BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c28086_g1_i1 len=1247 path=[1:0-1246]

Length=1247
                                                                      Score     E

ref|XP_009608401.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    462   2e-158   
ref|XP_009802367.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    458   5e-157   
ref|XP_006346585.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    437   1e-148   
ref|XP_004252327.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    430   4e-146   
emb|CDO98088.1|  unnamed protein product                                354   3e-116   
emb|CDO98087.1|  unnamed protein product                                325   6e-105   
gb|EYU21581.1|  hypothetical protein MIMGU_mgv1a010326mg                319   1e-102   
ref|XP_002284983.1|  PREDICTED: probable inactive 2-oxoglutarate-...    316   1e-101   Vitis vinifera
emb|CBI36206.3|  unnamed protein product                                318   2e-100   
ref|XP_002284974.1|  PREDICTED: probable 2-oxoglutarate-dependent...    308   2e-98    Vitis vinifera
ref|XP_010110313.1|  Gibberellin 3-beta-dioxygenase 4                   308   2e-98    
emb|CAN80139.1|  hypothetical protein VITISV_028513                     308   2e-98    Vitis vinifera
gb|EYU24677.1|  hypothetical protein MIMGU_mgv1a010266mg                308   3e-98    
ref|XP_002298131.1|  hypothetical protein POPTR_0001s17670g             304   7e-97    Populus trichocarpa [western balsam poplar]
emb|CDP17011.1|  unnamed protein product                                302   4e-96    
ref|XP_011072270.1|  PREDICTED: probable 2-oxoglutarate-dependent...    300   5e-95    
ref|XP_011045368.1|  PREDICTED: probable 2-oxoglutarate-dependent...    297   4e-94    
ref|XP_006427128.1|  hypothetical protein CICLE_v10027501mg             298   7e-94    
ref|XP_006465516.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    296   7e-94    
ref|XP_002517546.1|  Gibberellin 20 oxidase, putative                   296   2e-93    Ricinus communis
gb|EYU21585.1|  hypothetical protein MIMGU_mgv1a010381mg                295   3e-93    
ref|XP_007024003.1|  2-oxoglutarate-dependent dioxygenase               294   6e-93    
ref|XP_002517548.1|  Gibberellin 20 oxidase, putative                   294   9e-93    Ricinus communis
ref|XP_007215723.1|  hypothetical protein PRUPE_ppa008973mg             293   2e-92    
gb|KDO58207.1|  hypothetical protein CISIN_1g037660mg                   291   5e-92    
ref|XP_006427130.1|  hypothetical protein CICLE_v10027182mg             292   7e-92    
gb|ADW66145.1|  gibberellin 20 oxidase 2                                286   5e-91    
ref|XP_002298127.1|  oxidoreductase family protein                      289   7e-91    Populus trichocarpa [western balsam poplar]
ref|XP_010033904.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    289   8e-91    
emb|CAN77851.1|  hypothetical protein VITISV_030994                     289   1e-90    Vitis vinifera
ref|XP_008228621.1|  PREDICTED: probable 2-oxoglutarate-dependent...    288   2e-90    
ref|XP_002280670.1|  PREDICTED: probable 2-oxoglutarate-dependent...    287   4e-90    Vitis vinifera
ref|XP_002284968.1|  PREDICTED: probable 2-oxoglutarate-dependent...    286   7e-90    Vitis vinifera
ref|XP_008377592.1|  PREDICTED: probable 2-oxoglutarate-dependent...    286   7e-90    
ref|XP_011045371.1|  PREDICTED: probable 2-oxoglutarate-dependent...    286   9e-90    
emb|CDO98091.1|  unnamed protein product                                285   3e-89    
gb|KDP37163.1|  hypothetical protein JCGZ_06219                         284   6e-89    
emb|CAN80138.1|  hypothetical protein VITISV_028512                     284   6e-89    Vitis vinifera
emb|CDP10326.1|  unnamed protein product                                282   3e-88    
ref|XP_002284985.1|  PREDICTED: probable 2-oxoglutarate-dependent...    282   3e-88    Vitis vinifera
emb|CDO98090.1|  unnamed protein product                                281   5e-88    
ref|XP_010110322.1|  Gibberellin 20 oxidase 1                           283   5e-88    
ref|XP_002517690.1|  Gibberellin 20 oxidase, putative                   281   8e-88    Ricinus communis
ref|XP_009339601.1|  PREDICTED: probable 2-oxoglutarate-dependent...    281   1e-87    
ref|XP_007024008.1|  2-oxoglutarate-dependent dioxygenase, putative     280   2e-87    
ref|XP_006427132.1|  hypothetical protein CICLE_v10027083mg             279   5e-87    
ref|XP_006427129.1|  hypothetical protein CICLE_v10027545mg             280   5e-87    
ref|XP_008377590.1|  PREDICTED: probable 2-oxoglutarate-dependent...    278   9e-87    
ref|XP_006465423.1|  PREDICTED: probable 2-oxoglutarate-dependent...    278   1e-86    
ref|XP_006465514.1|  PREDICTED: probable 2-oxoglutarate-dependent...    278   2e-86    
ref|XP_008228620.1|  PREDICTED: probable 2-oxoglutarate-dependent...    278   2e-86    
gb|AFC36356.1|  2-oxoglutarate-dependent dioxygenase                    277   3e-86    
ref|XP_009799663.1|  PREDICTED: probable 2-oxoglutarate-dependent...    277   3e-86    
ref|XP_004151475.1|  PREDICTED: gibberellin 20 oxidase 1-B-like         278   3e-86    
ref|XP_006427127.1|  hypothetical protein CICLE_v10027219mg             276   4e-86    
ref|XP_004302952.1|  PREDICTED: leucoanthocyanidin dioxygenase-like     276   5e-86    
gb|KDP37168.1|  hypothetical protein JCGZ_06224                         275   1e-85    
gb|KDO58204.1|  hypothetical protein CISIN_1g038676mg                   275   2e-85    
ref|XP_004302943.1|  PREDICTED: gibberellin 20 oxidase 1-like           275   2e-85    
ref|XP_007024335.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    284   4e-85    
ref|XP_007216862.1|  hypothetical protein PRUPE_ppa021358mg             274   4e-85    
ref|XP_008228619.1|  PREDICTED: probable 2-oxoglutarate-dependent...    274   5e-85    
gb|KDP24591.1|  hypothetical protein JCGZ_25507                         274   5e-85    
ref|XP_010034855.1|  PREDICTED: probable 2-oxoglutarate-dependent...    274   5e-85    
ref|XP_011072310.1|  PREDICTED: probable 2-oxoglutarate-dependent...    274   5e-85    
ref|XP_006427131.1|  hypothetical protein CICLE_v10027420mg             273   1e-84    
ref|XP_010110312.1|  Gibberellin 3-beta-dioxygenase 4                   273   2e-84    
emb|CDP19783.1|  unnamed protein product                                272   3e-84    
ref|XP_003535849.1|  PREDICTED: probable 2-oxoglutarate-dependent...    271   3e-84    
ref|XP_010665883.1|  PREDICTED: probable 2-oxoglutarate-dependent...    272   3e-84    
gb|ACU24369.1|  unknown                                                 271   3e-84    Glycine max [soybeans]
ref|XP_007217562.1|  hypothetical protein PRUPE_ppa021035mg             271   4e-84    
ref|XP_007216816.1|  hypothetical protein PRUPE_ppa023108mg             272   4e-84    
ref|XP_009603180.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    271   4e-84    
gb|KEH28749.1|  2-oxoglutarate-dependent dioxygenase                    271   4e-84    
gb|EYU21582.1|  hypothetical protein MIMGU_mgv1a010360mg                271   4e-84    
ref|XP_002298129.1|  2-oxoglutarate-dependent dioxygenase-related...    271   6e-84    Populus trichocarpa [western balsam poplar]
gb|AFK40822.1|  unknown                                                 271   7e-84    
ref|XP_008228622.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    271   9e-84    
gb|KHN31409.1|  Gibberellin 20 oxidase 1                                270   9e-84    
ref|XP_007145554.1|  hypothetical protein PHAVU_007G248400g             270   9e-84    
ref|XP_004165032.1|  PREDICTED: gibberellin 20 oxidase 1-B-like         271   1e-83    
ref|XP_006465422.1|  PREDICTED: probable 2-oxoglutarate-dependent...    270   1e-83    
emb|CAN66061.1|  hypothetical protein VITISV_007808                     270   2e-83    Vitis vinifera
emb|CDP08458.1|  unnamed protein product                                269   3e-83    
ref|XP_010061959.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    269   3e-83    
ref|XP_011045369.1|  PREDICTED: probable 2-oxoglutarate-dependent...    269   3e-83    
ref|XP_010061960.1|  PREDICTED: probable inactive 2-oxoglutarate-...    269   4e-83    
ref|XP_007024009.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    269   5e-83    
ref|XP_009780364.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    268   6e-83    
ref|XP_007135717.1|  hypothetical protein PHAVU_010G152300g             268   9e-83    
ref|XP_009588351.1|  PREDICTED: probable 2-oxoglutarate-dependent...    268   1e-82    
gb|KFK35768.1|  hypothetical protein AALP_AA4G033700                    267   2e-82    
ref|XP_009339603.1|  PREDICTED: probable 2-oxoglutarate-dependent...    268   2e-82    
ref|XP_003533058.1|  PREDICTED: probable 2-oxoglutarate-dependent...    267   2e-82    
ref|XP_009771248.1|  PREDICTED: probable 2-oxoglutarate-dependent...    267   2e-82    
ref|XP_009339602.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    266   3e-82    
emb|CDY26055.1|  BnaC06g05690D                                          266   3e-82    
ref|XP_011072311.1|  PREDICTED: probable 2-oxoglutarate-dependent...    266   4e-82    
ref|XP_006392870.1|  hypothetical protein EUTSA_v10011669mg             266   4e-82    
ref|XP_002517541.1|  Gibberellin 20 oxidase, putative                   266   4e-82    Ricinus communis
ref|XP_011072273.1|  PREDICTED: probable 2-oxoglutarate-dependent...    266   4e-82    
ref|XP_006465515.1|  PREDICTED: probable 2-oxoglutarate-dependent...    266   5e-82    
emb|CDY68239.1|  BnaA06g37440D                                          266   5e-82    
ref|XP_009147661.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    266   7e-82    
ref|NP_175688.1|  oxidoreductase, 2OG-Fe(II) oxygenase family pro...    265   1e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010545796.1|  PREDICTED: probable 2-oxoglutarate-dependent...    265   1e-81    
ref|XP_004241720.1|  PREDICTED: probable 2-oxoglutarate-dependent...    265   1e-81    
ref|XP_007214491.1|  hypothetical protein PRUPE_ppa020361mg             265   2e-81    
ref|XP_006356178.1|  PREDICTED: probable 2-oxoglutarate-dependent...    264   3e-81    
ref|XP_008461057.1|  PREDICTED: probable 2-oxoglutarate-dependent...    264   4e-81    
ref|XP_008377588.1|  PREDICTED: probable 2-oxoglutarate-dependent...    264   5e-81    
gb|AFK47428.1|  unknown                                                 263   8e-81    
ref|XP_008377591.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    263   9e-81    
ref|XP_008454372.1|  PREDICTED: probable 2-oxoglutarate-dependent...    262   1e-80    
ref|XP_004241717.1|  PREDICTED: probable 2-oxoglutarate-dependent...    262   1e-80    
ref|XP_004241716.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    262   2e-80    
ref|XP_004152262.1|  PREDICTED: gibberellin 20 oxidase 1-B-like         262   2e-80    
gb|KEH28750.1|  2-oxoglutarate-dependent dioxygenase                    262   2e-80    
ref|XP_009616143.1|  PREDICTED: probable 2-oxoglutarate-dependent...    262   2e-80    
ref|XP_004136073.1|  PREDICTED: gibberellin 2-beta-dioxygenase 8-...    261   3e-80    
ref|XP_008461058.1|  PREDICTED: probable inactive 2-oxoglutarate-...    261   3e-80    
gb|EYU31921.1|  hypothetical protein MIMGU_mgv1a010132mg                261   3e-80    
ref|XP_009379331.1|  PREDICTED: probable 2-oxoglutarate-dependent...    261   4e-80    
gb|KHG05406.1|  2'-deoxymugineic-acid 2'-dioxygenase                    261   4e-80    
ref|XP_008226092.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    260   9e-80    
ref|XP_003528366.1|  PREDICTED: probable 2-oxoglutarate-dependent...    260   1e-79    
ref|XP_004506877.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    259   2e-79    
emb|CDP08459.1|  unnamed protein product                                259   2e-79    
ref|XP_008784635.1|  PREDICTED: probable 2-oxoglutarate-dependent...    258   4e-79    
gb|KHN01361.1|  Gibberellin 20 oxidase 1                                258   9e-79    
ref|XP_008366303.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    258   9e-79    
ref|XP_006305421.1|  hypothetical protein CARUB_v10009821mg             258   9e-79    
ref|XP_004506878.1|  PREDICTED: S-norcoclaurine synthase 1-like         258   1e-78    
ref|XP_008386022.1|  PREDICTED: probable inactive 2-oxoglutarate-...    257   1e-78    
ref|XP_004136074.1|  PREDICTED: gibberellin 20 oxidase 1-like           257   2e-78    
ref|XP_004171510.1|  PREDICTED: LOW QUALITY PROTEIN: gibberellin ...    256   3e-78    
ref|XP_006306220.1|  hypothetical protein CARUB_v10011908mg             256   4e-78    
gb|KFK35767.1|  hypothetical protein AALP_AA4G033600                    256   4e-78    
emb|CDP19495.1|  unnamed protein product                                256   5e-78    
ref|XP_010110314.1|  Gibberellin 3-beta-dioxygenase 4                   256   5e-78    
ref|XP_010545794.1|  PREDICTED: probable 2-oxoglutarate-dependent...    256   5e-78    
ref|XP_009347560.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    256   6e-78    
gb|KDP37370.1|  hypothetical protein JCGZ_06824                         255   1e-77    
ref|XP_002517547.1|  Gibberellin 20 oxidase, putative                   254   1e-77    Ricinus communis
ref|XP_009799661.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    254   2e-77    
ref|XP_008384915.1|  PREDICTED: probable inactive 2-oxoglutarate-...    254   2e-77    
ref|XP_009375961.1|  PREDICTED: probable inactive 2-oxoglutarate-...    254   2e-77    
ref|XP_006356186.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    254   3e-77    
ref|XP_004302942.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    253   4e-77    
emb|CDP20247.1|  unnamed protein product                                253   5e-77    
ref|XP_009375959.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    253   5e-77    
ref|XP_010047771.1|  PREDICTED: probable 2-oxoglutarate-dependent...    252   1e-76    
gb|KDP37164.1|  hypothetical protein JCGZ_06220                         252   1e-76    
ref|XP_010462134.1|  PREDICTED: probable 2-oxoglutarate-dependent...    252   2e-76    
emb|CDO98089.1|  unnamed protein product                                252   2e-76    
ref|XP_007135718.1|  hypothetical protein PHAVU_010G152400g             252   2e-76    
emb|CDP14980.1|  unnamed protein product                                252   2e-76    
ref|XP_009364342.1|  PREDICTED: probable inactive 2-oxoglutarate-...    252   2e-76    
emb|CDY26044.1|  BnaC06g05800D                                          251   2e-76    
ref|XP_009616144.1|  PREDICTED: probable 2-oxoglutarate-dependent...    251   4e-76    
ref|XP_010500907.1|  PREDICTED: probable 2-oxoglutarate-dependent...    251   4e-76    
ref|XP_004241719.1|  PREDICTED: probable 2-oxoglutarate-dependent...    251   5e-76    
gb|KDO58208.1|  hypothetical protein CISIN_1g044747mg                   251   5e-76    
ref|XP_009371496.1|  PREDICTED: probable 2-oxoglutarate-dependent...    251   5e-76    
ref|XP_009147658.1|  PREDICTED: probable 2-oxoglutarate-dependent...    250   6e-76    
ref|XP_010033902.1|  PREDICTED: probable 2-oxoglutarate-dependent...    250   1e-75    
ref|XP_010542274.1|  PREDICTED: probable 2-oxoglutarate-dependent...    248   3e-75    
emb|CDP08608.1|  unnamed protein product                                249   5e-75    
ref|XP_006392868.1|  hypothetical protein EUTSA_v10011672mg             248   5e-75    
ref|XP_010500906.1|  PREDICTED: probable 2-oxoglutarate-dependent...    248   6e-75    
ref|XP_010462133.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    247   8e-75    
emb|CDP14441.1|  unnamed protein product                                247   1e-74    
ref|NP_175689.1|  oxidoreductase, 2OG-Fe(II) oxygenase family pro...    247   2e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006367749.1|  PREDICTED: probable 2-oxoglutarate-dependent...    246   2e-74    
ref|XP_011045370.1|  PREDICTED: probable 2-oxoglutarate-dependent...    246   2e-74    
ref|XP_006392865.1|  hypothetical protein EUTSA_v10011667mg             246   2e-74    
gb|KDP37380.1|  hypothetical protein JCGZ_06834                         246   2e-74    
emb|CDP10327.1|  unnamed protein product                                246   3e-74    
ref|XP_009147660.1|  PREDICTED: probable 2-oxoglutarate-dependent...    246   4e-74    
ref|XP_010033901.1|  PREDICTED: probable 2-oxoglutarate-dependent...    245   5e-74    
ref|XP_003547720.1|  PREDICTED: probable inactive 2-oxoglutarate-...    245   5e-74    
ref|XP_006305391.1|  hypothetical protein CARUB_v10009783mg             245   7e-74    
gb|KHN27538.1|  Gibberellin 20 oxidase 1                                244   1e-73    
ref|XP_006365982.1|  PREDICTED: probable 2-oxoglutarate-dependent...    244   1e-73    
ref|XP_010110321.1|  Gibberellin 20 oxidase 1                           244   1e-73    
ref|XP_010500899.1|  PREDICTED: probable 2-oxoglutarate-dependent...    244   1e-73    
emb|CDP19784.1|  unnamed protein product                                244   1e-73    
ref|XP_003555065.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    244   2e-73    
ref|NP_175691.1|  putative 2-oxoglutarate-dependent dioxygenase         244   2e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004293154.1|  PREDICTED: gibberellin 3-beta-dioxygenase 4-...    244   2e-73    
ref|XP_006367751.1|  PREDICTED: probable 2-oxoglutarate-dependent...    243   3e-73    
ref|XP_004241718.1|  PREDICTED: probable 2-oxoglutarate-dependent...    243   4e-73    
ref|XP_010479801.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    243   5e-73    
ref|XP_008227260.1|  PREDICTED: probable 2-oxoglutarate-dependent...    242   8e-73    
ref|XP_010463426.1|  PREDICTED: probable 2-oxoglutarate-dependent...    242   9e-73    
emb|CDP21179.1|  unnamed protein product                                242   1e-72    
ref|XP_003625060.1|  Gibberellin 20 oxidase                             241   2e-72    
ref|XP_010481152.1|  PREDICTED: probable 2-oxoglutarate-dependent...    244   3e-72    
ref|XP_010535123.1|  PREDICTED: probable 2-oxoglutarate-dependent...    241   3e-72    
emb|CDY26054.1|  BnaC06g05700D                                          241   4e-72    
ref|XP_010479810.1|  PREDICTED: probable 2-oxoglutarate-dependent...    240   7e-72    
ref|XP_002298128.2|  hypothetical protein POPTR_0001s17630g             239   1e-71    Populus trichocarpa [western balsam poplar]
emb|CDP10138.1|  unnamed protein product                                239   1e-71    
ref|XP_008344774.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    239   1e-71    
ref|XP_006356185.1|  PREDICTED: probable 2-oxoglutarate-dependent...    239   2e-71    
ref|XP_010462135.1|  PREDICTED: probable 2-oxoglutarate-dependent...    237   7e-71    
ref|XP_006348005.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    237   7e-71    
ref|XP_004229768.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    236   1e-70    
ref|XP_008227259.1|  PREDICTED: probable inactive 2-oxoglutarate-...    236   1e-70    
gb|KHN14924.1|  Gibberellin 20 oxidase 3                                236   1e-70    
ref|XP_010500908.1|  PREDICTED: probable 2-oxoglutarate-dependent...    236   2e-70    
ref|XP_008227273.1|  PREDICTED: probable 2-oxoglutarate-dependent...    235   4e-70    
ref|XP_003554143.1|  PREDICTED: probable 2-oxoglutarate-dependent...    235   5e-70    
ref|XP_002515914.1|  Flavonol synthase/flavanone 3-hydroxylase, p...    234   7e-70    Ricinus communis
ref|XP_010110319.1|  Protein SRG1                                       234   7e-70    
ref|XP_003553391.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    234   8e-70    
gb|KHN06108.1|  Gibberellin 3-beta-dioxygenase 3                        233   3e-69    
ref|XP_009395077.1|  PREDICTED: probable 2-oxoglutarate-dependent...    233   3e-69    
ref|XP_010061958.1|  PREDICTED: probable 2-oxoglutarate-dependent...    233   4e-69    
ref|XP_007214111.1|  hypothetical protein PRUPE_ppa017120mg             232   4e-69    
ref|XP_010061956.1|  PREDICTED: probable 2-oxoglutarate-dependent...    232   5e-69    
ref|XP_003553825.1|  PREDICTED: probable 2-oxoglutarate-dependent...    231   1e-68    
ref|XP_007145555.1|  hypothetical protein PHAVU_007G248500g             231   1e-68    
ref|XP_002517543.1|  Flavonol synthase/flavanone 3-hydroxylase, p...    231   2e-68    Ricinus communis
ref|XP_010041295.1|  PREDICTED: probable 2-oxoglutarate-dependent...    231   2e-68    
ref|XP_009621185.1|  PREDICTED: probable 2-oxoglutarate-dependent...    231   3e-68    
ref|XP_010032029.1|  PREDICTED: probable 2-oxoglutarate-dependent...    230   3e-68    
ref|XP_008382989.1|  PREDICTED: probable inactive 2-oxoglutarate-...    230   4e-68    
ref|XP_004301787.1|  PREDICTED: gibberellin 3-beta-dioxygenase 4-...    231   4e-68    
ref|XP_008390710.1|  PREDICTED: probable inactive 2-oxoglutarate-...    230   5e-68    
ref|XP_010050517.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    229   6e-68    
emb|CDP21163.1|  unnamed protein product                                228   6e-68    
ref|XP_009354842.1|  PREDICTED: probable inactive 2-oxoglutarate-...    229   7e-68    
ref|XP_009344329.1|  PREDICTED: probable inactive 2-oxoglutarate-...    229   7e-68    
gb|EYU21580.1|  hypothetical protein MIMGU_mgv1a010552mg                229   1e-67    
gb|AFK44600.1|  unknown                                                 229   1e-67    
gb|KCW67512.1|  hypothetical protein EUGRSUZ_F01241                     228   1e-67    
ref|XP_007162138.1|  hypothetical protein PHAVU_001G127300g             229   1e-67    
ref|XP_007024016.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    229   2e-67    
ref|XP_008372275.1|  PREDICTED: probable inactive 2-oxoglutarate-...    228   2e-67    
ref|XP_010060704.1|  PREDICTED: probable inactive 2-oxoglutarate-...    228   2e-67    
ref|XP_004229769.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    228   3e-67    
ref|XP_002298124.1|  hypothetical protein POPTR_0001s17580g             228   3e-67    Populus trichocarpa [western balsam poplar]
ref|XP_007162139.1|  hypothetical protein PHAVU_001G127400g             227   4e-67    
emb|CDP21546.1|  unnamed protein product                                228   5e-67    
ref|XP_007145557.1|  hypothetical protein PHAVU_007G248700g             227   5e-67    
ref|XP_010061957.1|  PREDICTED: probable 2-oxoglutarate-dependent...    227   5e-67    
ref|XP_006339306.1|  PREDICTED: probable 2-oxoglutarate-dependent...    227   6e-67    
gb|EYU21579.1|  hypothetical protein MIMGU_mgv1a010719mg                226   8e-67    
gb|AFK38656.1|  unknown                                                 226   1e-66    
ref|XP_010050515.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    226   1e-66    
ref|XP_010249917.1|  PREDICTED: probable 2-oxoglutarate-dependent...    226   2e-66    
emb|CDP11139.1|  unnamed protein product                                225   3e-66    
gb|KFK30903.1|  hypothetical protein AALP_AA6G041100                    225   3e-66    
ref|XP_011045372.1|  PREDICTED: probable 2-oxoglutarate-dependent...    225   5e-66    
ref|XP_007024010.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    225   5e-66    
ref|XP_006348004.1|  PREDICTED: probable 2-oxoglutarate-dependent...    224   7e-66    
gb|KCW79744.1|  hypothetical protein EUGRSUZ_C01088                     224   8e-66    
ref|XP_002889297.1|  predicted protein                                  224   1e-65    
ref|XP_002517544.1|  Flavonol synthase/flavanone 3-hydroxylase, p...    223   2e-65    Ricinus communis
gb|KCW82320.1|  hypothetical protein EUGRSUZ_C03724                     223   2e-65    
gb|AAL14687.1|  2-oxoglutarate-dependent dioxygenase                    222   2e-65    Arabidopsis halleri
ref|XP_006289716.1|  hypothetical protein CARUB_v10003282mg             223   2e-65    
ref|XP_002515925.1|  Flavonol synthase/flavanone 3-hydroxylase, p...    223   3e-65    Ricinus communis
ref|XP_008794218.1|  PREDICTED: probable 2-oxoglutarate-dependent...    223   4e-65    
ref|XP_006389780.1|  hypothetical protein EUTSA_v10018872mg             222   5e-65    
ref|XP_004306704.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    222   5e-65    
ref|XP_007212875.1|  hypothetical protein PRUPE_ppa021625mg             222   5e-65    
gb|KDO58205.1|  hypothetical protein CISIN_1g045288mg                   219   6e-65    
ref|XP_008227261.1|  PREDICTED: probable inactive 2-oxoglutarate-...    222   6e-65    
ref|XP_006396533.1|  hypothetical protein EUTSA_v10028799mg             222   6e-65    
ref|XP_011072272.1|  PREDICTED: probable 2-oxoglutarate-dependent...    219   8e-65    
emb|CBI36205.3|  unnamed protein product                                220   9e-65    
emb|CDY22099.1|  BnaA09g01280D                                          221   1e-64    
ref|XP_008792974.1|  PREDICTED: probable 2-oxoglutarate-dependent...    222   1e-64    
ref|XP_010912205.1|  PREDICTED: LOW QUALITY PROTEIN: 2-oxoglutara...    221   1e-64    
ref|XP_006392867.1|  hypothetical protein EUTSA_v10011672mg             220   1e-64    
ref|NP_178148.1|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...    221   1e-64    Arabidopsis thaliana [mouse-ear cress]
gb|KFK30901.1|  hypothetical protein AALP_AA6G040900                    220   3e-64    
ref|XP_003521152.1|  PREDICTED: probable 2-oxoglutarate-dependent...    220   3e-64    
ref|XP_010467243.1|  PREDICTED: probable 2-oxoglutarate-dependent...    220   3e-64    
emb|CDP21180.1|  unnamed protein product                                220   4e-64    
ref|XP_006301978.1|  hypothetical protein CARUB_v10022458mg             220   4e-64    
ref|XP_010050512.1|  PREDICTED: probable 2-oxoglutarate-dependent...    223   4e-64    
gb|KHG02338.1|  Flavonol synthase/flavanone 3-hydroxylase -like p...    220   6e-64    
ref|XP_009372397.1|  PREDICTED: probable inactive 2-oxoglutarate-...    219   8e-64    
emb|CDY21938.1|  BnaC09g00440D                                          219   8e-64    
ref|XP_009339369.1|  PREDICTED: probable 2-oxoglutarate-dependent...    219   9e-64    
ref|XP_009340682.1|  PREDICTED: probable inactive 2-oxoglutarate-...    219   9e-64    
ref|XP_009785369.1|  PREDICTED: probable 2-oxoglutarate-dependent...    219   1e-63    
ref|XP_007145552.1|  hypothetical protein PHAVU_007G248200g             218   2e-63    
gb|KDP24586.1|  hypothetical protein JCGZ_25502                         219   3e-63    
ref|XP_007162137.1|  hypothetical protein PHAVU_001G127200g             217   4e-63    
ref|XP_010429979.1|  PREDICTED: probable 2-oxoglutarate-dependent...    217   5e-63    
gb|KCW79743.1|  hypothetical protein EUGRSUZ_C01086                     217   5e-63    
emb|CDY38659.1|  BnaC02g23200D                                          217   6e-63    
gb|KFK42423.1|  hypothetical protein AALP_AA2G254300                    217   6e-63    
gb|KHN14925.1|  Gibberellin 20 oxidase 1                                216   7e-63    
gb|KHG02339.1|  2'-deoxymugineic-acid 2'-dioxygenase                    216   9e-63    
gb|AAL14645.1|AF417857_1  AOP1                                          216   1e-62    
gb|KHG07058.1|  hypothetical protein F383_33647                         216   1e-62    
ref|XP_010915540.1|  PREDICTED: probable 2-oxoglutarate-dependent...    216   1e-62    
gb|KHN45675.1|  Gibberellin 20 oxidase 1                                214   1e-62    
ref|NP_192216.1|  oxidoreductase AOP1                                   216   2e-62    
ref|XP_003554144.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    215   2e-62    
ref|XP_004148019.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    216   2e-62    
sp|Q945B6.1|AOP1L_ARATH  RecName: Full=Probable 2-oxoglutarate-de...    215   2e-62    
ref|XP_009122188.1|  PREDICTED: probable 2-oxoglutarate-dependent...    215   3e-62    
ref|XP_008386393.1|  PREDICTED: probable inactive 2-oxoglutarate-...    214   3e-62    
gb|KDP37165.1|  hypothetical protein JCGZ_06221                         214   8e-62    
emb|CDY37587.1|  BnaA02g19830D                                          214   9e-62    
gb|KDP37167.1|  hypothetical protein JCGZ_06223                         214   9e-62    
ref|XP_010050518.1|  PREDICTED: probable 2-oxoglutarate-dependent...    213   9e-62    
gb|AAL14686.1|  2-oxoglutarate-dependent dioxygenase                    213   1e-61    
ref|XP_010112085.1|  Gibberellin 20 oxidase 1                           214   1e-61    
ref|XP_004288730.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    213   1e-61    
gb|AAL14683.1|  2-oxoglutarate-dependent dioxygenase                    213   2e-61    
gb|KFK30904.1|  hypothetical protein AALP_AA6G041200                    213   2e-61    
gb|AAL14701.1|  2-oxoglutarate-dependent dioxygenase                    212   2e-61    
ref|XP_008351637.1|  PREDICTED: probable inactive 2-oxoglutarate-...    213   2e-61    
ref|XP_008238357.1|  PREDICTED: probable inactive 2-oxoglutarate-...    212   2e-61    
ref|XP_010472950.1|  PREDICTED: probable 2-oxoglutarate-dependent...    213   2e-61    
gb|KDP40825.1|  hypothetical protein JCGZ_24824                         212   3e-61    
ref|XP_009128434.1|  PREDICTED: probable 2-oxoglutarate-dependent...    213   3e-61    
ref|NP_001140777.1|  hypothetical protein                               212   4e-61    
ref|XP_009134375.1|  PREDICTED: probable 2-oxoglutarate-dependent...    212   5e-61    
ref|XP_010532145.1|  PREDICTED: probable 2-oxoglutarate-dependent...    212   5e-61    
ref|XP_007211257.1|  hypothetical protein PRUPE_ppa021247mg             211   5e-61    
ref|XP_010026428.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    211   5e-61    
sp|Q944Z5.1|AOP1V_ARATH  RecName: Full=Probable 2-oxoglutarate-de...    211   5e-61    
ref|XP_004233541.1|  PREDICTED: probable 2-oxoglutarate-dependent...    212   6e-61    
ref|XP_009340689.1|  PREDICTED: probable inactive 2-oxoglutarate-...    211   7e-61    
ref|XP_010472949.1|  PREDICTED: probable 2-oxoglutarate-dependent...    211   8e-61    
ref|XP_008650052.1|  PREDICTED: probable 2-oxoglutarate-dependent...    212   9e-61    
ref|XP_010479807.1|  PREDICTED: probable 2-oxoglutarate-dependent...    211   1e-60    
gb|AAL14699.1|  2-oxoglutarate-dependent dioxygenase                    210   1e-60    
ref|XP_009382147.1|  PREDICTED: probable 2-oxoglutarate-dependent...    213   1e-60    
ref|XP_009393623.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    211   2e-60    
ref|XP_007224636.1|  hypothetical protein PRUPE_ppa026475mg             210   2e-60    
ref|XP_010455020.1|  PREDICTED: probable 2-oxoglutarate-dependent...    209   2e-60    
ref|XP_004233542.1|  PREDICTED: probable 2-oxoglutarate-dependent...    209   3e-60    
ref|XP_002441559.1|  hypothetical protein SORBIDRAFT_09g029340          209   3e-60    
emb|CDY21937.1|  BnaC09g00430D                                          210   4e-60    
ref|XP_009340685.1|  PREDICTED: probable inactive 2-oxoglutarate-...    209   6e-60    
ref|XP_009122199.1|  PREDICTED: probable 2-oxoglutarate-dependent...    209   8e-60    
gb|KCW82770.1|  hypothetical protein EUGRSUZ_C04146                     208   1e-59    
emb|CDY17965.1|  BnaC03g30370D                                          208   1e-59    
ref|XP_009785373.1|  PREDICTED: probable 2-oxoglutarate-dependent...    207   1e-59    
ref|XP_006598543.1|  PREDICTED: probable 2-oxoglutarate-dependent...    206   1e-59    
ref|XP_010500902.1|  PREDICTED: probable 2-oxoglutarate-dependent...    208   1e-59    
emb|CDY17969.1|  BnaC03g30410D                                          208   2e-59    
emb|CDY22098.1|  BnaA09g01270D                                          207   2e-59    
gb|KHG05318.1|  2'-deoxymugineic-acid 2'-dioxygenase                    207   2e-59    
ref|XP_009372418.1|  PREDICTED: probable inactive 2-oxoglutarate-...    207   3e-59    
ref|XP_006304019.1|  hypothetical protein CARUB_v10009745mg             207   3e-59    
gb|AAL14698.1|  2-oxoglutarate-dependent dioxygenase                    206   4e-59    
gb|KDP32297.1|  hypothetical protein JCGZ_13222                         206   6e-59    
ref|XP_008219866.1|  PREDICTED: probable 2-oxoglutarate-dependent...    206   6e-59    
ref|XP_004233539.1|  PREDICTED: probable 2-oxoglutarate-dependent...    206   9e-59    
ref|XP_009621187.1|  PREDICTED: probable 2-oxoglutarate-dependent...    204   1e-58    
ref|XP_009373458.1|  PREDICTED: probable 2-oxoglutarate-dependent...    205   1e-58    
ref|XP_002284931.1|  PREDICTED: probable 2-oxoglutarate-dependent...    206   1e-58    
ref|XP_004228723.2|  PREDICTED: probable 2-oxoglutarate-dependent...    205   1e-58    
ref|XP_010049940.1|  PREDICTED: probable 2-oxoglutarate-dependent...    205   1e-58    
ref|XP_006354215.1|  PREDICTED: probable 2-oxoglutarate-dependent...    205   2e-58    
ref|XP_004982220.1|  PREDICTED: gibberellin 2-beta-dioxygenase 6-...    205   2e-58    
ref|XP_008356477.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    204   4e-58    
gb|KDP40826.1|  hypothetical protein JCGZ_24825                         204   5e-58    
ref|XP_008373690.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    203   6e-58    
ref|XP_007224725.1|  hypothetical protein PRUPE_ppa024900mg             203   9e-58    
emb|CDP11141.1|  unnamed protein product                                203   1e-57    
ref|XP_010532147.1|  PREDICTED: probable 2-oxoglutarate-dependent...    203   1e-57    
ref|XP_002890109.1|  predicted protein                                  202   1e-57    
ref|XP_006655618.1|  PREDICTED: probable 2-oxoglutarate-dependent...    202   2e-57    
gb|KHG17593.1|  2'-deoxymugineic-acid 2'-dioxygenase                    202   2e-57    
ref|XP_002515596.1|  Gibberellin 3-beta-dioxygenase, putative           202   3e-57    
ref|XP_006406954.1|  hypothetical protein EUTSA_v10021145mg             201   9e-57    
gb|KCW69003.1|  hypothetical protein EUGRSUZ_F02563                     198   2e-56    
ref|XP_004963576.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    202   2e-56    
ref|XP_008373535.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    199   2e-56    
gb|KHF99371.1|  hypothetical protein F383_19520                         200   2e-56    
gb|KDP40827.1|  hypothetical protein JCGZ_24826                         199   3e-56    
ref|XP_008346484.1|  PREDICTED: probable 2-oxoglutarate-dependent...    198   3e-56    
ref|XP_008447674.1|  PREDICTED: probable 2-oxoglutarate-dependent...    201   3e-56    
emb|CDP11140.1|  unnamed protein product                                198   5e-56    
ref|XP_006416895.1|  hypothetical protein EUTSA_v10008198mg             199   6e-56    
ref|XP_002517545.1|  Leucoanthocyanidin dioxygenase, putative           198   7e-56    
ref|XP_006853001.1|  hypothetical protein AMTR_s00174p00019750          198   8e-56    
ref|XP_009115437.1|  PREDICTED: probable 2-oxoglutarate-dependent...    198   8e-56    
gb|KHF99372.1|  hypothetical protein F383_19520                         197   1e-55    
ref|XP_009373457.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    197   2e-55    
ref|XP_009147659.1|  PREDICTED: probable 2-oxoglutarate-dependent...    197   2e-55    
emb|CDY20136.1|  BnaA01g28660D                                          197   2e-55    
ref|XP_009342594.1|  PREDICTED: probable 2-oxoglutarate-dependent...    197   2e-55    
ref|XP_002309592.1|  hypothetical protein POPTR_0006s26410g             196   3e-55    
ref|XP_006854891.1|  hypothetical protein AMTR_s00052p00016200          196   3e-55    
ref|XP_007213118.1|  hypothetical protein PRUPE_ppa023886mg             195   4e-55    
ref|XP_006476205.1|  PREDICTED: probable 2-oxoglutarate-dependent...    196   4e-55    
ref|XP_008356475.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    196   4e-55    
ref|XP_006450545.1|  hypothetical protein CICLE_v10010426mg             196   5e-55    
gb|AAL14685.1|  2-oxoglutarate-dependent dioxygenase                    194   7e-55    
gb|AAL14702.1|  2-oxoglutarate-dependent dioxygenase                    194   8e-55    
gb|KHG05367.1|  Flavonol synthase/flavanone 3-hydroxylase -like p...    195   9e-55    
emb|CDY71515.1|  BnaCnng73240D                                          195   1e-54    
gb|AAL14696.1|  2-oxoglutarate-dependent dioxygenase                    194   1e-54    
ref|XP_009771249.1|  PREDICTED: probable 2-oxoglutarate-dependent...    193   1e-54    
gb|KFK30902.1|  hypothetical protein AALP_AA6G041000                    195   1e-54    
ref|XP_006392866.1|  hypothetical protein EUTSA_v10011658mg             195   1e-54    
ref|XP_009116922.1|  PREDICTED: probable 2-oxoglutarate-dependent...    195   1e-54    
gb|KHG23333.1|  hypothetical protein F383_30224                         195   2e-54    
ref|XP_010913592.1|  PREDICTED: probable inactive 2-oxoglutarate-...    195   2e-54    
gb|EAY99141.1|  hypothetical protein OsI_21100                          194   2e-54    
ref|XP_011019740.1|  PREDICTED: probable 2-oxoglutarate-dependent...    196   2e-54    
emb|CDY39112.1|  BnaA01g29440D                                          194   2e-54    
ref|XP_009372949.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    194   3e-54    
gb|AAL14692.1|  2-oxoglutarate-dependent dioxygenase                    192   3e-54    
ref|XP_009349432.1|  PREDICTED: probable inactive 2-oxoglutarate-...    193   3e-54    
emb|CDX97295.1|  BnaA02g20860D                                          193   4e-54    
gb|EYU21589.1|  hypothetical protein MIMGU_mgv1a024911mg                191   4e-54    
gb|AAL14700.1|  2-oxoglutarate-dependent dioxygenase                    192   6e-54    
ref|XP_008366657.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    193   7e-54    
ref|XP_002324836.1|  hypothetical protein POPTR_0018s01190g             193   7e-54    
gb|AAL14684.1|  2-oxoglutarate-dependent dioxygenase                    191   8e-54    
ref|XP_009371876.1|  PREDICTED: probable inactive 2-oxoglutarate-...    192   2e-53    
emb|CDP12471.1|  unnamed protein product                                189   2e-53    
ref|XP_004291498.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    192   2e-53    
gb|KGN64234.1|  hypothetical protein Csa_1G044830                       189   2e-53    
ref|XP_011026516.1|  PREDICTED: probable 2-oxoglutarate-dependent...    192   2e-53    
ref|XP_007210837.1|  hypothetical protein PRUPE_ppa016751mg             191   2e-53    
gb|AAL14681.1|  2-oxoglutarate-dependent dioxygenase                    190   2e-53    
ref|XP_010110316.1|  Gibberellin 20 oxidase 1                           194   2e-53    
gb|KHG05299.1|  Gibberellin 2-beta-dioxygenase 8 -like protein          191   3e-53    
emb|CDY20137.1|  BnaA01g28650D                                          191   3e-53    
ref|XP_010654922.1|  PREDICTED: probable inactive 2-oxoglutarate-...    189   3e-53    
ref|XP_004228709.1|  PREDICTED: probable inactive 2-oxoglutarate-...    191   3e-53    
ref|XP_004253465.1|  PREDICTED: probable 2-oxoglutarate-dependent...    191   4e-53    
ref|XP_004292967.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    191   4e-53    
gb|AAL14680.1|  2-oxoglutarate-dependent dioxygenase                    189   4e-53    
ref|XP_009107019.1|  PREDICTED: probable 2-oxoglutarate-dependent...    191   4e-53    
gb|KFK35765.1|  hypothetical protein AALP_AA4G033400                    196   4e-53    
emb|CDX91263.1|  BnaC02g26740D                                          190   5e-53    
emb|CDY39662.1|  BnaC05g11910D                                          192   5e-53    
ref|XP_004287966.1|  PREDICTED: gibberellin 3-beta-dioxygenase 4-...    189   6e-53    
gb|AAL14695.1|  2-oxoglutarate-dependent dioxygenase                    189   6e-53    
ref|XP_009115427.1|  PREDICTED: probable 2-oxoglutarate-dependent...    190   7e-53    
gb|AAL14691.1|  2-oxoglutarate-dependent dioxygenase                    189   9e-53    
gb|EYU41035.1|  hypothetical protein MIMGU_mgv1a013300mg                187   1e-52    
gb|KCW69007.1|  hypothetical protein EUGRSUZ_F02567                     187   1e-52    
gb|AAL14678.1|  2-oxoglutarate-dependent dioxygenase                    188   1e-52    
ref|XP_006406953.1|  hypothetical protein EUTSA_v10021144mg             189   2e-52    
gb|AAL14689.1|  2-oxoglutarate-dependent dioxygenase                    187   2e-52    
ref|XP_008346506.1|  PREDICTED: probable inactive 2-oxoglutarate-...    188   3e-52    
ref|XP_010497232.1|  PREDICTED: probable 2-oxoglutarate-dependent...    189   3e-52    
ref|XP_006303647.1|  hypothetical protein CARUB_v10011635mg             189   3e-52    
ref|NP_174124.1|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...    189   3e-52    
ref|XP_009148950.1|  PREDICTED: probable 2-oxoglutarate-dependent...    189   3e-52    
ref|XP_008394038.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    189   4e-52    
gb|AAL14677.1|  2-oxoglutarate-dependent dioxygenase                    187   4e-52    
ref|XP_008229693.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    188   5e-52    
ref|XP_010476645.1|  PREDICTED: probable 2-oxoglutarate-dependent...    188   5e-52    
ref|XP_009377501.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    188   5e-52    
ref|XP_010476643.1|  PREDICTED: probable 2-oxoglutarate-dependent...    188   6e-52    
gb|KGN52785.1|  hypothetical protein Csa_4G001530                       185   6e-52    
ref|XP_008243039.1|  PREDICTED: probable inactive 2-oxoglutarate-...    187   7e-52    
ref|XP_007162140.1|  hypothetical protein PHAVU_001G127500g             187   7e-52    
ref|XP_006354213.1|  PREDICTED: probable 2-oxoglutarate-dependent...    188   7e-52    
gb|KFK38900.1|  hypothetical protein AALP_AA3G175500                    187   9e-52    
gb|AAL14688.1|  2-oxoglutarate-dependent dioxygenase                    186   9e-52    
gb|KEH28751.1|  2-oxoglutarate-dependent dioxygenase                    186   1e-51    
ref|XP_008373756.1|  PREDICTED: probable inactive 2-oxoglutarate-...    187   1e-51    
ref|XP_002298125.1|  hypothetical protein POPTR_0001s17610g             186   1e-51    
emb|CDY36571.1|  BnaA06g10240D                                          187   1e-51    
ref|XP_010026663.1|  PREDICTED: probable 2-oxoglutarate-dependent...    185   1e-51    
ref|XP_007161252.1|  hypothetical protein PHAVU_001G054800g             187   1e-51    
gb|KHG27363.1|  hypothetical protein F383_12181                         186   2e-51    
ref|XP_010459094.1|  PREDICTED: probable 2-oxoglutarate-dependent...    186   2e-51    
ref|XP_008348454.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    186   2e-51    
ref|XP_010459095.1|  PREDICTED: probable 2-oxoglutarate-dependent...    186   2e-51    
ref|XP_004291427.1|  PREDICTED: gibberellin 20 oxidase 1-B-like i...    186   3e-51    
gb|KDP32296.1|  hypothetical protein JCGZ_13221                         186   4e-51    
gb|KHG29411.1|  2'-deoxymugineic-acid 2'-dioxygenase                    186   4e-51    
gb|KHG23522.1|  hypothetical protein F383_29495                         185   6e-51    
ref|XP_009147662.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    183   6e-51    
ref|NP_173007.1|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...    185   7e-51    
gb|KHG18604.1|  hypothetical protein F383_26382                         184   1e-50    
ref|NP_175690.1|  2-oxoglutarate-dependent dioxygenase-related pr...    183   2e-50    
ref|XP_010460572.1|  PREDICTED: probable 2-oxoglutarate-dependent...    183   4e-50    
ref|XP_010478155.1|  PREDICTED: probable 2-oxoglutarate-dependent...    183   4e-50    
gb|KHG04599.1|  hypothetical protein F383_29178                         183   5e-50    
ref|XP_010499297.1|  PREDICTED: probable 2-oxoglutarate-dependent...    182   6e-50    
ref|XP_007203886.1|  hypothetical protein PRUPE_ppa008799mg             182   6e-50    
ref|XP_009341226.1|  PREDICTED: probable inactive 2-oxoglutarate-...    181   1e-49    
gb|KHG06206.1|  Gibberellin 2-beta-dioxygenase 8 -like protein          182   1e-49    
gb|KHG14763.1|  hypothetical protein F383_19492                         181   1e-49    
ref|XP_009355431.1|  PREDICTED: probable 2-oxoglutarate-dependent...    181   1e-49    
gb|KHG16680.1|  hypothetical protein F383_22967                         181   2e-49    
ref|XP_006304540.1|  hypothetical protein CARUB_v10011508mg             181   3e-49    
emb|CDP19782.1|  unnamed protein product                                177   3e-49    
ref|XP_004501289.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    180   3e-49    



