BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c28093_g1_i1 len=936 path=[1:0-935]

Length=936
                                                                      Score     E

ref|XP_002304735.2|  hypothetical protein POPTR_0003s18230g             432   8e-140   Populus trichocarpa [western balsam poplar]
ref|XP_006368488.1|  hypothetical protein POPTR_0001s03400g             426   2e-139   
ref|XP_006427668.1|  hypothetical protein CICLE_v10027227mg             427   6e-138   
gb|KDP41950.1|  hypothetical protein JCGZ_26968                         426   9e-138   
ref|XP_011020579.1|  PREDICTED: putative leucine-rich repeat rece...    424   7e-137   
ref|XP_011034574.1|  PREDICTED: putative leucine-rich repeat rece...    421   2e-136   
ref|XP_011034572.1|  PREDICTED: putative leucine-rich repeat rece...    421   7e-136   
ref|XP_011034573.1|  PREDICTED: putative leucine-rich repeat rece...    421   7e-136   
ref|XP_003632918.2|  PREDICTED: putative leucine-rich repeat rece...    420   4e-135   
ref|XP_011020583.1|  PREDICTED: putative leucine-rich repeat rece...    417   3e-134   
ref|XP_008342819.1|  PREDICTED: putative leucine-rich repeat rece...    415   2e-133   
ref|XP_009354218.1|  PREDICTED: putative leucine-rich repeat rece...    414   5e-133   
ref|XP_010063604.1|  PREDICTED: putative leucine-rich repeat rece...    413   1e-132   
ref|XP_006595194.1|  PREDICTED: putative leucine-rich repeat rece...    412   1e-132   
ref|XP_006595193.1|  PREDICTED: putative leucine-rich repeat rece...    412   2e-132   
ref|XP_010094066.1|  Putative leucine-rich repeat receptor-like s...    412   4e-132   
ref|XP_007217299.1|  hypothetical protein PRUPE_ppa018475mg             410   2e-131   
ref|NP_001168251.1|  uncharacterized protein LOC100382014               389   9e-129   Zea mays [maize]
ref|XP_008465122.1|  PREDICTED: putative leucine-rich repeat rece...    403   1e-128   
gb|KDO55361.1|  hypothetical protein CISIN_1g002746mg                   398   4e-128   
ref|XP_010273774.1|  PREDICTED: putative leucine-rich repeat rece...    401   5e-128   
ref|XP_007023495.1|  Serine-threonine protein kinase, plant-type,...    399   2e-127   
gb|KCW70840.1|  hypothetical protein EUGRSUZ_F03981                     398   4e-127   
dbj|BAK07386.1|  predicted protein                                      378   3e-126   
gb|EYU21747.1|  hypothetical protein MIMGU_mgv1a026510mg                394   1e-125   
tpg|DAA40097.1|  TPA: putative leucine-rich repeat receptor-like ...    390   1e-125   
ref|XP_010929464.1|  PREDICTED: putative leucine-rich repeat rece...    396   2e-125   
ref|XP_008652733.1|  PREDICTED: putative leucine-rich repeat rece...    396   3e-125   
ref|XP_007150820.1|  hypothetical protein PHAVU_005G183300g             392   4e-125   
ref|XP_002460231.1|  hypothetical protein SORBIDRAFT_02g025040          395   6e-124   Sorghum bicolor [broomcorn]
emb|CDO98245.1|  unnamed protein product                                386   3e-123   
ref|XP_004956858.1|  PREDICTED: putative leucine-rich repeat rece...    390   5e-123   
ref|NP_001175843.1|  Os09g0423000                                       389   8e-123   
gb|EAZ09141.1|  hypothetical protein OsI_31411                          389   8e-123   Oryza sativa Indica Group [Indian rice]
ref|XP_008668304.1|  PREDICTED: uncharacterized protein LOC100382...    390   9e-123   
dbj|BAD33417.1|  putative protein kinase Xa21, receptor type prec...    389   9e-123   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004956857.1|  PREDICTED: putative leucine-rich repeat rece...    389   1e-122   
ref|XP_009380777.1|  PREDICTED: putative leucine-rich repeat rece...    385   2e-122   
ref|XP_009380776.1|  PREDICTED: putative leucine-rich repeat rece...    386   4e-122   
ref|XP_010929463.1|  PREDICTED: putative leucine-rich repeat rece...    385   1e-121   
ref|XP_003578139.1|  PREDICTED: putative leucine-rich repeat rece...    382   1e-120   
ref|XP_010273698.1|  PREDICTED: putative leucine-rich repeat rece...    378   2e-119   
ref|XP_010929465.1|  PREDICTED: putative leucine-rich repeat rece...    378   1e-118   
ref|XP_008790142.1|  PREDICTED: putative leucine-rich repeat rece...    374   1e-118   
dbj|BAK06436.1|  predicted protein                                      374   7e-118   
ref|XP_008790141.1|  PREDICTED: putative leucine-rich repeat rece...    375   8e-118   
ref|XP_010905032.1|  PREDICTED: putative leucine-rich repeat rece...    371   1e-116   
ref|XP_008794419.1|  PREDICTED: putative leucine-rich repeat rece...    375   1e-116   
ref|XP_010905033.1|  PREDICTED: putative leucine-rich repeat rece...    370   2e-116   
ref|XP_009417790.1|  PREDICTED: putative leucine-rich repeat rece...    369   6e-116   
ref|XP_009399568.1|  PREDICTED: putative leucine-rich repeat rece...    362   4e-113   
ref|XP_009401294.1|  PREDICTED: putative leucine-rich repeat rece...    360   6e-113   
ref|XP_009401293.1|  PREDICTED: putative leucine-rich repeat rece...    360   2e-112   
gb|EMT18352.1|  LRR receptor-like serine/threonine-protein kinase...    355   1e-110   
ref|XP_006493473.1|  PREDICTED: putative leucine-rich repeat rece...    351   3e-108   
ref|XP_006857039.1|  hypothetical protein AMTR_s00065p00026770          345   6e-107   
ref|XP_002512743.1|  serine-threonine protein kinase, plant-type,...    345   6e-107   Ricinus communis
ref|XP_009395486.1|  PREDICTED: putative leucine-rich repeat rece...    344   2e-106   
ref|XP_004305472.1|  PREDICTED: putative leucine-rich repeat rece...    341   1e-105   
ref|XP_008228834.1|  PREDICTED: putative leucine-rich repeat rece...    331   7e-102   
ref|XP_004161420.1|  PREDICTED: LOW QUALITY PROTEIN: putative leu...    329   7e-101   
ref|XP_004137881.1|  PREDICTED: putative leucine-rich repeat rece...    329   7e-101   
ref|XP_010094046.1|  Putative leucine-rich repeat receptor-like s...    308   6e-93    
ref|XP_002274639.2|  PREDICTED: putative leucine-rich repeat rece...    282   1e-83    Vitis vinifera
gb|KDO62284.1|  hypothetical protein CISIN_1g042568mg                   280   1e-82    
ref|XP_006474611.1|  PREDICTED: putative leucine-rich repeat rece...    280   1e-82    
ref|XP_010273702.1|  PREDICTED: putative leucine-rich repeat rece...    279   2e-82    
ref|XP_006453569.1|  hypothetical protein CICLE_v10010652mg             279   3e-82    
ref|XP_002324522.2|  leucine-rich repeat transmembrane protein ki...    277   3e-82    Populus trichocarpa [western balsam poplar]
gb|KDP38712.1|  hypothetical protein JCGZ_04065                         278   5e-82    
ref|XP_010525796.1|  PREDICTED: putative leucine-rich repeat rece...    276   2e-81    
ref|XP_002309364.2|  leucine-rich repeat transmembrane protein ki...    276   2e-81    Populus trichocarpa [western balsam poplar]
ref|XP_007013876.1|  Leucine-rich receptor-like protein kinase fa...    275   1e-80    
ref|XP_011033374.1|  PREDICTED: putative leucine-rich repeat rece...    274   2e-80    
ref|XP_006343728.1|  PREDICTED: putative leucine-rich repeat rece...    273   3e-80    
ref|XP_006857038.1|  hypothetical protein AMTR_s00065p00025040          273   3e-80    
ref|XP_010273699.1|  PREDICTED: putative leucine-rich repeat rece...    271   2e-79    
ref|XP_008394281.1|  PREDICTED: putative leucine-rich repeat rece...    271   2e-79    
ref|XP_011069586.1|  PREDICTED: putative leucine-rich repeat rece...    271   2e-79    
ref|XP_004288728.1|  PREDICTED: putative leucine-rich repeat rece...    270   3e-79    
ref|XP_004242993.1|  PREDICTED: putative leucine-rich repeat rece...    270   4e-79    
ref|XP_010472414.1|  PREDICTED: putative leucine-rich repeat rece...    270   4e-79    
ref|XP_009358564.1|  PREDICTED: putative leucine-rich repeat rece...    270   5e-79    
ref|XP_011069651.1|  PREDICTED: putative leucine-rich repeat rece...    270   5e-79    
ref|XP_009766149.1|  PREDICTED: putative leucine-rich repeat rece...    270   5e-79    
emb|CDP02847.1|  unnamed protein product                                266   8e-79    
ref|XP_002528406.1|  Receptor protein kinase CLAVATA1 precursor, ...    268   1e-78    Ricinus communis
ref|XP_011018067.1|  PREDICTED: putative leucine-rich repeat rece...    268   1e-78    
emb|CDX76833.1|  BnaC08g34190D                                          268   1e-78    
ref|XP_006296083.1|  hypothetical protein CARUB_v10025233mg             268   2e-78    
ref|XP_007204786.1|  hypothetical protein PRUPE_ppa018417mg             268   2e-78    
ref|XP_009117245.1|  PREDICTED: putative leucine-rich repeat rece...    268   3e-78    
emb|CDY34795.1|  BnaA09g41620D                                          268   3e-78    
ref|NP_179990.1|  putative leucine-rich repeat receptor-like seri...    268   3e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008243030.1|  PREDICTED: putative leucine-rich repeat rece...    268   3e-78    
ref|XP_010905034.1|  PREDICTED: putative leucine-rich repeat rece...    267   4e-78    
ref|XP_010417158.1|  PREDICTED: putative leucine-rich repeat rece...    267   5e-78    
ref|XP_009611275.1|  PREDICTED: putative leucine-rich repeat rece...    267   6e-78    
ref|XP_010687636.1|  PREDICTED: putative leucine-rich repeat rece...    266   1e-77    
ref|XP_010429369.1|  PREDICTED: putative leucine-rich repeat rece...    266   1e-77    
ref|XP_002878725.1|  predicted protein                                  265   3e-77    
gb|AES92469.2|  LRR receptor-like kinase family protein                 265   3e-77    
gb|KFK32683.1|  hypothetical protein AALP_AA6G275300                    265   4e-77    
ref|XP_009366293.1|  PREDICTED: putative leucine-rich repeat rece...    265   4e-77    
ref|XP_010265514.1|  PREDICTED: putative leucine-rich repeat rece...    264   7e-77    
ref|XP_010091153.1|  Putative leucine-rich repeat receptor-like s...    263   2e-76    
ref|XP_010041053.1|  PREDICTED: putative leucine-rich repeat rece...    259   3e-75    
gb|EYU37151.1|  hypothetical protein MIMGU_mgv1a021124mg                258   5e-75    
ref|XP_010047056.1|  PREDICTED: putative leucine-rich repeat rece...    257   1e-74    
ref|XP_010047055.1|  PREDICTED: putative leucine-rich repeat rece...    257   2e-74    
gb|KCW44682.1|  hypothetical protein EUGRSUZ_L01784                     254   3e-73    
gb|KHN30272.1|  Putative leucine-rich repeat receptor-like serine...    253   5e-73    
ref|XP_008660682.1|  PREDICTED: putative leucine-rich repeat rece...    253   7e-73    
gb|AFW85540.1|  putative leucine-rich repeat receptor-like protei...    253   8e-73    
ref|XP_003518225.1|  PREDICTED: putative leucine-rich repeat rece...    252   1e-72    
gb|EMT33357.1|  Putative LRR receptor-like serine/threonine-prote...    249   1e-72    
ref|XP_004508235.1|  PREDICTED: putative leucine-rich repeat rece...    251   2e-72    
gb|KHN17512.1|  Putative leucine-rich repeat receptor-like serine...    251   3e-72    
ref|XP_003550679.2|  PREDICTED: putative leucine-rich repeat rece...    249   1e-71    
ref|XP_003525899.1|  PREDICTED: putative leucine-rich repeat rece...    249   2e-71    
gb|KHN23949.1|  Putative leucine-rich repeat receptor-like serine...    249   2e-71    
ref|XP_009409775.1|  PREDICTED: putative leucine-rich repeat rece...    248   2e-71    
ref|XP_008790186.1|  PREDICTED: putative leucine-rich repeat rece...    249   2e-71    
ref|XP_007154862.1|  hypothetical protein PHAVU_003G154000g             248   4e-71    
ref|XP_008443839.1|  PREDICTED: putative leucine-rich repeat rece...    248   5e-71    
ref|XP_006404913.1|  hypothetical protein EUTSA_v10000545mg             245   2e-70    
emb|CAN73698.1|  hypothetical protein VITISV_024434                     228   2e-70    Vitis vinifera
ref|XP_004964648.1|  PREDICTED: putative leucine-rich repeat rece...    243   2e-69    
ref|XP_010905056.1|  PREDICTED: putative leucine-rich repeat rece...    243   3e-69    
ref|XP_002437981.1|  hypothetical protein SORBIDRAFT_10g005850          243   4e-69    Sorghum bicolor [broomcorn]
dbj|BAD72442.1|  putative protein kinase Xa21, receptor type prec...    241   9e-69    Oryza sativa Japonica Group [Japonica rice]
gb|EAY99946.1|  hypothetical protein OsI_21949                          239   4e-68    Oryza sativa Indica Group [Indian rice]
ref|XP_003560979.1|  PREDICTED: putative leucine-rich repeat rece...    238   1e-67    
ref|XP_008443838.1|  PREDICTED: putative leucine-rich repeat rece...    238   1e-67    
ref|XP_004146720.1|  PREDICTED: putative leucine-rich repeat rece...    235   1e-66    
gb|EMT02279.1|  Putative LRR receptor-like serine/threonine-prote...    232   2e-65    
ref|XP_003560981.1|  PREDICTED: putative leucine-rich repeat rece...    229   1e-64    
gb|EMT31747.1|  LRR receptor-like serine/threonine-protein kinase...    229   2e-64    
ref|XP_007023494.1|  Serine-threonine protein kinase, plant-type,...    225   2e-63    
ref|XP_004964649.1|  PREDICTED: putative leucine-rich repeat rece...    225   5e-63    
ref|XP_008660681.1|  PREDICTED: putative leucine-rich repeat rece...    224   1e-62    
ref|XP_002437982.1|  hypothetical protein SORBIDRAFT_10g005860          219   5e-61    Sorghum bicolor [broomcorn]
gb|EMT06051.1|  LRR receptor-like serine/threonine-protein kinase...    218   1e-60    
emb|CBI36558.3|  unnamed protein product                                213   8e-59    
ref|XP_004964647.1|  PREDICTED: putative leucine-rich repeat rece...    213   9e-59    
gb|KGN65180.1|  hypothetical protein Csa_1G257860                       207   5e-58    
gb|KGN58648.1|  hypothetical protein Csa_3G710760                       209   8e-58    
ref|XP_008649174.1|  PREDICTED: putative leucine-rich repeat rece...    209   1e-57    
ref|XP_010909264.1|  PREDICTED: probable LRR receptor-like serine...    208   1e-57    
gb|AAT96696.1|  putative LRR-like protein kinase 2                      194   2e-57    Musa acuminata [banana]
ref|XP_008779781.1|  PREDICTED: probable LRR receptor-like serine...    196   2e-57    
ref|XP_003560978.1|  PREDICTED: putative leucine-rich repeat rece...    209   3e-57    
ref|XP_007212637.1|  hypothetical protein PRUPE_ppa018076mg             208   3e-57    
ref|XP_008778949.1|  PREDICTED: probable LRR receptor-like serine...    208   8e-57    
gb|EEC80146.1|  hypothetical protein OsI_21950                          207   1e-56    Oryza sativa Indica Group [Indian rice]
ref|XP_009782387.1|  PREDICTED: probable LRR receptor-like serine...    206   3e-56    
gb|EAZ36072.1|  hypothetical protein OsJ_20381                          206   3e-56    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008225338.1|  PREDICTED: probable LRR receptor-like serine...    206   6e-56    
ref|XP_009629748.1|  PREDICTED: probable LRR receptor-like serine...    201   6e-56    
ref|XP_008787554.1|  PREDICTED: probable LRR receptor-like serine...    206   7e-56    
ref|XP_009588501.1|  PREDICTED: probable LRR receptor-like serine...    203   8e-56    
ref|XP_010934694.1|  PREDICTED: probable LRR receptor-like serine...    205   9e-56    
ref|XP_010934695.1|  PREDICTED: probable LRR receptor-like serine...    205   1e-55    
ref|XP_009614227.1|  PREDICTED: probable LRR receptor-like serine...    204   1e-55    
ref|XP_010042840.1|  PREDICTED: probable LRR receptor-like serine...    195   1e-55    
emb|CBI36775.3|  unnamed protein product                                201   3e-55    
gb|EEE65226.1|  hypothetical protein OsJ_20379                          203   3e-55    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008809043.1|  PREDICTED: probable LRR receptor-like serine...    203   4e-55    
ref|NP_001057008.2|  Os06g0186300                                       204   5e-55    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010090360.1|  putative LRR receptor-like serine/threonine-...    204   6e-55    
ref|XP_002280784.1|  PREDICTED: putative receptor-like protein ki...    202   9e-55    Vitis vinifera
emb|CAN71346.1|  hypothetical protein VITISV_024251                     202   9e-55    Vitis vinifera
dbj|BAD72444.1|  putative protein kinase Xa21, receptor type prec...    202   1e-54    Oryza sativa Japonica Group [Japonica rice]
gb|KCW71988.1|  hypothetical protein EUGRSUZ_E00441                     192   1e-54    
ref|XP_006827187.1|  hypothetical protein AMTR_s00010p00257340          201   1e-54    
ref|NP_001046292.2|  Os02g0215900                                       191   2e-54    Oryza sativa Japonica Group [Japonica rice]
gb|KDP44795.1|  hypothetical protein JCGZ_01295                         203   2e-54    
ref|XP_010916722.1|  PREDICTED: probable LRR receptor-like serine...    201   3e-54    
emb|CAN79365.1|  hypothetical protein VITISV_033877                     199   3e-54    Vitis vinifera
ref|XP_008813550.1|  PREDICTED: probable LRR receptor-like serine...    199   3e-54    
ref|XP_003633210.1|  PREDICTED: probable LRR receptor-like serine...    200   3e-54    
gb|EAY99945.1|  hypothetical protein OsI_21948                          199   5e-54    Oryza sativa Indica Group [Indian rice]
ref|XP_007141779.1|  hypothetical protein PHAVU_008G225000g             200   6e-54    
ref|XP_006493616.1|  PREDICTED: probable LRR receptor-like serine...    190   7e-54    
ref|XP_008776167.1|  PREDICTED: LRR receptor-like serine/threonin...    201   8e-54    
ref|XP_002270587.2|  PREDICTED: probable LRR receptor-like serine...    199   9e-54    Vitis vinifera
ref|XP_008810835.1|  PREDICTED: probable LRR receptor-like serine...    199   1e-53    
ref|XP_009353384.1|  PREDICTED: putative receptor-like protein ki...    189   1e-53    
ref|XP_007214168.1|  hypothetical protein PRUPE_ppa018998mg             199   1e-53    
ref|XP_010050948.1|  PREDICTED: probable LRR receptor-like serine...    199   1e-53    
ref|XP_006442554.1|  hypothetical protein CICLE_v10018659mg             199   1e-53    
ref|XP_006346907.1|  PREDICTED: LRR receptor-like serine/threonin...    196   2e-53    
ref|XP_008370158.1|  PREDICTED: probable LRR receptor-like serine...    199   2e-53    
ref|XP_008809727.1|  PREDICTED: probable LRR receptor-like serine...    199   2e-53    
ref|XP_010659855.1|  PREDICTED: putative receptor-like protein ki...    198   2e-53    
emb|CAN60542.1|  hypothetical protein VITISV_018291                     198   2e-53    Vitis vinifera
ref|XP_002436615.1|  hypothetical protein SORBIDRAFT_10g005840          199   3e-53    Sorghum bicolor [broomcorn]
gb|KDP44788.1|  hypothetical protein JCGZ_01288                         194   3e-53    
gb|KHF97553.1|  hypothetical protein F383_36580                         192   3e-53    
gb|KCW80922.1|  hypothetical protein EUGRSUZ_C02282                     197   6e-53    
ref|XP_010915162.1|  PREDICTED: putative receptor-like protein ki...    196   6e-53    
ref|XP_010268543.1|  PREDICTED: probable LRR receptor-like serine...    192   6e-53    
ref|XP_010039512.1|  PREDICTED: probable LRR receptor-like serine...    196   6e-53    
gb|KHN19543.1|  Putative LRR receptor-like serine/threonine-prote...    194   6e-53    
emb|CBI36778.3|  unnamed protein product                                198   7e-53    
ref|XP_010656926.1|  PREDICTED: probable LRR receptor-like serine...    197   8e-53    
ref|XP_006351028.1|  PREDICTED: probable LRR receptor-like serine...    196   8e-53    
emb|CBI17790.3|  unnamed protein product                                194   8e-53    
ref|XP_006493621.1|  PREDICTED: probable LRR receptor-like serine...    190   9e-53    
ref|XP_010908730.1|  PREDICTED: probable LRR receptor-like serine...    197   9e-53    
ref|XP_010939780.1|  PREDICTED: probable LRR receptor-like serine...    196   9e-53    
ref|XP_010934131.1|  PREDICTED: probable LRR receptor-like serine...    184   9e-53    
gb|KCW45924.1|  hypothetical protein EUGRSUZ_L00190                     196   1e-52    
ref|XP_009351405.1|  PREDICTED: probable LRR receptor-like serine...    193   1e-52    
ref|XP_010930447.1|  PREDICTED: probable LRR receptor-like serine...    197   1e-52    
ref|XP_006442561.1|  hypothetical protein CICLE_v10024426mg             194   1e-52    
gb|AHZ44755.1|  LRR.XII-like protein                                    194   1e-52    
gb|KCW45939.1|  hypothetical protein EUGRSUZ_L00213                     196   1e-52    
gb|EEC68386.1|  hypothetical protein OsI_36534                          194   1e-52    Oryza sativa Indica Group [Indian rice]
ref|XP_010930449.1|  PREDICTED: probable LRR receptor-like serine...    196   2e-52    
gb|ABA94329.1|  receptor kinase, putative, expressed                    194   2e-52    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008345550.1|  PREDICTED: probable LRR receptor-like serine...    191   2e-52    
ref|XP_010909831.1|  PREDICTED: probable LRR receptor-like serine...    193   2e-52    
ref|XP_006296540.1|  hypothetical protein CARUB_v100225660mg            187   2e-52    
ref|XP_002270207.2|  PREDICTED: probable LRR receptor-like serine...    196   2e-52    Vitis vinifera
ref|XP_009377115.1|  PREDICTED: probable LRR receptor-like serine...    195   2e-52    
gb|KHN11804.1|  Putative LRR receptor-like serine/threonine-prote...    194   2e-52    
ref|XP_008353658.1|  PREDICTED: probable LRR receptor-like serine...    190   2e-52    
ref|XP_007207978.1|  hypothetical protein PRUPE_ppa015907mg             195   2e-52    
gb|KHG17758.1|  hypothetical protein F383_22961                         192   3e-52    
gb|KCW63532.1|  hypothetical protein EUGRSUZ_G01167                     187   3e-52    
ref|NP_001068119.1|  Os11g0569800                                       194   3e-52    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009341843.1|  PREDICTED: probable LRR receptor-like serine...    189   3e-52    
ref|XP_002528851.1|  serine-threonine protein kinase, plant-type,...    195   3e-52    Ricinus communis
ref|XP_006442565.1|  hypothetical protein CICLE_v10018687mg             195   3e-52    
gb|KCW71989.1|  hypothetical protein EUGRSUZ_E00442                     195   3e-52    
ref|XP_010939782.1|  PREDICTED: probable LRR receptor-like serine...    194   3e-52    
ref|XP_006663535.1|  PREDICTED: probable LRR receptor-like serine...    196   3e-52    
ref|XP_010654247.1|  PREDICTED: probable LRR receptor-like serine...    195   3e-52    
ref|XP_008809723.1|  PREDICTED: probable LRR receptor-like serine...    195   4e-52    
ref|XP_006442572.1|  hypothetical protein CICLE_v100188372mg            193   4e-52    
ref|XP_010655740.1|  PREDICTED: probable LRR receptor-like serine...    189   4e-52    
ref|XP_010050956.1|  PREDICTED: probable LRR receptor-like serine...    195   4e-52    
gb|AFW60350.1|  putative leucine-rich repeat receptor-like protei...    193   4e-52    
emb|CDP19732.1|  unnamed protein product                                187   5e-52    
gb|KCW45736.1|  hypothetical protein EUGRSUZ_L00483                     193   5e-52    
gb|KDP44793.1|  hypothetical protein JCGZ_01293                         194   5e-52    
gb|KCW45933.1|  hypothetical protein EUGRSUZ_L00201                     194   5e-52    
gb|KDO48776.1|  hypothetical protein CISIN_1g003855mg                   192   5e-52    
gb|AFW81417.1|  putative leucine-rich repeat receptor-like protei...    193   5e-52    
ref|NP_001146150.1|  uncharacterized protein LOC100279719               193   5e-52    Zea mays [maize]
ref|XP_006657092.1|  PREDICTED: probable LRR receptor-like serine...    195   6e-52    
gb|EEC66712.1|  hypothetical protein OsI_33040                          194   6e-52    Oryza sativa Indica Group [Indian rice]
ref|XP_009400129.1|  PREDICTED: probable LRR receptor-like serine...    194   6e-52    
ref|XP_003522531.1|  PREDICTED: probable LRR receptor-like serine...    194   6e-52    
ref|XP_003616620.1|  Receptor-like protein kinase                       194   6e-52    
ref|XP_006493619.1|  PREDICTED: probable LRR receptor-like serine...    192   6e-52    
ref|XP_010068345.1|  PREDICTED: putative receptor-like protein ki...    187   7e-52    
ref|XP_010656878.1|  PREDICTED: probable LRR receptor-like serine...    193   7e-52    
ref|XP_010090362.1|  putative LRR receptor-like serine/threonine-...    194   7e-52    
gb|KCW45936.1|  hypothetical protein EUGRSUZ_L00207                     192   8e-52    
gb|KCW45847.1|  hypothetical protein EUGRSUZ_L00309                     184   8e-52    
ref|XP_010039508.1|  PREDICTED: probable LRR receptor-like serine...    194   8e-52    
ref|XP_003602347.1|  Leucine-rich repeat receptor-like protein ki...    194   8e-52    
ref|XP_010915160.1|  PREDICTED: putative receptor-like protein ki...    195   8e-52    
ref|XP_010039507.1|  PREDICTED: probable LRR receptor-like serine...    194   8e-52    
ref|XP_010058195.1|  PREDICTED: putative receptor-like protein ki...    194   9e-52    
gb|KCW45919.1|  hypothetical protein EUGRSUZ_L00181                     193   1e-51    
gb|KCW78836.1|  hypothetical protein EUGRSUZ_C00269                     192   1e-51    
ref|XP_010027007.1|  PREDICTED: probable LRR receptor-like serine...    193   1e-51    
ref|XP_010039517.1|  PREDICTED: probable LRR receptor-like serine...    184   1e-51    
ref|XP_009144710.1|  PREDICTED: probable LRR receptor-like serine...    185   1e-51    
gb|KCW53535.1|  hypothetical protein EUGRSUZ_J02814                     192   1e-51    
ref|XP_009376600.1|  PREDICTED: probable LRR receptor-like serine...    192   1e-51    
ref|XP_010039795.1|  PREDICTED: probable LRR receptor-like serine...    193   1e-51    
ref|XP_009337773.1|  PREDICTED: probable LRR receptor-like serine...    186   1e-51    
ref|XP_010039503.1|  PREDICTED: probable LRR receptor-like serine...    193   1e-51    
ref|XP_008813539.1|  PREDICTED: probable LRR receptor-like serine...    181   1e-51    
ref|XP_010050260.1|  PREDICTED: putative receptor-like protein ki...    187   2e-51    
ref|XP_007026946.1|  EF-TU receptor, putative                           192   2e-51    
ref|XP_009399783.1|  PREDICTED: probable LRR receptor-like serine...    193   2e-51    
ref|XP_010034804.1|  PREDICTED: probable LRR receptor-like serine...    192   2e-51    
ref|XP_007136453.1|  hypothetical protein PHAVU_009G046600g             191   2e-51    
dbj|BAD34207.1|  putative protein kinase Xa21                           193   2e-51    
gb|KGN58773.1|  hypothetical protein Csa_3G731830                       192   2e-51    
emb|CDP06824.1|  unnamed protein product                                193   2e-51    
ref|XP_010050261.1|  PREDICTED: probable LRR receptor-like serine...    192   2e-51    
ref|XP_006442545.1|  hypothetical protein CICLE_v10018871mg             191   2e-51    
ref|XP_010655739.1|  PREDICTED: probable LRR receptor-like serine...    187   2e-51    
ref|XP_008654820.1|  PREDICTED: uncharacterized protein LOC100279...    193   3e-51    
ref|XP_008677956.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    193   3e-51    
ref|XP_010039510.1|  PREDICTED: putative receptor-like protein ki...    192   3e-51    
ref|XP_010265745.1|  PREDICTED: probable LRR receptor-like serine...    193   3e-51    
emb|CDO96820.1|  unnamed protein product                                189   3e-51    
ref|XP_010068339.1|  PREDICTED: putative receptor-like protein ki...    186   3e-51    
ref|XP_008345545.1|  PREDICTED: probable LRR receptor-like serine...    192   3e-51    
gb|EMT27520.1|  Putative LRR receptor-like serine/threonine-prote...    186   3e-51    
ref|XP_004307661.1|  PREDICTED: probable LRR receptor-like serine...    189   3e-51    
ref|XP_010691757.1|  PREDICTED: uncharacterized protein LOC104905013    194   3e-51    
ref|XP_009341018.1|  PREDICTED: probable LRR receptor-like serine...    192   4e-51    
gb|EAZ06573.1|  hypothetical protein OsI_28821                          191   4e-51    
ref|XP_009342058.1|  PREDICTED: probable LRR receptor-like serine...    182   4e-51    
ref|XP_008793516.1|  PREDICTED: probable LRR receptor-like serine...    192   4e-51    
ref|XP_004252061.1|  PREDICTED: LRR receptor-like serine/threonin...    192   4e-51    
ref|XP_006587651.1|  PREDICTED: probable LRR receptor-like serine...    192   5e-51    
ref|XP_008371720.1|  PREDICTED: probable LRR receptor-like serine...    189   5e-51    
ref|XP_009374260.1|  PREDICTED: probable LRR receptor-like serine...    191   5e-51    
ref|XP_004137908.1|  PREDICTED: LOW QUALITY PROTEIN: putative rec...    192   5e-51    
ref|XP_004156664.1|  PREDICTED: LOW QUALITY PROTEIN: putative rec...    192   5e-51    
ref|XP_006358714.1|  PREDICTED: probable LRR receptor-like serine...    184   5e-51    
ref|XP_008809710.1|  PREDICTED: LRR receptor-like serine/threonin...    192   5e-51    
gb|KEH19801.1|  receptor-like kinase                                    180   6e-51    
gb|EEE65946.1|  hypothetical protein OsJ_21823                          190   6e-51    
gb|KDP44790.1|  hypothetical protein JCGZ_01290                         184   6e-51    
emb|CBI22001.3|  unnamed protein product                                191   6e-51    
emb|CDP21590.1|  unnamed protein product                                186   6e-51    
gb|KDO75299.1|  hypothetical protein CISIN_1g048430mg                   191   6e-51    
dbj|BAD34191.1|  putative protein kinase Xa21                           191   7e-51    
ref|XP_009340996.1|  PREDICTED: putative receptor-like protein ki...    191   7e-51    
ref|XP_009340992.1|  PREDICTED: probable LRR receptor-like serine...    191   7e-51    
gb|KDP21115.1|  hypothetical protein JCGZ_21586                         191   7e-51    
ref|XP_010040119.1|  PREDICTED: putative receptor-like protein ki...    191   7e-51    
ref|XP_008387757.1|  PREDICTED: probable LRR receptor-like serine...    191   7e-51    
ref|XP_004308371.1|  PREDICTED: probable LRR receptor-like serine...    187   7e-51    
gb|KHN30848.1|  Putative LRR receptor-like serine/threonine-prote...    190   7e-51    
ref|XP_009761189.1|  PREDICTED: putative receptor-like protein ki...    192   7e-51    
ref|XP_010068252.1|  PREDICTED: LRR receptor-like serine/threonin...    189   8e-51    
ref|XP_010108669.1|  putative LRR receptor-like serine/threonine-...    191   8e-51    
ref|XP_002311065.2|  hypothetical protein POPTR_0008s03370g             191   9e-51    
gb|EYU40635.1|  hypothetical protein MIMGU_mgv1a026366mg                189   9e-51    
dbj|BAK05825.1|  predicted protein                                      191   1e-50    
ref|XP_009762649.1|  PREDICTED: probable LRR receptor-like serine...    191   1e-50    
ref|XP_008387726.1|  PREDICTED: probable LRR receptor-like serine...    191   1e-50    
ref|XP_010033733.1|  PREDICTED: probable LRR receptor-like serine...    191   1e-50    
ref|XP_010257114.1|  PREDICTED: probable LRR receptor-like serine...    190   1e-50    
gb|KDP44942.1|  hypothetical protein JCGZ_01442                         188   1e-50    
ref|XP_004302429.1|  PREDICTED: putative receptor-like protein ki...    190   1e-50    
gb|KCW63524.1|  hypothetical protein EUGRSUZ_G011581                    186   1e-50    
ref|XP_008669509.1|  PREDICTED: probable LRR receptor-like serine...    189   1e-50    
ref|XP_009351437.1|  PREDICTED: LRR receptor-like serine/threonin...    188   1e-50    
ref|XP_007213069.1|  hypothetical protein PRUPE_ppa020550mg             191   1e-50    
ref|XP_003616615.1|  Nodulation receptor kinase                         185   2e-50    
ref|XP_010039797.1|  PREDICTED: putative receptor-like protein ki...    187   2e-50    
ref|XP_010040523.1|  PREDICTED: probable LRR receptor-like serine...    182   2e-50    
gb|KEH38490.1|  receptor-like kinase                                    180   2e-50    
ref|XP_010068202.1|  PREDICTED: putative receptor-like protein ki...    190   2e-50    
ref|XP_008656771.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    191   2e-50    
gb|KDO48784.1|  hypothetical protein CISIN_1g007680mg                   187   2e-50    
ref|XP_004308369.1|  PREDICTED: probable LRR receptor-like serine...    190   2e-50    
emb|CAE01955.2|  OSJNBb0071D01.1                                        189   2e-50    
ref|XP_010929793.1|  PREDICTED: probable LRR receptor-like serine...    187   2e-50    
gb|KCW63152.1|  hypothetical protein EUGRSUZ_G00765                     189   2e-50    
ref|XP_006468350.1|  PREDICTED: probable LRR receptor-like serine...    188   2e-50    
gb|KCW45917.1|  hypothetical protein EUGRSUZ_L00178                     190   2e-50    
ref|XP_006484590.1|  PREDICTED: probable LRR receptor-like serine...    185   2e-50    
ref|XP_010039791.1|  PREDICTED: putative receptor-like protein ki...    188   2e-50    
gb|KDP44797.1|  hypothetical protein JCGZ_01297                         191   2e-50    
ref|XP_010250245.1|  PREDICTED: probable LRR receptor-like serine...    190   2e-50    
ref|XP_010527631.1|  PREDICTED: putative receptor-like protein ki...    190   2e-50    
ref|XP_008225337.1|  PREDICTED: putative receptor-like protein ki...    190   2e-50    
gb|KCW45849.1|  hypothetical protein EUGRSUZ_L00313                     190   2e-50    
gb|KCW53534.1|  hypothetical protein EUGRSUZ_J02813                     189   2e-50    
gb|EEC72746.1|  hypothetical protein OsI_06373                          188   2e-50    
ref|XP_010039622.1|  PREDICTED: probable LRR receptor-like serine...    190   2e-50    
ref|XP_008779677.1|  PREDICTED: probable LRR receptor-like serine...    178   2e-50    
gb|KCW53533.1|  hypothetical protein EUGRSUZ_J02812                     189   2e-50    
ref|XP_010039502.1|  PREDICTED: putative receptor-like protein ki...    190   2e-50    
gb|KHG24570.1|  hypothetical protein F383_10091                         182   2e-50    
ref|XP_006577603.1|  PREDICTED: probable LRR receptor-like serine...    189   2e-50    
ref|XP_010068333.1|  PREDICTED: putative receptor-like protein ki...    178   2e-50    
ref|XP_008354770.1|  PREDICTED: probable LRR receptor-like serine...    188   3e-50    
gb|KCW78832.1|  hypothetical protein EUGRSUZ_C00264                     187   3e-50    
ref|XP_008345546.1|  PREDICTED: probable LRR receptor-like serine...    189   3e-50    
ref|XP_010930450.1|  PREDICTED: probable LRR receptor-like serine...    190   3e-50    
emb|CBI35485.3|  unnamed protein product                                187   3e-50    
ref|XP_009618940.1|  PREDICTED: probable LRR receptor-like serine...    189   3e-50    
emb|CAE03915.2|  OSJNBb0015G09.9                                        188   3e-50    
ref|XP_006484593.1|  PREDICTED: probable LRR receptor-like serine...    188   3e-50    
ref|XP_006442548.1|  hypothetical protein CICLE_v10024125mg             188   3e-50    
gb|EEE60356.1|  hypothetical protein OsJ_13475                          189   3e-50    
ref|XP_007219655.1|  hypothetical protein PRUPE_ppa025151mg             189   3e-50    
ref|XP_008223907.1|  PREDICTED: putative receptor-like protein ki...    189   3e-50    
ref|XP_002446184.1|  hypothetical protein SORBIDRAFT_06g003150          189   3e-50    
ref|XP_006442393.1|  hypothetical protein CICLE_v10018832mg             188   3e-50    
emb|CDP07987.1|  unnamed protein product                                184   3e-50    
ref|XP_006481406.1|  PREDICTED: putative receptor-like protein ki...    189   3e-50    
emb|CDP17628.1|  unnamed protein product                                190   4e-50    
ref|XP_010274018.1|  PREDICTED: probable LRR receptor-like serine...    189   4e-50    
ref|XP_004980623.1|  PREDICTED: probable LRR receptor-like serine...    189   4e-50    
ref|XP_006442551.1|  hypothetical protein CICLE_v10018783mg             188   4e-50    
ref|XP_010034803.1|  PREDICTED: probable LRR receptor-like serine...    189   4e-50    
ref|XP_007136457.1|  hypothetical protein PHAVU_009G046900g             189   4e-50    
dbj|BAD17688.1|  putative protein kinase Xa21                           189   4e-50    
ref|XP_007213771.1|  hypothetical protein PRUPE_ppa024298m1g            177   4e-50    
gb|KHN20854.1|  Putative LRR receptor-like serine/threonine-prote...    188   4e-50    
ref|XP_007158141.1|  hypothetical protein PHAVU_002G127800g             189   4e-50    
emb|CDO96774.1|  unnamed protein product                                187   5e-50    
gb|KCW63228.1|  hypothetical protein EUGRSUZ_G00848                     189   5e-50    
gb|AHZ44757.1|  LRR.XII-like protein                                    189   5e-50    
ref|XP_002449858.1|  hypothetical protein SORBIDRAFT_05g024520          189   5e-50    
ref|XP_010268541.1|  PREDICTED: probable LRR receptor-like serine...    189   5e-50    
ref|XP_008356454.1|  PREDICTED: putative receptor-like protein ki...    186   5e-50    
gb|EMT18601.1|  Putative LRR receptor-like serine/threonine-prote...    188   5e-50    
ref|NP_198755.1|  leucine-rich repeat protein kinase                    184   5e-50    
ref|XP_010236334.1|  PREDICTED: putative receptor-like protein ki...    189   5e-50    
ref|XP_006494302.1|  PREDICTED: probable LRR receptor-like serine...    180   5e-50    
ref|XP_008246467.1|  PREDICTED: putative receptor-like protein ki...    189   5e-50    
ref|XP_007009036.1|  Serine-threonine protein kinase, plant-type,...    189   5e-50    
ref|XP_006596613.1|  PREDICTED: probable LRR receptor-like serine...    189   5e-50    
ref|XP_009390130.1|  PREDICTED: probable LRR receptor-like serine...    189   5e-50    
gb|KDO48773.1|  hypothetical protein CISIN_1g005040mg                   186   5e-50    
gb|KDO53264.1|  hypothetical protein CISIN_1g002883mg                   187   5e-50    
gb|KDP44811.1|  hypothetical protein JCGZ_01311                         189   5e-50    
dbj|BAG99388.1|  unnamed protein product                                187   6e-50    
ref|XP_002316396.2|  leucine-rich repeat transmembrane protein ki...    189   6e-50    
ref|XP_007214129.1|  hypothetical protein PRUPE_ppa018020mg             189   6e-50    
gb|KCW45726.1|  hypothetical protein EUGRSUZ_L00469                     188   6e-50    
ref|XP_006848179.1|  hypothetical protein AMTR_s00029p00236390          184   6e-50    
ref|XP_010930451.1|  PREDICTED: probable LRR receptor-like serine...    189   6e-50    
emb|CAE03719.2|  OSJNBa0021F22.13                                       179   6e-50    
gb|KDP33401.1|  hypothetical protein JCGZ_12857                         187   7e-50    
ref|XP_010068229.1|  PREDICTED: probable LRR receptor-like serine...    188   7e-50    
ref|XP_010916725.1|  PREDICTED: probable LRR receptor-like serine...    189   7e-50    
ref|XP_006843088.1|  hypothetical protein AMTR_s00140p00038150          181   7e-50    
ref|XP_004959355.1|  PREDICTED: probable LRR receptor-like serine...    188   8e-50    
ref|XP_010238188.1|  PREDICTED: probable LRR receptor-like serine...    189   8e-50    
ref|XP_004955869.1|  PREDICTED: putative receptor-like protein ki...    188   8e-50    
ref|XP_010238187.1|  PREDICTED: probable LRR receptor-like serine...    188   8e-50    
ref|XP_008345547.1|  PREDICTED: probable LRR receptor-like serine...    184   8e-50    
ref|XP_007212752.1|  hypothetical protein PRUPE_ppa016624mg             188   9e-50    
ref|XP_003600865.1|  Kinase-like protein                                188   9e-50    
ref|XP_009144709.1|  PREDICTED: probable LRR receptor-like serine...    185   9e-50    
gb|KEH19873.1|  LRR receptor-like kinase family protein                 186   9e-50    
ref|XP_009338588.1|  PREDICTED: probable LRR receptor-like serine...    188   9e-50    
ref|XP_009395674.1|  PREDICTED: putative receptor-like protein ki...    188   9e-50    
ref|XP_006477788.1|  PREDICTED: probable LRR receptor-like serine...    188   9e-50    
ref|XP_010068226.1|  PREDICTED: putative receptor-like protein ki...    186   9e-50    
gb|EEC69217.1|  hypothetical protein OsI_38218                          188   9e-50    
gb|KDO80190.1|  hypothetical protein CISIN_1g0052782mg                  181   1e-49    
ref|XP_002875847.1|  hypothetical protein ARALYDRAFT_347851             188   1e-49    
ref|XP_008237205.1|  PREDICTED: probable LRR receptor-like serine...    188   1e-49    
ref|XP_007009032.1|  Serine-threonine protein kinase, plant-type,...    188   1e-49    
ref|XP_009342047.1|  PREDICTED: probable LRR receptor-like serine...    177   1e-49    
gb|KCW71986.1|  hypothetical protein EUGRSUZ_E00438                     187   1e-49    
gb|KCW63638.1|  hypothetical protein EUGRSUZ_G01270                     187   1e-49    
ref|XP_007206228.1|  hypothetical protein PRUPE_ppa015372mg             187   1e-49    
gb|KDO42814.1|  hypothetical protein CISIN_1g001858mg                   187   1e-49    
ref|XP_010068338.1|  PREDICTED: putative receptor-like protein ki...    186   1e-49    
ref|XP_009377798.1|  PREDICTED: probable LRR receptor-like serine...    188   1e-49    
gb|KCW82341.1|  hypothetical protein EUGRSUZ_C03742                     188   1e-49    
ref|XP_009363703.1|  PREDICTED: probable LRR receptor-like serine...    186   1e-49    
ref|XP_006429333.1|  hypothetical protein CICLE_v10013652mg             187   1e-49    
ref|XP_007207860.1|  hypothetical protein PRUPE_ppa022443mg             187   1e-49    
gb|EEC76609.1|  hypothetical protein OsI_14473                          188   1e-49    
ref|XP_009775496.1|  PREDICTED: putative receptor-like protein ki...    187   1e-49    
ref|XP_004966011.1|  PREDICTED: probable LRR receptor-like serine...    188   1e-49    
gb|EEE60355.1|  hypothetical protein OsJ_13474                          187   1e-49    
ref|XP_009377741.1|  PREDICTED: probable LRR receptor-like serine...    187   1e-49    
ref|XP_004512441.1|  PREDICTED: probable LRR receptor-like serine...    187   1e-49    
ref|XP_007203343.1|  hypothetical protein PRUPE_ppa020277mg             187   1e-49    
ref|XP_008442449.1|  PREDICTED: putative receptor-like protein ki...    187   1e-49    
gb|KCW45930.1|  hypothetical protein EUGRSUZ_L00196                     187   1e-49    
ref|XP_002280075.2|  PREDICTED: probable LRR receptor-like serine...    188   1e-49    
ref|XP_006371567.1|  hypothetical protein POPTR_0019s13220g             185   1e-49    
ref|XP_010268403.1|  PREDICTED: probable LRR receptor-like serine...    188   2e-49    
ref|XP_010051564.1|  PREDICTED: putative receptor-like protein ki...    188   2e-49    
ref|XP_008812886.1|  PREDICTED: probable LRR receptor-like serine...    188   2e-49    
ref|XP_002461676.1|  hypothetical protein SORBIDRAFT_02g006310          187   2e-49    
ref|XP_010657055.1|  PREDICTED: LRR receptor-like serine/threonin...    186   2e-49    
ref|XP_010068230.1|  PREDICTED: putative receptor-like protein ki...    187   2e-49    
gb|EAZ36071.1|  hypothetical protein OsJ_20380                          187   2e-49    
ref|XP_004308532.1|  PREDICTED: probable LRR receptor-like serine...    187   2e-49    
ref|XP_009388674.1|  PREDICTED: probable LRR receptor-like serine...    187   2e-49    
gb|KDP37051.1|  hypothetical protein JCGZ_06107                         186   2e-49    
ref|XP_002875851.1|  hypothetical protein ARALYDRAFT_323370             187   2e-49    
ref|XP_006484588.1|  PREDICTED: probable LRR receptor-like serine...    186   2e-49    
ref|XP_003636118.1|  Cysteine-rich receptor-like protein kinase         185   2e-49    
ref|XP_010237309.1|  PREDICTED: probable LRR receptor-like serine...    178   2e-49    
ref|XP_010655181.1|  PREDICTED: putative receptor-like protein ki...    188   2e-49    
ref|XP_010657053.1|  PREDICTED: probable LRR receptor-like serine...    188   2e-49    
gb|KDP34540.1|  hypothetical protein JCGZ_11090                         182   2e-49    
ref|XP_010657052.1|  PREDICTED: putative receptor-like protein ki...    188   2e-49    
ref|XP_007203367.1|  hypothetical protein PRUPE_ppa020656mg             187   2e-49    
ref|XP_008225251.1|  PREDICTED: probable LRR receptor-like serine...    186   2e-49    
emb|CAH66130.1|  OSIGBa0135L04.4                                        187   2e-49    
ref|XP_010039799.1|  PREDICTED: putative receptor-like protein ki...    180   2e-49    
ref|XP_010050947.1|  PREDICTED: putative receptor-like protein ki...    187   2e-49    
ref|XP_008363413.1|  PREDICTED: putative receptor-like protein ki...    186   2e-49    
ref|XP_010068376.1|  PREDICTED: putative receptor-like protein ki...    187   2e-49    
ref|XP_009343564.1|  PREDICTED: LRR receptor-like serine/threonin...    185   2e-49    
ref|XP_008345430.1|  PREDICTED: probable LRR receptor-like serine...    187   3e-49    
ref|XP_010246503.1|  PREDICTED: probable LRR receptor-like serine...    187   3e-49    
dbj|BAJ97922.1|  predicted protein                                      186   3e-49    
ref|XP_008377050.1|  PREDICTED: probable LRR receptor-like serine...    187   3e-49    
ref|XP_008385923.1|  PREDICTED: probable LRR receptor-like serine...    186   3e-49    
ref|XP_010068179.1|  PREDICTED: probable LRR receptor-like serine...    182   3e-49    
emb|CDP18495.1|  unnamed protein product                                187   3e-49    
gb|KHN30623.1|  Putative LRR receptor-like serine/threonine-prote...    186   3e-49    
ref|XP_009337770.1|  PREDICTED: LRR receptor-like serine/threonin...    184   3e-49    
ref|XP_008674101.1|  PREDICTED: probable LRR receptor-like serine...    186   3e-49    



>ref|XP_002304735.2| hypothetical protein POPTR_0003s18230g [Populus trichocarpa]
 gb|EEE79714.2| hypothetical protein POPTR_0003s18230g [Populus trichocarpa]
Length=995

 Score =   432 bits (1110),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 224/295 (76%), Positives = 258/295 (87%), Gaps = 9/295 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL +Q+GNS KSF RECQVL+RIRHRNLIR+ITACSLPDFKALVLPYMANGSLD RLYP
Sbjct  699  KVLQLQSGNSTKSFNRECQVLKRIRHRNLIRIITACSLPDFKALVLPYMANGSLDSRLYP  758

Query  182  HPH----SGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALV  349
            H      SGSSDL+L+QRV ICSDIAEG+AYLHHHSPVKVIHCDLKPSNVLLN+DMTALV
Sbjct  759  HSETGLGSGSSDLTLLQRVRICSDIAEGMAYLHHHSPVKVIHCDLKPSNVLLNDDMTALV  818

Query  350  SDFGISKLVMTTTG-SGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVL  526
            SDFGI++LVMT  G +G A + +GNSTAN+LCGS+GYIAPEYGFGS+TSTKGDVYSFGVL
Sbjct  819  SDFGIARLVMTVAGGNGGAVENMGNSTANLLCGSVGYIAPEYGFGSNTSTKGDVYSFGVL  878

Query  527  VLEMVTRKKPTDDTFGRSLSLHQYVKSEQM----EIVDCSLMRALKEQSAEVMKMWEVAI  694
            VLE++TRK+PTDD F   L+LH++VK+        +VD SLMRA ++QS EV +MWEVAI
Sbjct  879  VLEILTRKRPTDDMFVDGLNLHKWVKTHYHGRVERVVDSSLMRASRDQSPEVKRMWEVAI  938

Query  695  RELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTLS  859
             EL E+G+LCTQ+ P+TRPTMLDAADDL+RLKRYL+GDTTATFASSLG+S STLS
Sbjct  939  GELAELGILCTQESPTTRPTMLDAADDLDRLKRYLSGDTTATFASSLGMSSSTLS  993



>ref|XP_006368488.1| hypothetical protein POPTR_0001s03400g [Populus trichocarpa]
 gb|ERP65057.1| hypothetical protein POPTR_0001s03400g [Populus trichocarpa]
Length=834

 Score =   426 bits (1096),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 227/294 (77%), Positives = 259/294 (88%), Gaps = 9/294 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL  Q+GNS KSF RECQVL+RIRHRNLIR+ITACSLPDFKALVLPYMANGSLD RLYP
Sbjct  538  KVLQFQSGNSTKSFNRECQVLKRIRHRNLIRIITACSLPDFKALVLPYMANGSLDSRLYP  597

Query  182  HPH----SGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALV  349
            H      SGSSDL+L+QRV+ICSDIAEG+AYLHHHSPVKVIHCDLKPSNVLLN+DMTALV
Sbjct  598  HSETGLGSGSSDLTLLQRVSICSDIAEGMAYLHHHSPVKVIHCDLKPSNVLLNDDMTALV  657

Query  350  SDFGISKLVMT-TTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVL  526
            SDFGI++LVMT   G+G   + +GNSTAN+LCGSIGYIAPEYGFGS+TSTKGDVYSFGVL
Sbjct  658  SDFGIARLVMTVGGGNGGVVENMGNSTANLLCGSIGYIAPEYGFGSNTSTKGDVYSFGVL  717

Query  527  VLEMVTRKKPTDDTFGRSLSLHQYVKSE---QME-IVDCSLMRALKEQSAEVMKMWEVAI  694
            VLEMVTRK+PTDD F   L+LH++VK+    ++E +VD SLMRA ++Q  EV +MWEVAI
Sbjct  718  VLEMVTRKRPTDDMFVGGLNLHKWVKTHYHGRLERVVDPSLMRASRDQFHEVKRMWEVAI  777

Query  695  RELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTL  856
             EL+E+G+LCTQ+ PSTRPTMLDAADDL+RLKRYL+GDTTATFASSLGIS STL
Sbjct  778  GELVELGILCTQESPSTRPTMLDAADDLDRLKRYLSGDTTATFASSLGISSSTL  831



>ref|XP_006427668.1| hypothetical protein CICLE_v10027227mg [Citrus clementina]
 gb|ESR40908.1| hypothetical protein CICLE_v10027227mg [Citrus clementina]
Length=989

 Score =   427 bits (1097),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 219/293 (75%), Positives = 253/293 (86%), Gaps = 8/293 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL +Q+GN  KSF RECQVL+RIRHRNL+R+ITACSLPDFKALVLPYMANGSLD  LYP
Sbjct  694  KVLQLQSGNFTKSFNRECQVLKRIRHRNLMRIITACSLPDFKALVLPYMANGSLDSHLYP  753

Query  182  HPH----SGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALV  349
            H      SGSSDL+L+QRVNICSDIAEG+AYLHHHSPV+VIHCDLKPSNVLLN+DMTALV
Sbjct  754  HSETEFGSGSSDLTLLQRVNICSDIAEGMAYLHHHSPVRVIHCDLKPSNVLLNDDMTALV  813

Query  350  SDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLV  529
            SDFGI+KLVMT     +  + +GNSTANMLCGSIGY+APEYGFGS+TSTKGDVYSFG+LV
Sbjct  814  SDFGIAKLVMTVGVGNDGAENMGNSTANMLCGSIGYMAPEYGFGSNTSTKGDVYSFGILV  873

Query  530  LEMVTRKKPTDDTFGRSLSLHQYVKSEQM----EIVDCSLMRALKEQSAEVMKMWEVAIR  697
            LEMVTR++PTDD F   LSLH++VK+       +++D SL+RA ++QS EV +MW+VAI 
Sbjct  874  LEMVTRRRPTDDMFAGGLSLHKWVKNHYHGRLEKVIDSSLLRASRDQSPEVKRMWDVAIG  933

Query  698  ELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTL  856
            ELIE+G+LCTQ+ PSTRPTMLDAADDL+RLKRYL GDTTATFASSLGIS S L
Sbjct  934  ELIELGILCTQESPSTRPTMLDAADDLDRLKRYLGGDTTATFASSLGISYSNL  986



>gb|KDP41950.1| hypothetical protein JCGZ_26968 [Jatropha curcas]
Length=1001

 Score =   426 bits (1096),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 227/294 (77%), Positives = 257/294 (87%), Gaps = 11/294 (4%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL  Q+GNS KSF RECQVL+RIRHRNLIR+ITACSLPDFKALVLPYMANGSLD RLYP
Sbjct  705  KVLQFQSGNSTKSFNRECQVLKRIRHRNLIRIITACSLPDFKALVLPYMANGSLDSRLYP  764

Query  182  HPH----SGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALV  349
            H      SGSSDL+L+QRVNICSDIAEG+AYLHHHS VKVIHCDLKPSNVLLN+DMTALV
Sbjct  765  HSGTGLCSGSSDLTLIQRVNICSDIAEGMAYLHHHSHVKVIHCDLKPSNVLLNDDMTALV  824

Query  350  SDFGISKLVMTTTGSGNAD--QKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGV  523
            SDFGI++LV+T  G GNA   + +GNSTAN+L GSIGYIAPEYGFGS+TSTKGDVYSFGV
Sbjct  825  SDFGIARLVLTV-GGGNAGVVENVGNSTANLLSGSIGYIAPEYGFGSNTSTKGDVYSFGV  883

Query  524  LVLEMVTRKKPTDDTFGRSLSLHQYVKSE---QME-IVDCSLMRALKEQSAEVMKMWEVA  691
            +VLEMVTRK+PTDD F   L+LH++VKS    +ME ++D SL+RA ++QS EV KMWEVA
Sbjct  884  VVLEMVTRKRPTDDMFAGGLNLHRWVKSYYHGRMEQVIDSSLLRAARDQSPEVTKMWEVA  943

Query  692  IRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCST  853
            I ELIE+G+LCTQ+ PSTRPTMLD ADDL+RLKRYL+GDTTATFASSLGIS ST
Sbjct  944  IGELIELGILCTQESPSTRPTMLDVADDLDRLKRYLSGDTTATFASSLGISSST  997



>ref|XP_011020579.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Populus euphratica]
 ref|XP_011020580.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Populus euphratica]
 ref|XP_011020581.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Populus euphratica]
Length=994

 Score =   424 bits (1090),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 222/295 (75%), Positives = 256/295 (87%), Gaps = 9/295 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL +Q+GNS KSF RECQVL+RIRHRNLIR+ITACSLPDFKALVLPYMANGSLD RLYP
Sbjct  698  KVLQLQSGNSTKSFNRECQVLKRIRHRNLIRIITACSLPDFKALVLPYMANGSLDSRLYP  757

Query  182  HPH----SGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALV  349
            H      SGSSDL+L+QRV+ICSDIAEG+AYLHHHSPVKVIHCDLKPSNVLLN+DMTALV
Sbjct  758  HSETGLASGSSDLTLLQRVSICSDIAEGMAYLHHHSPVKVIHCDLKPSNVLLNDDMTALV  817

Query  350  SDFGISKLVMTTT-GSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVL  526
            SDFGI++LVMT   G+G A + +GNSTAN+LCGS+GYIAPEYGFGS+TSTKGDVYSFGVL
Sbjct  818  SDFGIARLVMTVAGGNGGAVENMGNSTANLLCGSVGYIAPEYGFGSNTSTKGDVYSFGVL  877

Query  527  VLEMVTRKKPTDDTFGRSLSLHQYVKSEQM----EIVDCSLMRALKEQSAEVMKMWEVAI  694
            VLE +TRK+PTDD F   L+LH++VK+         VD SLMRA ++QS EV +MWEVAI
Sbjct  878  VLETLTRKRPTDDMFVDGLNLHKWVKTHYHGRVEREVDSSLMRASRDQSPEVKRMWEVAI  937

Query  695  RELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTLS  859
             EL E+G+LCTQ+ P+TRPT+LDAADDL+RLKRYL+GDTTATFASSL +S STLS
Sbjct  938  GELAELGILCTQESPTTRPTLLDAADDLDRLKRYLSGDTTATFASSLEMSSSTLS  992



>ref|XP_011034574.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 isoform X3 [Populus euphratica]
Length=912

 Score =   421 bits (1082),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 223/294 (76%), Positives = 255/294 (87%), Gaps = 9/294 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL  Q+GNS KSF RECQVL+RIRHRNLIR+ITACSLPDFKALVLPYMANGSLD RLYP
Sbjct  616  KVLQFQSGNSTKSFNRECQVLKRIRHRNLIRIITACSLPDFKALVLPYMANGSLDSRLYP  675

Query  182  HPH----SGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALV  349
            H      SGSSDL+L+QRV+IC DIAEG+AYLHHHSPVKVIHCDLKPSNVLLN+DMTALV
Sbjct  676  HSETDLGSGSSDLTLLQRVSICCDIAEGMAYLHHHSPVKVIHCDLKPSNVLLNDDMTALV  735

Query  350  SDFGISKLVMT-TTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVL  526
            SDFGI++LVMT   G+G   + +GNSTAN+LCGSIGY+APEYGFGS+TSTKGDVYSFGVL
Sbjct  736  SDFGIARLVMTVGGGNGGVVENMGNSTANLLCGSIGYVAPEYGFGSTTSTKGDVYSFGVL  795

Query  527  VLEMVTRKKPTDDTFGRSLSLHQYVKSEQM----EIVDCSLMRALKEQSAEVMKMWEVAI  694
            VLEMVTRK+PTDD F   L+LH++VK+       ++VD  LMRA ++Q  EV +MWEVAI
Sbjct  796  VLEMVTRKRPTDDMFVGGLNLHKWVKTHYHGRLEKVVDPYLMRASRDQFPEVKRMWEVAI  855

Query  695  RELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTL  856
             EL+E+G+LCTQ+ PSTRPTMLDAADDL+RLKRYL+GDTTATFASSLGIS STL
Sbjct  856  GELVELGILCTQESPSTRPTMLDAADDLDRLKRYLSGDTTATFASSLGISSSTL  909



>ref|XP_011034572.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 isoform X1 [Populus euphratica]
Length=996

 Score =   421 bits (1083),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 223/294 (76%), Positives = 255/294 (87%), Gaps = 9/294 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL  Q+GNS KSF RECQVL+RIRHRNLIR+ITACSLPDFKALVLPYMANGSLD RLYP
Sbjct  700  KVLQFQSGNSTKSFNRECQVLKRIRHRNLIRIITACSLPDFKALVLPYMANGSLDSRLYP  759

Query  182  HPH----SGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALV  349
            H      SGSSDL+L+QRV+IC DIAEG+AYLHHHSPVKVIHCDLKPSNVLLN+DMTALV
Sbjct  760  HSETDLGSGSSDLTLLQRVSICCDIAEGMAYLHHHSPVKVIHCDLKPSNVLLNDDMTALV  819

