMV LSG+HT G+ARCT
Sbjct  152   VRLGRRDSRSANFTAANTGVIPPPTSNLTNLITRFQDQGLSARDMVALSGAHTFGKARCT  211

Query  713   NFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             +FR RIYN++NID +FA +R+  CPR +G+GDNNLA LD +TP  FDNNY+ NL+ K+GL
Sbjct  212   SFRDRIYNQTNIDRTFALARQRRCPRTNGTGDNNLANLDFRTPNHFDNNYFKNLLIKRGL  271

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             L+SDQ LFNG STDS VR YS N   F SDF  AMI+MGDIKPLTG+ GE
Sbjct  272   LNSDQVLFNGGSTDSLVRTYSQNNKAFDSDFVKAMIRMGDIKPLTGSQGE  321



>ref|XP_003527340.1| PREDICTED: peroxidase 52-like [Glycine max]
Length=319

 Score =   403 bits (1035),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 193/288 (67%), Positives = 233/288 (81%), Gaps = 2/288 (1%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLSP FY+K+CP +   V+S +R A+ KEAR+GAS+LRLFFHDCFVNGCDGSILLDDT+
Sbjct  25    AQLSPTFYAKTCPNVQTIVSSAMRQAVAKEARIGASILRLFFHDCFVNGCDGSILLDDTA  84

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             +FTGEK A PN  SARGFEVID IK+ VE  C   VSCADILA+A+RD  V LGGPSW V
Sbjct  85    TFTGEKNAGPNRNSARGFEVIDTIKTNVEASCNATVSCADILALATRDGIVLLGGPSWTV  144

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
              LGRRDARTASQ+AANN IP P+S+L+ LIS F++ GL+ +D+ VLSG+HTIGQA+C  F
Sbjct  145   PLGRRDARTASQSAANNQIPGPSSDLSTLISMFASKGLTASDLTVLSGAHTIGQAQCQFF  204

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R RIYNE+NID++FA +RK  CP A+G G+ NLAPL+  TP +FDNNYY +LVN++GLLH
Sbjct  205   RTRIYNETNIDTNFAATRKTTCP-ATG-GNTNLAPLETLTPTRFDNNYYADLVNRRGLLH  262

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ LFNG S DS VR YS N   FS DFAAAM+K+G+I PLTG++GE
Sbjct  263   SDQVLFNGGSQDSLVRSYSGNSAAFSKDFAAAMVKLGNISPLTGSSGE  310



>ref|XP_004234419.1| PREDICTED: peroxidase P7-like [Solanum lycopersicum]
Length=320

 Score =   403 bits (1035),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 196/288 (68%), Positives = 225/288 (78%), Gaps = 2/288 (1%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  FY  SCP L   V + +  A+ +EAR+GAS+LRLFFHDCFVNGCD SILLDDTS
Sbjct  26    AQLSANFYGTSCPNLQTIVRNAMTQAVNREARLGASILRLFFHDCFVNGCDASILLDDTS  85

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             +F GEK A PN  SARG+EVID IK+ VE  CP V+SCADILA+A+R+ TV LGGPSW V
Sbjct  86    TFIGEKNANPNRNSARGYEVIDTIKTQVEAACPNVISCADILALAAREGTVLLGGPSWAV  145

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
              LGRRDARTASQ+AAN  IP P+S+L  LIS FSA GLS  DM  LSGSHTIGQARCT F
Sbjct  146   PLGRRDARTASQSAANTQIPAPSSSLATLISMFSAKGLSARDMTALSGSHTIGQARCTTF  205

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R RIYN++NID  FA +R+  CP ASG GD NLAPLD+QTP +FDN+YY NLV ++GLLH
Sbjct  206   RNRIYNDTNIDPQFAATRRATCP-ASG-GDANLAPLDIQTPNRFDNDYYQNLVVRRGLLH  263

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ+LFNG S D+ VR YS N   F SDFAAAM+KMG+I PLTG NGE
Sbjct  264   SDQELFNGGSQDALVRSYSNNGASFRSDFAAAMVKMGNISPLTGTNGE  311



>ref|XP_003577141.1| PREDICTED: peroxidase 4-like [Brachypodium distachyon]
Length=329

 Score =   403 bits (1036),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 189/287 (66%), Positives = 220/287 (77%), Gaps = 0/287 (0%)
 Frame = +2

Query  182   QLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTSS  361
             QLS GFY+ +CP     V SV+ +AI  E R+GAS+LRLFFHDCFV GCDGS+LLDD   
Sbjct  34    QLSTGFYAYTCPGAMDAVKSVMEAAIAGEPRIGASILRLFFHDCFVQGCDGSLLLDDAPG  93

Query  362   FTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVK  541
             F GEK A PN  S RGFEV+D  K+AVE +CP +VSCAD+LA+A+RDS V LGGPSW VK
Sbjct  94    FQGEKTATPNNGSVRGFEVVDAAKAAVEALCPAIVSCADVLALAARDSVVILGGPSWEVK  153

Query  542   LGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFR  721
             +GRRD+ TAS A ANN+IPPP S L  L + F+  GLS  DMV LSGSHTIGQARCTNFR
Sbjct  154   VGRRDSTTASFAGANNNIPPPASGLANLTALFAQQGLSQKDMVALSGSHTIGQARCTNFR  213

Query  722   ARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHS  901
             A IYN++NIDS FA  R+  CP  SGSGDNNLAPLDLQTP  F+NNYY NLV KKGLLHS
Sbjct  214   AHIYNDTNIDSGFAGGRRSGCPSTSGSGDNNLAPLDLQTPTTFENNYYKNLVGKKGLLHS  273

Query  902   DQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             DQ+LFNG +TD  V+ Y ++ + F +DF   MIKMGDI PLTGNNG+
Sbjct  274   DQELFNGGTTDPQVQSYVSSQSTFFADFVTGMIKMGDISPLTGNNGQ  320



>ref|XP_010653358.1| PREDICTED: cationic peroxidase 1-like [Vitis vinifera]
Length=325

 Score =   403 bits (1035),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 192/289 (66%), Positives = 225/289 (78%), Gaps = 2/289 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQL+  FY+K+CP     + S V SA++ EARMGASLLRL FHDCFVNGCD SILLDDT
Sbjct  30    SAQLTTNFYAKTCPNALSIIKSAVNSAVKSEARMGASLLRLHFHDCFVNGCDASILLDDT  89

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             S+FTGEK A PN  S RG+EV+D IKS +E  CPGVVSCADILA+A+RDS V L GPSW 
Sbjct  90    SNFTGEKTAGPNANSVRGYEVVDTIKSQLEASCPGVVSCADILAVAARDSVVALRGPSWM  149

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             V+LGRRD+ TAS +AAN++IP PT NL+ LIS+F+  G +  +MV LSGSHTIGQARCT 
Sbjct  150   VRLGRRDSTTASLSAANSNIPAPTLNLSGLISAFTNKGFNAREMVALSGSHTIGQARCTT  209

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR RIYNE+NID+SF  S + NCP  S  GDN L+PLD QTP  FDN YY NLVNKKGLL
Sbjct  210   FRTRIYNEANIDASFKTSLQANCP--SSGGDNTLSPLDTQTPTTFDNAYYTNLVNKKGLL  267

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQLFNG STD+ V  YST  T F +DFA AM+KMG++ PLTG +G+
Sbjct  268   HSDQQLFNGGSTDAVVNTYSTRSTTFFTDFANAMVKMGNLSPLTGTSGQ  316



>ref|XP_002319967.2| hypothetical protein POPTR_0013s15240g [Populus trichocarpa]
 gb|EEE95890.2| hypothetical protein POPTR_0013s15240g [Populus trichocarpa]
 gb|AHL39177.1| class III peroxidase [Populus trichocarpa]
Length=326

 Score =   401 bits (1031),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 193/289 (67%), Positives = 225/289 (78%), Gaps = 2/289 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SA LS  FY KSCP+LF TV SVV+SAI KE RMGASL+RLFFHDCFV GCD SILL+DT
Sbjct  31    SAHLSTDFYDKSCPQLFGTVKSVVQSAIAKERRMGASLVRLFFHDCFVKGCDASILLEDT  90

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             ++F GE+ A PN  S RG+ V+ +IKS +EKVCPG+VSCADI+ IA+RDSTV LGGP W 
Sbjct  91    ATFKGEQGAGPNNNSVRGYNVVAKIKSKLEKVCPGIVSCADIVVIAARDSTVLLGGPYWK  150

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VKLGRRD++TA+  AA+ S+P  TS +++LI  F + GLS  DMV LSGSHTIGQ +C  
Sbjct  151   VKLGRRDSKTANMNAASKSLPSDTSTVSQLIKRFKSKGLSATDMVALSGSHTIGQTKCKT  210

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FRARIYNE+NID SFA  R+  CP    +GD+NLAPLD QTP  FDNNYY NL++KKGLL
Sbjct  211   FRARIYNETNIDKSFATMRQKMCPLT--TGDDNLAPLDFQTPNVFDNNYYKNLIHKKGLL  268

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQ LF+G STDS VR YS NP  F SDFAAAM+KMGDI P TG  GE
Sbjct  269   HSDQVLFSGESTDSLVRTYSNNPDIFFSDFAAAMVKMGDIDPRTGTRGE  317



>ref|XP_010264472.1| PREDICTED: cationic peroxidase 1-like [Nelumbo nucifera]
Length=325

 Score =   401 bits (1030),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 200/289 (69%), Positives = 230/289 (80%), Gaps = 2/289 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  +Y  SCPK F T+ S V +A+ KE RMGASLLRL FHDCFVNGCDGSILLDDT
Sbjct  30    SAQLSSTYYDTSCPKAFSTIKSGVTAAVAKEKRMGASLLRLHFHDCFVNGCDGSILLDDT  89

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGEK A  N  S RGF+VID IKS VE VCPGVVSCADILA+A+RDS V LGGPSW 
Sbjct  90    SSFTGEKTATANANSVRGFDVIDTIKSKVESVCPGVVSCADILAVAARDSVVALGGPSWT  149

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             V+LGRRDA TAS +AAN+ IP PT +L+ L S+FS  GL+  +MV LSG+HTIGQARCT+
Sbjct  150   VQLGRRDATTASLSAANSDIPAPTLDLSDLTSAFSKKGLTAKEMVALSGAHTIGQARCTS  209

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR+RIYNE+NI+SS A S K NCP  S  GD+NL+PLD  +P  FDN Y+ NLVN KGLL
Sbjct  210   FRSRIYNETNINSSLATSLKSNCP--STGGDSNLSPLDATSPTAFDNAYFKNLVNNKGLL  267

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQL+NG STDS V  YS+N   FSSDFA+AM+KMG+I PLTG+NGE
Sbjct  268   HSDQQLYNGGSTDSQVSSYSSNSATFSSDFASAMVKMGNISPLTGSNGE  316



>gb|ABK25962.1| unknown [Picea sitchensis]
Length=323

 Score =   400 bits (1029),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 191/287 (67%), Positives = 225/287 (78%), Gaps = 0/287 (0%)
 Frame = +2

Query  182   QLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTSS  361
             QLS  FY KSCP     V + V+ A+ KE RMGASLLRL FHDCFVNGCDGS+LLDD+S 
Sbjct  28    QLSSTFYDKSCPAALSVVKAAVKQAVAKEQRMGASLLRLHFHDCFVNGCDGSVLLDDSSK  87

Query  362   FTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVK  541
              TGEK A PN  SARGF+VID IKS VEK C GVVSCADILAIA+RDS V LGGPSW V 
Sbjct  88    ITGEKTAVPNANSARGFDVIDTIKSQVEKSCSGVVSCADILAIAARDSVVELGGPSWTVL  147

Query  542   LGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFR  721
             LGRRD+ TAS++ ANN+IPPPTS+L+++IS F A GLS  +MV L+G+HTIGQARC NFR
Sbjct  148   LGRRDSTTASKSGANNNIPPPTSSLSKIISLFQAQGLSAKEMVALAGAHTIGQARCFNFR  207

Query  722   ARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHS  901
             A IYN++NI S+++ S +  CP  +GSGDNNL+PLD  +P  FD NYY NL  KKGLLHS
Sbjct  208   AHIYNDTNILSTYSTSLRSKCPPTNGSGDNNLSPLDYVSPTAFDKNYYCNLKIKKGLLHS  267

Query  902   DQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             DQ+LFNG STDS V  Y++N   F SDFAAAM+KMG+IKPLTG +G+
Sbjct  268   DQELFNGGSTDSQVTTYASNQNIFFSDFAAAMVKMGNIKPLTGTSGQ  314



>emb|CDX80957.1| BnaC03g02110D [Brassica napus]
Length=324

 Score =   400 bits (1029),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 197/288 (68%), Positives = 226/288 (78%), Gaps = 0/288 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQL P FY  +CP L   V   V SA+  + RMGASLLRLF+ DCFVNGCD SILLDDTS
Sbjct  28    AQLRPDFYRNTCPLLHAAVRGAVTSAVAFDPRMGASLLRLFYLDCFVNGCDASILLDDTS  87

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGE+ AA N  SARGF VID IKSAVE+VCPGVVSCADILAIA+RDS VTLGGPSW +
Sbjct  88    SFTGEQNAASNHNSARGFNVIDNIKSAVERVCPGVVSCADILAIAARDSVVTLGGPSWLL  147

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
              LGRRDARTASQAAAN+SIP PTS+L++LI+SF+ +G +  DMV LSG+HTIGQA+C NF
Sbjct  148   NLGRRDARTASQAAANSSIPAPTSSLSQLITSFANLGFTARDMVALSGAHTIGQAQCRNF  207

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R RIY E+NI   FA + + NCP ASGSGD NLAPLD  TP  FDN+Y+ NL++++GLLH
Sbjct  208   RTRIYQETNIAPPFAATLQQNCPIASGSGDGNLAPLDSITPFVFDNSYFRNLMSQRGLLH  267

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ LFNG STDS VR YS N   F +DFAAAM+KM  I PLTG  GE
Sbjct  268   SDQVLFNGGSTDSIVREYSQNARVFRNDFAAAMVKMSHISPLTGTAGE  315



>ref|XP_010695716.1| PREDICTED: peroxidase 4-like [Beta vulgaris subsp. vulgaris]
Length=323

 Score =   400 bits (1028),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 191/290 (66%), Positives = 232/290 (80%), Gaps = 2/290 (1%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQL    Y+K+CP+LF T+ +VV+SAI+KEARMGASLLRL FHDCFVNGCD S LLDD+ 
Sbjct  25    AQLDTSLYAKTCPQLFPTIRAVVQSAIKKEARMGASLLRLHFHDCFVNGCDASNLLDDSP  84

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SF  EK A PN  SARGFEVIDQIKSAVEKVCPGVVSCADILAI +RDS   LGGP+W+V
Sbjct  85    SFKSEKAATPNRNSARGFEVIDQIKSAVEKVCPGVVSCADILAITARDSVAILGGPAWDV  144

Query  539   KLGRRDARTASQAAAN--NSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  712
             KLGR+D+ TA+ A AN  N+IP   ++L+ L+SSF   GLST D+V L G+HTIG ARCT
Sbjct  145   KLGRKDSLTANFALANATNTIPAANASLSALLSSFQNHGLSTRDLVALYGAHTIGVARCT  204

Query  713   NFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             NFR  IY + NID SFA+S +G CP+ +G+GDNNLAPLD Q+P +FDN Y+  L+NK+ +
Sbjct  205   NFRQHIYQDKNIDPSFARSNQGRCPKNNGNGDNNLAPLDAQSPTRFDNTYFKTLLNKQAI  264

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQ+L+NG STD+ VR Y+TNP  F SDF A++IKMGDIKPLTG+ G+
Sbjct  265   LHSDQELYNGGSTDALVRTYATNPHAFISDFTASIIKMGDIKPLTGSQGQ  314



>ref|XP_010653359.1| PREDICTED: cationic peroxidase 1-like [Vitis vinifera]
Length=326

 Score =   400 bits (1028),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 193/289 (67%), Positives = 223/289 (77%), Gaps = 2/289 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQL+  +YS SCP     + S V +A+  EARMGASLLRL FHDCFVNGCD SILLDDT
Sbjct  31    SAQLTTNYYSSSCPNALSIIKSAVNTAVNNEARMGASLLRLHFHDCFVNGCDASILLDDT  90

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             S+FTGEK A PN  S RGF+VID IKS VE  CPGVVSCADILA+ +RDS V LGGPSW 
Sbjct  91    SNFTGEKTAVPNANSVRGFDVIDTIKSQVESSCPGVVSCADILAVVARDSVVALGGPSWT  150

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             V+LGRRD+ TAS + AN+ IP PT NL+ LISSFS  G S N+MV LSGSHTIGQARCTN
Sbjct  151   VRLGRRDSTTASLSTANSDIPAPTLNLSGLISSFSNKGFSANEMVALSGSHTIGQARCTN  210

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR R+YNE+NID+SF  S + NCP  S  GDNNL+PLD ++P  FDN Y+ NLVN KGLL
Sbjct  211   FRDRLYNETNIDASFQSSLQANCP--SSGGDNNLSPLDTKSPTTFDNAYFTNLVNNKGLL  268