>ref|XP_009608401.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Nicotiana 
tomentosiformis]
Length=313

 Score =   462 bits (1188),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 211/314 (67%), Positives = 256/314 (82%), Gaps = 1/314 (0%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             MA+   PKLPIIEFTD+N+  GT+ W +TS E+RR LEEYGCFAAVY KVS ELR+AMF 
Sbjct  1     MASQVEPKLPIIEFTDENLSSGTSCWISTSQEIRRALEEYGCFAAVYKKVSPELREAMFN  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
             HCK LFQLPLE K +NTSD+ GFGY GNF +MPLAEYFGI++G T  ST NF+KQMWP+A
Sbjct  61    HCKELFQLPLEVKLQNTSDVLGFGYGGNFPNMPLAEYFGIENGGTLNSTNNFAKQMWPNA  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
              N   FCE+T SYSKL+ +LD  V+RM+LESY L+KY++P+  S  YL+RFIKYR PK N
Sbjct  121   -NVDKFCEETLSYSKLIAELDDAVIRMMLESYSLEKYYEPVKNSCMYLMRFIKYRSPKMN  179

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             E   GH+PHRD SFM I+DTNQ+G LEM+TRDG WI F PSS KT+VFIAGE F AWSN 
Sbjct  180   EINIGHLPHRDKSFMGIIDTNQVGGLEMQTRDGNWITFNPSSYKTVVFIAGEPFTAWSNG  239

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANG  254
             R+YAP+HRV+MKGSEDKY++ALFSF+RGTV+IPEEL+D++NP  FK FDHFE+L +CA  
Sbjct  240   RVYAPIHRVIMKGSEDKYSLALFSFMRGTVKIPEELIDEENPQHFKSFDHFEYLKYCATD  299

Query  253   GGKEESPINAFCGV  212
             G KE++PI ++CGV
Sbjct  300   GWKEKNPIKSYCGV  313



>ref|XP_009802367.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Nicotiana 
sylvestris]
Length=313

 Score =   458 bits (1178),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 210/314 (67%), Positives = 256/314 (82%), Gaps = 1/314 (0%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             MA+   PKLPIIEFTD+N+  GTTSW +TS E+RR LEEYGCFAAVY KVS ELR+AMF 
Sbjct  1     MASQVEPKLPIIEFTDENLSSGTTSWISTSQEIRRALEEYGCFAAVYKKVSPELREAMFN  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
             HCK LFQLPLE K +NTSD+ GFGY GNF +MPLAEYFGI++G T  ST NF+KQMWP+ 
Sbjct  61    HCKELFQLPLEAKLQNTSDVLGFGYGGNFPNMPLAEYFGIENGGTLGSTKNFAKQMWPNG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
              N   FCE+T SYSKL+ +LD  V++M+L SYGL+KY+DPL  S  YL+RFIKYR PK +
Sbjct  121   -NVDKFCEETISYSKLIVELDDAVIQMILGSYGLEKYYDPLKNSYMYLMRFIKYRSPKID  179

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             E   GH+PHRD SFM I+DTNQ+G LEM+TRDG W+ F PSS KT+VFIAGE F AWSN 
Sbjct  180   EINIGHLPHRDKSFMGIIDTNQVGGLEMQTRDGNWMTFNPSSYKTVVFIAGEPFTAWSNG  239

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANG  254
             R+YAP+HRV+MKG++DKY++ALFSF+RGTV+IPEEL+D++NP  FK FDHFE+L +CA  
Sbjct  240   RVYAPMHRVIMKGTDDKYSLALFSFMRGTVKIPEELIDEENPQYFKSFDHFEYLKYCATD  299

Query  253   GGKEESPINAFCGV  212
             G KE++PI A+CGV
Sbjct  300   GWKEKNPIKAYCGV  313



>ref|XP_006346585.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Solanum 
tuberosum]
Length=315

 Score =   437 bits (1123),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 196/315 (62%), Positives = 249/315 (79%), Gaps = 1/315 (0%)
 Frame = -2

Query  1156  TMATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMF  977
             TMA    PKLPIIEFTD+ +R GTTSW +TS E+R  LEEYGCF AVY KV  ELR+AMF
Sbjct  2     TMAFQVEPKLPIIEFTDETLRGGTTSWLSTSREIRCALEEYGCFGAVYKKVMPELREAMF  61

Query  976   KHCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPD  797
              HCK LF+LPLETK +N SDI GFGY GNF +MPLAE+FGI DG T ++T +F+ +MWP+
Sbjct  62    DHCKELFKLPLETKLKNNSDILGFGYGGNFGTMPLAEFFGIVDGETIDATKDFANKMWPN  121

Query  796   ADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKW  617
              DN   +CE++ SYSKL+ +LD  ++RM LESYG++K+++ L  S  YL+R IKYR PK 
Sbjct  122   -DNVRKYCEESISYSKLIAELDDTIIRMTLESYGIEKHYEALKHSCMYLMRLIKYRSPKN  180

Query  616   NETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSN  437
             NE   GH+PHRD SFM I+DTNQ+G LEM+TRDGKWI F PSS KT+V IAGE F AWSN
Sbjct  181   NEKSIGHLPHRDKSFMGIIDTNQVGRLEMQTRDGKWITFHPSSYKTLVIIAGEPFTAWSN  240

Query  436   RRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCAN  257
              R+YAP+HRV+MKG EDKY++ALFSF+RGT+E+PEEL+D++NP +FK F++F++L +C  
Sbjct  241   GRVYAPIHRVIMKGVEDKYSLALFSFMRGTIEVPEELIDEENPKQFKSFNNFQYLKYCGT  300

Query  256   GGGKEESPINAFCGV  212
              G KE+ P+ A+CGV
Sbjct  301   HGSKEKDPLKAYCGV  315



>ref|XP_004252327.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3 [Solanum 
lycopersicum]
Length=313

 Score =   430 bits (1106),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 192/314 (61%), Positives = 251/314 (80%), Gaps = 1/314 (0%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             MA    PKLPIIEFT++ +R GTTSW +TS E+R  LEEYGCFAAVY KV  ELR+AMF 
Sbjct  1     MAFQVEPKLPIIEFTNETLRSGTTSWLSTSREIRCALEEYGCFAAVYKKVMPELREAMFD  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
             HCK LF+LPLETK +N SDIYGFGY+G F++MPLAE+FGI +G T ++T +F+ +MWP+ 
Sbjct  61    HCKELFKLPLETKLKNNSDIYGFGYSGKFSTMPLAEFFGIVNGETIDATKDFANKMWPN-  119

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             DN   +CE++ SYSKL+ +LD  ++RM+LE YG++K+++ L  S  YL+R IKYR PK +
Sbjct  120   DNVHKYCEESISYSKLIVELDDTIIRMILECYGIEKHYEALKNSCMYLMRLIKYRSPKND  179

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             E   GH+PHRD SFM I+DTNQ+G LEM+TRDG+WI F PSS KT+V IAGE F AWSN 
Sbjct  180   EKSIGHLPHRDKSFMGIIDTNQVGGLEMQTRDGRWITFHPSSYKTLVIIAGEPFTAWSNG  239

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANG  254
             R+YAP+HRV+MKG EDKY++ALFSF+RGT+E+PEEL+D++NP +FK F++F++L +C   
Sbjct  240   RVYAPIHRVIMKGDEDKYSLALFSFMRGTLEVPEELIDEENPKQFKSFNNFQYLKYCGTH  299

Query  253   GGKEESPINAFCGV  212
             G KE+ P+ AFCGV
Sbjct  300   GYKEKDPLKAFCGV  313



>emb|CDO98088.1| unnamed protein product [Coffea canephora]
Length=315

 Score =   354 bits (909),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 169/308 (55%), Positives = 223/308 (72%), Gaps = 3/308 (1%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQ  953
             KLPIIEF ++N+  GTTSW +TS  VR+ LE  GCF   Y K+S EL D MF+  K LFQ
Sbjct  10    KLPIIEFNEENLTPGTTSWLSTSDLVRQALESCGCFLVKYKKLSQELHDKMFELSKQLFQ  69

Query  952   LPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFC  773
             LP E K +NTS+I GFGY  NF+ MPL EYFGI++G T ++T  F+  MWP  +++  FC
Sbjct  70    LPTEIKVQNTSNILGFGYGTNFSFMPLVEYFGIENGATLKATEEFTNLMWPAGNSS--FC  127

Query  772   EDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHI  593
             E   SYSKL+ +LD  VMRMV  SYG++KY DPLI+SS YL+RF+KYR PK +E   G  
Sbjct  128   ETAFSYSKLLSELDHGVMRMVFGSYGVEKYLDPLIKSSFYLMRFLKYRAPKTDEINIGLH  187

Query  592   PHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSS-KTIVFIAGEAFMAWSNRRIYAPV  416
             PH D  F+AI+DTNQ+  LE++ + G+WI ++PS+S  T + IAGE F AWSN R++AP+
Sbjct  188   PHVDKGFLAILDTNQVTGLEIQLKHGEWITYEPSTSPSTFLVIAGEPFQAWSNGRVHAPL  247

Query  415   HRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANGGGKEES  236
             H+V+++G+E+KYT+ LFSF+R  V+IPEEL+D+ NPL+FK F+H +FL F   G    E 
Sbjct  248   HKVVIRGTEEKYTIGLFSFMREKVKIPEELIDEKNPLQFKDFNHLDFLEFLRGGKYTMER  307

Query  235   PINAFCGV  212
             PI AFCGV
Sbjct  308   PIVAFCGV  315



>emb|CDO98087.1| unnamed protein product [Coffea canephora]
Length=314

 Score =   325 bits (833),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 151/306 (49%), Positives = 217/306 (71%), Gaps = 5/306 (2%)
 Frame = -2

Query  1129  LPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQL  950
             LPII F  +N+  G++SW +TS  VR+ LE YGCF AVY  +S EL D M    K LF +
Sbjct  12    LPIIHFNSENLTPGSSSWLSTSEIVRKALESYGCFVAVYKNISPELHDKMLNLSKELFDV  71

Query  949   PLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFCE  770
             P+E K +NTSD  GFGY GN++ MPL EY GI +  T E+T +F+  +WPD +++  FCE
Sbjct  72    PVEIKVQNTSDYLGFGYGGNYSVMPLIEYLGITNAATLEATKDFTNLIWPDGNDS--FCE  129

Query  769   DTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHIP  590
                SY+K + +L  ++M+MVLE+YG++K+++ L++S+ +L+RFIKYR PK NE  TG  P
Sbjct  130   TAFSYAKQLLELKNLMMQMVLENYGVEKHYELLVRSAFHLMRFIKYRTPKTNEINTGLRP  189

Query  589   HRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPVHR  410
             H D +F++++  N +  L++ET+DG+WI+F P+ S  +V IAGE F AWSN ++YAP+HR
Sbjct  190   HVDKTFLSVLAGNHVKGLQIETKDGEWIDFAPTPSAFLV-IAGEGFTAWSNGKVYAPLHR  248

Query  409   VMMKGSEDKYTVALFSFLRGTVEIPEELVDDD-NPLKFKPFDHFEFLTFCANGGGKEESP  233
             V++ G+E+KYT+ LFSF+ GT++IP EL DDD NPL+FKPF++  FL +C+ G       
Sbjct  249   VIIGGAEEKYTIGLFSFMHGTLQIPVELADDDQNPLQFKPFNNVAFLDYCS-GDNITARA  307

Query  232   INAFCG  215
             I  FCG
Sbjct  308   IKDFCG  313



>gb|EYU21581.1| hypothetical protein MIMGU_mgv1a010326mg [Erythranthe guttata]
Length=316

 Score =   319 bits (818),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 150/310 (48%), Positives = 212/310 (68%), Gaps = 6/310 (2%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDK-VSWELRDAMFKH--CKH  962
             KLP IEF  +NM  GT  W++TS  VR+ LE YGCF   Y+  +  EL   +F     + 
Sbjct  10    KLPTIEFNQENMTPGTNPWKSTSDLVRQALEMYGCFVVSYESNIGSELHAKIFDGGLSEE  69

Query  961   LFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTP  782
             LF LPLETK+++ S   GFGY GN++ MPL EYFGI+D  T ++   F+  MW    +  
Sbjct  70    LFGLPLETKKKHISKFAGFGYGGNYSVMPLFEYFGIEDVATLDAAQKFTTLMWSQGHD--  127

Query  781   NFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKT  602
              FCE   SY KL+ +L++ V++MV +SYGL+KY+DPL++SS Y+ R ++Y  P  N+   
Sbjct  128   KFCETIYSYCKLLSELNKTVVKMVADSYGLEKYYDPLMESSFYMTRLMRYNSPGENQCSI  187

Query  601   GHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYA  422
             G +PHRD SF+ ++ TN++  LE+ETR G WI+++PS  K IV IAGE FMAWSN RIY+
Sbjct  188   GIVPHRDKSFITVIGTNEVKGLEIETRGGDWIDYEPSLGKFIV-IAGEPFMAWSNGRIYS  246

Query  421   PVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANGGGKE  242
             P+H+V+ KGS++K++V +FSF+ G +++P+ELVD +NPLKFK F H EF+ +C  GG K 
Sbjct  247   PLHKVVAKGSKEKHSVGVFSFIGGVLQVPDELVDHNNPLKFKSFRHLEFVEYCKEGGAKM  306

Query  241   ESPINAFCGV  212
             E  I  +CG+
Sbjct  307   EGAIQKYCGI  316



>ref|XP_002284983.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Vitis vinifera]
Length=313

 Score =   316 bits (810),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 151/315 (48%), Positives = 207/315 (66%), Gaps = 3/315 (1%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T+PKLPII+F+++N++ G+ SW +  ++VR  LEEYGCF A Y++V  EL + +F 
Sbjct  1     MGSETHPKLPIIDFSEENLKPGSDSWFSVCHDVRHALEEYGCFMAYYNQVPLELHNKIFN  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
                 LF LP E K +NTSD    GY G   + PL E  GI      E   +F+K MWP  
Sbjct  61    ALGELFDLPTEIKVKNTSDKPSHGYIGQIPAYPLHESMGIDHATNLEEIQSFAKLMWPAG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +   +FCE   SY+ L+ +L+QVVMRMVL+SYG++KYFD  I S+ YLLR +K R+PK N
Sbjct  121   NE--HFCEVVHSYTSLLAELEQVVMRMVLQSYGIEKYFDSHIASTRYLLRCLKNRVPKMN  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             E       H D SFM I+  N +  LE++T+DGK I F P S    + IAG+AFMAWSN 
Sbjct  179   ENDIAFPTHSDKSFMTILQQNHVSGLEVDTKDGKSIGFGPPSPSVFIVIAGDAFMAWSNG  238

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLT-FCAN  257
             RI+ P HRV+M+ +E++Y++ALF+F  G +++PEELVDD +PL+FKPFDH  F+  F   
Sbjct  239   RIHPPKHRVIMRANEERYSLALFAFKNGMIKVPEELVDDKHPLQFKPFDHVGFIRFFHTE  298

Query  256   GGGKEESPINAFCGV  212
              G K  S I A+CG+
Sbjct  299   EGRKSNSAIKAYCGI  313



>emb|CBI36206.3| unnamed protein product [Vitis vinifera]
Length=461

 Score =   318 bits (816),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/317 (48%), Positives = 208/317 (66%), Gaps = 3/317 (1%)
 Frame = -2

Query  1159  KTMATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAM  980
             K M + T+PKLPII+F+++N++ G+ SW +  ++VR  LEEYGCF A Y++V  EL + +
Sbjct  147   KIMGSETHPKLPIIDFSEENLKPGSDSWFSVCHDVRHALEEYGCFMAYYNQVPLELHNKI  206

Query  979   FKHCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWP  800
             F     LF LP E K +NTSD    GY G   + PL E  GI      E   +F+K MWP
Sbjct  207   FNALGELFDLPTEIKVKNTSDKPSHGYIGQIPAYPLHESMGIDHATNLEEIQSFAKLMWP  266

Query  799   DADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPK  620
               +   +FCE   SY+ L+ +L+QVVMRMVL+SYG++KYFD  I S+ YLLR +K R+PK
Sbjct  267   AGNE--HFCEVVHSYTSLLAELEQVVMRMVLQSYGIEKYFDSHIASTRYLLRCLKNRVPK  324

Query  619   WNETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWS  440
              NE       H D SFM I+  N +  LE++T+DGK I F P S    + IAG+AFMAWS
Sbjct  325   MNENDIAFPTHSDKSFMTILQQNHVSGLEVDTKDGKSIGFGPPSPSVFIVIAGDAFMAWS  384

Query  439   NRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLT-FC  263
             N RI+ P HRV+M+ +E++Y++ALF+F  G +++PEELVDD +PL+FKPFDH  F+  F 
Sbjct  385   NGRIHPPKHRVIMRANEERYSLALFAFKNGMIKVPEELVDDKHPLQFKPFDHVGFIRFFH  444

Query  262   ANGGGKEESPINAFCGV  212
                G K  S I A+CG+
Sbjct  445   TEEGRKSNSAIKAYCGI  461


 Score =   103 bits (257),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = -2

Query  757  YSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHIPHRDN  578
            YSKL+ +L+Q+VMRMVLESYG++  F   I S+++L+RF+KYR+PK NET     PH D 
Sbjct  54   YSKLLSELEQIVMRMVLESYGIENDFH--IGSATFLIRFLKYRVPKMNETSISVPPHTDK  111

Query  577  SFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAG  461
            SF++I+  NQ+  LE+ET+DGKWI+ Q +  +    I G
Sbjct  112  SFISILHQNQVNGLEIETKDGKWISHQIAHQELKTKIMG  150



>ref|XP_002284974.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Vitis vinifera]
 emb|CBI36203.3| unnamed protein product [Vitis vinifera]
Length=311

 Score =   308 bits (789),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/309 (48%), Positives = 209/309 (68%), Gaps = 4/309 (1%)
 Frame = -2

Query  1135  PKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLF  956
             P+LP++ F+   ++ GT SW     +V   LEEYGCF AVYDKVS EL +  F   + LF
Sbjct  6     PRLPVLNFSTGTLKPGTRSWLLACKDVLHALEEYGCFVAVYDKVSSELDNTTFCQLEELF  65

Query  955   QLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNF  776
              LP ETK +NTSD   FGY G    +PL E  GI+D  T +   +F+  MWP  ++  +F
Sbjct  66    DLPTETKVKNTSDKPYFGYIGQHPLIPLHESMGIEDATTLKGVESFTNIMWPAGND--HF  123

Query  775   CEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGH  596
             CE   SYSKLV +L+Q+V +MV ESY  +KY+D  IQS++YLLR IKYR P+ NET  G 
Sbjct  124   CETVLSYSKLVSELEQMVKKMVFESYDAEKYYDSHIQSTTYLLRLIKYRGPQKNETCIGT  183

Query  595   IPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPV  416
               H D SF+ ++  N++  LE+ T+DG+WI+F+PS S  +V +AG+A +AWSN RI++P 
Sbjct  184   SCHTDKSFITVLHQNEVCGLEIRTKDGEWISFKPSPSSYVV-MAGDALLAWSNGRIHSPE  242

Query  415   HRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFC-ANGGGKEE  239
             HRV+M G++ +Y++ LF++ RG +EIPEEL D+++PL+FKPF+H+  L F   N  G+ E
Sbjct  243   HRVIMNGNKARYSIGLFAYHRGIIEIPEELADEEHPLQFKPFNHYGLLHFYFTNKAGQAE  302

Query  238   SPINAFCGV  212
             S   A+CGV
Sbjct  303   STAKAYCGV  311



>ref|XP_010110313.1| Gibberellin 3-beta-dioxygenase 4 [Morus notabilis]
 gb|EXC25833.1| Gibberellin 3-beta-dioxygenase 4 [Morus notabilis]
Length=312

 Score =   308 bits (789),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/315 (47%), Positives = 214/315 (68%), Gaps = 4/315 (1%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M   + PK+P I+F++ N+  GT+SW +   +VRR LEEYGCF A+YDK+S +LR +MF 
Sbjct  1     MVVKSLPKIPTIDFSEGNLNPGTSSWFSVCNDVRRALEEYGCFVALYDKISQQLRTSMFS  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMP-LAEYFGIKDGVTPESTMNFSKQMWPD  797
               K LF LP E K +N SD   FGY GN  S+P L E  GI++  T E   +F+  +WP 
Sbjct  61    ELKELFDLPTEIKMKNVSDKPYFGYIGNHPSIPPLHESMGIENATTLEGGESFTNIIWPK  120

Query  796   ADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKW  617
               N  +FCE   SYS+LV +L+++V RMV +SYG++KY+D  + S+++LL+ IKYR+P+ 
Sbjct  121   GGNN-HFCETVVSYSRLVSELEKMVKRMVFQSYGVEKYYDSHLGSTTFLLKLIKYRVPEM  179

Query  616   NETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSN  437
             NE+  G  PH D SF+ ++  N++  LE+ETRDG WI F+PS S  +V +AG+AF+AW+N
Sbjct  180   NESSIGCAPHTDKSFITVLHQNEVNGLEIETRDGDWIQFEPSPSSFLV-LAGDAFLAWTN  238

Query  436   RRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCAN  257
              RI++  HRV+M G++ +Y++ LFS+  GT+EIP+ELVD+ +P +FK FDH+  L    +
Sbjct  239   GRIHSAAHRVVMTGTKPRYSIGLFSYHNGTIEIPDELVDEQHPQQFKSFDHYGLLHH-YH  297

Query  256   GGGKEESPINAFCGV  212
                K ES    +CGV
Sbjct  298   AAPKIESTAKDYCGV  312



>emb|CAN80139.1| hypothetical protein VITISV_028513 [Vitis vinifera]
Length=311

 Score =   308 bits (789),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/309 (48%), Positives = 209/309 (68%), Gaps = 4/309 (1%)
 Frame = -2

Query  1135  PKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLF  956
             P+LP++ F+   ++ GT SW     +V   LEEYGCF AVYDKVS EL +  F   + LF
Sbjct  6     PRLPVLNFSTGTLKPGTRSWLLACKDVLHALEEYGCFVAVYDKVSSELDNTTFCQLEELF  65

Query  955   QLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNF  776
              LP ETK +NTSD   FGY G    +PL E  GI+D  T +   +F+  MWP  ++  +F
Sbjct  66    DLPTETKVKNTSDKPYFGYIGQHPLIPLHESMGIEDATTLKGVESFTNIMWPAGND--HF  123

Query  775   CEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGH  596
             CE   SYSKLV +L+Q+V +MV ESY  +KY+D  IQS++YLLR IKYR P+ NET  G 
Sbjct  124   CETVLSYSKLVSELEQMVKKMVFESYDAEKYYDSHIQSTTYLLRLIKYRGPQKNETCIGT  183

Query  595   IPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPV  416
               H D SF+ ++  N++  LE+ T+DG+WI+F+PS S  +V +AG+A +AWSN RI++P 
Sbjct  184   SCHTDKSFITVLHQNEVCGLEIRTKDGEWISFKPSPSSYVV-MAGDALLAWSNGRIHSPE  242

Query  415   HRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFC-ANGGGKEE  239
             HRV+M G++ +Y++ LF++ RG +EIPEEL D+++PL+FKPF+H+  L F   N  G+ E
Sbjct  243   HRVIMNGNKARYSIGLFAYHRGIIEIPEELADEEHPLQFKPFNHYGLLHFYFTNKAGQTE  302

Query  238   SPINAFCGV  212
             S   A+CGV
Sbjct  303   STAKAYCGV  311



>gb|EYU24677.1| hypothetical protein MIMGU_mgv1a010266mg [Erythranthe guttata]
Length=317

 Score =   308 bits (789),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 153/317 (48%), Positives = 212/317 (67%), Gaps = 9/317 (3%)
 Frame = -2

Query  1138  NPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKV----SWELRDAMFKH  971
             + KL I++ T+ N  +GTTSW++TS  VRR LE +GC    YD V    +  +   +F  
Sbjct  2     DSKLHIVQLTEANSTLGTTSWKSTSDSVRRALELHGCVVVDYDNVHAAAAAAVEGGVFGV  61

Query  970   CKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDAD  791
              K +F LPLETK ++ S + GFGY GN+  MPL + FGI+DG T +   +F+  MWP   
Sbjct  62    LKEVFGLPLETKMKHKSGLLGFGYEGNYPEMPLFQCFGIEDGGTHQGIKDFTTLMWPHHH  121

Query  790   NTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGL-DKYFDPLIQSSSYLLRFIKYRMPKWN  614
                 FCE   SYS L+ +L   VM+MV+ SYGL DKY+D L+ SS Y+ R I+YR P  N
Sbjct  122   GHDIFCETIHSYSNLLSELHNTVMKMVVSSYGLDDKYYDNLVDSSLYMTRLIEYRPPGEN  181

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             E+  G   HRD  F+ ++ TN++  L++ET  G+WI+F+PS SK +V +AGEAFMAWSN 
Sbjct  182   ESDIGLQSHRDKGFLTVIGTNEVRGLQIETPGGEWIDFEPSPSKFLV-LAGEAFMAWSNG  240

Query  433   RIYAPVHRVMMKGS--EDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCA  260
             RIY+P+HRV+ +G+  E +Y+V  FSF+ G +++PEELVD+ NPLKFKPF++ EFL +C 
Sbjct  241   RIYSPLHRVVARGAEMEIRYSVGFFSFIGGILQVPEELVDNKNPLKFKPFNNLEFLEYCK  300

Query  259   NGGG-KEESPINAFCGV  212
             NGGG   ES I  +CG+
Sbjct  301   NGGGPTTESAIITYCGI  317



>ref|XP_002298131.1| hypothetical protein POPTR_0001s17670g [Populus trichocarpa]
 gb|EEE82936.1| hypothetical protein POPTR_0001s17670g [Populus trichocarpa]
Length=313

 Score =   304 bits (779),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 151/317 (48%), Positives = 217/317 (68%), Gaps = 7/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + + P+LP+I+F+ +NM+ GT+SW +T  +V   LEEYGCF AVYDKV   L + +F 
Sbjct  1     MGSLSPPELPVIDFSKENMKPGTSSWLSTCKDVMYALEEYGCFVAVYDKVPLTLHNDLFS  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMP-LAEYFGIKDGVTPESTMNFSKQMWPD  797
               K LF LP+ETKR+N SD+  +GY GN   +P L E  GI + +T E T +F+  MWP 
Sbjct  61    TLKDLFDLPIETKRKNVSDLPYYGYVGNQPFIPSLYEGMGIDNAITLEGTEDFADTMWPG  120

Query  796   ADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKW  617
              ++  +FC+   SYS LV +L+Q+V+RMV ESYG+ ++ D   +S++YL R +KYR P+ 
Sbjct  121   GND--HFCKTVLSYSMLVSELEQMVVRMVFESYGVYQHHDSHKESTTYLFRMMKYRGPEK  178

Query  616   NETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSN  437
             NE   G   H D SF+ ++  NQ+  LE++++DG+W+ F+PS S  IV +AGEA + WSN
Sbjct  179   NEANVGCDAHTDKSFITVLHQNQVSGLEVKSKDGQWMGFKPSPSSFIV-MAGEALLGWSN  237