Query  350  SDFGISKLVMT-TTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVL  526
            SDFGI++LVMT   G+G   + +GNSTAN+LCGSIGY+APEYGFGS+TSTKGDVYSFGVL
Sbjct  820  SDFGIARLVMTVGGGNGGVVENMGNSTANLLCGSIGYVAPEYGFGSTTSTKGDVYSFGVL  879

Query  527  VLEMVTRKKPTDDTFGRSLSLHQYVKSEQM----EIVDCSLMRALKEQSAEVMKMWEVAI  694
            VLEMVTRK+PTDD F   L+LH++VK+       ++VD  LMRA ++Q  EV +MWEVAI
Sbjct  880  VLEMVTRKRPTDDMFVGGLNLHKWVKTHYHGRLEKVVDPYLMRASRDQFPEVKRMWEVAI  939

Query  695  RELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTL  856
             EL+E+G+LCTQ+ PSTRPTMLDAADDL+RLKRYL+GDTTATFASSLGIS STL
Sbjct  940  GELVELGILCTQESPSTRPTMLDAADDLDRLKRYLSGDTTATFASSLGISSSTL  993



>ref|XP_011034573.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 isoform X2 [Populus euphratica]
Length=961

 Score =   421 bits (1081),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 223/294 (76%), Positives = 255/294 (87%), Gaps = 9/294 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL  Q+GNS KSF RECQVL+RIRHRNLIR+ITACSLPDFKALVLPYMANGSLD RLYP
Sbjct  665  KVLQFQSGNSTKSFNRECQVLKRIRHRNLIRIITACSLPDFKALVLPYMANGSLDSRLYP  724

Query  182  HPH----SGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALV  349
            H      SGSSDL+L+QRV+IC DIAEG+AYLHHHSPVKVIHCDLKPSNVLLN+DMTALV
Sbjct  725  HSETDLGSGSSDLTLLQRVSICCDIAEGMAYLHHHSPVKVIHCDLKPSNVLLNDDMTALV  784

Query  350  SDFGISKLVMT-TTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVL  526
            SDFGI++LVMT   G+G   + +GNSTAN+LCGSIGY+APEYGFGS+TSTKGDVYSFGVL
Sbjct  785  SDFGIARLVMTVGGGNGGVVENMGNSTANLLCGSIGYVAPEYGFGSTTSTKGDVYSFGVL  844

Query  527  VLEMVTRKKPTDDTFGRSLSLHQYVKSEQM----EIVDCSLMRALKEQSAEVMKMWEVAI  694
            VLEMVTRK+PTDD F   L+LH++VK+       ++VD  LMRA ++Q  EV +MWEVAI
Sbjct  845  VLEMVTRKRPTDDMFVGGLNLHKWVKTHYHGRLEKVVDPYLMRASRDQFPEVKRMWEVAI  904

Query  695  RELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTL  856
             EL+E+G+LCTQ+ PSTRPTMLDAADDL+RLKRYL+GDTTATFASSLGIS STL
Sbjct  905  GELVELGILCTQESPSTRPTMLDAADDLDRLKRYLSGDTTATFASSLGISSSTL  958



>ref|XP_003632918.2| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Vitis vinifera]
Length=1024

 Score =   420 bits (1080),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 225/294 (77%), Positives = 256/294 (87%), Gaps = 10/294 (3%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
             KVL +QTGNS KSF RECQVL+RIRHRNLIR+ITACSLPDFKALVLP+MANGSLD RLYP
Sbjct  723   KVLQLQTGNSTKSFNRECQVLKRIRHRNLIRIITACSLPDFKALVLPFMANGSLDSRLYP  782

Query  182   HPH----SGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALV  349
             H      SGSSDLSL+QRVNICSDIAEG+AYLHHHSPV+VIHCDLKPSNVLLN++MTALV
Sbjct  783   HSETGLGSGSSDLSLIQRVNICSDIAEGMAYLHHHSPVRVIHCDLKPSNVLLNDEMTALV  842

Query  350   SDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLV  529
             SDFGIS+LV +T G+    + +GNSTANMLCGSIGYIAPEYG+G++T+TKGDVYSFG+LV
Sbjct  843   SDFGISRLV-STVGNAGGVEHMGNSTANMLCGSIGYIAPEYGYGANTTTKGDVYSFGILV  901

Query  530   LEMVTRKKPTDDTFGRSLSLHQYVKSE---QME-IVDCSLMRALKEQSAEVMKMWEVAIR  697
             LEMVTRK+PTDD F   L+LH++VKS    +ME +VD SL+RA   Q  EV KMW+VAI 
Sbjct  902   LEMVTRKRPTDDMFVGGLNLHRWVKSHYHGRMERVVDSSLLRASTAQPPEVKKMWQVAIG  961

Query  698   ELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGD-TTATFASSLGISCSTL  856
             ELIE+G+LCTQ+  STRPTMLDAADDL+RLKRYLTGD TTATFASSLGIS STL
Sbjct  962   ELIELGILCTQESSSTRPTMLDAADDLDRLKRYLTGDSTTATFASSLGISSSTL  1015



>ref|XP_011020583.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Populus euphratica]
Length=994

 Score =   417 bits (1073),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 218/295 (74%), Positives = 254/295 (86%), Gaps = 9/295 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL +Q+GN+ +SF RECQVL+RIRHRNLIR+ITACSLPDFKALVLPYMANGSLD RLYP
Sbjct  698  KVLQLQSGNATESFNRECQVLKRIRHRNLIRIITACSLPDFKALVLPYMANGSLDSRLYP  757

Query  182  HPH----SGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALV  349
            H      SGSSDL+L+QRV+ICSDIAEG+AYLHHHSPVKVIHCDLKPSNVLLN+DMTALV
Sbjct  758  HSETGLASGSSDLTLLQRVSICSDIAEGMAYLHHHSPVKVIHCDLKPSNVLLNDDMTALV  817

Query  350  SDFGISKLVMTTT-GSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVL  526
            SDFGI++LVMT   G+G A   +G STAN+LCGS+GYIAPEYGFGS+TSTKGDVYSFGVL
Sbjct  818  SDFGIARLVMTVAGGNGGAVDNMGKSTANLLCGSVGYIAPEYGFGSNTSTKGDVYSFGVL  877

Query  527  VLEMVTRKKPTDDTFGRSLSLHQYVKSEQM----EIVDCSLMRALKEQSAEVMKMWEVAI  694
            VLE++TRK+PTDD F   L+LH++VK+         VD SLMRA ++ S EV +MWEVA+
Sbjct  878  VLEILTRKRPTDDMFVDGLNLHKWVKTHYHGRVERAVDSSLMRASRDHSPEVKRMWEVAV  937

Query  695  RELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTLS  859
             EL E+G+LCTQ+ P+TRPTMLDAADDL+RLKRYL+GDTTATFASSL +S STLS
Sbjct  938  GELAELGILCTQEPPTTRPTMLDAADDLDRLKRYLSGDTTATFASSLEMSSSTLS  992



>ref|XP_008342819.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Malus domestica]
Length=1004

 Score =   415 bits (1067),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 224/294 (76%), Positives = 253/294 (86%), Gaps = 11/294 (4%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
             KVL +Q+GNS KSF RECQVLRRIRHRNLIR+ITACSLPDFKA+VLPYMANGSL+  LY 
Sbjct  710   KVLQLQSGNSTKSFTRECQVLRRIRHRNLIRIITACSLPDFKAIVLPYMANGSLESCLYQ  769

Query  182   HP----HSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALV  349
             H      SGSSDLSL+QRVNICSDIAEG+AYLHHHSPVKVIHCDLKPSNVLLN DMTALV
Sbjct  770   HSKTGLRSGSSDLSLIQRVNICSDIAEGMAYLHHHSPVKVIHCDLKPSNVLLNNDMTALV  829

Query  350   SDFGISKLVMTTTGSGN-ADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVL  526
             SDFGI++L++   G GN A + +GNSTANML GSIGYIAPEYG+GS+ STKGDVYSFGVL
Sbjct  830   SDFGIARLLIA--GGGNSALENMGNSTANMLFGSIGYIAPEYGYGSNASTKGDVYSFGVL  887

Query  527   VLEMVTRKKPTDDTFGRSLSLHQYVKSE----QMEIVDCSLMRALKEQSAEVMKMWEVAI  694
             VLEMVTRK+PTDD F   L+LH++VK+       ++VD SLMRA ++QSAEV KMW+VAI
Sbjct  888   VLEMVTRKRPTDDMFVGGLNLHRWVKNHCHGRVEKVVDFSLMRASRDQSAEVRKMWDVAI  947

Query  695   RELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTL  856
              ELIE+G+LCTQ+ PSTRPTMLDAADDL+RLKRYL GDTTATFA SLGIS STL
Sbjct  948   GELIELGILCTQESPSTRPTMLDAADDLDRLKRYLCGDTTATFAPSLGISSSTL  1001



>ref|XP_009354218.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Pyrus x bretschneideri]
Length=1004

 Score =   414 bits (1065),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 224/294 (76%), Positives = 253/294 (86%), Gaps = 11/294 (4%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
             KVL +Q+GNS KSF RECQVLRRIRHRNLIR+ITACSLPDFKA+VLPYMANGSL+  LY 
Sbjct  710   KVLQLQSGNSTKSFNRECQVLRRIRHRNLIRIITACSLPDFKAIVLPYMANGSLESCLYQ  769

Query  182   HP----HSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALV  349
             H      SGSSDLSL+QRVNICSDIAEG+AYLHHHSPVKVIHCDLKPSNVLLN+DMTALV
Sbjct  770   HSKTGLRSGSSDLSLIQRVNICSDIAEGMAYLHHHSPVKVIHCDLKPSNVLLNDDMTALV  829

Query  350   SDFGISKLVMTTTGSGN-ADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVL  526
             SDFGI++L++   G GN A + +GNSTANML GSIGYIAPEYG+GS+ STKGDVYSFGVL
Sbjct  830   SDFGIARLLIA--GGGNSALENMGNSTANMLFGSIGYIAPEYGYGSNASTKGDVYSFGVL  887

Query  527   VLEMVTRKKPTDDTFGRSLSLHQYVKSEQM----EIVDCSLMRALKEQSAEVMKMWEVAI  694
             VLEMVTRK PTDD F   L+LH++VK+       ++VD SLMRA K+QSAEV KMW+VAI
Sbjct  888   VLEMVTRKTPTDDMFVGGLNLHRWVKNHYHGRVEKVVDFSLMRASKDQSAEVRKMWDVAI  947

Query  695   RELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTL  856
              ELIE+G+LCTQ+ PSTRPTMLDAADDL+RLKRYL GDTTATFAS+LGIS  TL
Sbjct  948   GELIELGILCTQESPSTRPTMLDAADDLDRLKRYLCGDTTATFASTLGISSPTL  1001



>ref|XP_010063604.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Eucalyptus grandis]
Length=999

 Score =   413 bits (1062),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 215/295 (73%), Positives = 252/295 (85%), Gaps = 11/295 (4%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL +Q+GNS KSF RECQVL+RIRHRNLI++ITACSLPDFKA+VLPYMANG+LD  LY 
Sbjct  702  KVLHVQSGNSTKSFNRECQVLKRIRHRNLIKIITACSLPDFKAIVLPYMANGNLDSHLYL  761

Query  182  HPHSG----SSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALV  349
            H  +G    SSDL+L+QRVNICSD+AEG+AYLHHHSPV+V+HCDLKPSNVLLN+DMTALV
Sbjct  762  HSGTGLSSRSSDLTLIQRVNICSDVAEGMAYLHHHSPVRVVHCDLKPSNVLLNDDMTALV  821

Query  350  SDFGISKLVMTTTGSGNAD--QKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGV  523
            SDFGI++L+M+  G GNA   + +GNSTANMLCGSIGYIAPEYG+G +TSTKGDVYSFGV
Sbjct  822  SDFGIARLIMSN-GGGNAGLVENMGNSTANMLCGSIGYIAPEYGYGLNTSTKGDVYSFGV  880

Query  524  LVLEMVTRKKPTDDTFGRSLSLHQYVK----SEQMEIVDCSLMRALKEQSAEVMKMWEVA  691
            LVLEMVTR++PTDDTF   L+LH++VK         ++D SL+RA ++QS EV KMWEVA
Sbjct  881  LVLEMVTRRRPTDDTFVGGLNLHKWVKVHYHGRAEMVIDSSLLRASRDQSPEVQKMWEVA  940

Query  692  IRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTL  856
            I ELIE+G+LCTQ+ PS RPTMLDAADDL+RLKRYL GD TATFASSLGIS ST 
Sbjct  941  IAELIELGILCTQESPSMRPTMLDAADDLDRLKRYLNGDATATFASSLGISSSTF  995



>ref|XP_006595194.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130-like isoform X2 [Glycine 
max]
Length=951

 Score =   412 bits (1059),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 215/294 (73%), Positives = 250/294 (85%), Gaps = 9/294 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL +Q+GNS KSF RECQVL+RIRHRNLIR+ITACSLPDFKALVLPYMANGSL+ RLYP
Sbjct  663  KVLHLQSGNSTKSFNRECQVLKRIRHRNLIRIITACSLPDFKALVLPYMANGSLESRLYP  722

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
                GSSDLS++QRVNICSD+AEG+AYLHHHSPV+VIHCDLKPSN+LLN+DMTALVSDFG
Sbjct  723  S--CGSSDLSIVQRVNICSDVAEGMAYLHHHSPVRVIHCDLKPSNILLNDDMTALVSDFG  780

Query  362  ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
            +++L+M+    G A   +GNS+AN+ CGSIGYIAPEYGFGS+TSTKGDVYSFG+LVLEMV
Sbjct  781  VARLIMSV--GGGAIDNMGNSSANLFCGSIGYIAPEYGFGSNTSTKGDVYSFGILVLEMV  838

Query  542  TRKKPTDDTFGRSLSLHQYVK----SEQMEIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
            TR++PTDD F   LSLHQ+VK        +++D +L+ A  +QS EV KMWE AI ELIE
Sbjct  839  TRRRPTDDMFVGGLSLHQWVKIHFHGRVEKVIDSALVTASIDQSREVRKMWEAAIVELIE  898

Query  710  VGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTLSIG*W  871
            +G+LCTQ+ PSTRPTMLDAADDLNRLKRYL GDTT TFASSLGIS ST+  G W
Sbjct  899  LGLLCTQESPSTRPTMLDAADDLNRLKRYLNGDTTGTFASSLGISSSTVG-GDW  951



>ref|XP_006595193.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130-like isoform X1 [Glycine 
max]
 gb|KHN31871.1| Putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Glycine soja]
Length=986

 Score =   412 bits (1059),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 215/294 (73%), Positives = 250/294 (85%), Gaps = 9/294 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL +Q+GNS KSF RECQVL+RIRHRNLIR+ITACSLPDFKALVLPYMANGSL+ RLYP
Sbjct  698  KVLHLQSGNSTKSFNRECQVLKRIRHRNLIRIITACSLPDFKALVLPYMANGSLESRLYP  757

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
                GSSDLS++QRVNICSD+AEG+AYLHHHSPV+VIHCDLKPSN+LLN+DMTALVSDFG
Sbjct  758  S--CGSSDLSIVQRVNICSDVAEGMAYLHHHSPVRVIHCDLKPSNILLNDDMTALVSDFG  815

Query  362  ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
            +++L+M+    G A   +GNS+AN+ CGSIGYIAPEYGFGS+TSTKGDVYSFG+LVLEMV
Sbjct  816  VARLIMSV--GGGAIDNMGNSSANLFCGSIGYIAPEYGFGSNTSTKGDVYSFGILVLEMV  873

Query  542  TRKKPTDDTFGRSLSLHQYVK----SEQMEIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
            TR++PTDD F   LSLHQ+VK        +++D +L+ A  +QS EV KMWE AI ELIE
Sbjct  874  TRRRPTDDMFVGGLSLHQWVKIHFHGRVEKVIDSALVTASIDQSREVRKMWEAAIVELIE  933

Query  710  VGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTLSIG*W  871
            +G+LCTQ+ PSTRPTMLDAADDLNRLKRYL GDTT TFASSLGIS ST+  G W
Sbjct  934  LGLLCTQESPSTRPTMLDAADDLNRLKRYLNGDTTGTFASSLGISSSTVG-GDW  986



>ref|XP_010094066.1| Putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
 gb|EXB55156.1| Putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
Length=1004

 Score =   412 bits (1058),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 224/295 (76%), Positives = 248/295 (84%), Gaps = 11/295 (4%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
             KVL +Q+GNS KSF RECQVL+RIRHRNLIR+ITACSLPDFKALVLPYMANGSLD  LYP
Sbjct  708   KVLHVQSGNSTKSFNRECQVLKRIRHRNLIRIITACSLPDFKALVLPYMANGSLDSCLYP  767

Query  182   HPHSGSSDLSLM----QRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALV  349
             H  +     S      QRVNICSDIAEG+AYLHHHSPV+VIHCDLKPSNVLLN+DMTALV
Sbjct  768   HSGTSLGSGSSDLSLLQRVNICSDIAEGMAYLHHHSPVRVIHCDLKPSNVLLNDDMTALV  827

Query  350   SDFGISKLVMTTTGSGNAD--QKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGV  523
             SDFGI++LVMT  G GNA   + LGNSTANML GSIGYIAPEYGFG +TSTKGDVYSFG+
Sbjct  828   SDFGIARLVMTAAG-GNAAAIENLGNSTANMLAGSIGYIAPEYGFGLNTSTKGDVYSFGI  886

Query  524   LVLEMVTRKKPTDDTFGRSLSLHQYVKSEQM----EIVDCSLMRALKEQSAEVMKMWEVA  691
             LVLEMVTRK+PTDD F   LSLH++VKS       ++VD SL+RA K+QS EV KMWEVA
Sbjct  887   LVLEMVTRKRPTDDMFVGGLSLHKWVKSHYHGRVEKVVDSSLLRAAKDQSPEVKKMWEVA  946

Query  692   IRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTL  856
               ELIE+G+LCTQ+ PSTRPTMLDAADDL+RLKRYL GDTTATFASSLGIS STL
Sbjct  947   TGELIELGLLCTQESPSTRPTMLDAADDLDRLKRYLFGDTTATFASSLGISSSTL  1001



>ref|XP_007217299.1| hypothetical protein PRUPE_ppa018475mg [Prunus persica]
 gb|EMJ18498.1| hypothetical protein PRUPE_ppa018475mg [Prunus persica]
Length=990

 Score =   410 bits (1053),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 217/293 (74%), Positives = 251/293 (86%), Gaps = 9/293 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL +Q+GNS KSF RECQ+LRRIRHRNLIR+ITACSLPDFKA+VLPYMANGSLD RLYP
Sbjct  696  KVLHLQSGNSTKSFTRECQILRRIRHRNLIRIITACSLPDFKAIVLPYMANGSLDSRLYP  755

Query  182  HPHSGSSDLSL----MQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALV  349
            H  +G S  S     +QR+NICSDIAEG+AYLHHHSPV+VIHCDLKPSNVLLN+DMTALV
Sbjct  756  HSQTGLSSGSSDLSLIQRLNICSDIAEGMAYLHHHSPVRVIHCDLKPSNVLLNDDMTALV  815

Query  350  SDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLV  529
            SDFGI++L++   G+ +A + +GNSTANMLCGSIGYIAPEYGFGS+ STKGDVYSFG+LV
Sbjct  816  SDFGIARLLIAG-GANSALENMGNSTANMLCGSIGYIAPEYGFGSNASTKGDVYSFGILV  874

Query  530  LEMVTRKKPTDDTFGRSLSLHQYVKSEQM----EIVDCSLMRALKEQSAEVMKMWEVAIR  697
            LEMVTRK+PTDD F   LSLH++VK+       ++VD SLMRA ++Q  EV KMW+VAI 
Sbjct  875  LEMVTRKRPTDDMFVGGLSLHKWVKNHYHGRVEKVVDSSLMRAFRDQPPEVKKMWDVAIG  934

Query  698  ELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTL  856
            ELIE+G+LCTQ+  STRPTMLDAADDL+RLKRYL GDTTATFASSLGIS STL
Sbjct  935  ELIELGILCTQESSSTRPTMLDAADDLDRLKRYLCGDTTATFASSLGISSSTL  987



>ref|NP_001168251.1| uncharacterized protein LOC100382014 [Zea mays]
 gb|ACN27596.1| unknown [Zea mays]
Length=526

 Score =   389 bits (1000),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 204/291 (70%), Positives = 244/291 (84%), Gaps = 8/291 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL +QTGNS KSF RECQVL+RIRHRNL+R++TACSLPDFKALVLP+MANGSL+R LY 
Sbjct  236  KVLQLQTGNSTKSFNRECQVLKRIRHRNLMRIVTACSLPDFKALVLPFMANGSLERCLYA  295

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
             P    ++LSL+QRVNICSDIAEG+AYLHHHSPVKVIHCDLKPSNVL+N+DMTALVSDFG
Sbjct  296  GP---PAELSLVQRVNICSDIAEGMAYLHHHSPVKVIHCDLKPSNVLINDDMTALVSDFG  352

Query  362  ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
            IS+LVM+  G  N    +G STANMLCGSIGYI PEYG+GS+ +TKGD YSFGVLVLEMV
Sbjct  353  ISRLVMSIGGVANT-ADVGASTANMLCGSIGYIPPEYGYGSNPTTKGDAYSFGVLVLEMV  411

Query  542  TRKKPTDDTFGRSLSLHQYVKSEQM----EIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
            TR+KPTDD F   LSLH++VK+        +VD +L+R +++Q+ EV +M +VAI EL+E
Sbjct  412  TRRKPTDDMFDAGLSLHKWVKTHYHGRADAVVDQALVRMVRDQTPEVRRMSDVAIGELLE  471

Query  710  VGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTLSI  862
            +G+LCTQ+  S RPTM+DAADDL+RLKRYL GDTTATFASSLG S +TL +
Sbjct  472  LGILCTQEQSSARPTMMDAADDLDRLKRYLGGDTTATFASSLGFSSTTLEV  522



>ref|XP_008465122.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Cucumis melo]
Length=1026

 Score =   403 bits (1036),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 215/294 (73%), Positives = 245/294 (83%), Gaps = 9/294 (3%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
             KVL  Q+GNS KSF REC+VL+RIRHRNLIR+ITACSLPDFKA+VLPYMANGSLD  LYP
Sbjct  717   KVLHTQSGNSTKSFNRECEVLKRIRHRNLIRIITACSLPDFKAIVLPYMANGSLDNHLYP  776

Query  182   HPHSGSS----DLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALV  349
             H  + S+    DL+L++RVNICSDIAEG+AYLHHHSPV+VIHCDLKPSNVLL +DMTALV
Sbjct  777   HSPTSSTSGSSDLNLIERVNICSDIAEGMAYLHHHSPVRVIHCDLKPSNVLLKDDMTALV  836

Query  350   SDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLV  529
             SDFGISKL+    GS    + +G STANML GSIGYIAPEYGFGS+ S KGDVYSFGVLV
Sbjct  837   SDFGISKLMTPGIGSSATVENMGKSTANMLSGSIGYIAPEYGFGSTASMKGDVYSFGVLV  896

Query  530   LEMVTRKKPTDDTFGRSLSLHQYVKSEQM----EIVDCSLMRALKEQSAEVMKMWEVAIR  697
             LEMVTRK+P DD F   LSLH++VKS       ++VD SL RA +++S E+ KMWEVAIR
Sbjct  897   LEMVTRKRPIDDMFAEGLSLHKWVKSHYYGRVEKVVDYSLQRASRDESPEMKKMWEVAIR  956

Query  698   ELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLT-GDTTATFASSLGISCSTL  856
             ELIE+G+LCTQ+ PSTRPTMLDAADDL+RLKRYL  GDTT TFASSLGIS STL
Sbjct  957   ELIELGLLCTQESPSTRPTMLDAADDLDRLKRYLNGGDTTTTFASSLGISSSTL  1010



>gb|KDO55361.1| hypothetical protein CISIN_1g002746mg [Citrus sinensis]
Length=885

 Score =   398 bits (1023),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 203/274 (74%), Positives = 237/274 (86%), Gaps = 8/274 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL +Q+GN  KSF RECQVL+RIRHRNL+R+ITACSLPDFKALVLPYMANGSLD  LYP
Sbjct  587  KVLQLQSGNFTKSFNRECQVLKRIRHRNLMRIITACSLPDFKALVLPYMANGSLDSHLYP  646

Query  182  HPH----SGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALV  349
            H      SGSSDL+L+QRVNICSDIAEG+AYLHHHSPV+VIHCDLKPSNVLLN+DMTALV
Sbjct  647  HSETEFGSGSSDLTLLQRVNICSDIAEGMAYLHHHSPVRVIHCDLKPSNVLLNDDMTALV  706

Query  350  SDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLV  529
            SDFGI+KLVMT     +  + +GNSTANMLCGSIGY+APEYGFGS+TSTKGDVYSFG+LV
Sbjct  707  SDFGIAKLVMTVGVGNDGAENMGNSTANMLCGSIGYMAPEYGFGSNTSTKGDVYSFGILV  766

Query  530  LEMVTRKKPTDDTFGRSLSLHQYVKSEQM----EIVDCSLMRALKEQSAEVMKMWEVAIR  697
            LEMVTR++PTDD F   LSLH++VK+       +++D SL+RA ++QS EV +MW+VAI 
Sbjct  767  LEMVTRRRPTDDMFAGGLSLHKWVKNHYHGRLEKVIDSSLLRASRDQSPEVKRMWDVAIG  826

Query  698  ELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYL  799
            ELIE+G+LCTQ+ PSTRPTMLDAADDL+RLKRYL
Sbjct  827  ELIELGILCTQESPSTRPTMLDAADDLDRLKRYL  860



>ref|XP_010273774.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Nelumbo nucifera]
Length=992

 Score =   401 bits (1030),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 221/294 (75%), Positives = 251/294 (85%), Gaps = 9/294 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL +Q+GNS KSF RECQVL+RIRHRNL+R+ITACSLPDFKALVLPYMANGSL+  LYP
Sbjct  695  KVLQLQSGNSTKSFDRECQVLKRIRHRNLMRIITACSLPDFKALVLPYMANGSLESHLYP  754

Query  182  HPH----SGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALV  349
            H      SGSSDLSL+QRVNICSDIAEG+AYLHHHSPV+VIHCDLKPSNVLLNEDMTALV
Sbjct  755  HQEIGLRSGSSDLSLIQRVNICSDIAEGMAYLHHHSPVRVIHCDLKPSNVLLNEDMTALV  814

Query  350  SDFGISKL-VMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVL  526
            SDFGI++L      G+G     +GNST NML GS+GYIAPEYGFGSSTSTKGDVYSFG+L
Sbjct  815  SDFGIARLVNTVGGGNGGIVDNMGNSTTNMLSGSVGYIAPEYGFGSSTSTKGDVYSFGIL  874

Query  527  VLEMVTRKKPTDDTFGRSLSLHQYVKSEQ----MEIVDCSLMRALKEQSAEVMKMWEVAI  694
            VLEMVTRKKPTDD F   LSLH++VKS        ++D SLMRA +++S EV KMWEVAI
Sbjct  875  VLEMVTRKKPTDDMFVGGLSLHKWVKSHYNGRVERVIDPSLMRAARDESPEVKKMWEVAI  934

Query  695  RELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTL  856
             EL+E+G+LCTQ+ PSTRPTMLDAAD+L+RLKRYL+GDTTATFASSLGIS ST+
Sbjct  935  GELLELGLLCTQEAPSTRPTMLDAADNLDRLKRYLSGDTTATFASSLGISSSTI  988



>ref|XP_007023495.1| Serine-threonine protein kinase, plant-type, putative [Theobroma 
cacao]
 gb|EOY26117.1| Serine-threonine protein kinase, plant-type, putative [Theobroma 
cacao]
Length=988

 Score =   399 bits (1026),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 217/297 (73%), Positives = 248/297 (84%), Gaps = 12/297 (4%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL +QTGNS KSF RECQVL+RIRHRNLIR+ITACSLPDFKALVLPYMANGSL+ RLYP
Sbjct  691  KVLHLQTGNSTKSFNRECQVLKRIRHRNLIRIITACSLPDFKALVLPYMANGSLESRLYP  750

Query  182  HPHSGSSDLSL----MQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALV  349
            H  SG    S     +QRV+ICSDIAEG+AYLHHHSPV+VIHCDLKPSNVLLN+DMTALV
Sbjct  751  HSESGLGSGSSDLSLIQRVSICSDIAEGMAYLHHHSPVRVIHCDLKPSNVLLNDDMTALV  810

Query  350  SDFGISKLVMTTTGSGNAD---QKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFG  520
            SDFGI++LVM T G+GN     + +G STANML GSIGYIAPEYGFG +TS +GDVYSFG
Sbjct  811  SDFGIARLVM-TVGAGNGAGTVENMGTSTANMLDGSIGYIAPEYGFGCNTSIRGDVYSFG  869

Query  521  VLVLEMVTRKKPTDDTFGRSLSLHQYVKSEQ----MEIVDCSLMRALKEQSAEVMKMWEV  688
            VLVLEMVTRK+PTD+ F   L+LH++VKS       ++VD SL+RA ++QS EV +MWEV
Sbjct  870  VLVLEMVTRKRPTDEMFVGGLNLHRWVKSHYPGRVEKVVDLSLIRASRDQSPEVTRMWEV  929

Query  689  AIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTLS  859
            AI ELIE+G+LCTQ+ P TRPTMLD ADDL+RLKRYL GDTT TFASSLGIS STLS
Sbjct  930  AIAELIELGILCTQETPFTRPTMLDVADDLDRLKRYLNGDTTVTFASSLGISSSTLS  986



>gb|KCW70840.1| hypothetical protein EUGRSUZ_F03981, partial [Eucalyptus grandis]
Length=973

 Score =   398 bits (1023),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 206/284 (73%), Positives = 243/284 (86%), Gaps = 11/284 (4%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL +Q+GNS KSF RECQVL+RIRHRNLI++ITACSLPDFKA+VLPYMANG+LD  LY 
Sbjct  691  KVLHVQSGNSTKSFNRECQVLKRIRHRNLIKIITACSLPDFKAIVLPYMANGNLDSHLYL  750

Query  182  HPHSG----SSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALV  349
            H  +G    SSDL+L+QRVNICSD+AEG+AYLHHHSPV+V+HCDLKPSNVLLN+DMTALV
Sbjct  751  HSGTGLSSRSSDLTLIQRVNICSDVAEGMAYLHHHSPVRVVHCDLKPSNVLLNDDMTALV  810

Query  350  SDFGISKLVMTTTGSGNAD--QKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGV  523
            SDFGI++L+M + G GNA   + +GNSTANMLCGSIGYIAPEYG+G +TSTKGDVYSFGV
Sbjct  811  SDFGIARLIM-SNGGGNAGLVENMGNSTANMLCGSIGYIAPEYGYGLNTSTKGDVYSFGV  869

Query  524  LVLEMVTRKKPTDDTFGRSLSLHQYVK----SEQMEIVDCSLMRALKEQSAEVMKMWEVA  691
            LVLEMVTR++PTDDTF   L+LH++VK         ++D SL+RA ++QS EV KMWEVA
Sbjct  870  LVLEMVTRRRPTDDTFVGGLNLHKWVKVHYHGRAEMVIDSSLLRASRDQSPEVQKMWEVA  929

Query  692  IRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATF  823
            I ELIE+G+LCTQ+ PS RPTMLDAADDL+RLKRYL GD TATF
Sbjct  930  IAELIELGILCTQESPSMRPTMLDAADDLDRLKRYLNGDATATF  973



>dbj|BAK07386.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=371

 Score =   378 bits (970),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 202/289 (70%), Positives = 239/289 (83%), Gaps = 8/289 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL +Q+GNS KSF RECQVL+RIRHRNL+R+ITACSL DFKALVLP+MA GSL+R LY 
Sbjct  82   KVLQLQSGNSTKSFSRECQVLKRIRHRNLMRIITACSLADFKALVLPFMAKGSLERCLYA  141

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
             P    S+LSL+QRVNICSDIAEG+AYLHHHSPVKVIHCDLKPSNVL+N+DMTALVSDFG
Sbjct  142  GP---PSELSLVQRVNICSDIAEGVAYLHHHSPVKVIHCDLKPSNVLINDDMTALVSDFG  198

Query  362  ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
            IS+LVM+  G  NA   +G STANMLCGSIGYI PEYG+GS+ +TKGDVYSFGVLV+EMV
Sbjct  199  ISRLVMSIGGVANA-ADVGASTANMLCGSIGYIPPEYGYGSNPTTKGDVYSFGVLVMEMV  257

Query  542  TRKKPTDDTFGRSLSLHQYVKSEQM----EIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
            TRKKPTD+ F   LSLH++VKS        +VD +L R + +Q+ EV +M + AI EL+E
Sbjct  258  TRKKPTDEMFEAGLSLHKWVKSHYHGRADAVVDQALARMVLDQTPEVRRMSDAAIGELLE  317

Query  710  VGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTL  856
            +G+LCTQ+  STRP+MLDAADDL+RLKRYL GDTTATF SSLG S + +
Sbjct  318  LGILCTQESASTRPSMLDAADDLDRLKRYLGGDTTATFESSLGFSSTVV  366



>gb|EYU21747.1| hypothetical protein MIMGU_mgv1a026510mg [Erythranthe guttata]
Length=964

 Score =   394 bits (1012),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 218/295 (74%), Positives = 251/295 (85%), Gaps = 9/295 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL  QTGNS KSF RECQVL+RIRHRNLIR+ITACSLP FKALVLPYM+NG+LD RLYP
Sbjct  668  KVLQFQTGNSTKSFNRECQVLKRIRHRNLIRIITACSLPGFKALVLPYMSNGNLDARLYP  727

Query  182  HP-----HSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTAL  346
            H       +GSSDL+L+QRVNICSD+AEG+AYLHHHSPVKVIHCDLKPSNVLLN+DMTAL
Sbjct  728  HSVDDNLRTGSSDLNLVQRVNICSDVAEGMAYLHHHSPVKVIHCDLKPSNVLLNDDMTAL  787

Query  347  VSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVL  526
            VSDFGIS+L+MT   +G   +  GNSTANMLCGSIGYIAPEYG GSS+STKGDVYSFG+L
Sbjct  788  VSDFGISRLIMTVESNGGVIENTGNSTANMLCGSIGYIAPEYGSGSSSSTKGDVYSFGIL  847

Query  527  VLEMVTRKKPTDDTFGRSLSLHQYVKSE---QME-IVDCSLMRALKEQSAEVMKMWEVAI  694
            VLEMVTRK+PTDD F   L+LH+YVK+    Q E  +D SL+R+L++Q+ EV KMWEVAI
Sbjct  848  VLEMVTRKRPTDDMFVNGLNLHKYVKNHYHMQTEGTLDNSLIRSLRDQTPEVRKMWEVAI  907

Query  695  RELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTLS  859
             EL+E+G+ CTQD PS RPTMLD ADDL+RLK+YL+GD TATF+SSLGIS ST S
Sbjct  908  GELVELGIFCTQDSPSMRPTMLDCADDLDRLKKYLSGDATATFSSSLGISSSTFS  962



>tpg|DAA40097.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=822

 Score =   390 bits (1002),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 204/291 (70%), Positives = 244/291 (84%), Gaps = 8/291 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL +QTGNS KSF RECQVL+RIRHRNL+R++TACSLPDFKALVLP+MANGSL+R LY 
Sbjct  532  KVLQLQTGNSTKSFNRECQVLKRIRHRNLMRIVTACSLPDFKALVLPFMANGSLERCLYA  591

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
             P    ++LSL+QRVNICSDIAEG+AYLHHHSPVKVIHCDLKPSNVL+N+DMTALVSDFG
Sbjct  592  GP---PAELSLVQRVNICSDIAEGMAYLHHHSPVKVIHCDLKPSNVLINDDMTALVSDFG  648

Query  362  ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
            IS+LVM+  G  N    +G STANMLCGSIGYI PEYG+GS+ +TKGD YSFGVLVLEMV
Sbjct  649  ISRLVMSIGGVANT-ADVGASTANMLCGSIGYIPPEYGYGSNPTTKGDAYSFGVLVLEMV  707

Query  542  TRKKPTDDTFGRSLSLHQYVKSEQM----EIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
            TR+KPTDD F   LSLH++VK+        +VD +L+R +++Q+ EV +M +VAI EL+E
Sbjct  708  TRRKPTDDMFDAGLSLHKWVKTHYHGRADAVVDQALVRMVRDQTPEVRRMSDVAIGELLE  767

Query  710  VGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTLSI  862
            +G+LCTQ+  S RPTM+DAADDL+RLKRYL GDTTATFASSLG S +TL +
Sbjct  768  LGILCTQEQSSARPTMMDAADDLDRLKRYLGGDTTATFASSLGFSSTTLEV  818



>ref|XP_010929464.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Elaeis guineensis]
Length=1082

 Score =   396 bits (1017),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 212/290 (73%), Positives = 248/290 (86%), Gaps = 11/290 (4%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
             KVL +QTGNS KSF RECQVL+RIRHRNL+R+ITACS PDFKALVLP+MANGSL+  LY 
Sbjct  785   KVLHLQTGNSTKSFNRECQVLKRIRHRNLMRIITACSRPDFKALVLPFMANGSLESFLY-  843

Query  182   HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
                SGSS+LSL+QRVNICSDIAEG+AYLHHHSPVKVIHCDLKPSNVLLN+DMTALVSDFG
Sbjct  844   ---SGSSELSLIQRVNICSDIAEGIAYLHHHSPVKVIHCDLKPSNVLLNDDMTALVSDFG  900

Query  362   ISKLVMTTTGSGNADQK--LGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLE  535
             I++LVM   G+GNA +   +G STANML GSIGYIAPEYGFGS  STKGDVYSFGV+VLE
Sbjct  901   IARLVM-NVGAGNATEADDMGTSTANMLRGSIGYIAPEYGFGSDASTKGDVYSFGVVVLE  959

Query  536   MVTRKKPTDDTFGRSLSLHQYVKSE---QME-IVDCSLMRALKEQSAEVMKMWEVAIREL  703
             MV RK+PTD+ F   LSL  +VKS    +ME ++D SL+ A+K Q+ EV +MWEVAI EL
Sbjct  960   MVARKRPTDEMFKGGLSLPNWVKSHYIGRMETVIDASLVTAVKNQTYEVKRMWEVAIGEL  1019

Query  704   IEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCST  853
             +++G+LCTQ+ PS+RPTMLDAADDL RLKRYL+GDTTA+FA+SLG+S ST
Sbjct  1020  VDLGLLCTQESPSSRPTMLDAADDLGRLKRYLSGDTTASFATSLGMSSST  1069



>ref|XP_008652733.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Zea mays]
 tpg|DAA61531.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1119

 Score =   396 bits (1018),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 207/291 (71%), Positives = 247/291 (85%), Gaps = 8/291 (3%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
             KVL +QTGNS KSF RECQVL+RIRHRNL+R++TACSLPDFKALVLP+MANGSL+R LY 
Sbjct  829   KVLQLQTGNSTKSFNRECQVLKRIRHRNLMRIVTACSLPDFKALVLPFMANGSLERCLYA  888

Query  182   HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
              P    ++LSL+QRVNICSDIAEG+AYLHHHSPVKVIHCDLKPSNVL+N+DMTALVSDFG
Sbjct  889   GP---PAELSLVQRVNICSDIAEGMAYLHHHSPVKVIHCDLKPSNVLINDDMTALVSDFG  945

Query  362   ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
             IS+LVM+  G  NA   +G STANMLCGSIGYI PEYG+GS+T+TKGDVYSFGVLVLEMV
Sbjct  946   ISRLVMSIGGVANA-ADVGASTANMLCGSIGYIPPEYGYGSNTTTKGDVYSFGVLVLEMV  1004

Query  542   TRKKPTDDTFGRSLSLHQYVKSEQM----EIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
             TR+KPTDD F   LSLH++VK+        +VD +L+R +++Q+ EV +M +VAI EL+E
Sbjct  1005  TRRKPTDDMFEAGLSLHKWVKAHYHGRADAVVDQALVRMVRDQTPEVRRMSDVAIGELLE  1064

Query  710   VGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTLSI  862
             +G+LC+QD  S RPTM+DAADDL+RLKRYL GDTTATFASSLG S +TL +
Sbjct  1065  LGILCSQDQASARPTMMDAADDLDRLKRYLGGDTTATFASSLGFSSTTLEV  1115



>ref|XP_007150820.1| hypothetical protein PHAVU_005G183300g [Phaseolus vulgaris]
 gb|ESW22814.1| hypothetical protein PHAVU_005G183300g [Phaseolus vulgaris]
Length=945

 Score =   392 bits (1008),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 206/294 (70%), Positives = 244/294 (83%), Gaps = 8/294 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL +Q+GNS KSF RECQVL+RIRHRNL+R+ITACSLPDFKALVLPYMANGSL+  LYP
Sbjct  656  KVLHLQSGNSTKSFNRECQVLKRIRHRNLMRIITACSLPDFKALVLPYMANGSLESILYP  715

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
               SGSS LS++QRVNICSDIAEG+AYLHHHSPV+VIHCDLKPSN LLN+DMTALVSDFG
Sbjct  716  S--SGSSHLSIVQRVNICSDIAEGMAYLHHHSPVRVIHCDLKPSNCLLNDDMTALVSDFG  773

Query  362  ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
            +++L+M  +  G A   + NS+AN+  GSIGYIAPEYGFGSS+S KGDVYSFG+LVLEMV
Sbjct  774  VARLIM--SAGGGAIDNMANSSANLFFGSIGYIAPEYGFGSSSSIKGDVYSFGILVLEMV  831

Query  542  TRKKPTDDTFGRSLSLHQYVK----SEQMEIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
            TR++P DD F   LSL ++VK        ++VD +L+ A +++S EV K WEVAI ELIE
Sbjct  832  TRRRPIDDMFVGGLSLQKWVKIHFHGRVEKVVDPALVTASRDESQEVRKTWEVAISELIE  891

Query  710  VGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTLSIG*W  871
            +G+LCTQ+ PSTRPTMLDAADDL+RLKRYL GDT  TFASSLGIS ST++ G W
Sbjct  892  LGLLCTQESPSTRPTMLDAADDLDRLKRYLNGDTAGTFASSLGISSSTIAGGDW  945



>ref|XP_002460231.1| hypothetical protein SORBIDRAFT_02g025040 [Sorghum bicolor]
 gb|EER96752.1| hypothetical protein SORBIDRAFT_02g025040 [Sorghum bicolor]
Length=1223

 Score =   395 bits (1014),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 205/291 (70%), Positives = 245/291 (84%), Gaps = 7/291 (2%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
             KVL +QTGNS KSF RECQVL+RIRHRNL+R++TACSLPDFKALVLP+MANGSL+R LY 
Sbjct  932   KVLQLQTGNSTKSFNRECQVLKRIRHRNLMRIVTACSLPDFKALVLPFMANGSLERCLYA  991

Query  182   HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
              P    ++LSL+QRVNICSDIAEG+AYLHHHSPVKVIHCDLKPSNVL+N+DMTALVSDFG
Sbjct  992   GP---PAELSLVQRVNICSDIAEGMAYLHHHSPVKVIHCDLKPSNVLINDDMTALVSDFG  1048

Query  362   ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
             IS+LVM+  G  N    +G STANMLCGSIGYI PEYG+GS+ +TKGDVYSFGVLVLEMV
Sbjct  1049  ISRLVMSIGGVANTAADVGASTANMLCGSIGYIPPEYGYGSNPTTKGDVYSFGVLVLEMV  1108

Query  542   TRKKPTDDTFGRSLSLHQYVKSEQM----EIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
             TR+KPTDD F   LSLH++VK+        +VD +L+R +++Q+ EV +M +VAI EL+E
Sbjct  1109  TRRKPTDDMFDAGLSLHKWVKTHYHGRADAVVDQALVRMVRDQTPEVRRMSDVAIGELLE  1168

Query  710   VGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTLSI  862
             +G+LCTQ+  S RPTM+DAADDL+RLKRYL GDTTATFASSLG S +TL +
Sbjct  1169  LGILCTQEQASARPTMMDAADDLDRLKRYLGGDTTATFASSLGFSSTTLEV  1219



>emb|CDO98245.1| unnamed protein product [Coffea canephora]
Length=905

 Score =   386 bits (992),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 213/292 (73%), Positives = 235/292 (80%), Gaps = 27/292 (9%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL +QTGNS KSF RECQVL+RIRHRNL+R+ITACSLPDFKALVLPYMANGSLD RLYP
Sbjct  632  KVLHLQTGNSTKSFNRECQVLKRIRHRNLMRIITACSLPDFKALVLPYMANGSLDSRLYP  691

Query  182  HPHSGSSDLSLM----QRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALV  349
            HP +G S  S      QR+NICSDIAEG+AYLHHHSPVKVIHCDLKPSNVLLN+DMTALV
Sbjct  692  HPRTGLSSGSSDLSLPQRINICSDIAEGMAYLHHHSPVKVIHCDLKPSNVLLNDDMTALV  751

Query  350  SDFGISKLVMTTTGSGNAD--QKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGV  523
            SDFGI++LVM T G+GNA   + +GNSTAN+L GS+GYIAPEYG G+S STKGDVYSFGV
Sbjct  752  SDFGIARLVM-TIGAGNAGVMENMGNSTANLLRGSVGYIAPEYGLGASASTKGDVYSFGV  810

Query  524  LVLEMVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQSAEVMKMWEVAIREL  703
            +VLEMVTRK+PTDD F   LSLH+YVK                       KM EVAI EL
Sbjct  811  MVLEMVTRKRPTDDMFVGGLSLHRYVK--------------------RFKKMSEVAIGEL  850

Query  704  IEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTLS  859
            IE+G+LCTQD PS RPTMLDAADDLNRLK+YL GDTTATFASSLGIS ST S
Sbjct  851  IELGILCTQDSPSARPTMLDAADDLNRLKKYLGGDTTATFASSLGISSSTFS  902



>ref|XP_004956858.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130-like isoform X2 [Setaria 
italica]
Length=1087

 Score =   390 bits (1001),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 202/289 (70%), Positives = 242/289 (84%), Gaps = 8/289 (3%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
             KVL +QTGNS KSF RECQVL+RIRHRNL+R++TACSLPDFKALVLP+MANGSL+R LY 
Sbjct  799   KVLQLQTGNSTKSFNRECQVLKRIRHRNLMRIVTACSLPDFKALVLPFMANGSLERCLYA  858

Query  182   HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
              P    ++LSL+QRVNICSD+AEG+AYLHHHSPVKVIHCDLKPSN+L+N+DMTALVSDFG
Sbjct  859   GP---PAELSLVQRVNICSDVAEGMAYLHHHSPVKVIHCDLKPSNILINDDMTALVSDFG  915

Query  362   ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
             IS+LVM+  G  N    +G STANMLCGSIGYI PEYG+GS+ +TKGDVYSFGVLVLEMV
Sbjct  916   ISRLVMSIGGVANT-ADVGASTANMLCGSIGYIPPEYGYGSNPTTKGDVYSFGVLVLEMV  974

Query  542   TRKKPTDDTFGRSLSLHQYVK----SEQMEIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
             TR+KPTDD F   LSLH++VK         +VD +L+R +++Q+ EV +M +VAI EL+E
Sbjct  975   TRRKPTDDMFEAGLSLHKWVKIHYHGRADAVVDPALVRMVRDQTPEVRRMSDVAISELLE  1034

Query  710   VGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTL  856
             +G+LCTQ+ PS RPTM+DAADDL+RLKRYL GDTT TFASSLG S +T 
Sbjct  1035  LGILCTQEQPSARPTMMDAADDLDRLKRYLGGDTTVTFASSLGFSSTTF  1083



>ref|NP_001175843.1| Os09g0423000 [Oryza sativa Japonica Group]
 dbj|BAH94571.1| Os09g0423000 [Oryza sativa Japonica Group]
Length=1093

 Score =   389 bits (1000),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 203/289 (70%), Positives = 243/289 (84%), Gaps = 7/289 (2%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
             KVL +Q+GNS KSF RECQVL+RIRHRNL+R++TACSLPDFKALVLP+MANGSL+R LY 
Sbjct  803   KVLQLQSGNSTKSFNRECQVLKRIRHRNLMRIVTACSLPDFKALVLPFMANGSLERCLYA  862

Query  182   HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
              P +G  +LSL+QRVNICSDIAEG+AYLHHHSPVKVIHCDLKPSNVL+N+DMTALVSDFG
Sbjct  863   GPPAG--ELSLVQRVNICSDIAEGMAYLHHHSPVKVIHCDLKPSNVLINDDMTALVSDFG  920

Query  362   ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
             IS+LVM+  G  NA   +G STANMLCGSIGYI PEYG+GS+ +TKGDVYSFGVLVLEMV
Sbjct  921   ISRLVMSVGGVANA-ADVGASTANMLCGSIGYIPPEYGYGSNPTTKGDVYSFGVLVLEMV  979

Query  542   TRKKPTDDTFGRSLSLHQYVKSEQM----EIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
             TRKKP DD F   LSLH++VK+        +VD +L R +++Q+ EV +M +VAI EL+E
Sbjct  980   TRKKPIDDMFDAGLSLHKWVKNHYHGRADAVVDPALARMVRDQTPEVRRMSDVAIGELLE  1039

Query  710   VGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTL  856
             +G+LCTQ+  + RPTM+DAADDL+RLKRY+ G+TTATFASSLG S ST 
Sbjct  1040  LGILCTQESAAVRPTMMDAADDLDRLKRYIGGETTATFASSLGFSSSTF  1088



>gb|EAZ09141.1| hypothetical protein OsI_31411 [Oryza sativa Indica Group]
Length=1080

 Score =   389 bits (999),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 203/289 (70%), Positives = 243/289 (84%), Gaps = 7/289 (2%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
             KVL +Q+GNS KSF RECQVL+RIRHRNL+R++TACSLPDFKALVLP+MANGSL+R LY 
Sbjct  790   KVLQLQSGNSTKSFNRECQVLKRIRHRNLMRIVTACSLPDFKALVLPFMANGSLERCLYA  849

Query  182   HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
              P +G  +LSL+QRVNICSDIAEG+AYLHHHSPVKVIHCDLKPSNVL+N+DMTALVSDFG
Sbjct  850   GPPAG--ELSLVQRVNICSDIAEGMAYLHHHSPVKVIHCDLKPSNVLINDDMTALVSDFG  907

Query  362   ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
             IS+LVM+  G  NA   +G STANMLCGSIGYI PEYG+GS+ +TKGDVYSFGVLVLEMV
Sbjct  908   ISRLVMSVGGVANA-ADVGASTANMLCGSIGYIPPEYGYGSNPTTKGDVYSFGVLVLEMV  966

Query  542   TRKKPTDDTFGRSLSLHQYVKSEQM----EIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
             TRKKP DD F   LSLH++VK+        +VD +L R +++Q+ EV +M +VAI EL+E
Sbjct  967   TRKKPIDDMFDAGLSLHKWVKNHYHGRADAVVDPALARMVRDQTPEVRRMSDVAIGELLE  1026

Query  710   VGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTL  856
             +G+LCTQ+  + RPTM+DAADDL+RLKRY+ G+TTATFASSLG S ST 
Sbjct  1027  LGILCTQESAAVRPTMMDAADDLDRLKRYIGGETTATFASSLGFSSSTF  1075



>ref|XP_008668304.1| PREDICTED: uncharacterized protein LOC100382014 isoform X1 [Zea 
mays]
 ref|XP_008668305.1| PREDICTED: uncharacterized protein LOC100382014 isoform X1 [Zea 
mays]
 ref|XP_008668306.1| PREDICTED: uncharacterized protein LOC100382014 isoform X1 [Zea 
mays]
Length=1118

 Score =   390 bits (1001),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 204/291 (70%), Positives = 244/291 (84%), Gaps = 8/291 (3%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
             KVL +QTGNS KSF RECQVL+RIRHRNL+R++TACSLPDFKALVLP+MANGSL+R LY 
Sbjct  828   KVLQLQTGNSTKSFNRECQVLKRIRHRNLMRIVTACSLPDFKALVLPFMANGSLERCLYA  887

Query  182   HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
              P    ++LSL+QRVNICSDIAEG+AYLHHHSPVKVIHCDLKPSNVL+N+DMTALVSDFG
Sbjct  888   GP---PAELSLVQRVNICSDIAEGMAYLHHHSPVKVIHCDLKPSNVLINDDMTALVSDFG  944

Query  362   ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
             IS+LVM+  G  N    +G STANMLCGSIGYI PEYG+GS+ +TKGD YSFGVLVLEMV
Sbjct  945   ISRLVMSIGGVANT-ADVGASTANMLCGSIGYIPPEYGYGSNPTTKGDAYSFGVLVLEMV  1003

Query  542   TRKKPTDDTFGRSLSLHQYVKSEQM----EIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
             TR+KPTDD F   LSLH++VK+        +VD +L+R +++Q+ EV +M +VAI EL+E
Sbjct  1004  TRRKPTDDMFDAGLSLHKWVKTHYHGRADAVVDQALVRMVRDQTPEVRRMSDVAIGELLE  1063

Query  710   VGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTLSI  862
             +G+LCTQ+  S RPTM+DAADDL+RLKRYL GDTTATFASSLG S +TL +
Sbjct  1064  LGILCTQEQSSARPTMMDAADDLDRLKRYLGGDTTATFASSLGFSSTTLEV  1114



>dbj|BAD33417.1| putative protein kinase Xa21, receptor type precursor [Oryza 
sativa Japonica Group]
 dbj|BAD33650.1| putative protein kinase Xa21, receptor type precursor [Oryza 
sativa Japonica Group]
 gb|EAZ44777.1| hypothetical protein OsJ_29408 [Oryza sativa Japonica Group]
Length=1080

 Score =   389 bits (999),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 203/289 (70%), Positives = 243/289 (84%), Gaps = 7/289 (2%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
             KVL +Q+GNS KSF RECQVL+RIRHRNL+R++TACSLPDFKALVLP+MANGSL+R LY 
Sbjct  790   KVLQLQSGNSTKSFNRECQVLKRIRHRNLMRIVTACSLPDFKALVLPFMANGSLERCLYA  849

Query  182   HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
              P +G  +LSL+QRVNICSDIAEG+AYLHHHSPVKVIHCDLKPSNVL+N+DMTALVSDFG
Sbjct  850   GPPAG--ELSLVQRVNICSDIAEGMAYLHHHSPVKVIHCDLKPSNVLINDDMTALVSDFG  907

Query  362   ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
             IS+LVM+  G  NA   +G STANMLCGSIGYI PEYG+GS+ +TKGDVYSFGVLVLEMV
Sbjct  908   ISRLVMSVGGVANA-ADVGASTANMLCGSIGYIPPEYGYGSNPTTKGDVYSFGVLVLEMV  966

Query  542   TRKKPTDDTFGRSLSLHQYVKSEQM----EIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
             TRKKP DD F   LSLH++VK+        +VD +L R +++Q+ EV +M +VAI EL+E
Sbjct  967   TRKKPIDDMFDAGLSLHKWVKNHYHGRADAVVDPALARMVRDQTPEVRRMSDVAIGELLE  1026

Query  710   VGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTL  856
             +G+LCTQ+  + RPTM+DAADDL+RLKRY+ G+TTATFASSLG S ST 
Sbjct  1027  LGILCTQESAAVRPTMMDAADDLDRLKRYIGGETTATFASSLGFSSSTF  1075



>ref|XP_004956857.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130-like isoform X1 [Setaria 
italica]
Length=1114

 Score =   389 bits (1000),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 202/289 (70%), Positives = 242/289 (84%), Gaps = 8/289 (3%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
             KVL +QTGNS KSF RECQVL+RIRHRNL+R++TACSLPDFKALVLP+MANGSL+R LY 
Sbjct  826   KVLQLQTGNSTKSFNRECQVLKRIRHRNLMRIVTACSLPDFKALVLPFMANGSLERCLYA  885

Query  182   HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
              P    ++LSL+QRVNICSD+AEG+AYLHHHSPVKVIHCDLKPSN+L+N+DMTALVSDFG
Sbjct  886   GP---PAELSLVQRVNICSDVAEGMAYLHHHSPVKVIHCDLKPSNILINDDMTALVSDFG  942

Query  362   ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
             IS+LVM+  G  N    +G STANMLCGSIGYI PEYG+GS+ +TKGDVYSFGVLVLEMV
Sbjct  943   ISRLVMSIGGVANT-ADVGASTANMLCGSIGYIPPEYGYGSNPTTKGDVYSFGVLVLEMV  1001

Query  542   TRKKPTDDTFGRSLSLHQYVK----SEQMEIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
             TR+KPTDD F   LSLH++VK         +VD +L+R +++Q+ EV +M +VAI EL+E
Sbjct  1002  TRRKPTDDMFEAGLSLHKWVKIHYHGRADAVVDPALVRMVRDQTPEVRRMSDVAISELLE  1061

Query  710   VGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTL  856
             +G+LCTQ+ PS RPTM+DAADDL+RLKRYL GDTT TFASSLG S +T 
Sbjct  1062  LGILCTQEQPSARPTMMDAADDLDRLKRYLGGDTTVTFASSLGFSSTTF  1110



>ref|XP_009380777.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=979

 Score =   385 bits (990),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 204/289 (71%), Positives = 239/289 (83%), Gaps = 9/289 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL++ TGNS KSF RECQVL+RIRHRNL+R+ITACSLPDFKALVLP+MANGSLD  LY 
Sbjct  686  KVLNLHTGNSTKSFNRECQVLKRIRHRNLMRIITACSLPDFKALVLPFMANGSLDSYLY-  744

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
               S SSDLSL+QRVNICSDIAEG+AYLHHHSPVKVIHCDLKPSNVLLN+DMTALVSDFG
Sbjct  745  ---SPSSDLSLIQRVNICSDIAEGMAYLHHHSPVKVIHCDLKPSNVLLNDDMTALVSDFG  801

Query  362  ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
            I++LVM   G G+  + +GNSTANMLCGSIGYIAPEYG+G+  STKGDVYSFGVLVLE+V
Sbjct  802  IARLVM-NVGVGSEVENVGNSTANMLCGSIGYIAPEYGYGARASTKGDVYSFGVLVLEVV  860

Query  542  TRKKPTDDTFGRSLSLHQYVKSEQM----EIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
            TRK+PTD+ F    SL Q+VKS        +VD +L    ++Q+ EV + WEVAI EL+E
Sbjct  861  TRKRPTDEVFEGGNSLQQWVKSHYHGGAETVVDSALGSEARKQTPEVRRTWEVAIGELLE  920

Query  710  VGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTL  856
            +G++CTQ+ PS+RPTM D ADDL+RLK+YL GDTTATF SSLG+S S  
Sbjct  921  LGVVCTQESPSSRPTMEDTADDLDRLKKYLAGDTTATFGSSLGMSSSIF  969



>ref|XP_009380776.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=1003

 Score =   386 bits (991),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 204/289 (71%), Positives = 239/289 (83%), Gaps = 9/289 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL++ TGNS KSF RECQVL+RIRHRNL+R+ITACSLPDFKALVLP+MANGSLD  LY 
Sbjct  710  KVLNLHTGNSTKSFNRECQVLKRIRHRNLMRIITACSLPDFKALVLPFMANGSLDSYLY-  768

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
               S SSDLSL+QRVNICSDIAEG+AYLHHHSPVKVIHCDLKPSNVLLN+DMTALVSDFG
Sbjct  769  ---SPSSDLSLIQRVNICSDIAEGMAYLHHHSPVKVIHCDLKPSNVLLNDDMTALVSDFG  825

Query  362  ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
            I++LVM   G G+  + +GNSTANMLCGSIGYIAPEYG+G+  STKGDVYSFGVLVLE+V
Sbjct  826  IARLVM-NVGVGSEVENVGNSTANMLCGSIGYIAPEYGYGARASTKGDVYSFGVLVLEVV  884

Query  542  TRKKPTDDTFGRSLSLHQYVKSEQM----EIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
            TRK+PTD+ F    SL Q+VKS        +VD +L    ++Q+ EV + WEVAI EL+E
Sbjct  885  TRKRPTDEVFEGGNSLQQWVKSHYHGGAETVVDSALGSEARKQTPEVRRTWEVAIGELLE  944

Query  710  VGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTL  856
            +G++CTQ+ PS+RPTM D ADDL+RLK+YL GDTTATF SSLG+S S  
Sbjct  945  LGVVCTQESPSSRPTMEDTADDLDRLKKYLAGDTTATFGSSLGMSSSIF  993



>ref|XP_010929463.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Elaeis guineensis]
Length=1038

 Score =   385 bits (989),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 209/291 (72%), Positives = 245/291 (84%), Gaps = 11/291 (4%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
             KVL +QTGNS KSF RECQVL+RIRHRNLIR+ITACS PDFKALVLP+MANGSL+  LY 
Sbjct  741   KVLHLQTGNSTKSFNRECQVLKRIRHRNLIRIITACSRPDFKALVLPFMANGSLESFLY-  799

Query  182   HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
                SGSS+LSL+QRVNICSDIAEG+AYLHHHSPVKVIHCDLKPSNVLLN+DMTALVSDFG
Sbjct  800   ---SGSSELSLIQRVNICSDIAEGIAYLHHHSPVKVIHCDLKPSNVLLNDDMTALVSDFG  856

Query  362   ISKLVMTTTGSGN--ADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLE  535
             IS+LVM   G+GN      +G+STAN+L GSIGYIAPEYGFGS  STKGDVYSFGV+VLE
Sbjct  857   ISRLVM-NVGAGNTTGADYMGSSTANILRGSIGYIAPEYGFGSDASTKGDVYSFGVVVLE  915

Query  536   MVTRKKPTDDTFGRSLSLHQYVKSE---QME-IVDCSLMRALKEQSAEVMKMWEVAIREL  703
             MV RK+PT + F   LSL  +VKS    +ME ++D SL+ A+K ++ EV +MWEVAI EL
Sbjct  916   MVARKRPTHEMFKGGLSLPNWVKSHYSGRMETVIDASLVTAVKNETYEVKRMWEVAIGEL  975