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQLFNG STDS V  YST  T F +DFA A++KMG++ PLTG +G+
Sbjct  269   HSDQQLFNGGSTDSQVTTYSTKSTTFFTDFANAIVKMGNLSPLTGTSGQ  317



>ref|XP_008369411.1| PREDICTED: peroxidase P7-like [Malus domestica]
Length=325

 Score =   400 bits (1027),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 186/286 (65%), Positives = 220/286 (77%), Gaps = 0/286 (0%)
 Frame = +2

Query  185   LSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTSSF  364
             LS  +Y+ SCPKLF TV S+V SAI+KEARMGASLLRLFFHDCFVNGCDGS+LLDD  +F
Sbjct  28    LSTTYYASSCPKLFPTVKSIVESAIKKEARMGASLLRLFFHDCFVNGCDGSVLLDDAPNF  87

Query  365   TGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVKL  544
              GEK   PN  S+RGFEVID++KSAVEKVCPG VSCADI+A  +RDS V LGGPSW ++L
Sbjct  88    IGEKNVPPNKNSSRGFEVIDEVKSAVEKVCPGTVSCADIVATVARDSVVMLGGPSWGIQL  147

Query  545   GRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFRA  724
             GR+DAR  +    N SIP   +NL  LI  FS + L+  D+V LSG+HT+GQA+C NFR 
Sbjct  148   GRKDARATNPVVTNVSIPTARANLKELILRFSGIALNKRDLVALSGAHTLGQAQCHNFRK  207

Query  725   RIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHSD  904
             RIYNE+NID+  AQ R+  CP+A GSGD++LAP+D QTPI FDN+YY NLV KKGLLHSD
Sbjct  208   RIYNETNIDTDLAQQRRSKCPKAKGSGDHHLAPIDAQTPIVFDNSYYKNLVQKKGLLHSD  267

Query  905   QQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             QQLF+G  TDS VR YS +   F +DF +AMIKMG I PL G  GE
Sbjct  268   QQLFSGGKTDSIVREYSEHQESFFNDFVSAMIKMGTINPLIGPAGE  313



>ref|XP_006842420.1| hypothetical protein AMTR_s00077p00014810 [Amborella trichopoda]
 gb|ERN04095.1| hypothetical protein AMTR_s00077p00014810 [Amborella trichopoda]
Length=315

 Score =   399 bits (1026),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 188/288 (65%), Positives = 230/288 (80%), Gaps = 2/288 (1%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  FY+ SCP    T+ + VRSA+  E+RMGASLLRL FHDCFVNGCDGS+LLDD +
Sbjct  21    AQLSSTFYNSSCPNALSTIQTAVRSAVNNESRMGASLLRLHFHDCFVNGCDGSLLLDDNA  80

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             +FTGEK A PN  S RGFEV+D IKS +E +CPGVVSCADILA+A+RDS V LGGP+W V
Sbjct  81    TFTGEKTARPNNNSVRGFEVVDNIKSQLESLCPGVVSCADILAVAARDSVVVLGGPTWTV  140

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
              LGRRD+ TAS + AN+ IP P+ +L+ LI+SFS  GLS+++MV LSGSHTIGQARCT F
Sbjct  141   LLGRRDSTTASLSTANSDIPAPSLSLSGLITSFSNKGLSSSEMVALSGSHTIGQARCTTF  200

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R  IYNE+NIDS++A S K NCP +   GDNNL+PLD+ +P  FDN YY NLVNKKGLLH
Sbjct  201   RTHIYNETNIDSTYATSLKSNCPFS--GGDNNLSPLDVTSPTVFDNAYYKNLVNKKGLLH  258

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ+LFNG STDS V GY+++ + F +DFA AM+KMG+I PLTG++G+
Sbjct  259   SDQELFNGGSTDSQVTGYTSSSSTFPTDFAKAMVKMGNISPLTGSSGQ  306



>ref|XP_009381203.1| PREDICTED: peroxidase P7-like [Musa acuminata subsp. malaccensis]
Length=317

 Score =   399 bits (1025),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 193/288 (67%), Positives = 229/288 (80%), Gaps = 2/288 (1%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLSP FYS +CP L   V   +  A+ +E RMGAS+LRLFFHDCFVNGCD S+LLDDT+
Sbjct  23    AQLSPSFYSLTCPTLRVVVLLRMTQAVLQEPRMGASILRLFFHDCFVNGCDASVLLDDTA  82

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             +FTGEK A PN  S RGF+VID IKSAVE VCPG VSCADILA+A+RD  V LGGPSW V
Sbjct  83    TFTGEKNAGPNANSLRGFDVIDDIKSAVELVCPGTVSCADILALAARDGVVLLGGPSWTV  142

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
              LGRRDA TASQ+AAN+++P P S+L++LIS+FSA GLS  DM  LSG+HTIGQARC NF
Sbjct  143   PLGRRDATTASQSAANSNLPSPASSLSQLISAFSAQGLSARDMTALSGAHTIGQARCVNF  202

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R+ IY+++NID+ FA  R+ NCP  S  GDN+LAPLDLQT  +FDN YY NLV  +GLLH
Sbjct  203   RSHIYDDTNIDADFASQRQQNCP--SSGGDNSLAPLDLQTATEFDNAYYQNLVGFQGLLH  260

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ+LFN  S DS V+ YST+ + F SDFAAAM+KMG+IKPLTG+NGE
Sbjct  261   SDQELFNNGSQDSLVQQYSTDGSTFFSDFAAAMVKMGNIKPLTGSNGE  308



>ref|XP_004302590.1| PREDICTED: cationic peroxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=317

 Score =   399 bits (1024),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 190/289 (66%), Positives = 228/289 (79%), Gaps = 2/289 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FYS SCPK   T+ S V SA+  EARMGASLLRL FHDCFVNGCD S+LLDDT
Sbjct  22    SAQLSSTFYSSSCPKALATIKSAVDSAVSSEARMGASLLRLHFHDCFVNGCDASVLLDDT  81

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             ++FTGEK A  N  S RGF+V+D IKS +E +CPGV SC+DILA+A+RDS V LGGPSW 
Sbjct  82    ANFTGEKTAGANANSLRGFDVVDTIKSQLESLCPGVFSCSDILAVAARDSVVALGGPSWT  141

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             V+LGRRD+ TAS +AAN +IP PT NL+ L++SFS  G +  ++V LSGSHTIGQARCT 
Sbjct  142   VQLGRRDSTTASLSAANTNIPAPTLNLSALLTSFSNKGFNAKELVALSGSHTIGQARCTT  201

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FRAR+YNE+NIDSSFA S K NCP  S  GD NL+PLD+ TP KFDN Y+ NLV++KGLL
Sbjct  202   FRARLYNEANIDSSFATSLKANCP--SSGGDANLSPLDVTTPNKFDNAYFKNLVSQKGLL  259

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQLF+G ST++ V  Y +NP  FS+DFA AM+KMG++ PLTG NG+
Sbjct  260   HSDQQLFSGGSTNAQVNAYVSNPGTFSTDFAKAMVKMGNLSPLTGTNGQ  308



>ref|XP_010931328.1| PREDICTED: cationic peroxidase 1-like [Elaeis guineensis]
Length=316

 Score =   398 bits (1023),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 196/287 (68%), Positives = 223/287 (78%), Gaps = 2/287 (1%)
 Frame = +2

Query  182   QLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTSS  361
             QLSP FY  SCP    T+ + VR+A+ KE RMGASLLRL FHDCFVNGCDGSILLDDT +
Sbjct  23    QLSPTFYETSCPGALYTIQNAVRAAVFKERRMGASLLRLHFHDCFVNGCDGSILLDDTPT  82

Query  362   FTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVK  541
             FTGEK A PN  S RGF+VID IKS VE +C  VVSCADILA+A+RDS V LGGPSW V+
Sbjct  83    FTGEKTAGPNNNSVRGFDVIDTIKSQVEAICTQVVSCADILAVAARDSVVALGGPSWAVQ  142

Query  542   LGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFR  721
             LGRRDA TAS + AN+ IP PTS+L+ LIS+FS  GLST DMV LSG+HTIGQARCT FR
Sbjct  143   LGRRDATTASFSGANSDIPSPTSDLSALISAFSKKGLSTTDMVALSGAHTIGQARCTVFR  202

Query  722   ARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHS  901
              R+YNE+NID+S A S K NCP  S  GD+NL+PLD  TP   DN YY +LVNKKGLLHS
Sbjct  203   TRLYNETNIDASLATSLKSNCP--SSGGDDNLSPLDAITPTIVDNFYYKDLVNKKGLLHS  260

Query  902   DQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             DQQL+NG STDS V  Y+ N  KF SDFAAAM+ MG+I PLTG +GE
Sbjct  261   DQQLYNGGSTDSQVTTYANNFAKFYSDFAAAMVNMGNISPLTGTSGE  307



>gb|ACU24215.1| unknown [Glycine max]
Length=329

 Score =   398 bits (1023),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 194/290 (67%), Positives = 226/290 (78%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SA LS  FYSK+CP +F TV SVV+SA+ KE R+GAS++RLFFHDCFV GCDGSILLDDT
Sbjct  31    SATLSKNFYSKTCPNVFNTVKSVVKSAVAKEPRIGASIVRLFFHDCFVQGCDGSILLDDT  90

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
              +F GEK AA N  S RG+E+ID IKS VEK+CPGVVSCADIL IASRDS V LGGP WN
Sbjct  91    PTFQGEKTAAANNNSVRGYELIDDIKSKVEKICPGVVSCADILDIASRDSVVLLGGPFWN  150

Query  536   VKLGRRDARTASQAAANNS-IPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  712
             V+LGRRD+R+A+  AAN   IPPPTSNL  LI+ F   GLS  DMV LSG+HT G+ARCT
Sbjct  151   VRLGRRDSRSANFTAANTGVIPPPTSNLTNLITRFQDQGLSARDMVALSGAHTFGKARCT  210

Query  713   NFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             +FR RIYN++NID +FA +R+  CPR +G+GDNNLA LD +TP  FDNNY+ NL  K+GL
Sbjct  211   SFRDRIYNQTNIDRTFALARQRRCPRTNGTGDNNLANLDFRTPNHFDNNYFKNLFIKRGL  270

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             L+ DQ LFNG STDS VR YS N   F  DF  AMI+MGDIKPLTG+ GE
Sbjct  271   LNFDQVLFNGGSTDSLVRTYSQNNKAFDFDFVKAMIRMGDIKPLTGSQGE  320



>ref|XP_006353885.1| PREDICTED: peroxidase 52-like [Solanum tuberosum]
Length=319

 Score =   398 bits (1022),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 203/311 (65%), Positives = 237/311 (76%), Gaps = 2/311 (1%)
 Frame = +2

Query  110   VSVKDNNITAvllcvlvlvggcSAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASL  289
             VS+  N I A L  +L  V   +AQLS  FY  SC  L   V + +  A+++EAR+GAS+
Sbjct  2     VSLSRNLILAFLCVLLGFVCFSNAQLSDNFYGTSCRNLQTIVRNGMIQAVKREARLGASI  61

Query  290   LRLFFHDCFVNGCDGSILLDDTSSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVS  469
             LRLFFHDCFVNGCD SILLDDTS+FTGEK A PN  SARG+EVID IK+ VE  CP VVS
Sbjct  62    LRLFFHDCFVNGCDASILLDDTSTFTGEKNANPNRNSARGYEVIDTIKAQVESACPNVVS  121

Query  470   CADILAIASRDSTVTLGGPSWNVKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVG  649
             CADILA+A+R  TV LGGPSW V LGRRDARTASQ+AAN  IP P S+L+ L+S FSA G
Sbjct  122   CADILALAARQGTVLLGGPSWAVPLGRRDARTASQSAANTQIPAPFSSLSTLLSMFSAKG  181

Query  650   LSTNDMVVLSGSHTIGQARCTNFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLD  829
             L+  DM  LSGSHTIGQARCT FR RIYN++NID+ FA +R+  CP ASG GD NLAPLD
Sbjct  182   LNARDMTALSGSHTIGQARCTTFRNRIYNDTNIDTQFAATRRATCP-ASG-GDANLAPLD  239

Query  830   LQTPIKFDNNYYVNLVNKKGLLHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMG  1009
             +QTP +FDN+YY NLV ++GLLHSDQ+LFNG S D+ VR YS N   F SDFAAAM+KMG
Sbjct  240   IQTPNRFDNDYYQNLVVRRGLLHSDQELFNGGSQDALVRSYSNNVASFRSDFAAAMVKMG  299

Query  1010  DIKPLTGNNGE  1042
             +I PLTG NGE
Sbjct  300   NISPLTGTNGE  310



>gb|KDP21683.1| hypothetical protein JCGZ_03354 [Jatropha curcas]
Length=316

 Score =   397 bits (1021),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 192/287 (67%), Positives = 227/287 (79%), Gaps = 2/287 (1%)
 Frame = +2

Query  182   QLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTSS  361
             +LSP +YS++CPK    V + V+ AI+ E R+GASLLRL FHDCFVNGCDGSILLDD ++
Sbjct  23    KLSPDYYSRTCPKALSVVEAGVKKAIKNETRIGASLLRLHFHDCFVNGCDGSILLDDNAT  82

Query  362   FTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVK  541
             F GEK AAPN  S RGF VID IKS +EK CPGVVSCADI+A+A+RDS V LGGPSW V 
Sbjct  83    FIGEKTAAPNNNSVRGFNVIDDIKSKLEKACPGVVSCADIVALAARDSAVYLGGPSWKVG  142

Query  542   LGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFR  721
             LGR+D+ TAS+A AN SIPPPTSNL+ LI+SFSA GLS  DMV LSGSHTIG ARCT++R
Sbjct  143   LGRKDSLTASRALANTSIPPPTSNLSALITSFSAQGLSLRDMVALSGSHTIGLARCTSYR  202

Query  722   ARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHS  901
               IYN+SNID SFA+S +  CPR+    DN LAPLD QTP +FDN YY NL+NKKGLLHS
Sbjct  203   GHIYNDSNIDPSFAKSLQQICPRS--GKDNVLAPLDRQTPTRFDNLYYKNLLNKKGLLHS  260

Query  902   DQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             DQ+LFNG S DS VR Y++ P  F  DFA AM+KM +IKPLTG++G+
Sbjct  261   DQELFNGRSADSLVRKYASKPFTFFKDFAQAMVKMSNIKPLTGSHGQ  307



>gb|AFV07575.1| putative peroxidase a2 [Solanum tuberosum]
Length=257

 Score =   395 bits (1015),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 198/249 (80%), Positives = 216/249 (87%), Gaps = 1/249 (0%)
 Frame = +2

Query  113  SVKDNNITAvllcvlvlvggcSAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLL  292
            S K+N +  + L V +L+G  SAQLS  FYSKSCPKL+QTV S V+SAI+KE RMGASLL
Sbjct  3    SSKNNTMVFLFLLVTLLIGSSSAQLSTSFYSKSCPKLYQTVKSTVQSAIKKETRMGASLL  62

Query  293  RLFFHDCFVNGCDGSILLDDTSSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSC  472
            RLFFHDCFVNGCDGS+LLDDTSSFTGEKRAAPN  S RGFEVID IKSAVEK CPGVVSC
Sbjct  63   RLFFHDCFVNGCDGSLLLDDTSSFTGEKRAAPNVNSVRGFEVIDNIKSAVEKACPGVVSC  122

Query  473  ADILAIASRDSTVTLGGPSWNVKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGL  652
            ADILA+ +RDS V LGGP+WNVKLGRRDARTASQ AAN+SIP PT NLNRLISSFSAVGL
Sbjct  123  ADILAVTARDSVVILGGPNWNVKLGRRDARTASQGAANSSIPAPTFNLNRLISSFSAVGL  182

Query  653  STNDMVVLSGSHTIGQARCTNFRARIYNESN-IDSSFAQSRKGNCPRASGSGDNNLAPLD  829
            ST DMV LSGSHTIGQARCT FRARIYNE+N IDSSFA++R+ +CPR SGSGDN LAPLD
Sbjct  183  STKDMVALSGSHTIGQARCTTFRARIYNETNSIDSSFARARQNSCPRNSGSGDNXLAPLD  242

Query  830  LQTPIKFDN  856
            LQTP KFDN
Sbjct  243  LQTPSKFDN  251



>ref|XP_009420366.1| PREDICTED: peroxidase P7-like [Musa acuminata subsp. malaccensis]
Length=317

 Score =   397 bits (1020),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 196/287 (68%), Positives = 223/287 (78%), Gaps = 1/287 (0%)
 Frame = +2

Query  182   QLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTSS  361
             QLS  FYS SCP   QT+   VR+A+ KEARMGASLLRL FHDCFVNGCDGS+LLDDTS 
Sbjct  23    QLSSTFYSTSCPLAIQTIRLAVRAAVAKEARMGASLLRLHFHDCFVNGCDGSVLLDDTSG  82

Query  362   FTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVK  541
             FTGEK A PN  S RGF+VID IKS VE VC  VVSCADILA+A+R+S   LGGP W V+
Sbjct  83    FTGEKTAVPNNNSLRGFDVIDNIKSQVEAVCKQVVSCADILAVAARESVAALGGPLWTVQ  142