Query  436   RRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLT--FC  263
              RI AP HRV+M  SE +Y+V LFSF++G +++PE+L+D+ NPL+FKPF++F  L   F 
Sbjct  238   DRINAPFHRVVMSESEPRYSVGLFSFIKGIIKVPEKLIDEKNPLRFKPFENFGLLRYFFT  297

Query  262   ANGGGKEESPINAFCGV  212
               G GK ES I A+CGV
Sbjct  298   EEGRGK-ESTIKAYCGV  313



>emb|CDP17011.1| unnamed protein product [Coffea canephora]
Length=313

 Score =   302 bits (774),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 150/316 (47%), Positives = 211/316 (67%), Gaps = 5/316 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M +    KLP+I+FT  N+  G++SW +T   V   LEEYGCF A+YDKVS EL +A+F+
Sbjct  1     MGSLAQHKLPVIDFTKKNLDPGSSSWLSTRQAVVGALEEYGCFIALYDKVSLELHEAIFR  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LP ETK  NT      GY G     PL E  GI D  + +    F+  MWP+ 
Sbjct  61    ASEDLFDLPTETKLLNTCHKPAPGYVGQNPRFPLYESLGIDDATSIDGVQKFTTLMWPNG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +++  FCE  +SYSKLV +LDQ+VMRMV E+YG++K ++ L+ S+SYLLR IKYR P+ N
Sbjct  121   NDS--FCESASSYSKLVAELDQMVMRMVSETYGVEKSYETLLGSTSYLLRLIKYREPQEN  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             ET  G +PH D SFM+I+  +Q+  LE++T+DG+W+   P  S  I+ +AGEAFMAW+N 
Sbjct  179   ETNLGIVPHTDKSFMSILQQHQVKGLEIKTKDGRWMEIDPFPSSFII-MAGEAFMAWTNG  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRG-TVEIPEELVDDDNPLKFKPFDHFEFLTF-CA  260
             RI AP HRV+M G+ ++Y+V LF+F+    +++PEELVD ++PL+FKPFDH +F  F   
Sbjct  238   RIEAPHHRVIMPGNAERYSVGLFTFIWDLLIQVPEELVDVEHPLQFKPFDHHKFHQFHTT  297

Query  259   NGGGKEESPINAFCGV  212
               G + +  I ++CGV
Sbjct  298   EEGMRSKCAIKSYCGV  313



>ref|XP_011072270.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X1 [Sesamum indicum]
Length=313

 Score =   300 bits (767),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 146/316 (46%), Positives = 204/316 (65%), Gaps = 5/316 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M +  NP LP I F+  N+  G+T+W +TS +V R LE+YGCFAA Y K S  +  A+F+
Sbjct  1     MGSLVNPTLPTIHFSGKNLEPGSTAWMSTSKDVVRALEDYGCFAATYSKFSLGMHKAIFR  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LP   K +NTSD    GY G    +PL E  GI++  T E    F+  +WP  
Sbjct  61    CSEELFDLPTNVKVQNTSDTPSHGYVGQEPIIPLYEGLGIENATTREGVKKFTNLLWPSG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             ++   FCE    YS+LV +LDQVVMRMV ESYG++  ++ L+ ++SYLLR IKYR P+  
Sbjct  121   ND--RFCETALEYSRLVAELDQVVMRMVSESYGIESSYESLLGATSYLLRIIKYRKPEKG  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             E   G +PH D SFM I+   Q+  LE++T+DG WI   PS S  IV +AG+A M W+N 
Sbjct  179   ENGLGIVPHTDKSFMTIIHQCQVNGLEIKTKDGDWITVDPSPSSFIV-MAGDACMGWTNG  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRG-TVEIPEELVDDDNPLKFKPFDHFEFLTF-CA  260
             RI   +HRV++KGSE++Y++ LF+F+R   +++PEELVDD +P +FKPFDH++F+ F   
Sbjct  238   RIEPSIHRVIIKGSEERYSLGLFTFIRDLKIQVPEELVDDHHPAQFKPFDHYKFIHFYYT  297

Query  259   NGGGKEESPINAFCGV  212
               G K   P+ A+CGV
Sbjct  298   EEGRKSNCPLRAYCGV  313



>ref|XP_011045368.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Populus euphratica]
Length=313

 Score =   297 bits (761),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 146/316 (46%), Positives = 214/316 (68%), Gaps = 5/316 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + + P+LP+I+F+ +N++ GT+SW +T  +V   LEEYGCF AVYDKV   L + +F 
Sbjct  1     MDSLSPPELPVIDFSKENLKPGTSSWLSTCKDVMYALEEYGCFVAVYDKVPLTLHNDLFS  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMP-LAEYFGIKDGVTPESTMNFSKQMWPD  797
               K LF LPLETKR+N SD+  +GY GN   +P L E  GI + +  E T +F+  MWP 
Sbjct  61    TLKDLFDLPLETKRKNVSDLPYYGYVGNQPFVPSLYEGMGIDNAIALEGTEDFADTMWPG  120

Query  796   ADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKW  617
              ++  +FC+   SYS LV +L+Q+V+RMV ESYG+ ++ D   +S++YL R +KYR P+ 
Sbjct  121   GND--HFCKTVLSYSMLVSELEQMVVRMVFESYGVYQHHDSHKESTTYLFRMMKYRGPEK  178

Query  616   NETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSN  437
             NE   G   H D SF+ ++  NQ+  LE++++DG+W+ F+PS S  IV +AG+A + WSN
Sbjct  179   NEANVGCDAHTDKSFITVLHQNQVSGLEVKSKDGQWMGFKPSPSSFIV-MAGDALLGWSN  237

Query  436   RRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLT-FCA  260
              RI AP HRV+M  SE +Y+V LFSF++G +++PE+L+D+ NPL+FKPF++F  L  F  
Sbjct  238   DRINAPFHRVVMSESEPRYSVGLFSFIKGIIKVPEKLIDEKNPLRFKPFENFGLLRYFIT  297

Query  259   NGGGKEESPINAFCGV  212
               G  +E  I A+CGV
Sbjct  298   EEGRGKEFTIKAYCGV  313



>ref|XP_006427128.1| hypothetical protein CICLE_v10027501mg [Citrus clementina]
 gb|ESR40368.1| hypothetical protein CICLE_v10027501mg [Citrus clementina]
Length=338

 Score =   298 bits (762),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 143/326 (44%), Positives = 211/326 (65%), Gaps = 5/326 (2%)
 Frame = -2

Query  1180  LAINQSRKTMATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVS  1001
             L I +  +       PKLP++  + +N + G +SW  TS +VR  LEE+GCF A+YD+VS
Sbjct  15    LPIAKDLQAKGLEVFPKLPVVNLSKENFKPGASSWLGTSRKVREALEEFGCFVALYDEVS  74

Query  1000  WELRDAMFKHCKHLFQLPLETKRRNTSDIYGFGYAGNFASMP-LAEYFGIKDGVTPESTM  824
              EL +A+F   + LF LP+E K +N S+   +GY GN   +P + E  G+    T E T 
Sbjct  75    LELHNAIFSAAEELFNLPIEIKEKNVSEKPYYGYLGNNPLVPAIYEGMGVDYANTIEGTQ  134

Query  823   NFSKQMWPDADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLR  644
             NF+  +WP+ +   NFC+   SYS+LV +L+Q+V RMV ESYG+DKY+D +++SS+YLLR
Sbjct  135   NFTNLIWPEGNE--NFCKTVVSYSRLVSELEQMVKRMVFESYGVDKYYDSVLESSTYLLR  192

Query  643   FIKYRMPKWNETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIA  464
              +KYR P+ NE   G   H D SF+ ++  N++  LE+ T+DG WI F   +  + + +A
Sbjct  193   IMKYRCPETNEKNLGCDVHTDKSFITVLHQNEVNGLEIRTKDGCWIGFDDPTPSSFIVLA  252

Query  463   GEAFMAWSNRRIYAPVHRVMMKG-SEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFD  287
             G+AF+AWSN RI++PVHRV++ G  + +Y++ LF+F  G ++IPEELVDD++PLKFK F+
Sbjct  253   GDAFLAWSNSRIHSPVHRVILNGIKQARYSLGLFTFNDGIIQIPEELVDDEHPLKFKSFE  312

Query  286   HFEFLT-FCANGGGKEESPINAFCGV  212
             HF  L  +    G K E    A+C V
Sbjct  313   HFGLLRYYLTEEGQKAECTAKAYCSV  338



>ref|XP_006465516.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Citrus 
sinensis]
 ref|XP_006495319.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Citrus 
sinensis]
Length=315

 Score =   296 bits (759),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/317 (44%), Positives = 211/317 (67%), Gaps = 5/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + + PKLP++  + +N++ G +SW  TS +VR  LEE+GCF A+YD+VS EL +A+F 
Sbjct  1     MGSLSVPKLPVVNLSKENLKPGASSWLGTSRKVREALEEFGCFVALYDEVSLELHNAIFS  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMP-LAEYFGIKDGVTPESTMNFSKQMWPD  797
               + LF LP+E K +N S+   +GY GN   +P + E  G+    T E T NF+  +WP+
Sbjct  61    AAEELFNLPIEIKEKNVSEKPYYGYLGNNPLVPAIYEGMGVDYANTIEGTQNFTNLIWPE  120

Query  796   ADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKW  617
              +   NFC+   SYS+LV +L+Q+V RMV ESYG+D+Y+D +++SS+YLLR +KYR P+ 
Sbjct  121   GNE--NFCKTVVSYSRLVSELEQMVKRMVFESYGVDQYYDSVLESSTYLLRIMKYRCPET  178

Query  616   NETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSN  437
             NE   G   H D SF+ ++  N++  LE+ T+DG WI F   +  + + +AG+AF+AWSN
Sbjct  179   NENNLGCDVHTDKSFITVLHQNEVNVLEIRTKDGCWIGFNDPTPSSFIVLAGDAFLAWSN  238

Query  436   RRIYAPVHRVMMKG-SEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLT-FC  263
              RI++PVHRV++ G  + +Y++ LF++  G ++IPEELVDD++PLKFK F+HF  L  + 
Sbjct  239   GRIHSPVHRVILNGIKQARYSLGLFTYNDGIIQIPEELVDDEHPLKFKSFEHFGLLRYYL  298

Query  262   ANGGGKEESPINAFCGV  212
                G K E    A+C V
Sbjct  299   KEEGQKAECTAKAYCCV  315



>ref|XP_002517546.1| Gibberellin 20 oxidase, putative [Ricinus communis]
 gb|EEF44710.1| Gibberellin 20 oxidase, putative [Ricinus communis]
Length=321

 Score =   296 bits (757),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/316 (44%), Positives = 212/316 (67%), Gaps = 4/316 (1%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M +   PK+P+I+F+ +N++ GT+SW +T   V R LEEYGCF AVY+K+  EL+ + + 
Sbjct  1     MGSRIPPKIPVIDFSQENLKPGTSSWVSTCKNVLRALEEYGCFIAVYEKIPLELQSSFYN  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMP-LAEYFGIKDGVTPESTMNFSKQMWPD  797
                 LF LP++TKR+N S I  +GY GN   +P L E  GI +  T E T++F+  MWP+
Sbjct  61    KLITLFDLPIDTKRKNVSAIPYYGYVGNQPFVPPLYEGMGINNAATMEGTLDFTNIMWPN  120

Query  796   ADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKW  617
              D+  +FC+   SYSK V +L+Q+V RMV E YG+   +D   + ++YL R +KYR P  
Sbjct  121   GDD--DFCKTVFSYSKWVAELEQMVTRMVFEGYGVQYSYDTQQERTNYLFRMMKYRAPTE  178

Query  616   NETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSN  437
              E+  G   H D  F+ ++  N++  LE++T+DG+W+ F+PSS  + + +A +A +AWSN
Sbjct  179   GESDLGCDVHTDKGFITVLHQNEVSGLEVQTKDGQWVCFEPSSPSSFIVMAADALLAWSN  238

Query  436   RRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCAN  257
              RI+A  HRV+M+GS+ +Y+V LFS+L+G  E+PEEL+D+++PL+FKPFD+F  L +   
Sbjct  239   GRIHAAFHRVVMRGSKARYSVGLFSYLKGITEVPEELIDEEHPLQFKPFDNFGLLHYFYT  298

Query  256   GGGKE-ESPINAFCGV  212
               G+E ES + A+CG+
Sbjct  299   EEGREKESTVKAYCGL  314



>gb|EYU21585.1| hypothetical protein MIMGU_mgv1a010381mg [Erythranthe guttata]
Length=314

 Score =   295 bits (755),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/308 (46%), Positives = 200/308 (65%), Gaps = 3/308 (1%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQ  953
             KL +IEF+D N++ GT SW  T  EV   LE+YGCF A YDK++ E    +FK  + LF 
Sbjct  9     KLDVIEFSDKNLKPGTESWSKTCNEVVSALEKYGCFVASYDKLTQETHTTVFKALEELFD  68

Query  952   LPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFC  773
             LP +TK +N S    +GY G    +PL E  GI +  T +   NF+K MWP+  N  +F 
Sbjct  69    LPTQTKVQNKSTKPLYGYVGQIPFIPLYESMGIDNADTLQGIQNFAKVMWPNGYN--DFS  126

Query  772   EDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHI  593
             E   SY+KL  +L+++V+RMV E YG+ K+++ LI S++YL R +KYR PK NE   G +
Sbjct  127   EKLVSYTKLAAELEKIVVRMVFERYGVGKHYESLIGSANYLCRVMKYREPKSNENNMGFV  186

Query  592   PHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPVH  413
              H D SFM+ +  NQ+  LE++T+DG W      SS +++ +AG+A MAWSN RI +P H
Sbjct  187   SHTDKSFMSTIHQNQVDGLEIKTKDGDWFGVHQLSSSSVIVMAGDAIMAWSNNRIKSPHH  246

Query  412   RVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANGGGKE-ES  236
             RV M+  + +Y++A FSFL  TVEIP+ELVD+D+P+++KPF+H EFL F +    +  ES
Sbjct  247   RVTMEAKKARYSIAQFSFLEKTVEIPQELVDEDHPMQYKPFEHLEFLDFYSKEENRRLES  306

Query  235   PINAFCGV  212
              I  +CGV
Sbjct  307   AIRTYCGV  314



>ref|XP_007024003.1| 2-oxoglutarate-dependent dioxygenase [Theobroma cacao]
 gb|EOY26625.1| 2-oxoglutarate-dependent dioxygenase [Theobroma cacao]
Length=313

 Score =   294 bits (753),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 141/315 (45%), Positives = 202/315 (64%), Gaps = 3/315 (1%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + ++P +P ++F+D++++ GT +W     +VR+ LEEYGCF   Y+K   EL + +F 
Sbjct  1     MGSESSPNVPFLDFSDEDLKPGTDTWLLACKKVRQALEEYGCFILEYNKFPLELHNQVFA  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LP ETK +N  +    GY G    +PL E  GI +  T E T  F+  MWP  
Sbjct  61    VLEELFDLPTETKMKNRYEKPLNGYVGQIPKLPLHESMGIDNANTLEGTRFFTNLMWPQG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             ++   FCE    Y+K+  +LDQ+V RM+ ESYGLDKY D  I +++YLLR +K R P+ N
Sbjct  121   ND--RFCEYIYKYAKVAAELDQMVTRMIFESYGLDKYSDAYIDTTTYLLRLLKNRAPREN  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             E   G I H D SF  I+  NQ+  LE+ETRDG WI+   SS  + V IAG+A MAWSN 
Sbjct  179   EPNLGFITHTDKSFTTILHQNQVNALEVETRDGTWIDVDFSSPSSFVVIAGDALMAWSND  238

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFC-AN  257
             R+ +P HRV+M+G+ D+Y++ LF+F  GT+++PEELVD+++PLK+K F+H   L F   +
Sbjct  239   RVLSPSHRVVMRGNMDRYSLGLFAFNSGTIQVPEELVDEEHPLKYKAFEHLGLLRFYRTD  298

Query  256   GGGKEESPINAFCGV  212
              G K + PI A+CGV
Sbjct  299   KGYKSKCPIKAYCGV  313



>ref|XP_002517548.1| Gibberellin 20 oxidase, putative [Ricinus communis]
 gb|EEF44712.1| Gibberellin 20 oxidase, putative [Ricinus communis]
Length=313

 Score =   294 bits (752),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 144/316 (46%), Positives = 201/316 (64%), Gaps = 5/316 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKV-SWELRDAMF  977
             M +   PKLP+++FT +N++ GT+ W     EVR+ LEEYGCF   Y+ + S +LRD +F
Sbjct  1     MGSAAQPKLPVLDFTLENLKPGTSCWAKACGEVRQALEEYGCFIVEYNNILSPKLRDGVF  60

Query  976   KHCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPD  797
                K LF LP ETK +N       GY G  A +PL E  GI +    E+T +F+  MWPD
Sbjct  61    NSLKELFDLPTETKMQNKYQKPLNGYVGQIAKLPLHESMGIDNATCLEATQDFTTLMWPD  120

Query  796   ADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKW  617
              ++  NFCE    Y+KL  ++DQ+V RM+ ESYG +KY D  ++S++YLLR +K R+PK 
Sbjct  121   GND--NFCECVYEYAKLTAEIDQMVTRMIFESYGAEKYHDSYVESTNYLLRLLKNRLPKG  178

Query  616   NETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSN  437
             +E   G I H D SF  I+  N I  LE++T+DG+ IN + S S + V IAG+A M WSN
Sbjct  179   DEPNLGFITHTDKSFTTILHQNHINGLEVDTKDGQKINIEFSPS-SFVVIAGDALMVWSN  237

Query  436   RRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFC-A  260
              RI +P HRV++ G ED+Y++ LF+F  G + +PEEL+D D+PL +KP DH   L F   
Sbjct  238   DRIISPSHRVIINGKEDRYSMGLFAFNSGIIRVPEELIDKDHPLMYKPLDHIGLLYFYRT  297

Query  259   NGGGKEESPINAFCGV  212
             + G K + P+ AFCGV
Sbjct  298   DEGYKSKCPVKAFCGV  313



>ref|XP_007215723.1| hypothetical protein PRUPE_ppa008973mg [Prunus persica]
 gb|EMJ16922.1| hypothetical protein PRUPE_ppa008973mg [Prunus persica]
Length=312

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/315 (45%), Positives = 210/315 (67%), Gaps = 4/315 (1%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T PKLP+I+ +++N++ GT +W   S  V+  LEEYGCF AV+ KV  +L +++F 
Sbjct  1     MGSETQPKLPVIDLSNENLKPGTEAWVLASKHVKYALEEYGCFEAVFHKVPLQLHNSIFS  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LP+ETKR+ TS+     Y G ++ +PL E  G+ +  T E    F+K MWP  
Sbjct  61    VVEDLFDLPIETKRQQTSERPYHSYFGQYSFLPLYESLGVDNPTTVEGAKGFTKIMWPAG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             ++  +FCE   S+SKLV +LDQ+V RMV + YG+++ +D  + S++YLLR  KYR  K N
Sbjct  121   ND--HFCESAQSFSKLVAELDQMVTRMVFDIYGVERLYDSHMASTTYLLRCFKYREQKEN  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             ET  G  PH+D +F +I+  +Q+  L++ ++DG+WI  +PS S  +V +AG+AFMAWSN 
Sbjct  179   ETNVGLRPHKDKTFTSILHQSQVHGLQVRSKDGQWIEAEPSPSSFLV-MAGDAFMAWSND  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANG  254
             R+ +  H+V+MK ++ +Y+V LFSF  G +++PEEL DD +PL +KPFDHF FL F    
Sbjct  238   RVRSCDHQVIMKENKTRYSVGLFSFNSGILQVPEELTDDQHPLLYKPFDHFSFLRFDQTP  297

Query  253   GGKE-ESPINAFCGV  212
               K+ E PI A+CGV
Sbjct  298   EAKKSECPIKAYCGV  312



>gb|KDO58207.1| hypothetical protein CISIN_1g037660mg [Citrus sinensis]
Length=312

 Score =   291 bits (746),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 132/315 (42%), Positives = 212/315 (67%), Gaps = 4/315 (1%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T PK+ +++  ++N++ GT++W +T  E+R+ +E+ GCF A+Y+K+  EL + +FK
Sbjct  1     MGSQTQPKILVVDLCNENLKPGTSTWISTCNEIRQAMEDTGCFEAIYNKIPLELHNEIFK  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
                 LF LP+ETK +NTSD     Y G +  +PL E   I D     +T +F+ +MWP+ 
Sbjct  61    AADELFDLPIETKMQNTSDKPYHEYFGQYTGIPLYESLAIDDPTNLTATQSFTDRMWPNG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +  P FCE   S++K++ ++DQ+VMRM++ESYG++KY+D  I++S+YLLRF KYR P+ N
Sbjct  121   N--PPFCESVHSFAKIIVEVDQLVMRMIMESYGIEKYYDSHIETSNYLLRFFKYRKPEIN  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             E   G  PH D + ++I+  N I  L+++ +DG+WI+ +PS S + V +A +  +AWSN 
Sbjct  179   EHNVGLYPHTDKNMVSIIHQNHINGLQIKAKDGEWIDLEPSPS-SFVIMAADGLLAWSNG  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFC-AN  257
             RI +  H+V++   E +Y++ LFSF RG V IPEE VD+ +PL+++PFD +EFL F  ++
Sbjct  238   RIRSCEHQVIINAHETRYSMGLFSFNRGIVHIPEEFVDELHPLRYRPFDIYEFLRFHDSD  297

Query  256   GGGKEESPINAFCGV  212
              G K +  I +FCG+
Sbjct  298   EGKKTDGSITSFCGI  312



>ref|XP_006427130.1| hypothetical protein CICLE_v10027182mg, partial [Citrus clementina]
 gb|ESR40370.1| hypothetical protein CICLE_v10027182mg, partial [Citrus clementina]
Length=323

 Score =   292 bits (747),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 132/315 (42%), Positives = 212/315 (67%), Gaps = 4/315 (1%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T PK+ +++  ++N++ GT++W +T  E+R+ +E+ GCF A+Y+K+  EL + +FK
Sbjct  12    MGSQTQPKILVVDLCNENLKPGTSTWISTCNEIRQAMEDTGCFEAIYNKIPLELHNEIFK  71

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
                 LF LP+ETK +NTSD     Y G +  +PL E   I D     +T +F+ +MWP+ 
Sbjct  72    AADELFDLPIETKMQNTSDKPYHEYFGQYTGIPLYESLAIDDPTNLTATQSFTDRMWPNG  131

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +  P FCE   S++K++ ++DQ+VMRM++ESYG++KY+D  I++S+YLLRF KYR P+ N
Sbjct  132   N--PPFCESVHSFAKIIVEVDQLVMRMIMESYGIEKYYDSHIETSNYLLRFFKYRKPEIN  189

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             E   G  PH D + ++I+  N I  L+++ +DG+WI+ +PS S + V +A +  +AWSN 
Sbjct  190   EHNVGLYPHTDKNMVSIIHQNHINGLQIKAKDGEWIDLEPSPS-SFVIMAADGLLAWSNG  248

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFC-AN  257
             RI +  H+V++   E +Y++ LFSF RG V IPEE VD+ +PL+++PFD +EFL F  ++
Sbjct  249   RIRSCEHQVIINAHETRYSMGLFSFNRGIVHIPEEFVDELHPLRYRPFDIYEFLRFHDSD  308

Query  256   GGGKEESPINAFCGV  212
              G K +  I +FCG+
Sbjct  309   EGKKTDGSITSFCGI  323



>gb|ADW66145.1| gibberellin 20 oxidase 2 [Solanum nigrum]
Length=225

 Score =   286 bits (732),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/224 (60%), Positives = 178/224 (79%), Gaps = 0/224 (0%)
 Frame = -2

Query  1009  KVSWELRDAMFKHCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPES  830
             KV  ELR+AMF HCK LF+LPLETK++NT D+YGFGY GNF   PLAE+FGI DG T ++
Sbjct  2     KVMPELREAMFDHCKELFKLPLETKKQNTCDVYGFGYGGNFGKTPLAEFFGIVDGETLDA  61

Query  829   TMNFSKQMWPDADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYL  650
             T +F+ +MWP+ +N   FCE++ SY+KL+ +LD  ++RM+L SYG+DK+++ L  S  YL
Sbjct  62    TKDFANKMWPNDNNVHKFCEESVSYAKLIAELDDTIIRMILASYGVDKHYEALKHSCMYL  121

Query  649   LRFIKYRMPKWNETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVF  470
             +R  +YR PK NET  GH+PH+D SF+ I+DTNQ+G LEM+TRDGKWI F PSS KT+V 
Sbjct  122   MRLNRYRSPKKNETNLGHLPHKDKSFVGIIDTNQVGGLEMQTRDGKWITFHPSSHKTLVI  181

Query  469   IAGEAFMAWSNRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEI  338
             IAGE F AWSN R+YAP HRV+MKG+EDKY++ALFSF++ T+E+
Sbjct  182   IAGEPFTAWSNGRVYAPKHRVIMKGAEDKYSLALFSFMKETIEV  225



>ref|XP_002298127.1| oxidoreductase family protein [Populus trichocarpa]
 gb|EEE82932.1| oxidoreductase family protein [Populus trichocarpa]
Length=313

 Score =   289 bits (739),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 140/308 (45%), Positives = 201/308 (65%), Gaps = 4/308 (1%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQ  953
             KLPI++F  ++++ GT+SW     +VR  LEEYGCF   Y+++  ELRD +F   K LF 
Sbjct  9     KLPILDFAKEDLKPGTSSWLKACSDVRLALEEYGCFVVEYNRLPLELRDKVFGVLKELFD  68

Query  952   LPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFC  773
             LP ETK +N  +    GY G  A +PL E  GI +  + ++T NF+  MWP+ ++   FC
Sbjct  69    LPTETKMQNKYEKPLNGYVGQIAKLPLHESMGIDNATSLDATQNFTDLMWPNGND--RFC  126

Query  772   EDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHI  593
             E    Y+ L  +LD++V RMV ESYG++KY D  ++S++YLLR +K R PK +E   G +
Sbjct  127   ECVLKYANLAAELDRMVTRMVFESYGVEKYHDSYVESTTYLLRLLKNRPPKVDEHNLGFV  186

Query  592   PHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPVH  413
              H D SF  I+  N+I  LE++T+DGK IN + S S + V IAG+A MAWSN R+ +P H
Sbjct  187   THTDKSFTTILHQNEINGLEVDTKDGKKINVELSPS-SFVVIAGDALMAWSNDRVISPSH  245

Query  412   RVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANGGG-KEES  236
             RV+M G  D+Y++ALF+F +G +++PEELVD+++PL +KP DH   L F     G K + 
Sbjct  246   RVIMNGKIDRYSLALFAFNKGILQVPEELVDEEHPLMYKPLDHIGLLHFYRTEEGYKSKC  305

Query  235   PINAFCGV  212
             PI A+CGV
Sbjct  306   PIKAYCGV  313



>ref|XP_010033904.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Eucalyptus 
grandis]
 gb|KCW53770.1| hypothetical protein EUGRSUZ_J03023 [Eucalyptus grandis]
Length=318

 Score =   289 bits (739),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 148/317 (47%), Positives = 205/317 (65%), Gaps = 6/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKV-SWELRDAMF  977
             M +  +PKLPI+ F+ +N++ GTTSW  T  EV + LEE+G F   YD+V   ++ DA F
Sbjct  1     MGSEGSPKLPILNFSSENLKPGTTSWVATCKEVIQALEEFGFFVVNYDEVIPSQVHDATF  60

Query  976   KHCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPD  797
             +    LF LP ETK +N       GY G  A +PL E  GI D  + E+T  F+  MWPD
Sbjct  61    RVLHELFALPTETKMKNRYQKPLNGYVGQIAKLPLHESLGIDDATSLEATQKFTDLMWPD  120

Query  796   ADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKW  617
              +N   F +   S++KL  +LDQ+V RM+ ESY  +K++D  I+S++YLLR +K R P  
Sbjct  121   GNN--RFRDIMNSFAKLAAELDQIVTRMIFESYNSEKHYDSYIESTTYLLRLLKNRAPLE  178

Query  616   NETKTGHIPHRDNSFMAIVDTN-QIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWS  440
             NE   G I H D SF  I+  + ++  LE+ETRDG+WI  + S SK +V IAG+A MAWS
Sbjct  179   NEPNLGFINHTDKSFTTILHQDSEVHGLEVETRDGEWITVEMSPSKFVV-IAGDALMAWS  237

Query  439   NRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFC-  263
             N RI +P H+V + G ED+Y++ALF+F  GT+++PEELVDDD+PLK+KPF+H   L F  
Sbjct  238   NDRIQSPNHKVTINGKEDRYSLALFAFNNGTLQVPEELVDDDHPLKYKPFEHLGLLRFYR  297

Query  262   ANGGGKEESPINAFCGV  212
              + G K + PI A+CGV
Sbjct  298   TDEGYKSKCPIKAYCGV  314



>emb|CAN77851.1| hypothetical protein VITISV_030994 [Vitis vinifera]
Length=317

 Score =   289 bits (739),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/315 (43%), Positives = 205/315 (65%), Gaps = 4/315 (1%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M +H++ K+P+++F+ +N+  G++SW  T  +V   LEE+GCF AVYDKV  EL++ +F 
Sbjct  1     MGSHSSAKIPVVDFSKENLNPGSSSWSATCKDVLLALEEFGCFIAVYDKVPSELQNKLFS  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LP ETK +N  +    GY G  + +PL E  GI +  T E   +F+  MWP  
Sbjct  61    ALEELFNLPTETKMQNAHNKPYHGYVGQHSXLPLHESIGIDNATTLEGXQSFANLMWPAG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             ++  +FCE T  +SK+  +LD +V +M+ ESYG+ KY+D  ++  SYLLR +K++ PK  
Sbjct  121   ND--HFCEITREFSKIALELDHLVTKMIFESYGVGKYYDSHLEPMSYLLRVLKHKAPKVK  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             E   G   H D SF+ ++  NQ+  LE+ET+DG+WI+ + S S +   IAG+A +AWSN 
Sbjct  179   EPNLGFARHTDKSFITVLYQNQVKGLEVETKDGEWISLELSPS-SFAVIAGDALVAWSNG  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLT-FCAN  257
             R+++P H+VMM G+E++Y++ LF F  G ++IPEEL DD++PL+FK FDH   L  F   
Sbjct  238   RLHSPYHKVMMSGNEERYSLGLFQFSSGMIQIPEELGDDEHPLQFKSFDHLGLLRFFHTE  297

Query  256   GGGKEESPINAFCGV  212
              G K +S I ++CG+
Sbjct  298   EGQKSKSLIKSYCGI  312



>ref|XP_008228621.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Prunus mume]
Length=312

 Score =   288 bits (736),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/315 (44%), Positives = 209/315 (66%), Gaps = 4/315 (1%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T PKLP+I+ +++N++ GT +W   S  V+  LEEYGCF AV+ KV  +L +++F 
Sbjct  1     MGSETQPKLPVIDLSNENLKPGTEAWVLASKHVKYALEEYGCFEAVFHKVPLQLHNSIFS  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LP+ETKR+ TS+     Y G ++ +PL E  G+ +  T E    F+K MWP  
Sbjct  61    VVEDLFDLPIETKRQQTSERPYHSYFGQYSFLPLYESLGVDNPTTVEGAQGFTKIMWPAG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             ++  +FCE   S+SKLV +LDQ+V RMV + YG+++ +D  + S++YL R  KYR  K N
Sbjct  121   ND--HFCESAQSFSKLVAELDQMVTRMVFDIYGVERLYDSHMASTTYLFRCFKYREQKEN  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             ET  G  PH+D +F +I+  +Q+  L++ ++D +WI+ +PS S  +V +AG+AFMAWSN 
Sbjct  179   ETNVGLRPHKDKTFTSILHQSQVHGLQVRSKDCQWIDAEPSPSSFLV-MAGDAFMAWSND  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANG  254
             R+ +  H+V+MK ++ +Y++ LFSF  G +E+PEEL DD +PL +KPFDHF FL F    
Sbjct  238   RVRSCDHQVIMKENKTRYSLGLFSFNSGILEVPEELTDDQHPLLYKPFDHFGFLRFDQTP  297

Query  253   GGKE-ESPINAFCGV  212
               K+ E PI A+CGV
Sbjct  298   EAKKSECPIKAYCGV  312



>ref|XP_002280670.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Vitis vinifera]
 emb|CBI36208.3| unnamed protein product [Vitis vinifera]
Length=317

 Score =   287 bits (734),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/315 (42%), Positives = 205/315 (65%), Gaps = 4/315 (1%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M +H++ K+P+++F+ +N+  G++SW  T  +V   LEE+GCF AVYDKV  EL++ +F 
Sbjct  1     MGSHSSAKIPVVDFSKENLNPGSSSWSATCKDVLLALEEFGCFIAVYDKVPSELQNKLFS  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LP ETK +N  +    GY G  + +PL E  GI +  T E   +F+  MWP  
Sbjct  61    ALEELFNLPTETKMQNAHNKPYHGYVGQHSRLPLHESIGIDNATTLEGMQSFANLMWPAG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             ++  +FCE T  +SK+  +LD +V +M+ ESYG+ KY+D  ++  SYLLR +K++ PK  
Sbjct  121   ND--HFCEITREFSKIALELDHLVTKMIFESYGVGKYYDSHLEPMSYLLRVLKHKAPKVK  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             E   G   H D SF+ ++  NQ+  LE+ET+DG+WI+ + S S +   IAG+A +AWSN 
Sbjct  179   EPNLGFARHTDKSFITVLYQNQVKGLEVETKDGEWISLELSPS-SFAVIAGDALVAWSNG  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLT-FCAN  257
             R+++P H+VMM G+E++Y++ LF F  G ++IPEEL DD++PL+FK F+H   L  F   
Sbjct  238   RLHSPYHKVMMSGNEERYSLGLFQFSSGMIQIPEELGDDEHPLQFKSFNHLGLLRFFHTE  297

Query  256   GGGKEESPINAFCGV  212
              G K +S I ++CG+
Sbjct  298   EGQKSKSLIKSYCGI  312



>ref|XP_002284968.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Vitis vinifera]
 emb|CBI36202.3| unnamed protein product [Vitis vinifera]
Length=314

 Score =   286 bits (733),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 137/317 (43%), Positives = 205/317 (65%), Gaps = 6/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T  KLP+I+F+D  ++ GT  W     +V++ LEEYGCF A ++KV  +LR A+F 
Sbjct  1     MGSETPLKLPVIDFSDPELKPGTLQWNLVKAQVQKALEEYGCFEAFFNKVPLDLRKAIFG  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LPL+TK RN+S     GY G + ++PL E  GI D +  E   +F+K +WP+ 
Sbjct  61    ALEELFDLPLQTKLRNSSKKPYHGYVGQYPTVPLYESMGIDDALVQEKAEHFTKLLWPEG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +  PNFC+   S+S+ + +LD  + RMVLES G++KY D  + S++YLLR +KY+ P+  
Sbjct  121   N--PNFCKTIQSFSEQLSELDHTIRRMVLESLGMEKYLDEHMDSTNYLLRVMKYKGPQTT  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             ETK G   H D + + I+  NQ+  L ++T+DG+WIN + S    I+ I G++F+AW+N 
Sbjct  179   ETKLGLNAHTDKNIVTILYQNQVDGLGVQTKDGQWINIKCSPDSFIIMI-GDSFLAWTNG  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTF-C  263
             R+++P HRVMM G+E +Y+  LFS  +    ++ PEELVD+++PL FKPFDH EFL F  
Sbjct  238   RLHSPYHRVMMTGNESRYSTGLFSIPKAGYVIKAPEELVDEEHPLLFKPFDHLEFLQFYY  297

Query  262   ANGGGKEESPINAFCGV  212
                G + ES +  +CGV
Sbjct  298   TEAGQRAESALKTYCGV  314



>ref|XP_008377592.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Malus domestica]
Length=312

 Score =   286 bits (732),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 135/315 (43%), Positives = 207/315 (66%), Gaps = 4/315 (1%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T PKLP+I+ +D+N++ GT +W     E++  LEEYGCF A+Y K+  EL +++F 
Sbjct  1     MGSETQPKLPVIDLSDENLKPGTDAWLLACKEIKDALEEYGCFEAIYHKIPLELHNSIFS  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LPLETK++ TSD     Y G ++ +PL E  G+ +  T E    F+  MWP  
Sbjct  61    AMEDLFGLPLETKKQKTSDRPYHSYFGQYSFLPLYESLGVDNPTTVEGAQGFTSIMWPQG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +   +FCE   S+SKLV +L Q+V RMV + YG+ + FD  ++S++YLLR  KYR  + N
Sbjct  121   N--AHFCETAHSFSKLVAELSQMVTRMVFDMYGVQRLFDSHMESTTYLLRCFKYRTQEEN  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             ET  G  PH D +F++I++ NQ+  L++ T+DG+WI+  PS S + + +AG+AFMAWSN 
Sbjct  179   ETNVGLHPHTDKTFISILNQNQVNGLQIGTKDGQWIDVNPSPS-SFLILAGDAFMAWSND  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANG  254
             R+ +  H+V MK ++ +Y++ LF+F  G +++PEEL+D+ +PL +KPFDHF FL F    
Sbjct  238   RVPSCDHQVTMKENKTRYSLGLFAFKSGIIQVPEELIDEKHPLLYKPFDHFSFLDFDRTP  297