Query  704   IEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTL  856
             +++G+LCTQ+ PS+RPTMLDAA DL RLKRYL+GDTTA+F SSLG+S ST+
Sbjct  976   VDLGLLCTQESPSSRPTMLDAAADLGRLKRYLSGDTTASFTSSLGMSSSTI  1026



>ref|XP_003578139.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Brachypodium distachyon]
Length=1007

 Score =   382 bits (981),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 201/285 (71%), Positives = 239/285 (84%), Gaps = 8/285 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL +Q+GNS +SF RECQVL+RIRHRNL+R+ITACSL DFKALVLP+MANGSL+R LY 
Sbjct  718  KVLQLQSGNSTRSFNRECQVLKRIRHRNLMRIITACSLADFKALVLPFMANGSLERCLYA  777

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
             P    ++LSL+QRVNICSDIAEG+AYLHHHSPVKVIHCDLKPSNVL+N+DMTALVSDFG
Sbjct  778  GP---PAELSLVQRVNICSDIAEGMAYLHHHSPVKVIHCDLKPSNVLINDDMTALVSDFG  834

Query  362  ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
            IS+LVM+ +G  N    +G STANMLCGSIGYI PEYG+GS+ +TKGDVYSFGVLV+EMV
Sbjct  835  ISRLVMSVSGVSNT-ADVGASTANMLCGSIGYIPPEYGYGSNPTTKGDVYSFGVLVMEMV  893

Query  542  TRKKPTDDTFGRSLSLHQYVKS----EQMEIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
            T+KKPTDD F   LSLH++VKS    +   +VD  L   + +Q+ EV +MW+VAI EL+E
Sbjct  894  TKKKPTDDMFDAGLSLHKWVKSHYHGQAHAVVDQVLAGMVLDQTPEVRRMWDVAIGELLE  953

Query  710  VGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGIS  844
            +G+LCTQ+  STRPTM+DAADDL+RLKRYL GDTT TFASSLG S
Sbjct  954  LGILCTQESASTRPTMIDAADDLDRLKRYLGGDTTVTFASSLGFS  998



>ref|XP_010273698.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Nelumbo nucifera]
Length=985

 Score =   378 bits (971),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 195/290 (67%), Positives = 237/290 (82%), Gaps = 6/290 (2%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL +QTGNS KSF RECQVL++IRHRNL+R+ITACSLP+FKALVLP+MANGSL+  LYP
Sbjct  694  KVLQLQTGNSTKSFDRECQVLKQIRHRNLMRIITACSLPEFKALVLPFMANGSLESHLYP  753

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
               S  S LSL+ RVNICSDIAEGLAYLHHHSPVKVIHCDLKPSN+LLN +M ALVSDFG
Sbjct  754  QTKSFGS-LSLITRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNILLNNEMNALVSDFG  812

Query  362  ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
            I++L+M   G  N  +   +STAN+LCGSIGYIAPEYG G + STKGDVYSFG+LV+E+V
Sbjct  813  IARLIMRV-GEANVTRNTNSSTANLLCGSIGYIAPEYGLGKNASTKGDVYSFGILVMEIV  871

Query  542  TRKKPTDDTFGRSLSLHQYVK----SEQMEIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
            TRK+PTD+ F   +SL  +VK        +I+D SL++ ++ QS E+  +WE+AI ELIE
Sbjct  872  TRKRPTDNMFNEDMSLPMWVKRHCHGHLDKIIDPSLLKDVRIQSPEIRNIWEIAIIELIE  931

Query  710  VGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTLS  859
            +G+ CTQ+ PSTRPTM+DAADDL RLKRYL+GDTT+TFASSLG S ST++
Sbjct  932  LGLQCTQEAPSTRPTMIDAADDLGRLKRYLSGDTTSTFASSLGTSSSTIT  981



>ref|XP_010929465.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Elaeis guineensis]
Length=1083

 Score =   378 bits (971),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 204/291 (70%), Positives = 242/291 (83%), Gaps = 11/291 (4%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
             KVL +QTGNS KSF RECQVL+RIRHRNL+R+ITACS PDFKALVLP+MANGSL+  LY 
Sbjct  786   KVLHLQTGNSTKSFNRECQVLKRIRHRNLMRIITACSRPDFKALVLPFMANGSLESVLY-  844

Query  182   HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
                SGSS+LSL+QRVNICSDIAEG+AYLHHHSPV VIHCDLKPSNVLLN+ MTALVSDFG
Sbjct  845   ---SGSSELSLIQRVNICSDIAEGIAYLHHHSPVMVIHCDLKPSNVLLNDGMTALVSDFG  901

Query  362   ISKLVMTTTGSGN--ADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLE  535
             I++LVM   G+GN      +G+STA ML GSIGYIAPEYG GS  S KGDVYSFGV+VLE
Sbjct  902   IARLVM-NVGAGNTTGADDMGSSTATMLRGSIGYIAPEYGIGSDASIKGDVYSFGVVVLE  960

Query  536   MVTRKKPTDDTFGRSLSLHQYVKSE---QME-IVDCSLMRALKEQSAEVMKMWEVAIREL  703
             MVTRK+PTD+ F   L L  +VKS    +ME ++D SL+ A++ Q+ EV +MWEVAI EL
Sbjct  961   MVTRKRPTDEMFKGGLGLPNWVKSHYIGRMETVIDASLVTAVENQTYEVKRMWEVAIGEL  1020

Query  704   IEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTL  856
             +++G+LCTQ+ PS+RPTMLDAADDL RLKRYL+GDTT +FA+SLG+S ST+
Sbjct  1021  VDLGLLCTQESPSSRPTMLDAADDLGRLKRYLSGDTTTSFATSLGMSSSTI  1071



>ref|XP_008790142.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 isoform X2 [Phoenix dactylifera]
Length=915

 Score =   374 bits (961),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 198/295 (67%), Positives = 237/295 (80%), Gaps = 5/295 (2%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL +Q+ NS +SF RECQVL+RIRHRNL+R+ITACSLPDFKALVLP+MANGSL+  LYP
Sbjct  621  KVLQLQSSNSARSFNRECQVLKRIRHRNLMRIITACSLPDFKALVLPFMANGSLESHLYP  680

Query  182  HPH-SGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
                S SS LSL++RVNICSDIAEGLAYLHHHSPV++IHCDLKPSN+LLN+DMTALVSDF
Sbjct  681  QAQQSASSKLSLIKRVNICSDIAEGLAYLHHHSPVQIIHCDLKPSNILLNDDMTALVSDF  740

Query  359  GISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEM  538
            GI++LVM             NSTAN LCGSIGY+APEYG+G   STKGDVYSFG+LVLE+
Sbjct  741  GIARLVMKVAEGNILCDTPTNSTANQLCGSIGYVAPEYGYGRGASTKGDVYSFGILVLEI  800

Query  539  VTRKKPTDDTFGRSLSLHQYVKS---EQME-IVDCSLMRALKEQSAEVMKMWEVAIRELI  706
            VTRK+PTDD F   LSL  +VK+   +Q+E ++D  LM+ L+++S EV  MWEVAI EL+
Sbjct  801  VTRKRPTDDMFIEGLSLQMWVKNHYHDQLENVIDYFLMQDLQDKSPEVRNMWEVAIVELL  860

Query  707  EVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTLSIG*W  871
            E+G++CTQ+ PSTRPTMLDAAD L+RLK YL  D TATF SS GIS ST++   W
Sbjct  861  ELGLICTQEAPSTRPTMLDAADVLDRLKHYLGCDKTATFTSSRGISSSTITGDYW  915



>dbj|BAK06436.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1001

 Score =   374 bits (961),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 201/289 (70%), Positives = 238/289 (82%), Gaps = 8/289 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL +Q+GNS KSF RECQVL+RIRHRNL+R+ITACSL DFKALVLP+MA GSL+R LY 
Sbjct  712  KVLQLQSGNSTKSFSRECQVLKRIRHRNLMRIITACSLADFKALVLPFMAKGSLERCLYA  771

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
             P    S+LSL+QRVNICSDIAEG+AYLHHHSPVKVIHCDLKPSNVL+N+DMTALVSDFG
Sbjct  772  GP---PSELSLVQRVNICSDIAEGVAYLHHHSPVKVIHCDLKPSNVLINDDMTALVSDFG  828

Query  362  ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
            IS+LVM+  G  NA   +G STANMLCGSIGYI PEYG+GS+ +TKGDVYSFGVLV+EMV
Sbjct  829  ISRLVMSIGGVANA-ADVGASTANMLCGSIGYIPPEYGYGSNPTTKGDVYSFGVLVMEMV  887

Query  542  TRKKPTDDTFGRSLSLHQYVKSEQM----EIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
            TRKKPTD+ F   LSLH++VKS        +VD +L R + +Q+ EV +M + AI  L+E
Sbjct  888  TRKKPTDEMFEAGLSLHKWVKSHYHGRADAVVDQALARMVLDQTPEVRRMSDAAIGGLLE  947

Query  710  VGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTL  856
            +G+LCTQ+  STRP+MLDAADDL+RLKRYL GDTTATF SSLG S + +
Sbjct  948  LGILCTQESASTRPSMLDAADDLDRLKRYLGGDTTATFESSLGFSSTVV  996



>ref|XP_008790141.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 isoform X1 [Phoenix dactylifera]
Length=1036

 Score =   375 bits (963),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 198/295 (67%), Positives = 237/295 (80%), Gaps = 5/295 (2%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
             KVL +Q+ NS +SF RECQVL+RIRHRNL+R+ITACSLPDFKALVLP+MANGSL+  LYP
Sbjct  742   KVLQLQSSNSARSFNRECQVLKRIRHRNLMRIITACSLPDFKALVLPFMANGSLESHLYP  801

Query  182   HPH-SGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
                 S SS LSL++RVNICSDIAEGLAYLHHHSPV++IHCDLKPSN+LLN+DMTALVSDF
Sbjct  802   QAQQSASSKLSLIKRVNICSDIAEGLAYLHHHSPVQIIHCDLKPSNILLNDDMTALVSDF  861

Query  359   GISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEM  538
             GI++LVM             NSTAN LCGSIGY+APEYG+G   STKGDVYSFG+LVLE+
Sbjct  862   GIARLVMKVAEGNILCDTPTNSTANQLCGSIGYVAPEYGYGRGASTKGDVYSFGILVLEI  921

Query  539   VTRKKPTDDTFGRSLSLHQYVKS---EQME-IVDCSLMRALKEQSAEVMKMWEVAIRELI  706
             VTRK+PTDD F   LSL  +VK+   +Q+E ++D  LM+ L+++S EV  MWEVAI EL+
Sbjct  922   VTRKRPTDDMFIEGLSLQMWVKNHYHDQLENVIDYFLMQDLQDKSPEVRNMWEVAIVELL  981

Query  707   EVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTLSIG*W  871
             E+G++CTQ+ PSTRPTMLDAAD L+RLK YL  D TATF SS GIS ST++   W
Sbjct  982   ELGLICTQEAPSTRPTMLDAADVLDRLKHYLGCDKTATFTSSRGISSSTITGDYW  1036



>ref|XP_010905032.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 isoform X1 [Elaeis guineensis]
Length=985

 Score =   371 bits (952),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 195/295 (66%), Positives = 236/295 (80%), Gaps = 5/295 (2%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL +Q+ NS KSF RECQVL+RIRHRNL+R+ITACSLPDFKALVLP+M NGSL+  LY 
Sbjct  691  KVLQLQSSNSAKSFNRECQVLKRIRHRNLMRIITACSLPDFKALVLPFMVNGSLESHLYL  750

Query  182  HPH-SGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
                S SS LSL++RVNICSDIAEGLAYLHHHSPV++IHCDLKPSN+LLN+DMTALVSDF
Sbjct  751  QAQQSASSKLSLIERVNICSDIAEGLAYLHHHSPVQIIHCDLKPSNILLNDDMTALVSDF  810

Query  359  GISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEM  538
            GI++LVM             NSTAN+LCGSIGY+APEYG+    STKGDVYSFG+LVLE+
Sbjct  811  GIARLVMKVAEGNIQYDTTTNSTANLLCGSIGYVAPEYGYRRGASTKGDVYSFGILVLEI  870

Query  539  VTRKKPTDDTFGRSLSLHQYVKS---EQME-IVDCSLMRALKEQSAEVMKMWEVAIRELI  706
            VTRK+PTDD F   LSL ++VK+   +Q+E ++D  LM+ L++QS +V  MWEVAI EL+
Sbjct  871  VTRKRPTDDMFIEGLSLQRWVKNHYHDQLENVIDYFLMQDLQDQSPDVRDMWEVAIVELL  930

Query  707  EVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTLSIG*W  871
            E+G++CTQ+ PSTRP+MLD ADDL+RLK YL  D TATF SS GIS ST++   W
Sbjct  931  ELGLICTQETPSTRPSMLDVADDLDRLKHYLGCDKTATFTSSHGISSSTITGDYW  985



>ref|XP_008794419.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Phoenix dactylifera]
Length=1250

 Score =   375 bits (964),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 200/288 (69%), Positives = 235/288 (82%), Gaps = 10/288 (3%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
             KVL +Q GN+ K F RECQVL+RIRHRNL+R+ITACS PDFKALVLP+MANGSLD  L  
Sbjct  956   KVLHLQAGNAAKIFNRECQVLKRIRHRNLMRIITACSRPDFKALVLPFMANGSLDSFL--  1013

Query  182   HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
               HSGSS+LSL+QRVNICSDIAE +AYLHHHSPVKVIHCDLKPSNVLLN+DMTALV+DFG
Sbjct  1014  --HSGSSELSLIQRVNICSDIAEAVAYLHHHSPVKVIHCDLKPSNVLLNDDMTALVADFG  1071

Query  362   ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
             I+ LVM +  +   D  LG STANML GS+GYIAPEYGFGS  ST+GDVYSFGVLVLE+V
Sbjct  1072  IASLVMNSGTTSTTD--LGTSTANMLRGSVGYIAPEYGFGSGASTRGDVYSFGVLVLEVV  1129

Query  542   TRKKPTDDTFGRSLSLHQYVKSEQ----MEIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
             TRK+PTD+ F   LSL ++VK         ++D SL+ A K Q+ E  +MWEVAI EL++
Sbjct  1130  TRKRPTDEMFEGGLSLPKWVKGHYNGRVERVIDASLVTAAKNQTCEARRMWEVAIGELVD  1189

Query  710   VGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCST  853
             +G+LCTQ+ PSTRPTMLDAADDL RLKRYL+GDT+A+  SSLG+S ST
Sbjct  1190  LGLLCTQESPSTRPTMLDAADDLGRLKRYLSGDTSASVPSSLGMSSST  1237



>ref|XP_010905033.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 isoform X2 [Elaeis guineensis]
Length=984

 Score =   370 bits (951),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 194/291 (67%), Positives = 235/291 (81%), Gaps = 5/291 (2%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL +Q+ NS KSF RECQVL+RIRHRNL+R+ITACSLPDFKALVLP+M NGSL+  LY 
Sbjct  691  KVLQLQSSNSAKSFNRECQVLKRIRHRNLMRIITACSLPDFKALVLPFMVNGSLESHLYL  750

Query  182  HPH-SGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
                S SS LSL++RVNICSDIAEGLAYLHHHSPV++IHCDLKPSN+LLN+DMTALVSDF
Sbjct  751  QAQQSASSKLSLIERVNICSDIAEGLAYLHHHSPVQIIHCDLKPSNILLNDDMTALVSDF  810

Query  359  GISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEM  538
            GI++LVM             NSTAN+LCGSIGY+APEYG+    STKGDVYSFG+LVLE+
Sbjct  811  GIARLVMKVAEGNIQYDTTTNSTANLLCGSIGYVAPEYGYRRGASTKGDVYSFGILVLEI  870

Query  539  VTRKKPTDDTFGRSLSLHQYVKS---EQME-IVDCSLMRALKEQSAEVMKMWEVAIRELI  706
            VTRK+PTDD F   LSL ++VK+   +Q+E ++D  LM+ L++QS +V  MWEVAI EL+
Sbjct  871  VTRKRPTDDMFIEGLSLQRWVKNHYHDQLENVIDYFLMQDLQDQSPDVRDMWEVAIVELL  930

Query  707  EVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTLS  859
            E+G++CTQ+ PSTRP+MLD ADDL+RLK YL  D TATF SS GIS ST++
Sbjct  931  ELGLICTQETPSTRPSMLDVADDLDRLKHYLGCDKTATFTSSHGISSSTIT  981



>ref|XP_009417790.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Musa acuminata subsp. malaccensis]
Length=994

 Score =   369 bits (948),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 193/286 (67%), Positives = 227/286 (79%), Gaps = 7/286 (2%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL +Q+GNS +SF RECQVL+ IRHRNL+R+ITACSLPDFKALVLP+MANGSL+  LYP
Sbjct  690  KVLQLQSGNSTRSFKRECQVLKNIRHRNLMRIITACSLPDFKALVLPFMANGSLESHLYP  749

Query  182  HPHS-GSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
                  S  LSL++RVNICSDIAEGLAYLHHHSPVKVIHCDLKPSN+LLN+DMTALVSDF
Sbjct  750  ETEKPDSPQLSLLERVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNILLNDDMTALVSDF  809

Query  359  GISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEM  538
            GI++LVMT      A     NSTAN+LCGSIGY+APEYG+G STSTKGDVYSFG+LVLE 
Sbjct  810  GIARLVMTVGEGNTAYASTSNSTANILCGSIGYVAPEYGYGGSTSTKGDVYSFGILVLET  869

Query  539  VTRKKPTDDTFGR--SLSLHQYVK----SEQMEIVDCSLMRALKEQSAEVMKMWEVAIRE  700
            VT K+PTD  FG    LSL ++VK    S   +++D  LMR   +Q  EV  +WEVAI E
Sbjct  870  VTGKRPTDGMFGSEDGLSLQRWVKRHYRSRPEDVIDSGLMREACDQRLEVRNVWEVAIME  929

Query  701  LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLG  838
            L+E+G++C+ + P+ RPTMLDAADDL+RLKRYL GDTT TF SS G
Sbjct  930  LLELGLVCSHESPAGRPTMLDAADDLDRLKRYLGGDTTVTFTSSRG  975



>ref|XP_009399568.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Musa acuminata subsp. malaccensis]
Length=987

 Score =   362 bits (928),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 188/279 (67%), Positives = 227/279 (81%), Gaps = 5/279 (2%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL +Q+GNS +SF REC VL+ IRHRNL+R+ITACSLPDFKALVLP+MANGSL+  LYP
Sbjct  693  KVLQLQSGNSTRSFNRECHVLKNIRHRNLMRIITACSLPDFKALVLPFMANGSLESHLYP  752

Query  182  HPHSGS-SDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
                   S LSL++RVNICSD+AEGLAYLHHHSPVKVIHCDLKPSN+LLN+DMTALVSDF
Sbjct  753  AAEKADCSQLSLVERVNICSDVAEGLAYLHHHSPVKVIHCDLKPSNILLNDDMTALVSDF  812

Query  359  GISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEM  538
            GI++LVMT   +  A +   NSTAN+LCGSIGY+APEYG+G + S KGDVYSFG+LVLE 
Sbjct  813  GIARLVMTVEEANAAGEAASNSTANVLCGSIGYVAPEYGYGRAASIKGDVYSFGILVLET  872

Query  539  VTRKKPTDDTFGRSLSLHQYVKSE---QME-IVDCSLMRALKEQSAEVMKMWEVAIRELI  706
            VTRK+PTD  FG  LSL ++VK +   ++E IVD  LMR   +Q+ EV  M+EVAI EL+
Sbjct  873  VTRKRPTDGMFGEGLSLQRWVKQQYRSRLESIVDSRLMREACDQNLEVRNMYEVAIVELL  932

Query  707  EVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATF  823
            E+G++C+ + PS RPTMLDAADDL+RLK YL G+TTATF
Sbjct  933  ELGLVCSHESPSGRPTMLDAADDLDRLKHYLGGETTATF  971



>ref|XP_009401294.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=951

 Score =   360 bits (925),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 198/290 (68%), Positives = 238/290 (82%), Gaps = 10/290 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL++Q GNS +SF RECQVL+RIRHRNL+R+ITACSLPDFKALVLP+M NGSL+ RL  
Sbjct  657  KVLNLQAGNSTRSFNRECQVLKRIRHRNLMRIITACSLPDFKALVLPFMGNGSLESRL--  714

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
              HSGS++LSL+QRVN+CSDIAEG+AYLHHHSPVKVIHCDLKPSNVLLN+DMTALVSDFG
Sbjct  715  --HSGSAELSLIQRVNVCSDIAEGMAYLHHHSPVKVIHCDLKPSNVLLNDDMTALVSDFG  772

Query  362  ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
            I++LVM + G GN  +  G+STANML GSIGYIAPEYG+GS+ STKGDVYSFGV+VLE+V
Sbjct  773  IARLVM-SVGVGNTAENTGSSTANMLRGSIGYIAPEYGYGSNASTKGDVYSFGVVVLEVV  831

Query  542  TRKKPTDDTFGRSLSLHQYVKSEQ----MEIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
            T ++PTD+ F   +S+H +VKS        IVD +L   ++ Q  EV  MWE AI EL+E
Sbjct  832  TGRRPTDEMFEGEMSMHGWVKSHHHGRAAAIVDSALASEVRRQMPEVQIMWEAAIGELLE  891

Query  710  VGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGD-TTATFASSLGISCSTL  856
            +G+LC+Q+ PS+RPTM+DAA DL RLKR L GD TTATFASSLG+S S  
Sbjct  892  LGLLCSQESPSSRPTMMDAAHDLGRLKRSLAGDTTTATFASSLGLSSSVF  941



>ref|XP_009401293.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=989

 Score =   360 bits (924),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 198/290 (68%), Positives = 238/290 (82%), Gaps = 10/290 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL++Q GNS +SF RECQVL+RIRHRNL+R+ITACSLPDFKALVLP+M NGSL+ RL  
Sbjct  695  KVLNLQAGNSTRSFNRECQVLKRIRHRNLMRIITACSLPDFKALVLPFMGNGSLESRL--  752

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
              HSGS++LSL+QRVN+CSDIAEG+AYLHHHSPVKVIHCDLKPSNVLLN+DMTALVSDFG
Sbjct  753  --HSGSAELSLIQRVNVCSDIAEGMAYLHHHSPVKVIHCDLKPSNVLLNDDMTALVSDFG  810

Query  362  ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
            I++LVM + G GN  +  G+STANML GSIGYIAPEYG+GS+ STKGDVYSFGV+VLE+V
Sbjct  811  IARLVM-SVGVGNTAENTGSSTANMLRGSIGYIAPEYGYGSNASTKGDVYSFGVVVLEVV  869

Query  542  TRKKPTDDTFGRSLSLHQYVKSEQ----MEIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
            T ++PTD+ F   +S+H +VKS        IVD +L   ++ Q  EV  MWE AI EL+E
Sbjct  870  TGRRPTDEMFEGEMSMHGWVKSHHHGRAAAIVDSALASEVRRQMPEVQIMWEAAIGELLE  929

Query  710  VGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGD-TTATFASSLGISCSTL  856
            +G+LC+Q+ PS+RPTM+DAA DL RLKR L GD TTATFASSLG+S S  
Sbjct  930  LGLLCSQESPSSRPTMMDAAHDLGRLKRSLAGDTTTATFASSLGLSSSVF  979



>gb|EMT18352.1| LRR receptor-like serine/threonine-protein kinase EFR [Aegilops 
tauschii]
Length=996

 Score =   355 bits (912),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 196/289 (68%), Positives = 231/289 (80%), Gaps = 8/289 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL +Q+GNS KSF RECQVL+RIRHRNL+R+ITACSL DFKALVLP+MA GSL+R LY 
Sbjct  708  KVLQLQSGNSTKSFSRECQVLKRIRHRNLMRIITACSLADFKALVLPFMAKGSLERCLYA  767

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
             P    ++LSL+QRVNICSDIAEG+AYLHHHSPVKVIHCDLKPSNVL+N+DMTALVSDFG
Sbjct  768  GP---PAELSLVQRVNICSDIAEGVAYLHHHSPVKVIHCDLKPSNVLINDDMTALVSDFG  824

Query  362  ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
            IS+LVM+  G  N    +G STANMLCGSIGYI PEYG+GS+ +TKGDVYSFGVL++EMV
Sbjct  825  ISRLVMSVGGVANT-ADVGASTANMLCGSIGYIPPEYGYGSNPTTKGDVYSFGVLMMEMV  883

Query  542  TRKKPTDDTFGRSLSLHQYVKSEQM----EIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
            TRKKPTDD F   LSLH++VKS        +VD +L R + +Q+ EV +M   AI E   
Sbjct  884  TRKKPTDDMFEGGLSLHKWVKSHYHGRADAVVDQALARMVMDQTPEVRRMAAAAIGEAGG  943

Query  710  VGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTL  856
              +LCTQ+  STRP+MLDAADDL+RLKRYL GDT ATF SSLG S + +
Sbjct  944  AAILCTQESASTRPSMLDAADDLDRLKRYLGGDTAATFESSLGFSSTVV  992



>ref|XP_006493473.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130-like [Citrus sinensis]
Length=1113

 Score =   351 bits (900),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 193/293 (66%), Positives = 224/293 (76%), Gaps = 39/293 (13%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
             KVL +Q+GN  KSF RECQVL+RIRHRNL+R+ITACSLPDFKALVLPYMANGSLD  LYP
Sbjct  849   KVLQLQSGNFTKSFNRECQVLKRIRHRNLMRIITACSLPDFKALVLPYMANGSLDSHLYP  908

Query  182   HPH----SGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALV  349
             H      SGSSDL+L+QRVNICSDIAEG+AYLHHHSPV+VIHCDLKPSNVLLN+DMTALV
Sbjct  909   HSETEFGSGSSDLTLLQRVNICSDIAEGMAYLHHHSPVRVIHCDLKPSNVLLNDDMTALV  968

Query  350   SDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLV  529
             SDFGI+KLVMT     +  + +GNSTANMLCGSIGY+AP                     
Sbjct  969   SDFGIAKLVMTVGVGNDGAENMGNSTANMLCGSIGYMAP---------------------  1007

Query  530   LEMVTRKKPTDDTFGRSLSLHQYVKSE---QME-IVDCSLMRALKEQSAEVMKMWEVAIR  697
                       DD F   LSLH++VK+    ++E ++D SL+RA ++QS EV +MW+VAI 
Sbjct  1008  ----------DDMFAGGLSLHKWVKNHFHGRLEKVIDSSLLRASRDQSPEVKRMWDVAIG  1057

Query  698   ELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTL  856
             ELIE+G+LCTQ+ PSTRPTMLDAADDL+RLKRYL GDTTATFASSLGIS S L
Sbjct  1058  ELIELGILCTQESPSTRPTMLDAADDLDRLKRYLGGDTTATFASSLGISYSNL  1110



>ref|XP_006857039.1| hypothetical protein AMTR_s00065p00026770 [Amborella trichopoda]
 gb|ERN18506.1| hypothetical protein AMTR_s00065p00026770 [Amborella trichopoda]
Length=979

 Score =   345 bits (885),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 182/292 (62%), Positives = 232/292 (79%), Gaps = 10/292 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL++Q GNS KSF+REC+VL++IRHRNL+R+ITACSLPDFKALVLP+MANGSL+  LY 
Sbjct  687  KVLNLQGGNSTKSFLRECEVLKKIRHRNLMRIITACSLPDFKALVLPFMANGSLESYLY-  745

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
             P+ G   L L Q ++ICSD+AEG+AYLHHH+PV+VIHCDLKPSNVLLNE+M A+VSDFG
Sbjct  746  GPNGG---LGLGQVISICSDMAEGVAYLHHHAPVRVIHCDLKPSNVLLNEEMMAMVSDFG  802

Query  362  ISKLVMTTTGSGN--ADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLE  535
            I++LVM   G G+    +    +TA++ CGSIGYIAPEYGFG S S KGDVYSFG +VL+
Sbjct  803  IARLVMRVAGDGSVAGGEAAVENTADVFCGSIGYIAPEYGFGRSPSVKGDVYSFGTMVLQ  862

Query  536  MVTRKKPTDDTFGRSLSLHQYVKSEQM----EIVDCSLMRALKEQSAEVMKMWEVAIREL  703
            +VT K+PTD+ F    SL ++V++       ++++  L  A  +QS EV KMW+ AI E+
Sbjct  863  IVTGKRPTDEMFAGGSSLQRWVRNHYPRHIDKVLNSRLACATMDQSPEVKKMWDCAILEI  922

Query  704  IEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTLS  859
            +E+G+LCTQ+ PSTRP+MLD ADDL+RLK YL GDTTATFASSLGIS ST++
Sbjct  923  VELGLLCTQETPSTRPSMLDVADDLDRLKGYLAGDTTATFASSLGISSSTIT  974



>ref|XP_002512743.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF49246.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=969

 Score =   345 bits (884),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 194/294 (66%), Positives = 222/294 (76%), Gaps = 42/294 (14%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL  Q+ NS K+F RECQVL+RIRHRNLIR+ITACSLPDFKALVLPYMANGSLD  LYP
Sbjct  704  KVLQFQSRNSTKTFNRECQVLKRIRHRNLIRIITACSLPDFKALVLPYMANGSLDNHLYP  763

Query  182  HPH----SGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALV  349
            H      SGSSDL+LMQRVNICSDIAEG+AYLHHHSPVKVIHCDLKPSNVLLN+DMTALV
Sbjct  764  HSETGLDSGSSDLTLMQRVNICSDIAEGMAYLHHHSPVKVIHCDLKPSNVLLNDDMTALV  823

Query  350  SDFGISKLVMTTTGSGNAD--QKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGV  523
            SDFGI++L+ +T G GNA   + +GNSTAN+LCGSIGYIAP                   
Sbjct  824  SDFGIARLI-STVGGGNAGLFENIGNSTANLLCGSIGYIAP-------------------  863

Query  524  LVLEMVTRKKPTDDTFGRSLSLHQYVKSEQM----EIVDCSLMRALKEQSAEVMKMWEVA  691
                        DD F   L LH++V+S       +++D SL+RA ++QS EV K WEVA
Sbjct  864  ------------DDMFVGGLDLHKWVRSHYHGRVEQVLDSSLVRASRDQSPEVKKTWEVA  911

Query  692  IRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCST  853
            + ELIE+G+LCTQ+ PSTRPTMLDAADDL+RLKRYL GDTTATFASSLGIS ST
Sbjct  912  VGELIELGLLCTQESPSTRPTMLDAADDLDRLKRYLGGDTTATFASSLGISSST  965



>ref|XP_009395486.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Musa acuminata subsp. malaccensis]
Length=980

 Score =   344 bits (882),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 177/293 (60%), Positives = 227/293 (77%), Gaps = 6/293 (2%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL +Q  NS ++F REC+VL+ IRHRNL+ + TACSLP+FKALV P+M+ GSL+  L+P
Sbjct  686  KVLQLQDHNSARTFNRECEVLKTIRHRNLMGITTACSLPEFKALVFPFMSEGSLEDHLHP  745

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
                 S  LSL +RV+ICSD+AEG+AYLHHH+PV+VIHCDLKPSN+LL +DMTA+VSDFG
Sbjct  746  KGDRMSPRLSLTERVSICSDVAEGMAYLHHHAPVQVIHCDLKPSNILLADDMTAMVSDFG  805

Query  362  ISKLVMTTTGSGNA-DQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEM  538
            I+ LV +  G GNA   ++ NST N+L GS+GY+APEYG G   STKGDVYSFG++VLEM
Sbjct  806  IAMLV-SPGGEGNASSDRMTNSTTNLLRGSVGYVAPEYGHGRPASTKGDVYSFGIVVLEM  864

Query  539  VTRKKPTDDTFGRSLSLHQYVK----SEQMEIVDCSLMRALKEQSAEVMKMWEVAIRELI  706
            VT K+PT+D F   LSL  +VK    S  + IVD SL++ ++EQS EV ++WEVAI E+I
Sbjct  865  VTGKRPTEDMFDEDLSLINWVKRHYASRLVNIVDSSLVKNIREQSHEVKRVWEVAIMEMI  924

Query  707  EVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTLSIG  865
            E+G+LCTQ+ P++RPTM+  ADDLN+LK YL GDTTAT ASS G++ S   IG
Sbjct  925  ELGLLCTQEAPASRPTMISVADDLNKLKDYLGGDTTATLASSQGMTSSIADIG  977



>ref|XP_004305472.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130-like [Fragaria vesca subsp. 
vesca]
Length=963

 Score =   341 bits (875),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 193/296 (65%), Positives = 223/296 (75%), Gaps = 42/296 (14%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL +Q+GNS KSF RECQVLRRIRHRNLIR+ITACSLPDFKA+VLPYMANGSLD RLYP
Sbjct  696  KVLHLQSGNSTKSFNRECQVLRRIRHRNLIRIITACSLPDFKAIVLPYMANGSLDSRLYP  755

Query  182  HPH----SGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALV  349
            H      SGSSDLSL+QRVNICSDIAEG+AYLHH+SPV+VIHCDLKPSNVLLN+DMTALV
Sbjct  756  HSQAGLGSGSSDLSLIQRVNICSDIAEGMAYLHHYSPVRVIHCDLKPSNVLLNDDMTALV  815

Query  350  SDFGISKLVMTTTGSGNAD---QKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFG  520
            SDFGI++LV+     G      + +GNSTAN+LCGSIGYIAP                  
Sbjct  816  SDFGIARLVIAGGAGGGNAAGLENMGNSTANILCGSIGYIAP------------------  857

Query  521  VLVLEMVTRKKPTDDTFGRSLSLHQYVKSEQM----EIVDCSLMRALKEQSAEVMKMWEV  688
                         DD F   LSLH +VK+       ++VD SL+RA ++QS EV KMW+V
Sbjct  858  -------------DDMFVGGLSLHSWVKNHYHGRIDKVVDSSLLRASRDQSPEVKKMWDV  904

Query  689  AIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTL  856
            AI E+IE+G+LCTQ+ PSTRPTM+DAADDL+RLKRYL GDTTATFASSLGIS ST+
Sbjct  905  AIEEMIELGILCTQESPSTRPTMVDAADDLDRLKRYLGGDTTATFASSLGISSSTI  960



>ref|XP_008228834.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Prunus mume]
Length=959

 Score =   331 bits (849),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 189/293 (65%), Positives = 220/293 (75%), Gaps = 40/293 (14%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL +Q+GNS KSF RECQVLRRIRHRNLIR+ITACSLPDFKA+VLPYMANGSLD RLYP
Sbjct  696  KVLHLQSGNSTKSFTRECQVLRRIRHRNLIRIITACSLPDFKAIVLPYMANGSLDSRLYP  755

Query  182  HPHSGSSDLSL----MQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALV  349
            H  +G S  S     +QR+NICSDIAEG+AYLHHHSPV+VIHCDLKPSNVLLN+DMTALV
Sbjct  756  HSQTGLSSGSSDLSLIQRLNICSDIAEGMAYLHHHSPVRVIHCDLKPSNVLLNDDMTALV  815

Query  350  SDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLV  529
            SDFGI++L++   G+ +A + +GNSTANMLCGSIGYIAP                     
Sbjct  816  SDFGIARLLI-AGGANSALENMGNSTANMLCGSIGYIAP---------------------  853

Query  530  LEMVTRKKPTDDTFGRSLSLHQYVKSEQM----EIVDCSLMRALKEQSAEVMKMWEVAIR  697
                      DD F   LSLH++VK+       ++VD SLMRA ++Q  EV KMW+VAI 
Sbjct  854  ----------DDMFVGGLSLHRWVKNHYHGRVEKVVDSSLMRASRDQPPEVKKMWDVAIG  903

Query  698  ELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTL  856
            ELIE+G+LCTQ+  STRPTMLDAADDL+RLKRY+ GDTTATFA SLGIS STL
Sbjct  904  ELIELGILCTQESSSTRPTMLDAADDLDRLKRYICGDTTATFAFSLGISSSTL  956



>ref|XP_004161420.1| PREDICTED: LOW QUALITY PROTEIN: putative leucine-rich repeat 
receptor-like serine/threonine-protein kinase At2g24130-like 
[Cucumis sativus]
Length=1009

 Score =   329 bits (844),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 188/294 (64%), Positives = 217/294 (74%), Gaps = 40/294 (14%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL  Q+GNS KSF REC+VL+RIRHRNLIR+ITACSLPDFKA+VLPYMANGSLD  LYP
Sbjct  731  KVLHTQSGNSTKSFNRECEVLKRIRHRNLIRIITACSLPDFKAIVLPYMANGSLDNHLYP  790

Query  182  HPHSGSS----DLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALV  349
            H  + S+    DL+L++RVNICSDIAEG+AYLHHHSPV+VIHCDLKPSNVLL +DMTALV
Sbjct  791  HSPTSSTSGSSDLNLIERVNICSDIAEGMAYLHHHSPVRVIHCDLKPSNVLLKDDMTALV  850

Query  350  SDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLV  529
            SDFGIS+L+    GS    + +G STANML GSIGYIAP                     
Sbjct  851  SDFGISRLMTPGIGSSATVENMGKSTANMLSGSIGYIAP---------------------  889

Query  530  LEMVTRKKPTDDTFGRSLSLHQYVKSEQM----EIVDCSLMRALKEQSAEVMKMWEVAIR  697
                      DD F   LSLH++VKS       ++VD SL RAL+++S E+ KMWEVAIR
Sbjct  890  ----------DDMFVEGLSLHKWVKSHYYGRVEKVVDYSLQRALRDESPEMKKMWEVAIR  939

Query  698  ELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLT-GDTTATFASSLGISCSTL  856
            ELIE+G+LCTQ+ P TRPTMLDAADDL+RLKRYL  GDTT TFASSLGIS STL
Sbjct  940  ELIELGLLCTQESPFTRPTMLDAADDLDRLKRYLNGGDTTTTFASSLGISSSTL  993



>ref|XP_004137881.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130-like [Cucumis sativus]
Length=1009

 Score =   329 bits (844),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 188/294 (64%), Positives = 217/294 (74%), Gaps = 40/294 (14%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL  Q+GNS KSF REC+VL+RIRHRNLIR+ITACSLPDFKA+VLPYMANGSLD  LYP
Sbjct  731  KVLHTQSGNSTKSFNRECEVLKRIRHRNLIRIITACSLPDFKAIVLPYMANGSLDNHLYP  790

Query  182  HPHSGSS----DLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALV  349
            H  + S+    DL+L++RVNICSDIAEG+AYLHHHSPV+VIHCDLKPSNVLL +DMTALV
Sbjct  791  HSPTSSTSGSSDLNLIERVNICSDIAEGMAYLHHHSPVRVIHCDLKPSNVLLKDDMTALV  850

Query  350  SDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLV  529
            SDFGIS+L+    GS    + +G STANML GSIGYIAP                     
Sbjct  851  SDFGISRLMTPGIGSSATVENMGKSTANMLSGSIGYIAP---------------------  889

Query  530  LEMVTRKKPTDDTFGRSLSLHQYVKSEQM----EIVDCSLMRALKEQSAEVMKMWEVAIR  697
                      DD F   LSLH++VKS       ++VD SL RAL+++S E+ KMWEVAIR
Sbjct  890  ----------DDMFVEGLSLHKWVKSHYYGRVEKVVDYSLQRALRDESPEMKKMWEVAIR  939

Query  698  ELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLT-GDTTATFASSLGISCSTL  856
            ELIE+G+LCTQ+ P TRPTMLDAADDL+RLKRYL  GDTT TFASSLGIS STL
Sbjct  940  ELIELGLLCTQESPFTRPTMLDAADDLDRLKRYLNGGDTTTTFASSLGISSSTL  993



>ref|XP_010094046.1| Putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
 gb|EXB55136.1| Putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
Length=989

 Score =   308 bits (788),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 173/276 (63%), Positives = 209/276 (76%), Gaps = 14/276 (5%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL  Q+ +S+ SF REC+ L+ IRHRN+IR+IT CS PDFKALV PYMANGSLD RLY 
Sbjct  711  KVLHTQSSSSIDSFRRECEALKIIRHRNVIRIITVCSFPDFKALVFPYMANGSLDSRLYE  770

Query  182  HPH----SGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALV  349
             P     S SS L+L QRVNICSD+AEG+AYLHH +P+ VIHCDLKPSNVLLN DMTALV
Sbjct  771  LPSNRLSSRSSCLTLAQRVNICSDVAEGMAYLHHQAPIVVIHCDLKPSNVLLNSDMTALV  830

Query  350  SDFGISKLVMTTTGSGNADQKLGNSTA-NMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVL  526
            SDFGIS L +T  G   A + L NST+ N+L GS+GYI PEYG GS T+TKGDVYSFG+L
Sbjct  831  SDFGISTL-LTPKG---AAENLENSTSDNILVGSVGYIPPEYGLGSKTTTKGDVYSFGIL  886

Query  527  VLEMVTRKKPTDDTFGRSLSLHQYV----KSEQME-IVDCSLMRALKEQSAEVMKMWEVA  691
            VLEMVT K+PT+D F   L+L  +V    + E +E +VD  + RA ++ S++  K+WEV+
Sbjct  887  VLEMVTGKRPTNDMFVGGLTLQHWVSKSYRHENIEKVVDAGMARASRDLSSKRKKIWEVS  946

Query  692  IRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYL  799
            I  LIE+G+ CTQD PS+RPTMLD A DLNRLKR L
Sbjct  947  IGSLIELGLRCTQDSPSSRPTMLDVAVDLNRLKRDL  982



>ref|XP_002274639.2| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Vitis vinifera]
Length=975

 Score =   282 bits (722),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 156/259 (60%), Positives = 198/259 (76%), Gaps = 6/259 (2%)
 Frame = +2

Query  38   SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYPHPHSGSSDLSLM  217
            SF RECQVL+R RHRNLIR+IT CS PDFKALVLP M+NG L+R LYP    G   L+L+
Sbjct  707  SFKRECQVLKRTRHRNLIRIITICSKPDFKALVLPLMSNGCLERHLYPGRDLGHG-LNLV  765

Query  218  QRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFGISKLVMTTTGSG  397
            Q V+ICSD+AEG+AYLHH+SPV+V+HCDLKPSN+LL+EDMTALV+DFGI+KLV    G+ 
Sbjct  766  QLVSICSDVAEGVAYLHHYSPVRVVHCDLKPSNILLDEDMTALVTDFGIAKLVSGDEGTS  825

Query  398  NADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMVTRKKPTDDTFGR  577
              D    +ST  +LCGSIGYIAPEYG G   ST+GDVYSFGVL+LE+VT K+PTD  F  
Sbjct  826  ANDSTSYSSTDGLLCGSIGYIAPEYGLGKRASTQGDVYSFGVLLLEIVTGKRPTDVLFHD  885

Query  578  SLSLHQYVKSE---QME-IVDCSLMRALKEQS-AEVMKMWEVAIRELIEVGMLCTQDCPS  742
              SLH++VKS+   ++E IV+ +L RA    +     ++W  AI ELIE+G++CTQ  P+
Sbjct  886  GSSLHEWVKSQYPNKLEPIVEQALTRATPPATPVNCSRIWRDAILELIELGLICTQYIPA  945

Query  743  TRPTMLDAADDLNRLKRYL  799
            TRP+MLD A+++ RLK+YL
Sbjct  946  TRPSMLDVANEMVRLKQYL  964



>gb|KDO62284.1| hypothetical protein CISIN_1g042568mg [Citrus sinensis]
Length=983

 Score =   280 bits (715),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 158/279 (57%), Positives = 200/279 (72%), Gaps = 9/279 (3%)
 Frame = +2

Query  2    KVLSMQT-GNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL + T G    SF RECQ+L+RIRHRNLIR+IT CS PDFKALVLP M+NGSL+  LY
Sbjct  697  KVLDLTTTGEITGSFKRECQILKRIRHRNLIRIITICSKPDFKALVLPLMSNGSLENHLY  756

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            P  H  S  L L+Q V ICSD+AEG+AYLHHHSP+KV+HCDLKPSN+LL+ED+TALV+DF
Sbjct  757  P-SHGLSHGLDLIQLVKICSDVAEGVAYLHHHSPIKVVHCDLKPSNILLDEDLTALVADF  815

Query  359  GISKLVMTTTGSGNA--DQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVL  532
            GI+KLV     S N   D     ST  +LCGS+GYIAPEYG G   ST GDVYSFGVL+L
Sbjct  816  GIAKLVKGIDESVNCANDSMSFTSTDGLLCGSVGYIAPEYGMGKRASTHGDVYSFGVLLL  875

Query  533  EMVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQSAEVM-----KMWEVAIR  697
            E+VT ++PTD  F    SLH++VK      +D  + +A+ + + + M     K+W   + 
Sbjct  876  EIVTGRRPTDVLFHDGSSLHEWVKRHYPHRLDPIVEKAIAKYAPQHMPIYYNKVWSDVVL  935

Query  698  ELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTT  814
            ELIE+G+LCTQ  PSTRP+MLD A ++ RLK+YL+  ++
Sbjct  936  ELIELGLLCTQYNPSTRPSMLDVAHEMGRLKQYLSSPSS  974



>ref|XP_006474611.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130-like [Citrus sinensis]
Length=983

 Score =   280 bits (715),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 158/279 (57%), Positives = 200/279 (72%), Gaps = 9/279 (3%)
 Frame = +2

Query  2    KVLSMQT-GNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL + T G    SF RECQ+L+RIRHRNLIR+IT CS PDFKALVLP M+NGSL+  LY
Sbjct  697  KVLDLTTAGEITGSFKRECQILKRIRHRNLIRIITICSKPDFKALVLPLMSNGSLENHLY  756

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            P  H  S  L L+Q V ICSD+AEG+AYLHHHSP+KV+HCDLKPSN+LL+ED+TALV+DF
Sbjct  757  PS-HGLSHGLDLIQLVKICSDVAEGVAYLHHHSPIKVVHCDLKPSNILLDEDLTALVADF  815

Query  359  GISKLVMTTTGSGNA--DQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVL  532
            GI+KLV     S N   D     ST  +LCGS+GYIAPEYG G   ST GDVYSFGVL+L
Sbjct  816  GIAKLVKGIDESVNCANDSMSFTSTDGLLCGSVGYIAPEYGMGKRASTHGDVYSFGVLLL  875

Query  533  EMVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQSAEVM-----KMWEVAIR  697
            E+VT ++PTD  F    SLH++VK      +D  + +A+ + + + M     K+W   + 
Sbjct  876  EIVTGRRPTDVLFHDGSSLHEWVKRHYPHRLDPIVEKAIAKYAPQHMPIYYNKVWSDVVL  935

Query  698  ELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTT  814
            ELIE+G+LCTQ  PSTRP+MLD A ++ RLK+YL+  ++
Sbjct  936  ELIELGLLCTQYNPSTRPSMLDVAHEMGRLKQYLSSPSS  974



>ref|XP_010273702.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Nelumbo nucifera]
Length=970

 Score =   279 bits (713),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 151/263 (57%), Positives = 193/263 (73%), Gaps = 10/263 (4%)
 Frame = +2

Query  38   SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYPHPHSGSSDLSLM  217
            SF RECQVL R RHRNL+R+IT CS PDFKALV P MANGSL+  LYP  H  S DLSL+
Sbjct  708  SFKRECQVLARTRHRNLMRIITTCSRPDFKALVFPLMANGSLETHLYPS-HRSSPDLSLV  766

Query  218  QRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFGISKLVMTTTGSG  397
            Q V+ICSD+AEG+AYLHHHSPV+V+HCDLKPSN+LL+ED+TALV+DFGI++LV      G
Sbjct  767  QLVSICSDVAEGVAYLHHHSPVRVVHCDLKPSNILLDEDLTALVTDFGIARLVKGGGEEG  826

Query  398  ----NADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMVTRKKPTDD  565
                  D     STA +LCGS+GYIAPEYG G   STKGDVYSFG+L+LE++T K+PTD 
Sbjct  827  AITRTIDSSTMGSTAGLLCGSVGYIAPEYGMGKRASTKGDVYSFGILLLEILTGKRPTDV  886

Query  566  TFGRSLSLHQYVKS----EQMEIVDCSLMRALKEQSAEVMKMWEVAIRELIEVGMLCTQD  733
             F +  SLH++VKS    +   I++ +L+R +   +  +   W   I ELIE+G++CTQ+
Sbjct  887  LFHQDSSLHEWVKSHYPNDLEPIIEEALLRFVPPVTP-LCDAWREIILELIELGLICTQN  945

Query  734  CPSTRPTMLDAADDLNRLKRYLT  802
             PS RP++LD A ++ RLK+YL 
Sbjct  946  SPSMRPSILDVALEIGRLKQYLA  968



>ref|XP_006453569.1| hypothetical protein CICLE_v10010652mg [Citrus clementina]
 gb|ESR66809.1| hypothetical protein CICLE_v10010652mg [Citrus clementina]
Length=983

 Score =   279 bits (713),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 158/279 (57%), Positives = 200/279 (72%), Gaps = 9/279 (3%)
 Frame = +2

Query  2    KVLSMQT-GNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL + T G    SF RECQ+L+RIRHRNLIR+IT CS PDFKALVLP M+NGSL+  LY
Sbjct  697  KVLDLTTTGEITGSFKRECQILKRIRHRNLIRIITICSKPDFKALVLPLMSNGSLENHLY  756

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            P  H  S  L L+Q V ICSD+AEG+AYLHHHSP+KV+HCDLKPSN+LL+ED+TALV+DF
Sbjct  757  PS-HGLSHGLDLIQLVKICSDVAEGVAYLHHHSPIKVVHCDLKPSNILLDEDLTALVADF  815

Query  359  GISKLVMTTTGSGNA--DQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVL  532
            GI+KLV     S N   D     ST  +LCGS+GYIAPEYG G   ST GDVYSFGVL+L
Sbjct  816  GIAKLVKGIDKSVNCANDSMSFTSTDGLLCGSVGYIAPEYGMGKRASTHGDVYSFGVLLL  875

Query  533  EMVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQSAEVM-----KMWEVAIR  697
            E+VT ++PTD  F    SLH++VK      +D  + +A+ + + + M     K+W   + 
Sbjct  876  EIVTGRRPTDVLFHDGSSLHEWVKRHYPYRLDPIVEKAIAKYAPQHMPIYYNKVWSDVVL  935

Query  698  ELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTT  814
            ELIE+G+LCTQ  PSTRP+MLD A ++ RLK+YL+  ++
Sbjct  936  ELIELGLLCTQYNPSTRPSMLDVAHEMGRLKQYLSSPSS  974



>ref|XP_002324522.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEF03087.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=860

 Score =   277 bits (708),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 152/275 (55%), Positives = 203/275 (74%), Gaps = 9/275 (3%)
 Frame = +2

Query  2    KVL-SMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL S + G   +SF RECQVL+R +HRNLI++IT CS PDFKALVLP M+NGSL+  LY
Sbjct  579  KVLDSKEDGEISRSFKRECQVLKRAKHRNLIKIITTCSKPDFKALVLPLMSNGSLEGHLY  638

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            P  H  ++ L L+Q V+IC+D+AEG+AYLHH+SPV+V+HCDLKPSN+LL+EDMTALV+DF
Sbjct  639  PS-HGLNTGLDLIQLVSICNDVAEGVAYLHHYSPVRVVHCDLKPSNILLDEDMTALVTDF  697

Query  359  GISKLVMTTTGSGNADQK--LGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVL  532
            GI++L+     S + D    L +S   +LCGS+GYIAPEYG G   ST+GDVYSFGVL+L
Sbjct  698  GIARLIKGADDSNSTDDSMFLSSSDHGLLCGSVGYIAPEYGMGKRASTQGDVYSFGVLLL  757

Query  533  EMVTRKKPTDDTFGRSLSLHQYVKS----EQMEIVDCSLMR-ALKEQSAEVMKMWEVAIR  697
            E++T ++PTD  F    SLH++VKS    +   IVD +++R A         K+W   I 
Sbjct  758  EIITGRRPTDVLFHEGSSLHEWVKSHYPHKLKPIVDQAVLRCAPSVMPVSYNKIWSDVIL  817

Query  698  ELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLT  802
            ELIE+G++CTQ+ PSTRP+MLD A+++  LK+YL+
Sbjct  818  ELIELGLVCTQNNPSTRPSMLDVANEMGSLKQYLS  852



>gb|KDP38712.1| hypothetical protein JCGZ_04065 [Jatropha curcas]
Length=956

 Score =   278 bits (710),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 155/277 (56%), Positives = 208/277 (75%), Gaps = 11/277 (4%)
 Frame = +2

Query  2    KVLSMQTGNSMK-SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL  +T   +  SF RECQVL+R RHRNLIR+IT CS PDFKALVLP M+NGSL+R LY
Sbjct  663  KVLDSKTAKEISGSFKRECQVLKRARHRNLIRIITICSKPDFKALVLPLMSNGSLERYLY  722

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            P  H  S+ L+L+Q V+ICSD+AEG+AYLHH+SPV+V+HCDLKPSN+LL++DMTALV+DF
Sbjct  723  PS-HGLSAKLNLIQLVSICSDVAEGIAYLHHYSPVRVVHCDLKPSNILLDDDMTALVTDF  781

Query  359  GISKL---VMTTTGSGNADQKLG-NSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVL  526
            GI++L   +     + NA+  +  +ST  +LCGS+GYIAPEYG G   ST+GDVYS+G+L
Sbjct  782  GIARLLKGIDENNATSNANDSVSFSSTDGLLCGSVGYIAPEYGIGRRVSTQGDVYSYGIL  841

Query  527  VLEMVTRKKPTDDTFGRSLSLHQYVKS---EQME-IVDCSLMR-ALKEQSAEVMKMWEVA  691
            +LE++  K+PTD  F    SLH++VKS    ++E IV+ +++R A    S    K+W   
Sbjct  842  LLEIIVGKRPTDVLFQEGSSLHEWVKSHYPRKLEPIVEEAMVRFAPLAISGYCNKIWSEV  901

Query  692  IRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLT  802
            I ELIE+G++CTQ  PSTRPTMLD A+++ RLK++L+
Sbjct  902  IVELIELGLMCTQYNPSTRPTMLDVANEMGRLKQFLS  938



>ref|XP_010525796.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Tarenaya hassleriana]
Length=988

 Score =   276 bits (707),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 149/261 (57%), Positives = 192/261 (74%), Gaps = 6/261 (2%)
 Frame = +2

Query  38   SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYPHPHSGSSDLSLM  217
            SF RECQ+L+R RHRNLIR+IT CS PDFKALVLP M NGSL+R LYP     S  L L+
Sbjct  712  SFKRECQILKRTRHRNLIRIITICSRPDFKALVLPLMPNGSLERHLYPKDGELSRKLDLI  771

Query  218  QRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFGISKLVMTTTGSG  397
            Q VNICSD+AEG+AYLHHHSPVKV+HCDLKPSN+L ++DMTALV+DFGIS+LV     + 
Sbjct  772  QLVNICSDVAEGVAYLHHHSPVKVVHCDLKPSNILPDDDMTALVTDFGISRLVKGIEETV  831

Query  398  NADQKLG-NSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMVTRKKPTDDTFG  574
            +AD  +  +ST  +LCGS+GYIAPEYG G   S  GDVYSFGVL+LE+VTR++PTD    
Sbjct  832  SADDSVSFSSTDGLLCGSVGYIAPEYGMGKRASIHGDVYSFGVLLLEIVTRRRPTDVMVN  891

Query  575  RSLSLHQYVKS---EQME-IVDCSLMRALKEQSAEVM-KMWEVAIRELIEVGMLCTQDCP  739
               SLH+++KS    ++E I++ +L++   +   E   K+W   + ELIE+G++CTQ CP
Sbjct  892  EGSSLHEFMKSHYPHKLEGIIEEALLKWRPKGKPESCDKLWHEIVLELIELGLICTQYCP  951

Query  740  STRPTMLDAADDLNRLKRYLT  802
            S RP MLD   ++ RLK Y++
Sbjct  952  SIRPNMLDVTHEMGRLKEYIS  972



>ref|XP_002309364.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE92887.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=981

 Score =   276 bits (706),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 150/274 (55%), Positives = 201/274 (73%), Gaps = 8/274 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMK-SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL  +T   +  SF RECQVL+R +HRNLI++IT CS PDFKALVLP M+NGSL+R LY
Sbjct  693  KVLDTKTAGEISGSFKRECQVLKRAKHRNLIKIITICSKPDFKALVLPLMSNGSLERHLY  752

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            P  H  ++ L L+Q V+IC+D+AEG+AYLHH+SPV+V+HCDLKPSN+LL+EDMTALV+DF
Sbjct  753  PS-HGLNTGLDLIQLVSICNDVAEGVAYLHHYSPVRVVHCDLKPSNILLDEDMTALVTDF  811

Query  359  GISKLVMTTTGSGNADQKLG-NSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLE  535
            GI++L+     S   D  +  +ST  +LCGS+GYIAPEYG G   ST+GDVYSFGVL+LE
Sbjct  812  GIARLIKGADDSNPTDDSVSFSSTDGLLCGSVGYIAPEYGMGKRASTQGDVYSFGVLLLE  871

Query  536  MVTRKKPTDDTFGRSLSLHQYVKSEQ----MEIVDCSLMR-ALKEQSAEVMKMWEVAIRE  700
            ++T ++PTD  F    SLH ++KS        IVD +++R A         K+W   I E
Sbjct  872  IITGRRPTDVLFHEGSSLHGWIKSHYPHNVKPIVDQAVLRFAPSGMPVYCNKIWSDVILE  931

Query  701  LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLT  802
            LIE+G++CTQ+ PSTRP+ML+ A+++  LK+YL+
Sbjct  932  LIELGLICTQNNPSTRPSMLEVANEMGSLKQYLS  965



>ref|XP_007013876.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY31495.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=989

 Score =   275 bits (702),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 161/287 (56%), Positives = 209/287 (73%), Gaps = 18/287 (6%)
 Frame = +2

Query  2    KVLSMQTGNSMK-SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL  +T   +  SF REC+VL+R RHRNLIR+IT CS PDFKALVLP M NGSL+R LY
Sbjct  703  KVLDTKTAGEISGSFKRECEVLKRTRHRNLIRIITICSKPDFKALVLPLMPNGSLERHLY  762

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            P  H  S  L+L Q VNICSD+AEG+AYLHHHSPVKV+HCDLKPSN+LL+EDMTALV+DF
Sbjct  763  PS-HGLSYGLNLSQLVNICSDVAEGVAYLHHHSPVKVVHCDLKPSNILLDEDMTALVTDF  821

Query  359  GISKLVMTTTGSGNADQKLGNSTAN-MLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLE  535
            GI++LV     S +A+  +  S+A+ +LCGS+GYIAPEYG G   ST+GDVYS+GVL+LE
Sbjct  822  GIARLVRGVDESISANDSISYSSADGLLCGSVGYIAPEYGMGKRASTQGDVYSYGVLLLE  881

Query  536  MVTRKKPTDDTFGRSLSLHQYVKS---EQME-IVDCSLMR-ALKEQSAEVMKMWEVAIRE  700
            +V+  +PTD       SLH++VKS    ++E IV+ +L+R +  E   +  +MW   I E
Sbjct  882  IVSGMRPTDH---EGTSLHEWVKSHYPHKLEAIVEQALIRCSPAEMPTKYDEMWRDVILE  938

Query  701  LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRY-------LTGDTTAT  820
            LIE+G++CTQ  P TRP+MLD A ++ RLK+Y       LTG+ ++T
Sbjct  939  LIELGLMCTQYNPLTRPSMLDVALEMGRLKQYLANPASMLTGEASST  985



>ref|XP_011033374.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Populus euphratica]
Length=981

 Score =   274 bits (700),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 146/274 (53%), Positives = 201/274 (73%), Gaps = 8/274 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMK-SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL  +T   +  SF RECQVL+R +HRNLI++IT CS PDFKALVLP M+NGSL+R LY
Sbjct  693  KVLDTKTAGEISGSFKRECQVLKRAKHRNLIKIITICSKPDFKALVLPLMSNGSLERHLY  752

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            P  H  ++ L L+Q V+IC+D+AEG+AYLHH+SPV+V+HCDLKPSN+LL+E+MTALV+DF
Sbjct  753  PS-HGLNTGLDLIQLVSICNDVAEGVAYLHHYSPVRVVHCDLKPSNILLDENMTALVTDF  811

Query  359  GISKLVMTTTGSGNADQKLG-NSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLE  535
            GI++L+     S   D  +  +ST  +LCGS+GYIAPEYG G   ST+GDVYSFG+L+LE
Sbjct  812  GIARLIKGADDSNPTDDSVSFSSTDGLLCGSVGYIAPEYGMGKRASTQGDVYSFGILLLE  871

Query  536  MVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQSAEVM-----KMWEVAIRE  700
            ++T ++PTD  F +  SLH ++KS     +   + RA+   +   M     K+W   I E
Sbjct  872  IITGRRPTDVLFHKGSSLHGWIKSHYPHKLKPIVARAVLRFAPSGMPVYYNKIWSDVILE  931

Query  701  LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLT  802
            LIE+G++CTQ+ PSTRP+ML+ A+++  LK+YL+
Sbjct  932  LIELGLICTQNNPSTRPSMLEIANEMGSLKQYLS  965



>ref|XP_006343728.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130-like [Solanum tuberosum]
Length=980

 Score =   273 bits (699),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 155/280 (55%), Positives = 201/280 (72%), Gaps = 10/280 (4%)
 Frame = +2

Query  2    KVLSMQTGNSMK-SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KV+  + G  +  SF RECQ+L+R RHRNLIR+IT CS PDFKALV P M+NGSL+  LY
Sbjct  696  KVIDTKGGGEISGSFKRECQILKRTRHRNLIRIITTCSRPDFKALVFPLMSNGSLENHLY  755

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            P  H     L L Q VNICSD+AEG++YLHH+SPVKV+HCDLKPSN+LL+ +MTALV+DF
Sbjct  756  P-SHGLRHQLDLAQLVNICSDVAEGVSYLHHYSPVKVVHCDLKPSNILLDYNMTALVTDF  814

Query  359  GISKLVMTTTGSGNA-DQKLG-NSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVL  532
            GIS LV     + N  D+ +  NST  +LCGSIGYIAPEYG G   STKGDV+SFGVL+L
Sbjct  815  GISTLVKAVEENTNPIDESVNYNSTDGLLCGSIGYIAPEYGMGRRASTKGDVFSFGVLLL  874