Query  542   LGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFR  721
             LGRRDA TAS  AAN  IP P S+L+ LIS++S  GL T DMV LSG+HTIGQARC +FR
Sbjct  143   LGRRDATTASLDAANTEIPSPKSDLDDLISAYSKKGLGTTDMVALSGAHTIGQARCISFR  202

Query  722   ARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHS  901
              RIYNE++IDSS A SR+ NCP +SG GD+NL+PLD  T   FDN Y+ NLV KKGLLHS
Sbjct  203   DRIYNETSIDSSLATSRQSNCP-SSGDGDDNLSPLDAVTCTLFDNFYFRNLVKKKGLLHS  261

Query  902   DQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             DQQLF+G STDS V  YSTN  +F SDFAAAM+KMG+I PLTG +GE
Sbjct  262   DQQLFSGGSTDSLVTTYSTNTARFFSDFAAAMVKMGNISPLTGTDGE  308



>emb|CAH10839.1| peroxidase [Picea abies]
Length=317

 Score =   397 bits (1019),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 193/287 (67%), Positives = 220/287 (77%), Gaps = 2/287 (1%)
 Frame = +2

Query  182   QLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTSS  361
             QL+  FY+K CP     V + V  A+  E RMGASLLRL FHDCFVNGCDGSILLDD S+
Sbjct  24    QLTSTFYNKLCPTALSIVKAAVNKAVNNEKRMGASLLRLHFHDCFVNGCDGSILLDDNST  83

Query  362   FTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVK  541
             FTGEK A PN  S RGF+VID IK+ VE  C GVVSCADILAI +RDS V LGGP+W V 
Sbjct  84    FTGEKTALPNANSVRGFDVIDTIKTQVEAACSGVVSCADILAIVARDSVVQLGGPTWTVL  143

Query  542   LGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFR  721
             LGRRD+ TAS +AANN+IP P SNL+ LISSF+A GLST D+V LSG HTIGQARCT FR
Sbjct  144   LGRRDSTTASLSAANNNIPSPASNLSALISSFTAHGLSTKDLVALSGGHTIGQARCTTFR  203

Query  722   ARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHS  901
             ARIYNESNID+SFA S K +CP  S  GDN L+PLDL TP  FDN YY +L N+KGLLHS
Sbjct  204   ARIYNESNIDTSFATSVKSSCP--SAGGDNTLSPLDLATPTTFDNKYYTDLGNRKGLLHS  261

Query  902   DQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             DQQLF+G ST+S V  YS N   F +DFAAAM+KMG+I PLTG +G+
Sbjct  262   DQQLFSGGSTNSQVTTYSANQNTFFTDFAAAMVKMGNISPLTGTSGQ  308



>sp|P22195.2|PER1_ARAHY RecName: Full=Cationic peroxidase 1; AltName: Full=PNPC1; Flags: 
Precursor [Arachis hypogaea]
 gb|AAB06183.1| cationic peroxidase [Arachis hypogaea]
Length=316

 Score =   396 bits (1018),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 191/289 (66%), Positives = 224/289 (78%), Gaps = 2/289 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FY+  CP    T+ S V SA+ KEARMGASLLRL FHDCFV GCD S+LLDDT
Sbjct  21    SAQLSSNFYATKCPNALSTIKSAVNSAVAKEARMGASLLRLHFHDCFVQGCDASVLLDDT  80

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             S+FTGEK A PN  S RGFEVID IKS VE +CPGVVSCADILA+A+RDS V LGG SWN
Sbjct  81    SNFTGEKTAGPNANSIRGFEVIDTIKSQVESLCPGVVSCADILAVAARDSVVALGGASWN  140

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             V LGRRD+ TAS ++AN+ +P P  NL+ LIS+FS  G +T ++V LSG+HTIGQA+CT 
Sbjct  141   VLLGRRDSTTASLSSANSDLPAPFFNLSGLISAFSNKGFTTKELVTLSGAHTIGQAQCTA  200

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR RIYNESNID ++A+S + NCP  S  GD NL+P D+ TP KFDN YY+NL NKKGLL
Sbjct  201   FRTRIYNESNIDPTYAKSLQANCP--SVGGDTNLSPFDVTTPNKFDNAYYINLRNKKGLL  258

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQLFNGVSTDS V  YS N   F++DF  AMIKMG++ PLTG +G+
Sbjct  259   HSDQQLFNGVSTDSQVTAYSNNAATFNTDFGNAMIKMGNLSPLTGTSGQ  307



>gb|KGN45822.1| hypothetical protein Csa_6G013940 [Cucumis sativus]
Length=265

 Score =   394 bits (1012),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 193/257 (75%), Positives = 217/257 (84%), Gaps = 2/257 (1%)
 Frame = +2

Query  275   MGASLLRLFFHDCFVNGCDGSILLDDTSSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVC  454
             MGAS+LRLFFHDCFVNGCDGSILLDDTSSFTGEK A PN  SARGF+VID IK+AVEK C
Sbjct  1     MGASILRLFFHDCFVNGCDGSILLDDTSSFTGEKNANPNRNSARGFDVIDNIKTAVEKAC  60

Query  455   PGVVSCADILAIASRDSTVTLGGPSWNVKLGRRDARTASQAAANNSIPPPTSNLNRLISS  634
             PGVVSCADILAIA+RDS V LGGPSWNVKLGRRD+ TASQ+ ANN IP PTS+L++L S 
Sbjct  61    PGVVSCADILAIAARDSVVLLGGPSWNVKLGRRDSTTASQSQANNDIPGPTSSLSQLSSR  120

Query  635   FSAVGLSTNDMVVLSGSHTIGQARCTNFRARIY-NESNIDSSFAQSRKGNCPRASGSGDN  811
             FSA+GLS+ D+V LSG HTIGQARCT FR+RIY N SNI+SSFA++R+ NCP  SG+GDN
Sbjct  121   FSALGLSSTDLVALSGGHTIGQARCTTFRSRIYSNSSNIESSFARTRQSNCPNTSGTGDN  180

Query  812   NLAPLDLQTPIKFDNNYYVNLVNKKGLLHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAA  991
             NLAPLD  TP  FDNNYY NLV  KGLL SDQ LFNG STDS V+ Y+  P +F SDFAA
Sbjct  181   NLAPLDF-TPTSFDNNYYKNLVQNKGLLQSDQVLFNGGSTDSVVQNYANAPARFLSDFAA  239

Query  992   AMIKMGDIKPLTGNNGE  1042
             AM+KMGDI PLTG+NG+
Sbjct  240   AMVKMGDIAPLTGSNGQ  256



>ref|XP_011080818.1| PREDICTED: uncharacterized protein LOC105163979 [Sesamum indicum]
Length=700

 Score =   409 bits (1051),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 197/272 (72%), Positives = 226/272 (83%), Gaps = 1/272 (0%)
 Frame = +2

Query  230   TVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTSSFTGEKRAAPNFQSARG  409
             T +SVV+ AI KE RMGASLLRL FHDCFV GCDGSILLDDTSSF GEK A PN  S RG
Sbjct  420   TGSSVVKDAIAKEKRMGASLLRLHFHDCFVQGCDGSILLDDTSSFRGEKTAGPNNNSVRG  479

Query  410   FEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVKLGRRDARTASQAAANN  589
             F+V+D IKS VE VCPGVVSC+DILAIA+RDS V LGGP+WNVKLGRRD++TAS +AAN+
Sbjct  480   FDVVDDIKSEVESVCPGVVSCSDILAIAARDSVVLLGGPNWNVKLGRRDSKTASLSAANS  539

Query  590   S-IPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFRARIYNESNIDSSFAQ  766
               IPPPTS LN L++ F A GLST DMVVLSG+HTIGQARCT FR R+YNE+NID+SFA+
Sbjct  540   GVIPPPTSTLNNLVNRFQARGLSTKDMVVLSGAHTIGQARCTLFRDRVYNETNIDTSFAR  599

Query  767   SRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHSDQQLFNGVSTDSTVR  946
             +R+ NCPR SGSGDNNLAPLD ++P  FDN+YY NL+NKKGLLHSDQ L+NG STDS + 
Sbjct  600   TRQTNCPRNSGSGDNNLAPLDHKSPTFFDNSYYKNLINKKGLLHSDQVLYNGGSTDSLIE  659

Query  947   GYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
              YS  P  F+ DF AAMI+MGDI PLTG+NGE
Sbjct  660   SYSKKPEAFNDDFVAAMIRMGDISPLTGSNGE  691


 Score =   352 bits (903),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 181/285 (64%), Positives = 216/285 (76%), Gaps = 2/285 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             +AQLS   YS SCP+   T+ + V  A+ KE RM ASLLRL FHDCFVNGCD S+LLDDT
Sbjct  139   TAQLSTNHYSTSCPRALFTIKAGVLKAVAKERRMAASLLRLHFHDCFVNGCDASVLLDDT  198

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGEK A PN  S RGFEVID IKS +E +CPGVVSCADILA+++RDS   +GGP W 
Sbjct  199   SSFTGEKTAGPNNNSLRGFEVIDSIKSELESLCPGVVSCADILAVSARDSVAAVGGPFWA  258

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             V LGRRD+ TAS  AAN  IP P  +L+ LIS+FS  G S  +MV LSG+HTIGQARC  
Sbjct  259   VPLGRRDSTTASLDAANTDIPSPVMDLSDLISAFSNKGFSAKEMVALSGAHTIGQARCVV  318

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR RIYNESNI +SFA S K NCP +SGS D++L+P+D  TP  FDN+Y+ NLV+ KGL+
Sbjct  319   FRDRIYNESNIFASFATSLKSNCP-SSGS-DDSLSPIDATTPGSFDNSYFKNLVSNKGLM  376

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTG  1030
             HSDQQLF+G STDS V  Y+ NP  F +DFA+AMI+MG++ PLTG
Sbjct  377   HSDQQLFSGASTDSQVTAYTNNPAAFFADFASAMIRMGNLSPLTG  421



>ref|XP_006833057.1| hypothetical protein AMTR_s00170p00037010 [Amborella trichopoda]
 gb|ERM98335.1| hypothetical protein AMTR_s00170p00037010 [Amborella trichopoda]
Length=315

 Score =   395 bits (1016),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 192/288 (67%), Positives = 225/288 (78%), Gaps = 3/288 (1%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  FYS SCP L   V + +  A+ +EAR+GAS+LRLFFHDCFVNGCD SILLDDT+
Sbjct  22    AQLSSTFYSSSCPNLLSIVRTAMTQAVNREARLGASILRLFFHDCFVNGCDASILLDDTA  81

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             +FTGEK AAPN  SARGFEVID IK+ V   C  VVSCADILA+A+RD  V LGGP+W V
Sbjct  82    NFTGEKNAAPNRNSARGFEVIDTIKTRVNAACGNVVSCADILALATRDGVVLLGGPTWTV  141

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
              LGRRDARTASQ+AAN+ IP P S+L  LIS F A GL+  +M  LSG HTIG ARC+ F
Sbjct  142   PLGRRDARTASQSAANSQIPSPFSSLTTLISMFQAKGLTAREMTALSGGHTIGFARCSTF  201

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R RIYNE+NID++FA++R+  CP A+G GD NLAPLD QT  +FDNNYY NLVN++GLLH
Sbjct  202   RTRIYNETNIDATFARTRRATCP-ATG-GDTNLAPLD-QTQTQFDNNYYQNLVNRRGLLH  258

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ+LFNG S D+ VR YSTN   FSSDFA+AM+ MG+I PLTG NGE
Sbjct  259   SDQELFNGGSQDALVRTYSTNGATFSSDFASAMVNMGNISPLTGTNGE  306



>ref|XP_010041557.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=319

 Score =   395 bits (1016),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 187/289 (65%), Positives = 228/289 (79%), Gaps = 2/289 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FYS SCP    T+ S V SA++ EARMGASLLRL FHDCFVNGCD S+LLDDT
Sbjct  24    SAQLSSTFYSTSCPSALSTIKSAVSSAVKSEARMGASLLRLHFHDCFVNGCDASVLLDDT  83

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             ++FTGEK A PN  S RGF+VID IKS +E  CPGVVSCAD+L +A+RDS V LGGPSW 
Sbjct  84    ANFTGEKNATPNANSLRGFDVIDTIKSQLESACPGVVSCADLLTVAARDSVVALGGPSWT  143

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             V LGRRD+ TASQ+AAN++IP PT NL+ LI++FS  G +T +MV LSGSHTIGQARCT+
Sbjct  144   VPLGRRDSTTASQSAANSNIPAPTLNLSGLITAFSNKGFTTKEMVALSGSHTIGQARCTS  203

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FRAR+YNE+NI+++FA S K NCP  S  GDNNL+PLD  +P  FDN Y+ NL  ++GLL
Sbjct  204   FRARLYNENNINTTFATSLKANCP--SSGGDNNLSPLDTTSPTSFDNAYFKNLQIQEGLL  261

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQLF+G STD+ V  YS+N   F +DFA AM+KMG++ PLTG++G+
Sbjct  262   HSDQQLFSGGSTDAQVNAYSSNSATFMTDFANAMVKMGNLSPLTGSSGQ  310



>ref|XP_004490701.1| PREDICTED: peroxidase 4-like [Cicer arietinum]
Length=335

 Score =   396 bits (1017),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 197/290 (68%), Positives = 221/290 (76%), Gaps = 2/290 (1%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             A+LS   Y K CP +F  +NSVV SA+ KE RMGASLLRLFFHDCFVNGCDGS+LLDDTS
Sbjct  37    AELSENLYVKKCPNVFNAINSVVHSAVAKEPRMGASLLRLFFHDCFVNGCDGSVLLDDTS  96

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             S  GEK A PN  S RGFEVID IKS VE +CPGVVSCADILAI +RDS V LGGP W V
Sbjct  97    SIKGEKNAGPNKDSLRGFEVIDAIKSKVEALCPGVVSCADILAITARDSVVNLGGPYWKV  156

Query  539   KLGRRDARTASQAAANNS-IPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             KLGRRD++ AS   AN+  IPPP S L  LIS F A GLST DMV LSG+HTIG+ARC  
Sbjct  157   KLGRRDSKRASFNDANSGVIPPPFSTLKNLISRFQAQGLSTKDMVALSGAHTIGKARCIV  216

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGS-GDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             +R  IYN++NIDS FA+SRK NCPR SGS  DNN+A LD +TP  FDN YY NL+NKKGL
Sbjct  217   YRDHIYNDTNIDSLFAKSRKRNCPRTSGSIKDNNVAVLDFKTPNHFDNLYYKNLINKKGL  276

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQ+LFNG STDS V+ YS N   F +DF  AMIKMG+  PLTG+ GE
Sbjct  277   LHSDQELFNGGSTDSLVKTYSNNQKAFENDFVIAMIKMGNNNPLTGSKGE  326



>ref|XP_008374568.1| PREDICTED: peroxidase 4-like [Malus domestica]
Length=318

 Score =   395 bits (1014),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 192/288 (67%), Positives = 225/288 (78%), Gaps = 3/288 (1%)
 Frame = +2

Query  182   QLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTSS  361
             +L+  FY   CPK    V   V +AI+ E R+GASLLRL FHDCFVNGCD S+LLDDTSS
Sbjct  24    KLTQNFYKSKCPKALSIVQEGVIAAIKNETRIGASLLRLHFHDCFVNGCDASVLLDDTSS  83

Query  362   FTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVK  541
             F GEK AAPN  S RGFEV+DQIK+ +EK CPGVVSCAD+LA+A+RDSTV LGGPSW V 
Sbjct  84    FVGEKTAAPNNNSIRGFEVVDQIKAKLEKACPGVVSCADLLALAARDSTVYLGGPSWKVG  143

Query  542   LGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFR  721
             LGRRD+ TAS++AAN SIPPPTSN++ LISSFSA GLS  D+V LSGSHTIG ARCT+FR
Sbjct  144   LGRRDSTTASRSAANTSIPPPTSNISALISSFSAQGLSIRDLVALSGSHTIGLARCTSFR  203

Query  722   ARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHS  901
             +RIYN+S ID++FAQS +G CPR+    DNNLA LDLQTP  FDN YY NL+ +KGLLHS
Sbjct  204   SRIYNDSAIDATFAQSLQGICPRS--GNDNNLASLDLQTPTHFDNKYYKNLLKEKGLLHS  261

Query  902   DQQLFNG-VSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             DQ+LFNG  STD  V+ Y+ N   F   FA AM+KMG+I PLTG+ GE
Sbjct  262   DQELFNGTTSTDKLVQIYANNTLTFFKHFAVAMVKMGNIDPLTGSQGE  309



>gb|KDO41520.1| hypothetical protein CISIN_1g020615mg [Citrus sinensis]
Length=298

 Score =   394 bits (1011),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 198/290 (68%), Positives = 222/290 (77%), Gaps = 26/290 (9%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FYSK+CPKL  TV S V+SA+ KE RMGASLLRL FHDCFVNGCDGSILLDDT
Sbjct  25    SAQLSTNFYSKTCPKLLNTVKSAVQSAVSKERRMGASLLRLHFHDCFVNGCDGSILLDDT  84