Query  253   GGKE-ESPINAFCGV  212
               ++ +  I A+CGV
Sbjct  298   EARKLKCSIKAYCGV  312



>ref|XP_011045371.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Populus euphratica]
Length=313

 Score =   286 bits (732),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 140/308 (45%), Positives = 199/308 (65%), Gaps = 4/308 (1%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQ  953
             KLPI++F  ++++ GT+SW     +V   LEEYGCF   Y+++  ELRD +F   K LF 
Sbjct  9     KLPILDFAKEDLKPGTSSWLKACSDVTLALEEYGCFVVEYNRLPLELRDKVFGVLKELFD  68

Query  952   LPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFC  773
             LP ETK +N       GY G  A +PL E  GI +  + ++T NF+  MWP+ ++   FC
Sbjct  69    LPTETKMQNKYQKPLNGYVGQIAKLPLHESMGIDNATSLDATQNFTDLMWPNGND--RFC  126

Query  772   EDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHI  593
             E    Y+ L  +LD++V RMV ESYG++KY D  ++S++YLLR +K R PK +E   G I
Sbjct  127   EYVFKYANLAAELDRMVTRMVFESYGVEKYHDSYVESTTYLLRLLKNRPPKVDEHNLGFI  186

Query  592   PHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPVH  413
              H D SF  I+  N+I  LE++T+DGK IN + S S + V IAG+A MAWSN R+ +P H
Sbjct  187   THTDKSFTTILHQNEINGLEVDTKDGKKINVELSPS-SFVVIAGDALMAWSNDRVISPSH  245

Query  412   RVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANGGG-KEES  236
             RV+M G  D+Y++ALF+F +G +++PEELVD+++PL +KP DH   L F     G K + 
Sbjct  246   RVIMNGKRDRYSLALFAFNKGIIQVPEELVDEEHPLMYKPLDHTGLLHFYRTEEGYKSKC  305

Query  235   PINAFCGV  212
             PI A+CGV
Sbjct  306   PIKAYCGV  313



>emb|CDO98091.1| unnamed protein product [Coffea canephora]
Length=314

 Score =   285 bits (728),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 139/309 (45%), Positives = 203/309 (66%), Gaps = 5/309 (2%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQ  953
             +LP+++FT + +   +T W +T  EV R LEEYGCF A YDKVS EL  A+F   + LF+
Sbjct  9     QLPVLDFTGETLNPSSTRWPSTREEVVRALEEYGCFIANYDKVSLELHQAIFLASQELFE  68

Query  952   LPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFC  773
             LP ETK  NTSD    GY  +   +PL E  GI++  T +    F+  +WP+ +N  +F 
Sbjct  69    LPTETKVLNTSDSPSHGYIAH-RRIPLLEALGIENATTVDGVQRFTNVLWPNGNN--HFS  125

Query  772   EDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHI  593
             E   SYSKLV +L+ VVMRMV E+YG++K  + L+ S  YLLR IKYR P+ +E+  G  
Sbjct  126   ETALSYSKLVAELNHVVMRMVAETYGVEKDCESLLGSIYYLLRLIKYRAPREDESNVGLF  185

Query  592   PHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPVH  413
             PH D +FM+I+   Q+  LE+ T++G W+     S  + + +AG+  MAW+N RI  P+H
Sbjct  186   PHADQTFMSILHQAQVNGLEIMTKNGDWMLIDSLSPSSFIVMAGDVCMAWTNGRIEPPLH  245

Query  412   RVMMKGSEDKYTVALFSFLRGT-VEIPEELVDDDNPLKFKPFDHFEFLTFCAN-GGGKEE  239
             RV M GSE++Y+++LF+F+R   V++PE+LVDD++PL++KPFD F++L FC    G K +
Sbjct  246   RVTMSGSEERYSLSLFAFMRDVMVQVPEKLVDDEHPLQYKPFDPFKYLLFCVTEEGQKSK  305

Query  238   SPINAFCGV  212
               I ++CGV
Sbjct  306   CQIKSYCGV  314



>gb|KDP37163.1| hypothetical protein JCGZ_06219 [Jatropha curcas]
Length=312

 Score =   284 bits (726),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 143/317 (45%), Positives = 201/317 (63%), Gaps = 8/317 (3%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M +   PKLP+++FT +N++ G++ W  T  EVR+ LEEYGCF   Y+K+S ELR+++F 
Sbjct  1     MGSVLAPKLPVLDFTQENLKPGSSFWVKTCSEVRQALEEYGCFIVKYNKLSPELRNSVFG  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               K LF LP ETK +N       GY G    +PL E  GI +  + E+ ++F+K MWPD 
Sbjct  61    ALKDLFDLPTETKMQNKYVKPLNGYVGQIPKIPLHESLGIDNATSLEALLSFTKLMWPDG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +    F E    Y+KL  +LD +V RMV ESYG++K  D  I S++YLLR +K R+PK +
Sbjct  121   NL--RFSEPIFEYAKLAAELDYMVTRMVFESYGVEKLHDSYIGSTTYLLRLLKNRVPKGD  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGK--WINFQPSSSKTIVFIAGEAFMAWS  440
             E   G I H D SF  I+  NQ+  LE++TRDG+   + F PSS    V IAG+A MAWS
Sbjct  179   EPNLGFITHTDKSFTTILHQNQVDGLEVDTRDGEKIMVEFSPSS---FVVIAGDALMAWS  235

Query  439   NRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFC-  263
             N RI +P HRVMM G  D+Y+  LF+F  G +++P+ELVD+++PL +KP DH   L F  
Sbjct  236   NDRIMSPSHRVMMNGKVDRYSTGLFAFNSGKIQVPQELVDEEHPLMYKPLDHIGLLYFYR  295

Query  262   ANGGGKEESPINAFCGV  212
              + G K + P+ A+CG+
Sbjct  296   TDEGYKSKCPVKAYCGI  312



>emb|CAN80138.1| hypothetical protein VITISV_028512 [Vitis vinifera]
Length=314

 Score =   284 bits (726),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 137/317 (43%), Positives = 203/317 (64%), Gaps = 6/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T  KLP I+F+D  ++ GT  W     +V++ LEEYGCF A ++KV  +LR A+F 
Sbjct  1     MGSETPLKLPXIDFSDPELKPGTLQWNLVKAQVQKALEEYGCFEAFFNKVPLDLRKAIFG  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LPL+TK RN+S     GY G + ++PL E  GI D +  E   +F+K +WP+ 
Sbjct  61    ALEELFDLPLQTKLRNSSKKPYHGYVGQYPTVPLYESMGIDDALVQEKAEHFTKLLWPEG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +  PNFC+   S+S+ + +LD  + RMVLES G++KY D  + S++YLLR +KY+ P+  
Sbjct  121   N--PNFCKTIQSFSEQLSELDHTIRRMVLESLGMEKYLDEHMDSTNYLLRVMKYKGPQTT  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             ETK G   H D + + I+  NQ+  L ++T+DG WIN + S    I+ I G++F+AW+N 
Sbjct  179   ETKLGLNAHTDKNIVTILYQNQVDGLGVQTKDGXWINIKCSPDSFIIMI-GDSFLAWTNG  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTF-C  263
             R+++P HRVMM G+E +Y+  LFS  +    ++ PEELVD+++PL FKPFDH EFL F  
Sbjct  238   RLHSPYHRVMMTGNESRYSTGLFSIPKAGYVIKAPEELVDEEHPLLFKPFDHLEFLQFYY  297

Query  262   ANGGGKEESPINAFCGV  212
                G + ES +  +CGV
Sbjct  298   TEAGQRAESALKTYCGV  314



>emb|CDP10326.1| unnamed protein product [Coffea canephora]
Length=313

 Score =   282 bits (722),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 139/316 (44%), Positives = 209/316 (66%), Gaps = 5/316 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T   LP+I+FT  N+   ++ W +T   V R LE+YGCF A+YD+V+ EL +A+F+
Sbjct  1     MCSLTQNYLPVIDFTKKNLDPSSSFWPSTRQAVVRALEDYGCFIALYDEVTLELNEAIFR  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LP E K  NTS+    GY G    +PL E  GI++  T +    F+  +WP+ 
Sbjct  61    ASEELFDLPTEIKVLNTSNTPSHGYVGQEPIIPLYEGLGIENATTLDGVEKFTNLLWPNG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +++  F E   SYSK+V +LDQ+VMRMV E+YG++K ++ L+ S SYLLR IKYR P  N
Sbjct  121   NHS--FSETAFSYSKIVAELDQMVMRMVSEAYGIEKNYESLLGSMSYLLRLIKYRRPHEN  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             E   G +PH D SFM+I+  +Q+  LE++T+DG+W+   PS    IV +AG+  MAW+N 
Sbjct  179   EKNLGIVPHTDKSFMSILQQDQVKGLEIKTKDGEWMVIDPSPFSFIV-MAGDVCMAWTNG  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRG-TVEIPEELVDDDNPLKFKPFDHFEFLT-FCA  260
             RI  P HRV+M  + ++Y++ LF+F+R   V++PEELVDD++PL+FKPFDH++++  +  
Sbjct  238   RIEPPHHRVVMTENAERYSLGLFTFIRDLIVQVPEELVDDEHPLQFKPFDHYKYIDYYYT  297

Query  259   NGGGKEESPINAFCGV  212
             + G + + PI  +CGV
Sbjct  298   DEGKRSKCPIRDYCGV  313



>ref|XP_002284985.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Vitis vinifera]
 emb|CBI36207.3| unnamed protein product [Vitis vinifera]
Length=316

 Score =   282 bits (722),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 140/319 (44%), Positives = 205/319 (64%), Gaps = 8/319 (3%)
 Frame = -2

Query  1159  KTMATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAM  980
             + M   T PK+P+++F+ +N++ GT SW      VR  LEEYGCF AVYD+V   + + +
Sbjct  3     RIMGLETLPKIPMVDFSKENLKPGTDSWLPACNNVRHALEEYGCFMAVYDQVPLGVHNTI  62

Query  979   FKHCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTP--ESTMNFSKQM  806
             F   + LF LP+ETK++N S+    GY     + PL +  GI D VT   E    F+K M
Sbjct  63    FGAMRELFDLPIETKKQNISEKPYQGYTSESPAAPLHQGLGI-DNVTTNLEEIRRFAKIM  121

Query  805   WPDADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRM  626
             WP  +   NFC+    YSKLV +LD++V+RMVLESYG++      I+S+S+L+R +K R+
Sbjct  122   WPAGNE--NFCQSVHCYSKLVAELDRMVVRMVLESYGIEN--GSHIESASFLVRLLKSRV  177

Query  625   PKWNETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMA  446
             PK NET      H D SF++I+  N++  LE++T+DGKWI+ +P S +  + +AGE   A
Sbjct  178   PKMNETNKAFPSHCDKSFISILHQNKVNGLEIQTKDGKWISHEPPSLQVFLVMAGEVLTA  237

Query  445   WSNRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTF  266
             WSN RI+   HRV++KG+E +YT+ LFS + G +++PEELVDD +PL+FKPFDH   L F
Sbjct  238   WSNGRIHPARHRVVVKGNEARYTLGLFSTINGMIKVPEELVDDHHPLQFKPFDHTGLLHF  297

Query  265   CANGGGKE-ESPINAFCGV  212
                  G+  E+ + A+CG+
Sbjct  298   LGTKEGRNPETALKAYCGL  316



>emb|CDO98090.1| unnamed protein product [Coffea canephora]
Length=311

 Score =   281 bits (720),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 138/315 (44%), Positives = 203/315 (64%), Gaps = 5/315 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T  KLP I+F+ ++++ GTT+W     EV   LEEYGCF A Y+K+  +L+DA+F 
Sbjct  1     MGSLTLHKLPTIDFSKEDLKPGTTAWIKIRKEVMSALEEYGCFVASYEKIP-QLQDAVFG  59

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LP + K +N S     GY G    +PL E  GI D  T E    F+  MWP+ 
Sbjct  60    ALEELFDLPSQIKMQNKSSKPMHGYVGQIPVVPLYESMGIDDANTSEGMQAFTYAMWPNG  119

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +    F E   +Y+KL  +L+++V+RM+ ESYG++KY+D  +QS  YL R +KYR  K N
Sbjct  120   NE--GFSEKLLAYTKLAAELEEIVVRMIFESYGVEKYYDNHLQSVGYLSRVMKYREAKEN  177

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             ETK G + H D SFM+ +  NQ+  LE++ +DG++ +   S S ++V +AG+A MAWSN 
Sbjct  178   ETKLGFVSHTDKSFMSTIHQNQVNGLEIKAKDGEYFSVDLSRS-SVVVMAGDAIMAWSNN  236

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANG  254
             RI +P H+V+M+G   +Y++A FSF+ GTV+ PEELVDD++PL+FKPFDH E+L+F +  
Sbjct  237   RIKSPHHQVIMEGKGPRYSIAQFSFMDGTVQTPEELVDDEHPLQFKPFDHLEYLSFFSKE  296

Query  253   GGKE-ESPINAFCGV  212
               +  E  +  +CGV
Sbjct  297   ENRRLECALKTYCGV  311



>ref|XP_010110322.1| Gibberellin 20 oxidase 1 [Morus notabilis]
 gb|EXC25842.1| Gibberellin 20 oxidase 1 [Morus notabilis]
Length=372

 Score =   283 bits (725),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 136/307 (44%), Positives = 196/307 (64%), Gaps = 4/307 (1%)
 Frame = -2

Query  1135  PKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLF  956
             PKLP+++F+ + ++ GT SW     +V+R  EEYGCF   Y+ +S ELR+AMF   + LF
Sbjct  8     PKLPVLDFSKETLKPGTKSWELARKDVQRAFEEYGCFLVTYEAISCELRNAMFGALEELF  67

Query  955   QLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNF  776
              LP ETK +N  +    GY G    +PL E  GI +    E   +F+  +WP  ++   F
Sbjct  68    DLPTETKMKNKYEKPLNGYVGQNPVVPLHESLGIDNATAKEGIQSFTNLLWPVGND--RF  125

Query  775   CEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGH  596
              E   S++KL  ++DQ+V RM+ ESY L+KY++  I S +YLLR +K+  P+ N+ + G 
Sbjct  126   SESAHSFAKLAAEIDQIVTRMIFESYSLEKYYEAYIGSITYLLRLLKHNAPQGNDPQLGF  185

Query  595   IPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPV  416
             + H D SF  I+  N +  LE+ET++G WI  + S S  +VF AG+A MAWSN RI +P 
Sbjct  186   VAHTDKSFTTILHQNHVNALEVETKNGDWIKVELSPSSFVVF-AGDALMAWSNDRIVSPK  244

Query  415   HRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCA-NGGGKEE  239
             HRV++ G+ED+Y++A FSF  G VE+PEELVD+ +PLK+KPF+H  FL F A N   + E
Sbjct  245   HRVVVSGNEDRYSLAQFSFGDGMVEVPEELVDEQHPLKYKPFNHLGFLGFFAENAYKRLE  304

Query  238   SPINAFC  218
              PI A+C
Sbjct  305   CPIKAYC  311



>ref|XP_002517690.1| Gibberellin 20 oxidase, putative [Ricinus communis]
 gb|EEF44854.1| Gibberellin 20 oxidase, putative [Ricinus communis]
Length=307

 Score =   281 bits (718),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 139/316 (44%), Positives = 195/316 (62%), Gaps = 11/316 (3%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M     PKLP ++F+ + ++ G++ W     EVR  LEEYGCF   Y K+S ELRD +F 
Sbjct  1     MVVEAAPKLPALDFSQETLKPGSSCWLKACGEVRTALEEYGCFVVEYKKLSLELRDEVFA  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               K LF LP   K +N        Y G  + +PL E  GI+D  TPE+  NF+  MWP+ 
Sbjct  61    ELKELFDLPTAVKMQNKCQRPLISYIGQNSRIPLHESMGIEDADTPEAAQNFTNLMWPNG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             ++   F E   +Y KLV +LD++V RM+ ESYGL KY D  ++S+ Y++R +K R PK +
Sbjct  121   ND--RFSECIHAYGKLVVELDKIVTRMIFESYGLGKYHDSYVESTCYVIRLLKTRAPKED  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWIN--FQPSSSKTIVFIAGEAFMAWS  440
             ET  G   H D SF  I+  NQ+  LE++T+DGK IN  F P+S    V +AG+A MAWS
Sbjct  179   ETVLGLGAHTDTSFTTILHQNQVNGLEIDTKDGKKINVDFSPTS---FVVMAGDALMAWS  235

Query  439   NRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCA  260
             N RI +P H+V+M G  D+Y++ LF+F  G +++PEELV++D+PL +KPF+H EFL F  
Sbjct  236   NDRIKSPRHQVIMNGKVDRYSMGLFTFNNGNLQVPEELVNEDHPLTYKPFNHIEFLHFYQ  295

Query  259   NGGGKEESPINAFCGV  212
             N       PI  +CG+
Sbjct  296   NN----HRPIRFYCGI  307



>ref|XP_009339601.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Pyrus x bretschneideri]
Length=312

 Score =   281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/315 (42%), Positives = 205/315 (65%), Gaps = 4/315 (1%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T PKLP+I+ +D+N++  T +W     E++  LEEYGCF A+Y KV  EL +++F 
Sbjct  1     MGSETQPKLPVIDLSDENLKPDTDAWLLACKEIKDALEEYGCFEAIYHKVPLELHNSIFS  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LPLETK + TSD     Y G ++ +PL E   + +  T + +  F+  MWP  
Sbjct  61    AMEDLFGLPLETKMQKTSDRPYHSYIGQYSFLPLYESLAVDNPTTVDGSQGFTNIMWPQG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             ++  +FCE   S SKLV +L Q+V RMV + YG+ + ++  ++S++Y LR +KYR P+ N
Sbjct  121   ND--HFCETVHSISKLVAELSQMVTRMVFDVYGVQRLYNSHMESTTYQLRCLKYRTPEEN  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             ET  G  PH D +F++IV+ NQ+  L++ T+DG+WI+  PS S + + +AG+AFMAWSN 
Sbjct  179   ETNMGLQPHTDKTFISIVNQNQVNGLQIRTKDGQWIDVNPSPS-SFLILAGDAFMAWSND  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANG  254
             R+ +  H+++MK ++ +Y++ LFSF  G +++PEEL+D+ +PL +KPFDHF FL F    
Sbjct  238   RVPSCEHQIIMKENKTRYSLGLFSFKSGIIQVPEELIDEKHPLLYKPFDHFSFLDFGRTP  297

Query  253   GGKE-ESPINAFCGV  212
               +     I A+CGV
Sbjct  298   EARNLLRTIKAYCGV  312



>ref|XP_007024008.1| 2-oxoglutarate-dependent dioxygenase, putative [Theobroma cacao]
 gb|EOY26630.1| 2-oxoglutarate-dependent dioxygenase, putative [Theobroma cacao]
Length=312

 Score =   280 bits (716),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 139/315 (44%), Positives = 202/315 (64%), Gaps = 4/315 (1%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M   +  KLP+I+F++ N+  GT++W +   +VR+ LEE GCF A +DKV  +L D +F 
Sbjct  1     MGLQSQFKLPVIDFSEGNLNPGTSTWVSACNDVRQALEEQGCFEARFDKVPLQLHDTVFA  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
                 LF LP E K RNTS+   F Y G + S+PL E   + +  T   T +F+  MWP  
Sbjct  61    TAAELFDLPTELKMRNTSNKPYFDYFGQYRSLPLYESLAMDNPTTHSGTQSFTNLMWPAG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             ++   F E   S+S+LV +LD+ VMRM+ ESYG+  Y+D  I+S++YLLRF KYR P+ N
Sbjct  121   ND--RFRESAQSFSELVAELDRTVMRMLFESYGVGNYYDYYIKSTNYLLRFYKYRKPEMN  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             E+ TG  PH D + ++I+   +I  L+++ +DG+W+  QPS +   V +AG+A MAWSN 
Sbjct  179   ESDTGLPPHTDRTLLSIIHQGRISGLQVKLKDGQWVGVQPSPTSFAV-MAGDALMAWSND  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTF-CAN  257
             RI    H+V MK  E +Y++ +FSF+ G + I EELVD+ +PLK+K FDHF+FL F  ++
Sbjct  238   RIPPCYHQVTMKEKETRYSIGMFSFISGIIHILEELVDETHPLKYKSFDHFQFLHFDRSD  297

Query  256   GGGKEESPINAFCGV  212
              G K +  I AFCGV
Sbjct  298   EGKKSKCSIKAFCGV  312



>ref|XP_006427132.1| hypothetical protein CICLE_v10027083mg [Citrus clementina]
 gb|ESR40372.1| hypothetical protein CICLE_v10027083mg [Citrus clementina]
 gb|KDO58209.1| hypothetical protein CISIN_1g043442mg [Citrus sinensis]
Length=309

 Score =   279 bits (713),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 138/310 (45%), Positives = 201/310 (65%), Gaps = 6/310 (2%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFA--AVYDKVSWELRDAMFKHCKHL  959
             KLP+++F++ +++ GT SW     +VR+ LEE+GCF     ++ +S E R  +F   K+L
Sbjct  3     KLPVVDFSNKDLKPGTNSWIKACNDVRQALEEFGCFIIECNHNLISSEFRSEVFGALKNL  62

Query  958   FQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPN  779
             F LP ETK +N  +    GY G    +PL E  GI +  + E+  +F+K MWP  +++  
Sbjct  63    FDLPTETKMKNKYERPLTGYVGQIPKLPLHESMGIDNATSLEAAQSFTKIMWPQGNDS--  120

Query  778   FCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTG  599
             FC+   SY+ L  +LD+ V RM+ ESY L+KY D  I+S +YLLR +K R P   E   G
Sbjct  121   FCKIVHSYATLAAELDRTVSRMIFESYSLEKYHDSYIESITYLLRVLKNRAPIGGEPNLG  180

Query  598   HIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAP  419
              + H D SF  I+  NQI  LE++TRDG+ IN + S S + V +AG+A MAWSN RI++P
Sbjct  181   FVTHTDKSFTTILHQNQINGLEIDTRDGQKINVELSPS-SFVVVAGDALMAWSNDRIHSP  239

Query  418   VHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLT-FCANGGGKE  242
              HRV+M G+ D+Y++ALFSF  G V++P+ELVDD++PLK+KPF+HF  L  F  + G K 
Sbjct  240   SHRVIMNGAVDRYSLALFSFSSGIVKVPDELVDDEHPLKYKPFEHFGLLRYFRTDEGYKS  299

Query  241   ESPINAFCGV  212
             + PI A+CG+
Sbjct  300   KCPIKAYCGI  309



>ref|XP_006427129.1| hypothetical protein CICLE_v10027545mg, partial [Citrus clementina]
 gb|ESR40369.1| hypothetical protein CICLE_v10027545mg, partial [Citrus clementina]
Length=339

 Score =   280 bits (715),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 135/332 (41%), Positives = 206/332 (62%), Gaps = 6/332 (2%)
 Frame = -2

Query  1198  PAQLLSLAINQSRKTMATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAA  1019
             P +L  L   QS+  M +    KLPI++ + +N++ G++SW+T   E+R  LEEYGCF A
Sbjct  11    PNKLSCLVQRQSKAKMGSEAAQKLPIVDLSQENLKPGSSSWQTACNEIRLALEEYGCFVA  70

Query  1018  VYDKVSWELRDAMFKHCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVT  839
             +YDK+  E R+ +F   + LF LP ETK +N +     GY G  ++ PL E  GI+    
Sbjct  71    LYDKLLPEFRNKVFDSLEELFDLPQETKMKNVNPKPAHGYMGKISAFPLHEGMGIEYATN  130

Query  838   PESTMNFSKQMWPDADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSS  659
                   F+  MWP  +    FCE   +Y+ +V +L Q+VM+M+ ESYG++K ++   +S+
Sbjct  131   RGECEKFTSLMWPQGNY--QFCEVAHTYANIVAELQQLVMKMLFESYGVEKLYESQKEST  188

Query  658   SYLLRFIKYRMPKWNETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKT  479
             +YLLRF+KYR  + + T      H D S ++I+ +N +  LE+ T+DG+WI+F+PS S +
Sbjct  189   TYLLRFLKYRKSQTDTTNLAFKGHTDKSLVSILHSNHVKGLELRTKDGEWIHFEPSPS-S  247

Query  478   IVFIAGEAFMAWSNRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKF  299
              V IAG+  MAWSN RI +  HRV++ G E +Y + LFSFL G ++ PEELVDD++PL++
Sbjct  248   FVIIAGDVCMAWSNDRIKSCYHRVIVDGPEVRYALGLFSFLSGVIQTPEELVDDEHPLQY  307

Query  298   KPFDHFEFLTFCANGGGK---EESPINAFCGV  212
             KPFDH   L F  +   +   E + + A+CG+
Sbjct  308   KPFDHAGLLQFYLSNSDQNKGERNMMKAYCGI  339



>ref|XP_008377590.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Malus domestica]
Length=291

 Score =   278 bits (710),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 126/293 (43%), Positives = 198/293 (68%), Gaps = 3/293 (1%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             MA+ T PKLP+I+ +D+N++ GT +W     E++  LEEYGCF A+Y KV  EL ++MF 
Sbjct  1     MASETQPKLPVIDLSDENLKPGTDAWLLACKEIKDALEEYGCFEAIYHKVPLELHNSMFT  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LPLETK++ TSD +   Y G ++ +PL E   + +  T E    F+  MWP  
Sbjct  61    AMEDLFGLPLETKKQKTSDRHLHSYLGQYSFIPLYESLAMANPTTVEGAQGFTSTMWPQG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             ++  +FCE   S+SKLV +L Q+V RMV + YG+ + +D  ++ ++Y LR+ KYR  + N
Sbjct  121   ND--HFCETAHSFSKLVAELSQMVTRMVFDMYGVQRLYDSHMELTTYQLRWYKYRTQQAN  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             ET  G +PH D SF++I++ +Q+  L++ T+D +WI+ +PS S + + +AG+AFMAWSN 
Sbjct  179   ETNVGMLPHTDKSFISILNQDQVNGLQIGTKDSQWIDVKPSPS-SFLILAGDAFMAWSND  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEF  275
             R+ +  H+V M+ ++ +Y++ LFSF  G +++PEEL+D+ +PL +KPFDHF F
Sbjct  238   RVPSCEHQVTMRENKTRYSLGLFSFKSGIIQVPEELIDEKHPLLYKPFDHFSF  290



>ref|XP_006465423.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Citrus sinensis]
Length=315

 Score =   278 bits (710),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/317 (43%), Positives = 198/317 (62%), Gaps = 5/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T  KLPII+F+  N++ GT  W +    VR+ LE+YGCF A+++KV  E+  A+F 
Sbjct  1     MGSETPIKLPIIDFSKPNLKPGTPEWDSVKSHVRKALEDYGCFEALFNKVPEEILKAVFG  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LPL TK RN S     GY G +  +PL E  GI D    E   + +  +WP+ 
Sbjct  61    ALEELFDLPLRTKMRNISKKPFHGYVGQYPQVPLYESMGIDDANVKEKVESMTNILWPEG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             + +  FC+   S+S+ V +LDQ + RM+LES GL+KY D  + S+SYLLR +KY+ P+  
Sbjct  121   NKS--FCKTIQSFSEQVSELDQTIRRMILESLGLEKYMDEHMNSTSYLLRVMKYKGPETT  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             E K G   H D + + I+  NQ+  LE++T++G+WIN +PSS  + + + G++  AW+N 
Sbjct  179   EKKLGLNAHTDKNIVTILYQNQVEGLELQTKNGEWINVKPSSPHSFIAMIGDSLYAWTNG  238

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTF-C  263
             ++Y+P HRVMM G E +Y+  LFS  +    +E PEELVD+++PL FK FDHFEFL F  
Sbjct  239   QLYSPYHRVMMTGIETRYSTGLFSIPKAGYKIEAPEELVDEEHPLLFKSFDHFEFLEFYY  298

Query  262   ANGGGKEESPINAFCGV  212
                G + ES +  +CGV
Sbjct  299   TEAGQRAESALKTYCGV  315



>ref|XP_006465514.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1-like, 
partial [Citrus sinensis]
Length=314

 Score =   278 bits (710),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/310 (45%), Positives = 200/310 (65%), Gaps = 6/310 (2%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFA--AVYDKVSWELRDAMFKHCKHL  959
             KLP+++F++ +++ GT SW     +VR+ LEE+GCF     ++ +S E R  +F   K+L
Sbjct  8     KLPVVDFSNKDLKPGTNSWIKACNDVRQALEEFGCFIIECNHNLISSEFRSEVFGALKNL  67

Query  958   FQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPN  779
             F LP ETK +N  +    GY G    +PL E  GI +  + E+  +F+K MWP  +++  
Sbjct  68    FDLPSETKMKNKYERPLTGYVGQIPKLPLHESMGIDNATSLEAAQSFTKIMWPQGNDS--  125

Query  778   FCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTG  599
             FC+   SY+ L  +LD+ V RM+ ESY L+KY D  I+S +YLLR +K R P   E   G
Sbjct  126   FCKIVNSYATLAAELDRTVSRMIFESYSLEKYHDSYIESITYLLRVLKNRAPIGGEPNLG  185

Query  598   HIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAP  419
              + H D SF  I+  NQI  LE++TRDG+ IN   S S + V +AG+A MAWSN RI++P
Sbjct  186   FVTHTDKSFTTILHQNQINGLEIDTRDGQKINVGLSPS-SFVVVAGDALMAWSNDRIHSP  244

Query  418   VHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLT-FCANGGGKE  242
              HRV+M G+ D+Y++ALFSF  G V++P+ELVDD++PLK+KPF+HF  L  F  + G K 
Sbjct  245   SHRVIMNGAVDRYSLALFSFSSGIVKVPDELVDDEHPLKYKPFEHFGLLRYFRTDEGYKS  304

Query  241   ESPINAFCGV  212
             + PI A+CG+
Sbjct  305   KCPIKAYCGI  314



>ref|XP_008228620.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Prunus mume]
Length=321

 Score =   278 bits (710),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/317 (42%), Positives = 202/317 (64%), Gaps = 6/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T  +LP+I+F++ ++  GTT W T   +V   LEEYGCF A++ KV   +R ++F+
Sbjct  1     MGSETPLRLPVIDFSNQSLTPGTTEWNTVRAQVHNALEEYGCFEALFTKVPSHIRKSIFQ  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + L  LPL+TK +  S     GYAG    MPL E   I      E   + +  +WP  
Sbjct  61    SIEELLDLPLQTKLKIVSKKPFRGYAGQSPMMPLYESMPIDGANVYEQVQSLANTLWPQG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +  P+FC+   S+++ V +LDQ++ RM+LES GL+KY +  + S++YLLR +KY++P+ N
Sbjct  121   N--PSFCKTIQSFTEKVSELDQIIRRMILESLGLEKYLEEHLNSTNYLLRVMKYKVPQTN  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             ETK G  PH D + + I+  NQ+  LE++T+DGKWIN +PSS   IV I GE+  AW+N 
Sbjct  179   ETKLGIPPHTDKNIVTILYQNQVDGLEVQTKDGKWINVKPSSDSFIVLI-GESLHAWTNG  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTFCA  260
             R+Y+P+HRVMM G+E +Y+  LFS  +    ++ P E+VD+++PL FKP++H +F  FC 
Sbjct  238   RLYSPIHRVMMNGNEARYSTGLFSAPKEGYIIKAPNEVVDEEHPLLFKPYEHAQFTAFCN  297

Query  259   NGGGKEES-PINAFCGV  212
             +  G+ +  P+  FCGV
Sbjct  298   SEAGRRDLFPLKTFCGV  314



>gb|AFC36356.1| 2-oxoglutarate-dependent dioxygenase [Salvia miltiorrhiza]
Length=316

 Score =   277 bits (709),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 135/316 (43%), Positives = 196/316 (62%), Gaps = 4/316 (1%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T  KL +IEFTD N    T SW  T  +V   LEEYGCF AVYDK++ E+    F 
Sbjct  1     MGSETVHKLGVIEFTDKNTNPETESWSETCKKVVDALEEYGCFVAVYDKLTHEIHKQAFS  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LP +TK +N S    +GY G    +PL E  GI D  T +   NFS  MW + 
Sbjct  61    SLQQLFDLPTQTKVQNKSSKPLYGYVGQIPFLPLYESMGIDDAHTIQGIQNFSNVMWHNG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +  P F E+   Y+KL  +++++ +RMV ESYG+ K++D  ++S++YL R +KYR PK  
Sbjct  121   N--PAFDENLVVYTKLAAEVERIAVRMVCESYGVGKHYDSYVESANYLCRVMKYREPKIG  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             E K   + H D SFM+ +  NQ+  L+++ +DG+W      S  +I+ +AG+A MAWSN+
Sbjct  179   ENKMAFVTHTDKSFMSTIHQNQVDGLQIKAKDGEWFTVHHLSPSSIIVMAGDAIMAWSNK  238

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFL-RGTVEIPEELVDDDNPLKFKPFDHFEFLTFCAN  257
             RI +P HRV M+G+E +Y++A FSF+ +  V  P+E VD+D+PL++KPFDH +FL F + 
Sbjct  239   RIKSPHHRVTMEGNEARYSIAQFSFMEKDMVATPDEFVDEDHPLQYKPFDHLKFLDFFSQ  298

Query  256   GGGKE-ESPINAFCGV  212
                +  ES I  +CGV
Sbjct  299   EENRRLESAITTYCGV  314



>ref|XP_009799663.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Nicotiana sylvestris]
Length=315

 Score =   277 bits (708),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 138/310 (45%), Positives = 201/310 (65%), Gaps = 6/310 (2%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQ  953
             KLPII+FT +N+  GT SW     EV   LEEYGCF A+YDK+S ++ + +F+  + LF 
Sbjct  9     KLPIIDFTKENLEPGTNSWFKVCKEVVCALEEYGCFVALYDKISLKIHNEVFQALEELFN  68

Query  952   LPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFC  773
             LP +TK +N S    +GY G    +PL E  GI +  T E   NFS  MWP+ +N   F 
Sbjct  69    LPTQTKIQNKSTKPLYGYVGQIPFIPLYESMGIDNANTIEGIQNFSNFMWPNGNNC--FS  126

Query  772   EDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHI  593
             E   +YSK   +++++V+RMV ESYG++KY++  I+S +YL R +KY+  +  E K G +
Sbjct  127   EALLAYSKAAAEVEEMVVRMVFESYGVEKYYESHIKSVNYLARVMKYKEAQVQEPKLGFV  186

Query  592   PHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPVH  413
              H D SFM+ +  NQ+  LE++ +DG+W   + S S +IV +AG+A MAWSN RI +P H
Sbjct  187   AHTDKSFMSTIHQNQVNGLEIKGKDGQWFGVELSPS-SIVVMAGDAIMAWSNNRIKSPHH  245

Query  412   RVMMKGSEDKYTVALFSFLRGT--VEIPEELVDDDNPLKFKPFDHFEFLTFCANGGGKE-  242
             RVMM+G  ++Y++A FSF+  T  VE PEELVD+++PLKFK F+H ++L F +    +  
Sbjct  246   RVMMEGKGERYSIAQFSFMEDTVMVETPEELVDEEHPLKFKSFNHLDYLHFFSKEENRRL  305

Query  241   ESPINAFCGV  212
             ES +  +CGV
Sbjct  306   ESALKTYCGV  315



>ref|XP_004151475.1| PREDICTED: gibberellin 20 oxidase 1-B-like [Cucumis sativus]
Length=335

 Score =   278 bits (710),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 144/321 (45%), Positives = 208/321 (65%), Gaps = 9/321 (3%)
 Frame = -2

Query  1153  MATH-TNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMF  977
             MAT+ ++ +LP+++F   N++ GT  W +T+ +VR  LEEYGCF A+YD VS E+   MF
Sbjct  1     MATNMSDEQLPVVKFCSQNLKSGTEEWVSTTKKVREALEEYGCFVALYDTVSAEVSSNMF  60

Query  976   KHCKHLF-QLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWP  800
                K LF ++PLE K +N S+    GY G    MP+ E  GI+  + P +  +F+  MWP
Sbjct  61    DSLKELFDEVPLERKLQNVSEKPYHGYFGQNPLMPIHESMGIEHPILPTNINSFTNLMWP  120

Query  799   DADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPK  620
                N  +F E+ T+Y+ LV +LD+ V  MV ESYG+       ++S+ YL+R IKYR+PK
Sbjct  121   SRGNH-SFRENVTAYANLVSELDKRVKSMVFESYGVGNALRSHMESTKYLMRMIKYRVPK  179

Query  619   WNETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQP---SSSKTIVFIAGEAFM  449
               E   G  PH D SF+ I+  N++  L+++TRD KWI + P   SS+ + + +AG+AF 
Sbjct  180   EKEMNLGAFPHTDKSFLTILHQNEVNGLQIKTRDNKWIQYHPFSSSSTSSFIVMAGDAFF  239