Query  533  EMVTRKKPTDDTFGRSLSLHQYVKSE---QME-IVDCSLMRALKEQSAEVMKMWEVAIRE  700
            E+VT K+PTD  F +  SLH++VKS+   ++E ++D +L R    Q      +W   + E
Sbjct  875  EIVTGKRPTDVLFQQGSSLHEWVKSQYSHKLEAMIDEALQRCTTVQRDS--NLWHDIVLE  932

Query  701  LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTAT  820
            LIE+G++CTQ  PSTRPTMLD A ++ RLK+Y++  + + 
Sbjct  933  LIELGLMCTQYNPSTRPTMLDVALEIGRLKQYVSSSSNSV  972



>ref|XP_006857038.1| hypothetical protein AMTR_s00065p00025040 [Amborella trichopoda]
 gb|ERN18505.1| hypothetical protein AMTR_s00065p00025040 [Amborella trichopoda]
Length=969

 Score =   273 bits (698),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 151/276 (55%), Positives = 206/276 (75%), Gaps = 9/276 (3%)
 Frame = +2

Query  2    KVLSMQ-TGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL +Q T ++ KSF REC+VL+RIRHRNLI++ITACS PDFKALVLP+MANGSL+  LY
Sbjct  691  KVLDLQVTESNTKSFERECRVLKRIRHRNLIKIITACSKPDFKALVLPFMANGSLETHLY  750

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
              P  G   LSL++ V+ICSDIAEG+AYLHHH+PV+VIHCDLKPSNVLL+E+M ALV+DF
Sbjct  751  -GPQGG---LSLVRVVHICSDIAEGVAYLHHHAPVRVIHCDLKPSNVLLDEEMGALVADF  806

Query  359  GISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEM  538
            G+++L    +G+  +++    S   +LCGSIGYIAPEYG G + ST+GDVYSFG+LVLEM
Sbjct  807  GVARL--AGSGAMGSEEVSSGSGTGLLCGSIGYIAPEYGLGRNASTEGDVYSFGILVLEM  864

Query  539  VTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMR--ALKEQSAEVMKMWEVAIRELIEV  712
            VT ++P D TF + L+L  +VK      +D  + R  ++++++    ++  +   ELIE+
Sbjct  865  VTGRRPVDLTFQQGLTLQDWVKGHYPHNMDPIIERTVSIEDETLSSPRLRRLIAIELIEL  924

Query  713  GMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTAT  820
            G+LCTQ  P  RPTM++ AD+L RLK+++  + T T
Sbjct  925  GLLCTQRTPKKRPTMMEIADELGRLKQFIAEENTTT  960



>ref|XP_010273699.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Nelumbo nucifera]
Length=983

 Score =   271 bits (693),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 153/277 (55%), Positives = 198/277 (71%), Gaps = 20/277 (7%)
 Frame = +2

Query  38   SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYPHPHSGSSDLSLM  217
            SF RECQVL+R RHRNLIR+ITACS P+FKALV P M NGSL+  LYP  HS   +LSL 
Sbjct  707  SFKRECQVLKRTRHRNLIRVITACSSPEFKALVFPLMPNGSLETHLYPS-HSSGPNLSLA  765

Query  218  QRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFGISKLVMTTTGSG  397
            Q V+ICSD+AEG+AYLHHH PV+V+HCDLKPSN+LL+EDMTALV+DFGI++LV      G
Sbjct  766  QLVSICSDVAEGVAYLHHHCPVRVVHCDLKPSNILLDEDMTALVTDFGIARLVK----GG  821

Query  398  NADQKLG---------NSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMVTRK  550
              D+ +          +STA +L GS GYIAPEYG G  +STKGD+YSFGVL+LE++T K
Sbjct  822  GEDEAITRTIDSLSTMDSTAGLLYGSFGYIAPEYGMGKRSSTKGDIYSFGVLILEILTGK  881

Query  551  KPTDDTFGRSLSLHQYVK---SEQME-IVDCSLMRALKEQSAE--VMKMWEVAIRELIEV  712
            +PTD  F +  SLH++VK   S+ +E I++ +L+R     +        W+  I ELIE+
Sbjct  882  RPTDVMFHQGSSLHEWVKRRYSDDLEPIMEEALLRFAPPPTPRNHSSNAWKQIILELIEL  941

Query  713  GMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATF  823
            G++CTQ+ PS RP+ LD A +++RLK+YL   TT T 
Sbjct  942  GLICTQNSPSMRPSTLDVALEIDRLKQYLANPTTLTL  978



>ref|XP_008394281.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Malus domestica]
Length=984

 Score =   271 bits (693),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 150/281 (53%), Positives = 206/281 (73%), Gaps = 10/281 (4%)
 Frame = +2

Query  2    KVLSMQT-GNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL ++T G+++ +F REC+VL+R RHRNLIR+ITACS PDFKALVLP M+NGSL+  LY
Sbjct  695  KVLDLKTDGDNLGTFKRECRVLKRTRHRNLIRIITACSRPDFKALVLPLMSNGSLESHLY  754

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            P  H     L+L+Q V+ICSD+AEG+AYLHHHSP +V+HCDLKPSN+LL+EDMTALV+DF
Sbjct  755  PS-HGLKDQLNLIQLVSICSDVAEGVAYLHHHSPXRVVHCDLKPSNILLDEDMTALVTDF  813

Query  359  GISKLVMTTTGSGNADQKLGNSTAN-MLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLE  535
            GI++LV      G  +     S+A+ +LCGSIGYIAPEY  G + ST+GDV+S+GVL+LE
Sbjct  814  GIARLVKGGDEKGPTNDSASFSSADGLLCGSIGYIAPEYAMGKTISTEGDVFSYGVLLLE  873

Query  536  MVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQSAEVM-----KMWEVAIRE  700
            +VT ++PTD       +LH++VKS+    +D  + +AL   +A++M     K+W   + E
Sbjct  874  IVTGRRPTDVLVHEGSTLHEWVKSQYPRRLDPIVQQALDRCAADLMPXQYNKVWRDVVLE  933

Query  701  LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATF  823
            LIE+G++CTQ  PS RP M D A ++ RLK Y++  + A+F
Sbjct  934  LIELGLICTQYNPSMRPNMQDIAHEIGRLKDYIS--SPASF  972



>ref|XP_011069586.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Sesamum indicum]
Length=977

 Score =   271 bits (692),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 161/286 (56%), Positives = 199/286 (70%), Gaps = 12/286 (4%)
 Frame = +2

Query  2    KVL-SMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL S   G  + SF RECQVL+R RHRNLIR+IT CS PDFKALVLP M NGSL+  LY
Sbjct  692  KVLHSKAAGEILGSFKRECQVLKRTRHRNLIRIITTCSRPDFKALVLPLMPNGSLEDHLY  751

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            P  H     L L+Q V ICSD+AEG+AYLHH++PVKV+HCDLKPSN+LL++DMTALV+DF
Sbjct  752  PR-HGLKHGLDLVQLVRICSDVAEGMAYLHHYAPVKVVHCDLKPSNILLDDDMTALVTDF  810

Query  359  GISKLVMTTTGSGNADQKLG-NSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLE  535
            GI++LV     SG  D     +ST  +LCGS+GYIAPEYG G   ST+GDVYSFGVL+LE
Sbjct  811  GIARLVKGADESGFVDDSASYDSTDGLLCGSVGYIAPEYGMGKHASTQGDVYSFGVLLLE  870

Query  536  MVTRKKPTDDTFGRSLSLHQYVKSE---QME-IVDCSLMRALKEQSAEV---MKMWEVAI  694
            MV  K+PTD  F    SLH+ VKS    ++E IV+ +++R     SA V    K+W   I
Sbjct  871  MVMGKRPTDVLFQEGSSLHECVKSRYPNKLETIVEAAVVRY--APSALVPYDRKIWADVI  928

Query  695  RELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASS  832
             ELIE+G++CTQ  PS RP MLD A +++ LK+YL   +T     S
Sbjct  929  LELIELGLICTQYNPSARPPMLDVAHEISLLKQYLCSPSTLVIEQS  974



>ref|XP_004288728.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130-like [Fragaria vesca subsp. 
vesca]
Length=996

 Score =   270 bits (691),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 150/292 (51%), Positives = 206/292 (71%), Gaps = 8/292 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMK-SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL ++T   +  SF RECQVL+R RHRNLIR+ITACS PDFKALVLP M+NGSL+R LY
Sbjct  706  KVLDLKTEEEISGSFKRECQVLKRTRHRNLIRIITACSRPDFKALVLPLMSNGSLERHLY  765

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
                S    L+L+Q V+ICSD+AEG+AYLHHHSPV+V+HCDLKPSN+LL++DMTALV+DF
Sbjct  766  SSS-SSHCGLNLIQLVSICSDVAEGVAYLHHHSPVRVVHCDLKPSNILLDDDMTALVTDF  824

Query  359  GISKLVMTTTGS-GNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLE  535
            GI++LV     +    D    NS   +LCGSIGYIAPEYG G   ST+GDV+SFGVL+LE
Sbjct  825  GIARLVKGEDETIAMTDSTSFNSADGLLCGSIGYIAPEYGMGKCASTQGDVFSFGVLLLE  884

Query  536  MVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQSAEVM-----KMWEVAIRE  700
            +VT ++PTD  F +  SL +++KS+  + ++  + +A++  +   +     K+W   I E
Sbjct  885  IVTGRRPTDVDFHKGSSLQEWIKSQYPQRLEPIVQQAVERCAPRSIPKHYNKIWGDVILE  944

Query  701  LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTL  856
            LIE+G++CTQ  PS RP M D A +++R+K Y++  ++A     + I   +L
Sbjct  945  LIEIGLMCTQHNPSLRPNMQDVAHEMSRVKEYISNPSSALLIEEVDIKVDSL  996



>ref|XP_004242993.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Solanum lycopersicum]
Length=980

 Score =   270 bits (690),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 156/280 (56%), Positives = 199/280 (71%), Gaps = 10/280 (4%)
 Frame = +2

Query  2    KVLSMQTGNSMK-SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KV+  + G  +  SF RECQ+L+R RHRNLIR+IT CS PDFKALV P M NGSL+  LY
Sbjct  696  KVIDTKGGGEISGSFKRECQILKRTRHRNLIRIITTCSRPDFKALVFPLMPNGSLENHLY  755

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            P  H     L L Q VNICSD+AEG++YLHH+SPVKV+HCDLKPSN+LL+ +MTALV+DF
Sbjct  756  P-SHGLRHQLDLAQLVNICSDVAEGVSYLHHYSPVKVVHCDLKPSNILLDYNMTALVTDF  814

Query  359  GISKLVMTTTGSGNA-DQKLG-NSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVL  532
            GIS LV     + N  D+ +  NST  +LCGSIGYIAPEYG G   STKGDV+SFGVLVL
Sbjct  815  GISTLVKAVEENTNPIDESVTYNSTDGLLCGSIGYIAPEYGMGRRASTKGDVFSFGVLVL  874

Query  533  EMVTRKKPTDDTFGRSLSLHQYVKSE---QME-IVDCSLMRALKEQSAEVMKMWEVAIRE  700
            E+VT K+PTD  F +  SLH++VKS+   ++E ++D  L R    Q      +W   + E
Sbjct  875  EIVTGKRPTDVLFQQGSSLHEWVKSQYSHKLEAMIDEVLQRCRIVQRDS--NIWHDIVLE  932

Query  701  LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTAT  820
            LIE+G++CTQ  PSTRPTMLD A ++ RLK+Y++  + + 
Sbjct  933  LIELGLMCTQYNPSTRPTMLDVALEIGRLKQYVSTSSNSV  972



>ref|XP_010472414.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Camelina sativa]
Length=991

 Score =   270 bits (690),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 151/273 (55%), Positives = 196/273 (72%), Gaps = 8/273 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMK-SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL  +T      SF RECQ+L+R +HRNLIR+IT CS P FKALVLP M NGSL+R LY
Sbjct  700  KVLDPKTAMEFSGSFKRECQILKRTKHRNLIRIITTCSKPGFKALVLPLMQNGSLERHLY  759

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            P  +S S +L L+Q VNICSD+AEG+AYLHH+SPVKV+HCDLKPSN+LL+++MTALV+DF
Sbjct  760  PGEYS-SKNLDLIQLVNICSDVAEGIAYLHHYSPVKVVHCDLKPSNILLDDEMTALVTDF  818

Query  359  GISKLVMTTTGSGNADQKLG-NSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLE  535
            GIS+ V +   + + D  +   S   +LCGS+GYIAPEYG G   ST GDVYSFGVL+LE
Sbjct  819  GISRFVQSVEETVSTDDSVSFGSPDGLLCGSVGYIAPEYGMGKRASTHGDVYSFGVLLLE  878

Query  536  MVTRKKPTDDTFGRSLSLHQYVKS---EQME-IVDCSLMRALKEQSAEVMKM-WEVAIRE  700
            +V+ ++PTD       SLH+++KS     +E I++ +L+R   +   E  KM W   I E
Sbjct  879  IVSGRRPTDVLVNEGSSLHEFMKSHYPNSLEGIIEQALLRWKPQGKPERCKMLWREVIME  938

Query  701  LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYL  799
            +IE+G++CTQ  PSTRP MLD A ++ RLK YL
Sbjct  939  MIELGLICTQYNPSTRPDMLDVAHEMGRLKEYL  971



>ref|XP_009358564.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Pyrus x bretschneideri]
Length=983

 Score =   270 bits (690),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 150/281 (53%), Positives = 206/281 (73%), Gaps = 10/281 (4%)
 Frame = +2

Query  2    KVLSMQT-GNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL ++T G+ + +F REC+VL+R RHRNLIR+ITACS P+FKALVLP M+NGSL+  LY
Sbjct  694  KVLDLKTDGDILGTFKRECRVLKRTRHRNLIRIITACSRPNFKALVLPLMSNGSLESHLY  753

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            P  H     L+L+Q V+ICSD+AEG+AYLHHHSPV+V+HCDLKPSN+LL+EDMTALV+DF
Sbjct  754  PS-HGLKDQLNLIQLVSICSDVAEGVAYLHHHSPVRVVHCDLKPSNILLDEDMTALVTDF  812

Query  359  GISKLVMTTTGSGNADQKLGNSTAN-MLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLE  535
            GI++LV      G  +     S+A+ +LCGSIGYIAPEY  G + ST+GDV+S+GVL+LE
Sbjct  813  GIARLVKGGDEKGPTNDSASFSSADGLLCGSIGYIAPEYAMGKTISTEGDVFSYGVLLLE  872

Query  536  MVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQSAEVM-----KMWEVAIRE  700
            +VT ++PTD       +LH++VKS+    +D  + +AL   +A++M     K+W   + E
Sbjct  873  IVTGRRPTDVLVHEGSTLHEWVKSQYPRRLDPIVQQALDRCAADLMPKQCNKVWRDVVLE  932

Query  701  LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATF  823
            LIE+G++CTQ  PS RP M D A ++ RLK Y++  + A+F
Sbjct  933  LIELGLICTQYNPSMRPNMQDIAHEIGRLKDYIS--SPASF  971



>ref|XP_011069651.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Sesamum indicum]
Length=975

 Score =   270 bits (690),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 160/283 (57%), Positives = 199/283 (70%), Gaps = 8/283 (3%)
 Frame = +2

Query  2    KVL-SMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL S   G    SF RECQVL+R RHRNLIR+IT CS PDFKALVLP M NGSL+  LY
Sbjct  692  KVLHSKAAGEISGSFKRECQVLKRTRHRNLIRIITTCSRPDFKALVLPLMPNGSLEDHLY  751

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            P  H   + L L+Q V ICSD+AEG+AYLHH+SPVKV+HCDLKPSN+LL++DMTALV+DF
Sbjct  752  PS-HGLKNGLDLVQLVRICSDVAEGMAYLHHYSPVKVVHCDLKPSNILLDDDMTALVTDF  810

Query  359  GISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEM  538
            GI++LV    G  +     G ST  +LCGS+GYIAPEYG G   S +GDVYSFGVL+LEM
Sbjct  811  GIARLVKGADGFLDDSASYG-STDGLLCGSVGYIAPEYGMGKHASPQGDVYSFGVLLLEM  869

Query  539  VTRKKPTDDTFGRSLSLHQYVKSE---QME-IVDCSLMR-ALKEQSAEVMKMWEVAIREL  703
            VT K+PTD  F    S H++VKS    ++E IV+ +++R A +       K+W   I EL
Sbjct  870  VTGKRPTDVLFQEGSSSHEWVKSRYPNKLEPIVEEAMVRYAPRALVPYDRKIWTDVILEL  929

Query  704  IEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASS  832
            IE+G++CTQ  PSTRPTMLD A +++ LK+YL   +T     S
Sbjct  930  IELGLICTQYNPSTRPTMLDVAHEISLLKQYLCTPSTLLIEQS  972



>ref|XP_009766149.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Nicotiana sylvestris]
Length=982

 Score =   270 bits (690),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 155/274 (57%), Positives = 201/274 (73%), Gaps = 10/274 (4%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KV+  +T    +SF RECQ+L+R RHRNLIR+IT CS PDFKALV P M+NGSL+  LYP
Sbjct  698  KVIDSKTAG--ESFKRECQILKRTRHRNLIRIITTCSRPDFKALVFPLMSNGSLENHLYP  755

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
                    L L Q V+ICSD+AEG+AYLHH+SPVKV+HCDLKPSN+LL+ +MTALV+DFG
Sbjct  756  S-DGLRHQLDLAQVVSICSDVAEGVAYLHHYSPVKVVHCDLKPSNILLDYNMTALVTDFG  814

Query  362  ISKLVMTTTGSGN-ADQKLG-NSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLE  535
            IS+LV     + N  D+ +  NST  +LCGSIGYIAPEYG G   STKGDVYSFGVL+LE
Sbjct  815  ISRLVKAAEENINHIDESVSYNSTDGLLCGSIGYIAPEYGMGKRASTKGDVYSFGVLLLE  874

Query  536  MVTRKKPTDDTFGRSLSLHQYVKSE---QME-IVDCSLMRALKEQSAEV-MKMWEVAIRE  700
            +VT K+PTD  F +  SLH++VKS+   ++E ++D +L R  +  +     KMW   + E
Sbjct  875  IVTGKRPTDILFQQGSSLHEWVKSQYPHKLEPMIDETLQRYPQGDTVPSDSKMWRDIVFE  934

Query  701  LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLT  802
            LIE+G++CTQ  PSTRPTM+D A ++ RLK+Y++
Sbjct  935  LIELGLMCTQYNPSTRPTMMDVALEIGRLKQYIS  968



>emb|CDP02847.1| unnamed protein product [Coffea canephora]
Length=740

 Score =   266 bits (679),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 151/277 (55%), Positives = 194/277 (70%), Gaps = 11/277 (4%)
 Frame = +2

Query  2    KVLS-MQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL+ +  G    SF REC+VLRR RHRNLIR+ T CS PDFKALVLP M NGSL+  LY
Sbjct  448  KVLTPIAAGEISGSFKRECEVLRRTRHRNLIRIKTICSRPDFKALVLPLMPNGSLENHLY  507

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            P P      L L+Q V+IC+D+AEG+AYLHHHSPVKV+HCDLKPSN+LL+ DMTA+V+DF
Sbjct  508  PSPEM-KHGLDLIQLVSICNDVAEGMAYLHHHSPVKVVHCDLKPSNILLDVDMTAMVTDF  566

Query  359  GISKLVM-TTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLE  535
            GIS+L+      +   D    +ST  +LCGS+GYIAPEYG G   ST+GDVYS+GVL+LE
Sbjct  567  GISRLIKGVDEHTSINDSASFSSTQGLLCGSVGYIAPEYGMGRRASTQGDVYSYGVLLLE  626

Query  536  MVTRKKPTDDTFGRSLSLHQYVKS----EQMEIVDCSLMRALKEQSAEVM----KMWEVA  691
            +VT K+PTD  F    SLH++VKS    +   IV+ ++MR     +  +     K W   
Sbjct  627  IVTGKRPTDVLFQEGSSLHEWVKSFYPNKFQPIVEEAVMRLSPSYAPPITNDQSKRWREV  686

Query  692  IRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLT  802
            I E++E+G++CTQ  PSTRPTMLD A ++ +LK YL+
Sbjct  687  ILEMLELGLICTQYNPSTRPTMLDIAHEVGQLKEYLS  723



>ref|XP_002528406.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF33999.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=960

 Score =   268 bits (686),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 153/280 (55%), Positives = 205/280 (73%), Gaps = 14/280 (5%)
 Frame = +2

Query  2    KVLSMQTGNSMK-SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL  +T  ++  SF RECQVL+R RHRNLIR+IT CS PDFKALVLP M+NGSL+R LY
Sbjct  670  KVLDSKTAGAISGSFKRECQVLKRARHRNLIRIITICSKPDFKALVLPLMSNGSLERYLY  729

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            P  H  +S L L+Q V+ICSD+AEG+AYLHH+SPV+V+HCDLKPSN++L++DMTALV+DF
Sbjct  730  PS-HGLNSGLDLVQLVSICSDVAEGVAYLHHYSPVRVVHCDLKPSNIVLDDDMTALVTDF  788

Query  359  GISKLV-------MTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSF  517
            GI++L+         +  +   D    +ST  +LCGS+GYIAPEYG G   ST+GDVYSF
Sbjct  789  GIARLIKGIDYENNNSNNTPANDSVSFSSTDCLLCGSLGYIAPEYGMGKRASTQGDVYSF  848

Query  518  GVLVLEMVTRKKPTDDTFGRSLSLHQYVKS---EQME-IVDCSLMR-ALKEQSAEVMKMW  682
            GVL+LE++  K+PTD  F    SLH++VKS    ++E IV  +++R A     +   K+W
Sbjct  849  GVLLLEIIAGKRPTDLLFHEGSSLHEWVKSHYPHKLENIVKQAILRCAPSAMPSYCNKIW  908

Query  683  EVAIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLT  802
               I ELIE+G++CTQ+ PSTRP+MLD A ++ RLK++L+
Sbjct  909  GDVILELIELGLMCTQNNPSTRPSMLDVAQEMGRLKQFLS  948



>ref|XP_011018067.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Populus euphratica]
Length=974

 Score =   268 bits (686),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 151/274 (55%), Positives = 204/274 (74%), Gaps = 8/274 (3%)
 Frame = +2

Query  2    KVL-SMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL S   G    SF RECQVL+R +HRNLI++IT CS PDFKALVLP M+NGSL+  LY
Sbjct  694  KVLDSKAAGEISGSFKRECQVLKRAKHRNLIKIITICSKPDFKALVLPLMSNGSLEGHLY  753

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            P  H  ++ L L+Q V+IC+D+AEG+AYLHH+SPV+V+HCDLKPSN+LL+EDMTALV+DF
Sbjct  754  PS-HGLNTGLDLIQLVSICNDVAEGVAYLHHYSPVRVVHCDLKPSNILLDEDMTALVTDF  812

Query  359  GISKLVMTTTGSGNADQKLGNSTAN-MLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLE  535
            GI++L+  +  S + D  +  S+++ +LCGS+GYIAPEYG G   ST+GDVYSFGVL+LE
Sbjct  813  GIARLIKGSDDSNSTDDSVFLSSSDGLLCGSVGYIAPEYGMGKRASTQGDVYSFGVLLLE  872

Query  536  MVTRKKPTDDTFGRSLSLHQYVKS----EQMEIVDCSLMR-ALKEQSAEVMKMWEVAIRE  700
            ++T ++PTD  F    SLH++VKS    +   IVD +++R A         K+W   I E
Sbjct  873  IITGRRPTDVLFHEGSSLHEWVKSHYPHKLKHIVDQAVLRCAPSVMPVSYNKIWSDVILE  932

Query  701  LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLT  802
            LIE+G++CTQ+ PSTRP+MLD A+++  LK+YL+
Sbjct  933  LIELGIVCTQNNPSTRPSMLDVANEMGSLKQYLS  966



>emb|CDX76833.1| BnaC08g34190D [Brassica napus]
Length=887

 Score =   268 bits (684),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 151/273 (55%), Positives = 193/273 (71%), Gaps = 8/273 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMK-SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL  +T      SF RECQ+L+R RHRNLIR+IT CS P FKALVLP M NGSL+R LY
Sbjct  596  KVLDPKTAVEFSGSFKRECQILKRTRHRNLIRIITTCSKPGFKALVLPLMPNGSLERHLY  655

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            P  +S S  L L+Q V+ICSD+AEG+AYLHH+SPVKV+HCDLKPSN+LL++DMTALV+DF
Sbjct  656  PGEYS-SRSLDLVQLVSICSDVAEGIAYLHHYSPVKVVHCDLKPSNILLDDDMTALVTDF  714

Query  359  GISKLVMTTTGSGNADQKLG-NSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLE  535
            GIS+LV     + + D  +   ST  +LCGS+GYIAPEYG G   S  GDVYSFGVL+LE
Sbjct  715  GISRLVQGVEDTVSTDDSVSFGSTDGLLCGSVGYIAPEYGMGRRASIHGDVYSFGVLLLE  774

Query  536  MVTRKKPTDDTFGRSLSLHQYVKSEQME----IVDCSLMRALKEQSAEVM-KMWEVAIRE  700
            +V+ ++PTD       SLH+++KS        I++ +L+R   +   E   K+W   I E
Sbjct  775  IVSGRRPTDVAVNGGSSLHEFIKSHYPNSLEGIIEQALIRWKPQGKPERCDKLWREVILE  834

Query  701  LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYL  799
            +IE+G++CTQ  PSTRP MLD A ++ RLK YL
Sbjct  835  MIELGLVCTQYTPSTRPNMLDVAHEMGRLKEYL  867



>ref|XP_006296083.1| hypothetical protein CARUB_v10025233mg [Capsella rubella]
 gb|EOA28981.1| hypothetical protein CARUB_v10025233mg [Capsella rubella]
Length=982

 Score =   268 bits (686),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 150/273 (55%), Positives = 195/273 (71%), Gaps = 8/273 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMK-SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL  +T      SF RECQ+L+R +HRNLIR+IT CS P FKALVLP M NGSL+R LY
Sbjct  691  KVLDPKTAVEFSGSFKRECQILKRTKHRNLIRIITTCSKPGFKALVLPLMPNGSLERHLY  750

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            P  +S S +L L+Q VNICSD+AEG+AYLHH+SPVKV+HCDLKPSN+LL+++MTALV+DF
Sbjct  751  PGDYS-SKNLDLIQLVNICSDVAEGIAYLHHYSPVKVVHCDLKPSNILLDDEMTALVTDF  809

Query  359  GISKLVMTTTGSGNADQKLG-NSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLE  535
            GIS+LV     + + D  +   ST  +LCGS+GYI PEYG G   ST GDVYSFGVL+LE
Sbjct  810  GISRLVQGLEETVSTDDSVSFGSTDGLLCGSVGYIPPEYGMGKRASTHGDVYSFGVLLLE  869

Query  536  MVTRKKPTDDTFGRSLSLHQYVKSEQME----IVDCSLMRALKEQSAE-VMKMWEVAIRE  700
            +V+ ++PTD       SLH+++KS        I++ +L+R   +   E   K+W+  I E
Sbjct  870  IVSGRRPTDVLVNEGSSLHEFMKSHYPNSLEGIIEQALIRWKPQGKPERCEKLWKEVIME  929

Query  701  LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYL  799
            +IE+G++CTQ  PSTRP MLD A ++ RLK YL
Sbjct  930  MIELGLICTQYNPSTRPDMLDVAHEMGRLKEYL  962



>ref|XP_007204786.1| hypothetical protein PRUPE_ppa018417mg [Prunus persica]
 gb|EMJ05985.1| hypothetical protein PRUPE_ppa018417mg [Prunus persica]
Length=985

 Score =   268 bits (685),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 152/281 (54%), Positives = 200/281 (71%), Gaps = 14/281 (5%)
 Frame = +2

Query  2    KVLSMQT-GNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL ++T G  + SF RECQVL+R RHRNLIR+ITACS PDFKALVLP M+NGSL+R LY
Sbjct  696  KVLDLKTDGEILGSFKRECQVLKRTRHRNLIRIITACSRPDFKALVLPLMSNGSLERHLY  755

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
               H  S  L+L+Q V+IC+D+AEG+AYLHHHSPV+V+HCDLKPSN+LL++DMTALV+DF
Sbjct  756  SS-HGLSHGLNLIQLVSICNDVAEGVAYLHHHSPVRVVHCDLKPSNILLDDDMTALVTDF  814

Query  359  GISKLVMTTTGSGN----ADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVL  526
            GI++LV    GSG      D    +S   +LCGSIGYIAPEYG G   S +GDV+SFGVL
Sbjct  815  GIARLV---KGSGENIPTNDSTSFSSADGLLCGSIGYIAPEYGMGKCASIEGDVFSFGVL  871

Query  527  VLEMVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQSAEVM-----KMWEVA  691
            +LE+VT ++PTD       SLH++VKS     VD  + +A+     + M     K+W   
Sbjct  872  LLEIVTGRRPTDVLLHEGSSLHEWVKSHYPSRVDSIVQQAIDRCVPDSMPKQYNKIWWDV  931

Query  692  IRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTT  814
            + ELIE+G++CTQ  PS RP+M D A ++ R+K Y++  ++
Sbjct  932  VLELIELGLMCTQYNPSMRPSMQDVAHEMGRVKEYISNPSS  972



>ref|XP_009117245.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Brassica rapa]
Length=992

 Score =   268 bits (684),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 151/273 (55%), Positives = 193/273 (71%), Gaps = 8/273 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMK-SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL  +T      SF RECQ+L+R RHRNLIR+IT CS P FKALVLP M NGSL+R LY
Sbjct  701  KVLDPKTAVEFSGSFKRECQILKRTRHRNLIRIITTCSKPGFKALVLPLMQNGSLERHLY  760

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            P  +S S  L L+Q V+ICSD+AEG+AYLHH+SPVKV+HCDLKPSN+LL++DMTALV+DF
Sbjct  761  PGEYS-SRSLDLVQLVSICSDVAEGIAYLHHYSPVKVVHCDLKPSNILLDDDMTALVTDF  819

Query  359  GISKLVMTTTGSGNADQKLG-NSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLE  535
            GIS+LV     + + D  +   ST  +LCGS+GYIAPEYG G   S  GDVYSFGVL+LE
Sbjct  820  GISRLVQGVEDTVSTDDSVSFGSTDGLLCGSVGYIAPEYGMGRRASIHGDVYSFGVLLLE  879

Query  536  MVTRKKPTDDTFGRSLSLHQYVKSEQME----IVDCSLMRALKEQSAEVM-KMWEVAIRE  700
            +V+ ++PTD       SLH+++KS        I++ +L+R   +   E   K+W   I E
Sbjct  880  IVSGRRPTDVAVNGGSSLHEFIKSHYPNSLEGIIEQALIRWKPQGKPERCDKLWREVILE  939

Query  701  LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYL  799
            +IE+G++CTQ  PSTRP MLD A ++ RLK YL
Sbjct  940  MIELGLVCTQYTPSTRPNMLDVAHEMGRLKEYL  972



>emb|CDY34795.1| BnaA09g41620D [Brassica napus]
Length=979

 Score =   268 bits (684),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 151/273 (55%), Positives = 193/273 (71%), Gaps = 8/273 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMK-SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL  +T      SF RECQ+L+R RHRNLIR+IT CS P FKALVLP M NGSL+R LY
Sbjct  688  KVLDPKTAVEFSGSFKRECQILKRTRHRNLIRIITTCSKPGFKALVLPLMPNGSLERHLY  747

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            P  +S S  L L+Q V+ICSD+AEG+AYLHH+SPVKV+HCDLKPSN+LL++DMTALV+DF
Sbjct  748  PGEYS-SRSLDLVQLVSICSDVAEGIAYLHHYSPVKVVHCDLKPSNILLDDDMTALVTDF  806

Query  359  GISKLVMTTTGSGNADQKLG-NSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLE  535
            GIS+LV     + + D  +   ST  +LCGS+GYIAPEYG G   S  GDVYSFGVL+LE
Sbjct  807  GISRLVQGVEDTVSTDDSVSFGSTDGLLCGSVGYIAPEYGMGRRASIHGDVYSFGVLLLE  866

Query  536  MVTRKKPTDDTFGRSLSLHQYVKSEQME----IVDCSLMRALKEQSAEVM-KMWEVAIRE  700
            +V+ ++PTD       SLH+++KS        I++ +L+R   +   E   K+W   I E
Sbjct  867  IVSGRRPTDVAVNGGSSLHEFIKSHYPNSLEGIIEQALIRWKPQGKPERCDKLWREVILE  926

Query  701  LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYL  799
            +IE+G++CTQ  PSTRP MLD A ++ RLK YL
Sbjct  927  MIELGLVCTQYTPSTRPNMLDVAHEMGRLKEYL  959



>ref|NP_179990.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Arabidopsis thaliana]
 sp|Q9ZUI0.1|Y2241_ARATH RecName: Full=Putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD03374.1| putative receptor-like protein kinase [Arabidopsis thaliana]
 gb|AEC07532.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Arabidopsis thaliana]
Length=980

 Score =   268 bits (684),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 145/260 (56%), Positives = 189/260 (73%), Gaps = 7/260 (3%)
 Frame = +2

Query  38   SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYPHPHSGSSDLSLM  217
            SF RECQ+L+R RHRNLIR+IT CS P F ALVLP M NGSL+R LYP  +S S +L L+
Sbjct  702  SFKRECQILKRTRHRNLIRIITTCSKPGFNALVLPLMPNGSLERHLYPGEYS-SKNLDLI  760

Query  218  QRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFGISKLVMTTTGSG  397
            Q VNICSD+AEG+AYLHH+SPVKV+HCDLKPSN+LL+++MTALV+DFGIS+LV     + 
Sbjct  761  QLVNICSDVAEGIAYLHHYSPVKVVHCDLKPSNILLDDEMTALVTDFGISRLVQGVEETV  820

Query  398  NADQKLG-NSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMVTRKKPTDDTFG  574
            + D  +   ST  +LCGS+GYIAPEYG G   ST GDVYSFGVL+LE+V+ ++PTD    
Sbjct  821  STDDSVSFGSTDGLLCGSVGYIAPEYGMGKRASTHGDVYSFGVLLLEIVSGRRPTDVLVN  880

Query  575  RSLSLHQYVKSEQMEIVDCSLMRALKE-----QSAEVMKMWEVAIRELIEVGMLCTQDCP  739
               SLH+++KS   + ++  + +AL       +  +  K+W   I E+IE+G++CTQ  P
Sbjct  881  EGSSLHEFMKSHYPDSLEGIIEQALSRWKPQGKPEKCEKLWREVILEMIELGLVCTQYNP  940

Query  740  STRPTMLDAADDLNRLKRYL  799
            STRP MLD A ++ RLK YL
Sbjct  941  STRPDMLDVAHEMGRLKEYL  960



>ref|XP_008243030.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Prunus mume]
Length=987

 Score =   268 bits (684),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 149/278 (54%), Positives = 200/278 (72%), Gaps = 8/278 (3%)
 Frame = +2

Query  2    KVLSMQTGNS-MKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL ++T    + SF RECQVL+R RHRNLIR+ITACS PDFKALVLP M+NGSL+R LY
Sbjct  698  KVLDLKTDREILGSFKRECQVLKRTRHRNLIRIITACSRPDFKALVLPLMSNGSLERHLY  757

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
               H  S  L+L+Q V+IC D+AEG+AYLHHHSPV+V+HCDLKPSN+LL++DMTALV+DF
Sbjct  758  SS-HGLSHGLNLIQLVSICDDVAEGVAYLHHHSPVRVVHCDLKPSNILLDDDMTALVTDF  816

Query  359  GISKLVMTTTGSGNADQKLGNSTAN-MLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLE  535
            GI++LV  +  +   +     S+A+ +LCGSIGYIAPEYG G   S +GDV+SFGVL+LE
Sbjct  817  GIARLVKGSDENIRPNDSTSFSSADGLLCGSIGYIAPEYGMGKCASIEGDVFSFGVLLLE  876

Query  536  MVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQSAEVM-----KMWEVAIRE  700
            +VT ++PTD  F    SLH++VKS     VD  + +A+     + M     K+W   + E
Sbjct  877  IVTGRRPTDILFHEGSSLHEWVKSHYPSRVDSIVQQAIDRCVPDSMPKQYNKIWWDVVLE  936

Query  701  LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTT  814
            LIE+G++CTQ  PS RP+M D A ++ R+K Y++  ++
Sbjct  937  LIELGLMCTQYNPSMRPSMQDVAHEMGRVKEYISNPSS  974



>ref|XP_010905034.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 isoform X3 [Elaeis guineensis]
Length=933

 Score =   267 bits (682),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 163/199 (82%), Gaps = 1/199 (1%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL +Q+ NS KSF RECQVL+RIRHRNL+R+ITACSLPDFKALVLP+M NGSL+  LY 
Sbjct  691  KVLQLQSSNSAKSFNRECQVLKRIRHRNLMRIITACSLPDFKALVLPFMVNGSLESHLYL  750

Query  182  HPH-SGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
                S SS LSL++RVNICSDIAEGLAYLHHHSPV++IHCDLKPSN+LLN+DMTALVSDF
Sbjct  751  QAQQSASSKLSLIERVNICSDIAEGLAYLHHHSPVQIIHCDLKPSNILLNDDMTALVSDF  810

Query  359  GISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEM  538
            GI++LVM             NSTAN+LCGSIGY+APEYG+    STKGDVYSFG+LVLE+
Sbjct  811  GIARLVMKVAEGNIQYDTTTNSTANLLCGSIGYVAPEYGYRRGASTKGDVYSFGILVLEI  870

Query  539  VTRKKPTDDTFGRSLSLHQ  595
            VTRK+PTDD F   LSL +
Sbjct  871  VTRKRPTDDMFIEGLSLQR  889



>ref|XP_010417158.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Camelina sativa]
Length=992

 Score =   267 bits (683),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 149/273 (55%), Positives = 195/273 (71%), Gaps = 8/273 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMK-SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL  +T      SF RECQ+L+R +HRNLI++IT CS P FKALVLP M NGSL+R LY
Sbjct  701  KVLDPKTAVEFSGSFKRECQILKRTKHRNLIKIITTCSKPGFKALVLPLMPNGSLERHLY  760

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            P  +S S +L L+Q VNICSD+AEG+AYLHH+SPVKV+HCDLKPSN+LL+++MTALV+DF
Sbjct  761  PGEYS-SKNLDLIQLVNICSDVAEGIAYLHHYSPVKVVHCDLKPSNILLDDEMTALVTDF  819

Query  359  GISKLVMTTTGSGNADQKLG-NSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLE  535
            GIS+ V     + + D  +   S   +LCGS+GYIAPEYG G   ST GDVYSFGVL+LE
Sbjct  820  GISRFVQGVEETVSTDDSVSFGSPDGLLCGSVGYIAPEYGMGKRASTHGDVYSFGVLLLE  879

Query  536  MVTRKKPTDDTFGRSLSLHQYVKS---EQME-IVDCSLMRALKEQSAEVMKM-WEVAIRE  700
            +V+ ++PTD       SLH+++KS     +E I++ +L+R   +   E  +M W   I E
Sbjct  880  IVSGRRPTDVLVNEGSSLHEFMKSHYPNSLEGIIEQALIRWKPQGKPERCEMLWREVIME  939

Query  701  LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYL  799
            +IE+G++CTQ  PSTRP MLD A ++ RLK YL
Sbjct  940  MIELGLICTQYNPSTRPDMLDVAHEMGRLKEYL  972



>ref|XP_009611275.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Nicotiana tomentosiformis]
Length=982

 Score =   267 bits (682),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 155/274 (57%), Positives = 199/274 (73%), Gaps = 10/274 (4%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KV+  +T    +SF RECQ+L+R RHRNLIR+IT CS PDFKALV P M NGSL+  LYP
Sbjct  698  KVIDSKTAG--ESFKRECQILKRTRHRNLIRIITTCSRPDFKALVFPLMPNGSLENHLYP  755

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
                    L L Q V+IC+D+AEG+AYLHH+SPVKV+HCDLKPSN+LL+ +MTALV+DFG
Sbjct  756  S-DGLRHQLDLAQVVSICNDVAEGVAYLHHYSPVKVVHCDLKPSNILLDYNMTALVTDFG  814

Query  362  ISKLVMTTTGSGNA-DQKLG-NSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLE  535
            IS+LV     S N  D+ +  NST  +L GSIGYIAPEYG G   STKGDVYSFGVL+LE
Sbjct  815  ISRLVKAVEESTNPIDESVSYNSTDGLLFGSIGYIAPEYGMGKRASTKGDVYSFGVLLLE  874

Query  536  MVTRKKPTDDTFGRSLSLHQYVKSE---QME-IVDCSLMRALKEQSAEV-MKMWEVAIRE  700
            +VT K+PTD  F +  SLH++VKS+   ++E ++D +L R  +  +     KMW   + E
Sbjct  875  IVTGKRPTDILFQQGSSLHEWVKSQYPHKLEPMIDETLQRYPQVDTVPSDNKMWHDVVFE  934

Query  701  LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLT  802
            LIE+G++CTQ  PSTRPTMLD A ++ RLK+Y++
Sbjct  935  LIELGLMCTQYNPSTRPTMLDVALEIGRLKQYIS  968



>ref|XP_010687636.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Beta vulgaris subsp. vulgaris]
Length=981

 Score =   266 bits (680),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 152/272 (56%), Positives = 195/272 (72%), Gaps = 13/272 (5%)
 Frame = +2

Query  38   SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYPHPHSGSSDLSLM  217
            SF REC+VL+ IRHRNLI++IT CS PDFKA+V P M+NGSL+R LYP  H  S  L L 
Sbjct  710  SFKRECEVLKNIRHRNLIKIITICSKPDFKAIVFPLMSNGSLERHLYPS-HGLSRGLDLA  768

Query  218  QRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFGISKLVMTTTGSG  397
            + V ICSD+AEGLAYLHHHSPVKV+HCDLKPSN+LL++DM ALV+DFGISKLV     S 
Sbjct  769  ELVCICSDVAEGLAYLHHHSPVKVVHCDLKPSNILLDDDMNALVTDFGISKLVKGGDESL  828

Query  398  NA-DQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMVTRKKPTDDTFG  574
            +  D    +ST  +LCGS+GYIAPEYG G   ST+GDVYSFGVL+LE+VT K+PTD  F 
Sbjct  829  SVYDSASSSSTDGLLCGSVGYIAPEYGLGRRASTQGDVYSFGVLLLEIVTGKRPTDVFFD  888

Query  575  RSLSLHQYVKS---EQME-IVDCSLMR-------ALKEQSAEVMKMWEVAIRELIEVGML  721
            ++ SL ++VK+     +E I + +L+R        +  QS +   ++   I ELIE+G++
Sbjct  889  KASSLQEWVKTHYPHNLEPIFELALVRFATLPPYGIASQSHKTKSLFHEIILELIELGLM  948

Query  722  CTQDCPSTRPTMLDAADDLNRLKRYLTGDTTA  817
            CTQ   STRPTMLD A D+ RLK+Y +  ++A
Sbjct  949  CTQYSASTRPTMLDVAQDMERLKQYTSNPSSA  980



>ref|XP_010429369.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Camelina sativa]
Length=992

 Score =   266 bits (680),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 147/273 (54%), Positives = 192/273 (70%), Gaps = 8/273 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMK-SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL  +T      SF RECQ+L+R +HRNLI++IT CS P FKALVLP M NGSL+R LY
Sbjct  701  KVLDPKTAMEFSGSFKRECQILKRTKHRNLIKIITTCSKPGFKALVLPLMPNGSLERHLY  760

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            P  +S S +L L+Q VNICSD+ EG+AYLHH+SPVKV+HCDLKPSN+LL+++MTALV+DF
Sbjct  761  PGEYS-SKNLDLIQLVNICSDVTEGIAYLHHYSPVKVVHCDLKPSNILLDDEMTALVTDF  819

Query  359  GISKLVMTTTGSGNADQKLG-NSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLE  535
            GIS+ V     + + D  +   S   +LCGS+GYIAPEYG G   ST GDVYSFGVL+LE
Sbjct  820  GISRFVQGVEETVSTDDSVSFGSPDGLLCGSVGYIAPEYGMGKRASTHGDVYSFGVLLLE  879

Query  536  MVTRKKPTDDTFGRSLSLHQYVKSEQME----IVDCSLMRALKEQSAEVMKM-WEVAIRE  700
            +V+ ++PTD       SLH+++KS        I++ +L+R   +   E  +M W   I E
Sbjct  880  IVSGRRPTDVLVNEGSSLHEFMKSHYPNSLEGIIEQALLRWKPQGKPERCEMLWREVIME  939

Query  701  LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYL  799
            +IE+G++CTQ  PSTRP MLD A ++ RLK YL
Sbjct  940  MIELGLICTQYNPSTRPDMLDVAHEMGRLKEYL  972



>ref|XP_002878725.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54984.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=987

 Score =   265 bits (677),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 146/260 (56%), Positives = 188/260 (72%), Gaps = 7/260 (3%)
 Frame = +2

Query  38   SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYPHPHSGSSDLSLM  217
            SF RECQ+L+R RHRNLIR+IT C  P FKALVLP M NGSL+R LYP  +  S +L L+
Sbjct  709  SFKRECQILKRTRHRNLIRIITTCRKPGFKALVLPLMPNGSLERHLYPGEYL-SKNLDLI  767

Query  218  QRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFGISKLVMTTTGSG  397
            Q V ICSD+AEG+AYLHH+SPVKVIHCDLKPSN+LL+++MTALV+DFGIS+LV     + 
Sbjct  768  QLVYICSDVAEGIAYLHHYSPVKVIHCDLKPSNILLDDEMTALVTDFGISRLVQGVEETV  827

Query  398  NADQKLG-NSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMVTRKKPTDDTFG  574
            + D  +   ST  +LCGS+GYIAPEYG G   ST GDVYSFGVL+LE+V+ ++PTD    
Sbjct  828  STDDSVSFGSTDGLLCGSVGYIAPEYGMGKRASTHGDVYSFGVLLLEIVSGRRPTDVLVN  887

Query  575  RSLSLHQYVKSEQ----MEIVDCSLMRALKEQSAE-VMKMWEVAIRELIEVGMLCTQDCP  739
               +LH+++KS       EI++ +L+R   +   E   K+W   I E+IE+G++CTQ  P
Sbjct  888  EGSNLHEFMKSHYPNSLEEIIEQALIRWKPQGKPERCEKLWREVILEMIELGLICTQYNP  947

Query  740  STRPTMLDAADDLNRLKRYL  799
            STRP MLD A ++ RLK YL
Sbjct  948  STRPDMLDVAHEMGRLKEYL  967



>gb|AES92469.2| LRR receptor-like kinase family protein [Medicago truncatula]
Length=983

 Score =   265 bits (677),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 149/279 (53%), Positives = 194/279 (70%), Gaps = 16/279 (6%)
 Frame = +2

Query  2    KVLSMQTGNSMK-SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL     N +  SF RECQ+L++IRHRNLIR+IT C+  +FKA+VLP M+NGSL+R LY
Sbjct  697  KVLDATKDNEISWSFRRECQILKKIRHRNLIRIITICNKQEFKAIVLPLMSNGSLERNLY  756

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
               H  S  L ++Q V ICSD+AEG+ YLHH+SPVKV+HCDLKPSN+LL++D TALVSDF
Sbjct  757  DPNHELSHRLDVIQLVRICSDVAEGMCYLHHYSPVKVVHCDLKPSNILLDDDFTALVSDF  816

Query  359  GISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEM  538
            GIS+L+     +   +    +ST  +LCGS+GYIAPEYG G   ST+GDVYSFGV++LE+
Sbjct  817  GISRLLKGDANTSTCNSTSFSSTHGLLCGSVGYIAPEYGMGKQASTEGDVYSFGVILLEI  876

Query  539  VTRKKPTDDTFGRSLSLHQYVKSEQME------IVDCSLMR-----ALKEQSAEVMKMWE  685
            VT K+PTD       SLH++VK + ++      IV+ +L R      L+  S    K+WE
Sbjct  877  VTGKRPTDVLVHEGSSLHEWVKRQYIQPHKLENIVEQALRRFSLSCVLRHGS----KIWE  932

Query  686  VAIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLT  802
              + E IE+G+LCTQ  PSTRPTMLD A ++ RLK YL 
Sbjct  933  DVVLEFIELGLLCTQQNPSTRPTMLDVAQEMGRLKDYLN  971



>gb|KFK32683.1| hypothetical protein AALP_AA6G275300 [Arabis alpina]
Length=975

 Score =   265 bits (676),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 148/273 (54%), Positives = 193/273 (71%), Gaps = 8/273 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMK-SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL  +T      SF REC++L+R RHRNLIR+IT CS P FKALVLP M NGSL++ LY
Sbjct  684  KVLDPKTALEFSGSFKRECEILKRTRHRNLIRIITTCSKPGFKALVLPLMPNGSLEKHLY  743

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            P  +S S DL L+Q V+ICSD+AEG+AYLHH+SPVKV+HCDLKPSN+LL+++MTALV+DF
Sbjct  744  PEEYS-SRDLDLIQLVSICSDVAEGIAYLHHYSPVKVVHCDLKPSNILLDDEMTALVTDF  802

Query  359  GISKLVMTTTGSGNADQKLG-NSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLE  535
            GIS+LV     + + D  +   ST  +LCGS+GYIAPEYG G   S  GDV+SFGVL+LE
Sbjct  803  GISRLVQGVEETVSTDDSVSFGSTDGLLCGSVGYIAPEYGMGKRASIHGDVFSFGVLLLE  862

Query  536  MVTRKKPTDDTFGRSLSLHQYVKSEQME----IVDCSLMRALKEQSAE-VMKMWEVAIRE  700
            +V+ ++PTD       SLH+++KS        IV+ +L+R   +   E   K+W   I E
Sbjct  863  IVSGRRPTDVLVNEGSSLHEFIKSHYPNSLEGIVEHALIRWKPQGKPEKCEKLWREVILE  922

Query  701  LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYL  799
            +IE+G++CTQ  P TRP MLD A ++ RLK YL
Sbjct  923  MIELGLICTQYTPLTRPNMLDVAHEMGRLKEYL  955



>ref|XP_009366293.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Pyrus x bretschneideri]
Length=985

 Score =   265 bits (676),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 148/278 (53%), Positives = 201/278 (72%), Gaps = 8/278 (3%)
 Frame = +2

Query  2    KVLSMQTGNS-MKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL ++T    + SF REC+VL+R RHRNLIR+ITACS PDFKALVLP M+NGSL+R LY
Sbjct  696  KVLDLKTDEEILGSFKRECRVLKRTRHRNLIRIITACSRPDFKALVLPLMSNGSLERHLY  755

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
             + H  S  L+L+Q V+ICSD+AEG++YLHHHSPV+V+HCDLKPSN+LL+EDMTALV+DF
Sbjct  756  SN-HGLSVRLNLIQLVSICSDVAEGVSYLHHHSPVRVVHCDLKPSNILLDEDMTALVTDF  814

Query  359  GISKLVMTTTGSGNADQKLGNSTAN-MLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLE  535
            GI++L     G+   +     S+A+ +LCGSIGYIAPEY  G   ST+GDV+SFGVL+LE
Sbjct  815  GIARLGKGDDGNVPTNDSASFSSADGLLCGSIGYIAPEYALGKPISTEGDVFSFGVLLLE  874

Query  536  MVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQSAEVM-----KMWEVAIRE  700
            +VT ++PTD       +LH++VK +    +D  + +AL   +A+ M     K+W   + E
Sbjct  875  IVTGRRPTDVLAHEGSTLHEWVKRQYPHRLDPIVQQALDRCAADSMPKQYNKVWRDVVFE  934

Query  701  LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTT  814
            LIE+G++CTQ  PS RP M D A ++ RLK Y++  ++
Sbjct  935  LIELGLMCTQYTPSLRPNMQDVAHEIGRLKDYVSNPSS  972



>ref|XP_010265514.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Nelumbo nucifera]
Length=973

 Score =   264 bits (674),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 148/265 (56%), Positives = 187/265 (71%), Gaps = 13/265 (5%)
 Frame = +2

Query  38   SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYPHPHSGSSDLSLM  217
            SF RECQVL+R RHRNLIR+IT CS PDFKAL+ P M NGSL+  LYP  H    DL+L+
Sbjct  709  SFKRECQVLKRTRHRNLIRIITTCSRPDFKALLFPLMPNGSLETHLYPR-HRSRPDLNLV  767

Query  218  QRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFGISKLV-------  376
            Q V++CSD+AEG+AYLHHHSPV+++HCDLKPSN+LL++DMTALV+DFGI++LV       
Sbjct  768  QLVSVCSDVAEGVAYLHHHSPVRIVHCDLKPSNILLDDDMTALVTDFGIARLVKDDDGGG  827

Query  377  MTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMVTRKKP  556
                 +   D    +STA +LCGS+GYIAPEYG G   STKGD YSFGVL+LE++T K+P
Sbjct  828  GDGVTTVTIDSSCMDSTAGLLCGSVGYIAPEYGMGKDVSTKGDAYSFGVLLLEILTGKRP  887

Query  557  TDDTFGRSLSLHQYVKS---EQME-IVDCSLMR-ALKEQSAEVMKMWEVAIRELIEVGML  721
            TD  F    +L ++VKS   + +E IV+ +L+R    E        W   I ELIE+G+ 
Sbjct  888  TDVLFDEGSNLPEWVKSHYPDNLEPIVEEALVRFEPPETPRNCSDRWWGIILELIELGLR  947

Query  722  CTQDCPSTRPTMLDAADDLNRLKRY  796
            CTQ  PSTRP+MLD A D+ RLK Y
Sbjct  948  CTQSSPSTRPSMLDVALDIGRLKHY  972



>ref|XP_010091153.1| Putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
 gb|EXB42923.1| Putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
Length=979

 Score =   263 bits (671),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 150/274 (55%), Positives = 196/274 (72%), Gaps = 9/274 (3%)
 Frame = +2

Query  2    KVLSM-QTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL + + G    SF RECQ+L+R RHRNLIR+IT CS PDFKALVLP M+NGSL+R LY
Sbjct  692  KVLDLKEAGIVSGSFRRECQILKRTRHRNLIRIITICSRPDFKALVLPLMSNGSLERHLY  751

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            P  H   + L+L+Q V+IC+D+AE +AYLHHHSPV+V+HCDLKPSN+LL+EDMTALV+DF
Sbjct  752  PS-HGLRNGLNLVQLVSICNDVAEAVAYLHHHSPVRVVHCDLKPSNILLDEDMTALVTDF  810

Query  359  GISKLVMTTTGSGNA--DQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVL  532
            GI++L+     S  A  D    +S   +L GS+GYIAPEYG G   ST GDVYSFGVL+L
Sbjct  811  GIARLLNGRDESNAATYDSTSFSSADGLLWGSVGYIAPEYGMGKRASTHGDVYSFGVLLL  870

Query  533  EMVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQSAEVM-----KMWEVAIR  697
            E+VT K+PTD       SLH++VK++    +   + +AL++ +   M     ++W  AI 
Sbjct  871  EIVTGKRPTDGFPVEGSSLHEWVKTQYPSRLQPIVEQALEKYTPTAMPKHYNRIWANAII  930

Query  698  ELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYL  799
            ELIE+G++CTQ  PSTRP+M D A ++ RLK YL
Sbjct  931  ELIELGLMCTQYNPSTRPSMQDVALEMGRLKEYL  964



>ref|XP_010041053.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Eucalyptus grandis]
Length=972

 Score =   259 bits (662),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 147/274 (54%), Positives = 194/274 (71%), Gaps = 8/274 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMK-SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KV   +T   +  +F RECQV +R RHRNL+R+IT CS PDFKALVLP  +NGSLDR LY
Sbjct  697  KVFDSKTAGGISGTFKRECQVYKRTRHRNLMRIITICSRPDFKALVLPLKSNGSLDRHLY  756

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            P  H  +  L L+Q V ICSD+AEGLAYLHHH PV+V+HCDLKPSN+LL++DMTA+++DF
Sbjct  757  PS-HQLNQGLDLVQLVGICSDVAEGLAYLHHHCPVRVVHCDLKPSNILLDDDMTAVIADF  815

Query  359  GISKLVM-TTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLE  535
            GI++LV     G    D    +ST  +L GS+GYIAPEYG G+  S++GDV+SFGVL+LE
Sbjct  816  GIARLVKGGDKGVPLYDSASFSSTNGLLHGSVGYIAPEYGMGTRASSQGDVFSFGVLLLE  875

Query  536  MVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQSAEVM-----KMWEVAIRE  700
            +VT  +PTD  F    SLH++VKS     +D  + +AL   S+  M     K     I E
Sbjct  876  IVTGVRPTDVPFHECSSLHEWVKSHYPHNLDPIVQKALSRCSSPSMSEHLRKACCEVIVE  935

Query  701  LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLT  802
            LIE+G++CTQ  PSTRP+M+D A++++RLK+YL+
Sbjct  936  LIELGLMCTQYSPSTRPSMMDMANEMSRLKKYLS  969



>gb|EYU37151.1| hypothetical protein MIMGU_mgv1a021124mg [Erythranthe guttata]
Length=924

 Score =   258 bits (659),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 147/276 (53%), Positives = 195/276 (71%), Gaps = 10/276 (4%)
 Frame = +2

Query  2    KVLSMQTGNSMK-SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL  ++   +  SF RECQVL+R RHRNLIR+IT CS PDFKALVLP M NGSL+  LY
Sbjct  633  KVLHAKSAAELSGSFKRECQVLKRTRHRNLIRIITTCSRPDFKALVLPLMPNGSLEDHLY  692

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            P      + L L+Q V ICSD+AEG+AYLHH++PVKV+HCDLKPSN+LL++D TALV+DF
Sbjct  693  PGSLKNINGLDLVQLVRICSDVAEGMAYLHHYAPVKVVHCDLKPSNILLDDDFTALVTDF  752

Query  359  GISKLVM---TTTGSGNADQKLG-NSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVL  526
            GI++LV      +GS   D  +  +ST  +LCGS+GYIAPEYG G   S +GDVYSFGVL
Sbjct  753  GIARLVKGGGDESGSCGVDDSVSYDSTDGLLCGSVGYIAPEYGMGRHASPQGDVYSFGVL  812

Query  527  VLEMVTRKKPTDDTFGRSLSLHQYVKSEQME----IVDCSLMRALKEQSAEV-MKMWEVA  691
            +LE+VT K+PTD  F    S+H++VKS+       IV+ +++R           K+W   
Sbjct  813  LLEIVTGKRPTDVLFQEGSSMHEWVKSQYPNKLGPIVEGAMVRRAPRGPVPFDRKIWADV  872

Query  692  IRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYL  799
            I E+IE+G++CTQ  P+TRP+MLD A++++ LK+ L
Sbjct  873  ILEMIELGLICTQYNPATRPSMLDVANEVSILKQCL  908



>ref|XP_010047056.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 isoform X2 [Eucalyptus grandis]
Length=904

 Score =   257 bits (657),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 153/279 (55%), Positives = 195/279 (70%), Gaps = 10/279 (4%)
 Frame = +2

Query  2    KVLSMQTGNSMK-SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL  +T   +  SF RECQ+L+R RHRNLIR+IT CS PDFKALVLP M+NGSL+R LY
Sbjct  618  KVLDSKTAGEIPGSFKRECQILKRTRHRNLIRIITICSRPDFKALVLPLMSNGSLERHLY  677

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            P  H     L L+Q V+ICSD+AE +AYLHH+SPV+V+HCDLKPSN+LL++DMTALV+DF
Sbjct  678  PS-HKLDQGLDLVQLVSICSDVAEAVAYLHHYSPVRVVHCDLKPSNILLDDDMTALVTDF  736

Query  359  GISKLVM-TTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLE  535
            GIS+LV          D     ST  +LCGS+GYIAPEYG G   ST+GDVYSFGVL+LE
Sbjct  737  GISRLVKGDDEDVPPYDLASFCSTDGLLCGSVGYIAPEYGMGKRASTQGDVYSFGVLLLE  796

Query  536  MVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQSAEVMKMW------EVAIR  697
            +VT  +PTD  F    SLH++VKS     +D  +  AL   S   M  +      EV I 
Sbjct  797  IVTGVRPTDVLFDGCSSLHEWVKSHYPHNLDPIVQPALSRCSTPSMSEYLRKACCEV-IV  855

Query  698  ELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTT  814
            ELIE+G++CTQ  PSTRP+M+D A +++ LK+YL+  ++
Sbjct  856  ELIELGLMCTQYAPSTRPSMMDMAHEMSTLKQYLSDSSS  894



>ref|XP_010047055.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 isoform X1 [Eucalyptus grandis]
Length=985

 Score =   257 bits (657),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 153/279 (55%), Positives = 195/279 (70%), Gaps = 10/279 (4%)
 Frame = +2

Query  2    KVLSMQTGNSMK-SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL  +T   +  SF RECQ+L+R RHRNLIR+IT CS PDFKALVLP M+NGSL+R LY
Sbjct  699  KVLDSKTAGEIPGSFKRECQILKRTRHRNLIRIITICSRPDFKALVLPLMSNGSLERHLY  758

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            P  H     L L+Q V+ICSD+AE +AYLHH+SPV+V+HCDLKPSN+LL++DMTALV+DF
Sbjct  759  PS-HKLDQGLDLVQLVSICSDVAEAVAYLHHYSPVRVVHCDLKPSNILLDDDMTALVTDF  817

Query  359  GISKLVM-TTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLE  535
            GIS+LV          D     ST  +LCGS+GYIAPEYG G   ST+GDVYSFGVL+LE
Sbjct  818  GISRLVKGDDEDVPPYDLASFCSTDGLLCGSVGYIAPEYGMGKRASTQGDVYSFGVLLLE  877

Query  536  MVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQSAEVMKMW------EVAIR  697
            +VT  +PTD  F    SLH++VKS     +D  +  AL   S   M  +      EV I 
Sbjct  878  IVTGVRPTDVLFDGCSSLHEWVKSHYPHNLDPIVQPALSRCSTPSMSEYLRKACCEV-IV  936