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGEK + PN  SARGFEV+D IKS                          LGGPSWN
Sbjct  85    SSFTGEKTSGPNINSARGFEVVDDIKS-------------------------KLGGPSWN  119

Query  536   VKLGRRDARTASQAAANNS-IPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  712
             VKLGRRD++TAS AAAN+  IPPPTS L+ LI+ F A GLS  DMV LSG+HTIGQARC 
Sbjct  120   VKLGRRDSKTASLAAANSGVIPPPTSTLSNLINRFQAKGLSAKDMVALSGAHTIGQARCV  179

Query  713   NFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
              FR RIYNESNI+SSFA++R+GNCPRA+GSGDNNLAPLD Q+P KFDN YY +L+N+KGL
Sbjct  180   AFRNRIYNESNIESSFAKNRRGNCPRATGSGDNNLAPLDFQSPNKFDNQYYKHLLNQKGL  239

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQ LFNG STDS V  Y++N   F+SDFAAAMIKMGDI PLTG+ GE
Sbjct  240   LHSDQILFNGGSTDSLVSTYASNSKTFNSDFAAAMIKMGDISPLTGSIGE  289



>ref|XP_007011215.1| Peroxidase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY20025.1| Peroxidase superfamily protein isoform 1 [Theobroma cacao]
Length=317

 Score =   394 bits (1013),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 189/287 (66%), Positives = 223/287 (78%), Gaps = 2/287 (1%)
 Frame = +2

Query  182   QLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTSS  361
             +LSP +YS +CP++   V   VR AI+KEARMGASLLRL FHDCFVNGCDGS+LLDDT++
Sbjct  24    KLSPNYYSSTCPEVLSIVKERVRVAIKKEARMGASLLRLHFHDCFVNGCDGSLLLDDTAT  83

Query  362   FTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVK  541
             F GEK AAPN  S RGF V+D IK+ VEK CPGVVSCADILAIA+RDST  LGGPSW VK
Sbjct  84    FIGEKTAAPNNNSVRGFYVVDDIKAKVEKACPGVVSCADILAIAARDSTAMLGGPSWEVK  143

Query  542   LGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFR  721
             LGRRD+ TAS+AAANNSIP PT N++ L+ SF+A GLS  D+V LSGSHTIG ARCT+FR
Sbjct  144   LGRRDSTTASRAAANNSIPAPTFNISGLLLSFAAQGLSLEDLVALSGSHTIGLARCTSFR  203

Query  722   ARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHS  901
               IYN+SNID+SFA+S +  CP++    DN   PLD QTP  FDN YY NL+  KGLLHS
Sbjct  204   THIYNDSNIDASFAKSLQRKCPKS--GKDNVHQPLDFQTPTSFDNLYYHNLLKMKGLLHS  261

Query  902   DQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             DQ+LFNG S D  V  Y+ + + F   FA +MIKMGDIKPLTG++GE
Sbjct  262   DQELFNGASADCLVEEYAADTSAFFKAFAKSMIKMGDIKPLTGSSGE  308



>gb|AIE12239.1| peroxide [Momordica charantia]
Length=324

 Score =   394 bits (1013),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 196/285 (69%), Positives = 226/285 (79%), Gaps = 3/285 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FYSK+CP L  TV + VRSAI KEAR+GASLLRL FHDCFVNGCDGSILLDDT
Sbjct  29    SAQLSTTFYSKTCPNLLSTVRAGVRSAIAKEARIGASLLRLHFHDCFVNGCDGSILLDDT  88

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
              +F GE+ A PN +S RGF+VI  IKS+VEKVCP VVSCADIL + SRDS V LGGPSW 
Sbjct  89    PTFMGEQTAPPNNRSVRGFDVIKDIKSSVEKVCPSVVSCADILTLTSRDSVVILGGPSWE  148

Query  536   VKLGRRDARTAS-QAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  712
             VKLGRRD++T S  AA++  IPPPTS L+ LI+ F+AVGLST DMV LSG+HTIGQARC 
Sbjct  149   VKLGRRDSKTVSFSAASSGVIPPPTSTLSNLINRFNAVGLSTKDMVALSGAHTIGQARCV  208

Query  713   NFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             +FR RIYNESNID+SFA+ R+ NCPR+   GD+NLAPLD+ TP  FDN YY NL+N+KGL
Sbjct  209   SFRNRIYNESNIDASFAKLRQRNCPRS--GGDDNLAPLDVVTPKLFDNYYYKNLLNQKGL  266

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLT  1027
             LHSDQ L NG STDS V  YS     F +DF AAMI+MG+ +PLT
Sbjct  267   LHSDQVLHNGGSTDSLVELYSKTIRTFDADFVAAMIRMGEHQPLT  311



>ref|XP_004500339.1| PREDICTED: cationic peroxidase 1-like [Cicer arietinum]
Length=318

 Score =   394 bits (1012),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 190/289 (66%), Positives = 225/289 (78%), Gaps = 2/289 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FY  +CPK    +NS V SA+ KE RMGASLLRL FHDCFVNGCD S+LLDDT
Sbjct  23    SAQLSSDFYGTTCPKALSIINSAVCSAVSKEQRMGASLLRLHFHDCFVNGCDASVLLDDT  82

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGEK A  N  S RGFEVID IK+ +E  CPG+VSCADI+A+A+RDS   LGGPSW+
Sbjct  83    SSFTGEKSAGANVNSLRGFEVIDDIKTQLETACPGIVSCADIVAVAARDSVKALGGPSWS  142

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             V LGRRD+ TAS+ AA N IP P  +L+ LIS+FS  G +TN+MVVLSG+HT GQARC  
Sbjct  143   VGLGRRDSTTASKDAATNDIPSPLMDLSDLISAFSNKGFTTNEMVVLSGAHTTGQARCQL  202

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR RIYNE+ IDS+FA S K NCP  S  GD+NL  LD+ T + FDN Y+ NLVNKKGLL
Sbjct  203   FRGRIYNETTIDSNFATSVKSNCP--STGGDSNLTSLDVTTNVLFDNAYFKNLVNKKGLL  260

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQLF+G STDS V  YST+P+ F++DFA+AM+KMG++ PLTGNNG+
Sbjct  261   HSDQQLFSGGSTDSQVTTYSTSPSTFNADFASAMVKMGNLSPLTGNNGQ  309



>gb|ABK23423.1| unknown [Picea sitchensis]
Length=318

 Score =   394 bits (1012),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 193/287 (67%), Positives = 222/287 (77%), Gaps = 2/287 (1%)
 Frame = +2

Query  182   QLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTSS  361
             QL+  FYS+SCP+    V + V  A+ KE RMGASLLRL FHDCFVNGCDGSILLDD S+
Sbjct  25    QLTSTFYSESCPRALSIVQAAVEQAVAKERRMGASLLRLHFHDCFVNGCDGSILLDDNST  84

Query  362   FTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVK  541
             FTGEK A PN  S RG++VID IK+ VE  C GVVSCADI+AIA+RDS V LGGP+W V 
Sbjct  85    FTGEKTATPNNNSVRGYDVIDTIKTQVEAACSGVVSCADIVAIAARDSVVALGGPTWTVL  144

Query  542   LGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFR  721
             LGRRD+ TAS  AAN+SIP P SNL+ LISSF +  LS  D+V LSG+HTIGQARCT+FR
Sbjct  145   LGRRDSTTASFNAANSSIPSPASNLSTLISSFRSHNLSPKDLVALSGAHTIGQARCTSFR  204

Query  722   ARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHS  901
             ARIYNESNID+S A + K  CPR    GDN L+PLDL TPI FD +YY NL +KKGLLHS
Sbjct  205   ARIYNESNIDTSLATAVKPKCPRT--GGDNTLSPLDLATPITFDKHYYCNLRSKKGLLHS  262

Query  902   DQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             DQQLFNG STDS V  YSTN   F +DFAAAM+ MG+IKPLTG +G+
Sbjct  263   DQQLFNGGSTDSQVTTYSTNQNNFFTDFAAAMVNMGNIKPLTGTSGQ  309



>ref|XP_008795235.1| PREDICTED: peroxidase P7-like [Phoenix dactylifera]
Length=317

 Score =   394 bits (1011),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 188/287 (66%), Positives = 231/287 (80%), Gaps = 2/287 (1%)
 Frame = +2

Query  182   QLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTSS  361
             QLSP FY+++CP L   V SV+  A+QKE+RM AS+LRL FHDCFVNGCDGSILLDDT +
Sbjct  24    QLSPTFYNRTCPNLQSIVRSVMAQAVQKESRMAASILRLVFHDCFVNGCDGSILLDDTPT  83

Query  362   FTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVK  541
             FTGEK A PN  SARGFEVID IK+ VE  C   VSCADILA+A RD    +GGP+WNV 
Sbjct  84    FTGEKNAGPNANSARGFEVIDAIKTQVEAACRATVSCADILALAGRDGVALVGGPTWNVP  143

Query  542   LGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFR  721
             LGRRDARTASQ+AAN+++P P+S+L+ LIS F+A GL+  DM VLSG+HTIGQARCT FR
Sbjct  144   LGRRDARTASQSAANSNLPGPSSSLSTLISMFAAKGLNARDMTVLSGAHTIGQARCTLFR  203

Query  722   ARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHS  901
             +RI+NE+N+++SFA  RK  CP ASG GD NLAPLD+++P +FDN YY +LV ++GLLHS
Sbjct  204   SRIFNEANVNASFAALRKRTCP-ASG-GDGNLAPLDVRSPDRFDNAYYQDLVARQGLLHS  261

Query  902   DQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             DQ+LFNG S D+ VR YST+  +F+ DFAAAM+KMG+I PLTG +GE
Sbjct  262   DQELFNGGSQDAQVRQYSTDSAQFARDFAAAMVKMGNISPLTGTSGE  308



>ref|XP_010925616.1| PREDICTED: peroxidase P7-like [Elaeis guineensis]
Length=317

 Score =   394 bits (1011),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 189/287 (66%), Positives = 230/287 (80%), Gaps = 2/287 (1%)
 Frame = +2

Query  182   QLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTSS  361
             QLSP FYS++CP L   V SV+  A+QKE RM AS+LRLFFHDCFVNGCDGSILLDDT +
Sbjct  24    QLSPTFYSRNCPNLQSIVRSVMAQAVQKEPRMAASILRLFFHDCFVNGCDGSILLDDTPT  83

Query  362   FTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVK  541
             FTGEK A PN  SARGFEVID IK+ VE  C   VSCADILA+A+RD    +GGP+WNV 
Sbjct  84    FTGEKNAGPNANSARGFEVIDAIKTQVEAACKATVSCADILALAARDGVALVGGPNWNVL  143

Query  542   LGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFR  721
             LGRRDARTASQ+AAN+++P P S+L+ LIS F+A GL+  ++  LSG+HTIG+ARC  FR
Sbjct  144   LGRRDARTASQSAANSNLPGPGSSLSTLISMFAAQGLNAQELTALSGAHTIGRARCLFFR  203

Query  722   ARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHS  901
              RI+NE+N+++SFA  RK  CP ASG GD+NLAP D++TP +FDN YY +LVN++GLLHS
Sbjct  204   NRIFNEANVNASFAALRKQTCP-ASG-GDSNLAPFDIRTPDRFDNAYYQDLVNQQGLLHS  261

Query  902   DQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             DQ+LFNG S D+ VR YSTNP  F+ DFAAAM+KMG+I PLTGN+GE
Sbjct  262   DQELFNGGSQDALVRQYSTNPALFARDFAAAMVKMGNISPLTGNSGE  308



>dbj|BAM28608.1| putative peroxidase [Nepenthes alata]
Length=317

 Score =   393 bits (1009),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 190/289 (66%), Positives = 226/289 (78%), Gaps = 2/289 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  +Y  SCPK   T+ S V SAIQKEARMGASLLRL FHDCFVNGCDGS+LLDDT
Sbjct  21    SAQLSSTYYDSSCPKALSTIESGVTSAIQKEARMGASLLRLHFHDCFVNGCDGSVLLDDT  80

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             ++FTGEK AAPN  S RGF+VID IK++VE VCPGVVSCADILA+ +RDS V LGG SW 
Sbjct  81    ANFTGEKTAAPNLNSLRGFDVIDTIKASVESVCPGVVSCADILAVVARDSVVKLGGQSWT  140

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             V LGRRD+ TAS +AAN +IP PT NL+ LISSFS  GL+ ++MV LSG+HTIG ARCT 
Sbjct  141   VLLGRRDSTTASLSAANANIPAPTLNLSGLISSFSNKGLTEDEMVALSGAHTIGLARCTT  200

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR+RIYNE+NIDSS+A S K  CP + G   NN APLD  +P  FDN Y+ +L+N KGLL
Sbjct  201   FRSRIYNETNIDSSYATSLKKTCPTSGGG--NNTAPLDTTSPYTFDNAYFKDLINLKGLL  258

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQL+N  S DS V  YS++P+ FS+DFA A++KMG++ PLTG  G+
Sbjct  259   HSDQQLYNNGSADSQVSKYSSSPSTFSTDFANAIVKMGNLSPLTGTEGQ  307



>ref|XP_004977590.1| PREDICTED: cationic peroxidase 1-like [Setaria italica]
Length=317

 Score =   393 bits (1009),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 188/289 (65%), Positives = 223/289 (77%), Gaps = 2/289 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQL+  FY KSCP    T+ + V+SA+ KE RMGASLLRL FHDCFVNGCDGS+LLDDT
Sbjct  22    SAQLTANFYDKSCPNALYTIQTAVKSAVAKENRMGASLLRLHFHDCFVNGCDGSVLLDDT  81

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
              +FTGEK A PN  S RGF+VID IK+ +E +CP VVSCADILA+A+RDS VTLGGP+W 
Sbjct  82    PTFTGEKTAVPNNNSIRGFDVIDSIKAQIEGICPQVVSCADILAVAARDSVVTLGGPTWV  141

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             V LGRRD+ TAS  AANN IP PT +L+ L  SFS  GL+  DM+ LSG HTIGQARC N
Sbjct  142   VNLGRRDSTTASLDAANNDIPKPTFDLSDLTKSFSNKGLTATDMIALSGGHTIGQARCVN  201

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR RIY+E+NID+S A S K NCP    +GDNN++PLD  TP  FDN YY NL+NKKG+L
Sbjct  202   FRNRIYSEANIDTSLATSLKSNCPNK--TGDNNISPLDASTPYVFDNFYYKNLLNKKGVL  259

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQLFNG S DS    YS+N  KF +DF+AAM+KMG+I PLTG++G+
Sbjct  260   HSDQQLFNGGSADSQTTTYSSNMAKFFTDFSAAMVKMGNISPLTGSSGQ  308



>ref|XP_009404515.1| PREDICTED: peroxidase P7-like [Musa acuminata subsp. malaccensis]
Length=317

 Score =   392 bits (1008),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 189/287 (66%), Positives = 223/287 (78%), Gaps = 2/287 (1%)
 Frame = +2

Query  182   QLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTSS  361
             QLS  FY+ +CP L Q V S +  A+ KE RM AS+LRLFFHDCFVNGCD SILLDDT++
Sbjct  24    QLSSTFYAGTCPNLQQIVRSTMAQAVNKEPRMAASILRLFFHDCFVNGCDASILLDDTAA  83

Query  362   FTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVK  541
             FTGEK A+PN  SARG+EVID IKS VE  C   VSCAD+LA+A+RD    LGGP+W V+
Sbjct  84    FTGEKNASPNRNSARGYEVIDAIKSNVEAACRATVSCADVLALAARDGVALLGGPTWAVQ  143

Query  542   LGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFR  721
             LGRRDARTASQ+ AN+++P P+S L+ LISSF+A GL+  DM  LSG+HTIGQA+C NFR
Sbjct  144   LGRRDARTASQSDANSNLPGPSSGLSTLISSFAAKGLNARDMTALSGAHTIGQAQCGNFR  203

Query  722   ARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHS  901
             + IYN++N++SSFA  RK NCP  S  GD NLAPLDL+TP +FDN YY +LV KKGLLHS
Sbjct  204   SHIYNDANVNSSFAALRKRNCP--SSGGDGNLAPLDLETPNRFDNGYYRDLVAKKGLLHS  261

Query  902   DQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             DQ+LFNG S DS VR YS N   FS DFAAAM+KMG I PLTGN GE
Sbjct  262   DQELFNGGSQDSLVRQYSVNNAAFSRDFAAAMVKMGAISPLTGNRGE  308



>ref|XP_009404514.1| PREDICTED: peroxidase P7-like [Musa acuminata subsp. malaccensis]
Length=317

 Score =   392 bits (1008),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 190/287 (66%), Positives = 223/287 (78%), Gaps = 2/287 (1%)
 Frame = +2

Query  182   QLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTSS  361
             QLS  FY+ +CP L Q V S +  A+ KE RM AS+LRLFFHDCFVNGCD SILLDDT++
Sbjct  24    QLSSTFYAGTCPNLQQIVRSTMAQAVNKEPRMAASILRLFFHDCFVNGCDASILLDDTAA  83