Query  448   AWSNRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLT  269
             AWSN RIY+P HRV+M G++++Y+V LFSF  G V+IP+ELVDD +P  FKPFDH ++L 
Sbjct  240   AWSNGRIYSPPHRVIMSGNKERYSVGLFSFNNGIVQIPKELVDDKHPQLFKPFDHQDYLR  299

Query  268   FCANGGGKEESP--INAFCGV  212
             F +   G + SP  I A+CGV
Sbjct  300   FYSTERG-QNSPCAIKAYCGV  319



>ref|XP_006427127.1| hypothetical protein CICLE_v10027219mg, partial [Citrus clementina]
 gb|ESR40367.1| hypothetical protein CICLE_v10027219mg, partial [Citrus clementina]
Length=307

 Score =   276 bits (707),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 133/309 (43%), Positives = 194/309 (63%), Gaps = 5/309 (2%)
 Frame = -2

Query  1129  LPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQL  950
             LPII+F+  N++ GT  W +    VR+ LEEYGCF A+++KV  E+  A+F   + LF L
Sbjct  1     LPIIDFSKPNLKPGTPEWDSVKSHVRKALEEYGCFEALFNKVPEEILKAVFGALEELFDL  60

Query  949   PLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFCE  770
             PL TK RN S     GY G +  +PL E  GI D    E   + +  +WP+ + +  FC+
Sbjct  61    PLRTKMRNISKKPFHGYVGQYPQVPLYESMGIDDANVKEKVESMTNILWPEGNKS--FCK  118

Query  769   DTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHIP  590
                S+S+ V +LDQ + RM+LES GL+KY D  + S+SYLLR +KY+ P+  E K G   
Sbjct  119   TIQSFSEQVSELDQTIRRMILESLGLEKYMDEHMNSTSYLLRVMKYKGPETTEKKLGLNS  178

Query  589   HRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPVHR  410
             H D + + I+  NQ+  LE++T++G+WIN +PSS  + + + G++  AW+N ++Y+P HR
Sbjct  179   HTDKNIVTILYQNQVEGLELQTKNGEWINIKPSSPHSFIAMIGDSLYAWTNGQLYSPYHR  238

Query  409   VMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTF-CANGGGKEE  239
             VMM G E +Y+   FS  +    +E PEELVD+++PL FKPFDHFEFL F     G + E
Sbjct  239   VMMTGIETRYSTGFFSIPKAGYKIEAPEELVDEEHPLLFKPFDHFEFLEFYYTEAGQRAE  298

Query  238   SPINAFCGV  212
             S +  +CGV
Sbjct  299   SALKTYCGV  307



>ref|XP_004302952.1| PREDICTED: leucoanthocyanidin dioxygenase-like [Fragaria vesca 
subsp. vesca]
Length=316

 Score =   276 bits (707),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 137/317 (43%), Positives = 203/317 (64%), Gaps = 6/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T  KLP I+F+  N++ GTT W +   +VR  LEEYGCF A+++KV  +++ A+F+
Sbjct  1     MGSETPIKLPTIDFSMPNLKPGTTEWDSVRAQVRFALEEYGCFEALFNKVPLDVQKAIFE  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LPL+TK RN S     GY G +  +PL E  GI +        +F+  +WP  
Sbjct  61    ATEELFDLPLQTKLRNVSQKPFHGYIGQYPMVPLYESVGIDEANVYGQVQSFTHTLWPQQ  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +  PNF +   S+S+ + +LDQ++ RMVLES GL+KY +  I S++YLLR +KY+ P+ N
Sbjct  121   N--PNFSKTVHSFSEKLSELDQIIRRMVLESLGLEKYLEEHIGSTNYLLRLMKYKGPQTN  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             ETK G   H D + + I+  NQ+  LE++T+DGKWIN +P     I  I G++  AW+N 
Sbjct  179   ETKLGINSHTDKNIVTILYQNQVHGLEIQTKDGKWINVKPLPESFIAMI-GDSLYAWTNG  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTF-C  263
             R+++P HRVMM G+ED+Y+  LFS  +    ++ PEE+VD+++PL FKPFDH EFL F  
Sbjct  238   RLHSPPHRVMMTGNEDRYSTGLFSIPKAGYIIKAPEEVVDEEHPLLFKPFDHVEFLGFYY  297

Query  262   ANGGGKEESPINAFCGV  212
             +  G +  S + A+CGV
Sbjct  298   SEAGQRAPSALKAYCGV  314



>gb|KDP37168.1| hypothetical protein JCGZ_06224 [Jatropha curcas]
Length=314

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 136/317 (43%), Positives = 199/317 (63%), Gaps = 6/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T  +LP+I+F++ N++ GT  W +   +V   L+EYGCF A Y++V  +L+  +  
Sbjct  1     MGSETPLRLPVIDFSEGNLKPGTEEWDSVRSQVFEALKEYGCFEAFYNRVPSDLKKGVVG  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF+LPLETK +N S     GY G +   PL E  GI D   PE+  + +  +WP  
Sbjct  61    AIEELFELPLETKLKNVSKKPFHGYVGQYPQAPLFESMGIDDADVPENVDSLTNTLWPQG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +  P F +   SYS+LV +LDQ V RM+LES G++KY D  + S++YLLR +KY+ P+  
Sbjct  121   N--PAFSKTVVSYSELVSELDQTVRRMILESLGVEKYLDEHMNSTNYLLRVMKYKGPQTT  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             ETK G  PH D + + I+  NQ+  LE++T++G+WIN + S    +V I G++  AW+N 
Sbjct  179   ETKLGLHPHTDKNIVTILYQNQVDGLEVKTKEGEWINVKLSPHSFVVMI-GDSLYAWANG  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTF-C  263
             R+Y+P HRVMM G+E +Y+  LFS  +    V+ PEELVD+ +PL FKPFDH +FL F  
Sbjct  238   RLYSPYHRVMMSGNEARYSAGLFSIPKAGYMVKAPEELVDEQHPLLFKPFDHVKFLGFYY  297

Query  262   ANGGGKEESPINAFCGV  212
                G K ES + A+CGV
Sbjct  298   TESGQKSESALKAYCGV  314



>gb|KDO58204.1| hypothetical protein CISIN_1g038676mg, partial [Citrus sinensis]
Length=307

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/309 (43%), Positives = 194/309 (63%), Gaps = 5/309 (2%)
 Frame = -2

Query  1129  LPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQL  950
             LPII+F+  N++ GT  W +    VR+ LE+YGCF A+++KV  E+  A+F   + LF L
Sbjct  1     LPIIDFSKPNLKPGTPEWDSVKSHVRKALEDYGCFEALFNKVPEEILKAVFGALEELFDL  60

Query  949   PLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFCE  770
             PL TK RN S     GY G +  +PL E  GI D    E   + +  +WP+ + +  FC+
Sbjct  61    PLRTKMRNISKKPFHGYVGQYPQVPLYESMGIDDANVKEKVESMTNILWPEGNKS--FCK  118

Query  769   DTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHIP  590
                S+S+ V +LDQ + RM+LES GL+KY D  + S+SYLLR +KY+ P+  E K G   
Sbjct  119   TIQSFSEQVSELDQTIRRMILESLGLEKYMDEHMNSTSYLLRVMKYKGPETTEKKLGLNA  178

Query  589   HRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPVHR  410
             H D + + I+  NQ+  LE++T++G+WIN +PSS  + + + G++  AW+N ++Y+P HR
Sbjct  179   HTDKNIVTILYQNQVEGLELQTKNGEWINVKPSSPHSFIAMIGDSLYAWTNGQLYSPYHR  238

Query  409   VMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTF-CANGGGKEE  239
             VMM G E +Y+   FS  +    +E PEELVD+++PL FKPFDHFEFL F     G + E
Sbjct  239   VMMTGIETRYSTGFFSIPKAGYKIEAPEELVDEEHPLLFKPFDHFEFLEFYYTEAGQRAE  298

Query  238   SPINAFCGV  212
             S +  +CGV
Sbjct  299   SALKTYCGV  307



>ref|XP_004302943.1| PREDICTED: gibberellin 20 oxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=313

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/317 (42%), Positives = 209/317 (66%), Gaps = 7/317 (2%)
 Frame = -2

Query  1153  MATHTNP--KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAM  980
             M +HT P  K+PI++ + +N++ GT +W   S E++  LEEYGCF A+Y+KV  EL ++ 
Sbjct  1     MGSHTQPAAKVPIVDLSKENVKPGTDAWLLASKEIKYALEEYGCFEAIYNKVPLELHNST  60

Query  979   FKHCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWP  800
             F   + LF LPLETK ++TSD     Y G ++ +PL E  G+ +    E    F+  MWP
Sbjct  61    FSVLQDLFNLPLETKMQSTSDRPYHSYFGQYSFLPLYESLGVDNPTKIEGVQRFTSIMWP  120

Query  799   DADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPK  620
             + ++   FCE   SYSKLV +LD++V +MV E+YG+++ ++  + S++YLLR   YR P+
Sbjct  121   EGND--KFCESAHSYSKLVAELDEMVTKMVFENYGVERLYESHMASTTYLLRCFYYREPQ  178

Query  619   WNETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWS  440
              +ET  G  PH D +F++I+  ++I  L++++++G+WI+ +PS S  IV +AG+AFMAWS
Sbjct  179   LDETDMGLHPHTDKTFISILHQDEINGLQIKSKEGQWIDVEPSPSSFIV-MAGDAFMAWS  237

Query  439   NRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCA  260
             N R+ +  H+V+MK  + +Y++ LF+F  G +++P ELVD+ +PL +KPFDH  FL F  
Sbjct  238   NDRVRSCEHQVIMKEKKTRYSIGLFAF-NGVLQVPAELVDEKHPLLYKPFDHIGFLLFNK  296

Query  259   NGGG-KEESPINAFCGV  212
                G K + PI  +CGV
Sbjct  297   TPEGMKSKCPIKDYCGV  313



>ref|XP_007024335.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein, 
putative [Theobroma cacao]
 gb|EOY26957.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein, 
putative [Theobroma cacao]
Length=642

 Score =   284 bits (727),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 143/294 (49%), Positives = 193/294 (66%), Gaps = 4/294 (1%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             MAT +  KLP+I+  DD    GT SW +   EV+R  EEYGCF A YDKVS +L+D +F 
Sbjct  331   MATQSAIKLPVIDLFDDESEPGTDSWISKCEEVQRAFEEYGCFLATYDKVSLQLQDEVFD  390

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LP E K  NTSD   FGY  +  S+PL+E  GI +    E T +F+  MWP+ 
Sbjct  391   SVRELFHLPTEKKVLNTSDKPYFGYFKH-PSIPLSESMGIDNPTILEGTQSFTNLMWPNG  449

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +    FCE   +Y+KLV +LD++V  MV ESYG+ KY+D  IQS++YLLR IKYR+P+ +
Sbjct  450   NQI--FCESIYAYAKLVSELDRMVKTMVFESYGVRKYYDSHIQSTNYLLRLIKYRVPRED  507

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             E      PH D SFM I+  N I  L+++ +DG WI  +PS S  +V +AG+AF+AWSN 
Sbjct  508   ENDFDGCPHTDKSFMTILHDNHIAGLQIKAKDGNWIGVEPSGSMFVV-MAGDAFLAWSNG  566

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFL  272
             RI +P HRV+MK  +++Y +ALFSF   T+  PEELVD+ +PL FKPFD+ + L
Sbjct  567   RIQSPTHRVIMKAKKERYCLALFSFSGETIRTPEELVDEAHPLLFKPFDNMDLL  620


 Score =   276 bits (705),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 138/294 (47%), Positives = 191/294 (65%), Gaps = 4/294 (1%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             MA  +  +LP+I+  D+N   GT SW +   +VR  LEEYGCF   YDKVS +L+D +F 
Sbjct  1     MAPQSAVRLPVIDLFDENSVPGTASWVSKCKDVRLALEEYGCFLTPYDKVSLQLQDQVFN  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LP E K +NTSD   FGY  +   +PL+E  GI      E T +F+  MWP+ 
Sbjct  61    SVQELFALPTEKKVQNTSDKPYFGYFKH-PLIPLSESMGIDGPTVLEGTQSFTDLMWPNG  119

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +    FCE   +Y+KLV QLD+ V  MV ESYG+ KYFD  I S+SYLLR IKYR+PK  
Sbjct  120   NK--RFCESVHTYAKLVSQLDRRVKYMVFESYGVGKYFDSHIDSTSYLLRLIKYRLPKEE  177

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             ET     PH D SF+ I+  NQ+  LE++T+DG+WI  +PS S  IV +AG+AF+AWSN 
Sbjct  178   ETNNCGFPHTDKSFLTILHDNQVAGLEIKTKDGRWIGVEPSGSMFIV-MAGDAFLAWSNG  236

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFL  272
             R+++ +HRV+  G +++Y++  FSF   T+  PEEL+D+ +PL FKPF++ + L
Sbjct  237   RVHSALHRVVTNGKKERYSLGFFSFSGETIRTPEELIDEAHPLLFKPFENIDLL  290



>ref|XP_007216862.1| hypothetical protein PRUPE_ppa021358mg [Prunus persica]
 gb|EMJ18061.1| hypothetical protein PRUPE_ppa021358mg [Prunus persica]
Length=321

 Score =   274 bits (701),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 131/317 (41%), Positives = 201/317 (63%), Gaps = 6/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T  KLP+I+F++ ++  GTT W T   +V   LEEYGCF A+++KV   +R ++F 
Sbjct  1     MGSETPLKLPVIDFSNQSLTPGTTEWNTVRAQVHNALEEYGCFEALFNKVPPHIRKSIFP  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LPL+TK +N S     GY G +  +PL E  G+ D    E   + +  +WP  
Sbjct  61    SIEELFDLPLQTKLQNVSKKPFHGYVGQYPMVPLYESMGVDDANVYEQVQSLTNTLWPQG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +  P+FC+   S+S+ V +LDQ++ RM+LES GL+KY +  ++S++YLLR +KY+ P+ N
Sbjct  121   N--PSFCKTIQSFSEQVSELDQIIRRMILESLGLEKYLEEHLESTNYLLRVMKYKGPQTN  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             ETK G   H D + + I+  NQ+  LE++ +DGKWIN +PS    I  I G++  AW+N 
Sbjct  179   ETKLGLNAHTDKNIVTILYQNQVDGLEVQNKDGKWINVKPSPDSFIAMI-GDSLYAWTNG  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTF-C  263
             R+++P HRVMM G+E +Y+  LFS  +    ++ PEE+VD+++PL FKPFDH +FL F  
Sbjct  238   RLHSPYHRVMMSGNEVRYSTGLFSIPKEGYIIKAPEEVVDEEHPLLFKPFDHVQFLGFYY  297

Query  262   ANGGGKEESPINAFCGV  212
             +  G +  S +  +CGV
Sbjct  298   SEAGQRAHSALKTYCGV  314



>ref|XP_008228619.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Prunus mume]
Length=321

 Score =   274 bits (701),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 130/317 (41%), Positives = 200/317 (63%), Gaps = 6/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T PKLP+I+F++ ++  GTT W     +V   LEEYGCF A+++KV   +R ++F 
Sbjct  1     MGSETPPKLPVIDFSNQSLTPGTTEWNAVRAQVHNALEEYGCFEALFNKVPSHIRKSIFP  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LPL+TK +N S     GY G +  +PL E  G+      E   + +  +WP  
Sbjct  61    SIEELFDLPLQTKLQNVSKKPYHGYVGQYPMVPLYESMGVDGANVYEQVQSLTNTLWPRG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +  P+FC+   S+S+ V +LDQ++ RM+LES GL+KY +  ++S++YLLR +KY+ P+ N
Sbjct  121   N--PSFCKAIQSFSEQVSELDQIIRRMILESLGLEKYLEEHLESTNYLLRVMKYKGPQTN  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             ETK G   H D + + I+  NQ+  LE++ +DGKWIN +PS    I  I G++  AW+N 
Sbjct  179   ETKLGLNAHTDKNIVTILYQNQVDGLEVQNKDGKWINVKPSPDSFIAMI-GDSLYAWTNG  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTF-C  263
             R+++P HRVMM G+E +Y+  LFS  +    ++ PEE+VD+++PL FKPFDH +FL F  
Sbjct  238   RLHSPYHRVMMSGNEARYSTGLFSIPKEGYIIKAPEEVVDEEHPLLFKPFDHVQFLGFYY  297

Query  262   ANGGGKEESPINAFCGV  212
             +  G +  S +  +CGV
Sbjct  298   SEAGQRAHSALKTYCGV  314



>gb|KDP24591.1| hypothetical protein JCGZ_25507 [Jatropha curcas]
Length=314

 Score =   274 bits (700),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 141/318 (44%), Positives = 199/318 (63%), Gaps = 8/318 (3%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRV-GTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMF  977
             M + +N KLP+I+F+  N+   GT+ W +   +V + LEEYGCF AVYD V  +L + +F
Sbjct  1     MGSLSNSKLPVIDFSRANLEAAGTSGWVSKCKDVLKALEEYGCFVAVYDNVPLQLHEDLF  60

Query  976   KHCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPD  797
                + LF LP ETKR+N SDI   GY       P  E  GI    T E T +F+K MWP+
Sbjct  61    NVLEELFDLPPETKRKNVSDIPFNGYIEYVPDRPFFESMGITRAETLEDTQDFTKTMWPN  120

Query  796   ADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKW  617
              ++  NFC++  SYSK V +L Q+VM+M+L  YG++KY++P ++S++Y LRFI Y  P+ 
Sbjct  121   GND--NFCQNVHSYSKAVEELYQMVMKMILNGYGIEKYYEPHMESTTYSLRFINYN-PEE  177

Query  616   NETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSN  437
             NET    +PH+D SF+ I+  N I  LE++ ++G+WIN   + S  IV IAGE  M WSN
Sbjct  178   NETNMFMVPHKDKSFLTILHQNDINGLEIKPKNGQWINVDLAPSNFIV-IAGEGIMGWSN  236

Query  436   RRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCAN  257
              RI A  HRV M+  E + TV LFS+++G   +P+E VDDD+PL +KPFDH   L F A+
Sbjct  237   DRIDACEHRVRMESREKRRTVGLFSYIKGITHVPQEFVDDDHPLMYKPFDHIGLLYFLAS  296

Query  256   GGGKEES---PINAFCGV  212
               G   S    + A+ G+
Sbjct  297   PEGHSTSLSHTMKAYAGL  314



>ref|XP_010034855.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Eucalyptus grandis]
 gb|KCW53769.1| hypothetical protein EUGRSUZ_J03022 [Eucalyptus grandis]
Length=315

 Score =   274 bits (700),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 140/310 (45%), Positives = 197/310 (64%), Gaps = 5/310 (2%)
 Frame = -2

Query  1135  PKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLF  956
             P+L +IEF+ +N+  GT  W +TS  V   LEEYGCF A     + +  + +F     LF
Sbjct  9     PELSVIEFSRENLDPGTDLWISTSKRVVFALEEYGCFIATCSDFTSQAHNEIFHALDELF  68

Query  955   QLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNF  776
              LP E K RNTS+   FGY G   S+PL E  GI D  T +   +F+  +WP  +    F
Sbjct  69    DLPTEIKSRNTSEKPYFGYVGQHPSIPLYESLGIDDATTLKGVQSFTNLLWPAGNE--RF  126

Query  775   CEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGH  596
              +   ++SK V +L+Q+V RMV E YG+ KY+D  + SS+YLLRF+KYR P+ NET  G 
Sbjct  127   RDGALAFSKKVSELEQMVKRMVFERYGVKKYYDSHVMSSTYLLRFMKYRAPEMNETNRGC  186

Query  595   IPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPV  416
               H D SF+ I+  NQI  LE++T+DG WI F+PS S  +V +AG+AF+AWSN RI++P+
Sbjct  187   DVHTDKSFVTILHQNQIDGLEVKTKDGDWIAFEPSPSSFLV-MAGDAFLAWSNGRIHSPL  245

Query  415   HRVMMKGSED-KYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLT-FCANGGGKE  242
             H+V+MK  +  +Y++ LF+F  G +EIP+EL D +NPLKFK FDH+  L  FC +G  ++
Sbjct  246   HQVVMKEKKSPRYSLGLFTFHSGIIEIPQELADPENPLKFKAFDHYGLLRYFCQDGVPQD  305

Query  241   ESPINAFCGV  212
                  A+CGV
Sbjct  306   VCTAQAYCGV  315



>ref|XP_011072310.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Sesamum indicum]
Length=314

 Score =   274 bits (700),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 128/316 (41%), Positives = 199/316 (63%), Gaps = 4/316 (1%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T  KLP+I FT++N + GT +W  T  +V   L+EYGCF A YD+++  +   +F+
Sbjct  1     MGSLTLHKLPVIAFTEENSKPGTETWSKTCRQVISALQEYGCFVAAYDQITQRIHTGVFE  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF +P E K +N S    +GY G    +PL E  GI +  T E   +F+K MWP+ 
Sbjct  61    ALEELFDIPTERKVQNKSAKPLYGYVGQIPLIPLYESMGIDNANTLEGIQSFAKVMWPNG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             ++   F E    Y+KL  +L+++V++MV E YG+ +Y++  I S++YL R ++YR PK  
Sbjct  121   ND--GFSEKLLLYTKLAAELEKIVVQMVFEGYGVGQYYESHISSANYLCRVMQYRQPKMQ  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             E + G + H D SFM+ +  NQ+  LE++ +DG+W      S  ++V +AG+A MAWSN 
Sbjct  179   ENRMGFVSHTDKSFMSTIHQNQVDGLEIKAKDGEWFGVHDLSPSSLVVMAGDAIMAWSNN  238

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFL-RGTVEIPEELVDDDNPLKFKPFDHFEFLTFCAN  257
             RI +P HRV M+G+E +Y++A FSF+ +  V+ P+EL++DDNP ++KPFDH +FL F + 
Sbjct  239   RIRSPPHRVTMQGNEARYSLAQFSFIEKSMVQTPQELINDDNPQQYKPFDHLKFLEFYSK  298

Query  256   GGGKE-ESPINAFCGV  212
                +  ES I  +CGV
Sbjct  299   EENRRLESAIRTYCGV  314



>ref|XP_006427131.1| hypothetical protein CICLE_v10027420mg [Citrus clementina]
 gb|ESR40371.1| hypothetical protein CICLE_v10027420mg [Citrus clementina]
Length=314

 Score =   273 bits (697),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/317 (43%), Positives = 200/317 (63%), Gaps = 6/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T  K+P+I+ +  +++ GT++W +T  +VR   EE+GCF A+Y K+S E R  +  
Sbjct  1     MGSQTKSKIPVIDLSKQDLKSGTSTWLSTCKDVRHAFEEFGCFEAIYQKISQEFRSEVLA  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF +P+E K +NTS    F Y G +  +PL E   I    T  +T +F+  MWP  
Sbjct  61    STEELFDVPIEIKVKNTSTKPYFEYYGQYTIIPLYESLAIDYPDTRNATQSFTNLMWPAG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             ++   FCE + S S+LV +LD++V RM+ ESYG++ Y+D  I S +YLLR+ KYR P+ N
Sbjct  121   NDC--FCESSLSMSELVVELDKMVTRMLFESYGVEGYYDSYIGSVNYLLRYFKYRAPEPN  178

Query  613   ETKTGHIPHRDNSFMAIV-DTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSN  437
             ETK G  PH D +  +I+   N I  L+++ +DG+WI+ +PS S  IV +AG+A MAW N
Sbjct  179   ETKMGLTPHTDKTMTSIIHQINHINGLQVQAKDGEWIDVEPSPSSFIV-MAGDALMAWGN  237

Query  436   RRIYAPVHRVMM-KGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTF-C  263
              RI    H+V+M   SE +Y++ LFSF  G V+IP+EL D+  PLK+KPFDHF FL F  
Sbjct  238   DRIRPCRHQVIMDNASETRYSLGLFSFSSGVVDIPKELGDETQPLKYKPFDHFGFLHFNQ  297

Query  262   ANGGGKEESPINAFCGV  212
             +  G K  S I A+CG+
Sbjct  298   SEEGKKSASSIKAYCGI  314



>ref|XP_010110312.1| Gibberellin 3-beta-dioxygenase 4 [Morus notabilis]
 gb|EXC25832.1| Gibberellin 3-beta-dioxygenase 4 [Morus notabilis]
Length=315

 Score =   273 bits (697),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/319 (43%), Positives = 203/319 (64%), Gaps = 9/319 (3%)
 Frame = -2

Query  1153  MATHTNP--KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAM  980
             M T T+P  KLP+I+F+   ++ GT  W     +VR+ LEE+GCF A++ K+S + R A+
Sbjct  1     MGTETSPSVKLPVIDFSIQPLKPGT-EWDLVRSQVRQALEEFGCFEALFGKISLDTRRAI  59

Query  979   FKHCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWP  800
             F   + LF LPL+TK RN S     GY G +  MPL E   I D    E+  + +  +WP
Sbjct  60    FDTLQELFDLPLQTKLRNVSKKPFHGYVGQYPQMPLFESMAIDDANIHENVESLANILWP  119

Query  799   DADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPK  620
               +  PNFC+   SYS+ + +LDQ++ RM+LES G++KY +  + S++YLLR +KY+ P+
Sbjct  120   QGN--PNFCKIIQSYSEQLSELDQIIRRMILESLGVEKYLEEHLGSANYLLRVMKYKGPQ  177

Query  619   WNETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWS  440
               ETK G   H D + + I+  NQ+  LE++T+DG+WI+ +PS +  IV I G++  AW+
Sbjct  178   TKETKMGLSAHTDKNIVTILYQNQVEGLEVQTKDGEWISVKPSPNSFIVMI-GDSLYAWA  236

Query  439   NRRIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLT-  269
             N R+++P HRV+M GSE +Y+  LFS  +    V+ PEELVD+++PL FKPFDH EFL  
Sbjct  237   NGRLHSPCHRVIMTGSEARYSAGLFSIPKAGYIVKAPEELVDEEHPLLFKPFDHVEFLEF  296

Query  268   FCANGGGKEESPINAFCGV  212
             F    G + ES +  +CGV
Sbjct  297   FYREAGQRAESALKTYCGV  315



>emb|CDP19783.1| unnamed protein product [Coffea canephora]
Length=311

 Score =   272 bits (695),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 134/317 (42%), Positives = 203/317 (64%), Gaps = 9/317 (3%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + +N +LP+I  T++ +R G  SW      V R  EEYGCF AV+DK   E+ D++F 
Sbjct  1     MDSASNIRLPVINLTEEILRSGKDSWTEARNTVTRAFEEYGCFIAVHDKYPSEVSDSIFS  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LPLE K +NTS    FGY G    +PL E   I+D +  E+   F+ QMWP  
Sbjct  61    ELQDLFNLPLEIKVQNTSQTPLFGYYGPNPYLPLYESTSIEDAINLEAVQKFTNQMWPSK  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +N  +FCE    Y+    +LD++V ++V ESYG++KY +  + S +Y++RF KYR+P+ N
Sbjct  121   NN--HFCELLHCYANQAAELDKMVSKLVFESYGVEKYHESHVGSVTYIVRFTKYRVPEQN  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWI--NFQPSSSKTIVFIAGEAFMAWS  440
             ET  G +PH D +F+ I+  +    LE++ ++G WI  +F PSS   +V +AG+AF  WS
Sbjct  179   ETNVGVLPHTDKNFITILQQSDADGLEVQLKNGSWIPVDFPPSS---VVIMAGDAFSVWS  235

Query  439   NRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCA  260
             N R+++P HRV MKG + +Y++A F++ +  V+ P ELVDD++PL +KPFD+F FL F +
Sbjct  236   NGRVHSPFHRVTMKG-KGRYSIAQFAYCKKLVKTPTELVDDEHPLLYKPFDNFGFLRFTS  294

Query  259   -NGGGKEESPINAFCGV  212
              + G K ++P+ A+CGV
Sbjct  295   TDEGRKAQNPLKAYCGV  311



>ref|XP_003535849.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Glycine max]
Length=307

 Score =   271 bits (694),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 132/315 (42%), Positives = 197/315 (63%), Gaps = 9/315 (3%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M +   P LP+++FT ++++ GT SW +T   VR+  EE G F AVYDK S EL++ +F 
Sbjct  1     MGSEGKPMLPVLDFTIEDLKPGTNSWLSTCTSVRQAFEENGYFVAVYDKASIELQNGVFG  60

Query  973   HCKHLFQLPLETKRRNTSDIYGF-GYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPD  797
               K LF LP ETKRRN  +     GY G    +PL E  GI  G T E   +F+++MWP 
Sbjct  61    SMKELFDLPTETKRRNIFEGMPLKGYVGQHPKIPLHESMGIDPGTTLEGIQSFAEKMWPH  120

Query  796   ADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKW  617
              ++   FC+    Y+K+   L+++V+RM+ ESYGL +++D  I S++YLLR + ++  + 
Sbjct  121   GND--QFCKYIFEYAKVAEVLNRMVVRMIFESYGLLEHYDTFIGSTNYLLRLLAHKALEQ  178

Query  616   NETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSN  437
             NE + G + H D SF  I+  N +  L +ET +G WI+   SS  + V +AG+A MAWSN
Sbjct  179   NEPQLGFVAHTDKSFTTILHQNHVNALMVETTNGNWIDVDFSSPTSFVVMAGDALMAWSN  238

Query  436   RRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCAN  257
              RI +P H VMM G+E +Y++ LF+F RG +++PEEL+D+++PL++KPFDH   L F  +
Sbjct  239   DRIKSPNHMVMMNGNETRYSLGLFAFYRGILKVPEELIDEEHPLQYKPFDHLALLNFTYS  298

Query  256   GGGKEESPINAFCGV  212
                K      A+CGV
Sbjct  299   ANMK------AYCGV  307



>ref|XP_010665883.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Beta vulgaris subsp. vulgaris]
Length=319

 Score =   272 bits (695),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/308 (42%), Positives = 197/308 (64%), Gaps = 4/308 (1%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQ  953
             +LP I    +N   GT+SW +T   +++ LEEYGCF AVYDK S +L +      + +F+
Sbjct  10    QLPTINLGGENTNPGTSSWTSTCNNIKQALEEYGCFIAVYDKFSLDLHNKAIDVIQPMFE  69

Query  952   LPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFC  773
             LP E K RN+S++   GY      MPL E  GI+D +   +  +F+  +WP  ++   FC
Sbjct  70    LPTEVKARNSSNLPYHGYYKPGNPMPLLESLGIEDALMRNAVRSFTNLLWPSGNH--QFC  127

Query  772   EDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHI  593
             E    Y+K V +L+Q+V+RMV ESYG++KY +  + S+SYLLR  KYR+P+ NE   G +
Sbjct  128   ETIDQYAKKVAELEQLVLRMVFESYGVEKYHNSHLNSTSYLLRIAKYRVPQKNEHNLGAV  187

Query  592   PHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPVH  413
              H D +F+ I+  N +  LE++T+DG+W++   SS ++ + +AGE F+AWSN RI+AP+H
Sbjct  188   GHTDKNFITILHENDVNGLEVQTKDGEWLSID-SSPQSFIVMAGEPFLAWSNNRIHAPLH  246

Query  412   RVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANGGGKEE-S  236
             RV+MKG + +Y+ ALFS  + T+E P+ELVDD++PL+FKPFD+   L F      +    
Sbjct  247   RVIMKGDKPRYSFALFSTTKDTIETPKELVDDEHPLQFKPFDYMGLLQFYTEDVSRMAVC  306

Query  235   PINAFCGV  212
              I  +CG+
Sbjct  307   TIKDYCGI  314



>gb|ACU24369.1| unknown [Glycine max]
Length=307

 Score =   271 bits (694),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 132/315 (42%), Positives = 197/315 (63%), Gaps = 9/315 (3%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M +   P LP+++FT ++++ GT SW +T   VR+  EE G F AVYDK S EL++ +F 
Sbjct  1     MGSEGKPMLPVLDFTIEDLKPGTNSWLSTCTSVRQAFEENGYFVAVYDKASTELQNGVFG  60

Query  973   HCKHLFQLPLETKRRNTSDIYGF-GYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPD  797
               K LF LP ETKRRN  +     GY G    +PL E  GI  G T E   +F+++MWP 
Sbjct  61    SMKELFDLPTETKRRNIFEGMPLKGYVGQHPKIPLHESMGIDPGTTLEGIQSFAEKMWPH  120

Query  796   ADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKW  617
              ++   FC+    Y+K+   L+++V+RM+ ESYGL +++D  I S++YLLR + ++  + 
Sbjct  121   GND--QFCKYIFEYAKVAEVLNRMVVRMIFESYGLLEHYDTFIGSTNYLLRLLAHKALEQ  178

Query  616   NETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSN  437
             NE + G + H D SF  I+  N +  L +ET +G WI+   SS  + V +AG+A MAWSN
Sbjct  179   NEPQLGFVAHTDKSFTTILHQNHVNALMVETTNGNWIDVDFSSPTSFVVMAGDALMAWSN  238

Query  436   RRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCAN  257
              RI +P H VMM G+E +Y++ LF+F RG +++PEEL+D+++PL++KPFDH   L F  +
Sbjct  239   DRIKSPNHMVMMNGNETRYSLGLFAFYRGILKVPEELIDEEHPLQYKPFDHLALLNFTYS  298

Query  256   GGGKEESPINAFCGV  212
                K      A+CGV
Sbjct  299   ANMK------AYCGV  307



>ref|XP_007217562.1| hypothetical protein PRUPE_ppa021035mg [Prunus persica]
 gb|EMJ18761.1| hypothetical protein PRUPE_ppa021035mg [Prunus persica]
Length=313

 Score =   271 bits (694),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 136/318 (43%), Positives = 193/318 (61%), Gaps = 9/318 (3%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M +   PKLP+++F+ + ++ GT  W +   +VR+ LEE+GCF A+YDK+S E R+A   
Sbjct  1     MGSEGQPKLPVLDFSKEALKPGTNPWLSVCKDVRQALEEFGCFVALYDKISPEFRNAFLG  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LP  TK  N  +    GY G    +PL E  GI +    E T  F+K MWP  
Sbjct  61    ALQELFDLPTRTKMTNKYEKPLNGYVGQIPKLPLHESLGIDNATNLEETQKFTKLMWPGG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             ++   FCE   S++K+  +LDQ+V RM+ ESYG++KY++  + S SYLLR +K R P+ N
Sbjct  121   ND--KFCESAYSFAKVAEELDQMVTRMIFESYGVEKYYESYVGSISYLLRLLKNRSPQEN  178

Query  613   ETKTGHIPHRDNSFMAIV-DTNQIGCLEMETRDGKWI--NFQPSSSKTIVFIAGEAFMAW  443
             E   G + H D SF  I+   N +  LE+ETR  +WI   F PSS    + +AG+A MAW
Sbjct  179   EPSLGFVAHTDKSFTTILYQNNHVNALEVETRSHEWIRVEFPPSS---FIVMAGDALMAW  235

Query  442   SNRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFC  263
             SN RI +P HRV+M G+E +Y++A FSF  G + +PEEL D+++PL++K FDH   L F 
Sbjct  236   SNDRILSPNHRVIMSGNETRYSLAQFSFSDGEIHVPEELADEEHPLRYKSFDHPGLLRFF  295

Query  262   ANGGG-KEESPINAFCGV  212
              N       S I A+CGV
Sbjct  296   RNDDRFNSNSAIKAYCGV  313



>ref|XP_007216816.1| hypothetical protein PRUPE_ppa023108mg [Prunus persica]
 gb|EMJ18015.1| hypothetical protein PRUPE_ppa023108mg [Prunus persica]
Length=321

 Score =   272 bits (695),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 129/317 (41%), Positives = 198/317 (62%), Gaps = 6/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T  +LP+I+F++ ++  GT  W T   +V   LEEYGCF A++ KV   +R ++F+
Sbjct  1     MGSETPLRLPVIDFSNQSLTPGTREWNTVRAQVHNALEEYGCFEALFTKVPSHIRKSIFQ  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + L  LPL+TK +N S     GYAG    MPL E  GI      E   + +  +WP  
Sbjct  61    SIEDLLDLPLQTKLKNVSRKPYRGYAGQLPMMPLYESMGIDGANVYEQVQSLANTLWPQG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +  P+FC+   S+++ V +LDQ++ RM+LES GL +Y +  + S+ YLLR +KY+ P+ N
Sbjct  121   N--PSFCKTIQSFTEKVSELDQIIRRMILESLGLKEYLEEHLNSTDYLLRVMKYKAPQTN  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             ETK G  PH D + + I+  NQ+  LE++T+DGKWIN +PSS   I  I GE+  AW+N 
Sbjct  179   ETKLGLPPHTDKNIVTILYQNQVDGLEVQTKDGKWINVKPSSDSFIALI-GESLHAWTNG  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTFCA  260
             R+++P+HRVMM G+E +Y+  LFS  +    ++ P E+VD+++PL FKP++H +F+ FC 
Sbjct  238   RLHSPIHRVMMNGNEIRYSTGLFSAPKEGYIIKAPNEVVDEEHPLLFKPYEHAQFIAFCN  297

Query  259   NGGGKEES-PINAFCGV  212
             +  G+     +  FCGV
Sbjct  298   SEAGQRGPFSLKTFCGV  314



>ref|XP_009603180.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Nicotiana 
tomentosiformis]
Length=316