Query  698  ELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTT  814
            ELIE+G++CTQ  PSTRP+M+D A +++ LK+YL+  ++
Sbjct  937  ELIELGLMCTQYAPSTRPSMMDMAHEMSTLKQYLSDSSS  975



>gb|KCW44682.1| hypothetical protein EUGRSUZ_L01784 [Eucalyptus grandis]
Length=975

 Score =   254 bits (648),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 147/277 (53%), Positives = 194/277 (70%), Gaps = 11/277 (4%)
 Frame = +2

Query  2    KVLSMQTGNSMK-SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KV   +T   +  +F RECQV +R RHRNL+R+IT CS PDFKALVLP  +NGSLDR LY
Sbjct  697  KVFDSKTAGGISGTFKRECQVYKRTRHRNLMRIITICSRPDFKALVLPLKSNGSLDRHLY  756

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            P  H  +  L L+Q V ICSD+AEGLAYLHHH PV+V+HCDLKPSN+LL++DMTA+++DF
Sbjct  757  PS-HQLNQGLDLVQLVGICSDVAEGLAYLHHHCPVRVVHCDLKPSNILLDDDMTAVIADF  815

Query  359  GISKLVM-TTTGSGNADQKLGNSTANMLCGSIGYIAP---EYGFGSSTSTKGDVYSFGVL  526
            GI++LV     G    D    +ST  +L GS+GYIAP   EYG G+  S++GDV+SFGVL
Sbjct  816  GIARLVKGGDKGVPLYDSASFSSTNGLLHGSVGYIAPENAEYGMGTRASSQGDVFSFGVL  875

Query  527  VLEMVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQSAEVM-----KMWEVA  691
            +LE+VT  +PTD  F    SLH++VKS     +D  + +AL   S+  M     K     
Sbjct  876  LLEIVTGVRPTDVPFHECSSLHEWVKSHYPHNLDPIVQKALSRCSSPSMSEHLRKACCEV  935

Query  692  IRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLT  802
            I ELIE+G++CTQ  PSTRP+M+D A++++RLK+YL+
Sbjct  936  IVELIELGLMCTQYSPSTRPSMMDMANEMSRLKKYLS  972



>gb|KHN30272.1| Putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Glycine soja]
Length=895

 Score =   253 bits (645),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 144/274 (53%), Positives = 190/274 (69%), Gaps = 12/274 (4%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL    G   +SF RE Q+L++IRHRNLIR+IT C  P+F ALV P M NGSL++ LYP
Sbjct  620  KVLDTTHGEISRSFRREYQILKKIRHRNLIRIITICCRPEFNALVFPLMPNGSLEKYLYP  679

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
                 S  L ++Q V ICSD+AEG++YLHH+SPVKV+HCDLKPSN+LL+EDMTALV+DFG
Sbjct  680  -----SQRLDVVQLVRICSDVAEGMSYLHHYSPVKVVHCDLKPSNILLDEDMTALVTDFG  734

Query  362  ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
            IS+LV +   +   +    +ST  +LCGS+GYIAPEYG G   ST+GDVYSFGVLVLEMV
Sbjct  735  ISRLVQSDENTSINESASFSSTHGLLCGSVGYIAPEYGMGKHASTEGDVYSFGVLVLEMV  794

Query  542  TRKKPTDDTFGRSLSLHQYVKSE--QMEIVDCSLMRALKEQSA-----EVMKMWEVAIRE  700
            + ++PTD       SL +++K +      ++  + +AL+  S         K+W+  I E
Sbjct  795  SGRRPTDVLSHEGSSLCEWIKKQYTHQHQLENFVEQALQRFSPCGVPNHRNKIWKDVILE  854

Query  701  LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLT  802
            LIE+G++CTQ  PSTRP+M D A ++ RLK YLT
Sbjct  855  LIELGLVCTQYNPSTRPSMHDIAQEMERLKDYLT  888



>ref|XP_008660682.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Zea mays]
Length=1007

 Score =   253 bits (646),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 144/290 (50%), Positives = 195/290 (67%), Gaps = 14/290 (5%)
 Frame = +2

Query  2    KVLSMQTGNSM-KSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL  ++G  + +SF RECQVLRR RHRNL+R++TACS PDF ALVLP M NGSL+ RLY
Sbjct  706  KVLDPKSGGEVSRSFKRECQVLRRTRHRNLVRVVTACSQPDFHALVLPLMPNGSLESRLY  765

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            P   +    L L Q V+I SD+AEG+AYLHH++PV+V+HCDLKPSNVLL++DMTA+V+DF
Sbjct  766  PPDGAPGRGLDLAQLVSIASDVAEGIAYLHHYAPVRVVHCDLKPSNVLLDDDMTAVVADF  825

Query  359  GISKLV--------MTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYS  514
            GI++LV          + GSG+AD    NS   +L GS+GYIAPEYG G   ST+GDVYS
Sbjct  826  GIARLVKDVGDSDLADSAGSGSADPC--NSITGLLQGSVGYIAPEYGMGGHPSTQGDVYS  883

Query  515  FGVLVLEMVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQSAEVM---KMWE  685
            FGV++LE++T K+PTD  F   L+LH +VK      V   +  +    +A  +   ++W 
Sbjct  884  FGVMLLELITGKRPTDVIFQEGLTLHDWVKRHYPHDVGRVVAESWLTDAASAVADERIWN  943

Query  686  VAIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSL  835
              + ELI++G++CTQ  PS RPTM +   ++  LK  L     A  A+++
Sbjct  944  DVMAELIDLGVVCTQHAPSGRPTMAEVCHEIALLKEDLARHLGAPAATTM  993



>gb|AFW85540.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=1030

 Score =   253 bits (645),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 144/290 (50%), Positives = 195/290 (67%), Gaps = 14/290 (5%)
 Frame = +2

Query  2     KVLSMQTGNSM-KSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
             KVL  ++G  + +SF RECQVLRR RHRNL+R++TACS PDF ALVLP M NGSL+ RLY
Sbjct  729   KVLDPKSGGEVSRSFKRECQVLRRTRHRNLVRVVTACSQPDFHALVLPLMPNGSLESRLY  788

Query  179   PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
             P   +    L L Q V+I SD+AEG+AYLHH++PV+V+HCDLKPSNVLL++DMTA+V+DF
Sbjct  789   PPDGAPGRGLDLAQLVSIASDVAEGIAYLHHYAPVRVVHCDLKPSNVLLDDDMTAVVADF  848

Query  359   GISKLV--------MTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYS  514
             GI++LV          + GSG+AD    NS   +L GS+GYIAPEYG G   ST+GDVYS
Sbjct  849   GIARLVKDVGDSDLADSAGSGSADPC--NSITGLLQGSVGYIAPEYGMGGHPSTQGDVYS  906

Query  515   FGVLVLEMVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQSAEVM---KMWE  685
             FGV++LE++T K+PTD  F   L+LH +VK      V   +  +    +A  +   ++W 
Sbjct  907   FGVMLLELITGKRPTDVIFQEGLTLHDWVKRHYPHDVGRVVAESWLTDAASAVADERIWN  966

Query  686   VAIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSL  835
               + ELI++G++CTQ  PS RPTM +   ++  LK  L     A  A+++
Sbjct  967   DVMAELIDLGVVCTQHAPSGRPTMAEVCHEIALLKEDLARHLGAPAATTM  1016



>ref|XP_003518225.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130-like [Glycine max]
Length=973

 Score =   252 bits (644),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 144/274 (53%), Positives = 190/274 (69%), Gaps = 12/274 (4%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL    G   +SF RE Q+L++IRHRNLIR+IT C  P+F ALV P M NGSL++ LYP
Sbjct  698  KVLDTTHGEISRSFRREYQILKKIRHRNLIRIITICCRPEFNALVFPLMPNGSLEKYLYP  757

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
                 S  L ++Q V ICSD+AEG++YLHH+SPVKV+HCDLKPSN+LL+EDMTALV+DFG
Sbjct  758  -----SQRLDVVQLVRICSDVAEGMSYLHHYSPVKVVHCDLKPSNILLDEDMTALVTDFG  812

Query  362  ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
            IS+LV +   +   +    +ST  +LCGS+GYIAPEYG G   ST+GDVYSFGVLVLEMV
Sbjct  813  ISRLVQSDENTSINESASFSSTHGLLCGSVGYIAPEYGMGKHASTEGDVYSFGVLVLEMV  872

Query  542  TRKKPTDDTFGRSLSLHQYVKSE--QMEIVDCSLMRALKEQSA-----EVMKMWEVAIRE  700
            + ++PTD       SL +++K +      ++  + +AL+  S         K+W+  I E
Sbjct  873  SGRRPTDVLSHEGSSLCEWIKKQYTHQHQLENFVEQALQRFSPCGVPNHRNKIWKDVILE  932

Query  701  LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLT  802
            LIE+G++CTQ  PSTRP+M D A ++ RLK YLT
Sbjct  933  LIELGLVCTQYNPSTRPSMHDIAQEMERLKDYLT  966



>gb|EMT33357.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=755

 Score =   249 bits (636),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 149/193 (77%), Gaps = 8/193 (4%)
 Frame = +2

Query  101  TACSLPDFKALVLPYMANGSLDRRLYPHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSP  280
            T CSL DFKALVLP+M  GSL+R LY  P    ++LSL+ RVNICSDIAEG+AYLHHHSP
Sbjct  561  TVCSLADFKALVLPFMVKGSLERCLYAGP---PAELSLVHRVNICSDIAEGVAYLHHHSP  617

Query  281  VKVIHCDLKPSNVLLNEDMTALVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYI  460
            VKVIHCDLKPSNVL+N+DMT LVSDFGIS+LVM+  G  N    +  STANMLCGSIGYI
Sbjct  618  VKVIHCDLKPSNVLINDDMTVLVSDFGISRLVMSVGGVANP-ADVDASTANMLCGSIGYI  676

Query  461  APEYGFGSSTSTKGDVYSFGVLVLEMVTRKKPTDDTFGRSLSLHQYVKSEQM----EIVD  628
             PEYG+GS+ +T GDVYSFGVLV+EMVTRKKPTDD F   LSLH++VKS        +VD
Sbjct  677  PPEYGYGSNPATMGDVYSFGVLVMEMVTRKKPTDDMFEGGLSLHKWVKSHYHGRADAVVD  736

Query  629  CSLMRALKEQSAE  667
             +  R + +Q+ E
Sbjct  737  QAPARMVMDQTPE  749



>ref|XP_004508235.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130-like [Cicer arietinum]
Length=970

 Score =   251 bits (641),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 142/263 (54%), Positives = 188/263 (71%), Gaps = 7/263 (3%)
 Frame = +2

Query  38   SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYPHPHSGSSDLSLM  217
            SF RECQ++++IRHRNLIR+IT CS  +FKA+VLP M NGSL+R LYP  +  S  L++ 
Sbjct  697  SFRRECQIIKKIRHRNLIRIITICSKTEFKAIVLPLMPNGSLERSLYPPNNELSQRLNVT  756

Query  218  QRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFGISKLVMTTTGSG  397
            Q V ICSD+AEG+ YLHH+SPVKV+HCDLKPSN+LL+E+ TALV+DFGIS+L+     + 
Sbjct  757  QFVRICSDVAEGICYLHHYSPVKVVHCDLKPSNILLDENFTALVTDFGISRLLKGDEKNF  816

Query  398  NADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMVTRKKPTDDTFGR  577
            + +    +ST  +LCGS+GYIAPEYG G   S++GDVYSFGV++LE+VT K+PTD     
Sbjct  817  SNNSTSFSSTHGLLCGSVGYIAPEYGMGKHASSEGDVYSFGVILLEIVTGKRPTDVLIHE  876

Query  578  SLSLHQYVKSEQME------IVDCSLMR-ALKEQSAEVMKMWEVAIRELIEVGMLCTQDC  736
              SLH++VK +  +      IV  +L R +L        K+ E  + ELIE+G+LCTQ+ 
Sbjct  877  GSSLHEWVKIQYTQPHKLENIVQQALQRCSLSCVPRHDTKILEDVMLELIELGLLCTQNN  936

Query  737  PSTRPTMLDAADDLNRLKRYLTG  805
            PSTRPTMLD A ++ RLK YL  
Sbjct  937  PSTRPTMLDVAQEMGRLKDYLNN  959



>gb|KHN17512.1| Putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Glycine soja]
Length=932

 Score =   251 bits (640),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 149/274 (54%), Positives = 191/274 (70%), Gaps = 12/274 (4%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL    G   +SF RE Q+L++IRHRNLIR+IT C  P+F ALV P M NGSL++ LYP
Sbjct  656  KVLDTTHGEISRSFRREYQILKKIRHRNLIRIITICCRPEFNALVFPLMPNGSLEKHLYP  715

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
                 S  L+++Q V ICSD+AEG++YLHH+SPVKV+HCDLKPSN+LL+EDMTALV+DFG
Sbjct  716  -----SQRLNVVQLVRICSDVAEGMSYLHHYSPVKVVHCDLKPSNILLDEDMTALVTDFG  770

Query  362  ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
            IS+LV++   +  +D    +ST  +LCGS+GYIAPEYG G   ST+GDVYSFGVLVLEMV
Sbjct  771  ISRLVLSDENTSTSDSASFSSTHGLLCGSVGYIAPEYGMGKHVSTEGDVYSFGVLVLEMV  830

Query  542  TRKKPTDDTFGRSLSL-----HQYVKSEQME-IVDCSLMRALK-EQSAEVMKMWEVAIRE  700
            + ++PTD       SL      QY    Q+E  V+ +L R          +K+W+ AI E
Sbjct  831  SGRRPTDVLSHEGSSLCDWIKKQYTHQHQLENFVEQALHRFSHCGVPNHRVKIWKDAILE  890

Query  701  LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLT  802
            L+EVG++CTQ  PSTRPTM D A ++ RLK  LT
Sbjct  891  LVEVGLVCTQYNPSTRPTMHDIAQEMERLKDNLT  924



>ref|XP_003550679.2| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130-like [Glycine max]
Length=932

 Score =   249 bits (635),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 148/274 (54%), Positives = 190/274 (69%), Gaps = 12/274 (4%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL    G   +SF RE Q+L++IRHRNLIR+IT C  P+F ALV P M NGSL++ LYP
Sbjct  656  KVLDTTHGEISRSFRREYQILKKIRHRNLIRIITICCRPEFNALVFPLMPNGSLEKHLYP  715

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
                 S  L+++Q V ICSD+AEG++YLHH+SPVKV+HCDLKPSN+LL+EDMTALV+DFG
Sbjct  716  -----SQRLNVVQLVRICSDVAEGMSYLHHYSPVKVVHCDLKPSNILLDEDMTALVTDFG  770

Query  362  ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
            IS+LV++   +  +D    +ST  +LCGS+GYIAPEYG G   ST+GDVYSFGVLVLEMV
Sbjct  771  ISRLVLSDENTSTSDSASFSSTHGLLCGSVGYIAPEYGMGKHVSTEGDVYSFGVLVLEMV  830

Query  542  TRKKPTDDTFGRSLSL-----HQYVKSEQME-IVDCSLMRALK-EQSAEVMKMWEVAIRE  700
            + ++PTD       SL      QY    Q+E  V+ +L R          +K+W+  I E
Sbjct  831  SGRRPTDVLSHEGSSLCDWIKKQYTHQHQLENFVEQALHRFSHCGVPNHRVKIWKDVILE  890

Query  701  LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLT  802
            L+EVG++CTQ  PSTRPTM D A ++ RLK  LT
Sbjct  891  LVEVGLVCTQYNPSTRPTMHDIAQEMERLKDNLT  924



>ref|XP_003525899.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130-like [Glycine max]
Length=981

 Score =   249 bits (635),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 145/274 (53%), Positives = 186/274 (68%), Gaps = 15/274 (5%)
 Frame = +2

Query  2    KVLSMQTGNSM--KSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRL  175
            KVL   T   +   SF RECQ+L R+RHRNLIR+IT CS  +FKALVLP M NGSL+R L
Sbjct  692  KVLDTATAGDIISGSFRRECQILTRMRHRNLIRIITICSKKEFKALVLPLMPNGSLERHL  751

Query  176  YPHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSD  355
            YP     S  L ++Q V ICSD+AEG+AYLHH+SPV+V+HCDLKPSN+LL++D TALV+D
Sbjct  752  YP-----SQRLDMVQLVRICSDVAEGMAYLHHYSPVRVVHCDLKPSNILLDDDFTALVTD  806

Query  356  FGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLE  535
            FGI++LV +      +D     ST  +LCGS+GYIAPEYG G   ST+GDVYSFGVLVLE
Sbjct  807  FGIARLVKSDDNMPTSDSSFC-STHGLLCGSLGYIAPEYGMGKIASTQGDVYSFGVLVLE  865

Query  536  MVTRKKPTDDTFGRSLSLHQYVKS----EQMEIVDCSLMRALKEQSA---EVMKMWEVAI  694
            +VT ++PTD        LH++VK     E   IV+ ++ R     S    +  K  +  +
Sbjct  866  IVTGRRPTDVLVHEGSCLHEWVKKQYPHELGNIVEQAMQRCCSSPSGMPNQYHKFGQDVM  925

Query  695  RELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRY  796
             ELIE+G+LCT   PSTRP+MLD A ++ +LK Y
Sbjct  926  LELIELGLLCTHHNPSTRPSMLDVAQEMGKLKDY  959



>gb|KHN23949.1| Putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Glycine soja]
Length=981

 Score =   249 bits (635),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 144/274 (53%), Positives = 186/274 (68%), Gaps = 15/274 (5%)
 Frame = +2

Query  2    KVLSMQTGNSM--KSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRL  175
            KVL   T   +   SF RECQ+L R+RHRNLIR+IT CS  +FKALVLP M NGSL+R L
Sbjct  692  KVLDTATAGDIISGSFRRECQILTRMRHRNLIRIITICSKKEFKALVLPLMPNGSLERHL  751

Query  176  YPHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSD  355
            YP     S  L ++Q V ICSD+AEG+AYLHH+SPV+V+HCDLKPSN+LL++D TALV+D
Sbjct  752  YP-----SQRLDMVQLVRICSDVAEGMAYLHHYSPVRVVHCDLKPSNILLDDDFTALVTD  806

Query  356  FGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLE  535
            FGI++LV +      +D     ST  +LCGS+GYIAPEYG G   ST+GDVYSFGVLVLE
Sbjct  807  FGIARLVKSDDNMPTSDSSFC-STHGLLCGSLGYIAPEYGMGKHASTQGDVYSFGVLVLE  865

Query  536  MVTRKKPTDDTFGRSLSLHQYVKS----EQMEIVDCSLMRALKEQSA---EVMKMWEVAI  694
            +VT ++PTD        LH+++K     E   IV+ ++ R     S    +  K  +  +
Sbjct  866  IVTGRRPTDVLVHEGSCLHEWIKKQYPHELGNIVEQAMQRCCSSPSGMPNQYHKFGQDVM  925

Query  695  RELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRY  796
             ELIE+G+LCT   PSTRP+MLD A ++ +LK Y
Sbjct  926  LELIELGLLCTHHNPSTRPSMLDVAQEMGKLKDY  959



>ref|XP_009409775.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Musa acuminata subsp. malaccensis]
Length=979

 Score =   248 bits (634),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 148/273 (54%), Positives = 190/273 (70%), Gaps = 8/273 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMK-SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL  ++G  +  SF RECQVL+R RHRNLIR+ITACS PDFKALVLP M NGSL++ L 
Sbjct  689  KVLDPKSGVEISGSFKRECQVLKRTRHRNLIRVITACSKPDFKALVLPLMPNGSLEKYLN  748

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            P P   +  L+L+Q ++I SD+AEG+AYLHH++P +VIHCDLKPSNVLL+EDMTALVSDF
Sbjct  749  P-PIESTPGLTLIQVISILSDVAEGMAYLHHYAPFRVIHCDLKPSNVLLDEDMTALVSDF  807

Query  359  GISKLVMTTTGSGNADQKLG--NSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVL  532
            GISKLV         D +    +S   +L GS+GYIAPEYG G   ST+GDVYSFGVL+L
Sbjct  808  GISKLVSGVNDDCIDDPESSGFHSITGLLQGSVGYIAPEYGLGGHPSTQGDVYSFGVLLL  867

Query  533  EMVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRA----LKEQSAEVMKMWEVAIRE  700
            EM+T K+PTD  F   L+LH +VK      ++    RA     +  SA+  ++    + E
Sbjct  868  EMITGKRPTDVIFHEGLTLHDWVKGHYPRNIEVITSRAPLGQYRSTSADHKELPRDVMAE  927

Query  701  LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYL  799
            LIE+G++CTQ  PS RPTM+D A ++  LK+ L
Sbjct  928  LIELGLVCTQLSPSMRPTMIDVAHEICLLKQDL  960



>ref|XP_008790186.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Phoenix dactylifera]
Length=1056

 Score =   249 bits (635),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 144/260 (55%), Positives = 177/260 (68%), Gaps = 6/260 (2%)
 Frame = +2

Query  38   SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYPHPHSGSSDLSLM  217
            SF RECQVL+R RHRNLIR+ITACS PDFKALVLP M NGSL+  LY HP      L L 
Sbjct  712  SFERECQVLKRTRHRNLIRVITACSKPDFKALVLPLMPNGSLESYLY-HPVGSGHGLDLN  770

Query  218  QRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFGISKLVMTTTGSG  397
            Q V I  D+AEG+AYLHH SPVKV+HCDLKPSNVLL+EDMTA+VSDFGI++LV     + 
Sbjct  771  QLVCIIGDVAEGIAYLHHFSPVKVVHCDLKPSNVLLDEDMTAIVSDFGIARLVKHDENND  830

Query  398  NADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMVTRKKPTDDTFGR  577
              +    NS    L GS+GYIAPEYG G   ST+GDVYSFGVL+LEM+T K+PTD  F  
Sbjct  831  ITNSSPYNSITGRLQGSVGYIAPEYGLGGRPSTQGDVYSFGVLILEMITGKRPTDAIFHE  890

Query  578  SLSLHQYVKSEQMEIVDCSLMRALKEQSAEVMKMWEVAIR-----ELIEVGMLCTQDCPS  742
             LSL ++VKS     ++    +A    S+ V  ++   IR     ELIE+G++C    P+
Sbjct  891  GLSLQEWVKSRYPNNIEVITSQAPLRDSSPVDSLYYKKIRREVMVELIELGLVCASFSPA  950

Query  743  TRPTMLDAADDLNRLKRYLT  802
             RPTM+D A ++  LK+ LT
Sbjct  951  LRPTMIDVAHEIALLKQDLT  970



>ref|XP_007154862.1| hypothetical protein PHAVU_003G154000g [Phaseolus vulgaris]
 gb|ESW26856.1| hypothetical protein PHAVU_003G154000g [Phaseolus vulgaris]
Length=977

 Score =   248 bits (632),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 142/278 (51%), Positives = 191/278 (69%), Gaps = 13/278 (5%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL    G   +SF RECQ+L++IRHRNLIR+IT C  P+F ALV P M N SL+R LYP
Sbjct  693  KVLDTTHGEISRSFRRECQILKKIRHRNLIRIITICCRPEFNALVFPLMPNNSLERHLYP  752

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
                 S  L+++Q + ICSD+AEG+AYLHH+SPVKV+HCDLKPSN+LL+EDMTAL++DFG
Sbjct  753  -----SQRLNVVQLLRICSDVAEGMAYLHHYSPVKVVHCDLKPSNILLDEDMTALITDFG  807

Query  362  ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
            IS+L+ +   +  +     ++ A +LCG++GYIAPEYG G   ST+GDVYSFGV+VLEMV
Sbjct  808  ISRLLQSDENTSTSISSFSSTNA-LLCGTVGYIAPEYGMGKDVSTEGDVYSFGVVVLEMV  866

Query  542  TRKKPTDDTFGRSLSLHQYVKS--EQMEIVDCSLMRALKEQSAEVM-----KMWEVAIRE  700
            + ++PTD       SL +++K    Q   +   + +AL+      +     K+W   I E
Sbjct  867  SGRRPTDVLSHEGSSLCEWLKKLYTQPHHLQNFVQQALQRCYPFGLPNPHNKVWRDVILE  926

Query  701  LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTT  814
            LIE+G++CTQ  PSTRPTM D A ++ RLK YLT  T+
Sbjct  927  LIELGLICTQHNPSTRPTMHDVAQEMERLKDYLTKSTS  964



>ref|XP_008443839.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Cucumis melo]
Length=992

 Score =   248 bits (632),  Expect = 5e-71, Method: Composition-based stats.
 Identities = 140/272 (51%), Positives = 193/272 (71%), Gaps = 14/272 (5%)
 Frame = +2

Query  38   SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYPHPHSGSS--DLS  211
            SF RECQVL+R RHRNLIR+IT CS PDF ALVLP M+NGSL+  LYP+ + GSS     
Sbjct  708  SFKRECQVLKRTRHRNLIRIITTCSRPDFNALVLPLMSNGSLESYLYPN-NRGSSIHKPD  766

Query  212  LMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFGISKLVM----  379
            L Q V+ICSD+A+G+AYLHHHSP++V+HCD+KPSN+LL++DM ALV+DFGIS+L++    
Sbjct  767  LAQLVSICSDVAQGVAYLHHHSPIRVVHCDIKPSNILLDDDMAALVTDFGISRLIIQGET  826

Query  380  TTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMVTRKKPT  559
              + S  ++    +ST  +LCGS+GYIAPEYG G   ST+GDV+SFGVL+LE+VT K+PT
Sbjct  827  NNSTSHRSESTSFSSTHGLLCGSVGYIAPEYGLGERASTEGDVFSFGVLLLEVVTGKRPT  886

Query  560  DDTFGRSLSLHQYVKSEQM----EIVDCSLMR---ALKEQSAEVMKMWEVAIRELIEVGM  718
            D  F +   LH++VKS       +IVD ++ R   +    + +  K+    I EL+E+ +
Sbjct  887  DLDFQQGAGLHEWVKSHYPHKLDDIVDEAMERYGFSRPNVAKQFPKLRREVIFELLELSI  946

Query  719  LCTQDCPSTRPTMLDAADDLNRLKRYLTGDTT  814
            +CTQ  PS RP+M+D A ++ RLK +L   ++
Sbjct  947  MCTQYTPSFRPSMVDVAHEMTRLKEHLLNSSS  978



>ref|XP_006404913.1| hypothetical protein EUTSA_v10000545mg, partial [Eutrema salsugineum]
 gb|ESQ46366.1| hypothetical protein EUTSA_v10000545mg, partial [Eutrema salsugineum]
Length=893

 Score =   245 bits (626),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/231 (54%), Positives = 163/231 (71%), Gaps = 8/231 (3%)
 Frame = +2

Query  122  FKALVLPYMANGSLDRRLYPHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCD  301
            FKA+VLP M NGSL+R LYP  +SG S L L+Q V+ICSD+AEG+AYLH +SPVKV+HCD
Sbjct  646  FKAIVLPLMPNGSLERHLYPEEYSGRS-LDLIQLVSICSDVAEGIAYLHDYSPVKVVHCD  704

Query  302  LKPSNVLLNEDMTALVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFG  481
            LKPSN+LL+++MTALV+DFGIS+LV     +   D     ST  +LCGS+GYIAPEYG G
Sbjct  705  LKPSNILLDDEMTALVTDFGISRLVQGVQET--VDSVSFGSTDGLLCGSVGYIAPEYGMG  762

Query  482  SSTSTKGDVYSFGVLVLEMVTRKKPTDDTFGRSLSLHQYVKSEQME----IVDCSLMRAL  649
               S  GDVYSFGVL+LE+V+ ++PTD       SLH+++K         I++ +L+R  
Sbjct  763  KRASIHGDVYSFGVLLLEIVSGRRPTDVLVNEGSSLHEFMKWNYQNSLEGIIEQALIRLK  822

Query  650  KEQSAE-VMKMWEVAIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYL  799
             +  AE   K+W   I E+IE+G++CTQ  PSTRP MLD A ++ RLK +L
Sbjct  823  PQGKAERCEKLWREVILEMIELGLICTQYTPSTRPNMLDVAQEMGRLKEFL  873



>emb|CAN73698.1| hypothetical protein VITISV_024434 [Vitis vinifera]
Length=196

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 141/161 (88%), Gaps = 7/161 (4%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL +QTGNS KSF RECQVL+RIRHRNLIR+ITACSLPDFKALVLP+MANGSLD RLYP
Sbjct  21   KVLQLQTGNSTKSFNRECQVLKRIRHRNLIRIITACSLPDFKALVLPFMANGSLDSRLYP  80

Query  182  HPH----SGSSDL--SLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTA  343
            H      SGSSDL   L+QRVNICSDIAEG+AYLHHHSPV+VIHCDLKPSNVLLN++MTA
Sbjct  81   HSETGLGSGSSDLISRLIQRVNICSDIAEGMAYLHHHSPVRVIHCDLKPSNVLLNDEMTA  140

Query  344  LVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAP  466
            LVSDFGIS+LV +T G+    + +GNSTANMLCGSIGYIAP
Sbjct  141  LVSDFGISRLV-STVGNAGGVEHMGNSTANMLCGSIGYIAP  180



>ref|XP_004964648.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130-like [Setaria italica]
Length=1034

 Score =   243 bits (621),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 143/299 (48%), Positives = 192/299 (64%), Gaps = 17/299 (6%)
 Frame = +2

Query  2     KVLSMQTGNSM-KSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
             KVL  + G  + +SF RECQVLRR RHRNL+R++TACS PDF ALVLP M NGSL+ RLY
Sbjct  727   KVLDPKGGGEVSRSFKRECQVLRRTRHRNLVRVVTACSQPDFHALVLPLMPNGSLESRLY  786

Query  179   PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
             P        L L Q V I  D+AEGLAYLHH++PV+V+HCDLKPSNVLL++DMTA+V+DF
Sbjct  787   PPDGGPGRGLGLAQVVAIAGDVAEGLAYLHHYAPVRVVHCDLKPSNVLLDDDMTAVVADF  846

Query  359   GISKLVMTT---------TGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVY  511
             GI++LV            TGSG+      NS   +L GS+GYIAPEYG G   ST+GDVY
Sbjct  847   GIAQLVKDVGDDSGFCGDTGSGDP----CNSITGLLQGSVGYIAPEYGLGGHPSTQGDVY  902

Query  512   SFGVLVLEMVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQSAEVM---KMW  682
             S+GV++LE++T K+PTD  F   L+LH +VK      V   + R+    +A  +   ++ 
Sbjct  903   SYGVMLLELITGKRPTDVIFQEGLTLHDWVKRHYPHDVGEVVARSWLTDAASAVADERLM  962

Query  683   EVAIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTLS  859
                + ELI++G+ CTQ  PS RPTM++   ++  LK  L     A   ++ G +  T++
Sbjct  963   ADVMGELIDLGLECTQHSPSARPTMVEVCHEITLLKEDLAKHRGAAVTTARGPASMTMT  1021



>ref|XP_010905056.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Elaeis guineensis]
Length=986

 Score =   243 bits (619),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 143/273 (52%), Positives = 183/273 (67%), Gaps = 7/273 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMKS-FIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL  + G  +   F RECQVL+R RHRNLIR+ITACS PDFKALVLP + NGSLD  LY
Sbjct  698  KVLDPKCGGGISGCFERECQVLKRTRHRNLIRVITACSKPDFKALVLPLILNGSLDSYLY  757

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            P P   S  L L Q + I SD+AEG+AYLHH +PV+V+HCDLKPSNVLL+EDMTA+VSDF
Sbjct  758  P-PVGPSHGLDLSQLICILSDVAEGVAYLHHFAPVRVVHCDLKPSNVLLDEDMTAIVSDF  816

Query  359  GISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEM  538
            GI++LV     +   +    NS   +L GS+GYIAPEYG G   S +GDVYSFGVLVLEM
Sbjct  817  GIARLVKQDENNDITNSSPYNSITGLLQGSVGYIAPEYGLGGRPSAQGDVYSFGVLVLEM  876

Query  539  VTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQSAEVMKMWEVAIR-----EL  703
            +T K+PTD  F   LSL ++VKS     ++    +A    S+ V  ++   +R     EL
Sbjct  877  ITGKRPTDALFHEGLSLQEWVKSHYPHDIEVITSQAPLRDSSLVDSLYYKKLRRELMVEL  936

Query  704  IEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLT  802
            IE+G++C    P+ RPTM++ A ++  LK+ L 
Sbjct  937  IELGLVCASFSPALRPTMINVAHEIALLKQDLV  969



>ref|XP_002437981.1| hypothetical protein SORBIDRAFT_10g005850 [Sorghum bicolor]
 gb|EER89348.1| hypothetical protein SORBIDRAFT_10g005850 [Sorghum bicolor]
Length=1033

 Score =   243 bits (619),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 141/277 (51%), Positives = 189/277 (68%), Gaps = 15/277 (5%)
 Frame = +2

Query  2     KVLSMQTGNSM-KSFIRECQVlrrirhrnlirliTACSLP-DFKALVLPYMANGSLDRRL  175
             KVL  ++G  + +SF RECQVLRR RHRNL+R++TACS P DF ALVLP M NGSL+ RL
Sbjct  729   KVLDAKSGGEVSRSFKRECQVLRRTRHRNLVRVVTACSQPPDFHALVLPLMPNGSLESRL  788

Query  176   YPHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSD  355
             YP   +    L L Q V+I SD+AEGLAYLHH++PV+V+HCDLKPSNVLL++DMTA+V+D
Sbjct  789   YPPDGAPGRGLDLAQLVSIASDVAEGLAYLHHYAPVRVVHCDLKPSNVLLDDDMTAVVAD  848

Query  356   FGISKLVMTTTGSGNADQKLG------NSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSF  517
             FGI++LV      G++D  LG      NS   +L GS+GYIAPEYG G   ST+GDVYSF
Sbjct  849   FGIARLVKDV---GDSDD-LGSTTDPCNSITGLLQGSVGYIAPEYGMGGHPSTQGDVYSF  904

Query  518   GVLVLEMVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQSAEVM---KMWEV  688
             GV++LE++T K+PTD  F   L+LH +V+      V   +  +    +A  +   ++W  
Sbjct  905   GVMLLELITGKRPTDVIFQEGLTLHDWVRRHYPHDVGKVVAESWLTDAATAVADERLWND  964

Query  689   AIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYL  799
              + ELI++G++CTQ  PS RPTM +   ++  LK  L
Sbjct  965   VMVELIDLGIVCTQHSPSGRPTMAEVCHEIALLKEDL  1001



>dbj|BAD72442.1| putative protein kinase Xa21, receptor type precursor [Oryza 
sativa Japonica Group]
Length=1060

 Score =   241 bits (616),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 139/276 (50%), Positives = 182/276 (66%), Gaps = 13/276 (5%)
 Frame = +2

Query  2     KVLSMQTGNSM-KSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
             KVL  ++G  + +SF REC+VLRR RHRNL+R++T CS PDF ALVLP M NGSL+ RLY
Sbjct  745   KVLDPKSGGEVSRSFKRECEVLRRTRHRNLVRVVTTCSQPDFHALVLPLMRNGSLEGRLY  804

Query  179   PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
             P        L L Q V + +D+AEGLAYLHH++PV+V+HCDLKPSNVLL++DMTA+V+DF
Sbjct  805   PRDGRAGRGLGLAQLVAVAADVAEGLAYLHHYAPVRVVHCDLKPSNVLLDDDMTAVVADF  864

Query  359   GISKLVMT-----TTGSGN---ADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYS  514
             GI+KLV       TT SG+   A     NS   +L GS+GYIAPEYG G   ST+GDVYS
Sbjct  865   GIAKLVKNADGDVTTNSGSIAAASSDPCNSITGLLQGSVGYIAPEYGLGGHPSTQGDVYS  924

Query  515   FGVLVLEMVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQSAEVMKMWEVAI  694
             FGV++LE++T K+PTD  F   L+LH +V+      V   + R+    +A    +    +
Sbjct  925   FGVMILELITGKRPTDVIFHEGLTLHDWVRRHYPHDVAAVVARSWLTDAAVGYDV----V  980

Query  695   RELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLT  802
              ELI VG+ CTQ  P  RPTM++   ++  LK  L 
Sbjct  981   AELINVGLACTQHSPPARPTMVEVCHEMALLKEDLA  1016



>gb|EAY99946.1| hypothetical protein OsI_21949 [Oryza sativa Indica Group]
Length=989

 Score =   239 bits (611),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 140/280 (50%), Positives = 185/280 (66%), Gaps = 13/280 (5%)
 Frame = +2

Query  2    KVLSMQTGNSM-KSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL  ++G  + +SF REC+VLRR RHRNL+R++T CS PDF ALVLP M NGSL+ RLY
Sbjct  666  KVLDPKSGGEVSRSFKRECEVLRRTRHRNLVRVVTTCSQPDFHALVLPLMRNGSLEGRLY  725

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            P        L L Q V + +D+AEGLAYLHH++PV+V+HCDLKPSNVLL++DMTA+V+DF
Sbjct  726  PRDGRPGRGLGLAQLVAVAADVAEGLAYLHHYAPVRVVHCDLKPSNVLLDDDMTAVVADF  785

Query  359  GISKLVM----TTTGSGN---ADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSF  517
            GI+KLV     TTT SG+   A     NS   +L GS+GYIAPEYG G   ST+GDVYSF
Sbjct  786  GIAKLVKNADDTTTNSGSIAAASSDPCNSITGLLQGSVGYIAPEYGLGGHPSTQGDVYSF  845

Query  518  GVLVLEMVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRAL-----KEQSAEVMKMW  682
            GV++LE++T K+PTD  F   L+LH +V+      V   + R+         +A+   + 
Sbjct  846  GVMILELITGKRPTDVIFHEGLTLHDWVRRHYPHDVAAVVARSWLTDAAAAAAADGAAVG  905

Query  683  EVAIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLT  802
               + ELI+VG+ CTQ  P  RPTM++   ++  LK  L 
Sbjct  906  YDVVAELIDVGLACTQHSPPARPTMVEVCHEIALLKEDLA  945



>ref|XP_003560979.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Brachypodium distachyon]
Length=1092

 Score =   238 bits (608),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 139/277 (50%), Positives = 184/277 (66%), Gaps = 21/277 (8%)
 Frame = +2

Query  23    GNSMKSFIRECQVlrrirhrnlirliTACSLP-DFKALVLPYMANGSLDRRLYPHPHSGS  199
             G+  +SF RECQVLRR RHRNL+R++TACS P DF ALVLP M NGSL+ RLYP      
Sbjct  792   GDVSRSFKRECQVLRRTRHRNLVRVVTACSAPPDFHALVLPLMRNGSLEGRLYPRDGRPG  851

Query  200   SDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFGISKLVM  379
               LSL + V++ SD+AEG+AYLHH++P++V+HCDLKPSNVLL++DMTA+V+DFGI++LV 
Sbjct  852   RGLSLARLVSVASDVAEGMAYLHHYAPMRVVHCDLKPSNVLLDDDMTAVVADFGIARLVK  911

Query  380   TT-------TGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEM  538
                      TGS   D    NS   +L GS+GYIAPEYG G   ST+GDVYSFGV+VLE+
Sbjct  912   DVGDEDDDFTGS---DADPCNSITGLLQGSVGYIAPEYGLGGHPSTEGDVYSFGVMVLEL  968

Query  539   VTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMR---------ALKEQSAEVMKMWEVA  691
             +T K+PTD  F   L+LH +V+      V   + R         A+++     M   EV 
Sbjct  969   ITGKRPTDVIFHEGLTLHDWVRRHHPHDVAAVVARSWLTDLEASAVRQADERSMTRAEV-  1027

Query  692   IRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLT  802
             + ELIE+G+ CTQ  PS RPTM++   ++  L+  L+
Sbjct  1028  VGELIELGLACTQHSPSARPTMVEVCHEMTLLREDLS  1064



>ref|XP_008443838.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Cucumis melo]
Length=997

 Score =   238 bits (607),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 146/298 (49%), Positives = 196/298 (66%), Gaps = 38/298 (13%)
 Frame = +2

Query  20   TGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYPHPHSGS  199
             G   +SF RECQVL+R RHRNLI++IT CS PDFKALVLP M NGSL+  LYP      
Sbjct  705  AGEISRSFKRECQVLKRTRHRNLIKIITTCSRPDFKALVLPLMGNGSLESHLYP------  758

Query  200  SDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFGISKLVM  379
            S + L+Q V+IC D+AEG+AYLHHHS V+V+HCDLKPSN+LL+EDMTALV+DFGI++LV 
Sbjct  759  SQIDLVQLVSICRDVAEGVAYLHHHSHVRVVHCDLKPSNILLDEDMTALVTDFGIARLV-  817

Query  380  TTTGSGNADQKLG--------------------NSTANMLCGSIGYIAPEYGFGSSTSTK  499
             + G G  D                        +ST  +LCGS+GYIAPEYG G   ST+
Sbjct  818  -SGGGGGEDNHNNSNNNNNGGGGGGGQDDSTSFSSTHGLLCGSVGYIAPEYGLGKQASTE  876

Query  500  GDVYSFGVLVLEMVTRKKPTDDTFGRSLSLHQYVKSE---QME-IVD------CSLMRAL  649
            GDV+SFGVL+LE++T K+PTD  F +   LH++VKS+   Q++ IVD      C+     
Sbjct  877  GDVFSFGVLLLELITGKRPTDHFFEQGAGLHEWVKSQYPHQLDPIVDDAMDRYCTAAAER  936

Query  650  KEQSAEVMKMWEVAIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATF  823
            ++      ++W   I E+IE+G++CTQ  PS RP+M+D A ++ RLK YL+   ++ +
Sbjct  937  RDGPRPCKRLWREVIVEVIEMGLMCTQFSPSMRPSMVDVAQEMTRLKEYLSHSLSSLY  994



>ref|XP_004146720.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130-like [Cucumis sativus]
 gb|KGN65181.1| hypothetical protein Csa_1G257870 [Cucumis sativus]
Length=992

 Score =   235 bits (600),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 150/299 (50%), Positives = 202/299 (68%), Gaps = 31/299 (10%)
 Frame = +2

Query  2    KVLS-MQT-GNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRL  175
            KVL+ M+T G   +SF RECQVL+R RHRNLI++IT CS PDFKALVLP M NGSL+  L
Sbjct  697  KVLNPMRTAGEISRSFKRECQVLKRTRHRNLIKIITTCSRPDFKALVLPLMGNGSLESHL  756

Query  176  YPHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSD  355
            YP      S + L+Q V+IC D+AEG+AYLHHHS V+V+HCDLKPSN+LL+EDMTALV+D
Sbjct  757  YP------SQIDLVQLVSICRDVAEGVAYLHHHSHVRVVHCDLKPSNILLDEDMTALVTD  810

Query  356  FGISKLV-------------MTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTST  496
            FGI++LV                 G G  D    +ST  +LCGS+GYIAPEYG G   ST
Sbjct  811  FGIARLVSGGGGEDNHNNNNNNGGGGGQDDSTSISSTHGLLCGSVGYIAPEYGLGKQAST  870

Query  497  KGDVYSFGVLVLEMVTRKKPTDDTFGRSLSLHQYVKSE---QME-IVD------CSLMRA  646
            +GDV+SFGVL+LE++T K+PTD  F +   LH++VKS+   Q++ IVD      C+   A
Sbjct  871  EGDVFSFGVLLLELITGKRPTDHFFEQGAGLHEWVKSQYPHQLDPIVDDAMDRYCTAAAA  930

Query  647  LKEQSAEVMKMWEVAIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATF  823
             +       ++W   I E+IE+G++CTQ  P+ RP+M+D A ++ RL+ YL+   ++ +
Sbjct  931  RRGGPRPCKRLWREVIVEVIEMGLMCTQFSPALRPSMVDVAQEMTRLQEYLSHSLSSLY  989



>gb|EMT02279.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=1035

 Score =   232 bits (591),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 143/299 (48%), Positives = 196/299 (66%), Gaps = 19/299 (6%)
 Frame = +2

Query  2     KVLSMQTGNS--MKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRL  175
             KVL  +TG     +SF REC VLRR RHRNL+R++T CS PDF ALVLP M NGSL  R+
Sbjct  736   KVLDPKTGGGEVSRSFKRECDVLRRTRHRNLVRVVTTCSQPDFHALVLPLMTNGSLASRI  795

Query  176   YPHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSD  355
             YP        + L + V I  ++AEGLAYLHH++PV+V+HCDLKPSNVLL++DMTA+V+D
Sbjct  796   YPRDGRPGRGMDLARLVAIAGNVAEGLAYLHHYAPVRVVHCDLKPSNVLLDDDMTAVVAD  855

Query  356   FGISKLVMTTTG------SGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSF  517
             FGI++LV    G      +G+AD    NS   +L GS+GYIAPEYG G   ST+GDVYSF
Sbjct  856   FGIARLVKDADGDVDDHITGSADPC--NSITGLLQGSVGYIAPEYGLGGPPSTEGDVYSF  913

Query  518   GVLVLEMVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRA---LKEQSAEVMKMWEV  688
             GVL+LE++T K+PTD  F   L+LH++V+ ++    D + + A   L +     ++  +V
Sbjct  914   GVLLLELITGKRPTDVLFQEGLTLHEWVRRQRHHTHDIAAVVAQPWLADAMFSTVQGDDV  973

Query  689   AIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLT--GDTTATFA--SSLGISCST  853
              + +LI++G+ CT+  P  RPTM++   ++  LK  L   G   A+ A  +S G SCST
Sbjct  974   VV-QLIDLGVACTEHSPLLRPTMVEVCHEIALLKEDLAKHGGAAASVAMTASEG-SCST  1030



>ref|XP_003560981.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Brachypodium distachyon]
Length=998

 Score =   229 bits (584),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 136/286 (48%), Positives = 189/286 (66%), Gaps = 12/286 (4%)
 Frame = +2

Query  20   TGNSMKSFIRECQVlrrirhrnlirliTACSLP-DFKALVLPYMANGSLDRRLYPHPHSG  196
            +G+  +SF RECQVLRR RHRNL+R+IT CS P DF ALVLP M NGSL+ RLYPH    
Sbjct  714  SGDVSRSFKRECQVLRRTRHRNLVRVITTCSAPPDFHALVLPLMRNGSLESRLYPHDGRL  773

Query  197  SSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFGISKLV  376
               LSL + +++ SD+AEG+AYLHH++P++V+HCDLKPSNVLL+++MTA+V+DFGI+KL+
Sbjct  774  VRGLSLARLMSVASDVAEGMAYLHHYAPIRVVHCDLKPSNVLLDDEMTAVVADFGIAKLL  833

Query  377  MTT------TGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEM  538
                     TGS   D    NS   +L GS+GY+APEYG G   ST+GDVYSFGV++LE+
Sbjct  834  KEDNDNDEFTGS---DADPCNSITGLLQGSVGYMAPEYGLGGRPSTQGDVYSFGVMLLEL  890

Query  539  VTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQSAEVMKMWEVAIRELIEVGM  718
            +T K+PTD  F   L+LH +V S      D +++      +     +   A+ +LI++G+
Sbjct  891  ITGKRPTDVIFHEGLTLHDWV-SRHHPHEDAAVVARSTSLTESPSALPADAMAQLIDLGL  949

Query  719  LCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTATFASSLGISCSTL  856
             CTQ  P  RPTM++   ++  L   L     A+  +S G SC+T+
Sbjct  950  ACTQHSPPVRPTMVEVCREITLLTEDLAKHPMASVTASEG-SCTTM  994



>gb|EMT31747.1| LRR receptor-like serine/threonine-protein kinase EFR [Aegilops 
tauschii]
Length=940

 Score =   229 bits (583),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 128/261 (49%), Positives = 172/261 (66%), Gaps = 7/261 (3%)
 Frame = +2

Query  23   GNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYPHPHSGSS  202
            G   +SF REC VLRR RHRNL+R++T C+ PDF A+VLP M NGSL+  LYP       
Sbjct  677  GEVSRSFKRECGVLRRTRHRNLVRVVTTCTQPDFHAIVLPLMTNGSLESHLYPRDGGPGR  736

Query  203  DLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFGISKLVMT  382
             + L   V I  DIAEGL YLHH++PV+V+HCDLKPSNVLL++DM A+V+DFGI++LV  
Sbjct  737  GMDLAWLVAIAGDIAEGLTYLHHYAPVRVVHCDLKPSNVLLDDDMMAVVADFGIARLVKD  796

Query  383  TT---GSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMVTRKK  553
                  +G+AD    NSTA +L GS+GYIAPEYG G   ST+GDVYSFGV++LEM+TRK+
Sbjct  797  MGDDDNTGSADPC--NSTAGLLQGSVGYIAPEYGLGGHPSTEGDVYSFGVMLLEMITRKR  854

Query  554  PTDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQSAEVMKMWEV--AIRELIEVGMLCT  727
            PTD  F   L+LH +V+      +   + R     +  ++ + +    + EL+++G+ CT
Sbjct  855  PTDVLFQEGLTLHGWVRRHHPHDLTAIIARPWLAATDAMLSVAQANNVVIELMDLGIACT  914

Query  728  QDCPSTRPTMLDAADDLNRLK  790
            Q  P  RPTM+D    +  LK
Sbjct  915  QHSPPARPTMVDVCRAIALLK  935



>ref|XP_007023494.1| Serine-threonine protein kinase, plant-type, putative [Theobroma 
cacao]
 gb|EOY26116.1| Serine-threonine protein kinase, plant-type, putative [Theobroma 
cacao]
Length=858

 Score =   225 bits (574),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 137/252 (54%), Positives = 164/252 (65%), Gaps = 36/252 (14%)
 Frame = +2

Query  125  KALVLPYMANGSLDRRLYPHPHSGSSDLSL----MQRVNICSDIAEGLAYLHHHSPVKVI  292
            KALVLPYMANGSL+ RLYPH  SG    S     +Q V+ICSDIAEG+AYLHHHS V+VI
Sbjct  632  KALVLPYMANGSLESRLYPHSKSGLGSGSSDLSLIQGVSICSDIAEGMAYLHHHSTVRVI  691

Query  293  HCDLKPSNVLLNEDMTALVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEY  472
            HCDLKPSNVLLN+D+TALVSD GI+ +VM T G+GN    +   T  +L   I Y+ P  
Sbjct  692  HCDLKPSNVLLNDDITALVSDIGIAIVVM-TVGAGNGAGAI--ETWEILL-QICYMDPSV  747

Query  473  GFGSSTSTKGDVYSFGVLVLEMVTRKKPTDDTFGRSLSLHQYVKSEQ----MEIVDCSLM  640
                S                         D   + LS   +VKS       ++VD SL+
Sbjct  748  TLHQSM------------------------DLDPKHLSGQIWVKSHYPGRVEKVVDSSLI  783

Query  641  RALKEQSAEVMKMWEVAIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTAT  820
            RA ++QS EV +MWEVAIRE+IE+G+L TQ+  S RPTMLDAADDL+RLKRY +GDTTA 
Sbjct  784  RASRDQSPEVTRMWEVAIREMIELGILRTQETRSIRPTMLDAADDLDRLKRYRSGDTTAA  843

Query  821  FASSLGISCSTL  856
            FASSLGIS STL
Sbjct  844  FASSLGISSSTL  855



>ref|XP_004964649.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130-like [Setaria italica]
Length=990

 Score =   225 bits (573),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 137/268 (51%), Positives = 175/268 (65%), Gaps = 17/268 (6%)
 Frame = +2

Query  38   SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYPHPHSGSSD----  205
            SF REC+VLR IRHRNLIR+IT CS PDFKA+VLP+M NGSLD  ++  P  G  +    
Sbjct  700  SFERECRVLRSIRHRNLIRVITTCSTPDFKAVVLPFMPNGSLDSLIHGPPCGGKPEGPRQ  759

Query  206  LSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFGISKLVMTT  385
            L L   + I S++AEG+AYLHHH+PVKV+HCDLKPSNVLL+ DMTA+VSDFGISKLV+T 
Sbjct  760  LDLDLLLGIASNVAEGMAYLHHHAPVKVVHCDLKPSNVLLDGDMTAIVSDFGISKLVITG  819

Query  386  TGS---GNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMVTRKKP  556
                  G A   + NS   +L GS+GYIAPEYG G   ST+GDVYSFGV++LEM++ K+P
Sbjct  820  ARDPEVGEASTSVCNSITRLLQGSVGYIAPEYGLGGRPSTQGDVYSFGVMLLEMISGKRP  879

Query  557  TDDTFGRSLSLHQYVKSEQME-IVDCSLMRALKEQSAEV---------MKMWEVAIRELI  706
            TD        LH + K   ++  VD    R L      V         M++  V + EL+
Sbjct  880  TDVISEEGHGLHDWAKKRCLQHDVDAVAERWLPRDPPSVLPFGPPRCEMEVIVVMVMELL  939

Query  707  EVGMLCTQDCPSTRPTMLDAADDLNRLK  790
            E+G+ C+Q  PS RPTM D A ++  L+
Sbjct  940  ELGVACSQLVPSMRPTMDDMAHEIACLR  967



>ref|XP_008660681.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Zea mays]
 gb|AFW85538.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=984

 Score =   224 bits (570),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 132/270 (49%), Positives = 177/270 (66%), Gaps = 3/270 (1%)
 Frame = +2

Query  2    KVLSMQTGNSMK-SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL  + G  +  SF REC+VL+R RH+NL+R+IT CS   F ALVLP M  GSLD  LY
Sbjct  696  KVLDPKGGGEVSGSFKRECEVLKRTRHKNLVRVITTCSTASFNALVLPLMPRGSLDGLLY  755

Query  179  PHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            P P   ++ L   Q + I +D+AEG+AYLHH++PV+V+HCDLKPSNVLL+E+M A++SDF
Sbjct  756  PRPQGDNAGLDFGQIMGIVNDVAEGMAYLHHYAPVRVVHCDLKPSNVLLDEEMRAVISDF  815

Query  359  GISKLVMTTTG--SGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVL  532
            GI++LV       S + +    NS   +L GS+GYIAPEYG G   ST+GDVYSFGV++L
Sbjct  816  GIARLVAVGEEAISTSDESAPCNSITGLLQGSVGYIAPEYGLGRHPSTQGDVYSFGVMLL  875

Query  533  EMVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQSAEVMKMWEVAIRELIEV  712
            E++T K+PTD  F   L+LH +V+      V   L  A   + A      EVA+ ELIE+
Sbjct  876  ELITGKRPTDVIFHEGLTLHDWVRRHYPHDVAAVLAHAPWRERALEAAAAEVAVVELIEL  935

Query  713  GMLCTQDCPSTRPTMLDAADDLNRLKRYLT  802
            G++CTQ  P+ RPTM D   ++  L+  L 
Sbjct  936  GLVCTQHSPALRPTMADVCHEITLLREDLA  965



>ref|XP_002437982.1| hypothetical protein SORBIDRAFT_10g005860 [Sorghum bicolor]
 gb|EER89349.1| hypothetical protein SORBIDRAFT_10g005860 [Sorghum bicolor]
Length=985

 Score =   219 bits (558),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 135/278 (49%), Positives = 181/278 (65%), Gaps = 13/278 (5%)
 Frame = +2

Query  2    KVLSMQTGNSMK-SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL  + G  +  SF REC+VL+R RH+NL+R+IT CS   F ALVLP M  GSLD  LY
Sbjct  702  KVLDPKGGGEVSGSFKRECEVLKRTRHKNLVRVITTCSTASFNALVLPLMPRGSLDGLLY  761

Query  179  PHPHSGSSD-------LSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDM  337
            P PH  ++        L  +Q + I SD+AEG+AYLHH++PV+V+HCDLKPSNVLL+++M
Sbjct  762  P-PHGDNAGAGGGGGVLDFVQIMGIVSDVAEGMAYLHHYAPVRVVHCDLKPSNVLLDDEM  820

Query  338  TALVSDFGISKLVMTTTG--SGNADQKLG-NSTANMLCGSIGYIAPEYGFGSSTSTKGDV  508
             A++SDFGI++LV    G  S  +D+    NS   +L GS+GYIAPEYG G   ST+GDV
Sbjct  821  RAVISDFGIARLVAGAVGEASSTSDESAPCNSITGLLQGSVGYIAPEYGLGGHPSTQGDV  880

Query  509  YSFGVLVLEMVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQSAEVMKMWEV  688
            YSFGV++LE++T K+PTD  F   L+LH +V+      V   L  A   + A   +  EV
Sbjct  881  YSFGVMLLELITGKRPTDVIFQEGLTLHDWVRRHYPHDVAAVLAHAPWRERAPPEEA-EV  939

Query  689  AIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLT  802
             + ELIE+G++CTQ  P+ RPTM D   ++  LK  L 
Sbjct  940  VVVELIELGLVCTQHSPALRPTMADVCHEITLLKEDLA  977



>gb|EMT06051.1| LRR receptor-like serine/threonine-protein kinase EFR [Aegilops 
tauschii]
Length=992

 Score =   218 bits (556),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 130/268 (49%), Positives = 174/268 (65%), Gaps = 9/268 (3%)
 Frame = +2

Query  38   SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYPHPHSGS-----S  202
            SF REC+ LRR RH+NLIR+IT CS   F ALVLP M +GSL+  LYPH   G      S
Sbjct  707  SFKRECEALRRTRHKNLIRVITTCSTASFNALVLPLMPHGSLEAHLYPHDDDGDDGGGGS  766

Query  203  DLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFGISKLVMT  382
             L   Q V I SD+AEG+AYLHH++PV+V+HCDLKPSNVLL++ M A++SDFGI++LV  
Sbjct  767  RLGFRQLVGIASDVAEGMAYLHHYAPVRVVHCDLKPSNVLLDDGMRAVISDFGIARLVAG  826

Query  383  TTGSGNADQKLGNSTAN-MLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMVTRKKPT  559
               S +      NS A  +L GS+GYIAPEYG G   S +GDVYSFGVL+LE++T K+PT
Sbjct  827  AEASSDDSAAPCNSIATGLLQGSVGYIAPEYGLGGHPSARGDVYSFGVLILELLTGKRPT  886

Query  560  DDTFGRSLSLHQYVKSEQMEIVDCSLMRA--LKEQSAEVMKMWEVAIRELIEVGMLCTQD  733
            D  F   L+LH +V+      V  +L  A  L+ +    + + ++A+ EL+E+G+ CTQ 
Sbjct  887  DVIFDEGLTLHDWVRRLYPHDVAGALAHAPWLRREGVP-LPVADMAVVELMELGLACTQH  945

Query  734  CPSTRPTMLDAADDLNRLKRYLTGDTTA  817
             P+ RPTM D   ++  +K  L    +A
Sbjct  946  SPALRPTMADVCHEITMIKDGLAKHASA  973



>emb|CBI36558.3| unnamed protein product [Vitis vinifera]
Length=882

 Score =   213 bits (541),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 131/259 (51%), Positives = 168/259 (65%), Gaps = 40/259 (15%)
 Frame = +2

Query  38   SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYPHPHSGSSDLSLM  217
            SF RECQVL+R RHRNLIR+IT CS PDFKALVLP M+NG L+R LYP    G   L+L+
Sbjct  648  SFKRECQVLKRTRHRNLIRIITICSKPDFKALVLPLMSNGCLERHLYPGRDLGHG-LNLV  706

Query  218  QRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFGISKLVMTTTGSG  397
            Q V+ICSD+AEG+AYLHH+SPV+                                  G+ 
Sbjct  707  QLVSICSDVAEGVAYLHHYSPVR----------------------------------GTS  732

Query  398  NADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMVTRKKPTDDTFGR  577
              D    +ST  +LCGSIGYIAPEYG G   ST+GDVYSFGVL+LE+VT K+PTD  F  
Sbjct  733  ANDSTSYSSTDGLLCGSIGYIAPEYGLGKRASTQGDVYSFGVLLLEIVTGKRPTDVLFHD  792

Query  578  SLSLHQYVKSE---QME-IVDCSLMRALKEQS-AEVMKMWEVAIRELIEVGMLCTQDCPS  742
              SLH++VKS+   ++E IV+ +L RA    +     ++W  AI ELIE+G++CTQ  P+
Sbjct  793  GSSLHEWVKSQYPNKLEPIVEQALTRATPPATPVNCSRIWRDAILELIELGLICTQYIPA  852

Query  743  TRPTMLDAADDLNRLKRYL  799
            TRP+MLD A+++ RLK+YL
Sbjct  853  TRPSMLDVANEMVRLKQYL  871



>ref|XP_004964647.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130-like [Setaria italica]
Length=990

 Score =   213 bits (542),  Expect = 9e-59, Method: Composition-based stats.
 Identities = 137/292 (47%), Positives = 185/292 (63%), Gaps = 17/292 (6%)
 Frame = +2

Query  2    KVLSMQTGNSMK-SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL  + G  +  SF REC+VLRR RH+NL+R+IT CS   F ALVLP M NGSLD  LY
Sbjct  693  KVLDPKGGGEVSGSFKRECEVLRRTRHKNLVRVITTCSTAGFNALVLPLMPNGSLDGFLY  752

Query  179  PHPHSGSSDLSLM---QRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALV  349
            PH    + D   +   Q + I SD+AEG+AYLHH++PV+V+HCDLKPSNVLL+E M A++
Sbjct  753  PHGGGDNGDGGGLDFGQIMGIASDVAEGMAYLHHYAPVRVVHCDLKPSNVLLDEGMRAVI  812

Query  350  SDFGISKLVMTTTGSGNA-----DQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYS  514
            SDFGI++L +   G+G A     +    NS   +L GS+GYIAPEYG G   ST+GDVYS
Sbjct  813  SDFGIARL-LAGAGAGEASSTSEESAPCNSITGLLQGSVGYIAPEYGLGGHPSTQGDVYS  871

Query  515  FGVLVLEMVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRAL---KEQSAEVMKMWE  685
            FGV++LE++T K+PTD  F   L+LH +V+      V   L  A    +   +      E
Sbjct  872  FGVMLLELITGKRPTDVIFHEGLTLHDWVRRHYPHDVAAVLAHAPWRGRPLQSPPAAAAE  931

Query  686  VAIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLK----RYLTGDTTATFAS  829
            VA+ ELIE+G++CTQ  P+ RPTM D   ++  L+    R+   D   +F++
Sbjct  932  VAVVELIELGLVCTQHSPALRPTMADVCHEITLLREDLARHGAADGRRSFST  983