Query  362   FTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVK  541
             FTGEK A+PN  SARG+EVID IKS VE  C   VSCADILA+A+RD    LGGP+W V+
Sbjct  84    FTGEKNASPNRNSARGYEVIDAIKSNVEAACRATVSCADILALAARDGVALLGGPTWAVQ  143

Query  542   LGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFR  721
             LGRRDARTASQ+ AN+++P P+S L+ LISSF+A GL+  DM  LSG+HTIGQA+C NFR
Sbjct  144   LGRRDARTASQSDANSNLPGPSSGLSTLISSFAAKGLNARDMTALSGAHTIGQAQCGNFR  203

Query  722   ARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHS  901
             + IYN++N++SSFA  RK NCP  S  GD NLAPLDL+TP +FDN YY +LV KKGLLHS
Sbjct  204   SHIYNDANVNSSFAALRKRNCP--SSGGDGNLAPLDLETPNRFDNGYYRDLVAKKGLLHS  261

Query  902   DQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             DQ+LFNG S DS VR YS N   FS DFAAAM+KMG I PLTGN GE
Sbjct  262   DQELFNGGSQDSLVRQYSVNNAAFSRDFAAAMVKMGAISPLTGNRGE  308



>gb|ACZ51443.1| peroxidase protein [Mikania micrantha]
Length=321

 Score =   393 bits (1009),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 186/287 (65%), Positives = 226/287 (79%), Gaps = 2/287 (1%)
 Frame = +2

Query  182   QLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTSS  361
             QLS  FY+ SCP     ++S V SA+  EARMGASLLRL FHDCFVNGCD S+LLDDT++
Sbjct  28    QLSANFYATSCPNFSSIISSAVNSAVSNEARMGASLLRLHFHDCFVNGCDASVLLDDTTN  87

Query  362   FTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVK  541
             FTGEK A PN  S RGF+VID IKS +E  CPGVVSCAD+LA A+RDS V LGGPSWN+ 
Sbjct  88    FTGEKTAGPNNNSLRGFDVIDTIKSQLESSCPGVVSCADLLATAARDSVVALGGPSWNLA  147

Query  542   LGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFR  721
              GRRD+ TAS +AAN++IP PT NL+ LI+SFS +G + N+MV LSGSHTIGQARCT FR
Sbjct  148   FGRRDSITASLSAANSNIPAPTLNLSGLITSFSNLGFTANEMVALSGSHTIGQARCTVFR  207

Query  722   ARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHS  901
             ARIYNE+NI+SSFA S + NCP  S  GDNNL+PLD+ +P  FDN Y+ NL+N+ GLLHS
Sbjct  208   ARIYNENNINSSFATSLRANCP--SSGGDNNLSPLDVVSPTSFDNTYFTNLLNQNGLLHS  265

Query  902   DQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             DQ+LFNG STD+ VR YS+N   FS+DFA  M+KM ++ PLTG++G+
Sbjct  266   DQELFNGGSTDAQVRTYSSNAATFSTDFANGMVKMSNLNPLTGSSGQ  312



>ref|XP_009388702.1| PREDICTED: peroxidase P7-like [Musa acuminata subsp. malaccensis]
Length=456

 Score =   397 bits (1021),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 192/287 (67%), Positives = 225/287 (78%), Gaps = 2/287 (1%)
 Frame = +2

Query  182   QLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTSS  361
             QLSP FYS +CP L   V S +  A+ KE RM AS+LRLFFHDCFV+GCDGSILLDDTS+
Sbjct  26    QLSPTFYSSTCPNLQSIVRSAMTQAVNKERRMAASILRLFFHDCFVSGCDGSILLDDTST  85

Query  362   FTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVK  541
             FTGEK A PN  S RGFEVID IKS VE  C   VSCADILA+A+RD  V LGGP+W V+
Sbjct  86    FTGEKNAGPNANSVRGFEVIDTIKSNVETACKATVSCADILALAARDGVVLLGGPTWTVQ  145

Query  542   LGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFR  721
             LGRRDA TASQ++AN+++P P S+L++LISSFS+ GLS  DM  LSG+HTIGQARCT FR
Sbjct  146   LGRRDATTASQSSANSNLPSPGSSLSQLISSFSSKGLSARDMTALSGAHTIGQARCTTFR  205

Query  722   ARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHS  901
             + IYN++N+D+SFA + K  CP ASG GD+NLAPLDL+TP  FDN YY NLV ++GLLHS
Sbjct  206   SHIYNDANVDASFASTHKHTCP-ASG-GDSNLAPLDLKTPTTFDNRYYQNLVVRRGLLHS  263

Query  902   DQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             DQ+LFN  S DS VR YSTN   FS DFAAAM+KMG+I PLTG  GE
Sbjct  264   DQELFNKGSQDSLVRQYSTNAAAFSCDFAAAMVKMGNISPLTGTKGE  310


 Score =   181 bits (459),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 101/131 (77%), Gaps = 2/131 (2%)
 Frame = +2

Query  650   LSTNDMVVLSGSHTIGQARCTNFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLD  829
             L+  D+  LSG+HTIGQARC NFR+ IYN++NID+SFA   + NCP  S  GDN LAPLD
Sbjct  319   LNARDLTALSGAHTIGQARCVNFRSHIYNDANIDASFASQTQQNCP--SSGGDNTLAPLD  376

Query  830   LQTPIKFDNNYYVNLVNKKGLLHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMG  1009
             LQTP  FDN YY NLV++KGLLHSDQ+LFN  + D+ VR YSTN   FS DFAAAM+KMG
Sbjct  377   LQTPTAFDNAYYQNLVSQKGLLHSDQELFNNGTQDALVRQYSTNAAAFSRDFAAAMVKMG  436

Query  1010  DIKPLTGNNGE  1042
             +I PLTG+ GE
Sbjct  437   NISPLTGSQGE  447



>gb|AAB02554.1| cationic peroxidase [Stylosanthes humilis]
Length=320

 Score =   392 bits (1008),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 190/290 (66%), Positives = 226/290 (78%), Gaps = 3/290 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             S QLS  FY+  CP    T+ S V SA+ KEAR+GASLLRL FHDCFV GCD S+LLDDT
Sbjct  24    SGQLSSNFYATKCPNALSTIKSAVNSAVSKEARLGASLLRLHFHDCFVQGCDASVLLDDT  83

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             S+FTGEK A PN  SARGF+VID IKS VE +CPGVVSCADILA+A+RDS V LGGPSWN
Sbjct  84    STFTGEKTAFPNVNSARGFDVIDTIKSQVESLCPGVVSCADILALAARDSVVALGGPSWN  143

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             V+LGRRD+ TAS  +AN+ +P P+ NL+ LIS+FS  G +  ++V LSG+HTIGQARCT 
Sbjct  144   VQLGRRDSTTASLNSANSDLPGPSFNLSGLISAFSKKGFTAKELVTLSGAHTIGQARCTT  203

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR RIYNESNID S+A+S +GNCP  S  GD+NL+P D+ TP KFDN YY+NL NKKGLL
Sbjct  204   FRTRIYNESNIDPSYAKSLQGNCP--SVGGDSNLSPFDVTTPNKFDNAYYINLKNKKGLL  261

Query  896   HSDQQLFN-GVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             H+DQQLFN G STDS V  YS N   F++DF  AMIKMG++ PLTG +G+
Sbjct  262   HADQQLFNGGGSTDSQVTAYSNNAATFNTDFGNAMIKMGNLSPLTGTSGQ  311



>ref|XP_003534655.2| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=342

 Score =   393 bits (1010),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 202/336 (60%), Positives = 250/336 (74%), Gaps = 5/336 (1%)
 Frame = +2

Query  35    TLIVTPLLLPNNLVAYKVVREGSMAVSVKDNNITAvllcvlvlvggcSAQLSPGFYSKSC  214
             TLI++  L P  LV Y   +     +++   NI      +  L+G  SAQLS  FY+K+C
Sbjct  3     TLIISHALNPIFLVTYFNFKT---PITMILPNIKVRFFLLFCLIGIVSAQLSSTFYAKTC  59

Query  215   PKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTSSFTGEKRAAPNF  394
             P    T+ S V SA+  E RMGASLLRL FHDCFV GCD S+LLDDTSSFTGEK A PN 
Sbjct  60    PNALSTIKSEVVSAVNNERRMGASLLRLHFHDCFVQGCDASVLLDDTSSFTGEKTAGPNA  119

Query  395   QSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVKLGRRDARTASQ  574
              S RGF+VID IKS VE +CPGVVSCADILA+A+RDS V LGG +W V+LGRRD+ TAS 
Sbjct  120   GSIRGFDVIDTIKSKVESLCPGVVSCADILAVAARDSVVALGGTTWTVQLGRRDSTTASL  179

Query  575   AAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFRARIYNESNIDS  754
             ++AN+ +P PTS+L+ LISSFS  G S+ ++V LSGSHTIGQA+C++FR RIYN++NIDS
Sbjct  180   SSANSDLPGPTSSLSALISSFSNKGFSSKELVALSGSHTIGQAQCSSFRTRIYNDTNIDS  239

Query  755   SFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHSDQQLFNGVSTD  934
             SFA+S +GNCP  S  GD+NLAPLD  +P  FDN Y+ NL +KKGLLHSDQ+LFNG STD
Sbjct  240   SFAKSLQGNCP--STGGDSNLAPLDTTSPNTFDNAYFKNLQSKKGLLHSDQELFNGGSTD  297

Query  935   STVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             S V  YS+NP  F +DFA AMIKMG++ PLTG++G+
Sbjct  298   SQVNSYSSNPASFQTDFANAMIKMGNLSPLTGSSGQ  333



>dbj|BAM28609.1| putative peroxidase [Nepenthes alata]
Length=317

 Score =   392 bits (1007),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 190/289 (66%), Positives = 225/289 (78%), Gaps = 2/289 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  +Y  SCPK   T+ S V SAIQKEARMGASLLRL FHDCFVNGCDGS+LLDDT
Sbjct  21    SAQLSSTYYDSSCPKALSTIESGVTSAIQKEARMGASLLRLHFHDCFVNGCDGSVLLDDT  80

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             ++FTGEK AAPN  S RGF+VID IK++VE VCPGVVSCADILA+ +RDS V LGG SW 
Sbjct  81    ANFTGEKTAAPNLNSLRGFDVIDTIKASVESVCPGVVSCADILAVVARDSVVKLGGQSWT  140

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             V LGRRD+ TAS +AAN +IP PT NL+ LISSFS  GL+ ++MV LSG+HTIG ARCT 
Sbjct  141   VLLGRRDSTTASLSAANANIPAPTLNLSGLISSFSNKGLTEDEMVALSGAHTIGLARCTT  200

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR+RIYNE+NIDSS+A S K  CP + G   NN APLD  +P  FDN Y+ +L+N KGLL
Sbjct  201   FRSRIYNETNIDSSYATSLKKTCPTSGGG--NNTAPLDTTSPYTFDNAYFKDLINLKGLL  258

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQL+N  S DS V  YS++P+ FS+DFA A++KMG+  PLTG  G+
Sbjct  259   HSDQQLYNNGSADSQVSKYSSSPSTFSTDFANAIVKMGNFSPLTGTEGQ  307



>ref|XP_009594465.1| PREDICTED: cationic peroxidase 1-like [Nicotiana tomentosiformis]
Length=314

 Score =   392 bits (1006),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 191/289 (66%), Positives = 223/289 (77%), Gaps = 3/289 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SA+L+  FYS +CP +   + + V SAI KE+RMGASLLRL FHDCFVNGCD S+LLDDT
Sbjct  20    SAELTSNFYSSTCPNVLSVIKTAVNSAISKESRMGASLLRLHFHDCFVNGCDASVLLDDT  79

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGEK A PN  S RGF+VID IK+ VE  C GVVSCADILA+A+RDS V LGGPSWN
Sbjct  80    SSFTGEKTANPNSGSLRGFDVIDTIKTQVESTCAGVVSCADILAVAARDSVVKLGGPSWN  139

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             V LGRRD+ TAS +AANN IP PT NL+ LISSFS  G +  +MV LSGSHTIGQARCT 
Sbjct  140   VLLGRRDSTTASLSAANNDIPAPTLNLSSLISSFSNKGFNAREMVALSGSHTIGQARCTT  199

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR R+YNE+NI+SSF  S K NCP+    GDNNL+PLD  +P  FDN YY NL ++KG+L
Sbjct  200   FRDRLYNETNINSSFGTSIKANCPQ--NGGDNNLSPLD-TSPTTFDNAYYKNLQSQKGIL  256

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQLFNG STDS V  YS+N   F +DFA AM+KMG++ PLTG NG+
Sbjct  257   HSDQQLFNGGSTDSIVNTYSSNSATFFTDFAMAMVKMGNLSPLTGTNGQ  305



>gb|AFK45898.1| unknown [Lotus japonicus]
Length=330

 Score =   392 bits (1008),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 196/292 (67%), Positives = 228/292 (78%), Gaps = 3/292 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FY K CP +F  V SVV SA+ KEARMG SLLRLFFHDCFVNGCDGS+LLDDT
Sbjct  30    SAQLSENFYVKKCPSVFNAVKSVVHSAVAKEARMGGSLLRLFFHDCFVNGCDGSVLLDDT  89

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSF GEK A PN  S RGF+VID IKS VE VCPGVVSCAD++AIA+RDS   LGGP W 
Sbjct  90    SSFKGEKTAPPNSNSLRGFDVIDAIKSKVEAVCPGVVSCADVVAIAARDSVAILGGPYWK  149

Query  536   VKLGRRDARTASQAAANNS-IPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  712
             VKLGRRD++TAS  AAN+  IP P S+L+ LIS F A GLST DMV LSG+HTIG+A+C+
Sbjct  150   VKLGRRDSKTASFNAANSGVIPSPFSSLSDLISKFQAQGLSTKDMVALSGAHTIGKAKCS  209

Query  713   NFRARIYNES-NIDSSFAQSRKGNCPRASGS-GDNNLAPLDLQTPIKFDNNYYVNLVNKK  886
              FR  +YNE+ NI+S FA++R+ NCPR SG+  DNN+A LD +TP +FDN YY NL+NKK
Sbjct  210   TFRQHVYNETNNINSLFAKARQRNCPRTSGTIRDNNVAVLDFKTPNQFDNLYYKNLINKK  269

Query  887   GLLHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             GLLHSDQ LF+G STDS VR YS N   F +DF  AMIKMG+ K LTG+NG+
Sbjct  270   GLLHSDQVLFSGGSTDSLVRTYSNNQKAFENDFVNAMIKMGNNKSLTGSNGQ  321



>pdb|1SCH|A Chain A, Peanut Peroxidase
 pdb|1SCH|B Chain B, Peanut Peroxidase
Length=294

 Score =   391 bits (1004),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 188/286 (66%), Positives = 221/286 (77%), Gaps = 2/286 (1%)
 Frame = +2

Query  185   LSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTSSF  364
             LS  FY+  CP    T+ S V SA+ KEARMGASLLRL FHDCFV GCD S+LLDDTS+F
Sbjct  2     LSSNFYATKCPNALSTIKSAVNSAVAKEARMGASLLRLHFHDCFVQGCDASVLLDDTSNF  61

Query  365   TGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVKL  544
             TGEK A PN  S RGFEVID IKS VE +CPGVVSCADILA+A+RDS V LGG SWNV L
Sbjct  62    TGEKTAGPNANSIRGFEVIDTIKSQVESLCPGVVSCADILAVAARDSVVALGGASWNVLL  121

Query  545   GRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFRA  724
             GRRD+ TAS ++AN+ +P P  NL+ LIS+FS  G +T ++V LSG+HTIGQA+CT FR 
Sbjct  122   GRRDSTTASLSSANSDLPAPFFNLSGLISAFSNKGFTTKELVTLSGAHTIGQAQCTAFRT  181

Query  725   RIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHSD  904
             RIYNESNID ++A+S + NCP  S  GD NL+P D+ TP KFDN YY+NL NKKGLLHSD
Sbjct  182   RIYNESNIDPTYAKSLQANCP--SVGGDTNLSPFDVTTPNKFDNAYYINLRNKKGLLHSD  239

Query  905   QQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             QQLFNGVSTDS V  YS N   F++DF  AMIKMG++ PLTG +G+
Sbjct  240   QQLFNGVSTDSQVTAYSNNAATFNTDFGNAMIKMGNLSPLTGTSGQ  285



>ref|XP_010689717.1| PREDICTED: peroxidase P7-like [Beta vulgaris subsp. vulgaris]
Length=320

 Score =   392 bits (1006),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 189/289 (65%), Positives = 226/289 (78%), Gaps = 1/289 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLSP FYS++CP L   V + +R AI KE RMGAS+LRLFFHDCFVNGCD S+LLDDTS
Sbjct  23    AQLSPFFYSRTCPNLPLIVTNTMRQAISKEPRMGASILRLFFHDCFVNGCDASVLLDDTS  82

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             +FTGEK A PN  S RGFEVID IKS VE VC G VSCADILA+A+R +   LG PSW+V
Sbjct  83    TFTGEKNAFPNSNSIRGFEVIDTIKSNVEVVCNGTVSCADILALAARAAVFLLGDPSWSV  142