 Score =   271 bits (694),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 133/295 (45%), Positives = 195/295 (66%), Gaps = 5/295 (2%)
 Frame = -2

Query  1087  TTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQLPLETKRRNTSDIYG  908
             +T+W +   EVRR LEEYGCF AVYD VS EL   +F+    LF LP E+K RNTS+   
Sbjct  24    STNWFSACDEVRRALEEYGCFLAVYDSVSPELNIDIFQAVVELFDLPTESKLRNTSEKPF  83

Query  907   FGYAGNFASMPLAEYFGIK--DGVTPESTMNFSKQMWPDADNTPNFCEDTTSYSKLVWQL  734
             +GY GN +  PL E  GI   D +T E   NF+  MWP  ++  +F E    Y+ +V  L
Sbjct  84    YGYYGNISDFPLQESLGINIGDAITAEGVQNFTSLMWPTGND--HFSEIIHDYANIVADL  141

Query  733   DQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHIPHRDNSFMAIVDT  554
             +++V RMV+ESYG++  +D L +S++YLLR IKYR PK +E+  G   H D +F++I+  
Sbjct  142   EKMVKRMVIESYGVENCYDFLDKSTTYLLRLIKYRTPKLDESNVGSQVHTDKTFLSILHQ  201

Query  553   NQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPVHRVMMKGSEDKYTV  374
             NQ+  LE++T+DG+W+    + + + + + GEAF AWSN R++ PVHRV++K ++ +YT+
Sbjct  202   NQVNGLEVKTKDGEWMAIDMTPANSFLVMVGEAFSAWSNNRLHCPVHRVIVKENKPRYTL  261

Query  373   ALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANGGGKE-ESPINAFCGV  212
             A FS++ G ++ PEELVD+ +P KF+PFD+FE L F A    ++ E  + AFCGV
Sbjct  262   AHFSYINGMIQTPEELVDEKHPKKFQPFDNFELLDFFAKHVNEQMEYTVRAFCGV  316



>gb|KEH28749.1| 2-oxoglutarate-dependent dioxygenase [Medicago truncatula]
Length=315

 Score =   271 bits (694),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 130/317 (41%), Positives = 201/317 (63%), Gaps = 5/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M T   PKLPII+F + N+   + +W     +V + L EYGCF AV+DKV  +LR A+F 
Sbjct  1     MGTEATPKLPIIDFNNLNLEAKSPNWELVKSQVYKALVEYGCFEAVFDKVPLDLRKAIFA  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LPLETK  N S     GY G +  +PL E  GI D    E   + +  +WPD 
Sbjct  61    SLQELFDLPLETKLLNVSKKPYHGYVGQYPMIPLFESMGIDDANILEKVDSMTNNLWPDG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +   NF +   S+S+ + +LDQ++ +M+LES G++KY +  + S++YLLR +KY+ P+ +
Sbjct  121   NQ--NFSKTIHSFSEELTELDQIIRKMILESLGVEKYLEEHMNSTNYLLRVMKYKGPQTS  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             +TK G   H D + + I+  NQ+  LE+ T+DG+WI+++PSSS + V + G++  AWSN 
Sbjct  179   DTKLGLSTHSDKNVVTILYQNQVEGLEVMTKDGQWISYKPSSSGSFVAMIGDSIHAWSNG  238

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLT-FC  263
             R+++P HRVMM G+E +Y+  LFS  +G   ++ PEELVD+++PL F+P+DH EFL  + 
Sbjct  239   RLHSPFHRVMMSGNEARYSTGLFSIPKGGYIIKAPEELVDEEHPLLFRPYDHVEFLKYYY  298

Query  262   ANGGGKEESPINAFCGV  212
                G +++  +  +CGV
Sbjct  299   TEKGQRDQFAMRTYCGV  315



>gb|EYU21582.1| hypothetical protein MIMGU_mgv1a010360mg [Erythranthe guttata]
Length=314

 Score =   271 bits (694),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 136/317 (43%), Positives = 204/317 (64%), Gaps = 6/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M +  NP LPII+F++ N+  G+ SW TT+ +V   LE+YGCF A Y K S E+  ++F 
Sbjct  1     MGSLENPTLPIIDFSEKNLEPGSPSWFTTAEKVVHALEDYGCFIATYSKFSPEMHRSIFG  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LP + K  NTS     GY G    +PL E  GI++  T      F+  +WP  
Sbjct  61    VSEQLFDLPTDVKILNTSGTPSHGYVGQEPIIPLYEGLGIENATTHTGVETFTSLLWPSG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             ++  +F E    YS+LV +L+Q VMRMV ++YG++  +  L+ ++SYLLRFIKYR P  +
Sbjct  121   NH--HFGETALEYSRLVAELEQEVMRMVSKNYGIEDSYQSLVGATSYLLRFIKYRAPGKD  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             ET  G +PH D SFM+I+   Q+  L+++T++G W+   PS S  +V +AG+A MAW+N 
Sbjct  179   ETGLGIVPHTDKSFMSILHQRQVKGLQIQTKNGDWLLVDPSPSYFVV-MAGDACMAWTNG  237

Query  433   RIYAPVHRVMM-KGSEDKYTVALFSFLRGT-VEIPEELVDDDNPLKFKPFDHFEFLTFCA  260
             RI    HRV++ +GSED+Y++ LF+F++   +++PEELVDDDNP +FKPFDH++++ F  
Sbjct  238   RIEPSKHRVIIDEGSEDRYSLGLFTFIKDVKIQVPEELVDDDNPSRFKPFDHYKYIHFYY  297

Query  259   NGGGKE-ESPINAFCGV  212
                GK  + PI  +CG+
Sbjct  298   TEEGKRSKCPIKDYCGI  314



>ref|XP_002298129.1| 2-oxoglutarate-dependent dioxygenase-related family protein [Populus 
trichocarpa]
 gb|EEE82934.1| 2-oxoglutarate-dependent dioxygenase-related family protein [Populus 
trichocarpa]
Length=314

 Score =   271 bits (693),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 133/317 (42%), Positives = 196/317 (62%), Gaps = 6/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T  KLPII+F++     G   W     +VR+ LEEYGCF A++DK+  E R A+F 
Sbjct  1     MGSETPLKLPIIDFSNLGQNPGAAEWDLVKLQVRKALEEYGCFEALFDKIPAESRKAIFG  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LPL+TK RN S     GY G +  +PL E  GI D    E   + +  +WP  
Sbjct  61    AVEELFDLPLQTKMRNASKKPYHGYVGQYPQVPLFESMGIDDANIAEEVESMTTILWPQG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             + +  F     S+S+ V +LDQ+V RM++ES GL+KY D  + S++YLLR +KY+ P+  
Sbjct  121   NQS--FSNTVLSFSEQVSELDQIVRRMIVESLGLEKYLDEHMNSTNYLLRVMKYKGPQTT  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             ETK G   H D + + I+  NQ+  LE++T+DG WI+ +P+    IV I G++  AW+N 
Sbjct  179   ETKLGLTAHTDKNMVTILYQNQVDGLELQTKDGCWIDLKPTPDSFIVMI-GDSLHAWANG  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTF-C  263
             R+++P HRVMM+G+E +Y+V LFS  +    V+ PEEL+D+++PL FKPFDH +FL F  
Sbjct  238   RLHSPYHRVMMRGNEARYSVGLFSVPKAGYIVKAPEELIDEEHPLLFKPFDHVKFLGFYY  297

Query  262   ANGGGKEESPINAFCGV  212
                G + +S +  +CGV
Sbjct  298   TEAGQRAQSALKTYCGV  314



>gb|AFK40822.1| unknown [Medicago truncatula]
Length=315

 Score =   271 bits (693),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 130/317 (41%), Positives = 201/317 (63%), Gaps = 5/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M T   PKLPII+F + N+   + +W     +V + L EYGCF AV+DKV  +LR A+F 
Sbjct  1     MGTEATPKLPIIDFNNLNLEAKSPNWELVKSQVYKALVEYGCFEAVFDKVPLDLRKAIFA  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LPLETK  N S     GY G +  +PL E  GI D    E   + +  +WPD 
Sbjct  61    SLQELFYLPLETKLLNVSKKPYHGYVGQYPMIPLFESMGIDDANILEKVDSMTNNLWPDG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +   NF +   S+S+ + +LDQ++ +M+LES G++KY +  + S++YLLR +KY+ P+ +
Sbjct  121   NQ--NFSKTIHSFSEELTELDQIIRKMILESLGVEKYLEEHMNSTNYLLRVMKYKGPQTS  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             +TK G   H D + + I+  NQ+  LE+ T+DG+WI+++PSSS + V + G++  AWSN 
Sbjct  179   DTKLGLSTHSDKNVVTILYQNQVEGLEVMTKDGQWISYKPSSSGSFVAMIGDSIHAWSNG  238

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLT-FC  263
             R+++P HRVMM G+E +Y+  LFS  +G   ++ PEELVD+++PL F+P+DH EFL  + 
Sbjct  239   RLHSPFHRVMMSGNEARYSTGLFSIPKGGYIIKAPEELVDEEHPLLFRPYDHVEFLKYYY  298

Query  262   ANGGGKEESPINAFCGV  212
                G +++  +  +CGV
Sbjct  299   TEKGQRDQFAMRTYCGV  315



>ref|XP_008228622.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Prunus 
mume]
Length=312

 Score =   271 bits (692),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 134/317 (42%), Positives = 193/317 (61%), Gaps = 8/317 (3%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M +   PKLP+++F+ + ++ GT SW     +VR+ LEE+GCF  +YDK+S E R+A   
Sbjct  1     MGSEGQPKLPVLDFSKEALKPGTNSWLLACKDVRQALEEFGCFVVLYDKISPEFRNAFLV  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LP +TK  N  +    GY G    +PL E  GI +      T  F+K MWP  
Sbjct  61    ALQELFDLPTQTKMTNKYEKPLNGYVGQIPKLPLHESLGIDNATKLVETQKFTKLMWPGG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             ++   FCE   S++K+  +LDQ+V RM+ ESYG++KY++  + S SYLLR +K R P+ N
Sbjct  121   ND--KFCESAYSFAKVAEELDQMVTRMIFESYGVEKYYESYVGSISYLLRLLKNRSPQEN  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWI--NFQPSSSKTIVFIAGEAFMAWS  440
             E   G + H D SF  I+  N +  LE+ETR  +WI   F PSS    + +AG+A MAWS
Sbjct  179   EPSLGFVAHTDKSFTTILYQNHVNALEVETRSHEWIRVEFPPSS---FIVMAGDALMAWS  235

Query  439   NRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFC-  263
             N RI +P HRV+M G+E +Y++A FSF  G + +PEEL D+++PL++K FDH   L F  
Sbjct  236   NDRILSPNHRVIMSGNETRYSLAQFSFSDGAIHVPEELADEEHPLRYKSFDHPGLLRFFR  295

Query  262   ANGGGKEESPINAFCGV  212
             ++      S I A+CGV
Sbjct  296   SDDRFNSNSAIKAYCGV  312



>gb|KHN31409.1| Gibberellin 20 oxidase 1 [Glycine soja]
Length=307

 Score =   270 bits (691),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 131/315 (42%), Positives = 197/315 (63%), Gaps = 9/315 (3%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M +   P LP+++FT ++++ GT SW +T   VR+  EE G F AVYDK S EL++ +F 
Sbjct  1     MGSEGKPMLPVLDFTIEDLKPGTNSWLSTCTSVRQAFEENGYFVAVYDKASIELQNGVFG  60

Query  973   HCKHLFQLPLETKRRNTSDIYGF-GYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPD  797
               K LF LP ETKRRN  +     GY G    +PL E  GI  G T E   +F++++WP 
Sbjct  61    SMKELFDLPTETKRRNIFEGMPLKGYVGQHPKIPLHESMGIDPGTTLEGIQSFAEKLWPH  120

Query  796   ADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKW  617
              ++   FC+    Y+K+   L+++V+RM+ ESYGL +++D  I S++YLLR + ++  + 
Sbjct  121   GND--QFCKYIFEYAKVAEVLNRMVVRMIFESYGLLEHYDTFIGSTNYLLRLLAHKALEQ  178

Query  616   NETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSN  437
             NE + G + H D SF  I+  N +  L +ET +G WI+   SS  + V +AG+A MAWSN
Sbjct  179   NEPQLGFVAHTDKSFTTILHQNHVNALMVETTNGNWIDVDFSSPTSFVVMAGDALMAWSN  238

Query  436   RRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCAN  257
              RI +P H VMM G+E +Y++ LF+F RG +++PEEL+D+++PL++KPFDH   L F  +
Sbjct  239   DRIKSPNHMVMMNGNETRYSLGLFAFYRGILKVPEELIDEEHPLQYKPFDHLALLNFTYS  298

Query  256   GGGKEESPINAFCGV  212
                K      A+CGV
Sbjct  299   ANMK------AYCGV  307



>ref|XP_007145554.1| hypothetical protein PHAVU_007G248400g [Phaseolus vulgaris]
 gb|ESW17548.1| hypothetical protein PHAVU_007G248400g [Phaseolus vulgaris]
Length=309

 Score =   270 bits (691),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 130/311 (42%), Positives = 197/311 (63%), Gaps = 11/311 (4%)
 Frame = -2

Query  1138  NPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHL  959
             +P+LP+++F+ + ++ G+ SW      VR+  EE+GCF AVYDKV  ELR+ +F   K L
Sbjct  8     HPRLPVLDFSTEELKPGSDSWLERCRSVRKAFEEHGCFVAVYDKVCDELRNDVFCSMKEL  67

Query  958   FQLPLETKRRNTSDIYGF-GYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTP  782
             F L +ETKRRNT +     GY G    +PL +  GI  G T E   +F+ +MWP  ++  
Sbjct  68    FDLSVETKRRNTYEGAPLKGYVGQHPKIPLHQSMGIDQGTTLEGIQSFAHKMWPKGND--  125

Query  781   NFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKT  602
              FC+    Y+K+  +LD  V RM+ ESYGL +Y++  I S+SYLLR +K+  P+  E + 
Sbjct  126   QFCKHIIEYAKVAEELDGKVARMIFESYGLSEYYESYIGSTSYLLRLLKHTAPEEVEPQL  185

Query  601   GHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYA  422
             G + H D SF  I+  N +  L +ETR+G WI+   SS+ + V +AG+A MAWSN RI +
Sbjct  186   GFLAHTDKSFTTILHQNHVNALMVETRNGVWIDVDFSSTNSFVVMAGDALMAWSNDRIQS  245

Query  421   PVHRVMMKGSED-KYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANGGGK  245
             P H+V+MK  ED +Y++ LF+F +G +++PEEL+D+++P+ +KPFDH   L F +     
Sbjct  246   PNHKVVMKNGEDTRYSLGLFAFYKGIMKVPEELIDEEHPVHYKPFDHLGLLNFYS-----  300

Query  244   EESPINAFCGV  212
               + + A+CGV
Sbjct  301   --ANMKAYCGV  309



>ref|XP_004165032.1| PREDICTED: gibberellin 20 oxidase 1-B-like [Cucumis sativus]
Length=321

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/309 (44%), Positives = 201/309 (65%), Gaps = 6/309 (2%)
 Frame = -2

Query  1153  MATH-TNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMF  977
             MAT+ ++ +LP+++F   N++ GT  W +T+ +VR  LEEYGCF A+YD VS E+   MF
Sbjct  1     MATNMSDEQLPVVKFCSQNLKSGTEEWVSTTKKVREALEEYGCFVALYDTVSAEVSSNMF  60

Query  976   KHCKHLF-QLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWP  800
                K LF ++PLE K +N S+    GY G    MP+ E  GI+  + P +  +F+  MWP
Sbjct  61    DSLKELFDEVPLERKLQNVSEKPYHGYFGQNPLMPIHESMGIEHPILPTNINSFTNLMWP  120

Query  799   DADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPK  620
                N  +F E+ T+Y+ LV +LD+ V  MV ESYG+       ++S+ YL+R IKYR+PK
Sbjct  121   SRGNH-SFRENVTAYANLVSELDKRVKSMVFESYGVGNALRSHMESTKYLMRMIKYRVPK  179

Query  619   WNETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQP---SSSKTIVFIAGEAFM  449
               E   G  PH D SF+ I+  N++  L+++TRD KWI + P   SS+ + + +AG+AF 
Sbjct  180   EKEMNLGAFPHTDKSFLTILHQNEVNGLQIKTRDNKWIQYHPFSSSSTSSFIVMAGDAFF  239

Query  448   AWSNRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLT  269
             AWSN RIY+P HRV+M G++++Y+V LFSF  G V+IP+ELVDD +P  FKPFDH ++L 
Sbjct  240   AWSNGRIYSPPHRVIMSGNKERYSVGLFSFNNGIVQIPKELVDDKHPQLFKPFDHQDYLR  299

Query  268   FCANGGGKE  242
             F +   G++
Sbjct  300   FYSTERGQK  308



>ref|XP_006465422.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Citrus sinensis]
 gb|KDO58206.1| hypothetical protein CISIN_1g046776mg [Citrus sinensis]
Length=314

 Score =   270 bits (691),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/317 (41%), Positives = 198/317 (62%), Gaps = 6/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M +    KLPI++ + +N++ G++SW+T   E+R  LEEYGCF A+YDK   E R+ +F 
Sbjct  1     MGSEAAQKLPIVDLSQENLKPGSSSWQTACNEIRLALEEYGCFVALYDKHLPEFRNKVFD  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LP ETK +N +     GY G  ++ PL E  GI+          F+  MWP  
Sbjct  61    SLEELFDLPQETKMKNVNPKPAHGYMGKISAFPLHEGMGIEYATNRGECEKFTSLMWPQG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +    FCE   +Y+ +V +L Q+VM+M+ ESYG++K ++   +S++YLLRF+KYR  + +
Sbjct  121   NY--QFCEVAHTYANIVAELQQLVMKMLFESYGIEKLYESQKESTTYLLRFLKYRKSQTD  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
              T      H D S ++I+ +N +  LE+ T+DG+WI+F+PS S + V IAG+  MAWSN 
Sbjct  179   TTNLAFKGHTDKSLVSILHSNHVKGLELRTKDGEWIHFEPSPS-SFVIIAGDVCMAWSND  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANG  254
             RI +  HRV++ G E +Y + LFSFL G ++ PEELVDD++PL++KPFDH   L F  + 
Sbjct  238   RIKSCYHRVIVDGPEVRYALGLFSFLSGVIQTPEELVDDEHPLQYKPFDHAGLLQFYLSN  297

Query  253   GGK---EESPINAFCGV  212
               +   E + + A+CG+
Sbjct  298   SDQNKGERNMMKAYCGI  314



>emb|CAN66061.1| hypothetical protein VITISV_007808 [Vitis vinifera]
Length=330

 Score =   270 bits (690),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/326 (42%), Positives = 201/326 (62%), Gaps = 20/326 (6%)
 Frame = -2

Query  1141  TNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKH  962
             T PK+P+++F+ +N++ GT SW      VR  LEEYGCF AVYD+V   + + +F   + 
Sbjct  9     TLPKIPMVDFSKENLKPGTDSWLPACNNVRHALEEYGCFMAVYDQVPLGVHNTIFGAMRE  68

Query  961   LFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTP-ESTMNFSKQMWPDADNT  785
             LF LP+ETK++N S+    GY     + PL +  GI +  T  E    F+K MWP  +  
Sbjct  69    LFDLPIETKKQNISEKPYQGYTSESPAXPLHQGLGIDNVTTXLEEIRXFAKIMWPAGNE-  127

Query  784   PNFC--------------EDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLL  647
              NFC              +    YSKLV +LD++V+RMVLESYG++      I+S+S+L+
Sbjct  128   -NFCYSFISDIFSSXLISQSVHCYSKLVAELDRMVVRMVLESYGIEN--GSHIZSASFLV  184

Query  646   RFIKYRMPKWNETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFI  467
             R +K R+PK NET      H D SF++I+  N++  LE++T+DGKWI+ +P S +  + +
Sbjct  185   RLLKSRVPKMNETNKAFPSHSDKSFISILHQNKVNGLEIQTKDGKWISHEPPSLQVFLVM  244

Query  466   AGEAFMAWSNRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFD  287
             AGE   AWSN RI+   HRV++KG+E +Y + LFS + G +++PEELVDD +PL+FKPFD
Sbjct  245   AGEVLTAWSNGRIHPARHRVVVKGNEARYALGLFSTINGMIKVPEELVDDHHPLQFKPFD  304

Query  286   HFEFLTFCANGGGKE-ESPINAFCGV  212
             H   L F     G+  E+ + A+CG+
Sbjct  305   HTGLLHFLGTKEGRNPETALKAYCGL  330



>emb|CDP08458.1| unnamed protein product [Coffea canephora]
Length=313

 Score =   269 bits (688),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/309 (42%), Positives = 195/309 (63%), Gaps = 6/309 (2%)
 Frame = -2

Query  1129  LPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQL  950
             LP I+F++  ++ G   W     +VR+ LEEYGCF A++DK+  EL+ ++F   + LF L
Sbjct  8     LPTIDFSNPGLKPGAPEWDLVKDQVRKALEEYGCFEALFDKIPLELQKSLFDALEELFDL  67

Query  949   PLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFCE  770
             PL+TK RN+S     GY G +  +PL E  GI D    E   +F+  +WP+ ++  NFC+
Sbjct  68    PLQTKVRNSSKKPFHGYVGQYPMVPLYESMGIDDATISEKVESFTDLLWPEGNS--NFCK  125

Query  769   DTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHIP  590
                SYS  +  LD++V RM+LES G +KY D  + S++YLLR +KY+ P+  E K G   
Sbjct  126   TVHSYSDQLSDLDKIVRRMILESLGAEKYMDEHMDSTNYLLRVMKYKGPQTTEPKLGLNA  185

Query  589   HRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPVHR  410
             H D + + I+  NQ+  LE+ T+DG WI+ +PS    IV I G++ +AW+N R+++P H+
Sbjct  186   HTDKNIVTILSQNQVQGLELLTKDGHWIDVKPSPGSFIVMI-GDSLLAWTNGRLHSPYHQ  244

Query  409   VMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTF-CANGGGKEE  239
             VMM G+E +Y+  LFS  +    ++ PEELVD+++PL FKPFDH EFL+F     G + +
Sbjct  245   VMMTGNEARYSAGLFSIPKAGYIIKAPEELVDEEHPLLFKPFDHVEFLSFYYTEAGQRAQ  304

Query  238   SPINAFCGV  212
             S +  +CGV
Sbjct  305   SALKTYCGV  313



>ref|XP_010061959.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Eucalyptus 
grandis]
 gb|KCW69006.1| hypothetical protein EUGRSUZ_F02566 [Eucalyptus grandis]
Length=313

 Score =   269 bits (688),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 135/317 (43%), Positives = 198/317 (62%), Gaps = 7/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T P +P I+ T +N +  ++SW TT  +VR  LEE+G F A YDK+S  LR+ +  
Sbjct  1     MGSQTMP-IPTIDLTLENSKPQSSSWVTTCNDVRLALEEHGWFVAKYDKLSPHLREVILS  59

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
                 LF+LP ETK +NTSD   FGY G  A++PL E  GI           F+K MWP  
Sbjct  60    DVVELFKLPYETKIQNTSDKPAFGYVGKIAAIPLHEGLGIDRATDLGECQKFTKLMWPSG  119

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             ++   FCE+   Y+K V +L+Q V+RM+ ESYG++K+ +  + +++YLLRF+ YR P+ +
Sbjct  120   ND--RFCENAQLYAKTVAELEQTVVRMLFESYGVEKHCESHLGATTYLLRFLNYRRPEND  177

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             E     + H D SF++I+  N +  LE+  +DG+WI F+PS S  +V +AG+A MAWSN 
Sbjct  178   EANLAFVTHTDKSFISILHQNHVRGLELRNKDGEWIGFEPSPSSFLV-LAGDACMAWSNN  236

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANG  254
             R+    HRV+MKG+E +Y + LFSF  G +E PEEL+DD++P+++KPFDH   L F    
Sbjct  237   RVRPGYHRVVMKGNEARYALGLFSFRGGLIETPEELIDDEHPMQYKPFDHVGLLRFYDTV  296

Query  253   GGKEESP---INAFCGV  212
               +E +      A+CGV
Sbjct  297   DVRERAKHTMTKAYCGV  313



>ref|XP_011045369.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Populus euphratica]
Length=314

 Score =   269 bits (688),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 132/317 (42%), Positives = 196/317 (62%), Gaps = 6/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T  KLPII+F++     G   W     +VR+ LEEYGCF A++DK+  E R A+F 
Sbjct  1     MGSETALKLPIIDFSNLGQNPGAAEWDLVKLQVRKALEEYGCFEALFDKIPAESRKAIFG  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LPL+TK RN S     GY G +  +PL E  GI D    E     +  +WP  
Sbjct  61    AVEELFDLPLQTKMRNASRKPYHGYVGQYPQVPLFESMGIDDANIAEEVERTTAILWPQG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             + +  F     S+SK V +LDQ+V RM++ES GL+KY D  + S++YLLR +KY++P+  
Sbjct  121   NQS--FSNTVLSFSKQVSELDQIVRRMIVESLGLEKYLDEHMNSTNYLLRVMKYKVPQTT  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             ETK G   H D + + I+  NQ+  LE++T+DG W + +P+    IV I G++  AW+N 
Sbjct  179   ETKLGLSSHTDKNMVTILCQNQVDGLELQTKDGCWTDLKPNPDSFIVMI-GDSLYAWANG  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLT-FC  263
             R+++P HRVMM+G+E +Y++ LF+  +    V+ PEEL+D+++PL FKPFDHFEFL  + 
Sbjct  238   RLHSPYHRVMMRGNEVRYSLGLFAVPKAGYIVKAPEELIDEEHPLLFKPFDHFEFLGYYY  297

Query  262   ANGGGKEESPINAFCGV  212
                G  ++S +  +CGV
Sbjct  298   TEAGQTDQSALKTYCGV  314



>ref|XP_010061960.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Eucalyptus grandis]
Length=318

 Score =   269 bits (687),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 135/316 (43%), Positives = 202/316 (64%), Gaps = 5/316 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             MA+  +  +P+I+F   +++ GT++W +T  ++  GLEE+GCF A+Y  V  EL DA FK
Sbjct  1     MASLISAVVPVIDFNGKDLKQGTSAWDSTMKQMCHGLEEFGCFIALYAGVPPELDDATFK  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
                 LF LP E K +N +D    GY G  + +PL E  GI +   PE    F+K MWP  
Sbjct  61    AADELFDLPTEIKSQNVNDKPYHGYVGQVSIIPLHEGLGIDNATDPEEVGKFTKLMWPHG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             ++  +F E   SYS  V +LD +V+RM+ E+YG++K++D  + S SYLLRF+KYR P+  
Sbjct  121   ND--HFGEVAYSYSMKVAELDHMVVRMIFENYGVEKHYDSHVASKSYLLRFLKYRAPETI  178

Query  613   ETKTGHIP-HRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSN  437
             +     IP H D +F++I+  N+I  LE++T++G+WI F    +  +V +AG+A M WSN
Sbjct  179   DQGDNAIPRHTDKTFLSILHQNRINGLEIKTKEGEWIGFDLPPNAFVV-MAGDALMGWSN  237

Query  436   RRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCAN  257
              RI +  HRV MK S  +YT+ LFSFL G V++P+ELVD+++PLK+KPFD+   + F A+
Sbjct  238   DRIRSCDHRVAMKASTTRYTLGLFSFLSGIVQVPQELVDENHPLKYKPFDNVAMIHFYAS  297

Query  256   GGG-KEESPINAFCGV  212
               G K E  + A+CG+
Sbjct  298   DEGRKHEYTVKAYCGI  313



>ref|XP_007024009.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Theobroma cacao]
 gb|EOY26631.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Theobroma cacao]
Length=316

 Score =   269 bits (687),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 134/317 (42%), Positives = 195/317 (62%), Gaps = 6/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T  KLP+I+FT  +++ GTT W     +V++ L+EYGCF A+++++  ++R+ +F 
Sbjct  1     MGSETPLKLPVIDFTKPDLKPGTTEWDLVKGQVQQALQEYGCFEALFNRIPLDVRETIFG  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LPLETK  N S     GY G +   PL E  GI D    E     ++ +WP+ 
Sbjct  61    ALEELFDLPLETKICNVSKKPYHGYVGQYPQAPLYESLGIDDANIIEKVEAQTRALWPEG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             + +  F     S+SK + +LDQ + RM+LESY LDKY D  + S+ YLLR +KY+ PK  
Sbjct  121   NKS--FSNIIQSFSKQLAELDQTIRRMILESYDLDKYMDEHLDSTKYLLRLMKYKGPKTT  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             ETK G   H D + + I+  N++  LE++T+DGKW + +PS    IV I GE+  AW N 
Sbjct  179   ETKLGLQSHTDKNIVTILYQNEVEGLEVQTKDGKWFDVKPSKGSFIVMI-GESLHAWLNG  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTF-C  263
             R++AP HRVMM G   +Y++ LFS  +G   ++ P+ELVD+ +PL FKPFDH +FL F  
Sbjct  238   RLHAPYHRVMMSGDMARYSIGLFSIPKGGYMIKAPDELVDEAHPLLFKPFDHVQFLGFYY  297

Query  262   ANGGGKEESPINAFCGV  212
                G K ES + A+CGV
Sbjct  298   TEAGQKAESALKAYCGV  314



>ref|XP_009780364.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Nicotiana 
sylvestris]
Length=315

 Score =   268 bits (686),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 131/299 (44%), Positives = 194/299 (65%), Gaps = 5/299 (2%)
 Frame = -2

Query  1099  MRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQLPLETKRRNTS  920
             ++  T++W +   EVRR LEE GCF AVYD VS EL   +F+  + LF LP ETK  NTS
Sbjct  19    LKPNTSNWFSACDEVRRALEECGCFLAVYDSVSPELNSDIFQAVEELFDLPTETKLYNTS  78

Query  919   DIYGFGYAGNFASMPLAEYFGIK--DGVTPESTMNFSKQMWPDADNTPNFCEDTTSYSKL  746
             +   +GY G     PL E  GI   D +T E   NF+  MWP  ++  +F E    Y+ +
Sbjct  79    EKPFYGYYGKIPDFPLQESLGINIGDAITAEGVQNFTNLMWPSGND--HFSEIIHDYANI  136

Query  745   VWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHIPHRDNSFMA  566
             V  L+++V +MV ESYG++K +D L +S++YLLR IKYR PK +E+  G   H D +F++
Sbjct  137   VAGLEKMVKKMVFESYGVEKCYDSLEESTTYLLRLIKYRTPKLDESNVGSQVHTDKTFLS  196

Query  565   IVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPVHRVMMKGSED  386
             I+  NQ+  LE++T+DG+W+    + + + + + GEAF AWSN R++ PVHRV++K ++ 
Sbjct  197   ILHQNQVNGLEIKTKDGEWMAVDMTPANSFLVMVGEAFSAWSNNRLHCPVHRVIVKENKP  256

Query  385   KYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANG-GGKEESPINAFCGV  212
             +YT+A FS++ G ++ PEELVD+ +P+KF+PFD+FE L F A     + E  + AFCGV
Sbjct  257   RYTIAHFSYINGMIQTPEELVDEKHPIKFQPFDNFELLDFFAKHINDQMEYTVRAFCGV  315



>ref|XP_007135717.1| hypothetical protein PHAVU_010G152300g [Phaseolus vulgaris]
 gb|ESW07711.1| hypothetical protein PHAVU_010G152300g [Phaseolus vulgaris]
Length=314

 Score =   268 bits (685),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 130/317 (41%), Positives = 198/317 (62%), Gaps = 6/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M +   PKLP+I FTD  +     +W     +V R L E+GCF AV+D+V  ELR A+  
Sbjct  1     MGSEDTPKLPVINFTDLKLEAKDPNWEAVKSQVHRALVEFGCFEAVFDRVPLELRKAILG  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LPL+TK  N S     GY G +  +PL E  GI D V  E   + +  MWP+ 
Sbjct  61    SLQELFDLPLQTKLLNVSKKLFHGYVGQYPMVPLFESMGIDDAVVYEEVESLTNTMWPNG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +  PNF +   S+S+ + +LDQ++ +MVLES G++KY +  + S++YLLR +KY+ P+ +
Sbjct  121   N--PNFSKTIQSFSEELAELDQIIRKMVLESLGVEKYLEEHMNSTNYLLRVMKYQGPQTS  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             +TK G   H D + + I+  N++  LE+ T+DG WI+++PS    +V I G++F AW+N 
Sbjct  179   DTKLGLSAHTDKNIVTILYQNEVEGLEVLTKDGTWISYKPSPHSFVVMI-GDSFNAWANG  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLT-FC  263
             R+++P HRVMM G+E +Y+  LFS  +G   ++ PEELVD+++PL FKPFDH EFL  + 
Sbjct  238   RLHSPFHRVMMSGNETRYSAGLFSIPKGGSIIKAPEELVDEEHPLLFKPFDHMEFLKYYY  297

Query  262   ANGGGKEESPINAFCGV  212
                G +++  +  +CGV
Sbjct  298   TEKGQRDQFALLTYCGV  314



>ref|XP_009588351.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Nicotiana tomentosiformis]
Length=313

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/310 (43%), Positives = 197/310 (64%), Gaps = 6/310 (2%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQ  953
             KLP I+F++ +++ GT  W     +V + L  YGCF A +DK+   LR ++F+  K LF 
Sbjct  7     KLPNIDFSNVDLKPGTLVWNQVKSQVHKALVNYGCFEASFDKIPIHLRKSIFESLKELFD  66

Query  952   LPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFC  773
             LPL+TK RN S     GY G + ++PL E  GI D   P+   +F++ +WP+ +  P FC
Sbjct  67    LPLQTKIRNISTKPFHGYVGQYPAVPLYESMGIDDANIPDKAESFTRILWPEGN--PTFC  124

Query  772   EDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHI  593
             +   SYS+ + +LDQ V RM+LES G++ Y    + S++YLLR +KY+ P+ +ETK G  
Sbjct  125   KTIQSYSEQLSELDQTVRRMILESLGVENYMGEHMNSTNYLLRVMKYKGPQSSETKVGLN  184

Query  592   PHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPVH  413
              H D + + I+  NQ+  LE+ T DG+WIN +P+ +  IV I G++  AW+N R+++P H
Sbjct  185   AHTDKNIVTILYQNQVNGLEVLTEDGQWINVEPTPNAFIVMI-GDSLYAWANGRVHSPFH  243

Query  412   RVMMKGSEDKYTVALFSFLRGTVEI--PEELVDDDNPLKFKPFDHFEFLTFCANGGGKE-  242
             RVMM+G+E +Y+V LFS  +   +I  PEELVD+++PL FKPFDH EFL F     G+  
Sbjct  244   RVMMRGNEARYSVGLFSIPKAGYKIMAPEELVDEEHPLLFKPFDHVEFLAFYYTEEGQRC  303

Query  241   ESPINAFCGV  212
              S +  +CGV
Sbjct  304   GSALKTYCGV  313



>gb|KFK35768.1| hypothetical protein AALP_AA4G033700 [Arabis alpina]
Length=310

 Score =   267 bits (683),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/309 (42%), Positives = 191/309 (62%), Gaps = 4/309 (1%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAA-VYDKVSWELRDAMFKHCKHLF  956
             K+P ++F+ ++++ GT  W +TS  + + LEEYGCF   + DK   +L D +F     LF
Sbjct  4     KIPTLDFSREDLKQGTKYWESTSKNIIQALEEYGCFIIDLQDKTPLDLLDQVFGSLVELF  63

Query  955   QLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNF  776
              LP +TK +NT D    GY G   ++PL E  GI +  + E+T +F+  MWP  +   +F
Sbjct  64    NLPTQTKMKNTYDKPLNGYVGQIPALPLHESLGIDNATSLEATSSFTGLMWPQGNK--HF  121

Query  775   CEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGH  596
              E    Y++   +LDQ+V RMV ESY + KY+D  I+S++YLLR +K R P     K   
Sbjct  122   SECMHKYAEFTAELDQMVTRMVFESYNVKKYYDQYIKSTTYLLRVLKNRAPNNENKKLAF  181

Query  595   IPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPV  416
             + H D SF  I+  NQ+  LEMET +G+ IN   SS    + +AG+A MAWSN R+++P 
Sbjct  182   VTHTDKSFTTILHQNQVNGLEMETTEGERININLSSPSLFMIVAGDALMAWSNDRVWSPR  241

Query  415   HRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFC-ANGGGKEE  239
             H+V+M G  D+Y++ +FSF  GT+++PEEL+D  +PLK+KPFDH   L F   + G K E
Sbjct  242   HQVLMSGDTDRYSLGMFSFNNGTLQVPEELIDHQHPLKYKPFDHIGLLRFYRTDTGYKSE  301

Query  238   SPINAFCGV  212
              PI A+CG+
Sbjct  302   CPIKAYCGL  310



>ref|XP_009339603.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Pyrus x bretschneideri]
Length=322