>gb|KGN65180.1| hypothetical protein Csa_1G257860 [Cucumis sativus]
Length=593

 Score =   207 bits (527),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 127/261 (49%), Positives = 171/261 (66%), Gaps = 39/261 (15%)
 Frame = +2

Query  38   SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYPHPHSGSS--DLS  211
            SF RECQVL+R RHRNLIR+IT CS PDF ALVLP M+NGSL+  LYP+ + GSS     
Sbjct  346  SFKRECQVLKRTRHRNLIRIITTCSRPDFNALVLPLMSNGSLESNLYPN-NRGSSIHKTD  404

Query  212  LMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFGISKLVMTTTG  391
            L+Q V+IC  +A+G+AYLHHHSP++V+HCD+KPSN+LL++DMTALV+DFGIS LV+    
Sbjct  405  LVQLVSICCVVAQGVAYLHHHSPIRVVHCDIKPSNILLDDDMTALVTDFGISGLVIEGET  464

Query  392  SGN-----ADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMVTRKKP  556
            + N     ++    +ST  +LCGS+GYIAP    G   ST+GDV+SFGVL+LE+VT K+P
Sbjct  465  NNNISYHPSESISFSSTHGLLCGSVGYIAP----GERASTEGDVFSFGVLLLEVVTGKRP  520

Query  557  TDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQSAEVMKMWEVAIRELIEVGMLCTQDC  736
            TD  F +   LH++VKS     +D                       ++++  M      
Sbjct  521  TDLDFQQGAGLHEWVKSHYPHKID-----------------------DIVDEAMY----T  553

Query  737  PSTRPTMLDAADDLNRLKRYL  799
            PS RP+M+D A ++ RLK +L
Sbjct  554  PSLRPSMVDVAHEMTRLKEHL  574



>gb|KGN58648.1| hypothetical protein Csa_3G710760 [Cucumis sativus]
Length=895

 Score =   209 bits (533),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 134/159 (84%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL  Q+GNS KSF REC+VL+RIRHRNLIR+ITACSLPDFKA+VLPYMANGSLD  LYP
Sbjct  731  KVLHTQSGNSTKSFNRECEVLKRIRHRNLIRIITACSLPDFKAIVLPYMANGSLDNHLYP  790

Query  182  HPHSGSS----DLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALV  349
            H  + S+    DL+L++RVNICSDIAEG+AYLHHHSPV+VIHCDLKPSNVLL +DMTALV
Sbjct  791  HSPTSSTSGSSDLNLIERVNICSDIAEGMAYLHHHSPVRVIHCDLKPSNVLLKDDMTALV  850

Query  350  SDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAP  466
            SDFGIS+L+    GS    + +G STANML GSIGYIAP
Sbjct  851  SDFGISRLMTPGIGSSATVENMGKSTANMLSGSIGYIAP  889



>ref|XP_008649174.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Zea mays]
 gb|AFW76585.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=958

 Score =   209 bits (533),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 134/274 (49%), Positives = 176/274 (64%), Gaps = 29/274 (11%)
 Frame = +2

Query  38   SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYPHPHSGSSDLSLM  217
            SF REC+VLR IRHRNLIR++TACS P+FKA+VLP+M NGSLD  +    H   +  +  
Sbjct  665  SFERECRVLRSIRHRNLIRVVTACSTPEFKAVVLPFMPNGSLDSLI----HGPPAAAAGG  720

Query  218  QR---------VNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFGISK  370
             R         + + S++AEG+AYLHHH+PVKV+HCDLKPSNVLL+ DMTA+VSDFGISK
Sbjct  721  PRHLGLDLDLLLGVASNVAEGMAYLHHHAPVKVVHCDLKPSNVLLDGDMTAVVSDFGISK  780

Query  371  LVMTTTGS------GNAD-QKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLV  529
            LV T  G+      G A    + NS   +L GS+GYIAPEYG G   ST+GDVYSFGV++
Sbjct  781  LVATDDGARGPEVTGEASTSSVCNSITRLLQGSVGYIAPEYGLGGRPSTQGDVYSFGVML  840

Query  530  LEMVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQS------AEVMKMWEVA  691
            LEM++ K+PTD        LH + K       D  L   ++E+S          +M EVA
Sbjct  841  LEMISGKRPTDVISEEGHGLHDWAKKLLQHKRD--LGAVVEERSLLPFGPPPRGEMEEVA  898

Query  692  -IRELIEVGMLCTQDCPSTRPTMLDAADDLNRLK  790
             + EL+E+G+ C+Q  PS RP+M D A ++  L+
Sbjct  899  VVLELLEIGVACSQLAPSMRPSMDDVAHEIAYLR  932



>ref|XP_010909264.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Elaeis guineensis]
Length=719

 Score =   208 bits (529),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 131/275 (48%), Positives = 178/275 (65%), Gaps = 33/275 (12%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
            K+L++Q   + +SFI EC+ LR IRHRNL+++ITACS       DFKALVL +M NGSL 
Sbjct  438  KMLNLQQQGASRSFIAECEALRSIRHRNLVKIITACSGVDFRGNDFKALVLEFMENGSLK  497

Query  167  RRLYPHPHSG--SSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMT  340
            + L+P  + G     L+L QRV+I  D+A  L YLHHHSPV  +HCDLKPSN+LLN DMT
Sbjct  498  QWLHPKVNKGIPMRILNLEQRVSIAIDVASALDYLHHHSPVPTVHCDLKPSNILLNVDMT  557

Query  341  ALVSDFGISKLVMTTTGSGNADQKLGNSTANMLC--GSIGYIAPEYGFGSSTSTKGDVYS  514
            A VSDFG++K +  +T        L + +A+++   GS+GYIAPEYG G   ST+GDVYS
Sbjct  558  AHVSDFGLAKFLSEST-------DLISISASLVAIKGSVGYIAPEYGLGCEVSTQGDVYS  610

Query  515  FGVLVLEMVTRKKPTDDTFGRSLSLHQYVK----SEQMEIVDCSLMRALKEQSAEVMK--  676
            +G+L+LEM T K+PTD+TF  SL LH++V+    S+ M IVD  L+R   E+  E++   
Sbjct  611  YGILLLEMFTGKRPTDETFNESLDLHRFVEMAFPSQIMNIVDPQLIR---EEEYEIINDI  667

Query  677  ----MWEVAIRE----LIEVGMLCTQDCPSTRPTM  757
                  +  IRE    +I +G+ C+   P  RP M
Sbjct  668  QQRCTIQDKIRECLILVISIGLQCSSKVPKERPHM  702



>gb|AAT96696.1| putative LRR-like protein kinase 2 [Musa acuminata]
Length=167

 Score =   194 bits (493),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 137/155 (88%), Gaps = 5/155 (3%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL++ TGNS KSF RECQVL+RIRHRNL+R+ITACSLPDFKALVLP MANGSLD  LY 
Sbjct  18   KVLNLHTGNSTKSFNRECQVLKRIRHRNLMRIITACSLPDFKALVLPLMANGSLDSYLY-  76

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
               S SSDLSL+QRVNICSDIAEG+AYLHHHSPVKVIHCDLKPSNVLLN+DMTALVSDFG
Sbjct  77   ---SSSSDLSLIQRVNICSDIAEGMAYLHHHSPVKVIHCDLKPSNVLLNDDMTALVSDFG  133

Query  362  ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAP  466
            I++LVM + G G+  + +G STANMLCGSIGYIAP
Sbjct  134  IARLVM-SVGVGSDVENVGISTANMLCGSIGYIAP  167



>ref|XP_008779781.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570, partial [Phoenix dactylifera]
Length=228

 Score =   196 bits (498),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 114/231 (49%), Positives = 158/231 (68%), Gaps = 19/231 (8%)
 Frame = +2

Query  14   MQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLDRRLY  178
            +Q   + +SFI EC+ LR IRHRNL+++ITACS       DFKALVL +M NGSL+R L+
Sbjct  1    LQQQGASRSFIAECEALRSIRHRNLVKIITACSSVDFRGNDFKALVLEFMENGSLERWLH  60

Query  179  PHPHSGS--SDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVS  352
            P  +      +L+L QRV+I  D+A  L YLHHHSPV ++HCDLKPSN+LL+ DMTA VS
Sbjct  61   PEVNEQCPMRNLNLEQRVSIAIDVASALDYLHHHSPVPIVHCDLKPSNILLDGDMTARVS  120

Query  353  DFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVL  532
            DFG++K +  +T S +    L       + GS+GYIAPEYG GS  ST+GDVYS+G+L+L
Sbjct  121  DFGLAKFLSESTNSFSISASLA-----AIKGSVGYIAPEYGLGSQVSTQGDVYSYGILLL  175

Query  533  EMVTRKKPTDDTFGRSLSLHQYVK----SEQMEIVDCSLMRALKEQSAEVM  673
            EM T ++PTD+ F  SL LH+ V+    ++ M IVD    ++++E+  E++
Sbjct  176  EMFTGRRPTDEAFNESLDLHRVVEMAFPTQIMNIVDP---QSIREEEYEII  223



>ref|XP_003560978.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Brachypodium distachyon]
Length=1007

 Score =   209 bits (531),  Expect = 3e-57, Method: Composition-based stats.
 Identities = 127/266 (48%), Positives = 168/266 (63%), Gaps = 14/266 (5%)
 Frame = +2

Query  38   SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYPHP---HSGSSDL  208
            SF REC+ LRR RH+NLIR+IT CS P F ALVLP M  GSL+  LYP     H G   L
Sbjct  713  SFRRECEALRRTRHKNLIRVITTCSTPSFHALVLPLMPRGSLEDHLYPRDRERHGGPEGL  772

Query  209  SLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFGISKLVMTTT  388
               Q V++ SD+AEG+AYLHH+SPV+V+HCDLKPSNVLL++ M A++SDFGI++LV    
Sbjct  773  DFRQLVSVASDVAEGMAYLHHYSPVRVVHCDLKPSNVLLDDGMRAVISDFGIARLV-AGA  831

Query  389  GSGNADQKL--------GNSTAN-MLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
            G+G               NS A  +L GS+GYIAPEYG G + S +GDVYSFGV++L+++
Sbjct  832  GAGETTSSTTSDESAPCNNSIATGLLQGSVGYIAPEYGLGGNPSARGDVYSFGVMLLQLI  891

Query  542  TRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQSAEVMKMWEVAIRELIEVGML  721
            T K+PTD  F   L+LH +V+      +  +L  A   +         VA+ ELIE+G+ 
Sbjct  892  TGKRPTDVIFDEGLTLHDWVRRHHPHDIAAALAHAPWARRDAAAANGMVAV-ELIELGLA  950

Query  722  CTQDCPSTRPTMLDAADDLNRLKRYL  799
            CT   P+ RPTM D   ++  L+  L
Sbjct  951  CTHYSPALRPTMEDVCHEITLLREDL  976



>ref|XP_007212637.1| hypothetical protein PRUPE_ppa018076mg, partial [Prunus persica]
 gb|EMJ13836.1| hypothetical protein PRUPE_ppa018076mg, partial [Prunus persica]
Length=880

 Score =   208 bits (529),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 118/277 (43%), Positives = 177/277 (64%), Gaps = 23/277 (8%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KV S+Q   + KSF REC++L  IRHRNLI++I+ CS  DFKALVL YM NGSL++ LY 
Sbjct  616  KVFSLQLEGAFKSFDRECEILSNIRHRNLIKIISCCSELDFKALVLNYMPNGSLEKWLYS  675

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
              +S    L+++QR+NI  D+A  L YLHH + V ++HCD+KPSN+LL++DM A V+DFG
Sbjct  676  ENYS----LNMLQRMNIMIDVASALEYLHHGNSVPIVHCDMKPSNILLDDDMVAHVADFG  731

Query  362  ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
            I+KLV    G G++      +T  M   +IGY+APEYG     ST+GDVYSFG++++E  
Sbjct  732  IAKLV----GVGDS------TTQTMTLATIGYMAPEYGTEGIISTRGDVYSFGIVLMETF  781

Query  542  TRKKPTDDTFGRSLSLHQYVKSEQM-------EIVDCSLMRALKEQSAEVMKMWEVAIRE  700
            TR+KPTD+ F   +SL Q++ +  +       E+VD +L+   K++    ++ W   +  
Sbjct  782  TRRKPTDEMFSGKMSLKQWIANSLLLPDAIIDEVVDANLLEKTKQEHD--VETWRDCLSS  839

Query  701  LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDT  811
            +I + + C+ + P+ R  M ++   LN++K  L  D 
Sbjct  840  IIRLALACSAESPAQRINMQESVATLNKIKNKLLKDN  876



>ref|XP_008778949.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Phoenix dactylifera]
Length=1093

 Score =   208 bits (530),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 125/264 (47%), Positives = 174/264 (66%), Gaps = 23/264 (9%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
             K+L++Q   + +SFI EC+ LR IRHRNL+++ITACS       DFKALVL +M NGSL+
Sbjct  818   KILNVQQQGASRSFIAECEALRSIRHRNLVKIITACSSVDFRGNDFKALVLEFMENGSLE  877

Query  167   RRLYPHPHSGSS--DLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMT  340
             R L+P  +      +L+L QRV+I  D+A  L YLHHHSPV ++HCDLKPSN+LL+ DMT
Sbjct  878   RWLHPEVNEQCQMRNLNLEQRVSIAIDVASALDYLHHHSPVPIVHCDLKPSNILLDGDMT  937

Query  341   ALVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFG  520
             A VSDFG++K +  +  S +    L       + GS+GYIAPEYG GS  ST+GDVYS+G
Sbjct  938   ARVSDFGLAKFLSESANSFSISASLA-----AIKGSVGYIAPEYGLGSQVSTQGDVYSYG  992

Query  521   VLVLEMVTRKKPTDDTFGRSLSLHQYVK----SEQMEIVDCSLMRALKEQSAEVMKMWEV  688
             +L+LEM T ++PT +TF  SL LHQ+V+    ++ M IVD  L+R   E+  E++   + 
Sbjct  993   ILLLEMFTGRRPTHETFNESLDLHQFVEMAFPTQIMNIVDPQLIR---EEEYEIIDDIQH  1049

Query  689   AIRE----LIEVGMLCTQDCPSTR  748
              I+E    +I +G+ C+   P  R
Sbjct  1050  RIQECLISVINIGLQCSCKLPKER  1073



>gb|EEC80146.1| hypothetical protein OsI_21950 [Oryza sativa Indica Group]
Length=1009

 Score =   207 bits (527),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 128/283 (45%), Positives = 175/283 (62%), Gaps = 20/283 (7%)
 Frame = +2

Query  2    KVLSMQTGNSMK-SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL  + G  +  SF REC+VLRR RH+NL+R+IT CS   F ALVLP M +GSL+  LY
Sbjct  688  KVLDPKGGGEVSGSFKRECEVLRRTRHKNLVRVITTCSTATFHALVLPLMPHGSLEGHLY  747

Query  179  PHPHSGSSD-----LSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTA  343
            P    G        L   + +++ SD+AEGLAYLHH++PV+V+HCDLKPSNVLL++DM A
Sbjct  748  PPERGGGGGGAATGLDFGRLMSVVSDVAEGLAYLHHYAPVRVVHCDLKPSNVLLDDDMRA  807

Query  344  LVSDFGISKLVMTTTG-------SGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKG  502
            ++SDFGI+KL+            S + +    NS   +L GS+GYIAPEYG G   ST+G
Sbjct  808  VISDFGIAKLISGAAAVGDGGACSTSDESAPCNSITGLLQGSVGYIAPEYGLGGHPSTQG  867

Query  503  DVYSFGVLVLEMVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQSAE-----  667
            DVYSFGV++LE++T K+PTD  F   L+LH +V+      V   +  A   + A      
Sbjct  868  DVYSFGVMILELITGKRPTDVIFHEGLTLHDWVRRHYPHDVAAVVAHAPWSREAPSPMST  927

Query  668  --VMKMWEVAIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLK  790
                   +VA  ELIE+G++CTQ  P+ RP+M+D   ++  L 
Sbjct  928  AASPAAADVAAVELIELGLVCTQHSPALRPSMVDVCHEITLLN  970



>ref|XP_009782387.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Nicotiana sylvestris]
 ref|XP_009782388.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Nicotiana sylvestris]
Length=1010

 Score =   206 bits (524),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 129/284 (45%), Positives = 177/284 (62%), Gaps = 26/284 (9%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLP-----DFKALVLPYMANGSLD  166
             KVL +Q   ++KSFI EC+VL+ +RHRNL++L+TACS       DFKAL+  +M NGSLD
Sbjct  735   KVLDLQHRGALKSFIAECEVLKNLRHRNLVKLVTACSGTNFQGNDFKALIYEFMVNGSLD  794

Query  167   RRLYPHPHSGS---SDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDM  337
              RL+   + GS     L L QRVNI  DIA  L YLHH S + V+HCDLKPSNVLL++DM
Sbjct  795   DRLHSFFNDGSLHVRHLDLYQRVNIAMDIAFALEYLHHGSQIPVVHCDLKPSNVLLDKDM  854

Query  338   TALVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSF  517
             TA V DFG+S+ +  T     A Q    S+   + GSIGY APEYG GS  ST GD+YS+
Sbjct  855   TARVGDFGLSRFLQET-----AQQT---SSTIGIKGSIGYAAPEYGMGSEVSTLGDIYSY  906

Query  518   GVLVLEMVTRKKPTDDTFGRSLSLHQYVK-----SEQMEIVDCSLMRALKEQSAEVM-KM  679
             G+++LE++T KKPTDD F   L+LH YVK        MEIVD  L +  +  ++ +  + 
Sbjct  907   GIIILEIITGKKPTDDAFSNGLNLHSYVKMAFSAGRVMEIVDPMLCQEKETTNSTIAERK  966

Query  680   WEVAIRE----LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYL  799
              +  IRE    + ++G+ CT + P  R  + D   +L  + +++
Sbjct  967   TKDYIRECLISMCKIGIACTMESPKERMGISDVVKELQLIIKFI  1010



>gb|EAZ36072.1| hypothetical protein OsJ_20381 [Oryza sativa Japonica Group]
Length=1029

 Score =   206 bits (524),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 126/284 (44%), Positives = 175/284 (62%), Gaps = 22/284 (8%)
 Frame = +2

Query  2    KVLSMQTGNSMK-SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL  + G  +  SF REC+VLRR RH+NL+R+IT CS   F ALVLP M +GSL+  LY
Sbjct  704  KVLDPKGGGEVSGSFKRECEVLRRTRHKNLVRVITTCSTATFHALVLPLMPHGSLEGHLY  763

Query  179  PHPHSGSSDLSLM------QRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMT  340
            P                  + +++ SD+AEGLAYLHH++PV+V+HCDLKPSNVLL++DM 
Sbjct  764  PPERGAGGGAGGGDGLDFGRLMSVVSDVAEGLAYLHHYAPVRVVHCDLKPSNVLLDDDMR  823

Query  341  ALVSDFGISKLV-------MTTTGSGNADQKLG-NSTANMLCGSIGYIAPEYGFGSSTST  496
            A++SDFGI+KL+            S  +D+    NS   +L GS+GYIAPEYG G   S 
Sbjct  824  AVISDFGIAKLISGAAAAVGDGGASSTSDESAPCNSITGLLQGSVGYIAPEYGLGGHPSR  883

Query  497  KGDVYSFGVLVLEMVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRA-LKEQSAEVM  673
            +GDVYSFGV++LE++T K+PTD  F   L+LH +V+      V   +  A  + ++   M
Sbjct  884  QGDVYSFGVMILELITGKRPTDVIFHEGLTLHDWVRRHYPHDVAAVVAHAPWRREAPSPM  943

Query  674  KM------WEVAIRELIEVGMLCTQDCPSTRPTMLDAADDLNRL  787
                     +VA  ELIE+G++CTQ  P+ RP+M+D   ++  L
Sbjct  944  STAASPAGADVAAVELIELGLVCTQHSPALRPSMVDVCHEITLL  987



>ref|XP_008225338.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Prunus mume]
Length=1128

 Score =   206 bits (524),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 118/277 (43%), Positives = 177/277 (64%), Gaps = 23/277 (8%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
             KV S+Q   + KSF REC++L  IRHRNLI++I+ CS  DFKALVL YM NGSL++ LY 
Sbjct  864   KVFSLQLEGAFKSFDRECEILSNIRHRNLIKIISCCSELDFKALVLNYMPNGSLEKWLYS  923

Query  182   HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
               +S    L+++QR+NI  D+A  L YLHH + V ++HCD+KPSN+LL++DM A V+DFG
Sbjct  924   ENYS----LNMLQRMNIMIDVASALEYLHHGNSVPIVHCDMKPSNILLDDDMVAHVADFG  979

Query  362   ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
             I+KLV    G G++      +T  M   +IGY+APEYG     ST+GDVYSFG++++E  
Sbjct  980   IAKLV----GLGDS------TTQTMTLATIGYMAPEYGTEGIISTRGDVYSFGIVLMETF  1029

Query  542   TRKKPTDDTFGRSLSLHQYVKSEQM-------EIVDCSLMRALKEQSAEVMKMWEVAIRE  700
             TR+KPTD+ F   +SL Q++ +  +       E+VD +L+   K++    ++ W   +  
Sbjct  1030  TRRKPTDEMFSGKMSLKQWIANSLLLPDAIIDEVVDANLLGKTKQEHD--VETWRDCLSS  1087

Query  701   LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDT  811
             +I + + C+ + P+ R  M ++   LN++K  L  D 
Sbjct  1088  IIRLALACSAESPAQRINMQESVATLNKIKNKLLKDN  1124



>ref|XP_009629748.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Nicotiana tomentosiformis]
Length=530

 Score =   201 bits (510),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 116/271 (43%), Positives = 166/271 (61%), Gaps = 18/271 (7%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KV  MQ   ++K+F  EC++L  +RHRNL+++++ CS  DF A+VL YM NGSLD+ LY 
Sbjct  264  KVFDMQWQGALKNFDSECEILSNVRHRNLVQIVSTCSNMDFVAMVLEYMPNGSLDKMLY-  322

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
               S  + LSL++R+NI  D+A  + YLHH   V ++HCDLKP+NVLL++D+TA V+DFG
Sbjct  323  ---SDRNCLSLVERLNIMIDVALAVEYLHHDYTVSIVHCDLKPANVLLDQDLTAHVADFG  379

Query  362  ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
            I+K++           + GN+      G+IGYIAPEYG     ST  DVYSFG+L+LE  
Sbjct  380  IAKML----------AQEGNNAQTKTLGTIGYIAPEYGLDGQISTSSDVYSFGILLLETF  429

Query  542  TRKKPTDDTFGRSLSLHQYVK----SEQMEIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
            TRKKPTDD FG  LSLH++V        ++I+D  L+  +   S E     +  +  +I 
Sbjct  430  TRKKPTDDMFGGDLSLHKWVSLSFPDAVIDILDADLVSDIAFTSDENQSRIKQLLVSIIN  489

Query  710  VGMLCTQDCPSTRPTMLDAADDLNRLKRYLT  802
            V  LC ++ P  R  M +    L +++  LT
Sbjct  490  VAFLCLKELPEERINMREVVVQLKKIRAELT  520



>ref|XP_008787554.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Phoenix dactylifera]
Length=1079

 Score =   206 bits (523),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 123/267 (46%), Positives = 169/267 (63%), Gaps = 23/267 (9%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
             K+L++Q   + +SFI EC+ LR IRHRNL+++ITACS       DFKALVL +M NGSL+
Sbjct  788   KILNLQQQGASRSFIAECEALRSIRHRNLVKIITACSSVDFRGNDFKALVLEFMENGSLE  847

Query  167   RRLYPHPHSGSS--DLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMT  340
             R L+P  +      +L+L QRV+I  D+A  L YLHHHSPV ++HCDLKPSN+LL+ DMT
Sbjct  848   RWLHPEANKQCPMRNLNLEQRVSIAIDVASALDYLHHHSPVPIVHCDLKPSNILLDGDMT  907

Query  341   ALVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFG  520
             A V+DFG++K +  +T S +    L       + GS+GYIAPEYG GS  ST GDVYS+G
Sbjct  908   ARVTDFGLAKFLSESTNSFSISASLA-----AIKGSVGYIAPEYGLGSQVSTHGDVYSYG  962

Query  521   VLVLEMVTRKKPTDDTFGRSLSLHQYVK----SEQMEIVDCSLMRAL-------KEQSAE  667
             +L+LEM T ++PTD+TF  S  LHQ+V+    ++ M IVD  L R         K+Q   
Sbjct  963   ILLLEMFTGRRPTDETFTESQDLHQFVEMAFPTQIMNIVDPQLTREEEFESIDDKQQRCA  1022

Query  668   VMKMWEVAIRELIEVGMLCTQDCPSTR  748
                  +  +  +I +G+ C+   P  R
Sbjct  1023  KQDRIQECLISVINIGLQCSSKLPKER  1049



>ref|XP_009588501.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Nicotiana tomentosiformis]
Length=800

 Score =   203 bits (517),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 128/289 (44%), Positives = 175/289 (61%), Gaps = 29/289 (10%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
            KVL +Q   ++KSFI EC+VL+ +RHRNL++L+TACS       DFKAL+  +M +GSLD
Sbjct  511  KVLDLQHRGALKSFIAECEVLKNLRHRNLVKLVTACSGIDFQGNDFKALIYEFMVHGSLD  570

Query  167  RRLYPHPHSGS---SDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDM  337
              L+   + GS     L   QRVNI  DIA  L YLH+ S + V+HCDLKPSNVLL+ DM
Sbjct  571  DWLHSFSNDGSLHIQYLDFYQRVNIAMDIAFALEYLHNGSQIPVVHCDLKPSNVLLDMDM  630

Query  338  TALVSDFGISKLVMTTTGSGNADQKLGNSTANM-LCGSIGYIAPEYGFGSSTSTKGDVYS  514
            TA V DFG+S+ +  T     A Q   + T+ + + GSIGY APEYG GS  ST GD+YS
Sbjct  631  TARVGDFGLSRFLQET-----AQQTSASETSTIGIKGSIGYAAPEYGMGSEVSTYGDIYS  685

Query  515  FGVLVLEMVTRKKPTDDTFGRSLSLHQYVK-----SEQMEIVDCSLMRALKEQSAEVMKM  679
            +G+++LE++T KKPTDDTF   L+LH YV         MEIVD  L   ++E+  E   +
Sbjct  686  YGIIILEIITEKKPTDDTFSNGLNLHNYVNMAFSAGRVMEIVDPMLFHNMQEE--ETTSI  743

Query  680  WEVAIRELI--------EVGMLCTQDCPSTRPTMLDAADDLNRLKRYLT  802
             E   ++ I        ++G+ CT + P  R  + D   +L  +K  L+
Sbjct  744  SERKTKDYITECLISMCKIGIACTMESPKERMGISDVVKELQLIKETLS  792



>ref|XP_010934694.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Elaeis guineensis]
Length=1048

 Score =   205 bits (522),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 124/269 (46%), Positives = 176/269 (65%), Gaps = 27/269 (10%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
             K+L++Q   + ++FI EC+ LR IRHRNL+++ITACS       DFKALVL +M NGSL+
Sbjct  767   KILNLQQQGASRTFIAECEALRSIRHRNLVKIITACSSVDFRGNDFKALVLEFMENGSLE  826

Query  167   RRLYPHPHSGSS--DLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMT  340
             + L+P  +      +L+L QRV+I  D+A  L YLHHHSPV ++HCDLKPSN+LL++DMT
Sbjct  827   QWLHPEVNERCPMRNLNLEQRVSIAIDVASALDYLHHHSPVPIVHCDLKPSNILLDDDMT  886

Query  341   ALVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFG  520
             A VSDFG +K +     SG+ D    +++   + GS+GYIAPEYG GS  ST+GDVYS+G
Sbjct  887   AHVSDFGQAKFL-----SGSTDSFSISASLVAIKGSVGYIAPEYGLGSEVSTQGDVYSYG  941

Query  521   VLVLEMVTRKKPTDDTFGRSLSLHQYVK----SEQMEIVDCSLMRALKEQSAEVMKMWEV  688
             +L+LEM T K+P D+TF  SL LH++VK    ++ M IVD  L++  KE+   +  M + 
Sbjct  942   ILLLEMFTGKRPIDETFNESLDLHRFVKMAFPTQIMNIVDPQLIQ--KEEYEIINDMQQR  999

Query  689   AIRE---------LIEVGMLCTQDCPSTR  748
               +E         +I +G+ C+   P  R
Sbjct  1000  CTKEDRITECLISVINIGLQCSNKLPKER  1028



>ref|XP_010934695.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Elaeis guineensis]
Length=1062

 Score =   205 bits (521),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 123/266 (46%), Positives = 173/266 (65%), Gaps = 22/266 (8%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
             KVL++Q   +  SFI EC+ LR IRHRNL+++ITACS       DFKALVL +M NGSL+
Sbjct  782   KVLNLQQQGASSSFIAECEALRSIRHRNLVKIITACSGVDFRGNDFKALVLEFMENGSLE  841

Query  167   RRLYP--HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMT  340
             + L+P  +      +L+L QRV+I  D+A  + YLHHHSPV ++HCDLKPSN+LL++DMT
Sbjct  842   QWLHPKVNEQIPMRNLNLEQRVSIAIDVASAMDYLHHHSPVPIVHCDLKPSNILLDDDMT  901

Query  341   ALVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFG  520
             A VSDFG++K +   T S +    L       + GS+GYIAPEYG GS  ST+GDVYS+G
Sbjct  902   AHVSDFGLAKFLSEPTNSFSISASLV-----AIKGSVGYIAPEYGLGSEISTRGDVYSYG  956

Query  521   VLVLEMVTRKKPTDDTFGRSLSLHQYVK----SEQMEIVDCSLMRALKEQSA----EVMK  676
             +L+LEM T K+PTD+ F  S+ LHQ+V+    ++ M I+D  L+R  K +      E  K
Sbjct  957   ILLLEMFTGKRPTDEIFNESIDLHQFVEMAFPTQIMNIIDPQLIRKEKYEIVNDIRERFK  1016

Query  677   MWEV--AIRELIEVGMLCTQDCPSTR  748
              +++   +  +I +G+ C+   P  R
Sbjct  1017  RYKILECLISVISIGLQCSNRLPKER  1042



>ref|XP_009614227.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Nicotiana tomentosiformis]
Length=1022

 Score =   204 bits (520),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 130/288 (45%), Positives = 175/288 (61%), Gaps = 26/288 (9%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDF-----KALVLPYMANGSLD  166
             KVL +Q   ++KSFI EC+VL+ +RHRNL++L+TACS  DF     KAL+  +M NGSLD
Sbjct  734   KVLDLQHRGALKSFIAECEVLKNLRHRNLVKLVTACSGTDFQGNDFKALIYEFMVNGSLD  793

Query  167   RRLYPHPHSGSSD---LSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDM  337
               L+   + GS     L L QRVN+  DIA  L YLHH S + V+HCDLKPSNVLL+ DM
Sbjct  794   DWLHSFSNDGSLHVLHLDLYQRVNVAMDIAFALEYLHHGSQIPVVHCDLKPSNVLLDMDM  853

Query  338   TALVSDFGISKLVMTTTGSGNADQKLGNSTANM-LCGSIGYIAPEYGFGSSTSTKGDVYS  514
             TA V DFG+S+ +  T     A Q     T+ + + GSIGY APE+G GS  ST GD+YS
Sbjct  854   TARVGDFGLSRFLQET-----AQQTSPKETSTIGIKGSIGYAAPEFGMGSEVSTLGDIYS  908

Query  515   FGVLVLEMVTRKKPTDDTFGRSLSLHQYVK-----SEQMEIVDCSLMRALKEQSAE---V  670
             +G+++LEM+T KKPTDD F   L+LH YVK        MEIVD  +   L+E+       
Sbjct  909   YGIIILEMITGKKPTDDAFSNGLNLHNYVKMAFSAGRVMEIVDPMICHNLQEEETTNTIA  968

Query  671   MKMWEVAIRE----LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLT  802
              +  +  IRE    + ++G+ CT + P  R  + D   +L  +K  L+
Sbjct  969   ERKTKDYIRECLIFMCKIGIACTMESPKERMGISDVVKELQLVKETLS  1016



>ref|XP_010042840.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570, partial [Eucalyptus grandis]
Length=348

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 124/287 (43%), Positives = 178/287 (62%), Gaps = 25/287 (9%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
            K+L +    + KSFI EC+VLRRIRHRNL++++TACS       DFKALV  +M+NGSLD
Sbjct  59   KILDLTCDGASKSFIAECEVLRRIRHRNLVKVLTACSGFDFNGNDFKALVYEFMSNGSLD  118

Query  167  RRLYPHPHSGS--SDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMT  340
              L+P     +  + LSL++RVNI  D+A  L YLHHH  + ++HCDLKPSNVLL+++M 
Sbjct  119  EWLHPTASQDTERNKLSLLERVNIAIDVACALDYLHHHYEMPIVHCDLKPSNVLLDDEMN  178

Query  341  ALVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFG  520
              V DFG+++ +   T    ADQ    S++  + GS GY+APEYG GS+ ST+GDVYSFG
Sbjct  179  GHVGDFGLARFLPEATHKLLADQ----SSSVGVKGSFGYVAPEYGVGSAVSTEGDVYSFG  234

Query  521  VLVLEMVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQSAEVMKMWEVA---  691
            VLVLEM T K+P DD F   L LH++ K+   + V+ ++   L ++  E+ K   +A   
Sbjct  235  VLVLEMFTGKRPIDDMFENGLDLHRFTKAAFADRVEKAIDPILLQEIEELEKRRTIAPEG  294

Query  692  -------IRE----LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYL  799
                   I++    +IEVG+ C+ +    R  + DA   L  +++ L
Sbjct  295  KSKSWCSIKDCLVLIIEVGITCSFESSKERMDIYDALTKLQGMRKKL  341



>emb|CBI36775.3| unnamed protein product [Vitis vinifera]
Length=725

 Score =   201 bits (512),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 122/271 (45%), Positives = 171/271 (63%), Gaps = 13/271 (5%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL  +     +SF RECQ+L  IRHRNL+R+I +     FKA+VL Y+ NG+L++ LYP
Sbjct  439  KVLQEECVQGYRSFKRECQILSEIRHRNLVRMIGSTWNSGFKAIVLEYIGNGNLEQHLYP  498

Query  182  H-PHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
                 G S+L L +R+ I  D+A GL YLH   PV+V+HCDLKP NVLL+ DM A V+DF
Sbjct  499  GGSDEGGSELKLRERMGIAIDVANGLEYLHEGCPVQVVHCDLKPQNVLLDNDMVAHVADF  558

Query  359  GISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEM  538
            GI KL+     SG+  +    +T   L GS+GYI PEYG G   ST+GDVYSFGV++LEM
Sbjct  559  GIGKLI-----SGDKPRGHVTTTTAFLRGSVGYIPPEYGQGIDVSTRGDVYSFGVMMLEM  613

Query  539  VTRKKPTDDTFGRSLSLHQYVKS----EQMEIVDCSLMRA--LKEQSAEVMKMWEVAIRE  700
            +TRK+PT++ F   L L ++V S    + ++IVD SL     L+E S  + K+ +  I  
Sbjct  614  ITRKRPTNEMFSDGLDLRKWVCSAFPNQVLDIVDISLKHEAYLEEGSGALHKLEQCCIH-  672

Query  701  LIEVGMLCTQDCPSTRPTMLDAADDLNRLKR  793
            +++ GM+CT++ P  RP +   A  L  + +
Sbjct  673  MLDAGMMCTEENPQKRPLISSVAQRLKNVWK  703



>gb|EEE65226.1| hypothetical protein OsJ_20379 [Oryza sativa Japonica Group]
Length=987

 Score =   203 bits (517),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 128/274 (47%), Positives = 177/274 (65%), Gaps = 27/274 (10%)
 Frame = +2

Query  38   SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYPHPHSGSS-----  202
            SF REC+VLR IRHRNLIR+ITACS P+FKA+VLP+MANGSLD  ++P P          
Sbjct  687  SFERECRVLRSIRHRNLIRVITACSSPEFKAVVLPFMANGSLDGLIHPPPPPPPGGKPAA  746

Query  203  ------DLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFGI  364
                  DL L+  ++I  ++A+G+AYLHHH+P  V+HCDLKPSNVLL++DMTA+VSDFG+
Sbjct  747  KAHRRLDLELL--LSIAGNVADGMAYLHHHAPFGVVHCDLKPSNVLLDDDMTAIVSDFGV  804

Query  365  SKLV------------MTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDV  508
            SKLV                   ++     +S   +L GS+GYIAPEYG G + ST+GDV
Sbjct  805  SKLVAQQEDAKDPDAIDDDDDDASSTPYPRSSITRLLQGSVGYIAPEYGLGCNPSTQGDV  864

Query  509  YSFGVLVLEMVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQSAEVMKMWEV  688
            YSFGVL++EM+T K+PT+       SLH++VK       D  ++ A++  +A   +    
Sbjct  865  YSFGVLLMEMITGKRPTEVIAEEGHSLHEWVKRRLSS--DDDVVAAVELSAATSPRHETH  922

Query  689  AIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLK  790
             + EL+E+G+ C++  P+ RPTM D A ++ RLK
Sbjct  923  VVVELLELGVACSRIVPAMRPTMDDVAQEIARLK  956



>ref|XP_008809043.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Phoenix dactylifera]
Length=1031

 Score =   203 bits (516),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 123/262 (47%), Positives = 173/262 (66%), Gaps = 22/262 (8%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
             K+L++    + +SFI EC+ LR IRHRNL+++ITACS       DFKALVL +M NGSL+
Sbjct  759   KILNLHQQGASRSFIAECEALRSIRHRNLVKIITACSSVDFRGNDFKALVLEFMENGSLE  818

Query  167   RRLYPHPHSGSS--DLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMT  340
             R L+P  +      +L+L QRV+I  D+A  L YLHHHS V ++HCDLKPSN+LL+ DMT
Sbjct  819   RWLHPEVNEQCPMRNLNLEQRVSIAIDVASALDYLHHHSLVPIVHCDLKPSNILLDGDMT  878

Query  341   ALVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFG  520
             A VSDFG++K +  +T S +    L       + GS+GYIAPEYG GS  ST+GDVYS+G
Sbjct  879   ARVSDFGLAKFLSESTNSFSMSASLA-----AIKGSVGYIAPEYGLGSQVSTQGDVYSYG  933

Query  521   VLVLEMVTRKKPTDDTFGRSLSLHQYVK----SEQMEIVDCSLMRALKEQSAEVM--KMW  682
             +L+LEM T ++PTD+ F  SL LH++V+    ++ M IVD  L+R   E+  E++  ++ 
Sbjct  934   ILLLEMFTGRRPTDEAFNESLDLHRFVEMAFPTQIMNIVDPQLIR---EEEYEIINDRIR  990

Query  683   EVAIRELIEVGMLCTQDCPSTR  748
             E  I  +I +G+ C+   P  R
Sbjct  991   ECLI-SVINIGLQCSSKLPKER  1011



>ref|NP_001057008.2| Os06g0186300 [Oryza sativa Japonica Group]
 dbj|BAF18922.2| Os06g0186300 [Oryza sativa Japonica Group]
Length=1175

 Score =   204 bits (518),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 126/285 (44%), Positives = 173/285 (61%), Gaps = 22/285 (8%)
 Frame = +2

Query  2    KVLSMQTGNSMK-SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL  + G  +  SF REC+VLRR RH+NL+R+IT CS   F ALVLP M +GSL+  LY
Sbjct  702  KVLDPKGGGEVSGSFKRECEVLRRTRHKNLVRVITTCSTATFHALVLPLMPHGSLEGHLY  761

Query  179  PHPHSGSSDLSLM------QRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMT  340
            P                  + +++ SD+AEGLAYLHH++PV+V+HCDLKPSNVLL++DM 
Sbjct  762  PPERGAGGGAGGGDGLDFGRLMSVVSDVAEGLAYLHHYAPVRVVHCDLKPSNVLLDDDMR  821

Query  341  ALVSDFGISKLV-------MTTTGSGNADQKLG-NSTANMLCGSIGYIAPEYGFGSSTST  496
            A++SDFGI+KL+            S  +D+    NS   +L GS+GYIAPEYG G   S 
Sbjct  822  AVISDFGIAKLISGAAAAVGDGGASSTSDESAPCNSITGLLQGSVGYIAPEYGLGGHPSR  881

Query  497  KGDVYSFGVLVLEMVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQSAE---  667
            +GDVYSFGV++LE++T K+PTD  F   L+LH +V+      V   +  A   + A    
Sbjct  882  QGDVYSFGVMILELITGKRPTDVIFHEGLTLHDWVRRHYPHDVAAVVAHAPWRREAPSPM  941

Query  668  ----VMKMWEVAIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLK  790
                     +VA  ELIE+G++CTQ  P+ RP+M+D   ++  L 
Sbjct  942  STAASPAAADVAAVELIELGLVCTQHSPALRPSMVDVCHEITLLN  986



>ref|XP_010090360.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB39330.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=1222

 Score =   204 bits (518),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 123/278 (44%), Positives = 183/278 (66%), Gaps = 22/278 (8%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
            KV +++   + KSF+ EC+ LR IRHRNL+++IT+CS       DFKAL+  ++ANGSL+
Sbjct  720  KVFNLERRGASKSFMAECEALRNIRHRNLVKIITSCSSVDFQGNDFKALIYEFIANGSLE  779

Query  167  RRLYPHPHSGSSD---LSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDM  337
              L+P P +G +    L+L  R+NI  D+A  L YLH+H+   +IHCDLKPSN+LL++DM
Sbjct  780  DWLHPRPQTGENQRKSLTLALRLNIVIDVASALDYLHNHNEHPIIHCDLKPSNILLDQDM  839

Query  338  TALVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSF  517
            T+ V DFG+S+++       + D    N+++  + G+IGY APEYG GS  ST+GDVYSF
Sbjct  840  TSHVGDFGLSRIIAEEDVETSQD----NTSSLGIRGTIGYAAPEYGMGSKVSTQGDVYSF  895

Query  518  GVLVLEMVTRKKPTDDTFGRSLSLHQYVKS----EQMEIVDCSLMRALKEQSAEVMKMWE  685
            G+L+LE+ T KKPTD+     LSLHQYVK       MEIVD    ++L+E+++   ++ E
Sbjct  896  GILMLEIFTGKKPTDENL-EGLSLHQYVKMALPIRVMEIVD----QSLQEEASRGNRVHE  950

Query  686  VAIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYL  799
              I  +  +G+ C+++ PS R  + DA  DL+++K  L
Sbjct  951  CLI-SIFMIGLKCSEELPSQRMKINDALKDLHKIKNML  987



>ref|XP_002280784.1| PREDICTED: putative receptor-like protein kinase At3g47110 isoform 
X1 [Vitis vinifera]
Length=1052

 Score =   202 bits (514),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 122/271 (45%), Positives = 171/271 (63%), Gaps = 13/271 (5%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
             KVL  +     +SF RECQ+L  IRHRNL+R+I +     FKA+VL Y+ NG+L++ LYP
Sbjct  766   KVLQEECVQGYRSFKRECQILSEIRHRNLVRMIGSTWNSGFKAIVLEYIGNGNLEQHLYP  825

Query  182   H-PHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
                  G S+L L +R+ I  D+A GL YLH   PV+V+HCDLKP NVLL+ DM A V+DF
Sbjct  826   GGSDEGGSELKLRERMGIAIDVANGLEYLHEGCPVQVVHCDLKPQNVLLDNDMVAHVADF  885

Query  359   GISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEM  538
             GI KL+     SG+  +    +T   L GS+GYI PEYG G   ST+GDVYSFGV++LEM
Sbjct  886   GIGKLI-----SGDKPRGHVTTTTAFLRGSVGYIPPEYGQGIDVSTRGDVYSFGVMMLEM  940

Query  539   VTRKKPTDDTFGRSLSLHQYVKS----EQMEIVDCSLMRA--LKEQSAEVMKMWEVAIRE  700
             +TRK+PT++ F   L L ++V S    + ++IVD SL     L+E S  + K+ +  I  
Sbjct  941   ITRKRPTNEMFSDGLDLRKWVCSAFPNQVLDIVDISLKHEAYLEEGSGALHKLEQCCIH-  999

Query  701   LIEVGMLCTQDCPSTRPTMLDAADDLNRLKR  793
             +++ GM+CT++ P  RP +   A  L  + +
Sbjct  1000  MLDAGMMCTEENPQKRPLISSVAQRLKNVWK  1030



>emb|CAN71346.1| hypothetical protein VITISV_024251 [Vitis vinifera]
Length=1052

 Score =   202 bits (514),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 122/271 (45%), Positives = 172/271 (63%), Gaps = 13/271 (5%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
             KVL  +     +SF RECQ+L  IRHRNL+R+I +     FKA+VL Y+ NG+L++ LYP
Sbjct  766   KVLQEECIQGYRSFKRECQILSEIRHRNLVRMIGSTWNSGFKAIVLEYIGNGNLEQHLYP  825

Query  182   H-PHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
                  G S+L L +R+ I  D+A GL YLH   PV+V+HCDLKP NVLL++DM A V+DF
Sbjct  826   GGSDEGGSELKLRERMGIAIDVANGLEYLHEGCPVQVVHCDLKPQNVLLDDDMVAHVADF  885

Query  359   GISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEM  538
             GI KL+     SG+  +    +T   L GS+GYI PEYG G   ST+GDVYSFGV++LEM
Sbjct  886   GIGKLI-----SGDKPRGHVTTTTAFLRGSVGYIPPEYGQGIDVSTRGDVYSFGVMMLEM  940

Query  539   VTRKKPTDDTFGRSLSLHQYVKS----EQMEIVDCSLMRA--LKEQSAEVMKMWEVAIRE  700
             +TRK+PT++ F   L L ++V S    + ++IVD SL     L+E S  + K+ +  I  
Sbjct  941   ITRKRPTNEMFSDGLDLRKWVCSAFPNQVLDIVDISLKHEAYLEEGSGALHKLEQCCIH-  999

Query  701   LIEVGMLCTQDCPSTRPTMLDAADDLNRLKR  793
             +++ GM+CT++ P  RP +   A  L  + +
Sbjct  1000  MLDAGMMCTEENPQKRPLISSVAQRLKNVWK  1030



>dbj|BAD72444.1| putative protein kinase Xa21, receptor type precursor [Oryza 
sativa Japonica Group]
Length=1026

 Score =   202 bits (513),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 124/284 (44%), Positives = 172/284 (61%), Gaps = 22/284 (8%)
 Frame = +2

Query  2    KVLSMQTGNSMK-SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLY  178
            KVL  + G  +  SF REC+VLRR RH+NL+R+IT CS   F ALVLP M +GSL+  LY
Sbjct  702  KVLDPKGGGEVSGSFKRECEVLRRTRHKNLVRVITTCSTATFHALVLPLMPHGSLEGHLY  761

Query  179  PHPHSGSSDLSLM------QRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMT  340
            P                  + +++ SD+AEGLAYLHH++PV+V+HCDLKPSNVLL++DM 
Sbjct  762  PPERGAGGGAGGGDGLDFGRLMSVVSDVAEGLAYLHHYAPVRVVHCDLKPSNVLLDDDMR  821

Query  341  ALVSDFGISKLV-------MTTTGSGNADQKLG-NSTANMLCGSIGYIAPEYGFGSSTST  496
            A++SDFGI+KL+            S  +D+    NS   +L GS+GYIAPEYG G   S 
Sbjct  822  AVISDFGIAKLISGAAAAVGDGGASSTSDESAPCNSITGLLQGSVGYIAPEYGLGGHPSR  881

Query  497  KGDVYSFGVLVLEMVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRA-LKEQSAEVM  673
            +GDVYSFGV++LE++T K+PTD  F   L+LH +V+      V   +  A  + ++   M
Sbjct  882  QGDVYSFGVMILELITGKRPTDVIFHEGLTLHDWVRRHYPHDVAAVVAHAPWRREAPSPM  941

Query  674  KMWEVAIR------ELIEVGMLCTQDCPSTRPTMLDAADDLNRL  787
                          ELIE+G++CTQ  P+ RP+M+D   ++  L
Sbjct  942  STAASPAAADVAAVELIELGLVCTQHSPALRPSMVDVCHEITLL  985



>gb|KCW71988.1| hypothetical protein EUGRSUZ_E00441 [Eucalyptus grandis]
Length=338

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 113/276 (41%), Positives = 166/276 (60%), Gaps = 21/276 (8%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACS-----LPDFKALVLPYMANGSLD  166
            KVL++Q   + K F+ EC+ L  +RHRNL++++TACS       DFKALV  +M NG+LD
Sbjct  31   KVLNLQQKGAFKGFLAECKALSSVRHRNLVKILTACSSIDSHRNDFKALVYEFMVNGNLD  90

Query  167  RRLYPH-PHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTA  343
              L+P+  H     LS  +R+NI  D+A  L YLHH     +IHCDLKPSN+LL++D TA
Sbjct  91   IWLHPNDEHMQFKPLSFQRRLNITIDVASALDYLHHQCRTPIIHCDLKPSNILLDDDFTA  150

Query  344  LVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGV  523
             +SDFG+S+L+  +    N D   G+ +++   G++GYIAPEYG G   ST GDVYSFG+
Sbjct  151  HISDFGLSRLIFNS----NKDIFSGHPSSSAFQGTMGYIAPEYGMGVCPSTSGDVYSFGI  206

Query  524  LVLEMVTRKKPTDDTFGRSLSLHQYVKS----EQMEIVDCSLMRALKEQSAEVMKMWE--  685
            L+LEM T ++PTD+ F  + +L ++VKS        I+D S+      +S +   +W   
Sbjct  207  LLLEMFTGRRPTDNIFKENFNLQKFVKSVLSKRATGILDQSIFCGEVGESMDEEGIWRDC  266

Query  686  -----VAIRELIEVGMLCTQDCPSTRPTMLDAADDL  778
                   +  + E+G++C+ + P  R  M   A DL
Sbjct  267  GTDQAKCLISVFEIGLICSAESPKDRKDMNGVARDL  302



>ref|XP_006827187.1| hypothetical protein AMTR_s00010p00257340 [Amborella trichopoda]
 gb|ERM94424.1| hypothetical protein AMTR_s00010p00257340 [Amborella trichopoda]
Length=944

 Score =   201 bits (510),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 121/270 (45%), Positives = 172/270 (64%), Gaps = 29/270 (11%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL++Q   + KSF  EC+V++ IRHRNL+++IT CS  DFKALVL +MANG+L+R LYP
Sbjct  674  KVLNLQREGATKSFHAECRVMQNIRHRNLVKIITVCSNLDFKALVLQFMANGNLERWLYP  733

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
                    LSL+QR++I  D+A+ L YLHH   V +IH DLKPSN+LLNEDMTA V DFG
Sbjct  734  Q-DGAHCRLSLLQRLDIVIDVAQALEYLHHSYSVPIIHRDLKPSNILLNEDMTAHVGDFG  792

Query  362  ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
            +++L+         DQ + + T+ +  G+IGYIAPEYG GS+ +T GDVYSFGV++ E+ 
Sbjct  793  LARLI--------GDQNIASQTSTI--GTIGYIAPEYGTGSNITTSGDVYSFGVVLFEIF  842

Query  542  TRKKPTDDTFGRSLSLHQYVKSEQ----MEIVDCSLM----------RALKEQSAEVMKM  679
            TRK+PTD  F   LSL ++V  E     +E+V   L+           +  + S+   K 
Sbjct  843  TRKRPTDPMFSNGLSLSKWVDQEHSDGILEVVHGDLLLENDSHNNGSNSKLQYSSSTFK-  901

Query  680  WEVAIRELIEVGMLCTQDCPSTRPTMLDAA  769
                +  ++++G+ CT++ P+ R  M DA 
Sbjct  902  ---CLSSVMQIGLSCTKERPNERIDMRDAV  928



>ref|NP_001046292.2| Os02g0215900 [Oryza sativa Japonica Group]
 dbj|BAF08206.2| Os02g0215900 [Oryza sativa Japonica Group]
Length=329

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 111/280 (40%), Positives = 172/280 (61%), Gaps = 21/280 (8%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
            KVL++Q   + +SF  EC+ LR IRHRNL++++T CS       DFKALV  ++ NG+LD
Sbjct  46   KVLNLQQAGAYRSFDAECEALRCIRHRNLVKILTVCSGIDFQGSDFKALVFEFLPNGNLD  105

Query  167  RRLYPHPHSGSSD--LSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMT  340
            + L+ H         L+L++R+ I  D+A  L YLH H P  ++HCDLKPSN+LL+ DM 
Sbjct  106  QWLHKHLEEEGEPKVLNLVERLQIAIDVASALEYLHQHKPCPIVHCDLKPSNILLDNDMV  165

Query  341  ALVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFG  520
            A V DFG+++  +    S ++D+  G    N + G+IGY+APEYG G+  S  GDVYS+G
Sbjct  166  AHVGDFGLARF-LHQEHSNSSDKSTG---WNAIRGTIGYVAPEYGLGNEVSIHGDVYSYG  221

Query  521  VLVLEMVTRKKPTDDTFGRSLSLHQYVKS----EQMEIVDCSLMRALKEQSAEVMKMWEV  688
            +L+LEM T K+PT+  FG  L+LH+YV++    +   ++D SL+ A         K  ++
Sbjct  222  ILLLEMFTGKRPTNSEFGDVLTLHEYVETALPDQTTSVIDQSLLDATWNSEGTAQKYHDI  281

Query  689  A------IRELIEVGMLCTQDCPSTRPTMLDAADDLNRLK  790
                   I  +++VG+LC+++ P+ R  + DA  +L  ++
Sbjct  282  EEIRTECIVSILKVGILCSKEIPTDRMQIGDALRELQAIR  321



>gb|KDP44795.1| hypothetical protein JCGZ_01295 [Jatropha curcas]
Length=1891

 Score =   203 bits (516),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 120/273 (44%), Positives = 173/273 (63%), Gaps = 21/273 (8%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
            KVL++Q   + KSF+ EC+ LR I+HRNL++++TACS       DFKALV  +M NGSL+
Sbjct  707  KVLNLQCHGAAKSFMAECEALRNIKHRNLVKIVTACSSVDYQGNDFKALVYEFMVNGSLE  766

Query  167  RRLYPHP-----HSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNE  331
              L+PH      H G   L+L QRVNI SD+A  + YLHHHS   ++HCDLKPSNVLL++
Sbjct  767  EWLHPHVLVNRMHEGYKILNLTQRVNIASDVASAIEYLHHHSGTSIVHCDLKPSNVLLHD  826

Query  332  DMTALVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVY  511
             MTA + DFG++K ++ +  +  ++Q    S    L G+IGY  PEYG GS  S +GDVY
Sbjct  827  AMTARIGDFGLAKFLLHSIHNNFSNQ----SNTAGLRGTIGYAPPEYGLGSEVSKQGDVY  882

Query  512  SFGVLVLEMVTRKKPTDDTFGRSLSLHQYVKS----EQMEIVDCSLMRALKEQSAEVMKM  679
            S+G+L+LEM TRK+PTDD F    +LH++VKS        I+D  L++   +   ++M  
Sbjct  883  SYGILLLEMFTRKRPTDDMFKEDWNLHEFVKSAFPNRASTIIDPILIQEGGQSDDKIMME  942

Query  680  WEVAIRELIEVGMLCTQDCPSTRPTMLDAADDL  778
              ++I   + +G+ C+ + P  R  + DAA +L
Sbjct  943  CLISI---LGIGISCSVESPIDRIDISDAAMNL  972


 Score =   187 bits (476),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 116/260 (45%), Positives = 165/260 (63%), Gaps = 15/260 (6%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
            KVL++Q   + KSF+ EC+ LR IRHRNL++++TACS       DFKALV  +M NGSL+
Sbjct  116  KVLNLQYHGAAKSFMAECEALRNIRHRNLVKIVTACSGVDYQGNDFKALVYEFMVNGSLE  175

Query  167  RRLYPHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTAL  346
              L+P  + G  +L+L+QR+NI  D+A    YLHH+    ++HCDLKPS VLL+++MTA 
Sbjct  176  EWLHPSVNEGYKNLNLIQRINIAIDVASATEYLHHYCGTPIVHCDLKPSKVLLHDEMTAH  235

Query  347  VSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVL  526
            + DFG++K ++ +  +    Q    S++  L G+IGY  PEYG GS  STKGDVYS+G+L
Sbjct  236  IGDFGLAKFLLHSVQNNCTYQ----SSSAGLRGTIGYTPPEYGLGSEVSTKGDVYSYGIL  291

Query  527  VLEMVTRKKPTDDTF-GRSLSLHQYVKSEQMEIVDCSLMRALKEQSAEVMKMWEVAIREL  703
            +LEM+TRK+PTDD F G + S+    ++EQ+ ++D     A+   S  VM  W   I   
Sbjct  292  LLEMITRKRPTDDMFKGGTYSIAGN-ETEQLALLDFKAKIAV--DSLGVMTSWNATIHFC  348

Query  704  IEVGMLCTQDCPSTRPTMLD  763
               G+ C +     R TMLD
Sbjct  349  QWYGITCGRR--HRRVTMLD  366


 Score =   172 bits (435),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 99/241 (41%), Positives = 147/241 (61%), Gaps = 22/241 (9%)
 Frame = +2

Query  101   TACSL-----PDFKALVLPYMANGSLDRRLYPH--PHSGSSD----LSLMQRVNICSDIA  247
             TACS       DF ALV  +M NGSL++ L+P     +G  +    L+L+QR+NI  D+A
Sbjct  1635  TACSGVDNQGNDFMALVYEFMVNGSLEKWLHPSLVAVNGMQERYMFLNLIQRINIAIDVA  1694

Query  248   EGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFGISKLVMTTTGSGNADQKLGNST  427
               + YLHHHS   ++HCDLKPSNVLL+++MTA + DFG++K +  +  +  ++Q    S+
Sbjct  1695  FAIEYLHHHSGTPIVHCDLKPSNVLLDDEMTAHIGDFGLAKFLSHSIQNNFSNQ----SS  1750

Query  428   ANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMVTRKKPTDDTFGRSLSLHQYVKS  607
             +  L G+IGY  PEYG GS  ST+GDVYS+G+L+LEM TRK+PT D F   L+LH++V+S
Sbjct  1751  SAGLRGTIGYAPPEYGLGSEVSTQGDVYSYGILLLEMFTRKRPTADMFKEGLNLHKFVES  1810

Query  608   ----EQMEIVDCSLMRALKEQSAEVMKMWEVAIRELIEVGMLCTQDCPSTRPTMLDAADD  775
                 E   I D  L +   + +   M    ++I   + +G+ C+ +    R  + DAA +
Sbjct  1811  ALPNEVSAIADPFLFQEGGQSNERTMIECLISI---LGIGVSCSAELSRERMDITDAAIE  1867

Query  776   L  778
             L
Sbjct  1868  L  1868



>ref|XP_010916722.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Elaeis guineensis]
Length=1026

 Score =   201 bits (510),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 120/288 (42%), Positives = 182/288 (63%), Gaps = 23/288 (8%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
             KVL++Q   + +SF  EC+ LR IRHRNL++++T+CS       DFKALV  + +NGSL+
Sbjct  740   KVLNLQQHGASRSFFAECEALRNIRHRNLVKILTSCSSMDYRGNDFKALVFEFFSNGSLE  799

Query  167   RRLYPHP--HSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMT  340
             + L+P     S S  LSL +R+NI  D+A  + YLH+H P  ++HCDLKPSNVLL++DMT
Sbjct  800   KWLHPESSEQSNSRKLSLTERLNIAIDVASAVEYLHYHGPKPIVHCDLKPSNVLLSDDMT  859

Query  341   ALVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFG  520
             A VSDFG+++ +  T     ++  L   ++  L GSIGY+APEYG  +  ST GDVYSFG
Sbjct  860   ARVSDFGLARFLNRTI----SNSFLIPVSSMELKGSIGYVAPEYGLANKVSTNGDVYSFG  915

Query  521   VLVLEMVTRKKPTDDTFGRSLSLHQYVK----SEQMEIVD-CSLMRALKEQSAEVMKMW-  682
             +L+LE+ T K+PTDD F    SLH+ V+     E ++I+D C +++    ++++  + W 
Sbjct  916   ILLLELFTGKRPTDDLFREGFSLHKLVQMAFPHEVLDIMDPCMVLQEEDGEASDHTQNWS  975

Query  683   ------EVAIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGD  808
                   E  I  ++ VG+LC+++ P  R  M+D   +L+ ++  L  D
Sbjct  976   DIRGKAEKCIASVLNVGLLCSKESPIERMQMMDVTGELHAIRDALRLD  1023



>emb|CAN79365.1| hypothetical protein VITISV_033877 [Vitis vinifera]
Length=797

 Score =   199 bits (506),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 122/270 (45%), Positives = 172/270 (64%), Gaps = 21/270 (8%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL++Q   + KSF  EC+VL R+RHRNL++ IT+CS P+ +ALVL YM NGSL++ LY 
Sbjct  544  KVLNLQLEGAFKSFDAECKVLARVRHRNLVKXITSCSNPELRALVLQYMXNGSLEKWLY-  602

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
               S +  LSL QRV+I  D+A  L YLHH     V+HCDLKPSNVLL+++M A V DFG
Sbjct  603  ---SFNYXLSLFQRVSIXXDVALALEYLHHGQSEPVVHCDLKPSNVLLDDEMVAHVGDFG  659

Query  362  ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
            I+K++        A+ K    T  +  G++GYIAPEYG     S++GD+YS+G+++LEMV
Sbjct  660  IAKIL--------AENKTVTQTKTL--GTLGYIAPEYGLEGRVSSRGDIYSYGIMLLEMV  709

Query  542  TRKKPTDDTFGRSLSLHQYVKS----EQMEIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
            TRKKP D+ F   +SL Q+VK+    + ME+VD +L R      A   +   +AI EL  
Sbjct  710  TRKKPMDEMFSEEMSLRQWVKATIPNKIMEVVDENLARNQDGGGAIATQEKLLAIMEL--  767

Query  710  VGMLCTQDCPSTRPTMLDAADDLNRLKRYL  799
             G+ C+++ P  R  + +    LN++K  L
Sbjct  768  -GLECSRELPEERMDIKEVVVKLNKIKLQL  796



>ref|XP_008813550.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Phoenix dactylifera]
Length=850