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
              LGRRDARTASQ+AAN ++PPPT+NL+ LIS F+A GL+  DM  LSG+HTIGQARCT F
Sbjct  143   PLGRRDARTASQSAANTNLPPPTANLSTLISMFAAQGLNARDMTALSGAHTIGQARCTTF  202

Query  719   RARIYNESNIDSSFAQSRKGNCP-RASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             R  IYNE+NI+ SFA  R+  CP  ASG+GD N+APLD+ TP +FD  Y++ LV ++GLL
Sbjct  203   RTHIYNETNINPSFAPLRQAQCPGPASGAGDENIAPLDIVTPNRFDRGYFLGLVTRRGLL  262

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQ+L NG S D+ VR YS N   F++DFA AM+KMG+I PLTG+NGE
Sbjct  263   HSDQELLNGGSQDALVRLYSINYVAFANDFANAMVKMGNINPLTGSNGE  311



>ref|XP_009785653.1| PREDICTED: cationic peroxidase 1-like [Nicotiana sylvestris]
Length=314

 Score =   391 bits (1005),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 190/289 (66%), Positives = 224/289 (78%), Gaps = 3/289 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SA+L+  FYS +CP +   + + V SAI KE+RMGASLLRL FHDCFVNGCD S+LLDDT
Sbjct  20    SAELTSNFYSSTCPNVLSVIKTAVNSAISKESRMGASLLRLHFHDCFVNGCDASVLLDDT  79

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGEK A PN  S RGF+VID IK+ VE  C GVVSCADILA+A+RDS V LGGPSWN
Sbjct  80    SSFTGEKTANPNSGSLRGFDVIDTIKTQVESTCAGVVSCADILAVAARDSVVKLGGPSWN  139

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             V LGRRD+ TAS +AANN IP PT NL+ LISSFS  G ++ +MV LSGSHTIGQARCT 
Sbjct  140   VLLGRRDSTTASLSAANNDIPAPTLNLSSLISSFSNKGFNSREMVALSGSHTIGQARCTT  199

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR R+YNE+NI+SSF  + K NCP+    GDNNL+PLD  +P  FDN YY NL ++KG+L
Sbjct  200   FRDRLYNETNINSSFGTTIKANCPQ--NGGDNNLSPLD-TSPTSFDNVYYKNLQSQKGIL  256

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQLFNG STDS V  YS+N   F +DFA AM+KMG++ PLTG NG+
Sbjct  257   HSDQQLFNGGSTDSIVNTYSSNSATFFTDFAMAMVKMGNLSPLTGTNGQ  305



>ref|XP_010263838.1| PREDICTED: cationic peroxidase 1-like isoform X1 [Nelumbo nucifera]
 ref|XP_010263839.1| PREDICTED: cationic peroxidase 1-like isoform X2 [Nelumbo nucifera]
Length=318

 Score =   391 bits (1005),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 191/289 (66%), Positives = 221/289 (76%), Gaps = 2/289 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FY+ SCP     + S V SA+ KE RMGASLLRL FHDCFVNGCD SILLDDT
Sbjct  23    SAQLSSNFYATSCPSALSIIKSAVTSAVAKERRMGASLLRLHFHDCFVNGCDASILLDDT  82

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSFTGEK AAPN  SARGF+VID IKS +E  CPGVVSCADILA+ASRDS V LGG SW 
Sbjct  83    SSFTGEKTAAPNANSARGFDVIDTIKSQLESACPGVVSCADILAVASRDSVVALGGTSWT  142

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             V+LGRRD+ TAS   ANN++P P  +L+ LIS+F+  G +  ++VVLSG H+IGQARC+ 
Sbjct  143   VQLGRRDSTTASLDDANNNLPSPFLDLSDLISAFANKGFTAKELVVLSGGHSIGQARCSL  202

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR+RIYNE+N+DSSFA+S K NCP  S  GDN LA LD  T   FDN Y+ NL+N KGLL
Sbjct  203   FRSRIYNETNVDSSFAKSIKSNCP--SAGGDNTLANLDTTTSTVFDNAYFTNLLNNKGLL  260

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQLFNG STD+ VR YSTN   F SDF  AMIKMG++ PLTG +G+
Sbjct  261   HSDQQLFNGGSTDAQVRAYSTNSATFFSDFGNAMIKMGNLSPLTGTSGQ  309



>ref|XP_010035985.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=320

 Score =   391 bits (1005),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 189/290 (65%), Positives = 223/290 (77%), Gaps = 3/290 (1%)
 Frame = +2

Query  176   SAQLS-PGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDD  352
             SAQLS   +Y K CPK  QT+ S V+SA+  E+RMGASLLRL FHDCFVNGCDGSILLDD
Sbjct  24    SAQLSNQNYYEKGCPKALQTIGSAVKSAVANESRMGASLLRLHFHDCFVNGCDGSILLDD  83

Query  353   TSSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSW  532
             T++FTGEK A PN  S RGF+V+D IKS VEK+CPGVVSCADILAI +RDS V LGG SW
Sbjct  84    TANFTGEKTAFPNLNSLRGFDVVDTIKSEVEKLCPGVVSCADILAIVARDSVVELGGQSW  143

Query  533   NVKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  712
              V+LGRRD+ TAS   AN  +P PT NL+ LI+SFS  G +  +MV LSGSHTIGQ+RC 
Sbjct  144   QVQLGRRDSTTASLNTANTDLPAPTLNLSALITSFSNKGFTAEEMVTLSGSHTIGQSRCV  203

Query  713   NFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
              FRAR+YNESNIDSSFA + K NCP  S  GDNNL+PLD+ +P  FDN Y+ NLV +KGL
Sbjct  204   TFRARLYNESNIDSSFATTLKANCP--SSGGDNNLSPLDVTSPTSFDNAYFTNLVCQKGL  261

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQQLF+G ST++ V  YS N   F +DFA AM+KMG + PLTG+ G+
Sbjct  262   LHSDQQLFSGGSTNAQVTAYSKNFGSFQNDFAKAMVKMGGLSPLTGSTGQ  311



>emb|CAH10840.1| peroxidase [Picea abies]
Length=320

 Score =   391 bits (1004),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 190/287 (66%), Positives = 223/287 (78%), Gaps = 2/287 (1%)
 Frame = +2

Query  182   QLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTSS  361
             QLS  FY+KSCP++   V +VV+ A+ KE RMGASL+RL FHDCFVNGCDGSILLDD ++
Sbjct  27    QLSSTFYAKSCPRVQSIVKTVVKQAVAKEKRMGASLVRLHFHDCFVNGCDGSILLDDNAT  86

Query  362   FTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVK  541
             FTGEK A PN  SARGF+VID IK+ VE  C GVVSCADIL IA+RDS V L GP+W V 
Sbjct  87    FTGEKTAGPNANSARGFDVIDTIKTQVEAACSGVVSCADILTIAARDSIVELQGPTWTVM  146

Query  542   LGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFR  721
             LGRRD+ TAS +AANN+IP P S+L+ LI+SF   GLST D+V LSG+HTIGQ+RC  FR
Sbjct  147   LGRRDSPTASLSAANNNIPSPASSLSTLITSFQNHGLSTKDLVALSGAHTIGQSRCAFFR  206

Query  722   ARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHS  901
              RIYNESNI+++FA S K NCP  S  GDN L+PLD+ TP  FDN YY NL  +KGLLHS
Sbjct  207   TRIYNESNINAAFATSVKPNCP--SAGGDNTLSPLDVVTPTTFDNKYYSNLKVQKGLLHS  264

Query  902   DQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             DQQLFNG STDS V  YSTN   F +DFAAAM+KMG+I PLTG +G+
Sbjct  265   DQQLFNGGSTDSQVTTYSTNQNSFFTDFAAAMVKMGNISPLTGTSGQ  311



>dbj|BAM28607.1| putative peroxidase [Nepenthes alata]
Length=317

 Score =   391 bits (1004),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 189/289 (65%), Positives = 226/289 (78%), Gaps = 2/289 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  +Y  SCPK   T+ S V SAIQKEARMGASLLRL FHDCFVNGCDGS+LLDDT
Sbjct  21    SAQLSSTYYDSSCPKALSTIESGVTSAIQKEARMGASLLRLHFHDCFVNGCDGSVLLDDT  80

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             ++FTGEK AAPN  S RGF+VID IK++VE VCPGVVSCADILA+ +RDS V LGG SW 
Sbjct  81    ANFTGEKTAAPNLNSLRGFDVIDTIKASVESVCPGVVSCADILAVVARDSVVKLGGQSWT  140

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             V LGRRD+ TAS +AAN +IP PT NL+ LISSFS  GL+ ++MV LSG+HTIG ARC  
Sbjct  141   VLLGRRDSTTASLSAANANIPAPTLNLSGLISSFSNKGLTEDEMVALSGAHTIGLARCVT  200

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR+RIYNE+NI SS+A S K NCP  +  G NN APLD+ TP  FDN Y+ +L+N +GLL
Sbjct  201   FRSRIYNETNIKSSYAASLKKNCP--TNDGGNNTAPLDITTPFIFDNAYFKDLINLEGLL  258

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQL+N  S DS V  YS++P+ FS+DFA A++KMG++ PLTG  G+
Sbjct  259   HSDQQLYNNGSADSQVSKYSSSPSTFSTDFANAIVKMGNLSPLTGTEGQ  307



>ref|NP_001065566.1| Os11g0112200 [Oryza sativa Japonica Group]
 tpe|CAH69373.1| TPA: class III peroxidase 131 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF27411.1| Os11g0112200 [Oryza sativa Japonica Group]
Length=317

 Score =   390 bits (1003),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 188/289 (65%), Positives = 221/289 (76%), Gaps = 2/289 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FY KSCP    T+ + VRSA+ KE RMGASLLRL FHDCFVNGCDGS+LLDDT
Sbjct  22    SAQLSANFYDKSCPNALSTIRTAVRSAVAKENRMGASLLRLHFHDCFVNGCDGSVLLDDT  81

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
              +FTGEK AAPN  S RGF+VID IK+ VE +CP VVSCADILA+A+RDS   LGGP+W 
Sbjct  82    PTFTGEKTAAPNNNSLRGFDVIDNIKAQVEGICPQVVSCADILAVAARDSVFALGGPTWV  141

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             V+LGRRD+ TAS   ANN IP PT +L  L  SFS  GLS  DM+ LSG+HTIGQARC N
Sbjct  142   VQLGRRDSTTASLDTANNDIPAPTLDLGDLTKSFSNKGLSATDMIALSGAHTIGQARCVN  201

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR RIY+E+NID+S A S K NCP    +GDNN++PLD  TP  FDN YY NL+NKKG+L
Sbjct  202   FRNRIYSETNIDTSLATSLKSNCPNT--TGDNNISPLDASTPYTFDNFYYKNLLNKKGVL  259

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQLFNG S DS    YS+N   F +DF+AA++KMG+I PLTG++G+
Sbjct  260   HSDQQLFNGGSADSQTTTYSSNMATFFTDFSAAIVKMGNIDPLTGSSGQ  308



>emb|CDY32701.1| BnaA02g07630D [Brassica napus]
Length=326

 Score =   390 bits (1003),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 193/289 (67%), Positives = 223/289 (77%), Gaps = 1/289 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  FY++SCP LF  V  V++ A+ KE RM ASLLRLFFHDCFVNGCDGSILLDDTS
Sbjct  29    AQLSSDFYAESCPSLFPAVRRVMQRAVAKERRMAASLLRLFFHDCFVNGCDGSILLDDTS  88

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SF GEK A PN  S RGFEVID+IKS VEK+CPGVVSCADI+AI++RDS + LGGP W+V
Sbjct  89    SFRGEKTAGPNNNSVRGFEVIDKIKSRVEKLCPGVVSCADIVAISARDSVLLLGGPRWSV  148

Query  539   KLGRRDARTASQAAANNS-IPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             KLGRRD++ A  +AAN+  IP P S L  LI+ F A GLS  DMV LSG+HTIGQA C  
Sbjct  149   KLGRRDSKKAGFSAANSGVIPSPFSTLKNLINRFKAQGLSVRDMVALSGAHTIGQANCLT  208

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR RIYNESNID SFA SR+ NCP  SGSGDN  APLD+ +P +FD++YY  L++KKGLL
Sbjct  209   FRNRIYNESNIDLSFALSRRKNCPATSGSGDNKKAPLDIGSPTRFDHSYYNQLLDKKGLL  268

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
              SDQ LFNG STDS V  YS +   F  DF  AMIKMGDIKPLTG++G+
Sbjct  269   TSDQVLFNGGSTDSLVGTYSRSLNTFYRDFVRAMIKMGDIKPLTGSHGQ  317



>ref|XP_010093550.1| Cationic peroxidase 1 [Morus notabilis]
 gb|EXB54257.1| Cationic peroxidase 1 [Morus notabilis]
Length=322

 Score =   390 bits (1002),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 189/289 (65%), Positives = 228/289 (79%), Gaps = 4/289 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FYS SCP     V S V++A+  EARMGASLLRL FHDCF  GCD SILLDDT
Sbjct  29    SAQLSSNFYSSSCPNALSIVKSAVKTAVSNEARMGASLLRLHFHDCF--GCDASILLDDT  86

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             S+FTGEK A PN  S RGF+V+D IK+ +E  C GVVSCADILA+A+RDS V LGGPSW 
Sbjct  87    STFTGEKNAGPNANSVRGFDVVDTIKTQLESACAGVVSCADILAVAARDSVVLLGGPSWT  146

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             V+LGRRDA TASQ+AA ++IP PT+NL+ LI++FS  G +T ++V LSG HTIGQA+C++
Sbjct  147   VQLGRRDATTASQSAAGSNIPAPTTNLSGLITAFSNKGFTTKELVALSGGHTIGQAKCSS  206

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FRAR+YNE+NI++SFA S K  CP  SGS DNNL+PLD+ +P  FDN Y+ N+V+ KGLL
Sbjct  207   FRARLYNENNIEASFATSTKSKCPN-SGS-DNNLSPLDVTSPTTFDNAYFKNVVSLKGLL  264

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQLFN  STDS VR YSTNPT F +DFA AMIKMG++ PLTG +G+
Sbjct  265   HSDQQLFNNGSTDSQVRAYSTNPTSFRTDFANAMIKMGNLSPLTGTSGQ  313



>ref|XP_006349568.1| PREDICTED: cationic peroxidase 1-like [Solanum tuberosum]
Length=316

 Score =   390 bits (1002),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 189/290 (65%), Positives = 226/290 (78%), Gaps = 3/290 (1%)
 Frame = +2

Query  176   SAQ-LSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDD  352
             SAQ LS  FYS SCP +   + + V SA+  EARMGASLLRL FHDCFVNGCD S+LLDD
Sbjct  20    SAQSLSANFYSSSCPNVLSVIKTAVNSAVSSEARMGASLLRLHFHDCFVNGCDASVLLDD  79

Query  353   TSSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSW  532
             TS+FTGEK A PN  S RGF+VID IK+ VE  C G+VSCADILA+A+RDS V LGGPSW
Sbjct  80    TSNFTGEKTAGPNSGSIRGFDVIDTIKTQVESSCAGIVSCADILAVAARDSVVKLGGPSW  139

Query  533   NVKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  712
              V LGRRD+ TAS +AAN+++P PTS+L+ LISSFS  GL+  +MV LSGSHTIGQARCT
Sbjct  140   TVLLGRRDSTTASLSAANSNLPGPTSSLSALISSFSNKGLTAREMVALSGSHTIGQARCT  199

Query  713   NFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
              FR R+YNE+NI++SFA + K NCP++   GDNNL+PLD+ +P  FDN YY NL  +KGL
Sbjct  200   TFRTRLYNEANINASFATTVKANCPQS--GGDNNLSPLDITSPTSFDNAYYKNLQIQKGL  257

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             LHSDQ LFNG STDS V  YS+N   FS+DFA AM+KMG++ PLTG NG+
Sbjct  258   LHSDQVLFNGGSTDSIVNTYSSNSATFSTDFANAMVKMGNLSPLTGTNGQ  307



>gb|KFK27367.1| hypothetical protein AALP_AA8G373800 [Arabis alpina]
Length=325

 Score =   390 bits (1002),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 192/289 (66%), Positives = 223/289 (77%), Gaps = 1/289 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQL   FY +SCP LF  V  VV+ A+ +E RM ASLLRLFFHDCFVNGCDGSILLDDTS
Sbjct  28    AQLDSDFYRESCPSLFPAVRRVVQRAVARERRMAASLLRLFFHDCFVNGCDGSILLDDTS  87

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SF GEK A PN  S RGFEVID+IKS VE++CPGVVSCADILAI +RDS   LGGP W+V
Sbjct  88    SFVGEKTAGPNNNSVRGFEVIDRIKSRVERLCPGVVSCADILAITARDSVRLLGGPGWSV  147

Query  539   KLGRRDARTASQAAANNS-IPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             KLGRRD+ TAS +AAN+  IPPPTS LN LI+ F A GLS  D+V LSG+HTIGQA+C  
Sbjct  148   KLGRRDSTTASLSAANSGVIPPPTSTLNNLINRFRAQGLSQRDLVALSGAHTIGQAKCAT  207