 Score =   268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/317 (40%), Positives = 196/317 (62%), Gaps = 5/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             MA+ T   +PII+F+  ++  GT  W     +VR  LEEYGCF A++DKV  ++R +  +
Sbjct  1     MASETPLGIPIIDFSKPDLNQGTKEWDLVRAQVRNALEEYGCFEALFDKVPSDIRKSTIE  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LPL+TK +N S     GY G +  +PL E  G  D    E   + +  +WP  
Sbjct  61    SIEELFDLPLQTKLQNVSKKPYHGYVGQYPMVPLYESMGFDDANVYEQVESLTNTLWPQG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +  P FC    S+S+ V +LDQ++ RM+LES GL+KYF+  ++S++YLLR +KY+ P+  
Sbjct  121   N--PRFCTTIQSFSEQVSELDQIIRRMILESLGLEKYFEEHVESTNYLLRVMKYKGPETK  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             ETK G   H D + + I+  NQ+  LE++T+ GKWI  +PS   + + + G++  AW+N 
Sbjct  179   ETKLGINAHTDKNIVTILYQNQVDGLEVQTKAGKWIKVKPSLPHSFIAMIGDSLYAWTNG  238

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTF-C  263
             R+++P HRVMM G+E +Y+  LFS  +    ++ PEE+VD+++PL FKPFDH EFL F  
Sbjct  239   RLHSPYHRVMMSGNEARYSTGLFSIPKEGYIIKAPEEVVDEEHPLLFKPFDHVEFLGFYY  298

Query  262   ANGGGKEESPINAFCGV  212
                G + +S +  +CGV
Sbjct  299   TEAGQRAQSALKTYCGV  315



>ref|XP_003533058.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1-like 
[Glycine max]
 gb|KHN47794.1| Gibberellin 20 oxidase 2 [Glycine soja]
Length=319

 Score =   267 bits (683),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/316 (42%), Positives = 200/316 (63%), Gaps = 5/316 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T  ++PI++FTD+ ++ GT  W +    +R  LE++GCF A+ DKV  +L +++F 
Sbjct  1     MGSQTACQVPIVDFTDEELKPGTAKWASACLVIRSALEDHGCFYALCDKVPMDLYNSVFA  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LPLETK +  SD    GY G F  +PL E  GI D +T E   NF+K MWP  
Sbjct  61    LMEELFYLPLETKLQKMSDKPYHGYYGQFTHLPLYESLGINDPLTMEGVQNFTKLMWPAG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLD-KYFDPLIQSSSYLLRFIKYRMPKW  617
              +  +FCE  + Y+KL+ +LD +  RMV + YGLD ++ D L++S++Y+LR  KYR+P+ 
Sbjct  121   YD--HFCETLSLYAKLLVELDHMAKRMVFDGYGLDQRHCDSLLESTNYMLRSFKYRLPQK  178

Query  616   NETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSN  437
             +E   G   H D SF  I+  N +  L+++ ++G+W++   S    ++ +AG+AF  WSN
Sbjct  179   DENNLGLHAHTDTSFFTILHQNNVNGLQVKLKNGEWVDIDLSPFMLLI-LAGDAFKVWSN  237

Query  436   RRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCAN  257
              RI+   HRV++KG +D+Y++ LFS     VE PEELVD+D+P ++KPFDH+E+L F A 
Sbjct  238   DRIHCCEHRVIIKGKKDRYSMGLFSLGGKMVETPEELVDEDHPRRYKPFDHYEYLRFYAT  297

Query  256   GGGKE-ESPINAFCGV  212
                 E E  I AFCG+
Sbjct  298   KKALESECRIKAFCGI  313



>ref|XP_009771248.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X1 [Nicotiana sylvestris]
Length=313

 Score =   267 bits (683),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/310 (42%), Positives = 196/310 (63%), Gaps = 6/310 (2%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQ  953
             KLP I+F++++++ G+  W     +V + L  YGCF A +DK+   LR ++F+  K LF 
Sbjct  7     KLPNIDFSNEDLKPGSLVWNQVKNQVHKALVNYGCFEASFDKIPIHLRKSIFESLKELFD  66

Query  952   LPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFC  773
             LPL+TK RN S     GY G + ++PL E  GI D    +    F++ +WP+ +  PNFC
Sbjct  67    LPLQTKIRNISTKPFHGYVGQYPAVPLYESMGIDDANISDKAERFTRILWPEGN--PNFC  124

Query  772   EDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHI  593
             +   SYS+ + +LDQ V +M+LES G++KY D  + S++YLLR +KY+ P+ N+TK G  
Sbjct  125   KTIQSYSEQLSELDQTVRKMILESLGVEKYMDEHMNSTNYLLRVMKYKGPQSNDTKLGLN  184

Query  592   PHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPVH  413
              H D + + I+  NQ+  LE+ T+DG+WIN +P+    IV I G++  AW+N R+++P H
Sbjct  185   AHTDKNIVTILYQNQVNGLEVLTKDGQWINVEPTPDAFIVMI-GDSLYAWANGRVHSPYH  243

Query  412   RVMMKGSEDKYTVALFSFLRGTVEI--PEELVDDDNPLKFKPFDHFEFLTFCANGGGKE-  242
             RVMM G+E +Y+V LFS  +   +I  PEEL D ++PL FKPFDH EFL F     G+  
Sbjct  244   RVMMTGNEARYSVGLFSIPKAGYKIKAPEELADKEHPLLFKPFDHVEFLAFYYTEEGQRC  303

Query  241   ESPINAFCGV  212
              S +  +CGV
Sbjct  304   GSALKTYCGV  313



>ref|XP_009339602.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2 [Pyrus x 
bretschneideri]
Length=313

 Score =   266 bits (681),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 132/318 (42%), Positives = 196/318 (62%), Gaps = 9/318 (3%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M +    KLP+++F+ + ++ GT SW     +V++ LEE+GCF  +YDK+S E R+A+ +
Sbjct  1     MGSEVEQKLPVLDFSKEALKPGTNSWLLACNDVQQALEEFGCFVVLYDKISDEFRNALLR  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LP ETK  N  +    GY G    +PL E  GI +    E T  F+K MWP  
Sbjct  61    SLEELFDLPTETKMTNKYEKPLNGYVGQIPKLPLHESLGIDNATNFEETQKFTKLMWPAG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             ++   FCE   +++K+  +LDQ+V RM+ +SYG++KY+D  + S SYLLR ++ R PK N
Sbjct  121   ND--KFCEAAYAFAKVAEELDQMVARMIFQSYGVEKYYDSYVGSISYLLRILQNRSPKEN  178

Query  613   ETKTGHIPHRDNSFMAIV-DTNQIGCLEMETRDGKWIN--FQPSSSKTIVFIAGEAFMAW  443
             E   G + H D SF  ++   NQ+  LE+ETR+ +WI   F PSS    + +AG+A MAW
Sbjct  179   EHNLGFVAHTDKSFTTVLYQNNQVHALEVETRNHEWIKVEFPPSS---FIVMAGDALMAW  235

Query  442   SNRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFC  263
             SN RI +P HRV+M G+E +Y++A F+F  G + +PEEL +++ PL++K FDH   L F 
Sbjct  236   SNDRILSPNHRVIMSGNETRYSLAQFAFSDGEIHVPEELGNEERPLRYKSFDHPGLLRFF  295

Query  262   -ANGGGKEESPINAFCGV  212
              +  G    S I A+CGV
Sbjct  296   RSQDGYISNSAIKAYCGV  313



>emb|CDY26055.1| BnaC06g05690D [Brassica napus]
Length=310

 Score =   266 bits (681),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/309 (41%), Positives = 194/309 (63%), Gaps = 4/309 (1%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAA-VYDKVSWELRDAMFKHCKHLF  956
             K+P ++F+ ++++ GT  W++TS  +R+ LEEYGCF   + DK   +L D +F     LF
Sbjct  4     KIPTLDFSREDLKPGTKYWKSTSKNIRQALEEYGCFIIDLQDKTPLDLLDQVFGSLVQLF  63

Query  955   QLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNF  776
              LP +TK +N  D    GY G   ++PL E  GI +  + E+T +F+  MWP  +   +F
Sbjct  64    DLPTQTKMKNKYDKPLNGYVGQIPALPLHESLGIDNATSLEATRSFTGLMWPQGNK--HF  121

Query  775   CEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGH  596
              E    Y++   +LDQ+V RMV ESY ++K++ P I+S++YLLR +K   P  ++   G 
Sbjct  122   SECVHKYAEFAAKLDQMVTRMVFESYNVEKHYKPYIESTTYLLRVLKNSAPNNDKPNLGF  181

Query  595   IPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPV  416
             + H D SF  I+  NQ+  LEMETR+G+ IN   SS    + +AG+A MAWSN R+++P 
Sbjct  182   VTHTDKSFTTILHQNQVNGLEMETREGEKININLSSPSLFMIVAGDALMAWSNDRVWSPR  241

Query  415   HRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFC-ANGGGKEE  239
             H+V++ G  D+Y++ +FSF  GT+++PEEL+D  +PL +KPFDH   L F   + G K E
Sbjct  242   HQVLVSGETDRYSLGMFSFNNGTLQVPEELIDHQHPLMYKPFDHIGLLRFYRTDIGYKSE  301

Query  238   SPINAFCGV  212
              PI A+CG+
Sbjct  302   CPIKAYCGI  310



>ref|XP_011072311.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Sesamum indicum]
Length=314

 Score =   266 bits (681),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 129/319 (40%), Positives = 201/319 (63%), Gaps = 10/319 (3%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M +   P+L +I+ +++ ++ G++SW +   ++R+ LE +GCF A+YDK+S +L  ++F+
Sbjct  1     MGSLNLPELVVIDLSNEGLKAGSSSWSSACKDIRQALENHGCFIALYDKISPQLHRSIFQ  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
                 LF LP E K +N ++    GY G    +PL E  GI    T E   +F+K MWPD 
Sbjct  61    AADQLFDLPTEVKVQNINEKPYHGYVGQMPIVPLHEGLGIDYATTLEGAQSFTKLMWPDG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +++  FCE   S++K V  ++++ +R++ ESYG+ KY D  +++++YLLRF+KYR P+  
Sbjct  121   NDS--FCETAMSFAKTVADIEKIAVRLLFESYGVQKYTDSHVEATTYLLRFLKYRAPEEG  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWIN--FQPSSSKTIVFIAGEAFMAWS  440
             E+      H D SF  ++  N I  LE+  R+G+WIN  F PSS    V +AG+A  AWS
Sbjct  179   ESNNAFPSHTDKSFFTVLHQNHISGLEVRARNGEWINVVFPPSS---FVVMAGDACQAWS  235

Query  439   NRRIYAPVHRVMM--KGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTF  266
             N R+ +P H+V +   G E +YT+A FSFL   VE+PEELVDD++PL+FKPF H + L F
Sbjct  236   NNRVLSPNHKVSLDKNGKETRYTMAQFSFLSKMVEVPEELVDDEHPLQFKPFAHVDLLNF  295

Query  265   CA-NGGGKEESPINAFCGV  212
              A + G + ++ +  FCGV
Sbjct  296   YATDHGRRSQNILKDFCGV  314



>ref|XP_006392870.1| hypothetical protein EUTSA_v10011669mg [Eutrema salsugineum]
 gb|ESQ30156.1| hypothetical protein EUTSA_v10011669mg [Eutrema salsugineum]
Length=316

 Score =   266 bits (681),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 129/309 (42%), Positives = 191/309 (62%), Gaps = 4/309 (1%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAA-VYDKVSWELRDAMFKHCKHLF  956
             K+P ++F+ + ++ GT  W +TS  +R+ LEEYGCF   + DK   +L D +F     LF
Sbjct  4     KIPTLDFSREVLKPGTKYWESTSKNIRQALEEYGCFIIDLQDKTPLDLLDQVFGSLVELF  63

Query  955   QLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNF  776
              LP +TK +N  D    GY G   ++PL E  GI D  +  +T +F+  MWP  +    F
Sbjct  64    DLPTQTKMKNKYDKPLNGYVGQIPALPLHESLGIDDATSLVATRSFTGLMWPQGNE--RF  121

Query  775   CEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGH  596
              +    Y++ V +LDQ+V RMV ESY ++K ++P I+S++YLLR +K R P    +  G 
Sbjct  122   SDSVHKYAEFVAKLDQMVTRMVFESYNVEKDYNPYIESTTYLLRVLKTRAPNSKNSNLGF  181

Query  595   IPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPV  416
             I H D SF  I+  NQ+  L METR+G+ IN   SS    + +AG+A MAWSN R+++P 
Sbjct  182   ITHTDKSFTTILHQNQVNGLVMETREGERININLSSPSLFMVVAGDALMAWSNDRVWSPR  241

Query  415   HRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFC-ANGGGKEE  239
             H+V++ G  D+Y++ +FSF  GT+++PEEL+D  +PLK+KPFDH   L F   + G K E
Sbjct  242   HQVLVSGETDRYSLGMFSFNNGTLQVPEELIDHQHPLKYKPFDHIGLLRFYRTDTGYKSE  301

Query  238   SPINAFCGV  212
              PI A+CG+
Sbjct  302   CPIKAYCGI  310



>ref|XP_002517541.1| Gibberellin 20 oxidase, putative [Ricinus communis]
 gb|EEF44705.1| Gibberellin 20 oxidase, putative [Ricinus communis]
Length=314

 Score =   266 bits (680),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 133/317 (42%), Positives = 199/317 (63%), Gaps = 6/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T  KLP I+F+ +N++ GT  W     +VR  LEEYGCF A + +V  +L+  +F 
Sbjct  1     MGSETPLKLPAIDFSTENLKPGTVEWELVKTQVRNALEEYGCFEAFFSRVHNDLKKGVFG  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF+LPL+TK +N S     GY G +   PL E  GI+D  T E   +F+  +WP  
Sbjct  61    AIEELFELPLQTKLKNVSRKPFHGYVGQYPQAPLYESMGIEDPDTVEKVESFTSVLWPQG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             + T  F +   S+S+ V +LD+VV RM++ES GL+KY D  + S+ YLLR +KY+ P+ +
Sbjct  121   NLT--FSKTVQSFSEQVSKLDKVVRRMIVESLGLEKYMDEHMNSTDYLLRVMKYKGPETS  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             E K G  PH D + + I+  NQ+  LE++T++G+WI  + S    +V I G++ +AW+N 
Sbjct  179   EAKLGLHPHTDKNIVTILFQNQVDGLEVKTKNGEWITVKLSPDSFVVMI-GDSLLAWANG  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTF-C  263
             R+++P HRVMM G+E +Y+  LFS  +    V+ PEELVD+++PL FKPFDH EFL F  
Sbjct  238   RLHSPYHRVMMTGNEARYSCGLFSIPKAGYIVKAPEELVDEEHPLLFKPFDHVEFLGFYY  297

Query  262   ANGGGKEESPINAFCGV  212
                G + +S + A+CGV
Sbjct  298   TEAGQRAQSALKAYCGV  314



>ref|XP_011072273.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Sesamum indicum]
Length=315

 Score =   266 bits (681),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 134/317 (42%), Positives = 195/317 (62%), Gaps = 5/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + +  KLP+I+F++      T +W +T  +VR  LEEYGCF AV+D++   LR +   
Sbjct  1     MGSESCMKLPVIDFSNLKQDSRTPTWESTKTQVRAALEEYGCFEAVFDQIPPTLRQSTID  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               K LF LPL+TK RN S+    GY G +  +PL E  GI+D ++P    +FS  MWP+ 
Sbjct  61    GIKQLFDLPLQTKLRNRSNKPYHGYVGQYPIVPLYESLGIEDALSPAKVDSFSNLMWPE-  119

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             D  P F +     S+   +LD+VV RMV+ES GL+KY +  ++S+ YL+R  KY  P+  
Sbjct  120   DGNPTFSKSIACLSEQFSELDKVVRRMVVESLGLEKYMNEHMESTDYLVRVQKYDGPQSA  179

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             E+K G   H D + + I+  N++  LE+ T+DG+WI   PS +  IV I GE+F AW+N 
Sbjct  180   ESKIGLTSHTDKNIVTILHQNEVKGLEVLTKDGQWIAADPSHNSFIVMI-GESFYAWTNG  238

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTF-C  263
             R++ P HRVMM+G E +Y++ LFS  +    ++ PEELVDD++PL FKPFDH EFL F  
Sbjct  239   RLHPPYHRVMMRGDEARYSIGLFSVPKAGYIIKAPEELVDDEHPLLFKPFDHVEFLDFYY  298

Query  262   ANGGGKEESPINAFCGV  212
                G +  + + A+CG 
Sbjct  299   TEAGQRSPAALKAYCGA  315



>ref|XP_006465515.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Citrus sinensis]
Length=314

 Score =   266 bits (680),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 135/317 (43%), Positives = 198/317 (62%), Gaps = 6/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T  K+P+I+ +  +++ GT++W +T  ++R   EE+GCF A+Y K S ELR  +  
Sbjct  1     MGSQTKSKIPVIDLSKQDLKSGTSTWLSTCKDIRHAFEEFGCFEAIYQKFSQELRSEVLA  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF +P+E K +NTS    F Y G +  +PL E   I    T  +T +F+  MWP  
Sbjct  61    STEELFDVPIEIKVKNTSTKPYFEYYGQYTIIPLYESLAIDYPDTRNATQSFTNLMWPAG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             ++   FCE + S S+LV +LD++V RM+ ESYG++ Y+D  I S +YLLR+ KYR P+ N
Sbjct  121   NDC--FCESSLSMSELVVELDKMVTRMLFESYGVEGYYDSYIGSVNYLLRYFKYRAPEPN  178

Query  613   ETKTGHIPHRDNSFMAIV-DTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSN  437
             ETK G  PH D +  +I+   N I  L+++ +DG+WI+ +PS S  IV +AG+A  AW N
Sbjct  179   ETKMGLTPHTDKTMTSIIHQINHINGLQVQAKDGEWIDVEPSPSSFIV-MAGDALKAWGN  237

Query  436   RRIYAPVHRVMM-KGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFC-  263
              RI    H+V+M   SE +Y++ LFSF  G V+IP+EL  +  PLK+KPFDHF FL F  
Sbjct  238   DRIRPCRHQVIMDNASETRYSLGLFSFSSGVVDIPKELGVETQPLKYKPFDHFGFLHFNQ  297

Query  262   ANGGGKEESPINAFCGV  212
             +  G K  S I A+CG+
Sbjct  298   SEEGKKSASSIKAYCGI  314



>emb|CDY68239.1| BnaA06g37440D [Brassica napus]
Length=310

 Score =   266 bits (680),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 127/308 (41%), Positives = 194/308 (63%), Gaps = 4/308 (1%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAA-VYDKVSWELRDAMFKHCKHLF  956
             K+P ++F+ ++++ GT  W++TS  +R+ LEEYGCF   + DK   +L D +F     LF
Sbjct  4     KIPTLDFSREDLKPGTKYWKSTSKNIRQALEEYGCFIIDLQDKTPLDLLDQVFGSLVELF  63

Query  955   QLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNF  776
              LP +TK +N  D    GY G   ++PL E  GI +  + E+T +F+  MWP  +   +F
Sbjct  64    DLPTQTKMKNKYDKPLNGYVGQIPALPLHESLGIDNATSLEATRSFTGLMWPQGNK--HF  121

Query  775   CEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGH  596
              E    Y++   +LDQ+V RMV ESY ++K++ P I+S++YLLR +K   P  +++  G 
Sbjct  122   SECVHKYAEFAAKLDQMVTRMVFESYNVEKHYKPYIESTTYLLRVLKNSAPNNDKSNLGF  181

Query  595   IPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPV  416
             + H D SF  I+  NQ+  LEMETR+G+ IN   SS    + +AG+A MAWSN R+++P 
Sbjct  182   VTHTDKSFTTILHQNQVNGLEMETREGERININLSSPSLFMIVAGDALMAWSNDRVWSPR  241

Query  415   HRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFC-ANGGGKEE  239
             H+V++ G  D+Y++ +FSF  GT+++PEEL+D  +PL +KPFDH   L F   + G K E
Sbjct  242   HQVLVSGDTDRYSLGMFSFNNGTLQVPEELIDHQHPLMYKPFDHIGLLRFYRTDIGYKSE  301

Query  238   SPINAFCG  215
              PI A+CG
Sbjct  302   CPIKAYCG  309



>ref|XP_009147661.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3 isoform 
X1 [Brassica rapa]
Length=310

 Score =   266 bits (679),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 127/309 (41%), Positives = 194/309 (63%), Gaps = 4/309 (1%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAA-VYDKVSWELRDAMFKHCKHLF  956
             K+P ++F+ ++++ GT  W++TS  +R+ LEEYGCF   + DK   +L D +F     LF
Sbjct  4     KIPTLDFSREDLKPGTKYWKSTSKNIRQALEEYGCFIIDLQDKTPLDLLDQVFGSLVELF  63

Query  955   QLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNF  776
              LP +TK RN  D    GY G   ++PL E  GI +  + E+T +F+  MWP  +   +F
Sbjct  64    DLPTQTKMRNKYDKPLNGYVGQIPALPLHESLGIDNATSLEATRSFTGLMWPQGNK--HF  121

Query  775   CEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGH  596
              E    Y++   +LDQ+V RMV ESY ++K++ P I+S++YLLR +K   P  +++  G 
Sbjct  122   SECVHKYAEFAAKLDQMVTRMVFESYNVEKHYKPYIESTTYLLRVLKNSAPNNDKSNLGF  181

Query  595   IPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPV  416
             + H D SF  I+  NQ+  LEMETR+G+ IN   SS    + +AG+A MAWSN R+++P 
Sbjct  182   VTHTDKSFTTILHQNQVNGLEMETREGERININLSSPSLFMIVAGDALMAWSNDRVWSPR  241

Query  415   HRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFC-ANGGGKEE  239
             H+V++ G  D+Y++ +FSF  GT+++PEEL+D  +PL +KPFDH   L F   + G K  
Sbjct  242   HQVLVSGDTDRYSLGMFSFNNGTLQVPEELIDHQHPLMYKPFDHIGLLRFYRTDIGYKSV  301

Query  238   SPINAFCGV  212
              PI A+CG+
Sbjct  302   CPIKAYCGI  310



>ref|NP_175688.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
 gb|AAG52288.1|AC019018_25 putative oxidoreductase; 32373-31266 [Arabidopsis thaliana]
 gb|AEE32852.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
Length=310

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/310 (41%), Positives = 193/310 (62%), Gaps = 4/310 (1%)
 Frame = -2

Query  1138  NPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAA-VYDKVSWELRDAMFKHCKH  962
             +PK+P ++F+ ++++ GT  W +T   +R+ LEEYGCF   + DK   +L D +F     
Sbjct  2     SPKIPTLDFSREDLKPGTKYWESTRENIRQALEEYGCFIIDLKDKTPLDLLDRVFGSLVD  61

Query  961   LFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTP  782
             LF LP +TK +N  D    GY G   ++PL E  GI +  + E+T +F+  MWP  +   
Sbjct  62    LFDLPTQTKMKNKYDKPLNGYVGQIPALPLHESLGIDNATSLEATRSFTGLMWPQGNE--  119

Query  781   NFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKT  602
             +F E    Y++   +LDQ+V RMV +SY ++KY+DP I+S++YLLR +K R P       
Sbjct  120   HFSECLYKYAEFAAELDQMVTRMVFQSYNVEKYYDPYIESTTYLLRVLKNRAPNNENPTL  179

Query  601   GHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYA  422
             G + H D SF  I+  +Q+  LEMETR+G+ IN   SS    + +AG+A MAWSN R+++
Sbjct  180   GFVTHTDKSFTTILHQDQVNGLEMETREGERININLSSPSLFMVVAGDALMAWSNDRVWS  239

Query  421   PVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFC-ANGGGK  245
             P H+V++ G  D+Y++ +F+F  GT+++PEEL+D  +PL +KPFDH   L F   + G K
Sbjct  240   PRHQVLVSGETDRYSLGMFAFNNGTLQVPEELIDHQHPLMYKPFDHLGLLRFYRTDTGYK  299

Query  244   EESPINAFCG  215
              E PI A+CG
Sbjct  300   SECPIKAYCG  309



>ref|XP_010545796.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X2 [Tarenaya hassleriana]
Length=310

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/310 (42%), Positives = 195/310 (63%), Gaps = 4/310 (1%)
 Frame = -2

Query  1135  PKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAA-VYDKVSWELRDAMFKHCKHL  959
             P +P ++F+ ++++ GT+ W TTS  +R+ LE+YGCF   +++K  ++L   +F   K L
Sbjct  3     PMIPTLDFSREDLKPGTSYWETTSKNIRQALEQYGCFIVDLHEKAPFDLLARVFDSLKQL  62

Query  958   FQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPN  779
             F LP  TK +N  D    GY G   ++PL E  GI +  + +ST +F+  MWP  ++   
Sbjct  63    FDLPTPTKMKNKYDKPMNGYVGQIPALPLHESLGIDNATSLQSTRSFTDLMWPRGND--R  120

Query  778   FCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTG  599
             FC+    Y++ V ++D++V RM+  SYG+ KY++P ++S+SYLLR +K R PK       
Sbjct  121   FCDCMHRYAEFVAEMDRMVARMIFGSYGVAKYYEPYMKSTSYLLRLLKNRAPKDENPYLA  180

Query  598   HIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAP  419
              + H D SF  I+  +QI  LEMETR G+ IN   SS    + IAG+A MAWSN RI +P
Sbjct  181   FVTHTDKSFTTILHQDQINGLEMETRLGERINVDLSSPSLFMVIAGDALMAWSNDRILSP  240

Query  418   VHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFC-ANGGGKE  242
              HRV++ G  D+Y++  F+F  GT+++PEELVD+++PL +KPFDH   L F   + G + 
Sbjct  241   RHRVLVSGETDRYSLGQFAFSNGTLQVPEELVDNEHPLMYKPFDHIGLLHFYRTDIGYRA  300

Query  241   ESPINAFCGV  212
             E PI A+CGV
Sbjct  301   ECPIKAYCGV  310



>ref|XP_004241720.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Solanum lycopersicum]
Length=313

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/312 (42%), Positives = 194/312 (62%), Gaps = 6/312 (2%)
 Frame = -2

Query  1138  NPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHL  959
             N KLP I+F+ ++++  T  W     +V + L EYGCF A +DK+   LR ++F+  + L
Sbjct  5     NMKLPKIDFSHEDLKPDTLVWNQVKSQVHKALVEYGCFEASFDKIPIHLRKSIFESLQEL  64

Query  958   FQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPN  779
             F LPL+TK +N S     GY G +  +PL E  GI D   P     F++ +WP  +  P 
Sbjct  65    FDLPLQTKLKNISKKPFHGYVGQYPQVPLYESMGIDDANIPHKAEKFTQILWPQGN--PT  122

Query  778   FCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTG  599
             FC+   SYS+ + +LDQ + RM++ES G++KY D  + S+SYLLR +KY+ P+ +ETK G
Sbjct  123   FCKTIQSYSEQLSELDQTIRRMIVESLGVEKYMDEHMNSTSYLLRVMKYKGPQSSETKVG  182

Query  598   HIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAP  419
                H D + + I+  N++  LE+ T+DGKWIN  P+     V I G++  AW+N R+++P
Sbjct  183   LNAHTDKNIVTILYQNEVSGLEVLTKDGKWINVDPTPDTFTVMI-GDSLYAWANGRLHSP  241

Query  418   VHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTFCANGGGK  245
              HRVMM+G+E +Y+V LFS  +   T++ PEELVD+++ L FKPFDH EFL F     G+
Sbjct  242   YHRVMMRGNEARYSVGLFSIPKAGYTIKAPEELVDEEHSLLFKPFDHVEFLDFYYTEEGQ  301

Query  244   E-ESPINAFCGV  212
                S +  +CGV
Sbjct  302   RCASALKTYCGV  313



>ref|XP_007214491.1| hypothetical protein PRUPE_ppa020361mg [Prunus persica]
 gb|EMJ15690.1| hypothetical protein PRUPE_ppa020361mg [Prunus persica]
Length=315

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 136/320 (43%), Positives = 194/320 (61%), Gaps = 11/320 (3%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDN--MRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAM  980
             M +   PKLP+++F+ +   ++ GT SW +   +VR+ LEE+GCF   YDK+  E ++  
Sbjct  1     MGSDGQPKLPVLDFSKEAEALKPGTNSWVSACKDVRQALEEFGCFFVSYDKLPPEFQNGF  60

Query  979   FKHCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWP  800
                 K LF LP +TK  N S+    GY G   S+PL E  GI++    E T  F+K MWP
Sbjct  61    LGTLKELFDLPTQTKMTNKSENPSSGYFGQIPSLPLHEGLGIENATNLEETQKFTKLMWP  120

Query  799   DADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPK  620
               ++  NFCE   S++K+  +LDQ+V RM+ ESYG++KY+D  + S SYLLR +K R P+
Sbjct  121   GGND--NFCESAHSFAKVAEELDQMVTRMIFESYGMEKYYDSYVGSVSYLLRLLKNRTPQ  178

Query  619   WNETKTGHIPHRDNSFMAIV-DTNQIGCLEMETRDGKWI--NFQPSSSKTIVFIAGEAFM  449
              NE   G + H D SF  ++   NQ   LE+ET+  +WI   F PSS    + +AG+A M
Sbjct  179   ENEPSLGFVAHTDKSFTTLLYQNNQAHGLEVETKSHEWIRAEFPPSS---FLVMAGDALM  235

Query  448   AWSNRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLT  269
             AWSN RI +P HRV+M G+E +Y++A F+F  G + +PEEL D+ +PL++K FDH   L 
Sbjct  236   AWSNDRILSPNHRVIMNGNEARYSLAQFAFSDGEIHVPEELADEQHPLRYKSFDHPGLLV  295

Query  268   FC-ANGGGKEESPINAFCGV  212
             F   N      S I A+CGV
Sbjct  296   FFRTNESYVSNSAIKAYCGV  315



>ref|XP_006356178.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Solanum tuberosum]
Length=313

 Score =   264 bits (675),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 130/312 (42%), Positives = 195/312 (63%), Gaps = 6/312 (2%)
 Frame = -2

Query  1138  NPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHL  959
             N KLPII+F+ ++++  T  W     +V + L EYGCF A +DK+   LR ++F+  + L
Sbjct  5     NTKLPIIDFSHEDLKPDTLVWNQVKSQVHKALVEYGCFEASFDKIPIHLRKSIFESLQEL  64

Query  958   FQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPN  779
             F LPL+TK +N S     GY G +  +PL E  GI D   P  T  F++ +WP  +  P 
Sbjct  65    FDLPLQTKLKNISKKPFHGYVGQYPQVPLYESMGIDDANIPHKTEKFTQILWPQGN--PT  122

Query  778   FCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTG  599
             FCE   SYS+ + +LDQ V +M+LES G++KY D  + S++YLLR +KY+ P+ +ETK G
Sbjct  123   FCETIQSYSEHLSELDQTVRKMILESLGVEKYMDEHMNSTNYLLRVMKYKGPQSSETKLG  182

Query  598   HIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAP  419
                H D + + I+  N++  LE+ T+DG WIN  P+     V I G++  AW+N ++++P
Sbjct  183   LNAHTDKNIVTILYQNEVSGLEVLTKDGHWINVDPTPDTFTVMI-GDSLYAWANGQLHSP  241

Query  418   VHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTFCANGGGK  245
              HRVMM+G+E +Y+V LFS  +   T++ P+ELVD+++ L FKPFDH EFL F     G+
Sbjct  242   NHRVMMRGNEARYSVGLFSIPKAGYTIKAPKELVDEEHSLLFKPFDHVEFLDFYYTEEGQ  301

Query  244   E-ESPINAFCGV  212
                S +  +CGV
Sbjct  302   RCASALKTYCGV  313



>ref|XP_008461057.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X1 [Cucumis melo]
Length=317

 Score =   264 bits (674),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 129/309 (42%), Positives = 202/309 (65%), Gaps = 6/309 (2%)
 Frame = -2

Query  1129  LPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQL  950
             +P I+ +   + VGT  W     E+R GLEE+GCF+ VYDKVS EL +++ +  K LF L
Sbjct  11    IPTIDLS--KLEVGTKEWGLACKEMRFGLEEFGCFSVVYDKVSLELHNSIVEATKELFHL  68

Query  949   PLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFCE  770
             P+ET+ +NTS+    GY G ++ +PL E   I + +  +ST +F+  MWP  DN  +FC 
Sbjct  69    PIETRMKNTSEKPYHGYFGGYSFLPLYESMAIDNPIQLKSTQSFANLMWPTRDNN-HFCV  127

Query  769   DTTSYSKLVWQLDQVVMRMVLESYGLDKYF-DPLIQSSSYLLRFIKYRMPKWNETKTGHI  593
                 +S LV +L+++V +MVLESYG+ K   +P+++S++YLLR  KYR+ + +ET  G  
Sbjct  128   TVERFSTLVAKLEKMVTKMVLESYGVSKVVNEPIMESTNYLLRLFKYRVAEKDETDVGLH  187

Query  592   PHRDNSFMAIVDTNQIGCLEMET-RDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPV  416
              H D +F +I+  + I  L++++  D +W++  PSS  + + +AG+A MAWSN RI +  
Sbjct  188   SHTDLTFFSIIHQHLISGLQIQSLNDDQWLDVHPSSHCSFIVMAGDALMAWSNERIRSCR  247

Query  415   HRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTF-CANGGGKEE  239
             HRV+M+G E +Y++ +FSF  GT+E+P+  VDD NPL++KPF+H++FLT+  AN      
Sbjct  248   HRVIMRGEETRYSIGMFSFKNGTIEVPQGFVDDANPLRYKPFNHYDFLTYDKANASHNTI  307

Query  238   SPINAFCGV  212
             S I  +CG+
Sbjct  308   SRIKDYCGL  316



>ref|XP_008377588.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Malus domestica]
Length=322

 Score =   264 bits (674),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/317 (40%), Positives = 195/317 (62%), Gaps = 5/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             MA+ T   LPII+F+  ++  GT  W     +V   LEEYGCF A+++KV  ++R +  +
Sbjct  1     MASETPLGLPIIDFSKPDLNQGTKEWDLVRAQVHNALEEYGCFEALFNKVPSDIRKSTIE  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LPL+TK +N S     GY G +  +PL E  G  D    E   + +  +WP  
Sbjct  61    SMEELFDLPLQTKLQNVSKKPYHGYVGQYPMVPLYESMGFDDANVYEQVESLTNTLWPQG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +  P FC    S+S+ V +LDQ++ RM+LES GL+KYF+  ++S++YLLR +KY+ P+  
Sbjct  121   N--PRFCTSIQSFSEQVSELDQIIRRMILESLGLEKYFEEHVESTNYLLRVMKYKGPETK  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             E+K G   H D + + I+  NQ+  LE++T+  KWI  +PSS  + + + G++  AW+N 
Sbjct  179   ESKLGINAHTDKNIVTILYQNQVDGLEVQTKACKWIKVKPSSPHSFIAMIGDSLHAWTNG  238

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTF-C  263
             R+++P HRVMM G+E +Y+  LFS  +    ++ PEE+VD+++PL FKPFDH EFL F  
Sbjct  239   RLHSPYHRVMMSGNEARYSTGLFSIPKAGYIIKAPEEVVDEEHPLLFKPFDHVEFLGFYY  298

Query  262   ANGGGKEESPINAFCGV  212
                G + +S +  +CGV
Sbjct  299   TEAGQRAQSALKTYCGV  315



>gb|AFK47428.1| unknown [Lotus japonicus]
Length=311

 Score =   263 bits (672),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 131/317 (41%), Positives = 196/317 (62%), Gaps = 9/317 (3%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T  KLP+I+FTD N      +W     +V   L EYGCF A++DKV  +LR  +F 
Sbjct  1     MGSETTRKLPVIDFTDLN---SLANWEAVKSKVHEALVEYGCFEAIFDKVPLDLRKEIFA  57

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LPL+TK  N S     GY G +  +PL E  GI D    E     +  +WPD 
Sbjct  58    SLEELFNLPLQTKLLNVSKKPYHGYVGQYPMVPLFESMGIDDANVSEKVEAMANILWPDG  117

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +  P+F +   S+S+ + +LD ++ +MVLES G++KY D  + S++YLLR +KY+ P+ +
Sbjct  118   N--PSFSKTINSFSEQLSELDHIIRKMVLESLGVEKYLDEHLHSTNYLLRVMKYKGPETS  175

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             +TK G   H D + + I+  NQ+  LE+ T+DGKWI+++PSS   +V I G++  AWSN 
Sbjct  176   DTKLGLTTHSDKNIVTILYQNQVEGLEVLTKDGKWISYKPSSEGFVVMI-GDSLHAWSNG  234

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLT-FC  263
             R+++P HRVMM G+E +Y+  LFS  +G   ++ PEELVD+++PL FKPFDH EFL  + 
Sbjct  235   RLHSPFHRVMMTGNEARYSTGLFSIPKGEYIIKTPEELVDEEHPLLFKPFDHVEFLKYYY  294

Query  262   ANGGGKEESPINAFCGV  212
                G +++  +  +CGV
Sbjct  295   TEKGQRDQFALRTYCGV  311



>ref|XP_008377591.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2 [Malus domestica]
Length=313