 Score =   199 bits (507),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 111/209 (53%), Positives = 150/209 (72%), Gaps = 12/209 (6%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
            K+L++Q   + +SFI EC+ LR IRHRNL+++ITACS       DFKALVL +M NGSL+
Sbjct  643  KILNLQQQGASRSFIAECEALRSIRHRNLVKIITACSSVDFRGNDFKALVLEFMENGSLE  702

Query  167  RRLYPHPHSGS--SDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMT  340
            R L+P  +      +L+L QRV+I  D+A  L YLHHHSPV ++HCDLKPSN+LL+ +MT
Sbjct  703  RWLHPEVNEQCPMRNLNLEQRVSIAIDVASALDYLHHHSPVPIVHCDLKPSNILLDGNMT  762

Query  341  ALVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFG  520
            A VSDFG++K +  +T S +    L       + GS+GYIAPEYG GS  ST+GDVYS+G
Sbjct  763  ARVSDFGLAKFLSESTNSFSISASLA-----AIKGSVGYIAPEYGLGSQVSTRGDVYSYG  817

Query  521  VLVLEMVTRKKPTDDTFGRSLSLHQYVKS  607
            +L+LE+ TRK+PTD TF  SL LH++V++
Sbjct  818  ILLLEIFTRKRPTDATFNESLDLHRFVET  846



>ref|XP_003633210.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Vitis vinifera]
Length=928

 Score =   200 bits (508),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 122/270 (45%), Positives = 173/270 (64%), Gaps = 21/270 (8%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL++Q   + KSF  EC+VL R+RHRNL+++IT+CS P+ +ALVL YM NGSL++ LY 
Sbjct  675  KVLNLQLEGAFKSFDAECKVLARVRHRNLVKVITSCSNPELRALVLQYMPNGSLEKWLYS  734

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
              +S    LSL QRV+I  D+A  L YLHH     V+HCDLKPSNVLL+++M A V DFG
Sbjct  735  FNYS----LSLFQRVSILLDVALALEYLHHGQSEPVVHCDLKPSNVLLDDEMVAHVGDFG  790

Query  362  ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
            I+K++        A+ K    T  +  G++GYIAPEYG     S++GD+YS+G+++LEMV
Sbjct  791  IAKIL--------AENKTVTQTKTL--GTLGYIAPEYGLEGRVSSRGDIYSYGIMLLEMV  840

Query  542  TRKKPTDDTFGRSLSLHQYVKS----EQMEIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
            TRKKP D+ F   +SL Q+VK+    + ME+VD +L R      A   +   +AI EL  
Sbjct  841  TRKKPMDEMFSEEMSLRQWVKATIPNKIMEVVDENLARNQDGGGAIATQEKLLAIMEL--  898

Query  710  VGMLCTQDCPSTRPTMLDAADDLNRLKRYL  799
             G+ C+++ P  R  + +    LN++K  L
Sbjct  899  -GLECSRELPEERMDIKEVVVKLNKIKSQL  927



>gb|EAY99945.1| hypothetical protein OsI_21948 [Oryza sativa Indica Group]
Length=946

 Score =   199 bits (507),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 126/276 (46%), Positives = 174/276 (63%), Gaps = 25/276 (9%)
 Frame = +2

Query  38   SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYPH--------PHS  193
            SF REC+VLR IRHRNLIR+ITACS P+FKA+VLP+MANGSLD  ++P           +
Sbjct  640  SFERECRVLRSIRHRNLIRVITACSTPEFKAVVLPFMANGSLDGLIHPPPPPPGGKPAAN  699

Query  194  GSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFGISKL  373
                L L   ++I  ++A+G+AYLHHH+P +V+HCDLKPSNVLL++DMTA+VSDFGISKL
Sbjct  700  ADRRLDLELLLSIAGNVADGMAYLHHHAPFRVVHCDLKPSNVLLDDDMTAIVSDFGISKL  759

Query  374  V--------------MTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVY  511
            V                     +      +S   +L GS+GYIAPEYG G + ST+GDVY
Sbjct  760  VAQQEDAKDPDAIDDDDDDDDASPTPHPRSSITRLLQGSVGYIAPEYGLGRNPSTQGDVY  819

Query  512  SFGVLVLEMVTRKKPTDDTFGRSLSLHQYVK---SEQMEIVDCSLMRALKEQSAEVMKMW  682
            +FGVL++EM+T K+PT+       SLH++VK   S   ++V    + +    S    +  
Sbjct  820  NFGVLLMEMITGKRPTEVIAEEGHSLHEWVKRRLSSDDDVVAAVDLSSSTATSVMTPRHE  879

Query  683  EVAIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLK  790
               + EL+E+G+ C++  P+ RPTM D A ++ RLK
Sbjct  880  THVMVELLELGVACSRIVPAMRPTMDDVAQEIARLK  915



>ref|XP_007141779.1| hypothetical protein PHAVU_008G225000g [Phaseolus vulgaris]
 gb|ESW13773.1| hypothetical protein PHAVU_008G225000g [Phaseolus vulgaris]
Length=1014

 Score =   200 bits (508),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 121/281 (43%), Positives = 175/281 (62%), Gaps = 22/281 (8%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
             KVL+++TG + KSF+ EC+VL RI HRNL+ ++T CS       DFKA+V  +M NGSL+
Sbjct  739   KVLNLETGGASKSFVAECKVLGRIMHRNLLNILTCCSSIDYNGKDFKAIVFDFMPNGSLE  798

Query  167   RRLYPHPHSGSSDLSLMQRV--NICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMT  340
               L+ +    S + SL   +  NI  D+A  L YLHH S   V+HCD+KPSNVLL++D+ 
Sbjct  799   SLLHNNEDLESRNFSLNLELMLNIALDVANALDYLHHGSEQAVVHCDIKPSNVLLDDDIV  858

Query  341   ALVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFG  520
             A + DFG+++L+  TTG  N DQ     +++ + G+IGY+ PEYG G   S KGD+YS+G
Sbjct  859   AHLGDFGLARLLHVTTGHSNRDQ----VSSSAIRGTIGYVPPEYGTGCKVSAKGDIYSYG  914

Query  521   VLVLEMVTRKKPTDDTFGRSLSLHQY----VKSEQMEIVDCSLMRALKEQSAEVMKMWEV  688
             ++VLEM+TR+KPTD  FG +LSLH++    +     EIVD  L+    E+   VM   E 
Sbjct  915   IVVLEMLTRRKPTDAMFGEALSLHKFCQMAIPEGISEIVDPRLLVPTNEEGRRVM---ES  971

Query  689   AIRE----LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYL  799
              IRE       +G+LC+ + P  R  + D   +L+ +K+ L
Sbjct  972   KIRECLVGFARIGVLCSAELPDERMDIKDVVLELHTIKQTL  1012



>ref|XP_006493616.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Citrus sinensis]
Length=327

 Score =   190 bits (482),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 117/268 (44%), Positives = 169/268 (63%), Gaps = 23/268 (9%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            K+ ++Q   + +SF  EC+VLR +RHRNLI+++++CS PDFKALVL +M NGSL++ LY 
Sbjct  67   KIFNLQLERAFRSFDSECEVLRNVRHRNLIKILSSCSNPDFKALVLEFMPNGSLEKWLYS  126

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHH-HSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            H +     L +++R+NI  D+   L YLHH HS   +IHCDLKP+N+LL+E+M A VSDF
Sbjct  127  HNYF----LDILERLNIMIDVGSALEYLHHGHSSAPIIHCDLKPTNILLDENMVAHVSDF  182

Query  359  GISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEM  538
            GISKL+    G G       ++T  M   +IGY+APEYG     S K DVYS+GVL++E 
Sbjct  183  GISKLL----GEGE-----DSATQTMTMATIGYMAPEYGSEGIVSAKCDVYSYGVLLMET  233

Query  539  VTRKKPTDDTFGRSLSLHQYVKS----EQMEIVDCSLMRALKEQSAEVMKMWEVAIRELI  706
             TRK+PTD+ F   +SL ++V         E+VD +L+R   E+ A   KM    +  ++
Sbjct  234  FTRKRPTDEMFTGEMSLRRWVMESLPHRLSEVVDANLVR---EEQAFSAKM--DCLLSIM  288

Query  707  EVGMLCTQDCPSTRPTMLDAADDLNRLK  790
            ++ + C  + P  R  M DAA  L ++K
Sbjct  289  DLALDCCMESPDNRMHMTDAAAKLKKIK  316



>ref|XP_008776167.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR [Phoenix dactylifera]
Length=1228

 Score =   201 bits (510),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 126/283 (45%), Positives = 179/283 (63%), Gaps = 26/283 (9%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPD-----FKALVLPYMANGSLD  166
             KV ++    ++KSF  EC+ LR +RHRNL+++IT+CS  D     FKALV  YM NGSL+
Sbjct  933   KVFNLHQIGALKSFSAECEALRNMRHRNLVKIITSCSTIDSRGNEFKALVFEYMPNGSLE  992

Query  167   RRLYPHP--HSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMT  340
               L+P    H  +  L+L QR+NI  D+A GL YLHH   V V+HCDLKPSN+LL+ DMT
Sbjct  993   EWLHPKAPKHDQAKKLNLTQRLNIVIDVASGLNYLHHGYAVPVVHCDLKPSNILLDNDMT  1052

Query  341   ALVSDFGISKLVMTTTGSGNADQKLGNSTANM-LCGSIGYIAPEYGFGSSTSTKGDVYSF  517
             A V DFG+++ + T   S +A  K  NST+ M + GSIGY+APEY  GS  ST+GDVYS+
Sbjct  1053  AHVGDFGLARFLST---SSSATSK--NSTSCMGIKGSIGYVAPEYAMGSKISTQGDVYSY  1107

Query  518   GVLVLEMVTRKKPTDDTFGRSLSLHQYVKS----EQMEIVDCSLMRA--------LKEQS  661
             G+L+LEM+T KKPTDD F   L+LH++V +    E MEI+   +++          + ++
Sbjct  1108  GILLLEMLTGKKPTDDMFKDGLNLHKFVSTAFPEEIMEILHPQILQEECEEANNNSRNEN  1167

Query  662   AEVMKMWEVAIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLK  790
             A +M+     I  L+ +G+ C+++ P  R  M D  + L  +K
Sbjct  1168  AAIMRTRR-CITSLLGIGLSCSKESPKERMDMRDVVNKLKAVK  1209



>ref|XP_002270587.2| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Vitis vinifera]
Length=928

 Score =   199 bits (505),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 122/270 (45%), Positives = 172/270 (64%), Gaps = 21/270 (8%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL++Q   + KSF  EC VL R+RHRNL+++IT+CS P+ +ALVL YM NGSL++ LY 
Sbjct  675  KVLNLQLEGAFKSFDAECNVLARVRHRNLVKVITSCSNPELRALVLQYMPNGSLEKWLYS  734

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
              +S    LSL QRV+I  D+A  L YLHH     V+HCDLKPSNVLL+++M A V DFG
Sbjct  735  FNYS----LSLFQRVSILLDVALALEYLHHGQSEPVVHCDLKPSNVLLDDEMVAHVGDFG  790

Query  362  ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
            I+K++        A+ K    T  +  G++GYIAPEYG     S++GD+YS+G+++LEMV
Sbjct  791  IAKIL--------AENKTVTQTKTL--GTLGYIAPEYGLEGRVSSRGDIYSYGIMLLEMV  840

Query  542  TRKKPTDDTFGRSLSLHQYVKS----EQMEIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
            TRKKP D+ F   +SL Q+VK+    + ME+VD +L R      A   +   +AI EL  
Sbjct  841  TRKKPMDEMFSEEMSLRQWVKATIPNKIMEVVDENLARNQDGGGAIATQEKLLAIMEL--  898

Query  710  VGMLCTQDCPSTRPTMLDAADDLNRLKRYL  799
             G+ C+++ P  R  + +    LN++K  L
Sbjct  899  -GLECSRELPEERMDIKEVVVKLNKIKLQL  927



>ref|XP_008810835.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Phoenix dactylifera]
Length=1107

 Score =   199 bits (507),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 123/287 (43%), Positives = 178/287 (62%), Gaps = 26/287 (9%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
             KV ++Q   ++KSF  EC+++R +RH NL+R+IT+CS       DFKAL+  YM NGSLD
Sbjct  814   KVFNIQRVGALKSFKAECEIIRNVRHNNLVRIITSCSSVDSTGSDFKALIFEYMPNGSLD  873

Query  167   RRLYPHPHS--GSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMT  340
               L+P       +  L+L QR+NI  D+A  L YLHH   V  IH DLKPSNVLL+ DMT
Sbjct  874   EWLHPRAQECHQTRKLNLTQRLNIALDVASALYYLHHSIAVPAIHGDLKPSNVLLDNDMT  933

Query  341   ALVSDFGISKLVMTTTGSGNADQKLGNSTANM-LCGSIGYIAPEYGFGSSTSTKGDVYSF  517
             A + DFG+++  ++T+GS  ++    NST+ M + G+IGY+APEY  GS  ST+GDVYS+
Sbjct  934   AHLGDFGLARF-LSTSGSMASE----NSTSLMGIKGTIGYVAPEYAMGSQISTQGDVYSY  988

Query  518   GVLVLEMVTRKKPTDDTFGRSLSLHQYV----KSEQMEIVDCSLMR--------ALKEQS  661
             G+LVLEM+T KKPT+D F   L+LH++V        MEI+D  +++         ++ + 
Sbjct  989   GILVLEMLTGKKPTNDVFKDGLNLHKFVDMAFPERVMEILDPQILQDENKEADGNIRNED  1048

Query  662   AEVMKMWEVAIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLT  802
                M++    I  LI +G+LC ++ P+ RP M D    +   K  L+
Sbjct  1049  FSRMRLRRCVI-SLIRIGLLCAKESPNERPKMQDVTTKVRAAKEMLS  1094



>ref|XP_009353384.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Pyrus 
x bretschneideri]
Length=326

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 110/263 (42%), Positives = 164/263 (62%), Gaps = 17/263 (6%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KV ++Q   + KSF REC++L  IRH+NLI++I+ CS  DF+A++L YM NGSL++ LY 
Sbjct  58   KVFNLQLEGAFKSFERECEMLSNIRHQNLIKIISCCSQIDFEAVILNYMPNGSLEKWLY-  116

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
               S +S L+++QR+NI  D+A  L YLHH   + V+HCD+KPSN+LL+EDM A V+DFG
Sbjct  117  ---SQNSSLNIVQRLNIMIDVALALEYLHHGYSISVVHCDVKPSNILLDEDMVAHVADFG  173

Query  362  ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
            I+KL     G G+        T  M   +IGY+APEYG     ST+GDVYSFG++++E  
Sbjct  174  IAKL-----GGGDY------VTHTMTLATIGYMAPEYGTEGIVSTRGDVYSFGIVLMEAF  222

Query  542  TRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQSAEVMKMWEVAIRELIEVGML  721
            T +KPTD+ F   +SL Q+V +    +VD +L+   +E      +     +  ++ + + 
Sbjct  223  TERKPTDEMFVEEMSLKQWVSNSLSTVVDANLLGMHQEDHD--FETCNDCLSSIMRLALA  280

Query  722  CTQDCPSTRPTMLDAADDLNRLK  790
            C  + P  R  ML+A   L ++K
Sbjct  281  CAAESPEERINMLEAVYTLKKIK  303



>ref|XP_007214168.1| hypothetical protein PRUPE_ppa018998mg, partial [Prunus persica]
 gb|EMJ15367.1| hypothetical protein PRUPE_ppa018998mg, partial [Prunus persica]
Length=1018

 Score =   199 bits (505),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 119/279 (43%), Positives = 172/279 (62%), Gaps = 21/279 (8%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
             KV S+Q   + +SF REC++L  IRHRNLIR+I+ CS  DFKALVL YM+NGSL++ LY 
Sbjct  751   KVFSLQLEGAFRSFERECEMLSNIRHRNLIRIISCCSQTDFKALVLNYMSNGSLEKWLY-  809

Query  182   HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
                S SS L+++QR+NI  D+A  L YLHH   V ++HCDLKPSN+LL++DM A V+DFG
Sbjct  810   ---SQSSSLNILQRMNIMVDVALALEYLHHGYSVPIVHCDLKPSNILLDDDMVAHVADFG  866

Query  362   ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
             I+KL+    G G++       T  M   ++GY+APEYG     ST+GDVYSFG++V+E  
Sbjct  867   IAKLL----GEGDS------ITQTMTLATVGYMAPEYGLEGMVSTRGDVYSFGIVVMETF  916

Query  542   TRKKPTDDTFGRSLSLHQYVKSEQM-------EIVDCSLMRALKEQSAEVMKMWEVAIRE  700
             TR+KPTD+ F   ++L Q++ +  +       E+VD +L+    EQ  +        +  
Sbjct  917   TRRKPTDEMFDGEMNLKQWIANSLVFPDAMIDEVVDANLLGIGTEQEDDDHVRKRDCLSS  976

Query  701   LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTA  817
             ++ + + C  + P  R  M +A   LN++K     D  A
Sbjct  977   IMRLAIACCAESPEERVNMKEAVARLNKIKTTFLKDAVA  1015



>ref|XP_010050948.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Eucalyptus grandis]
Length=1108

 Score =   199 bits (507),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 121/267 (45%), Positives = 168/267 (63%), Gaps = 20/267 (7%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
             KVL++    ++KSF  EC+V R+IRHRNL+++I+ C+  D +ALVL Y+ NGSL++ LY 
Sbjct  854   KVLNLHIEGALKSFDVECEVFRKIRHRNLLKVISTCTNADLRALVLQYVPNGSLEKWLY-  912

Query  182   HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
                S + +L L QRV I  DIA  L YLHH  P  ++HCDLKPSNVLLNED+ A V DFG
Sbjct  913   ---SNNYNLGLHQRVKIMVDIATALDYLHHGQPEPIVHCDLKPSNVLLNEDLVAQVCDFG  969

Query  362   ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
             ISK++        A+ KL   T  +  G+IGY+APEYG     STKGDVYSFG+L+LE++
Sbjct  970   ISKIL--------AENKLETQTQTL--GTIGYVAPEYGLEGKVSTKGDVYSFGILLLEVI  1019

Query  542   TRKKPTDDTFGRSLSLHQYV----KSEQMEIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
             TRKKPTD+ F   +SL  +V     +  ++I+D  L+    E     +   E  I  ++E
Sbjct  1020  TRKKPTDEMFNADMSLRLWVGAAIPNRVLDIMDGKLISTKHEDLT--LSELESIISSVLE  1077

Query  710   VGMLCTQDCPSTRPTMLDAADDLNRLK  790
             +G+ C++D P  R  M      LN++K
Sbjct  1078  LGLECSKDLPEERMDMKTIMVKLNKIK  1104



>ref|XP_006442554.1| hypothetical protein CICLE_v10018659mg [Citrus clementina]
 gb|ESR55794.1| hypothetical protein CICLE_v10018659mg [Citrus clementina]
Length=1021

 Score =   199 bits (505),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 123/278 (44%), Positives = 174/278 (63%), Gaps = 23/278 (8%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
             K+ ++Q   + +SF  EC+VLR +RHRNLI+++++CS PDFKALVL +M NGSL++ LY 
Sbjct  761   KIFNLQFERAFRSFDSECEVLRNVRHRNLIKILSSCSNPDFKALVLEFMPNGSLEKWLYS  820

Query  182   HPHSGSSDLSLMQRVNICSDIAEGLAYLHH-HSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
             H +     L +++R+NI  D+   L YLHH HS   +IHCDLKP+N+LL+E+M A VSDF
Sbjct  821   HNYF----LDILERLNIMIDVGSALEYLHHGHSSAPIIHCDLKPTNILLDENMVAHVSDF  876

Query  359   GISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEM  538
             GISKL+    G G   +     T  M   +IGY+APEYG     STK DVYS+GVL++E 
Sbjct  877   GISKLL----GEGEDSE-----TQTMTMATIGYMAPEYGSEGIVSTKCDVYSYGVLLMET  927

Query  539   VTRKKPTDDTFGRSLSLHQYVKSE----QMEIVDCSLMRALKEQSAEVMKMWEVAIRELI  706
              TRK+PTD+ F   +SL ++VK       +E+VD +L+R   E+ A   KM    I  ++
Sbjct  928   FTRKRPTDEMFTGEMSLRRWVKESLSHGLIEVVDANLVR---EEQAFSAKM--DCILSIM  982

Query  707   EVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTAT  820
             ++ + C  + P  R  M DAA  L ++K     D  AT
Sbjct  983   DLALDCCMESPDMRINMTDAAAKLKKIKVKFLDDAAAT  1020



>ref|XP_006346907.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR-like [Solanum tuberosum]
Length=705

 Score =   196 bits (499),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 114/271 (42%), Positives = 163/271 (60%), Gaps = 18/271 (7%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KV  MQ    +++F  EC++L  +RHRNL+++++ CS  DF A+VL YM NGSLD+RLY 
Sbjct  447  KVFDMQWQRDLRNFDSECEILSNVRHRNLVKIVSTCSNLDFTAIVLEYMPNGSLDKRLY-  505

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
               S  + LSL++R+NI  D+A  + YLHH   V ++HCDLKP NVLL++D+TA V+DFG
Sbjct  506  ---SDENCLSLVERLNIMIDVALAMEYLHHDYTVPIVHCDLKPGNVLLDQDLTAHVADFG  562

Query  362  ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
            I+K++           + GN       G+IGYIAPEYG     ST  DVYSFG+L+LE  
Sbjct  563  IAKML----------AQEGNMAQTKTLGTIGYIAPEYGLDGQISTSSDVYSFGILLLETF  612

Query  542  TRKKPTDDTFGRSLSLHQYVK----SEQMEIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
            TRKKPTDD F   LSLH++         ++I+D  L+  +   + E     +  +  +I 
Sbjct  613  TRKKPTDDLFSGDLSLHKWTSLSFPDAVLDILDADLVSDIGFTTDENQSEIKQLLVLIIN  672

Query  710  VGMLCTQDCPSTRPTMLDAADDLNRLKRYLT  802
            V  LC ++ P  R  M +    LN+++  LT
Sbjct  673  VAFLCLKELPEERINMREVVVQLNKIRAELT  703



>ref|XP_008370158.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Malus domestica]
Length=1043

 Score =   199 bits (505),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 116/228 (51%), Positives = 150/228 (66%), Gaps = 15/228 (7%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
            KVL++Q   + KSFI EC+ LR IRHRNL++++TACS       DFK+LV  +M NGSLD
Sbjct  749  KVLNLQQHRASKSFIDECKALRSIRHRNLLKIVTACSSIDNQGKDFKSLVFEFMVNGSLD  808

Query  167  RRLYP--HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMT  340
              LYP     S S  LS MQR+NI  D+A GL YLHHH    ++HCDLKPSNVLL+EDM 
Sbjct  809  SMLYPREEEQSLSKRLSFMQRLNIAIDVASGLDYLHHHCETAIVHCDLKPSNVLLDEDMV  868

Query  341  ALVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFG  520
            A V DFG+++ +  T+     D     + ++ L GSIGYI PEYG G   ST GDVYS+G
Sbjct  869  AHVGDFGLARFLFETSN----DPSFSQTMSSQLKGSIGYIPPEYGIGGQVSTTGDVYSYG  924

Query  521  VLVLEMVTRKKPTDDTFGRSLSLHQYV----KSEQMEIVDCSLMRALK  652
            +L+LEM T K+PTDD F   LS++Q+V        M++VD S+M  L+
Sbjct  925  ILLLEMFTGKRPTDDMFKGGLSIYQFVAMALHDHVMDVVDHSIMLDLE  972



>ref|XP_008809727.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Phoenix dactylifera]
Length=1204

 Score =   199 bits (506),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 124/287 (43%), Positives = 181/287 (63%), Gaps = 26/287 (9%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
             KV ++    ++KSF  EC+ LR +RHRNL+++IT+CS       DFKALV  YM NGSL+
Sbjct  909   KVFNLDQIGALKSFSAECEALRNMRHRNLVKIITSCSTVDSRGNDFKALVFEYMPNGSLE  968

Query  167   RRLYPHP--HSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMT  340
               L+P    H  +  L+L QR+NI  D+A GL YLHH + + ++HCDLKPSN+LL+ DMT
Sbjct  969   EWLHPKAPEHDQAKKLNLTQRLNIVIDVASGLNYLHHGNAMPLVHCDLKPSNILLDNDMT  1028

Query  341   ALVSDFGISKLVMTTTGSGNADQKLGNSTANM-LCGSIGYIAPEYGFGSSTSTKGDVYSF  517
             A V DFG+++ + T++ + +      NST+ M + GSIGY+APEY  GS  ST+GDVYS+
Sbjct  1029  AHVGDFGLARFLPTSSSATSE-----NSTSWMGIKGSIGYVAPEYAMGSKISTQGDVYSY  1083

Query  518   GVLVLEMVTRKKPTDDTFGRSLSLHQYV----KSEQMEIVDCSLMRAL--------KEQS  661
             G+L+LE +T KKPTDD F   L+LH++V        MEI+D  +++          + ++
Sbjct  1084  GILLLETLTGKKPTDDMFKDGLNLHKFVDIAFPEGIMEILDLQILQEECEEANNDGRNEN  1143

Query  662   AEVMKMWEVAIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLT  802
             A  M+M    I  LI +G+ C+++ P  R  M D A+ L  +K  L+
Sbjct  1144  AARMRMRR-CITSLIGIGLSCSKESPKERMDMRDVANKLKAVKDRLS  1189



>ref|XP_010659855.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Vitis 
vinifera]
Length=1052

 Score =   198 bits (504),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 122/277 (44%), Positives = 172/277 (62%), Gaps = 13/277 (5%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
             KVL  +     +SF RECQ+L  IRHRNL+R+I +     FKA+VL Y+ NG+L++ LYP
Sbjct  766   KVLQEERVQGYRSFKRECQILSEIRHRNLVRMIGSTWNSGFKAIVLEYIGNGNLEQHLYP  825

Query  182   H-PHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
                  G S+L L +R+ I  D+A GL YLH   PV+V+HCDLKP NVLL+ DM A V D 
Sbjct  826   GGSDEGGSELKLRERMGIAIDVANGLEYLHEGCPVQVVHCDLKPQNVLLDNDMVAHVGDS  885

Query  359   GISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEM  538
             GI KL+     SG+  +    +T   L GS+GYI PEYG G   ST+GDVYSFGV++LEM
Sbjct  886   GIGKLI-----SGDKPRGHVTTTTAFLRGSVGYIPPEYGQGIDVSTRGDVYSFGVMMLEM  940

Query  539   VTRKKPTDDTFGRSLSLHQYVKS----EQMEIVDCSLMRA--LKEQSAEVMKMWEVAIRE  700
             +TRK+PT++ F   L L ++V S    + ++IVD SL     L+E S  + K+ +  I  
Sbjct  941   ITRKRPTNEMFSDGLDLRKWVCSAFPNQVLDIVDISLKHEAYLEEGSGALHKLEQCCIH-  999

Query  701   LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDT  811
             +++ GM+CT++ P  RP +   A  L  + + +  +T
Sbjct  1000  MLDAGMMCTEENPQKRPLISSVAQRLKNVWKEMGFET  1036



>emb|CAN60542.1| hypothetical protein VITISV_018291 [Vitis vinifera]
Length=992

 Score =   198 bits (503),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 121/271 (45%), Positives = 170/271 (63%), Gaps = 13/271 (5%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL  +     +SF RECQ+L  IRHRNL+R+I +     FKA+VL Y+ NG+L++ LYP
Sbjct  706  KVLQEECVQGYRSFKRECQILSEIRHRNLVRMIGSTWNSGFKAIVLEYIGNGNLEQHLYP  765

Query  182  H-PHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
                 G S+L L +R+ I  D+A GL YLH   PV+V+HCDLKP NVLL+ DM A V+DF
Sbjct  766  GGSDEGGSELKLRERMGIAIDVANGLEYLHEGCPVQVVHCDLKPQNVLLDNDMVAHVADF  825

Query  359  GISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEM  538
            GI KL+     SG+  +    +T   L GS+GYI PEYG G   ST+GDVYSFGV++LEM
Sbjct  826  GIGKLI-----SGDKPRGHVTTTTAFLRGSVGYIPPEYGQGIDVSTRGDVYSFGVMMLEM  880

Query  539  VTRKKPTDDTFGRSLSLHQYVKS----EQMEIVDCSLMRA--LKEQSAEVMKMWEVAIRE  700
            +TRK+PT++ F   L L ++V S    + ++IVD SL     L+E S  + K+ +  I  
Sbjct  881  ITRKRPTNEMFSDGLDLRKWVCSAFPNQVLDIVDISLKHEAYLEEGSGALHKLEQCCIH-  939

Query  701  LIEVGMLCTQDCPSTRPTMLDAADDLNRLKR  793
            +++ GM+CT++ P   P +   A  L  + +
Sbjct  940  MLDAGMMCTEENPQKCPLISSVAQRLKNVWK  970



>ref|XP_002436615.1| hypothetical protein SORBIDRAFT_10g005840 [Sorghum bicolor]
 gb|EER87982.1| hypothetical protein SORBIDRAFT_10g005840 [Sorghum bicolor]
Length=1156

 Score =   199 bits (505),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 133/274 (49%), Positives = 180/274 (66%), Gaps = 23/274 (8%)
 Frame = +2

Query  38    SFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYPHPHSGSSDLSLM  217
             SF REC+VLR IRHRNLIR+ITACS P+FKA+VLP+M NGSL+  ++  P SG+      
Sbjct  859   SFERECRVLRSIRHRNLIRVITACSTPEFKAVVLPFMPNGSLETLIHGPPSSGAGGGGKP  918

Query  218   QRVN------ICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFGISKLVM  379
              R++      + S++AEG+AYLHHH+PV+V+HCDLKPSNVLL+ DMTA+VSDFGISKLV+
Sbjct  919   ARLDLDLLLSVASNVAEGMAYLHHHAPVRVVHCDLKPSNVLLDADMTAVVSDFGISKLVV  978

Query  380   T--------TTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLE  535
             T        T G  +    + NS   +L GS+GYIAPEYG G   ST+GDVYSFGV++LE
Sbjct  979   TDGGARDPETMGEASTSSSVCNSITRLLQGSVGYIAPEYGLGGRPSTQGDVYSFGVMLLE  1038

Query  536   MVTRKKPTDDTFGRSLSLHQYVKS----EQMEI-----VDCSLMRALKEQSAEVMKMWEV  688
             M++ K+PTD        LH + K     +Q ++     V+ SL+        E+  +  V
Sbjct  1039  MISGKRPTDVISEEGHGLHDWAKKLLQHQQHDVVGTVDVESSLLPFGSPPRGEMEVVVVV  1098

Query  689   AIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLK  790
              + EL+E+G+ C+Q  PS RPTM D A ++  L+
Sbjct  1099  VVLELLELGVACSQLAPSMRPTMDDVAHEIACLR  1132



>gb|KDP44788.1| hypothetical protein JCGZ_01288 [Jatropha curcas]
Length=582

 Score =   194 bits (493),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 115/268 (43%), Positives = 172/268 (64%), Gaps = 16/268 (6%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
            KVL++Q   + KSF+ EC+ LR IRHRNL++++TACS       DFKALV  +M NGSL+
Sbjct  312  KVLNLQYHGAAKSFMAECEALRNIRHRNLVKIVTACSGVDYQGNDFKALVYEFMVNGSLE  371

Query  167  RRLYPHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTAL  346
            + L+P  + G  +L+L+QR+NI  D+A    YLHH+    ++HCDLKPSN LL+++MTA 
Sbjct  372  QWLHPSVNEGYKNLNLIQRINIAIDVASATEYLHHYCGTPIVHCDLKPSNDLLHDEMTAH  431

Query  347  VSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVL  526
            + DFG++K ++ +       Q    S++  L G+IGY  PEYG GS  S KGDVYS+G+L
Sbjct  432  IGDFGLAKFLLHSVQKNCTYQ----SSSAGLRGTIGYTPPEYGLGSEVSIKGDVYSYGIL  487

Query  527  VLEMVTRKKPTDDTFGRSLSLHQYVKS----EQMEIVDCSLMRALKEQSAEVMKMWEVAI  694
            +LEM+TRK+PTD  F   L+L ++V+S    E  E+ D  L++   + +  +M    ++I
Sbjct  488  LLEMITRKRPTDVMFKEGLNLRKFVESALPNEVSEVADPILLQEGGQSNDRIMMECLISI  547

Query  695  RELIEVGMLCTQDCPSTRPTMLDAADDL  778
               +E+G+ C+   P  R  + DAA +L
Sbjct  548  ---LEIGISCSAKLPIDRMDISDAAIEL  572



>gb|KHF97553.1| hypothetical protein F383_36580 [Gossypium arboreum]
Length=477

 Score =   192 bits (488),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 125/294 (43%), Positives = 183/294 (62%), Gaps = 33/294 (11%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
            KVL++    + +SF+ EC+VL+ IRHRNL++L+TA S       DFKALV  +M NGSL+
Sbjct  184  KVLNLLNHGASRSFLAECEVLKNIRHRNLVKLLTAISGVDYQGNDFKALVYEFMVNGSLE  243

Query  167  RRLYPHPHSGSSD------LSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLN  328
              L  HP +G+++      L+L QR+N+  D+A  L YLHHH  + +IHCDLKPSN+LL+
Sbjct  244  DWL--HPPAGTNEPKTIRNLNLFQRLNMAIDVAHALEYLHHHCEILIIHCDLKPSNILLD  301

Query  329  EDMTALVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDV  508
            E+M A +SDFG++K++     + +A Q    S++  L G++GY  PEYG GS  STKGDV
Sbjct  302  EEMVAHISDFGLAKILSADKLNYSASQ----SSSLGLRGTVGYAPPEYGMGSELSTKGDV  357

Query  509  YSFGVLVLEMVTRKKPTDDTFGRSLSLHQYVKS---EQM-EIVDCSLMRALKEQSAEVMK  676
            YS+G+L+LEM T K+PTD+ F   LSLH +VK+   E+M EI+D  L++    Q  +   
Sbjct  358  YSYGILLLEMFTGKRPTDEIFEEGLSLHNFVKTTLPERMTEIIDPILLQEKVRQGTKKDI  417

Query  677  MWEVAIRE----------LIEVGMLCTQDCPSTRPTMLDAADDLNRLKR--YLT  802
            +    I E          ++E+G+ C+ + PS R  M D   +L  ++   YLT
Sbjct  418  ILSGNIIENDRCLQCMNSILEIGLTCSTELPSERVDMCDVVTELCSIRDQIYLT  471



>gb|KCW80922.1| hypothetical protein EUGRSUZ_C02282, partial [Eucalyptus grandis]
Length=1075

 Score =   197 bits (502),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 120/266 (45%), Positives = 167/266 (63%), Gaps = 20/266 (8%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
             KVL++    ++KSF  EC+V R+IRHRNL+++I+ C+  D +ALVL Y+ NGSL++ LY 
Sbjct  826   KVLNLHIEGALKSFDVECEVFRKIRHRNLLKVISTCTNADLRALVLQYVPNGSLEKWLY-  884

Query  182   HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
                S + +L L QRV I  DIA  L YLHH  P  ++HCDLKPSNVLLNED+ A V DFG
Sbjct  885   ---SNNYNLGLHQRVKIMVDIATALDYLHHGQPEPIVHCDLKPSNVLLNEDLVAQVCDFG  941

Query  362   ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
             ISK++        A+ KL   T  +  G+IGY+APEYG     STKGDVYSFG+L+LE++
Sbjct  942   ISKIL--------AENKLETQTQTL--GTIGYVAPEYGLEGKVSTKGDVYSFGILLLEVI  991

Query  542   TRKKPTDDTFGRSLSLHQYV----KSEQMEIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
             TRKKPTD+ F   +SL  +V     +  ++I+D  L+    E     +   E  I  ++E
Sbjct  992   TRKKPTDEMFNADMSLRLWVGAAIPNRVLDIMDGKLISTKHEDLT--LSELESIISSVLE  1049

Query  710   VGMLCTQDCPSTRPTMLDAADDLNRL  787
             +G+ C++D P  R  M      LN++
Sbjct  1050  LGLECSKDLPEERMDMKTIMVKLNKI  1075



>ref|XP_010915162.1| PREDICTED: putative receptor-like protein kinase At3g47110 isoform 
X3 [Elaeis guineensis]
Length=829

 Score =   196 bits (497),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 121/280 (43%), Positives = 176/280 (63%), Gaps = 25/280 (9%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
            KVL++Q   + +SF+ EC+ LR IRHRNL+++ T+CS       DFKALV  +M NGSL+
Sbjct  560  KVLNLQRYGASRSFMAECRALRNIRHRNLVKIFTSCSSIDHHGNDFKALVFEFMPNGSLE  619

Query  167  RRLYPHPHSG--SSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMT  340
              L+P       S  LSL+QR+NI  D+A  L YLHH     ++HCDLKPSNVLL+ D+T
Sbjct  620  EWLHPKAREDHQSRSLSLIQRLNIAIDVASALEYLHHLGSTPIVHCDLKPSNVLLDNDLT  679

Query  341  ALVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFG  520
            A V DFG+++ ++ T G    +    +S+   + G++GY+ PEYG G+  ST GDVYS+G
Sbjct  680  AHVGDFGLARFLVQTHG----ESFQSSSSTVGIKGTVGYVPPEYGMGNQASTAGDVYSYG  735

Query  521  VLVLEMVTRKKPTDDTFGRSLSLHQYVK---SEQ-MEIVDCSLMRALKEQSAEVMKMWEV  688
            +L+LE+ T KKPTDD F   L+LH+YV+   SEQ M+I+D  L     E+  E       
Sbjct  736  ILLLEIFTGKKPTDDKFKDGLNLHKYVQMAFSEQVMDIIDHRLFST--EEHKE-------  786

Query  689  AIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLK-RYLTG  805
             I  +I+ G+LC+++ P  R  M + A ++  L+ ++L G
Sbjct  787  CIASVIKYGLLCSKESPEERLEMTEVAKEMVALRDKFLKG  826



>ref|XP_010268543.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Nelumbo nucifera]
Length=527

 Score =   192 bits (489),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 121/260 (47%), Positives = 172/260 (66%), Gaps = 21/260 (8%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL +Q   ++KSF  ECQVLR +RHRNL+++I++CS  DF+ALV+ YM  GSL++ LY 
Sbjct  272  KVLDLQLEGAIKSFDAECQVLRNVRHRNLVKVISSCSNLDFRALVMEYMPQGSLEKWLY-  330

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
               S +  L+L+QR+NI  D+A  L YLHH+    V+HCD+KP+NVLL+EDM A V DFG
Sbjct  331  ---SQNYFLNLLQRINIMIDVALALEYLHHNQSGPVVHCDVKPNNVLLDEDMVAHVGDFG  387

Query  362  ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
            I+K++     S N D+ +  + A    GSIGYIAPEYG     ST  DVYS+G+L++EM 
Sbjct  388  IAKIL-----SAN-DKPVAQTKA---LGSIGYIAPEYGSEGRVSTSCDVYSYGILLMEMF  438

Query  542  TRKKPTDDTFGRSLSLHQYV----KSEQMEIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
            TRKKPT++ F   L L ++V     +E ME+VD +L+   +E+S   MK  +     +IE
Sbjct  439  TRKKPTNEMFAGELCLRKWVPMSLPTEIMEVVDKNLID--REESDSPMK--QQTFVSIIE  494

Query  710  VGMLCTQDCPSTRPTMLDAA  769
            +G+ C+++ P  R TM + A
Sbjct  495  LGLDCSRELPEERITMKEVA  514



>ref|XP_010039512.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Eucalyptus grandis]
Length=865

 Score =   196 bits (497),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 125/286 (44%), Positives = 181/286 (63%), Gaps = 30/286 (10%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
            K+L +    + KSFI EC+VLRRIRHRN ++++TACS       DFKALV  +M+NGSLD
Sbjct  576  KILDLTRHGASKSFIAECEVLRRIRHRNFVKVLTACSGFDFNGNDFKALVYEFMSNGSLD  635

Query  167  RRLYPHP--HSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMT  340
              L+P    ++    LSL++RVNI +D+A  L YLHHH    ++HCDLKPSNVLL+++ T
Sbjct  636  EWLHPTALQNTERRKLSLLERVNIATDVACALDYLHHHCETPIVHCDLKPSNVLLDDEKT  695

Query  341  ALVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFG  520
              V DFG+++ +        ADQ    S++  + GS GY+APEYG GS+ S  GD YSFG
Sbjct  696  GHVGDFGLARFLPEAMHKLLADQ----SSSVGVKGSFGYVAPEYGMGSAVSIDGDTYSFG  751

Query  521  VLVLEMVTRKKPTDDTFGRSLSLHQYVK---SEQME-IVDCSLMRALKEQSAEVM-----  673
            VLVLEM T K+PTDD F   L LH++ K   ++++E ++D  L++ L+E     M     
Sbjct  752  VLVLEMFTGKRPTDDMFKDGLDLHRFAKVALADRVEKVIDPVLLQELEESEKRRMSTLEG  811

Query  674  --KMWEVAIRE----LIEVGMLCTQDCPSTRPTMLDAADDLNRLKR  793
              K+W  +I+E    +IE+G+ C+ + P  R   +D  + L+RL++
Sbjct  812  KNKIW-CSIQECLVLIIEIGVACSFESPRER---MDIGNALSRLQQ  853



>gb|KHN19543.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=679

 Score =   194 bits (494),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 121/287 (42%), Positives = 177/287 (62%), Gaps = 31/287 (11%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPD-----FKALVLPYMANGSLD  166
            KVL +Q   + +SF  ECQ L+ +RHRNL+++IT+CS  D     FKALV+ +M NG+LD
Sbjct  394  KVLDLQQSKASQSFSSECQALKNVRHRNLVKVITSCSSLDYKGEEFKALVMEFMPNGNLD  453

Query  167  RRLYPHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTAL  346
              LYP      S L+L+QR+NI  D+A  + YLHH     V+HCD+KP+NVLL+E+M A 
Sbjct  454  VSLYPEDVESGSSLTLLQRLNIAIDVASAMDYLHHDCNPPVVHCDMKPANVLLDENMVAH  513

Query  347  VSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVL  526
            V+DFG+++ +  +T       ++ +ST   L GSIGYIAPEYG G+  ST+GDVYSFG+L
Sbjct  514  VADFGLARFLSQST------SEMQSSTLG-LKGSIGYIAPEYGLGAKASTRGDVYSFGIL  566

Query  527  VLEMVTRKKPTDDTFGRSLSLHQYV----KSEQMEIVDCSLMRALK---------EQSAE  667
            +LEM T K+PTD+ F   LSL ++V    ++E +++ D SL+   +         +QS+ 
Sbjct  567  LLEMFTAKRPTDEIFKEGLSLSKFVSAMDENEVLKVADRSLIVDYEYSTQSSITGDQSSG  626

Query  668  V------MKMWEVAIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLK  790
            +      ++  E  I  +I VG+ CT   P  R +M +A   L  +K
Sbjct  627  IGSNTHWIRKAEECIAGVIRVGLCCTAQEPKDRWSMREAITKLQAIK  673



>emb|CBI36778.3| unnamed protein product [Vitis vinifera]
Length=1271

 Score =   198 bits (503),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 122/277 (44%), Positives = 172/277 (62%), Gaps = 13/277 (5%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL  +     +SF RECQ+L  IRHRNL+R+I +     FKA+VL Y+ NG+L++ LYP
Sbjct  604  KVLQEERVQGYRSFKRECQILSEIRHRNLVRMIGSTWNSGFKAIVLEYIGNGNLEQHLYP  663

Query  182  H-PHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
                 G S+L L +R+ I  D+A GL YLH   PV+V+HCDLKP NVLL+ DM A V D 
Sbjct  664  GGSDEGGSELKLRERMGIAIDVANGLEYLHEGCPVQVVHCDLKPQNVLLDNDMVAHVGDS  723

Query  359  GISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEM  538
            GI KL+     SG+  +    +T   L GS+GYI PEYG G   ST+GDVYSFGV++LEM
Sbjct  724  GIGKLI-----SGDKPRGHVTTTTAFLRGSVGYIPPEYGQGIDVSTRGDVYSFGVMMLEM  778

Query  539  VTRKKPTDDTFGRSLSLHQYVKS----EQMEIVDCSLMRA--LKEQSAEVMKMWEVAIRE  700
            +TRK+PT++ F   L L ++V S    + ++IVD SL     L+E S  + K+ +  I  
Sbjct  779  ITRKRPTNEMFSDGLDLRKWVCSAFPNQVLDIVDISLKHEAYLEEGSGALHKLEQCCI-H  837

Query  701  LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDT  811
            +++ GM+CT++ P  RP +   A  L  + + +  +T
Sbjct  838  MLDAGMMCTEENPQKRPLISSVAQRLKNVWKEMGFET  874



>ref|XP_010656926.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Vitis vinifera]
Length=1069

 Score =   197 bits (501),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 115/267 (43%), Positives = 174/267 (65%), Gaps = 21/267 (8%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
             K+L++    + KSF  EC+VL R+RHRNL+R+I++CS P+ +A+VL YM NGSL++ LY 
Sbjct  811   KLLNLHLEGAFKSFEAECKVLARVRHRNLVRVISSCSNPELRAVVLQYMPNGSLEKWLYS  870

Query  182   HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
             H +     L+L QRV+I  D+A  L YLHH     V+HCDLKPSNVLL++DM A V DFG
Sbjct  871   HNYC----LNLFQRVSIMVDVALALEYLHHGQSEPVVHCDLKPSNVLLDDDMVAHVGDFG  926

Query  362   ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
             I+K+++             ++T     G++GYIAPEYG     ST+GD+YS+G+++LEM+
Sbjct  927   IAKILVEKK----------STTQTKTLGTLGYIAPEYGLEGRVSTRGDIYSYGIMLLEML  976

Query  542   TRKKPTDDTFGRSLSLHQYVKS----EQMEIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
             TRKKPTDD F     L ++VK+    + ME++D +L+R   E   +V+   +  + E++E
Sbjct  977   TRKKPTDDMFVGEFCLREWVKAKIPDKIMEVIDGNLLRI--EDGRDVVAAQD-HLLEIME  1033

Query  710   VGMLCTQDCPSTRPTMLDAADDLNRLK  790
             +G+ C+++ P  R  + D    LN++K
Sbjct  1034  LGLECSKEFPEERIDIKDVVVKLNKIK  1060



>ref|XP_006351028.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Solanum tuberosum]
Length=1002

 Score =   196 bits (499),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 124/281 (44%), Positives = 171/281 (61%), Gaps = 25/281 (9%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDF-----KALVLPYMANGSLD  166
             K L +Q   ++KSFI EC+VL+ +RHRNL++L+TACS  DF     KAL+  +M NGSLD
Sbjct  733   KALDLQHKGALKSFIAECEVLKNLRHRNLVKLVTACSGTDFQGNDFKALIYEFMVNGSLD  792

Query  167   RRLYPHPHSGS---SDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDM  337
               L+   + GS     L L QRVNI SDIA  L YLHH +   V+HCDLKPSN+LL++DM
Sbjct  793   DWLHSFSNDGSLHVRYLDLYQRVNIASDIAFALDYLHHGTQTPVVHCDLKPSNILLDKDM  852

Query  338   TALVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSF  517
             TA V DFG+S+ +  T  S      +G      + GS+GY APEYG  S  ST GD+YS+
Sbjct  853   TARVGDFGLSRFLQET--SQRETSTIG------IKGSVGYAAPEYGMVSEVSTYGDIYSY  904

Query  518   GVLVLEMVTRKKPTDDTFGRSLSLHQYVK-----SEQMEIVDCSLMRALKE-QSAEVMKM  679
             G+++LEM+T KKPTDD F   L+LH Y K        MEIVD  +   L+E ++ + ++ 
Sbjct  905   GIIILEMLTGKKPTDDAFSNGLNLHNYAKMAYSTGRVMEIVDQMVYHNLQEMKTKDYIEE  964

Query  680   WEVAIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLT  802
               +    + ++G+ CT D P  R  + D   +L  +K  L+
Sbjct  965   CSIC---MCKIGIACTIDSPKERMRISDVIKELQLVKETLS  1002



>emb|CBI17790.3| unnamed protein product [Vitis vinifera]
Length=667

 Score =   194 bits (493),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 118/253 (47%), Positives = 164/253 (65%), Gaps = 21/253 (8%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL++Q   + KSF  EC VL R+RHRNL+++IT+CS P+ +ALVL YM NGSL++ LY 
Sbjct  384  KVLNLQLEGAFKSFDAECNVLARVRHRNLVKVITSCSNPELRALVLQYMPNGSLEKWLYS  443

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
              +S    LSL QRV+I  D+A  L YLHH     V+HCDLKPSNVLL+++M A V DFG
Sbjct  444  FNYS----LSLFQRVSILLDVALALEYLHHGQSEPVVHCDLKPSNVLLDDEMVAHVGDFG  499

Query  362  ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
            I+K++        A+ K    T  +  G++GYIAPEYG     S++GD+YS+G+++LEMV
Sbjct  500  IAKIL--------AENKTVTQTKTL--GTLGYIAPEYGLEGRVSSRGDIYSYGIMLLEMV  549

Query  542  TRKKPTDDTFGRSLSLHQYVKS----EQMEIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
            TRKKP D+ F   +SL Q+VK+    + ME+VD +L R      A   +   +AI EL  
Sbjct  550  TRKKPMDEMFSEEMSLRQWVKATIPNKIMEVVDENLARNQDGGGAIATQEKLLAIMEL--  607

Query  710  VGMLCTQDCPSTR  748
             G+ C+++ P  R
Sbjct  608  -GLECSRELPEER  619



>ref|XP_006493621.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Citrus sinensis]
Length=429

 Score =   190 bits (482),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 120/278 (43%), Positives = 169/278 (61%), Gaps = 23/278 (8%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KV ++Q   + +SF  EC+VLR +RHRNLI+++++CS PDFKALVL +M NGSL++ LY 
Sbjct  169  KVFNLQLERAFRSFNSECEVLRNVRHRNLIKILSSCSNPDFKALVLEFMPNGSLEKWLYS  228

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHH-HSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            + +       +++R+NI  D+   L Y HH HS   +IHCDLKP+N+LL+E+M A VSDF
Sbjct  229  YNYF----FDILERLNIMIDVGSALEYPHHGHSSAPIIHCDLKPTNILLDENMVAHVSDF  284

Query  359  GISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEM  538
            GISKL+    G G         T  M   +IGY+APEYG     S K DVYS+GVL++E 
Sbjct  285  GISKLL----GEGE-----DFVTQTMTMATIGYMAPEYGSEGIVSAKCDVYSYGVLLMET  335

Query  539  VTRKKPTDDTFGRSLSLHQYVKSE----QMEIVDCSLMRALKEQSAEVMKMWEVAIRELI  706
             TRK+PTD+ F   +SL ++VK        E+VD +L+R   E+ A   KM    I  ++
Sbjct  336  FTRKRPTDEMFTGEMSLRRWVKESLPHGLTEVVDANLVR---EEQAFAAKM--DCIVSIM  390

Query  707  EVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTAT  820
            ++ + C  + P  R  M DAA  L ++K     D  AT
Sbjct  391  DLALDCCMESPGKRINMTDAAAKLKKIKVKFLDDAAAT  428



>ref|XP_010908730.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Elaeis guineensis]
Length=1105

 Score =   197 bits (500),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 125/285 (44%), Positives = 176/285 (62%), Gaps = 28/285 (10%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
             KVL++QT  + +SF  EC+ LR  R RNL+++++A S  DFKALVL YM NGSL+R LY 
Sbjct  832   KVLNLQTEGASESFHTECRALRMARPRNLVKILSATSNLDFKALVLQYMPNGSLERWLYS  891

Query  182   HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
             + +     LSL+QR+NI  D+A  L YLHHH    V+HCDLKPSNVLL+EDM A VSDFG
Sbjct  892   YNYC----LSLIQRINIMLDVAMALEYLHHHYLEVVLHCDLKPSNVLLDEDMVAHVSDFG  947

Query  362   ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
             I+KL+   +      + + ++TA    G+IGY+APEYG     S + DVYS+G+L+LE  
Sbjct  948   IAKLLHGIS------RSIASATA---PGTIGYMAPEYGLDGRVSRRSDVYSYGILLLETF  998

Query  542   TRKKPTDDTFGRSLSLHQYVK----SEQMEIVDCSLMR------ALKEQSAEV----MKM  679
             TRKKPTD  F   LSL Q+V     S  + +VD +L+R      A    S+E+    +  
Sbjct  999   TRKKPTDAMFAGELSLRQWVNQAFPSAVLNVVDGNLLRDEAGSGASNTFSSEILMEDLSR  1058

Query  680   WEVAIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLK-RYLTGDT  811
               +    ++E+G+LC+++ P  R  M D    L  +K +YL+  +
Sbjct  1059  KHICFSSVLELGLLCSKELPKERILMEDVVVRLKNIKEKYLSNSS  1103



>ref|XP_010939780.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Elaeis guineensis]
Length=967

 Score =   196 bits (498),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 124/277 (45%), Positives = 177/277 (64%), Gaps = 22/277 (8%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL+++   + +SF  EC  LR +RHRNLI++I+ CS  DFKALVL YM NGSLDR LY 
Sbjct  708  KVLNLEMEKASRSFDAECHALRTVRHRNLIKIISTCSNLDFKALVLQYMPNGSLDRWLYS  767

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
            H +     LSL+QR+NI  D+A  L YLHHH P  V+HCDLKPSNVLL+EDM A V DFG
Sbjct  768  HNYC----LSLLQRINIMLDVASALEYLHHHHPQVVLHCDLKPSNVLLDEDMNAHVGDFG  823

Query  362  ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
            I+KL++     G++   +  ST     G+IGYIAPEYG     S   DVYS+G+L+LE++
Sbjct  824  IAKLLL-----GDSKSMVSAST----LGTIGYIAPEYGSAGRVSRSVDVYSYGILLLEIM  874

Query  542  TRKKPTDDTFGRSLSLHQYV----KSEQMEIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
            TRKKPT   F    SL ++V     +  +++VD +L   L+++ A+ +   +  + + +E
Sbjct  875  TRKKPTGAMFEGESSLRKWVYEAHPTRVLDVVDHNL---LEDEHADPITRHQ-CLSDSLE  930

Query  710  VGMLCTQDCPSTRPTMLDAADDLNRLKR-YLTGDTTA  817
            +G++C++D P  R  M +    L ++K+ YL+    A
Sbjct  931  LGLVCSKDSPKDRILMKEVVPRLQKIKKNYLSNQPRA  967



>ref|XP_010934131.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570, partial [Elaeis guineensis]
Length=239

 Score =   184 bits (468),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 152/245 (62%), Gaps = 23/245 (9%)
 Frame = +2

Query  101  TACSLPDFKALVLPYMANGSLDRRLYPHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSP  280
            + CS  DFKALVL YM NGSL+R LY H +     LSL+QR+NI  D+A  L YLHHH P
Sbjct  12   STCSTLDFKALVLQYMPNGSLERWLYSHNYC----LSLLQRINIMLDVASALDYLHHHHP  67

Query  281  VKVIHCDLKPSNVLLNEDMTALVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYI  460
              V+HCDLKPSNVLL+EDM A V DFGI+KL++     G++   +  ST     G+IGYI
Sbjct  68   QVVLHCDLKPSNVLLDEDMNAHVGDFGIAKLLL-----GDSKSMVSASTP----GTIGYI  118

Query  461  APEYGFGSSTSTKGDVYSFGVLVLEMVTRKKPTDDTFGRSLSLHQYV----KSEQMEIVD  628
            APEYG     S   DVYS+G+L+LE++TRKKPTD  F    SL ++V     +  ++IVD
Sbjct  119  APEYGSTGRVSRSVDVYSYGILLLEIITRKKPTDAMFEGESSLRKWVCEAHPTAVLDIVD  178

Query  629  CSLMRALKEQSAEVMKMWEVAIRELIEVG-MLCTQDCPSTRPTMLDAADDLNRLKR-YLT  802
             +L   LK++  + +   +  +   +E+G +LC++D P  R  M D    L ++K+ YL+
Sbjct  179  NNL---LKDEHVDPITRHQ-CLSASLELGLLLCSKDSPKDRILMKDVLPRLQKIKKNYLS  234

Query  803  GDTTA  817
                A
Sbjct  235  KQPRA  239



>gb|KCW45924.1| hypothetical protein EUGRSUZ_L00190 [Eucalyptus grandis]
Length=1003

 Score =   196 bits (498),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 123/287 (43%), Positives = 182/287 (63%), Gaps = 25/287 (9%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
            K+L++    + KSFI EC+VLRRIRHRNL++++TACS       DFKALV  +M+NGSLD
Sbjct  714  KILNLTCDGASKSFIAECEVLRRIRHRNLVKVLTACSGFDFNGNDFKALVYEFMSNGSLD  773

Query  167  RRLYP--HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMT  340
              L+P    ++  + LSL++RVNI  D+A  L YLHHH  + ++HCDLKPSNVLL+++M 
Sbjct  774  EWLHPIASQYTERNKLSLLERVNIAIDVACALDYLHHHCEMPIVHCDLKPSNVLLDDEMN  833

Query  341  ALVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFG  520
              V DFG+++ +   T    ADQ    S++  + GS GY+APEYG GS+ ST+GDVYSFG
Sbjct  834  GHVGDFGLARFLPEATHKLLADQ----SSSVGVKGSFGYVAPEYGVGSAVSTEGDVYSFG  889

Query  521  VLVLEMVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQSAEVMKMWEVA---  691
            VL+LEM T K+P DD F   L LH++ K+  ++ V+ ++   L ++  E+ K  ++A   
Sbjct  890  VLILEMFTGKRPIDDMFENGLDLHRFTKAALVDRVEKAIDPILLQEIEELEKRRKIAPEG  949

Query  692  -------IRE----LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYL  799
                   I++    +IEVG+ C+ +    R  + DA   L  +++ L
Sbjct  950  KNKSWCSIKDCLVLIIEVGITCSFESSKERMDIYDALTKLQGMRKKL  996



>ref|XP_009351405.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Pyrus x bretschneideri]
Length=609

 Score =   193 bits (490),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 112/268 (42%), Positives = 171/268 (64%), Gaps = 22/268 (8%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KV ++Q   + KSF  EC+V+  IRHRNLI++I++CS  DFKALVL YM NGSL++ LY 
Sbjct  349  KVFNLQIEGAFKSFDSECEVISNIRHRNLIKIISSCSQIDFKALVLQYMPNGSLEKWLY-  407

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
               S +S L+++QR+NI  D+A  L YLHH     V+HCD+KPSN+LL+EDM A V+DFG
Sbjct  408  ---SQNSPLNILQRLNIMMDVALALEYLHHGYSTPVVHCDMKPSNILLDEDMVAHVADFG  464

Query  362  ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
            I+KL+    G G++       T  M   +IGY+APEYG     STKGDVYSFG++++E  
Sbjct  465  IAKLL----GEGDS------FTQTMTLATIGYMAPEYGMDGIVSTKGDVYSFGIVLMETF  514

Query  542  TRKKPTDDTFGRSLSLHQYVKSEQ-----MEIVDCSLMRALKEQSAEVMKMWEVAIRELI  706
            T++KPTD+ F   ++L Q++ +        E+VD +L++  +++     +     +  ++
Sbjct  515  TKRKPTDEMFAGEMNLKQWISNSLFQDVIFEVVDATLLQTEEDRDFSSKR---DCLSSIL  571

Query  707  EVGMLCTQDCPSTRPTMLDAADDLNRLK  790
             + + C+ + P  R ++ DA   LN++K
Sbjct  572  RLALGCSAEFPEERVSLPDAVATLNKIK  599



>ref|XP_010930447.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Elaeis guineensis]
Length=1131

 Score =   197 bits (500),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 120/286 (42%), Positives = 178/286 (62%), Gaps = 24/286 (8%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
             KV ++Q   ++KSF  EC+++R +RH NL+++IT+CS       DFKAL+  YM NGSL+
Sbjct  838   KVFNIQQVGALKSFKTECEIIRNVRHNNLVKIITSCSSMDFAGNDFKALIFEYMPNGSLE  897

Query  167   RRLYPHPHS--GSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMT  340
               L+P       +  L+L QR+NI  D+A  L YLHH+  V  IHCDLKPSNVLL+ DMT
Sbjct  898   EWLHPRAQERHQTRKLNLTQRLNIALDVASALCYLHHNIEVPAIHCDLKPSNVLLDHDMT  957

Query  341   ALVSDFGISKLVMTTTGSGNADQKLGNSTANM-LCGSIGYIAPEYGFGSSTSTKGDVYSF  517
             A V DFG++  + T   SG+   K  NST  M + G+IGY+APEY  GS  ST+GDVY +
Sbjct  958   AHVGDFGLASFLPT---SGSTISK--NSTGLMGIKGTIGYVAPEYAMGSQISTQGDVYGY  1012

Query  518   GVLVLEMVTRKKPTDDTFGRSLSLHQYV----KSEQMEIVDCSLMRALKEQSAEVMKMWE  685
             G+L+LEM+T +KPT++ F   L+LH++V        MEI+D  ++    E++   ++  +
Sbjct  1013  GILLLEMLTGRKPTNNMFKDGLNLHKFVDMAFPERVMEILDPQILPDESEEADGNIRNDD  1072

Query  686   VA-------IRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLT  802
              +       I  LI +G+LC+++ P+ RP M D    ++ +K  L+
Sbjct  1073  FSRMQLRRCIISLIRIGLLCSKESPNERPRMQDVTTKVHAIKEMLS  1118



>ref|XP_006442561.1| hypothetical protein CICLE_v10024426mg, partial [Citrus clementina]
 gb|ESR55801.1| hypothetical protein CICLE_v10024426mg, partial [Citrus clementina]
Length=788

 Score =   194 bits (494),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 121/278 (44%), Positives = 172/278 (62%), Gaps = 23/278 (8%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            K+ ++Q   + +SF  EC+VLR +RHRNLI+++++CS PDFKALVL +M NGSL++ LY 
Sbjct  528  KIFNLQLERAFRSFDSECEVLRNVRHRNLIKILSSCSNPDFKALVLEFMPNGSLEKWLYS  587