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR RIYNESNID +FA S++ +CP +SGSGDNN A LDL++P +FD NYY  L+N +GLL
Sbjct  208   FRNRIYNESNIDLTFALSKQSSCPASSGSGDNNQATLDLRSPGRFDLNYYRQLLNHRGLL  267

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
              SDQ L+N  STDS V  YS +   F SDF  AM+KMGDI PLTG+NG+
Sbjct  268   TSDQVLYNNGSTDSLVVAYSRSLNAFYSDFVRAMVKMGDISPLTGSNGQ  316



>emb|CDY02820.1| BnaC02g10690D [Brassica napus]
Length=326

 Score =   390 bits (1002),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 192/289 (66%), Positives = 223/289 (77%), Gaps = 1/289 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  FY++SCP LF  V  V++ A+ KE RM ASLLRLFFHDCF+NGCDGSILLDDTS
Sbjct  29    AQLSSDFYAESCPSLFPAVRGVMQRAVAKERRMAASLLRLFFHDCFINGCDGSILLDDTS  88

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SF GEK A PN  S RGFEVID+IKS VEK+CPGVVSCADI+AI++RDS + LGGP W+V
Sbjct  89    SFRGEKTAGPNNNSVRGFEVIDKIKSRVEKLCPGVVSCADIVAISARDSVLLLGGPRWSV  148

Query  539   KLGRRDARTASQAAANNS-IPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             KLGRRD++ A  +AAN+  IP P S L  LI+ F A GLS  DMV LSG+HTIGQA C  
Sbjct  149   KLGRRDSKKAGFSAANSGVIPSPFSTLKNLINRFKAQGLSVRDMVALSGAHTIGQANCLT  208

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR RIYNESNID SFA SR+ NCP  SGSGDN  APLD+ +P +FD++YY  L++KKGLL
Sbjct  209   FRNRIYNESNIDLSFALSRRKNCPATSGSGDNKKAPLDIGSPTRFDHSYYNQLLDKKGLL  268

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
              SDQ LFNG STDS V  YS +   F  DF  AMIKMGDIKPLTG++G+
Sbjct  269   TSDQVLFNGGSTDSLVGKYSRSLNTFYRDFVRAMIKMGDIKPLTGSHGQ  317



>gb|ACJ11762.1| class III peroxidase [Gossypium hirsutum]
Length=323

 Score =   390 bits (1002),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 188/289 (65%), Positives = 225/289 (78%), Gaps = 2/289 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             +AQLS  FYS +CP+   T+ S V SA+  EARMGASL RL FHDCFVNGCDGSILLDDT
Sbjct  28    TAQLSSTFYSTTCPRALSTIKSAVNSAVSNEARMGASLPRLHFHDCFVNGCDGSILLDDT  87

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             ++ TGEK A PN  SARGFEVID IKS VE +CPGVVSCADI+A+A+RDS V LGGPSW 
Sbjct  88    ANMTGEKTAVPNSNSARGFEVIDTIKSQVESLCPGVVSCADIVAVAARDSVVALGGPSWI  147

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             V LGRRD+ TAS +AAN++IP PT NL+ LI++FS  G +  +MV LSGSHTIGQARCT 
Sbjct  148   VLLGRRDSTTASLSAANSNIPAPTLNLSGLITAFSNKGFTAKEMVALSGSHTIGQARCTT  207

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR RIYNE+NIDS+FA S + NCP  S  GDN+L+PLD  +   FDN Y+ NL  +KGLL
Sbjct  208   FRTRIYNETNIDSTFATSLRANCP--SNGGDNSLSPLDTTSSTSFDNAYFKNLQGQKGLL  265

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQLF+G STDS V  YS+N   F++DFA AM+KMG++ PLTG +G+
Sbjct  266   HSDQQLFSGGSTDSQVNAYSSNLGSFTTDFANAMVKMGNLSPLTGTSGQ  314



>ref|XP_009126754.1| PREDICTED: peroxidase 67 [Brassica rapa]
Length=326

 Score =   390 bits (1002),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 192/289 (66%), Positives = 223/289 (77%), Gaps = 1/289 (0%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLS  FY++SCP LF  V  V++ A+ KE RM ASLLRLFFHDCF+NGCDGSILLDDTS
Sbjct  29    AQLSSDFYAESCPSLFPAVRRVMQRAVAKERRMAASLLRLFFHDCFINGCDGSILLDDTS  88

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SF GEK A PN  S RGFEVID+IKS VEK+CPGVVSCADI+AI++RDS + LGGP W+V
Sbjct  89    SFRGEKTAGPNNNSVRGFEVIDKIKSRVEKLCPGVVSCADIVAISARDSVLLLGGPRWSV  148

Query  539   KLGRRDARTASQAAANNS-IPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             KLGRRD++ A  +AAN+  IP P S L  LI+ F A GLS  DMV LSG+HTIGQA C  
Sbjct  149   KLGRRDSKKAGFSAANSGVIPSPFSTLKNLINRFKAQGLSVRDMVALSGAHTIGQANCLT  208

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR RIYNESNID SFA SR+ NCP  SGSGDN  APLD+ +P +FD++YY  L++KKGLL
Sbjct  209   FRNRIYNESNIDLSFALSRRKNCPATSGSGDNKKAPLDIGSPTRFDHSYYNQLLDKKGLL  268

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
              SDQ LFNG STDS V  YS +   F  DF  AMIKMGDIKPLTG++G+
Sbjct  269   TSDQVLFNGGSTDSLVGTYSRSLNTFYRDFVRAMIKMGDIKPLTGSHGQ  317



>dbj|BAK06463.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=319

 Score =   389 bits (1000),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/289 (63%), Positives = 218/289 (75%), Gaps = 0/289 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS GFYS+SCP + + V S +  AI +E R+GAS++RLFFHDCFV GCD S+LLDD 
Sbjct  22    SAQLSSGFYSRSCPGMLKAVRSALHPAITRERRVGASIVRLFFHDCFVQGCDASLLLDDA  81

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
                 GEK AAPN  S RGFEVID IK+AVEK CPGVVSCAD+LA+A+ +S V LGGPSW 
Sbjct  82    PGLRGEKNAAPNKNSVRGFEVIDAIKAAVEKECPGVVSCADVLAVAAEESVVFLGGPSWE  141

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             VK+GRRD+ TAS   A N+IPPPTS L  L S F+A GL   DMV LSG+HTIG ARCTN
Sbjct  142   VKMGRRDSTTASFTGAENNIPPPTSGLANLTSLFAAQGLCQKDMVALSGAHTIGLARCTN  201

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR  IYN++NID  FA+SR+  CPR +G GDNNLAPLDLQTP  F+NNYY NLV K+ LL
Sbjct  202   FRDHIYNDTNIDDGFARSRQSGCPRTAGFGDNNLAPLDLQTPTVFENNYYKNLVQKRALL  261

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQ+L NG + D+ VR Y  + + F  DF   M+KMGDI PLTG++G+
Sbjct  262   HSDQELLNGGAADALVRQYVGSQSSFFKDFVVGMVKMGDIGPLTGSSGQ  310



>ref|XP_010925617.1| PREDICTED: peroxidase P7-like [Elaeis guineensis]
Length=317

 Score =   389 bits (1000),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 186/287 (65%), Positives = 225/287 (78%), Gaps = 2/287 (1%)
 Frame = +2

Query  182   QLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTSS  361
             QLSP FY ++C  L   V SV+  A+QKE RM AS+LRLFFHDCFVNGCDGSILLDDT +
Sbjct  24    QLSPTFYGRNCSNLQSIVRSVMAQAVQKEPRMAASILRLFFHDCFVNGCDGSILLDDTPT  83

Query  362   FTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVK  541
             FTGEK A PN  SARGFEVID IK+ VE  C   VSCADILA+A+R     +GGP+WNV 
Sbjct  84    FTGEKNAGPNINSARGFEVIDAIKTQVEAACKATVSCADILALAARAGVSLVGGPNWNVL  143

Query  542   LGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFR  721
             LGRRDARTASQ+AAN+++P P S+L+ LIS F+  GL+T D+  LSG+HTIG+ARC  FR
Sbjct  144   LGRRDARTASQSAANSNLPGPGSSLSTLISMFAVQGLNTRDLTALSGAHTIGRARCLFFR  203

Query  722   ARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHS  901
              RI+NE+N+++SFA  RK  CP  + SGDNNLAP D++TP +FDN YY +LVN++GLLHS
Sbjct  204   NRIFNEANVNASFAALRKQTCP--ASSGDNNLAPFDIRTPDRFDNAYYQDLVNQQGLLHS  261

Query  902   DQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             DQ+LFNG S D+ VR YS NP  F+SDFAAAM+KMG+I PLTGN GE
Sbjct  262   DQELFNGGSQDALVRQYSNNPALFASDFAAAMVKMGNISPLTGNRGE  308



>ref|XP_010256954.1| PREDICTED: cationic peroxidase 1-like [Nelumbo nucifera]
Length=323

 Score =   389 bits (999),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 194/289 (67%), Positives = 226/289 (78%), Gaps = 2/289 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  +YS SCP+   T+ S V SA+ KE RMGASLLRL FHDCFVNGCDGSILLDDT
Sbjct  28    SAQLSSTYYSTSCPEALSTIKSAVTSAVAKERRMGASLLRLHFHDCFVNGCDGSILLDDT  87

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             +SFTGEK A PN  S RGF+VID IKS VE VC GVVSCADILA+A+RDS V LGGP+W 
Sbjct  88    TSFTGEKTATPNANSLRGFDVIDTIKSQVESVCAGVVSCADILAVAARDSVVALGGPTWT  147

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             V+LGRRDA TAS +AAN+ IP PT +L+ LIS+FS  G +  +MV LSG+HTIGQARCT+
Sbjct  148   VQLGRRDATTASLSAANSDIPAPTLDLSGLISAFSNKGFTAKEMVALSGAHTIGQARCTS  207

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR RIYNE+NI+SSFA S K  CP  S  GDNNL+PLD  +   FDN Y+ NLVN KGLL
Sbjct  208   FRDRIYNETNINSSFATSLKSKCP--SAGGDNNLSPLDATSATTFDNAYFTNLVNNKGLL  265

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQL+N  STDS V  YS+N   F SDFA+AM+KMG++ PLTG++GE
Sbjct  266   HSDQQLYNSGSTDSQVSSYSSNSATFFSDFASAMVKMGNLSPLTGSSGE  314



>ref|XP_006664869.1| PREDICTED: cationic peroxidase 1-like [Oryza brachyantha]
Length=317

 Score =   388 bits (997),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 189/289 (65%), Positives = 220/289 (76%), Gaps = 2/289 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FY KSCP    T+ + VRSAI KE RMGASLLRL FHDCFV GCDGS+LLDDT
Sbjct  22    SAQLSANFYDKSCPNALSTIRTAVRSAITKENRMGASLLRLHFHDCFVKGCDGSVLLDDT  81

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
              +FTGEK AAPN  S RGF+VID IK+ +E +CP VVSCADILA+A+RDS V LGGP+W 
Sbjct  82    PTFTGEKTAAPNNNSLRGFDVIDNIKAQIEGICPQVVSCADILAVAARDSVVALGGPTWV  141

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             V+LGRRD+ TAS  AANN IP PT +L  L  SFS  GLS  DM+ LSG+HTIGQARC N
Sbjct  142   VQLGRRDSTTASLDAANNDIPAPTLDLGDLNKSFSNKGLSATDMIALSGAHTIGQARCVN  201

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR RIY+E+NIDSS A S K NCP    +GDNN++PLD  TP  FDN YY NL+ KKG+L
Sbjct  202   FRNRIYSETNIDSSLATSLKSNCPNT--TGDNNISPLDASTPYVFDNFYYKNLLKKKGVL  259

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQLFNG S DS    YS+N   F +DF+AAM+KM +I PLTG++G+
Sbjct  260   HSDQQLFNGGSADSQTTTYSSNMATFFTDFSAAMVKMSNITPLTGSSGQ  308



>ref|XP_003552297.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=316

 Score =   388 bits (997),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 188/289 (65%), Positives = 226/289 (78%), Gaps = 2/289 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FY K+CP    T+ S V SA+  E RMGASLLRL FHDCFV GCD S+LLDDT
Sbjct  21    SAQLSSTFYGKTCPNALSTIKSEVVSAVNNERRMGASLLRLHFHDCFVQGCDASVLLDDT  80

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             SSF GEK A PN  S RGF VID IKS VE +CPGVVSCADILA+A+RDS V LGGP+W 
Sbjct  81    SSFKGEKTAGPNAGSIRGFNVIDTIKSKVESLCPGVVSCADILAVAARDSVVALGGPTWT  140

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             V+LGRRD+ TAS ++AN+ +P PTS+L+ LISSFS  G S+ ++V LSGSHTIGQA+C++
Sbjct  141   VQLGRRDSTTASLSSANSDLPAPTSSLSALISSFSNKGFSSKELVALSGSHTIGQAQCSS  200

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR RIYN++NIDSSFA+S +GNCP  S  G + LAPLD  +P  FDN Y+ NL +KKGLL
Sbjct  201   FRTRIYNDTNIDSSFAKSLQGNCP--STGGGSTLAPLDTTSPNTFDNAYFKNLQSKKGLL  258

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQ+LFNG STDS V  YS+NP  F +DFA AMIKMG++ PLTG++G+
Sbjct  259   HSDQELFNGGSTDSQVNSYSSNPASFKTDFANAMIKMGNLSPLTGSSGQ  307



>ref|XP_004303193.1| PREDICTED: peroxidase 52-like [Fragaria vesca subsp. vesca]
Length=319

 Score =   388 bits (997),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 189/288 (66%), Positives = 222/288 (77%), Gaps = 3/288 (1%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLSP FYSK+CP L  TV + +  A+ KE+RMGAS+LRLFFHDCFVNGCD SILLDDT+
Sbjct  26    AQLSPTFYSKTCPTLLSTVRTAMSQAVAKESRMGASILRLFFHDCFVNGCDASILLDDTA  85

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             SFTGEK A PN  SARGFEVID IK+ VE  C   VSCADILA+A+RD  V LGG SW V
Sbjct  86    SFTGEKNAFPNQNSARGFEVIDTIKTRVEAACNATVSCADILALAARDGVVLLGGSSWTV  145

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
              LGRRDARTASQ+AAN+++P P ++L  LISSF+A GL+  DM VLSG+HTIGQ++C++F
Sbjct  146   PLGRRDARTASQSAANSNLPSPFADLAALISSFTAKGLTAKDMTVLSGAHTIGQSQCSSF  205

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R RIYNE+NID SFA +RK  CP  + SG+ NLAP D  TP KFDN+YY  LV ++GLLH
Sbjct  206   RTRIYNETNIDPSFATTRKSTCP--ASSGNTNLAPFD-TTPNKFDNDYYKALVGRQGLLH  262

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQQLFN  S D+ VR YSTN   F+ DFAAAM+KM  I PL G  GE
Sbjct  263   SDQQLFNNGSQDALVRTYSTNVAAFNRDFAAAMVKMSRISPLLGAKGE  310



>gb|ACI03401.1| peroxidase 1 [Litchi chinensis]
Length=318

 Score =   388 bits (996),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 189/288 (66%), Positives = 220/288 (76%), Gaps = 2/288 (1%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
              QL P FY  +CP+    V+  V +AI+ E R+GASLLRL FHDCFVNGCDGS+LLDDTS
Sbjct  23    GQLCPNFYESTCPQALSIVHKGVVAAIKNETRIGASLLRLHFHDCFVNGCDGSLLLDDTS  82

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             +F GEK A PN  S RGF V+DQIK+ +EK CPGVVSCAD+LAIA+RDS V LGGPSW V
Sbjct  83    TFVGEKTAVPNNISVRGFNVVDQIKAKLEKACPGVVSCADLLAIAARDSVVHLGGPSWKV  142

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
             +LGRRD+ TAS+A AN SIPPPTSNL+ LISSFSA GLS  D+V LSGSHTIG ARCT+F
Sbjct  143   RLGRRDSTTASRALANTSIPPPTSNLSALISSFSAQGLSLKDLVALSGSHTIGLARCTSF  202

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R  +YN++NIDSSFAQS +  CPR+    DN LA LD QTP  FD  YY NL+ KKGLLH
Sbjct  203   RGHVYNDTNIDSSFAQSLRRKCPRS--GNDNVLANLDRQTPFCFDKLYYDNLLKKKGLLH  260

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQQLF G S D  V+ Y+ N + F  DFA AM+KMG+IKPLTG  G+
Sbjct  261   SDQQLFKGGSADPFVKKYANNTSAFFKDFAGAMVKMGNIKPLTGRAGQ  308



>tpe|CAH69378.1| TPA: class III peroxidase 136 precursor [Oryza sativa Japonica 
Group]
Length=317

 Score =   388 bits (996),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 187/289 (65%), Positives = 221/289 (76%), Gaps = 2/289 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FY KSCP    T+   VRSAI +E RMGASLLRL FHDCFVNGCDGS+LLDDT
Sbjct  22    SAQLSANFYDKSCPNALPTIRIAVRSAIARENRMGASLLRLHFHDCFVNGCDGSVLLDDT  81