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHH-HSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            H +     L +++R+NI  D+   L YLHH HS   +IHCDLKP+N+LL+E+M A VSDF
Sbjct  588  HNYF----LDILERLNIMIDVGSALEYLHHGHSSAPIIHCDLKPTNILLDENMAAHVSDF  643

Query  359  GISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEM  538
            GISKL+      G  +  +   T  M   +IGY+APEYG     S K DVYS+GVL++E 
Sbjct  644  GISKLL------GEGEDSV---TQTMTMATIGYMAPEYGSEGIVSAKCDVYSYGVLLMET  694

Query  539  VTRKKPTDDTFGRSLSLHQYVKSE----QMEIVDCSLMRALKEQSAEVMKMWEVAIRELI  706
             TRK+PTD+ F   +SL ++VK        E+VD +L+R   E+ A   KM    I  ++
Sbjct  695  FTRKRPTDEMFTGEMSLRKWVKESLPHGLTEVVDANLVR---EEQAFSAKM--DCILSIM  749

Query  707  EVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTAT  820
            ++ + C  + P  R  M DAA  L ++K     D  AT
Sbjct  750  DLALDCCMESPDMRINMTDAAAKLKKIKVKFLDDAAAT  787



>gb|AHZ44755.1| LRR.XII-like protein, partial [Platanus x acerifolia]
Length=802

 Score =   194 bits (494),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 121/288 (42%), Positives = 173/288 (60%), Gaps = 31/288 (11%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
            K+L++Q   + KSFI EC+ LR IRHRNL++++TACS       DFKALV  +M NG+L+
Sbjct  512  KLLNLQQQGASKSFIAECKALRNIRHRNLVKILTACSSIDFKGNDFKALVFEFMPNGNLE  571

Query  167  RRLYPHPHSGSSDL---SLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDM  337
            R L+P  +    +L   SL+QR+NI  D+A  L YLHHH  + +IHCDLKPSN+LL+ DM
Sbjct  572  RWLHPETNDTEDELKSLSLLQRLNIAIDVASALEYLHHHCQIPIIHCDLKPSNILLDNDM  631

Query  338  TALVSDFGISKLVMTTTGSGNADQKLGNSTANM-LCGSIGYIAPEYGFGSSTSTKGDVYS  514
            TA V DFG+S+ ++ T   GN  Q   N T+++ + GSIGY APEYG G+  S+ GD YS
Sbjct  632  TAHVGDFGLSRFLLKT---GNTSQ---NQTSSIGIKGSIGYTAPEYGVGAEVSSHGDSYS  685

Query  515  FGVLVLEMVTRKKPTDDTFGRSLSLHQYVK----SEQMEIVDCSLMRALKEQSAE-----  667
            +G+L+LEM T K+P D  F   L+LH   K     + MEIVD  L     E   E     
Sbjct  686  YGILLLEMFTGKRPIDKMFKDGLNLHYLAKMSFPDKVMEIVDPILSYREGEDEEELAANI  745

Query  668  -------VMKMWEVAIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLK  790
                   + K  +  +  ++ +G+ C+ + P  R  M+D   +L+ ++
Sbjct  746  TESRKNNIRKCTQECLTSVVRIGVACSVESPRERMNMIDVVKELHLIR  793



>gb|KCW45939.1| hypothetical protein EUGRSUZ_L00213, partial [Eucalyptus grandis]
Length=973

 Score =   196 bits (497),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 125/286 (44%), Positives = 181/286 (63%), Gaps = 30/286 (10%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
            K+L +    + KSFI EC+VLRRIRHRN ++++TACS       DFKALV  +M+NGSLD
Sbjct  687  KILDLTRHGASKSFIAECEVLRRIRHRNFVKVLTACSGFDFNGNDFKALVYEFMSNGSLD  746

Query  167  RRLYPHP--HSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMT  340
              L+P    ++    LSL++RVNI +D+A  L YLHHH    ++HCDLKPSNVLL+++ T
Sbjct  747  EWLHPTALQNTERRKLSLLERVNIATDVACALDYLHHHCETPIVHCDLKPSNVLLDDEKT  806

Query  341  ALVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFG  520
              V DFG+++ +        ADQ    S++  + GS GY+APEYG GS+ S  GD YSFG
Sbjct  807  GHVGDFGLARFLPEAMHKLLADQ----SSSVGVKGSFGYVAPEYGMGSAVSIDGDTYSFG  862

Query  521  VLVLEMVTRKKPTDDTFGRSLSLHQYVK---SEQME-IVDCSLMRALKEQSAEVM-----  673
            VLVLEM T K+PTDD F   L LH++ K   ++++E ++D  L++ L+E     M     
Sbjct  863  VLVLEMFTGKRPTDDMFKDGLDLHRFAKVALADRVEKVIDPVLLQELEESEKRRMSTLEG  922

Query  674  --KMWEVAIRE----LIEVGMLCTQDCPSTRPTMLDAADDLNRLKR  793
              K+W  +I+E    +IE+G+ C+ + P  R   +D  + L+RL++
Sbjct  923  KNKIW-CSIQECLVLIIEIGVACSFESPRER---MDIGNALSRLQQ  964



>gb|EEC68386.1| hypothetical protein OsI_36534 [Oryza sativa Indica Group]
Length=739

 Score =   194 bits (493),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 130/285 (46%), Positives = 177/285 (62%), Gaps = 22/285 (8%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
            KVL +QT  ++KSF  EC+ LR +RHRNL+++IT CS       DFKA+VL +M+NGSL+
Sbjct  457  KVLKLQTPGALKSFSAECEALRDLRHRNLVKIITVCSSIDNRGNDFKAIVLDFMSNGSLE  516

Query  167  RRLYPHPHSGSSD--LSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMT  340
              L+P  +  +    LSL++RV +  D+A GL YLH H P  V+HCDLK SNVLL+ DM 
Sbjct  517  GWLHPDKNDQTDQRYLSLLERVCVLLDVAYGLDYLHCHGPTPVVHCDLKSSNVLLDADMV  576

Query  341  ALVSDFGISKLVMTTTGSGNADQKLGNSTANM-LCGSIGYIAPEYGFGSSTSTKGDVYSF  517
            A V DFG++K+++   GS    Q    ST++M   G+IGY APEYG G+  ST GD+YS+
Sbjct  577  AHVGDFGLAKILVE--GSSMFQQ----STSSMGFRGTIGYAAPEYGAGNMVSTNGDIYSY  630

Query  518  GVLVLEMVTRKKPTDDTFGRSLSLHQYVKS----EQMEIVD----CSLMRALKEQSAEVM  673
            G+LVLE VT KKP    F + LSL +YVKS    E MEIVD      L   +   +    
Sbjct  631  GILVLETVTGKKPAGSEFRQGLSLREYVKSGLEDEVMEIVDMRLCMDLTNGIPTGNDATY  690

Query  674  KMWEVAIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGD  808
            K     I  L+++GM C+Q+ PS+R +  D   +L  +K  L+GD
Sbjct  691  KRKVECIVLLLKLGMSCSQELPSSRSSTGDIVKELLAIKESLSGD  735



>ref|XP_010930449.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Elaeis guineensis]
Length=1130

 Score =   196 bits (499),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 119/286 (42%), Positives = 180/286 (63%), Gaps = 30/286 (10%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
             KV ++Q   +++SF  EC+++R +RH NL+++IT+CS       DFKAL+  YM NGSL+
Sbjct  837   KVFNIQQVGALESFKTECEIIRNVRHYNLVKIITSCSSMDSSGNDFKALIFEYMPNGSLE  896

Query  167   RRLYPHPHS--GSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMT  340
               L+P       + +L+L QR+NI  D+A  L YLHH+  V  IHCDLKPSNVLL+ DMT
Sbjct  897   EWLHPRAQECDQTRNLNLTQRLNIALDVASALCYLHHNIEVPAIHCDLKPSNVLLDNDMT  956

Query  341   ALVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFG  520
             A V DFG+++  ++T+GS  +++    ++   + G+IGY+APEY  GS  ST+GDVYS+G
Sbjct  957   AHVGDFGLARF-LSTSGSTTSEKS---TSLVGIKGTIGYVAPEYAMGSQISTQGDVYSYG  1012

Query  521   VLVLEMVTRKKPTDDTFGRSLSLHQYV----KSEQMEIVDCSLMRALKEQSAEV------  670
             +L+LEM+T KKPT++ F   L+LH++V        MEI+D  +   L+ +S EV      
Sbjct  1013  ILLLEMLTGKKPTNNMFKDGLNLHKFVDMAFPESVMEILDPQI---LQNESEEVDGNIRN  1069

Query  671   -----MKMWEVAIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKR  793
                  M++    I  LI +G+LC+++ P+ RP M D    +  +K 
Sbjct  1070  DNFSRMQLRRCII-SLIRIGLLCSKESPNERPRMRDVTTKVRVVKE  1114



>gb|ABA94329.1| receptor kinase, putative, expressed [Oryza sativa Japonica Group]
 gb|EAZ18788.1| hypothetical protein OsJ_34315 [Oryza sativa Japonica Group]
Length=791

 Score =   194 bits (493),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 122/278 (44%), Positives = 180/278 (65%), Gaps = 19/278 (7%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
            KVL +QT  ++KSF  EC+ LR +RHRNL+++ITACS       DFKA+V  +M +G+L+
Sbjct  520  KVLKLQTPGALKSFTAECEALRNLRHRNLVKIITACSSIDNSGNDFKAIVFDFMPSGNLE  579

Query  167  RRLYPHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTAL  346
              L+P  ++    L+L+QRV I  D+A  L YLH H P  V+HCDLKPSNVLL+ +M A 
Sbjct  580  GWLHPATNN-PKYLNLLQRVGILLDVANALDYLHCHGPTPVVHCDLKPSNVLLDAEMVAH  638

Query  347  VSDFGISKLVMTTTGSGNADQKLGNSTANM-LCGSIGYIAPEYGFGSSTSTKGDVYSFGV  523
            V DFG++K++      GN+   L  ST++M L G+IGY  PEYG G++ ST+GD+YS+G+
Sbjct  639  VGDFGLAKILF----EGNS--LLQQSTSSMGLRGTIGYAPPEYGAGNTVSTQGDIYSYGI  692

Query  524  LVLEMVTRKKPTDDTFGRSLSLHQYVK----SEQMEIVDCSLMRALKEQ--SAEVMKMWE  685
            LVLE VT K+PTD  F + LSL +YV+     + M++VD  L   L+ +  + +  K+  
Sbjct  693  LVLETVTGKRPTDKKFIQGLSLREYVELGLHGKMMDVVDTQLSLHLENELRTTDEYKVMI  752

Query  686  VAIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYL  799
              +  L+ +G+ C+Q+ PS R +  D   +LN +K+ L
Sbjct  753  DCLVSLLRLGLYCSQEIPSNRMSTGDIIKELNAIKQTL  790



>ref|XP_008345550.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Malus domestica]
Length=497

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 116/234 (50%), Positives = 151/234 (65%), Gaps = 16/234 (7%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
            KVL++Q   + KSFI EC+ LR IRHRNL+++ITACS       DFK+LV  +MANGSLD
Sbjct  203  KVLNLQQQGASKSFIDECKALRSIRHRNLLKIITACSSFDNQGKDFKSLVFXFMANGSLD  262

Query  167  RRLYP--HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMT  340
              LYP     S S  +S MQ +NI  D+A  L YLHHH    ++HCDLKPSNVLL+EDM 
Sbjct  263  SMLYPXYEEESPSKRMSFMQXLNIAIDVASALDYLHHHCETAIVHCDLKPSNVLLDEDMV  322

Query  341  ALVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFG  520
            A V DFG+++ +  T+     D     + ++ L GSIGYI PEYG G   S  GDVYS+G
Sbjct  323  AHVGDFGLARFLFETSN----DPSFSQTMSSQLKGSIGYIPPEYGTGGQVSILGDVYSYG  378

Query  521  VLVLEMVTRKKPTDDTFGRSLSLHQYVK----SEQMEIVDCSLMRALKEQSAEV  670
            +L+LEM T K+PTDD F   LS++Q+V        M++VD S++  L E  A+V
Sbjct  379  ILLLEMFTGKRPTDDVFKGGLSIYQFVAMALPDHVMDVVDHSIILDL-ETDADV  431



>ref|XP_010909831.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570, partial [Elaeis guineensis]
Length=685

 Score =   193 bits (491),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 116/227 (51%), Positives = 158/227 (70%), Gaps = 20/227 (9%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
            K+ ++Q   S +SFI EC+ LR IRHRNL+++ITACS       DFKALVL +M +GSL+
Sbjct  464  KIQNLQQQGSSRSFIAECEALRSIRHRNLVKIITACSGVDFRGNDFKALVLEFMEHGSLE  523

Query  167  RRLYPHPHS--GSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMT  340
            + L+P  +       L+L QRV+I  D+A  L YLHHHSPV ++HCDLKP+N+LLN DMT
Sbjct  524  QWLHPKVNERIPMRILNLEQRVSIAIDVASALDYLHHHSPVPIVHCDLKPTNILLNVDMT  583

Query  341  ALVSDFGISKLVMTTTGSGNADQKLGNSTANMLC--GSIGYIAPEYGFGSSTSTKGDVYS  514
            A VSDFG++K +  +T        L + +A+++   GS+GYIAPEYG G   ST+GDVYS
Sbjct  584  AHVSDFGLAKFLSEST-------DLISISASLVAIKGSVGYIAPEYGLGCDVSTQGDVYS  636

Query  515  FGVLVLEMVTRKKPTDDTFGRSLSLHQYVK----SEQMEIVDCSLMR  643
            +G+L+LEM T K+PTD+TF  SL LH++V+    S+ M IVD  L+R
Sbjct  637  YGILLLEMFTGKRPTDETFNESLDLHRFVEMAFPSQIMNIVDPQLIR  683



>ref|XP_006296540.1| hypothetical protein CARUB_v100225660mg, partial [Capsella rubella]
 gb|EOA29438.1| hypothetical protein CARUB_v100225660mg, partial [Capsella rubella]
Length=382

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 121/289 (42%), Positives = 178/289 (62%), Gaps = 28/289 (10%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDF-----KALVLPYMANGSLD  166
            KVL+MQ   +MKSF+ EC+ L+ IRHRNL++L+TACS  DF     +AL+  +M NGSLD
Sbjct  103  KVLNMQRRGAMKSFMAECESLKDIRHRNLVKLLTACSSIDFQGNEFRALIYEFMPNGSLD  162

Query  167  RRLYPH----PHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNED  334
              L+P         S  L+L++R+NI  D+A  L YLH H    + HCD+KPSNVLL++D
Sbjct  163  MWLHPEDVEESRRPSRTLTLLERLNIAIDVASVLDYLHVHCYEPIAHCDIKPSNVLLDDD  222

Query  335  MTALVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYS  514
            +T+ VSDFG+++L++      + +      ++  + G+IGY APEYG G   S  GDVYS
Sbjct  223  LTSHVSDFGLARLLLKF----DQESFFNQLSSAGVRGTIGYAAPEYGMGGQPSIHGDVYS  278

Query  515  FGVLVLEMVTRKKPTDDTFGRSLSLHQYVKS----EQMEIVDCSLM-RALKE--QSAEVM  673
            FGVL+LEM TRK+PTD  FG + +LH Y+KS      ++IVD S++   L+    +AE +
Sbjct  279  FGVLLLEMFTRKRPTDALFGGNFTLHNYIKSALPERVLDIVDESVLGNGLRVGFPAAECL  338

Query  674  KMWEVAIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLK-RYLTGDTTA  817
             +       + EVG+ C ++ P+ R  + +A  +L  L+ R+     TA
Sbjct  339  TL-------IFEVGLRCAEESPTNRLGVSEATKELISLRERFFKATRTA  380



>ref|XP_002270207.2| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Vitis vinifera]
Length=1118

 Score =   196 bits (498),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 121/268 (45%), Positives = 172/268 (64%), Gaps = 19/268 (7%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
             KVL+++   + KSF  EC+VL RIRHRNLI++I++CS  D +ALVL YM+NGSL++ LY 
Sbjct  856   KVLNLRLEGAFKSFDAECKVLARIRHRNLIKVISSCSNLDVRALVLQYMSNGSLEKWLYS  915

Query  182   HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
             H +     L+L QRV+I  D+A  L YLHH     V+HCDLKPSNVLL++DM A V DFG
Sbjct  916   HNYC----LNLFQRVSIMLDVALALEYLHHSQSEPVVHCDLKPSNVLLDDDMVAHVGDFG  971

Query  362   ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
             ++K+++        + K+   T  +  G++GYIAPEYG     STKGDVYS+G+++LE+ 
Sbjct  972   LAKILV--------ENKVVTQTKTL--GTLGYIAPEYGSEGRVSTKGDVYSYGIMLLEIF  1021

Query  542   TRKKPTDDTFGRSLSLHQYVKSEQ----MEIVDCSLMRALK-EQSAEVMKMWEVAIRELI  706
             TRKKPTD+ F   LSL Q+V +      ME+VD  L+     E   +VM      +  ++
Sbjct  1022  TRKKPTDEMFSEELSLRQWVNASLPENVMEVVDGGLLSIEDGEAGGDVMATQSNLLLAIM  1081

Query  707   EVGMLCTQDCPSTRPTMLDAADDLNRLK  790
             E+G+ C++D P  R  + D    LN++K
Sbjct  1082  ELGLECSRDLPEERKGIKDVVVKLNKIK  1109



>ref|XP_009377115.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Pyrus x bretschneideri]
Length=1009

 Score =   195 bits (496),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 116/242 (48%), Positives = 156/242 (64%), Gaps = 14/242 (6%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
            K+L++Q   + +SFIREC  LR IRHRNL+++ITACS       DFK+LV  YM NGSLD
Sbjct  714  KILNLQQEGASRSFIRECNALRSIRHRNLLKIITACSSIDNQGNDFKSLVFEYMVNGSLD  773

Query  167  RRLYPHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTAL  346
              L+P   S S  LSL+QR+NI +DIA  L YLHHH    ++HCDLKPSNVLL+EDM A 
Sbjct  774  AWLHPIEQSHSKRLSLIQRLNIATDIASTLDYLHHHCDTSIVHCDLKPSNVLLDEDMVAH  833

Query  347  VSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVL  526
            V+DFG+++ ++    + +  Q +       L GSIGYI PEYG G   S  GDVYSFG+L
Sbjct  834  VADFGLARFLLEVVDNPSQSQTMSVG----LKGSIGYIPPEYGMGGKVSILGDVYSFGIL  889

Query  527  VLEMVTRKKPTDDTFGRSLSLHQYVK----SEQMEIVDCSLMRALKEQSAEVMKMWEVAI  694
            +LEM T K+PTD  FG  +++H ++        M+IVD SL+   ++  A   + +E  I
Sbjct  890  LLEMFTGKRPTDRMFGDGINIHNFIALAMPDHAMDIVDPSLLTEGEDADANDNR-YEDEI  948

Query  695  RE  700
            +E
Sbjct  949  QE  950



>gb|KHN11804.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=920

 Score =   194 bits (494),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 120/290 (41%), Positives = 178/290 (61%), Gaps = 31/290 (11%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPD-----FKALVLPYMANGSLD  166
            KVL +Q   + KSFI EC  L+ I+HRNL++++T CS  D     FKA++  YM NGSLD
Sbjct  635  KVLKLQNKGAHKSFIVECNALKNIKHRNLVQILTCCSSTDYKGQEFKAIIFQYMTNGSLD  694

Query  167  RRLYP------HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLN  328
            + L+P      HP +    LSL QR+NI  D+A  L YLHH     +IHCDLKPSNVLL+
Sbjct  695  QWLHPSTISAEHPRT----LSLNQRLNIMIDVASALHYLHHECEQMIIHCDLKPSNVLLD  750

Query  329  EDMTALVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDV  508
            +DM A VSDFGI++L+ T+ G+ N++Q    ++   + G+IGY  PEYG GS  S  GD+
Sbjct  751  DDMIAHVSDFGIARLISTSNGT-NSEQ----ASTIGIKGTIGYAPPEYGVGSEVSMNGDM  805

Query  509  YSFGVLVLEMVTRKKPTDDTFGRSLSLHQYVKS----EQMEIVDCSLMRAL------KEQ  658
            YSFG+L+LEM+T ++PTD+ F    +L  +V++       +I+D SL+         +E 
Sbjct  806  YSFGILMLEMLTGRRPTDEIFEDGQNLRSFVENSFPGNLSQILDPSLVLKQGEAPIEEEN  865

Query  659  SAEVMKMWEVAIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKR-YLTG  805
            +  +  + +  +  L  +G+ C+ + P  R  M++   +LN+ KR +LTG
Sbjct  866  NQNISPVVQKCLVTLFSIGLACSVESPKQRMNMVNVTKELNKTKRAFLTG  915



>ref|XP_008353658.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Malus domestica]
Length=484

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 119/277 (43%), Positives = 169/277 (61%), Gaps = 19/277 (7%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
            KVL++Q   + KSF+ EC+ LR IRHRNL+++ITACS       DFK+LV  YM NGSLD
Sbjct  203  KVLNLQQQGASKSFMDECKALRSIRHRNLLKIITACSSIDNQGQDFKSLVFQYMVNGSLD  262

Query  167  RRLYPH--PHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMT  340
              L+P     S S  LSL+QR+NI  D+A  L Y+HHH    ++HCD+KPSNVLL+EDM 
Sbjct  263  VWLHPRDDEQSQSKRLSLIQRLNIAIDVASALDYIHHHCGTSIVHCDIKPSNVLLDEDMV  322

Query  341  ALVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFG  520
            A V DFG+++ ++ ++   +  Q +       L GSIGYI  EYG G   S  GD+YSFG
Sbjct  323  AHVGDFGLARFLLESSDDPSQSQTMSTG----LKGSIGYIPSEYGMGGQVSIFGDIYSFG  378

Query  521  VLVLEMVTRKKPTDDTFGRSLSLHQY----VKSEQMEIVDCSLMRA---LKEQSAEVMKM  679
            +L+LE+ T +KPTDD F   LS+ Q+    +    M+IVD SL+     +     E  ++
Sbjct  379  ILLLEIFTGRKPTDDMFNDGLSIRQFATMAMPDHAMDIVDPSLLIECGDVDSSRLEARRL  438

Query  680  WEVAIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLK  790
             E +I  +I++G+ C+   P  R  M  A + L +++
Sbjct  439  KECSI-AVIQIGLSCSAISPLERMLMDVAVNKLKKIR  474



>ref|XP_007207978.1| hypothetical protein PRUPE_ppa015907mg [Prunus persica]
 gb|EMJ09177.1| hypothetical protein PRUPE_ppa015907mg [Prunus persica]
Length=961

 Score =   195 bits (495),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 123/281 (44%), Positives = 175/281 (62%), Gaps = 19/281 (7%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
            KV ++    + KSFI EC+ LR I+HRNL+++ITACS       DFKALV  YM NGSL+
Sbjct  687  KVFNLLRHGAWKSFIVECEALRNIKHRNLVKIITACSSVDFHGNDFKALVYEYMENGSLE  746

Query  167  RRLYP--HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMT  340
              L+P          L+L QR++I  D+A  L YLH+H    ++HCDLKPSNVLL+ +MT
Sbjct  747  EWLHPPTEVEEVREALNLEQRLDIAIDVACALDYLHNHCETPIVHCDLKPSNVLLDNEMT  806

Query  341  ALVSDFGISKLVMTTTGSGNADQKLGNSTANM-LCGSIGYIAPEYGFGSSTSTKGDVYSF  517
              VSDFG+++ +   TG+ NA +   N T+++ + G++GY APEYG G+  ST GDVYSF
Sbjct  807  GHVSDFGLARFLSQQTGT-NASE---NPTSSIGIKGTVGYAAPEYGMGNEVSTNGDVYSF  862

Query  518  GVLVLEMVTRKKPTDDTFGRSLSLHQYVK----SEQMEIVDCSLMRALKEQSAEVMKMWE  685
            G+L+LEM   K+PTDD F   L+LH YVK    +  MEIVD +L       S   ++  E
Sbjct  863  GILLLEMFAGKRPTDDMFNGDLNLHTYVKMAFPNRVMEIVDSTLFEG--GTSERRVQKIE  920

Query  686  VAIRELIEVGMLCTQDCPSTR-PTMLDAADDLNRLKRYLTG  805
            V +  +  +G+ C+ + P+ R   + DAA +L+ ++  L G
Sbjct  921  VCLNSIFRIGIECSAESPTDRLKNISDAASELHSIRDVLLG  961



>gb|KHG17758.1| hypothetical protein F383_22961 [Gossypium arboreum]
Length=654

 Score =   192 bits (489),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 117/282 (41%), Positives = 171/282 (61%), Gaps = 27/282 (10%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPD-----FKALVLPYMANGSLD  166
            KVL++    + +SF+ EC+ L+ IRHRNL++L+TA S  D     FKALV  +MANGSL+
Sbjct  354  KVLNLLNSGASRSFLAECEALKNIRHRNLVKLLTAISGVDHQGNEFKALVYEFMANGSLE  413

Query  167  RRLYPHPHSGSS----DLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNED  334
              L+P      S    +LS +QR+N+  D+A  L YLHH   V +IHCDLKPSN+LL+E 
Sbjct  414  DWLHPFDDMNGSKAMRNLSFVQRINVAIDVAHALEYLHHGCEVPIIHCDLKPSNILLDEK  473

Query  335  MTALVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYS  514
            M   +SDFG++K++   T + + +Q    S++  L G+IGY  PEY  GS  STKGDVYS
Sbjct  474  MVGHISDFGLAKILSVNTINYSTNQ----SSSLGLRGTIGYTPPEYAMGSELSTKGDVYS  529

Query  515  FGVLVLEMVTRKKPTDDTFGRSLSLHQYVKS----EQMEIVDCSLMRALKEQSAEVMKMW  682
            +G+L+LEM TRK+PTD++F  +LSL  +VK+      +EI+D  L++   +Q       +
Sbjct  530  YGILLLEMFTRKRPTDESFKENLSLRNFVKAALSGRVIEIIDPILLQERAKQGTVTNITF  589

Query  683  E----------VAIRELIEVGMLCTQDCPSTRPTMLDAADDL  778
                         +  + E+G++C+ D PS R  M+D    L
Sbjct  590  NKINLGNDIHFQCLNSIFEIGIICSADSPSKRMDMIDVVSKL  631



>gb|KCW63532.1| hypothetical protein EUGRSUZ_G01167 [Eucalyptus grandis]
Length=355

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 116/278 (42%), Positives = 166/278 (60%), Gaps = 17/278 (6%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
            KVL++    + KSFI EC+ L  IRHRNL+++++ CS       DFKAL+  +MAN SL+
Sbjct  68   KVLNLMQRGASKSFITECRTLGTIRHRNLVKILSVCSSVDFCGNDFKALIYEFMANESLE  127

Query  167  RRLYPHPH------SGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLN  328
              L+P         S S +L L+QR+NI  DIA  + YLH      ++H DLKPSNVLL 
Sbjct  128  EWLHPGTIGRDGECSESRNLRLVQRLNIAIDIATAIEYLHEGCYPAIVHGDLKPSNVLLG  187

Query  329  EDMTALVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDV  508
             DM A V DFG++K++ T +      Q  G+ST+ ++ GSIGY+ PEYG G   ST GD 
Sbjct  188  NDMMARVGDFGLAKIISTVSTEAIGVQDQGSSTSTVVRGSIGYVPPEYGMGHKVSTLGDA  247

Query  509  YSFGVLVLEMVTRKKPTDDTFGRSLSLHQYVK----SEQMEIVDCSLMRALKEQSAEVMK  676
            YS+G+L+LEM T K+P +D FG  L+LH +V+       M+I+D  L     ++  E MK
Sbjct  248  YSYGILLLEMFTGKRPIEDAFGHHLNLHNFVRMALPDRAMDIIDLRLWSEAGDRQQE-MK  306

Query  677  MWEVAIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLK  790
            + +  I  + EVG+ C+ + P  R  M +A   L+ +K
Sbjct  307  IRDCII-SVFEVGVACSMESPPDRMDMTEAIRKLHLIK  343



>ref|NP_001068119.1| Os11g0569800 [Oryza sativa Japonica Group]
 dbj|BAF28482.1| Os11g0569800, partial [Oryza sativa Japonica Group]
Length=822

 Score =   194 bits (492),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 122/278 (44%), Positives = 180/278 (65%), Gaps = 19/278 (7%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
            KVL +QT  ++KSF  EC+ LR +RHRNL+++ITACS       DFKA+V  +M +G+L+
Sbjct  551  KVLKLQTPGALKSFTAECEALRNLRHRNLVKIITACSSIDNSGNDFKAIVFDFMPSGNLE  610

Query  167  RRLYPHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTAL  346
              L+P  ++    L+L+QRV I  D+A  L YLH H P  V+HCDLKPSNVLL+ +M A 
Sbjct  611  GWLHPATNN-PKYLNLLQRVGILLDVANALDYLHCHGPTPVVHCDLKPSNVLLDAEMVAH  669

Query  347  VSDFGISKLVMTTTGSGNADQKLGNSTANM-LCGSIGYIAPEYGFGSSTSTKGDVYSFGV  523
            V DFG++K++      GN+   L  ST++M L G+IGY  PEYG G++ ST+GD+YS+G+
Sbjct  670  VGDFGLAKILF----EGNS--LLQQSTSSMGLRGTIGYAPPEYGAGNTVSTQGDIYSYGI  723

Query  524  LVLEMVTRKKPTDDTFGRSLSLHQYVK----SEQMEIVDCSLMRALKEQ--SAEVMKMWE  685
            LVLE VT K+PTD  F + LSL +YV+     + M++VD  L   L+ +  + +  K+  
Sbjct  724  LVLETVTGKRPTDKKFIQGLSLREYVELGLHGKMMDVVDTQLSLHLENELRTTDEYKVMI  783

Query  686  VAIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYL  799
              +  L+ +G+ C+Q+ PS R +  D   +LN +K+ L
Sbjct  784  DCLVSLLRLGLYCSQEIPSNRMSTGDIIKELNAIKQTL  821



>ref|XP_009341843.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Pyrus x bretschneideri]
Length=478

 Score =   189 bits (481),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 122/278 (44%), Positives = 172/278 (62%), Gaps = 22/278 (8%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
            KVL++Q   + KSF+ EC+ LR IRHRNL+++ITACS       DFK+LV  YM N SLD
Sbjct  197  KVLNLQQQGASKSFMDECKALRSIRHRNLLKIITACSSIDNQGQDFKSLVFQYMVNQSLD  256

Query  167  RRLYPHP--HSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMT  340
              L+P     S S  LSL+QR+NI  D+A  L Y+HH     ++HCD+KPSNVLL+EDM 
Sbjct  257  VWLHPREDEQSQSKRLSLIQRLNIAIDVASALDYIHHRCGTSIVHCDIKPSNVLLDEDMV  316

Query  341  ALVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFG  520
            A V DFG+++ ++ ++   +  Q +       L GSIGYI PEYG G   S  GD+YSFG
Sbjct  317  AHVGDFGLARFLLESSDDPSQSQTMSTG----LKGSIGYIPPEYGMGGQVSIFGDIYSFG  372

Query  521  VLVLEMVTRKKPTDDTFGRSLSLHQY----VKSEQMEIVDCSLM---RALKEQSAEVMKM  679
            +L+LE+ T +KPTDD F   LS+ Q+    +    M+IVD SL+    A+     E  ++
Sbjct  373  ILLLEIFTGRKPTDDMFNNGLSICQFATMAMPDHAMDIVDPSLLIECGAVDGSRLEARRL  432

Query  680  WEVAIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKR  793
             E  I  +I++G+ C+   PS R  ++D A  +N+LK+
Sbjct  433  EECLI-AVIQIGISCSTTSPSER-MLVDVA--VNKLKK  466



>ref|XP_002528851.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF33525.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=988

 Score =   195 bits (495),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 129/294 (44%), Positives = 176/294 (60%), Gaps = 36/294 (12%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
            KVL++    + KSF+ EC+VLR +RHRNL++++TACS       DFKALV  ++ NGSLD
Sbjct  704  KVLNLMHRGAAKSFLAECKVLRNVRHRNLVKVLTACSGIDYHGNDFKALVYEFIDNGSLD  763

Query  167  RRLYPHPHSGSS---DLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDM  337
              L+P P         L+++ R+NI  D+A  L YLH HS   +IHCDLKPSNVLLN++M
Sbjct  764  DWLHPRPLRSDEVPRTLNVLHRLNISIDVACALEYLHCHSGTPIIHCDLKPSNVLLNKEM  823

Query  338  TALVSDFGISKLVMTTTGSGNADQKLGNSTANMLC-----GSIGYIAPEYGFGSSTSTKG  502
            T  VSDFG++K +        +D+KL NS AN        G+IGY  PEYG GS  ST G
Sbjct  824  TGHVSDFGLAKFL--------SDEKL-NSAANHSSSVGARGTIGYCPPEYGLGSDVSTSG  874

Query  503  DVYSFGVLVLEMVTRKKPTDDTFGRSLSLHQYVK---SEQ-MEIVDCSLM---------R  643
            D++SFGVLVLEM T K+PTDD F   L+LH +VK   SEQ +E+VDC ++         R
Sbjct  875  DIFSFGVLVLEMFTGKRPTDDMFKEGLTLHNFVKNALSEQVIEVVDCKILQMQTDATTNR  934

Query  644  ALKEQSAEVMKMWEVAIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTG  805
                +S    K+ E  I  + E+G+ C+ + P  R  + D    L+ ++    G
Sbjct  935  HPNLRSRRNNKLIECLI-AIFEIGICCSSELPRERMNIDDVVVQLSSIRNKFLG  987



>ref|XP_006442565.1| hypothetical protein CICLE_v10018687mg [Citrus clementina]
 gb|ESR55805.1| hypothetical protein CICLE_v10018687mg [Citrus clementina]
Length=996

 Score =   195 bits (495),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 121/278 (44%), Positives = 172/278 (62%), Gaps = 23/278 (8%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            K+ ++Q   + +SF  EC+VLR +RHRNLI+++++CS PDFKALVL +M NGSL++ LY 
Sbjct  736  KIFNLQLERAFRSFDSECEVLRNVRHRNLIKILSSCSNPDFKALVLEFMPNGSLEKWLYS  795

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHH-HSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            H +     L +++R+NI  D+   L YLHH HS   +IHCDLKP+N+LL+E+M A VSDF
Sbjct  796  HNYF----LDILERLNIMIDVGSALEYLHHGHSSAPIIHCDLKPTNILLDENMAAHVSDF  851

Query  359  GISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEM  538
            GISKL+      G  +  +   T  M   +IGY+APEYG     S K DVYS+GVL++E 
Sbjct  852  GISKLL------GEGEDSV---TQTMTMATIGYMAPEYGSEGIVSAKCDVYSYGVLLMET  902

Query  539  VTRKKPTDDTFGRSLSLHQYVKSE----QMEIVDCSLMRALKEQSAEVMKMWEVAIRELI  706
             TRK+PTD+ F   +SL ++VK        E+VD +L+R   E+ A   KM    I  ++
Sbjct  903  FTRKRPTDEMFTGEMSLRKWVKESLPHGLTEVVDANLVR---EEQAFSAKM--DCILSIM  957

Query  707  EVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTAT  820
            ++ + C  + P  R  M DAA  L ++K     D  AT
Sbjct  958  DLALDCCMESPDMRINMTDAAAKLKKIKVKFLDDAAAT  995



>gb|KCW71989.1| hypothetical protein EUGRSUZ_E00442, partial [Eucalyptus grandis]
Length=994

 Score =   195 bits (495),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 115/276 (42%), Positives = 167/276 (61%), Gaps = 21/276 (8%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPD-----FKALVLPYMANGSLD  166
            KVL++Q   + K F+ EC+ L  IRHRNL++++TACS  D     FKALV  +M NG+LD
Sbjct  718  KVLNLQQKGAFKGFLAECKALSSIRHRNLVKILTACSSIDSHHNEFKALVYEFMVNGNLD  777

Query  167  RRLYPHPHSGS-SDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTA  343
              L+P+        LS +QR+NI  D+A  L YLHH     +IHCDLKPSN+LL++D TA
Sbjct  778  IWLHPNDERMQFKPLSFLQRLNITIDVASALDYLHHQCRTPIIHCDLKPSNILLDDDFTA  837

Query  344  LVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGV  523
             +SDFG+S+L+  +    N D   G+ +++   G++GYIAPEYG G   ST GDVYSFG+
Sbjct  838  HISDFGLSRLIFNS----NKDIFSGHPSSSAFQGTMGYIAPEYGMGVRPSTSGDVYSFGI  893

Query  524  LVLEMVTRKKPTDDTFGRSLSLHQYVKS----EQMEIVDCSLMRALKEQSAEVMKMWE--  685
            L+LEM T ++PTD+ F  + +L ++VKS      M I+D S+      +S +   +W   
Sbjct  894  LLLEMFTGRRPTDNLFKENFNLQKFVKSVLSKRAMGILDLSIFCGEVGESMDEEGIWRDC  953

Query  686  -----VAIRELIEVGMLCTQDCPSTRPTMLDAADDL  778
                   +  + E+G++C+ + P  R  M   A DL
Sbjct  954  GIDQAECLISVFEIGLICSAESPKDRKDMNGVARDL  989



>ref|XP_010939782.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Elaeis guineensis]
Length=966

 Score =   194 bits (494),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 124/277 (45%), Positives = 175/277 (63%), Gaps = 22/277 (8%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KVL+++   + +SF  EC+ LR +RHRNLI++I+ CS  DFKALVL YM NGSL++ L+ 
Sbjct  707  KVLNLEMEAASRSFDAECRALRVVRHRNLIKIISTCSNLDFKALVLQYMPNGSLEKWLHS  766

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
            H +     LSL+QR+NI  D+A  L YLHHH P  V+HCDLKPSNVLL+EDM A + DFG
Sbjct  767  HNYC----LSLLQRINIMLDVASALEYLHHHHPQVVLHCDLKPSNVLLDEDMNAHLGDFG  822

Query  362  ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
            I+KL++     G++   +  ST     G+IGYIAPEYG     S   DVYS+G+L+LE++
Sbjct  823  IAKLLL-----GDSKSMVSASTP----GTIGYIAPEYGSTGRVSRSVDVYSYGILLLEII  873

Query  542  TRKKPTDDTFGRSLSLHQYV----KSEQMEIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
            TRKKPTD  F    SL  +V     +  ++IVD +L +   EQ+  + +     +   +E
Sbjct  874  TRKKPTDAMFEGESSLRNWVFEAHPTAVLDIVDNNLFK--DEQADPITR--HQCLSASLE  929

Query  710  VGMLCTQDCPSTRPTMLDAADDLNRLKR-YLTGDTTA  817
            +G+LC++D P  R  M D    L ++K+ YL+    A
Sbjct  930  LGLLCSKDSPKDRILMKDVVPRLQKIKKNYLSKQPRA  966



>ref|XP_006663535.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Oryza brachyantha]
Length=1108

 Score =   196 bits (497),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 123/279 (44%), Positives = 175/279 (63%), Gaps = 20/279 (7%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
             KVL +QT  ++KSF  EC+ LR +RHRNL+++ITACS       DFKA+V  +M NGSL+
Sbjct  836   KVLKLQTPGALKSFRAECEALRSLRHRNLVKIITACSSIDSTGNDFKAIVFDFMPNGSLE  895

Query  167   RRLYPHPHSGSSD-LSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTA  343
               L  HPH+ + + L+L++RV+I  D+A  L YLH H P  V+HCDLKPSNVLL+ DM A
Sbjct  896   DWL--HPHTDNPEYLNLLERVSILLDVAHALDYLHCHGPTPVVHCDLKPSNVLLDADMIA  953

Query  344   LVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGV  523
              V DFG++K+++     GN   +   S+     G+IGY  PEYG G+  ST GD+YS+G+
Sbjct  954   HVGDFGLAKILV----DGNPSLQQSRSSVGFR-GTIGYAPPEYGAGNMVSTHGDIYSYGI  1008

Query  524   LVLEMVTRKKPTDDTFGRSLSLHQYVK----SEQMEIVDCSLMRALKEQSAEVMKMWEVA  691
             LVLE +T K+PTD+ F + LSL +YV+     + ME+VD  L+    E  A     +   
Sbjct  1009  LVLETITGKRPTDNKFTQGLSLREYVELGLHGKLMEVVDTQLLGLENELHAADDSSYRGT  1068

Query  692   IR---ELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYL  799
             I     L+ +G+ C+Q+ PS R +  D   +LN +K+ L
Sbjct  1069  IDCLVSLLRLGLSCSQEMPSNRMSTGDITKELNAIKQSL  1107



>ref|XP_010654247.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Vitis vinifera]
Length=1003

 Score =   195 bits (495),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 115/270 (43%), Positives = 162/270 (60%), Gaps = 17/270 (6%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KV +M    + +SF+ EC+ LR +RHRNL+++++ACS P FKALVL +M NGSL++ L+ 
Sbjct  735  KVFNMDQHGASRSFLAECEALRYVRHRNLVKILSACSSPTFKALVLQFMPNGSLEKWLHH  794

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
                G   L+L QR++I  ++A  + YLHH+    V+HCDLKPSNVLL++DMTA V DFG
Sbjct  795  GGEDGRQRLNLKQRMDIVVEVASAMEYLHHNCETPVVHCDLKPSNVLLDQDMTAHVGDFG  854

Query  362  ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
            +++++            LG      L GSIGYIAPEYG G   STKGDVY FG+LVLEM 
Sbjct  855  LARILHGAASDHQISSTLG------LKGSIGYIAPEYGLGGGVSTKGDVYCFGILVLEMF  908

Query  542  TRKKPTDDTFGRSLSLHQYVKS----EQMEIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
            T KKPT + F    SL ++V++    + M IVD  L    K    E +         +I+
Sbjct  909  TGKKPTQEMFSGEFSLRRWVEAAVPDQVMGIVDNELEGDCKILGVEYLN-------SVIQ  961

Query  710  VGMLCTQDCPSTRPTMLDAADDLNRLKRYL  799
            +G+ C  + P  RP M D +  + + +  L
Sbjct  962  IGLSCASEKPEDRPDMKDVSAMMEKTRAVL  991



>ref|XP_008809723.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Phoenix dactylifera]
Length=1092

 Score =   195 bits (496),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 118/288 (41%), Positives = 178/288 (62%), Gaps = 23/288 (8%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
             KVL++Q   + +SF  EC+ LR IRHRNL++++T+CS       DFKALV  +  NGSL+
Sbjct  806   KVLNLQQHGASRSFFAECEALRNIRHRNLVKILTSCSSMDFEGNDFKALVFEFFPNGSLE  865

Query  167   RRLYPHP--HSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMT  340
             + L+P     S S  LSL +R+NI  D+A  + YLH+H P  ++HCDLKPSNVLL++DMT
Sbjct  866   KWLHPESSEQSNSRKLSLTERLNIAIDVASAVEYLHYHGPKPIVHCDLKPSNVLLSDDMT  925

Query  341   ALVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFG  520
             A VSDFG+++ +  T     ++  L   ++  L GSIGY+APEYG  +  ST GDVYSFG
Sbjct  926   ARVSDFGLARFLNRTI----SNSFLNPVSSMELKGSIGYVAPEYGLANKISTNGDVYSFG  981

Query  521   VLVLEMVTRKKPTDDTFGRSLSLHQYVK----SEQMEIVDCSLMRALKEQSA--------  664
             +L+LE+ T K+PTD  F    SLH++V+     E + I+D  ++   ++  A        
Sbjct  982   ILLLELFTGKRPTDYIFTEGFSLHEFVQMAFPHEVLGIMDPRMVLQKEDGEASDYTRNLS  1041

Query  665   EVMKMWEVAIRELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGD  808
             ++    E  I  +++VG+LC+++ P  R  M+D   +L+ ++  L  D
Sbjct  1042  DIRGEAEKCIASVLKVGLLCSKESPIERMQMMDVTRELHAIRDALRLD  1089



>ref|XP_006442572.1| hypothetical protein CICLE_v100188372mg, partial [Citrus clementina]
 gb|ESR55812.1| hypothetical protein CICLE_v100188372mg, partial [Citrus clementina]
Length=788

 Score =   193 bits (490),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 122/278 (44%), Positives = 170/278 (61%), Gaps = 23/278 (8%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            K+ ++Q   +  SF  EC+VLR +RHRNLI+++++CS PDFKALVL +M NGSL++ LY 
Sbjct  528  KIFNLQLERAFTSFDSECEVLRNVRHRNLIKILSSCSNPDFKALVLEFMPNGSLEKWLYS  587

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHH-HSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            H +     L +++R+NI  D+   L YLHH HS   +IHCDLKP+N+LL+E+M A VSDF
Sbjct  588  HNYF----LDILERLNIMIDVGSALEYLHHGHSSAPIIHCDLKPTNILLDENMVAHVSDF  643

Query  359  GISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEM  538
            GISKLV      G  +  +   T  M   +IGY+APEYG     S K DVYS+GVL++E 
Sbjct  644  GISKLV------GEEEDSV---TQTMTMATIGYMAPEYGSEGIVSAKCDVYSYGVLLMET  694

Query  539  VTRKKPTDDTFGRSLSLHQYVKSE----QMEIVDCSLMRALKEQSAEVMKMWEVAIRELI  706
             TRK PTD+ F   +SL ++VK        E+VD +L+R   E+ A   KM    I  ++
Sbjct  695  FTRKGPTDEMFTGEMSLRRWVKESLPDGLTEVVDANLVR---EEQAFSAKM--DCILSIM  749

Query  707  EVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTAT  820
            ++ + C  + P  R  M DAA  L ++K     D  AT
Sbjct  750  DLALDCCMESPDMRINMTDAAAKLKKIKVKFLDDAAAT  787



>ref|XP_010655740.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Vitis vinifera]
Length=473

 Score =   189 bits (480),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 117/266 (44%), Positives = 163/266 (61%), Gaps = 21/266 (8%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KV +++   +++SF  EC+V++ I HRNLIR+IT CS  DFKALVL YM  GSLD+ LY 
Sbjct  221  KVFNLEFQGALRSFDSECEVMQGICHRNLIRIITCCSNLDFKALVLEYMPKGSLDKWLYS  280

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
            H +     L L QR+NI  D+A  L YLHH     V+HCDLKPSNVLL+ +M A V+DFG
Sbjct  281  HNYF----LDLFQRLNIMIDVASALEYLHHDCSSLVVHCDLKPSNVLLDNNMVAHVADFG  336

Query  362  ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
            I++L +T T S    + L         G+IGY+APEYG     STKGDVYS+G+L++E+ 
Sbjct  337  IARL-LTETESMQQTKTL---------GTIGYMAPEYGSDGIVSTKGDVYSYGILLMEVF  386

Query  542  TRKKPTDDTFGRSLSLHQYVK---SEQMEIVDCSLMRALKEQSAEVMKMWEVAIRELIEV  712
             RKKP D+ F   ++L  +V+   S  +E+VD +L+R   E  A  +      +  L+ +
Sbjct  387  ARKKPMDEMFTGDVTLKTWVESLSSSVIEVVDANLLRRDDEDLATKLSY----LSSLMAL  442

Query  713  GMLCTQDCPSTRPTMLDAADDLNRLK  790
             + CT D P  R  M D   +L ++K
Sbjct  443  ALACTADSPEERINMKDVVVELKKIK  468



>ref|XP_010050956.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Eucalyptus grandis]
 gb|KCW80965.1| hypothetical protein EUGRSUZ_C02328 [Eucalyptus grandis]
Length=1113

 Score =   195 bits (496),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 119/267 (45%), Positives = 172/267 (64%), Gaps = 20/267 (7%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
             KVL++    ++KSF  EC+V R+IRHRNL+++I++C+  D +ALVL Y+ NGSL++ L  
Sbjct  854   KVLNLHIEGALKSFDAECEVFRKIRHRNLVKVISSCTNADLRALVLQYVPNGSLEKWL--  911

Query  182   HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
               HS + +L L QRVN+  DIA  L YLHH  P  ++HCDLKPSNVLLNE + A V DFG
Sbjct  912   --HSNNRNLGLHQRVNLVVDIATALDYLHHRQPEPIVHCDLKPSNVLLNEGLVAQVCDFG  969

Query  362   ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
             I+K++        A  KL   T  +  G+IGYIAPEYG     STKGDVYSFG+L+LE++
Sbjct  970   IAKIL--------AKSKLETQTQTL--GTIGYIAPEYGLEGKVSTKGDVYSFGILLLEVI  1019

Query  542   TRKKPTDDTFGRSLSLHQYVKSEQ----MEIVDCSLMRALKEQSAEVMKMWEVAIRELIE  709
             T KKPTD+ F   +SL Q+V +      ++I+D  L+ ++K +     ++ E  +  ++E
Sbjct  1020  TSKKPTDEMFDADMSLRQWVGAATPDRVLDIMDSKLI-SMKLEDLTPPEL-ESIVLSILE  1077

Query  710   VGMLCTQDCPSTRPTMLDAADDLNRLK  790
             +G+ C++D P  R  M      LN++K
Sbjct  1078  LGLECSKDLPEERMDMKTIIVKLNKIK  1104



>gb|AFW60350.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=804

 Score =   193 bits (490),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 119/287 (41%), Positives = 177/287 (62%), Gaps = 23/287 (8%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPD-----FKALVLPYMANGSLD  166
            KV  +Q   S++SF+ EC+ LR++RHRNL+ +IT CS  D     FKA+VL YM NGSLD
Sbjct  517  KVFDLQQSGSLRSFMSECEALRKVRHRNLVSVITCCSGYDSNQNNFKAIVLEYMTNGSLD  576

Query  167  RRLYPHPHSGSSD---LSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDM  337
            + ++P     S+D   L+LMQR+NI  D  + + YLH+     ++HCDLKPSN+LLNED 
Sbjct  577  KWIHPDQGGQSTDPVGLTLMQRLNIAIDTCDAMDYLHNSCQPPIVHCDLKPSNILLNEDF  636

Query  338  TALVSDFGISKLVMTTTGS-GNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYS  514
             ALV DFGI+K++  +TG   N + +  +ST   + G+IGY+APEYG G   S  GDVYS
Sbjct  637  GALVGDFGIAKILRDSTGDPSNMNSR--SSTGTGIRGTIGYVAPEYGEGHQVSPCGDVYS  694

Query  515  FGVLVLEMVTRKKPTDDTFGRSLSLHQYVKS----EQMEIVDCSLMRALKEQSAEVMKMW  682
            FG+L+LE+ T K PT+D F   LSL  YV++      ++IVD +++ A +  + +V    
Sbjct  695  FGILLLELFTGKAPTNDMFADGLSLQGYVQAAFPDHLVDIVDPAIVAAEENYAHDVHSGT  754

Query  683  EVAIR--------ELIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYL  799
                R         +  + +LCT+  P+ R +M +AA +L +++ + 
Sbjct  755  SNGPRGQNNSVMVSVTGLALLCTKQAPAERISMRNAATELRKIRAHF  801



>emb|CDP19732.1| unnamed protein product [Coffea canephora]
Length=416

 Score =   187 bits (476),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 109/288 (38%), Positives = 172/288 (60%), Gaps = 24/288 (8%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            KV ++    S+KSF+REC+VL+ + HRNL +++ +C  PDFKALVL YM+NG++++ LY 
Sbjct  147  KVFNLLVEGSLKSFVRECEVLKSLCHRNLTKVLGSCYNPDFKALVLKYMSNGNVEKWLYS  206

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTALVSDFG  361
            H H     L + QR+NI  D+A  L YLH+      +HCDLKPSN+LL+EDM A VSDFG
Sbjct  207  HNHY----LDMFQRINIIIDVACALEYLHYSYDTPAVHCDLKPSNILLDEDMAAHVSDFG  262

Query  362  ISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEMV  541
            I+K+       G  +  L  +T      ++GYIAPEYG     ST+ DVYSFG++++E+ 
Sbjct  263  IAKMF------GEGESILHTNTL----ATLGYIAPEYGSEGIVSTRIDVYSFGIVLMEVF  312

Query  542  TRKKPTDDTFGRSLSLHQYVKS---EQMEIVDCSLMRALKEQSAEVMKMWEVAIRELIEV  712
             R  P D+ F   LSL+ +V+    + +++VD +L+R   E   + +K     +  ++++
Sbjct  313  ARMTPNDEMFSGDLSLNSWVEDSLPDALQVVDANLIRPEDEHFTDKLK----CVTLIMKL  368

Query  713  GMLCTQDCPSTRPTMLDAADDLNRLK---RYLTGDTTATFASSLGISC  847
             + C ++CP  R +M D    L ++K   ++L   +   F ++    C
Sbjct  369  ALNCYRECPRERISMKDVLAKLIKIKHQFQFLMTVSIYPFCTNFTSEC  416



>gb|KCW45736.1| hypothetical protein EUGRSUZ_L00483 [Eucalyptus grandis]
Length=896

 Score =   193 bits (491),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 124/287 (43%), Positives = 178/287 (62%), Gaps = 25/287 (9%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
            K L +    + KSFI EC+VLRRIRHRNL++++TACS       DFKALV  +M+NGSLD
Sbjct  607  KTLDLTCDGASKSFIAECEVLRRIRHRNLVKVLTACSGFDFNGNDFKALVYEFMSNGSLD  666

Query  167  RRLYP--HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMT  340
              L+P    ++  + LSL++RVNI  D+A  L YLHHH  + ++HCDLKPSNVLL+++M 
Sbjct  667  EWLHPTTSQYTERNKLSLLERVNIAIDVACALDYLHHHYEMPIVHCDLKPSNVLLDDEMN  726

Query  341  ALVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFG  520
              V DFG+++ +   T     DQ    S++  + GS GY+APEYG GS+ ST+GDVYSFG
Sbjct  727  GHVGDFGLARFLPEATHKLLVDQ----SSSVGVKGSFGYVAPEYGAGSAVSTEGDVYSFG  782

Query  521  VLVLEMVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQSAEVMKMWEVA---  691
            VLVLEM T K+P DDTF   L LH++ K+   + V+ ++   L ++  E+ K   +A   
Sbjct  783  VLVLEMFTGKRPIDDTFENGLDLHRFTKAALADRVEKAIDPILLQEIEELEKRRTIAPEG  842

Query  692  -------IRE----LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYL  799
                   I++    +IEVG+ C+ +    R  + DA   L  +++ L
Sbjct  843  KNRSWCSIKDCLVLIIEVGITCSFESSKERMGIYDALTKLQGMRKKL  889



>gb|KDP44793.1| hypothetical protein JCGZ_01293 [Jatropha curcas]
Length=1022

 Score =   194 bits (494),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 114/268 (43%), Positives = 176/268 (66%), Gaps = 16/268 (6%)
 Frame = +2

Query  2     KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
             KVL++Q   + KSF+ EC+ LR IRHRNL++++TACS       DFKALV  +M NGSL+
Sbjct  752   KVLNLQYHGAAKSFMAECEALRNIRHRNLVKIVTACSGVDYQGNDFKALVYEFMVNGSLE  811

Query  167   RRLYPHPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMTAL  346
             + L+P  + G  +L+L+QR+NI  D+A    YLHH+    ++H DLKPS+VLL+++MTA 
Sbjct  812   QWLHPSVNEGYKNLNLIQRINIAIDVASATEYLHHYCGSAIVHSDLKPSSVLLDDEMTAH  871

Query  347   VSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVL  526
             + DFG++K ++ +  +    Q    S++  L G+I Y  PEYG GS  STKGD+YS+G+L
Sbjct  872   IGDFGLAKFLLHSVQNNCTYQ----SSSAGLRGTIVYTPPEYGLGSKVSTKGDIYSYGIL  927

Query  527   VLEMVTRKKPTDDTFGRSLSLHQYVKS----EQMEIVDCSLMRALKEQSAEVMKMWEVAI  694
             +LEM+TRK+PTDD F   L+L ++V+S    E  E+ D  L++   + +  +M    ++I
Sbjct  928   LLEMITRKRPTDDMFKEGLNLRKFVESALPNEVSEVADPILLQEGGQSNDRIMIECLISI  987

Query  695   RELIEVGMLCTQDCPSTRPTMLDAADDL  778
                +E+G+ C+ + P+ R  + DAA +L
Sbjct  988   ---LEIGISCSAELPTDRMDISDAAIEL  1012



>gb|KCW45933.1| hypothetical protein EUGRSUZ_L00201, partial [Eucalyptus grandis]
Length=1000

 Score =   194 bits (493),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 121/286 (42%), Positives = 176/286 (62%), Gaps = 24/286 (8%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
            K+L +  G + KSFI EC+VLRRIRH NL++++TACS       DFKALV  +M+NGSLD
Sbjct  712  KILDLTCGGASKSFIAECEVLRRIRHCNLVKILTACSGFDFNGNDFKALVYEFMSNGSLD  771

Query  167  RRLYP--HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMT  340
              L+P    ++  + LSL++RVNI  D+A  L YLHHH  + ++HCDLKPSNVLL+++M 
Sbjct  772  EWLHPIASQYTERNKLSLLERVNIAIDVACALDYLHHHCEIPIVHCDLKPSNVLLDDEMN  831

Query  341  ALVSDFGISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFG  520
              V DFGI++ +         DQ    S++  + GS GY+APEYG GS+ S +GDVYSFG
Sbjct  832  GHVGDFGIARFLPEAIHKLLVDQ----SSSVGVKGSFGYVAPEYGMGSAVSIEGDVYSFG  887

Query  521  VLVLEMVTRKKPTDDTFGRSLSLHQYVKSEQMEIVDCSLMRALKEQSAEVMKMWEVA---  691
            VL+LEM T K+P DD F   L LH++ K+   + V+ ++   L ++  E+ K   +A   
Sbjct  888  VLILEMFTGKRPIDDMFENGLDLHRFTKAALADQVEKAIDPILLQEIEELKKRRTIAPGK  947

Query  692  ------IRE----LIEVGMLCTQDCPSTRPTMLDAADDLNRLKRYL  799
                  I++    +IEVG+ C+ +    R  + DA   L  +++ L
Sbjct  948  NKSWCSIKDCLVLIIEVGITCSFESSKERMDIYDALTKLQGMRKKL  993



>gb|KDO48776.1| hypothetical protein CISIN_1g003855mg [Citrus sinensis]
Length=791

 Score =   192 bits (489),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 120/278 (43%), Positives = 173/278 (62%), Gaps = 23/278 (8%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSLPDFKALVLPYMANGSLDRRLYP  181
            K+ ++Q   + +SF  EC+VLR +RHRNLI+++++CS PDFKALVL +M NGSL++ LY 
Sbjct  531  KIFNLQLERAFRSFDSECEVLRNVRHRNLIKILSSCSNPDFKALVLEFMPNGSLEKWLYS  590

Query  182  HPHSGSSDLSLMQRVNICSDIAEGLAYLHH-HSPVKVIHCDLKPSNVLLNEDMTALVSDF  358
            H +     L +++R+NI  D+   L YLHH HS   +IHCDLKP+N+LL+E+M A VSDF
Sbjct  591  HNYF----LDILERLNIMIDVGSALEYLHHGHSSAPIIHCDLKPTNILLDENMAAHVSDF  646

Query  359  GISKLVMTTTGSGNADQKLGNSTANMLCGSIGYIAPEYGFGSSTSTKGDVYSFGVLVLEM  538
            GISKL+      G  +  +   T  M   +IGY+APEYG     S K DVYS+GVL++E 
Sbjct  647  GISKLL------GEGEDSV---TQTMTMATIGYMAPEYGSEGIVSAKCDVYSYGVLLMET  697

Query  539  VTRKKPTDDTFGRSLSLHQYVKSE----QMEIVDCSLMRALKEQSAEVMKMWEVAIRELI  706
             TRK+PTD+ F   +SL ++VK        E+VD +L+R   E+ A   KM    I  ++
Sbjct  698  FTRKRPTDEMFTGEMSLRRWVKESLPHGLTEVVDANLVR---EEQAFSAKM--DCILSIM  752

Query  707  EVGMLCTQDCPSTRPTMLDAADDLNRLKRYLTGDTTAT  820
            ++ + C  + P  R  + DAA  L ++K     D +AT
Sbjct  753  DLALDCCIESPDMRINVTDAAAKLKKIKVKFLDDASAT  790



>gb|AFW81417.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=865

 Score =   193 bits (490),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 118/269 (44%), Positives = 170/269 (63%), Gaps = 20/269 (7%)
 Frame = +2

Query  2    KVLSMQTGNSMKSFIRECQVlrrirhrnlirliTACSL-----PDFKALVLPYMANGSLD  166
            KV  +    +  SF+ EC+ LR  RHRNL+++ITACS       DFKA++L YM+NGSL+
Sbjct  587  KVFKLDQLGAPNSFLAECEALRNTRHRNLVKVITACSTIDSEGHDFKAVILEYMSNGSLE  646

Query  167  RRLYP--HPHSGSSDLSLMQRVNICSDIAEGLAYLHHHSPVKVIHCDLKPSNVLLNEDMT  340
              LYP  + +     LSL  R+ I +DIA  L YLH+H    ++HCDLKPSNVLL++ M 
Sbjct  647  NWLYPKLNRYGIRKPLSLGSRIEIAADIACALDYLHNHCVPAIVHCDLKPSNVLLDDAMV  706

Query  341  ALVSDFGISKLVMTTTGSGNADQKLGNSTANMLCG---SIGYIAPEYGFGSSTSTKGDVY  511
            A + DFG++KL+ T + S      + +S++  L G   SIGYIAPEYGFGS  ST+GDVY
Sbjct  707  AHLGDFGLAKLLHTCSYS------ITHSSSTSLIGPRGSIGYIAPEYGFGSKLSTQGDVY  760

Query  512  SFGVLVLEMVTRKKPTDDTFGRSLSLHQYVK----SEQMEIVDCSLMRALKEQSAEVMKM  679
            S+G+ VLEM+T K+PTD+ F + L+LH++VK     +  EI+D S+    ++        
Sbjct  761  SYGITVLEMLTGKRPTDEMFSKGLTLHKFVKEAFPQKIHEILDPSIFPVTRDGDNHTTDE  820

Query  680  WEVAIRELIEVGMLCTQDCPSTRPTMLDA  766
               +I  L+++G+ C+ D P+ RPT+ D 
Sbjct  821  ITRSIMNLLKIGISCSADAPTDRPTIDDV  849



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1997200541776