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
              +FTGEK AAPN  S RGF+VID IK+ +E +CP VVSCADILA+A+R+S V LGGP+W 
Sbjct  82    PTFTGEKTAAPNNNSLRGFDVIDNIKAHIEGICPQVVSCADILAVAARESVVALGGPTWV  141

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             V+LGRRD+ TAS   ANN IP PT +L  L  SFS  GLS  DM+ LSG+HTIGQARC N
Sbjct  142   VQLGRRDSTTASLDTANNDIPAPTFDLGDLTKSFSNKGLSATDMIALSGAHTIGQARCVN  201

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR RIY+E+NID+S A S K NCP    +GDNN++PLD  TP  FDN YY NL+NKKG+L
Sbjct  202   FRNRIYSETNIDTSLATSLKSNCPNT--TGDNNISPLDASTPYAFDNFYYKNLLNKKGVL  259

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQLFNG S DS    YS+N   F +DF+AAM+KMG+I P+TG++G+
Sbjct  260   HSDQQLFNGGSADSQTTTYSSNMATFFTDFSAAMVKMGNINPITGSSGQ  308



>gb|ACU23223.1| unknown [Glycine max]
Length=328

 Score =   388 bits (997),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 196/290 (68%), Positives = 228/290 (79%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SA LS  FYSK+CP +F TV SVV+SA+ +E R+GAS++RLFFHDCFV GCDGSILLDDT
Sbjct  30    SANLSKNFYSKTCPNVFNTVKSVVKSAVVREPRIGASIVRLFFHDCFVQGCDGSILLDDT  89

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
              +F GEK AA N  S RGFEVID IKS VEK+CPGVVSCADIL IASRDS V LGGP W 
Sbjct  90    PTFQGEKTAAANNNSVRGFEVIDAIKSEVEKICPGVVSCADILDIASRDSVVLLGGPFWK  149

Query  536   VKLGRRDARTASQAAANNS-IPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  712
             V+LGRRD+RTA+  AAN   IPPPTSNL  LI+ F   GLS  DMV LSG+HT G+ARCT
Sbjct  150   VRLGRRDSRTANFTAANTGVIPPPTSNLTNLITRFRDQGLSARDMVALSGAHTFGKARCT  209

Query  713   NFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             +FR RIYN++NID +FA +R+  CPR +G+GDNNLA LD +TP  FDNNY+ NL+ K+GL
Sbjct  210   SFRDRIYNQTNIDRTFALARQRRCPRTNGTGDNNLANLDFRTPNHFDNNYFKNLLIKRGL  269

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             L+SDQ LFNG STDS VR YS N   F +DF  AMI+MGDIKPLTG+ GE
Sbjct  270   LNSDQVLFNGGSTDSLVRTYSQNNKAFDTDFVKAMIRMGDIKPLTGSQGE  319



>gb|KHN48395.1| Peroxidase 4 [Glycine soja]
Length=328

 Score =   388 bits (997),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 196/290 (68%), Positives = 228/290 (79%), Gaps = 1/290 (0%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SA LS  FYSK+CP +F TV SVV+SA+ +E R+GAS++RLFFHDCFV GCDGSILLDDT
Sbjct  30    SANLSKNFYSKTCPNVFNTVKSVVKSAVVREPRIGASIVRLFFHDCFVQGCDGSILLDDT  89

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
              +F GEK AA N  S RGFEVID IKS VEK+CPGVVSCADIL IASRDS V LGGP W 
Sbjct  90    PTFQGEKTAAANNNSVRGFEVIDAIKSEVEKICPGVVSCADILDIASRDSVVLLGGPFWK  149

Query  536   VKLGRRDARTASQAAANNS-IPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  712
             V+LGRRD+RTA+  AAN   IPPPTSNL  LI+ F   GLS  DMV LSG+HT G+ARCT
Sbjct  150   VRLGRRDSRTANFTAANTGVIPPPTSNLTNLITRFRDQGLSARDMVALSGAHTFGKARCT  209

Query  713   NFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGL  892
             +FR RIYN++NID +FA +R+  CPR +G+GDNNLA LD +TP  FDNNY+ NL+ K+GL
Sbjct  210   SFRDRIYNQTNIDRTFALARQRRCPRTNGTGDNNLANLDFRTPNHFDNNYFKNLLIKRGL  269

Query  893   LHSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             L+SDQ LFNG STDS VR YS N   F +DF  AMI+MGDIKPLTG+ GE
Sbjct  270   LNSDQVLFNGGSTDSLVRTYSQNNKAFDTDFVKAMIRMGDIKPLTGSQGE  319



>ref|XP_008364165.1| PREDICTED: peroxidase 4-like [Malus domestica]
Length=318

 Score =   387 bits (995),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 188/288 (65%), Positives = 222/288 (77%), Gaps = 3/288 (1%)
 Frame = +2

Query  182   QLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTSS  361
             +L+  FY   CPK    V   V +AI+ E R+GASLLRL FHDCFVNGCD S+LLDDTSS
Sbjct  24    ELTQNFYKSKCPKALSIVQEGVIAAIKNETRIGASLLRLHFHDCFVNGCDASVLLDDTSS  83

Query  362   FTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVK  541
             F GEK AAPN  S RGFEV+DQIK+ +EK CPGVVSCAD+LA+A+RDSTV LGGPSW V 
Sbjct  84    FVGEKTAAPNNNSIRGFEVVDQIKAKLEKACPGVVSCADLLALAARDSTVYLGGPSWKVG  143

Query  542   LGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFR  721
             LGRRD+ TAS++AAN   P PTSN++ LISSFSA GLS  D+V LSGSHTIG ARCT FR
Sbjct  144   LGRRDSTTASRSAANTXJPXPTSNISALISSFSAQGLSJRDLVALSGSHTIGLARCTXFR  203

Query  722   ARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHS  901
             +RIYN+S ID++FAQS +G CPR+    D+NLA LDLQTP  FDN YY NL+ +KGLLHS
Sbjct  204   SRIYNDSAIDATFAQSLQGICPRS--GNDDNLASLDLQTPTHFDNEYYKNLLKEKGLLHS  261

Query  902   DQQLFNG-VSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             DQ+LFNG  STD+ V+ Y+ N   F   FA AM+KMG+I PLTG+ GE
Sbjct  262   DQELFNGTTSTDNLVQIYTNNTLTFFKHFAVAMVKMGNIXPLTGSQGE  309



>ref|XP_007033589.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY04515.1| Peroxidase superfamily protein [Theobroma cacao]
Length=322

 Score =   388 bits (996),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 188/289 (65%), Positives = 224/289 (78%), Gaps = 2/289 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FY+ +CP+   T+ S V SA+ KEARMGASLLRL FHDCFVNGCD SILLDDT
Sbjct  27    SAQLSSNFYATTCPRALATIKSAVDSAVSKEARMGASLLRLHFHDCFVNGCDASILLDDT  86

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             ++ TGEK A PN  S RG+EVID IKS +E +CP VVSCADI+A+A+RDS V LGGPSW+
Sbjct  87    ANITGEKTAGPNNNSVRGYEVIDTIKSQLESLCPAVVSCADIVAVAARDSVVALGGPSWS  146

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             V LGRRD+ TAS  AAN++IP PT +L+ LIS+FS  G +  +MV LSGSHTIGQARCT 
Sbjct  147   VLLGRRDSTTASLNAANSNIPAPTLSLSGLISAFSNKGFTAKEMVALSGSHTIGQARCTT  206

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR+RIYNE+ ID SFA S + NCP  S  GDNNL+PLD  +P  FDN YY NL ++KGLL
Sbjct  207   FRSRIYNETTIDPSFATSLRANCP--STGGDNNLSPLDTTSPTSFDNAYYKNLQSQKGLL  264

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQQLF+G STDS V  YS+N   F +DFA AMIKMG++ PLTG +G+
Sbjct  265   HSDQQLFSGGSTDSQVNAYSSNLGSFRTDFANAMIKMGNLSPLTGTSGQ  313



>gb|KDO63401.1| hypothetical protein CISIN_1g020966mg [Citrus sinensis]
Length=319

 Score =   387 bits (995),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 187/288 (65%), Positives = 223/288 (77%), Gaps = 3/288 (1%)
 Frame = +2

Query  179   AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  358
             AQLSP FY+ SCP   +     +  A+ ++ R  AS+LRLFFHDCFVNGCDGS+LLDDT+
Sbjct  26    AQLSPTFYATSCPNFQRIARDEMTKAVNRQPRNAASILRLFFHDCFVNGCDGSVLLDDTA  85

Query  359   SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  538
             +FTGEK A PN  SARGFEVID IK+ +E  C   VSCADILA+A+RD    LGGP+W V
Sbjct  86    TFTGEKNAGPNRNSARGFEVIDAIKTRLEAACNATVSCADILAVAARDGVALLGGPTWTV  145

Query  539   KLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  718
              LGRRDARTASQ+AAN+ IP P+S+L  LIS F+A GL+  DM VLSG H IG ARC  F
Sbjct  146   PLGRRDARTASQSAANSQIPGPSSSLATLISMFAAKGLTAQDMTVLSGGHAIGFARCAAF  205

Query  719   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  898
             R RIYN++NID +FA +R+  CP A+G GD NLAPLD QTP +FDN+YY NLVN++GLLH
Sbjct  206   RNRIYNDTNIDPAFATTRRTTCP-ATG-GDPNLAPLD-QTPNRFDNSYYQNLVNRRGLLH  262

Query  899   SDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             SDQ+LFNG S D+TVRGYSTNP  F+ DFAAAM+KMG+I PLTG NGE
Sbjct  263   SDQELFNGGSQDATVRGYSTNPASFARDFAAAMVKMGNISPLTGTNGE  310



>ref|XP_008234083.1| PREDICTED: peroxidase P7-like [Prunus mume]
Length=306

 Score =   387 bits (993),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 178/287 (62%), Positives = 215/287 (75%), Gaps = 0/287 (0%)
 Frame = +2

Query  182   QLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTSS  361
             ++SP F++ SCPKLF TV  +V SAI+KEARMGASLLRLF+HDCFVNGCD S+LLDD  +
Sbjct  8     EMSPSFHATSCPKLFPTVKPIVESAIKKEARMGASLLRLFYHDCFVNGCDASLLLDDAPN  67

Query  362   FTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVK  541
             F GEK   PN  S RG+EVID+IKSAVEK+CPG+VSCADI+AI +RDS   LGGPSW+V+
Sbjct  68    FIGEKNIPPNKNSTRGYEVIDEIKSAVEKMCPGIVSCADIIAIVARDSVSILGGPSWHVQ  127

Query  542   LGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFR  721
             LGRRDAR  +    N SIP P +NL  L+  F  + L   D+V L G+HT+G+A+C +FR
Sbjct  128   LGRRDARATNAIVTNVSIPLPKANLKELVLRFRGIALKRRDLVALVGAHTLGEAQCHSFR  187

Query  722   ARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHS  901
              RIYNESN++   AQ R+  CPR+ GSGD NLAP+D QTPI FDN+YY NLV  KGLLHS
Sbjct  188   ERIYNESNMNKELAQKRRLKCPRSKGSGDANLAPIDAQTPIVFDNSYYKNLVQNKGLLHS  247

Query  902   DQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             DQQLF+G  TD  VR YS +   F  DFA+AMIKMG + PL G  GE
Sbjct  248   DQQLFSGGKTDPIVRTYSEDQEAFFDDFASAMIKMGSVNPLIGPAGE  294



>ref|XP_008343635.1| PREDICTED: peroxidase 4-like [Malus domestica]
Length=318

 Score =   387 bits (994),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 188/288 (65%), Positives = 222/288 (77%), Gaps = 3/288 (1%)
 Frame = +2

Query  182   QLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTSS  361
             +L+  FY   CPK    V   V +AI+ E R+GASLLRL FHDCFVNGCD S+LLDDTSS
Sbjct  24    ELTQNFYKSKCPKALSIVQEGVIAAIKNETRIGASLLRLHFHDCFVNGCDASVLLDDTSS  83

Query  362   FTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVK  541
             F GEK AAPN  S RGFEV+DQIK+ +EK CPGVVSCAD+LA+A+RDSTV LGGPSW V 
Sbjct  84    FVGEKTAAPNNNSIRGFEVVDQIKAKLEKACPGVVSCADLLALAARDSTVYLGGPSWKVG  143

Query  542   LGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFR  721
             LGRRD+ TAS++AAN  +P PTSN++ LISSFSA GLS  D+V LSGSHTIG ARCT FR
Sbjct  144   LGRRDSTTASRSAANTXLPXPTSNISALISSFSAQGLSLRDLVALSGSHTIGLARCTTFR  203

Query  722   ARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHS  901
             +RIYN+S ID++FAQS +G CPR+    D+NLA LDLQTP  FDN YY NL+ +KGLLHS
Sbjct  204   SRIYNDSAIDATFAQSLQGICPRS--GNDDNLASLDLQTPTHFDNEYYKNLLKEKGLLHS  261

Query  902   DQQLFNG-VSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             DQ+LFNG  STD+ V+ Y  N   F   FA AM+KMG+I PLTG+ GE
Sbjct  262   DQELFNGTTSTDNLVQIYXNNTLTFFKHFAVAMVKMGNIXPLTGSQGE  309



>ref|XP_011033755.1| PREDICTED: peroxidase P7-like [Populus euphratica]
Length=316

 Score =   387 bits (994),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 192/289 (66%), Positives = 224/289 (78%), Gaps = 3/289 (1%)
 Frame = +2

Query  176   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  355
             SAQLS  FY+ +CP L   V + +  A+  + R+ AS+LRLFFHDCFVNGCDGSILLDDT
Sbjct  22    SAQLSATFYASTCPNLQTIVRNAMTGAVNGQPRLAASILRLFFHDCFVNGCDGSILLDDT  81

Query  356   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  535
             ++FTGEK A PN  SARGFEVID IK+ VE  C   VSCADILA+A+RD  V LGGPSW 
Sbjct  82    ATFTGEKNANPNRNSARGFEVIDTIKTRVEAACNATVSCADILALAARDGVVLLGGPSWT  141

Query  536   VKLGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTN  715
             V LGRRDARTASQ+AAN+ IP P S+L  LIS FSA GLS +DM  LSG HTIG ARCT+
Sbjct  142   VPLGRRDARTASQSAANSQIPSPASSLATLISMFSAKGLSASDMTALSGGHTIGFARCTS  201

Query  716   FRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLL  895
             FR RIYN++NID+SFA +R+ +CP ASG GD NLAPLD  T  +FDNNYY NLV ++GLL
Sbjct  202   FRNRIYNDTNIDASFATTRRASCP-ASG-GDANLAPLD-GTQTRFDNNYYTNLVARRGLL  258

Query  896   HSDQQLFNGVSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             HSDQ+LFNG S D+ VR YSTN   F+ DFAAAM+KMG+I PLTG NGE
Sbjct  259   HSDQELFNGGSQDALVRTYSTNGATFARDFAAAMVKMGNISPLTGRNGE  307



>ref|XP_008374511.1| PREDICTED: peroxidase P7-like isoform X1 [Malus domestica]
Length=318

 Score =   387 bits (994),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 188/288 (65%), Positives = 223/288 (77%), Gaps = 3/288 (1%)
 Frame = +2

Query  182   QLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTSS  361
             +L+  FY   CPK    V   V +AI+ E R+GASLLRL FHDCFVNGCD S+LLDDTSS
Sbjct  24    ELTQNFYKSKCPKALSIVQEGVIAAIKNETRIGASLLRLHFHDCFVNGCDASVLLDDTSS  83

Query  362   FTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVK  541
             F GEK AAPN  S RGFEV+DQIK+ +EK CPGVVSCAD+LA+A+RDSTV LGGPSW V 
Sbjct  84    FVGEKTAAPNNNSIRGFEVVDQIKAKLEKACPGVVSCADLLALAARDSTVYLGGPSWKVG  143

Query  542   LGRRDARTASQAAANNSIPPPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFR  721
             LGRRD+ TAS++AAN  +P PTSN++ LISSFSA GLS  D+V LSGSHTIG ARCT FR
Sbjct  144   LGRRDSTTASRSAANTFLPSPTSNISALISSFSAQGLSLRDLVALSGSHTIGLARCTTFR  203

Query  722   ARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHS  901
             +RIYN+S ID++FAQS +G CPR+    D+NLA LDLQTP  FDN YY NL+ +KGLLHS
Sbjct  204   SRIYNDSAIDATFAQSLQGICPRS--GNDDNLASLDLQTPTHFDNEYYKNLLKEKGLLHS  261

Query  902   DQQLFNG-VSTDSTVRGYSTNPTKFSSDFAAAMIKMGDIKPLTGNNGE  1042
             DQ+LFNG  STD+ V+ Y+ N   F   FA AM+KMG+I PLTG+ GE
Sbjct  262   DQELFNGTTSTDNLVQIYTNNTLTFFKHFAVAMVKMGNISPLTGSQGE  309



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3545987704900