 Score =   263 bits (671),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 134/318 (42%), Positives = 192/318 (60%), Gaps = 9/318 (3%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M +    KLP+++F+ + ++ GT SW     +V+R LEE+GCF  +YDK+S E R+A   
Sbjct  1     MGSEVEQKLPVLDFSKEALKPGTNSWLLACKDVQRALEEFGCFVVLYDKISDEFRNAFVG  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LP ETK  N  +    GY G    +PL E  GI      E T  F+K MWP  
Sbjct  61    SLEELFDLPTETKMTNKYEKPLNGYVGQIPKLPLHESLGIDCATNFEETKKFTKLMWPAG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             ++   FCE   +++K+  +LDQ+V RM+ ESYG++KY+D  + S SYLLR ++ R PK N
Sbjct  121   ND--KFCERAYAFAKVAEELDQMVARMIFESYGVEKYYDSYVGSISYLLRILQNRSPKEN  178

Query  613   ETKTGHIPHRDNSFMAIV-DTNQIGCLEMETRDGKWIN--FQPSSSKTIVFIAGEAFMAW  443
             E   G + H D SF  ++   NQ+  LE+ETR+ +WI   F PSS    + +AG+A MAW
Sbjct  179   EHNLGFVAHTDKSFTTVLYQNNQVNALEVETRNHEWIKVEFPPSS---FIVMAGDALMAW  235

Query  442   SNRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFC  263
             SN RI +P HRV+M G+E +Y++A F+F  G + +PEEL D++ PL++K FDH   L F 
Sbjct  236   SNDRILSPNHRVIMSGNETRYSLAQFAFSDGEIHVPEELGDEERPLRYKSFDHPGLLRFF  295

Query  262   -ANGGGKEESPINAFCGV  212
              +       S I A+CGV
Sbjct  296   RSQDRYISNSAIKAYCGV  313



>ref|XP_008454372.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Cucumis melo]
Length=314

 Score =   262 bits (670),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/318 (42%), Positives = 194/318 (61%), Gaps = 9/318 (3%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M   ++ KLP+I+F+  N+  G   W     +V+  LEE+GCF A +DKV  E+R  +F+
Sbjct  1     MDGESSLKLPLIDFS--NLESGGPKWELAKAQVKEALEEFGCFEASFDKVPIEVRKGLFE  58

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LPLETK RN S     GY G +   PL E  G+ D   P+   +F+  +WP  
Sbjct  59    ALEELFNLPLETKLRNVSQKPFHGYVGQYPMAPLFESMGVDDSTIPQKVQDFTNILWPQG  118

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYR-MPKW  617
             +  P F +   +YS+ + +LD++V RMVLES G++KY +  ++S++YLLR +KY+   + 
Sbjct  119   N--PTFSKVIETYSQQLSELDEMVRRMVLESLGVEKYMEEHLESTNYLLRVMKYKGTDQS  176

Query  616   NETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSN  437
             NETK G   H D + + I+  N +  L+++T+DGKWINFQPS    +  I G++F AW+N
Sbjct  177   NETKIGLHSHTDKNIVTILYQNHVEGLQVQTKDGKWINFQPSPHSFVAMI-GDSFHAWTN  235

Query  436   RRIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTF-  266
              R+++P HRVMM G E +Y+  LFS  +    V+ PEELVD+ +PL F PFDH +FL F 
Sbjct  236   GRLHSPYHRVMMSGEEVRYSAGLFSIPKAGYIVKAPEELVDEQHPLLFNPFDHVQFLQFY  295

Query  265   CANGGGKEESPINAFCGV  212
                 G K +S +  FCG 
Sbjct  296   YTEAGQKAQSALKTFCGA  313



>ref|XP_004241717.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Solanum lycopersicum]
Length=318

 Score =   262 bits (670),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 134/318 (42%), Positives = 199/318 (63%), Gaps = 13/318 (4%)
 Frame = -2

Query  1141  TNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK-HCK  965
             T PKL +++F ++ +R GTT+W +T  E+R   E +GCF A+YDK+S +L+ ++F+ + +
Sbjct  6     TPPKLLVVDFNNEELRPGTTTWESTCKEIRHAFENHGCFIALYDKISPQLQKSIFQDNSQ  65

Query  964   HLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNT  785
              LF+LPLE K  N S+    GY G  + +P  E FGI    T +    FS  MWP  +++
Sbjct  66    QLFELPLERKVLNISEKPYHGYVGQISFLPNHEAFGIDYATTSQGIQTFSNLMWPQGNDS  125

Query  784   PNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETK  605
               FCE +  +SK+V  LD  V+RM+ ESYG+ K  +  ++S++YLLR++KY  PK  ET 
Sbjct  126   --FCESSLMFSKIVAALDNKVVRMLFESYGITKNCESYVESTTYLLRYLKYNTPKTKETS  183

Query  604   TGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWIN--FQPSSSKTIVFIAGEAFMAWSNRR  431
                 PH D +F  I+  N I  LE++TRD +WI   F PSS    V +AGEA   WSN R
Sbjct  184   MVFPPHTDKTFTTILYQNHISGLEVQTRDLQWITLEFPPSS---FVVMAGEALRGWSNDR  240

Query  430   IYAPVHRVMM--KGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTFC  263
             +  P+HRV+M   GSE +YT+ LF+FL+    +E+ EEL+D+++PLKFKPF H + + F 
Sbjct  241   VLTPIHRVIMDINGSETRYTIGLFTFLKNDKIIEVDEELIDEEHPLKFKPFVHLDLIKFF  300

Query  262   -ANGGGKEESPINAFCGV  212
                 G + ++ +  FCGV
Sbjct  301   DTERGRRSQNLVEDFCGV  318



>ref|XP_004241716.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Solanum 
lycopersicum]
Length=317

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 137/314 (44%), Positives = 200/314 (64%), Gaps = 12/314 (4%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQ  953
             KLP+I+FT +N+  GT SW   S E    LEEYGCF A+YDKVS ++ D +F+  + LF 
Sbjct  9     KLPVIDFTMENLEPGTNSWSKASKEAVCALEEYGCFVALYDKVSSKIHDDVFQALEELFD  68

Query  952   LPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFC  773
             LP + K +N S    +GY G    +PL E  GI +  T E   NF+  MWP+ +N  +F 
Sbjct  69    LPTQKKVQNKSSKPLYGYVGQIPFIPLYESMGIDNANTLEGIQNFTNFMWPNGNN--DFS  126

Query  772   EDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHI  593
             E   +YSK   +L+++V++MV ESYG++KY++  I+S +YL R +KYR  +  E K G +
Sbjct  127   EALLAYSKAAAELEEMVVKMVFESYGVEKYYESHIKSVNYLARVMKYREAQVEEAKLGFV  186

Query  592   PHRDNSFMAIV-DTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPV  416
              H D SFM+ +  TNQ+  LE++ +DG+W   + S S +IV +AG+A MAWSN RI +P 
Sbjct  187   AHTDKSFMSTIHQTNQVNGLEIKGKDGQWFKVELSPS-SIVVMAGDAIMAWSNNRIKSPH  245

Query  415   HRVMM---KGSEDKYTVALFSFLRGT--VEIPEELVDDDNPLKFKPFDHFEFLTFCANGG  251
             HRVMM   KG+  +Y++A FSF+  +  VE P+ELVDDD+PL F  F+H ++L F +   
Sbjct  246   HRVMMGEEKGA--RYSIAQFSFMEDSLMVETPKELVDDDHPLLFNSFNHLDYLKFFSKEE  303

Query  250   GKE-ESPINAFCGV  212
              +  E  + ++CGV
Sbjct  304   NRRLECALKSYCGV  317



>ref|XP_004152262.1| PREDICTED: gibberellin 20 oxidase 1-B-like [Cucumis sativus]
 ref|XP_004156846.1| PREDICTED: gibberellin 20 oxidase 1-B-like [Cucumis sativus]
Length=314

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 131/318 (41%), Positives = 195/318 (61%), Gaps = 9/318 (3%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + ++ KLP+I+F+  N+  G   W     +V+  LEE+GCF A +DKV  E+R  +F+
Sbjct  1     MDSESSLKLPLIDFS--NLESGGPKWELAKAQVKEALEEFGCFEASFDKVPVEVRKGLFE  58

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LPLETK RN S     GY G +   PL E  G+ D   P+   +F+  +WP  
Sbjct  59    ALEELFNLPLETKLRNVSQKPFHGYVGQYPMAPLFESMGVDDSTIPQKVQDFTNILWPQG  118

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +  P F +   +YS+ + +LD++V RMVLES G++KY +  ++S++YLLR +KY+  + N
Sbjct  119   N--PTFSKVMETYSQQLAELDEMVRRMVLESLGVEKYLEEHLESTNYLLRVMKYKGTESN  176

Query  613   -ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSN  437
              ETK G   H D + + I+  N +  L+++T+DGKWINFQPS    +  I G++F AW+N
Sbjct  177   YETKIGLHSHTDKNIVTILYQNHVQGLQVKTKDGKWINFQPSPDSFVAMI-GDSFHAWTN  235

Query  436   RRIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTF-  266
              R+++P HRVMM G E +Y+  LFS  +    V+ PEELVD+ +PL F PFDH +FL F 
Sbjct  236   GRLHSPYHRVMMSGEEVRYSAGLFSIPKAGYIVKAPEELVDEQHPLLFNPFDHVQFLQFY  295

Query  265   CANGGGKEESPINAFCGV  212
                 G K +S +  +CG 
Sbjct  296   YTEAGQKAQSALKTYCGA  313



>gb|KEH28750.1| 2-oxoglutarate-dependent dioxygenase [Medicago truncatula]
Length=314

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/317 (41%), Positives = 198/317 (62%), Gaps = 6/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M +    KLP+I+F + N      +W     +V + L EYGCF A++DKV  +LR A+F 
Sbjct  1     MGSEHTQKLPLIDFNNLNFEAKNPNWELVKSQVYKALVEYGCFEAIFDKVPLDLRKAIFT  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LPLETK  N S+    GY G +  +PL E   I+D    E   + +  +WPD 
Sbjct  61    SIEELFDLPLETKLLNVSNKPYDGYIGQYPVVPLYESMAIEDANILEKVKSMTNILWPDG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +   NF E   S+S+ + +LDQ++ +M+LES G++KY +  + S++Y LR +KY+ P+ +
Sbjct  121   NK--NFSETIHSFSEELIELDQIIRKMILESLGVEKYLEEHMNSTNYRLRAMKYKGPQTS  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             +TK G  PH D +F+ I+  NQ+  LEM T+DG+WI+++PSS  + V + G++  AWSN 
Sbjct  179   DTKVGLTPHTDKNFVTILYQNQVEGLEMMTKDGQWISYKPSSG-SFVVVLGDSIHAWSNG  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTFC-  263
             R+++P HRVMM G+E +Y+  LFS  +G   ++ PEELVD+++PL FKPFD  EFL +  
Sbjct  238   RLHSPFHRVMMSGNEARYSAGLFSTPKGGYIIKAPEELVDEEHPLLFKPFDQAEFLKYYH  297

Query  262   ANGGGKEESPINAFCGV  212
             +  G ++   I  +CGV
Sbjct  298   SREGARDRFAIRTYCGV  314



>ref|XP_009616143.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Nicotiana tomentosiformis]
Length=315

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/310 (42%), Positives = 195/310 (63%), Gaps = 6/310 (2%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQ  953
             KLPII+FT +N+  GT SW     E    LEEYGCF A+ DK+S ++ + +F   + +F 
Sbjct  9     KLPIIDFTKENLEPGTNSWSKVCKEAVCALEEYGCFVALSDKISLKIHNEVFGALEKVFD  68

Query  952   LPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFC  773
             LP++TK +N S    +GY G    +PL E  GI +  T E   NF+  MW   +N   F 
Sbjct  69    LPIQTKIQNKSTKPLYGYVGQIPFIPLYESMGIDNANTLEGIQNFTNFMWSSGNNA--FS  126

Query  772   EDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHI  593
             +   +YSK   +L+++V+RMV ESYG++K ++  I+S +YL R +KY+  +  E K G +
Sbjct  127   QALLAYSKAAAELEEMVVRMVFESYGVEKNYESHIKSVNYLARVMKYKEAQLEEPKLGFV  186

Query  592   PHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPVH  413
              H D SFM+ +  NQ+  LE++ +DG+W   + S S +IV +AG+A MAWSN RI +P H
Sbjct  187   AHTDKSFMSTIHQNQVNGLEIKGKDGQWFGVELSPS-SIVVMAGDAIMAWSNNRIKSPHH  245

Query  412   RVMMKGSEDKYTVALFSFLRGT--VEIPEELVDDDNPLKFKPFDHFEFLTFCANGGGKE-  242
             RVMM+G  ++Y++A FSF+  T  VE P+E VD+++PLKFKPF+H ++L F +    +  
Sbjct  246   RVMMEGKGERYSIAQFSFMEDTVMVETPKEFVDEEHPLKFKPFNHLDYLHFFSKEENRRL  305

Query  241   ESPINAFCGV  212
             E  +  +CGV
Sbjct  306   ECALKTYCGV  315



>ref|XP_004136073.1| PREDICTED: gibberellin 2-beta-dioxygenase 8-like [Cucumis sativus]
 ref|XP_004171509.1| PREDICTED: gibberellin 2-beta-dioxygenase 8-like [Cucumis sativus]
Length=316

 Score =   261 bits (668),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/309 (41%), Positives = 197/309 (64%), Gaps = 6/309 (2%)
 Frame = -2

Query  1129  LPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQL  950
             +PII+ +   +  GT  W     E+R GLE++GCF+ VYDKVS EL +++F+  K LF L
Sbjct  11    IPIIDLS--KLEEGTKEWGLACREMRFGLEQFGCFSVVYDKVSLELHNSIFEATKELFHL  68

Query  949   PLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFCE  770
             P+ET+ +NTS+    GY G ++ +PL E   I + +  + T +F+  MWP  +N  +FC 
Sbjct  69    PIETRMKNTSEKPYHGYFGGYSFLPLYESMAIDNPIQLQPTQSFANLMWPTTENN-HFCV  127

Query  769   DTTSYSKLVWQLDQVVMRMVLESYGLDKYF--DPLIQSSSYLLRFIKYRMPKWNETKTGH  596
                 +S LV +L+ +V +MVLESYG+      +P+++S++YLLR  KYR+ + +E   G 
Sbjct  128   AVERFSTLVAKLEHMVTKMVLESYGVSNKVVSEPIMESTNYLLRLFKYRVAEKDENDVGL  187

Query  595   IPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPV  416
               H D +F++I+  + I  L+++  D +W+   PSS  +   +AG+A MAWSN RI +  
Sbjct  188   HSHTDLTFLSIIHQHLISGLQIQLLDDQWLEVHPSSHCSFTVMAGDALMAWSNERIRSCR  247

Query  415   HRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTF-CANGGGKEE  239
             HRV+M+G E +Y++ +FSF  G +E+P+E VDD NPL++KPF H++FLT+  AN   K  
Sbjct  248   HRVIMRGEETRYSIGMFSFKNGRIEVPQEFVDDANPLRYKPFHHYDFLTYDKANASHKTI  307

Query  238   SPINAFCGV  212
             S I  +CG+
Sbjct  308   SRIKDYCGL  316



>ref|XP_008461058.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 isoform X2 [Cucumis melo]
Length=316

 Score =   261 bits (668),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/309 (41%), Positives = 193/309 (62%), Gaps = 4/309 (1%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRV-GTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLF  956
             +LP+I F+D+ ++  G+  WR TS +VR  LEEYGCF A Y+ V  ELR+ + K  K LF
Sbjct  9     RLPVINFSDEKVKAEGSVEWRRTSKKVREALEEYGCFIAKYEGVGKELREEVLKAVKELF  68

Query  955   QLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNF  776
             +LP+E K+ N  +    GY G   ++PL E  GI D        +FS  MWP+ ++  +F
Sbjct  69    ELPIERKKMNKYEKPFNGYVGELRTLPLHESLGIDDATNFNGVQSFSHLMWPEGNH--HF  126

Query  775   CEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGH  596
                  S++K   +LD++V +M+ ESYG++KY++    S +YLLR +K + P+  +     
Sbjct  127   SATLHSFAKRAEELDKMVTKMIFESYGVEKYYNSHADSITYLLRILKNKAPQSPDPTLCL  186

Query  595   IPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPV  416
             + H D SF  ++  + I  LE++T++G+WI    SS  + V IAG+AF AWSN RI +  
Sbjct  187   VDHTDKSFTTMIYQDHINGLELKTKNGQWIQVDNSSPSSFVVIAGDAFKAWSNERIRSCR  246

Query  415   HRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTF-CANGGGKEE  239
             HRV+M+G E +Y++ +FSF  GT+E+P+  VDD NPL++KPF+H++FLT+  AN      
Sbjct  247   HRVIMRGEETRYSIGMFSFKNGTIEVPQGFVDDANPLRYKPFNHYDFLTYDKANASHNTI  306

Query  238   SPINAFCGV  212
             S I  +CG+
Sbjct  307   SRIKDYCGL  315



>gb|EYU31921.1| hypothetical protein MIMGU_mgv1a010132mg [Erythranthe guttata]
Length=321

 Score =   261 bits (668),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 140/323 (43%), Positives = 199/323 (62%), Gaps = 13/323 (4%)
 Frame = -2

Query  1153  MATHTNP-KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMF  977
             MA    P K+PI + +  N+  G++SW      V++ LEEYG F A YD+V +EL   +F
Sbjct  1     MANSQEPSKVPIFDLSPKNLNPGSSSWPQACKNVKQALEEYGFFIAHYDRVPYELDKQLF  60

Query  976   KHCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPD  797
             +  + LF LPLETK RNTSD+  +GY G     PL E  GI D  T ++  NF+  MWP 
Sbjct  61    EELQELFDLPLETKTRNTSDLVFYGYVGQLPHAPLHESMGIPDVTTFDAVQNFTNLMWPS  120

Query  796   ADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKW  617
              + T  FCE   SY+KLV +L+Q+V +MV ESYG  K++   I+S++YLLR IKY +PK 
Sbjct  121   GNKT--FCESILSYAKLVSELEQIVDKMVFESYGTQKHYKSHIESTTYLLRTIKYSVPKI  178

Query  616   NETKT----GHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQ-PSSSKTIVFIAGEAF  452
              + K+    G   H D SF++I+  NQI  L ++ R+G+W+  + P  S   V +AG+A+
Sbjct  179   ADDKSKDNIGTNVHTDKSFLSILHQNQINGLYIQLRNGEWLAVEVPPGS--FVVMAGDAY  236

Query  451   MAWSNRRIYAPVHRVMMKGS--EDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFE  278
              AWSN RI+A  H+V+MKG     ++ +ALFSF  G   +PEELVD ++PL+F PFD+F 
Sbjct  237   QAWSNGRIFAAKHQVVMKGDVRMPRFCLALFSFNHGMTHVPEELVDPEHPLRFNPFDNFG  296

Query  277   FLTFCANGGGK-EESPINAFCGV  212
                F  +G  +  ES   A+CG+
Sbjct  297   LARFYLSGVTQMTESTAQAYCGI  319



>ref|XP_009379331.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Pyrus x bretschneideri]
Length=313

 Score =   261 bits (667),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 126/316 (40%), Positives = 200/316 (63%), Gaps = 5/316 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTD-DNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMF  977
             M +    KLP+++ T+ +N++ GT +WR+T  +V++ LE+ GCF A Y  V  +L +AMF
Sbjct  1     MGSEGQAKLPVVDLTNAENLKPGTEAWRSTCKQVQQALEDCGCFEATYHGVPLDLHNAMF  60

Query  976   KHCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPD  797
                  LF LP+ETK + TSD     Y G  +S+PL E  G+    TPE    F+  MWP 
Sbjct  61    SMSNGLFDLPVETKCQKTSDKPYHSYIGQISSLPLYESLGVDYATTPEGVEKFTNMMWPA  120

Query  796   ADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKW  617
               +   F E   ++S LV +L ++V +MV  +YG+ + ++  + S+ YLLR+ +YR  K 
Sbjct  121   GSD--EFREKVYNFSNLVAELTKLVTKMVFHNYGVQRLYESHMASTIYLLRWSQYREQKE  178

Query  616   NETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSN  437
             NET  G  PH D +F++++   ++  LE++T+DG+W   +PS + + V +AG+AFMAWSN
Sbjct  179   NETNVGLPPHTDKAFISVLHQKEVNGLEVQTKDGQWFVAEPSPT-SFVVMAGDAFMAWSN  237

Query  436   RRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCAN  257
              R+ +  H+V+MK ++ + ++ LFS+L GTV++PEEL+DD++PL +KPFDHF +L F   
Sbjct  238   GRVPSCFHQVIMKQNKTRLSIGLFSWLNGTVQVPEELIDDEHPLSYKPFDHFSYLHFSVT  297

Query  256   GGGKE-ESPINAFCGV  212
                K+ +  I  +CGV
Sbjct  298   PEAKQSKCAIKTYCGV  313



>gb|KHG05406.1| 2'-deoxymugineic-acid 2'-dioxygenase [Gossypium arboreum]
Length=314

 Score =   261 bits (667),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 128/317 (40%), Positives = 193/317 (61%), Gaps = 6/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T  KLP+I+F+  +++ G+  W     +V++ L+EYGCF A++DK+   LR+A+F 
Sbjct  1     MGSQTPLKLPVIDFSKPDLKAGSNEWDLVKGQVQQALQEYGCFEALFDKIPLHLREAIFG  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LPL+ K RN S+    GY G +  +PL E  G+ D    E     +  +WP  
Sbjct  61    SLQELFDLPLQAKIRNVSNKPYHGYVGQYPQVPLYESMGVDDANITEKVEALTTTLWPQG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +++  F     S+S+ + +LDQ+V RM+LES+ L+KY D  + S++YLLR +KY+ PK  
Sbjct  121   NSS--FSNTIQSFSEQLSELDQIVRRMILESFDLEKYMDEHMGSTNYLLRVMKYKGPKTT  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             ETK G   H D + + I+  N++  LE+ ++ G+WIN +PS     V I GE+  AW N 
Sbjct  179   ETKLGLNSHTDKNIVTILYQNEVDGLEVLSKQGEWINVKPSKHSFTVMI-GESLYAWLNG  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTF-C  263
             R++AP HRVMM G + +Y+  LFS  +    ++ P+ELVD+ +PL FKPFDH +FL F  
Sbjct  238   RLHAPYHRVMMTGDKARYSAGLFSVPKAGYIIKAPDELVDEAHPLLFKPFDHVDFLRFYY  297

Query  262   ANGGGKEESPINAFCGV  212
                G K ES +  FCGV
Sbjct  298   TEAGQKAESALKVFCGV  314



>ref|XP_008226092.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Prunus 
mume]
Length=315

 Score =   260 bits (665),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 134/320 (42%), Positives = 194/320 (61%), Gaps = 11/320 (3%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDN--MRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAM  980
             M +   PKLP+++F+ +   ++ GT SW +   +VR+ LEE+GCF   YDK+  E ++  
Sbjct  1     MGSDGQPKLPVLDFSKEAEALKPGTNSWLSACKDVRQALEEFGCFFVSYDKLPPEFQNGF  60

Query  979   FKHCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWP  800
                 + LF LP +TK  N S+    GY G   S+PL E  GI++    E T  F+K MW 
Sbjct  61    LGALQELFDLPTQTKMTNKSENPSSGYFGQIPSLPLHEGLGIENATNLEETQKFTKLMWA  120

Query  799   DADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPK  620
               ++  NFCE T S++K+  +L+Q+V RM+ ESYG++KY+D  + S SYLLR +K R P+
Sbjct  121   GGND--NFCESTHSFAKVAEELNQMVTRMIFESYGMEKYYDSYVGSVSYLLRLLKNRTPQ  178

Query  619   WNETKTGHIPHRDNSFMAIV-DTNQIGCLEMETRDGKWI--NFQPSSSKTIVFIAGEAFM  449
              NE   G + H D SF  ++   NQ   LE+ET+  +WI   F PSS    + +AG+A M
Sbjct  179   ENEPSLGFVAHTDKSFTTLLYQNNQAHGLEVETKSHEWIRAEFPPSS---FLVMAGDALM  235

Query  448   AWSNRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLT  269
             AWSN RI +P HRV+M G+E +Y++A F+F  G + +PEEL D+ +PL++K FDH   L 
Sbjct  236   AWSNDRILSPNHRVIMSGNEARYSLAQFAFSDGEIHVPEELADEQHPLRYKSFDHPGLLV  295

Query  268   FC-ANGGGKEESPINAFCGV  212
             F   N      S I A+CGV
Sbjct  296   FFRTNESYISNSAIKAYCGV  315



>ref|XP_003528366.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Glycine max]
Length=314

 Score =   260 bits (664),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/317 (39%), Positives = 198/317 (62%), Gaps = 6/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M +    KLP+I+FT+  +     +W     +V + L +YGCF A+++KV  ELR A+F 
Sbjct  1     MGSEATLKLPVIDFTNLKLEANNPNWEAIKSQVHKALVDYGCFEAIFEKVPLELRKAIFA  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LPL+TK  N S     GY G +  +PL E  GI D    E+  + +  MWP  
Sbjct  61    ALQELFDLPLQTKILNVSKKPYHGYVGQYPMVPLFESMGIDDANVYENVESMTNIMWPHG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +  P+F +   S+S+ + +LDQ++ +M+LES G++KY +  + S++YLLR +KY+ P+ +
Sbjct  121   N--PSFSKTIQSFSEQLSELDQIIRKMILESLGVEKYLEEHMNSTNYLLRVMKYKGPQTS  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             +TK G   H D + + I+  N++  LE+ T+DGKWI+++PS    +V I G++  AWSN 
Sbjct  179   DTKVGLTTHSDKNIVTILYQNEVEGLEVMTKDGKWISYRPSPDSFVVMI-GDSLHAWSNG  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLT-FC  263
             R+++P HRVMM G+E +Y+  LFS  +G   ++ PEELVD+++PL FKPFDH EFL  + 
Sbjct  238   RLHSPFHRVMMSGNEARYSAGLFSIPKGGNIIKAPEELVDEEHPLLFKPFDHVEFLKYYY  297

Query  262   ANGGGKEESPINAFCGV  212
                G +++  +  +CGV
Sbjct  298   TEKGQRDQFALRTYCGV  314



>ref|XP_004506877.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Cicer arietinum]
Length=314

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/317 (39%), Positives = 203/317 (64%), Gaps = 6/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M++ T PKLPII+F + N+   + +W +   +V + LEEYGCF A+ DKV  +LR  +F 
Sbjct  1     MSSETIPKLPIIDFNNLNLEAKSPNWESVKSQVYKALEEYGCFEAILDKVPLDLRKTIFS  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LPL+TK+ N S     GY   +  +PL E  GI D    E+  + +  +WPD 
Sbjct  61    SLEELFDLPLQTKQLNVSKKLHHGYLSQYPMLPLYESIGIDDANIFENVESLTNILWPDG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             + +  F +   ++S+ + +LDQ++ +M+LES G++KY +  + S+SYLLRF+KY+ P+ +
Sbjct  121   NQS--FSKTVHTFSEELLELDQIIRKMILESLGVEKYLEEHMNSTSYLLRFMKYKGPQTS  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             +TK G   H D + + I+  NQ+  LE+  +DGKWI+++PS    +V + GE+  AWSN 
Sbjct  179   DTKVGLKAHTDKNTVTILYQNQVEGLEVMNKDGKWISYKPSLDSFVVLV-GESLHAWSNG  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLT-FC  263
             R+++P+HRVMM G+E +Y++AL S  +    ++ P+ELVDD++PL FKP+ + EFL  F 
Sbjct  238   RLHSPLHRVMMSGNEARYSIALGSIPKEECIIKAPDELVDDEHPLLFKPYVYDEFLKYFF  297

Query  262   ANGGGKEESPINAFCGV  212
             +  G +++  +  +CGV
Sbjct  298   SEKGQRDQFAMRTYCGV  314



>emb|CDP08459.1| unnamed protein product [Coffea canephora]
Length=313

 Score =   259 bits (662),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/298 (42%), Positives = 189/298 (63%), Gaps = 5/298 (2%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQ  953
             KLP I+F+   ++ G   W +   +VR+ LEE+GCF A+YDK+S EL+ + FK  + LF 
Sbjct  7     KLPAIDFSQPGLKPGNPEWDSVKGQVRKALEEFGCFEAMYDKISLELQKSFFKALEELFN  66

Query  952   LPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFC  773
             LPL+TK+RN S     GY G +   PL E  G+ D    E   +F+  +WP+ ++  NFC
Sbjct  67    LPLQTKQRNASKKIYHGYIGQYPIFPLYESMGLDDANILEKVESFTDLLWPEGNS--NFC  124

Query  772   EDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHI  593
             +   SYS+ + +LD++V RM+LES GL+KY D  ++ ++YLLR +KY  P+  ETK G  
Sbjct  125   KTVHSYSEQISELDKIVRRMILESLGLEKYMDEHMELTNYLLRAMKYEGPQTTETKVGLP  184

Query  592   PHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPVH  413
              H D + ++I+  +QI  L++ T+DG WI+ +PS     V I G+A  AW+N R++ P H
Sbjct  185   AHTDKNILSILCQDQIRGLQVLTKDGHWIDVEPSPGSFTVMI-GDALFAWTNGRLHCPFH  243

Query  412   RVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTFCANGGGK  245
             RVMM G+  +Y+  +FS  +    ++ PEELVD+++PL FKPFD+ EFL+F     GK
Sbjct  244   RVMMTGNIARYSAGIFSMPKAGYIIKAPEELVDEEHPLLFKPFDNVEFLSFLRTEAGK  301



>ref|XP_008784635.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Phoenix dactylifera]
Length=314

 Score =   258 bits (660),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 135/317 (43%), Positives = 192/317 (61%), Gaps = 6/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             MA+    KLP ++ +D+ ++ G+ SW     +VR+ LE +GCF AV+ KV  ELR A+F 
Sbjct  1     MASKALVKLPRLDLSDEGLQPGSESWGLVRAQVRQALETFGCFEAVFPKVPEELRRAIFP  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
                 LF LP E K RN SD    GY G +  +PL E  GI+D   PE    F+  MWP  
Sbjct  61    ALDELFSLPTEAKLRNISDKPSHGYVGQYPHLPLFESMGIEDAEIPEEAQKFTALMWPPH  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
              N  +F E   S+SK V +LDQ+V RMVLES G++KY D  +Q + Y+LR +KY+ P   
Sbjct  121   GNQ-SFSETICSFSKHVGELDQMVRRMVLESLGVEKYLDSHMQLTRYVLRVMKYKGPDTA  179

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             E   G   H D++ + I+  NQ G LE++T+DG+WI    +S  + V + G++F AWSN 
Sbjct  180   EATMGLGAHSDSNIVTILYQNQDG-LEIQTKDGRWIPVS-TSPDSFVVMTGDSFTAWSNG  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTFCA  260
             R++AP HRVMM GSE +Y+  LF+  +    V  P+ELVD+++PL +KPFDH +FL F  
Sbjct  238   RVHAPEHRVMMTGSEVRYSAGLFAMPKAGHLVRAPDELVDEEHPLLYKPFDHMDFLRFHR  297

Query  259   NGGGKE-ESPINAFCGV  212
                 +  ++ +N FCG 
Sbjct  298   TRLNQTVKAALNEFCGA  314



>gb|KHN01361.1| Gibberellin 20 oxidase 1 [Glycine soja]
Length=314

 Score =   258 bits (658),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 124/317 (39%), Positives = 197/317 (62%), Gaps = 6/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M +    KLP+I+FT+  +     +W     +V + L +YGCF A+++KV  ELR A+F 
Sbjct  1     MGSEATLKLPVIDFTNLKLEANNPNWEAIKSQVHKALVDYGCFEAIFEKVPLELRKAIFA  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LPL+TK  N S     GY G +  +PL E  GI D    E+  + +  MWP  
Sbjct  61    ALQELFDLPLQTKILNVSKKPYHGYVGQYPMVPLFESMGIDDANVYENVESMTNIMWPHG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +  P+F +   S+S+ + +LDQ++ +M+LES G++KY +  + S++YLL  +KY+ P+ +
Sbjct  121   N--PSFSKTIQSFSEQLSELDQIIRKMILESLGVEKYLEEHMNSTNYLLEVMKYKGPQTS  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             +TK G   H D + + I+  N++  LE+ T+DGKWI+++PS    +V I G++  AWSN 
Sbjct  179   DTKVGLTTHSDKNIVTILYQNEVEGLEVMTKDGKWISYRPSPDSFVVMI-GDSLHAWSNG  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLT-FC  263
             R+++P HRVMM G+E +Y+  LFS  +G   ++ PEELVD+++PL FKPFDH EFL  + 
Sbjct  238   RLHSPFHRVMMSGNEARYSAGLFSIPKGGNIIKAPEELVDEEHPLLFKPFDHVEFLKYYY  297

Query  262   ANGGGKEESPINAFCGV  212
                G +++  +  +CGV
Sbjct  298   TEKGQRDQFALRTYCGV  314



>ref|XP_008366303.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Malus 
domestica]
Length=317

 Score =   258 bits (658),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 131/319 (41%), Positives = 197/319 (62%), Gaps = 7/319 (2%)
 Frame = -2

Query  1153  MATHTNPKL-PIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMF  977
             M + T PK+ P+++ +D+N++ GT +W     +V+  LEEY CF AVY+K + E+ +++F
Sbjct  1     MVSKTQPKVVPVVDLSDENLKPGTDAWLLACKQVQHALEEYSCFEAVYNKXTLEIHNSIF  60

Query  976   KHCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPD  797
                K L  LPLETK +  SD     Y G     P  E  GI+D  + E    F+  MWP 
Sbjct  61    SAIKELCDLPLETKMQKASDRPFHHYFGQLPLNPRYETLGIQDPASLEGAQRFTSIMWPA  120

Query  796   ADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKW  617
              ++   F E   S+SK+V +LDQ+V RMV ++YG+ + +D    S++Y LR I Y+    
Sbjct  121   GND--RFXESVHSFSKVVVELDQMVKRMVFDAYGVGRLYDSYKASTTYQLRCINYKSXLT  178

Query  616   NE-TKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWS  440
             NE T  G IPH D +F +I+  N +G L+++T+DG+WI   PSS  + + +A + FMAWS
Sbjct  179   NETTDXGLIPHTDKNFTSILHQNDVGGLQIKTKDGEWIEAAPSSPSSFLVLASDLFMAWS  238

Query  439   NRRIYAPVHRVMMKGSEDKYTVALFSFL-RGTVEIPEELVDDDNPLKFKPFDHFEFLTFC  263
             N RI A  H+V +K  + +Y++ALFS++  G V++PEE VDD +PLK+KPF HF++L F 
Sbjct  239   NDRISACEHQVXLKEKKARYSLALFSYIGDGVVQVPEEFVDDXHPLKYKPFGHFDYLRFY  298

Query  262   ANG--GGKEESPINAFCGV  212
                    K ++PI A+CGV
Sbjct  299   ETDEEARKXKNPIKAYCGV  317



>ref|XP_006305421.1| hypothetical protein CARUB_v10009821mg [Capsella rubella]
 gb|EOA38319.1| hypothetical protein CARUB_v10009821mg [Capsella rubella]
Length=310

 Score =   258 bits (658),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 123/309 (40%), Positives = 193/309 (62%), Gaps = 4/309 (1%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAA-VYDKVSWELRDAMFKHCKHLF  956
             K+P ++F+ ++++ GT  W TTS  +R+ LEEYGCF   + +K   +L D +F     LF
Sbjct  4     KIPTLDFSREDLKQGTQYWETTSKNIRQALEEYGCFIIDLQNKTPLDLLDQVFGSLVDLF  63

Query  955   QLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNF  776
              LP +TK +N  D    GY G   ++PL E  GI +  + + T +F+  MWP  +   +F
Sbjct  64    DLPTQTKMKNKYDKPLSGYVGQIPALPLHESLGIDNATSLKETRSFTGLMWPQGNE--HF  121

Query  775   CEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGH  596
              E    Y++   +LDQ+V++MV ESY ++KY+DP I+S++YLLR +K   P   +   G 
Sbjct  122   SECLHKYAEFAAKLDQMVVQMVFESYNVEKYYDPYIESTTYLLRVLKNCAPNNEKPTLGF  181

Query  595   IPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPV  416
             + H D SF  I+  +Q+  LE+ETR+G+ +N   SS    +  AG+A  AWSN R+++P 
Sbjct  182   VTHTDKSFTTILHQDQVNGLELETREGERVNINLSSPSLFMVFAGDALRAWSNDRVWSPR  241

Query  415   HRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFC-ANGGGKEE  239
             H+V++ G  D+Y++A+F+F  GT+++PEEL+D  +PL +KPFDH   L+F   + G K E
Sbjct  242   HQVLVSGKTDRYSLAMFAFNNGTLQVPEELIDHQHPLMYKPFDHLGLLSFYRTDTGYKSE  301

Query  238   SPINAFCGV  212
              PI A+CG+
Sbjct  302   CPIKAYCGI  310



>ref|XP_004506878.1| PREDICTED: S-norcoclaurine synthase 1-like [Cicer arietinum]
Length=314

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/317 (40%), Positives = 200/317 (63%), Gaps = 6/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M++ T  KLP I+FT  N+   + +W     +V   L EYGCF A++D++  ELR A+F 
Sbjct  1     MSSKTTLKLPQIDFTSLNLEAKSPNWELVKSQVYEALLEYGCFEAIFDEIPIELRKAIFA  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LPLETK+ N S     GY G +  +PL E  GI D    +   + +   WPD 
Sbjct  61    SLEELFDLPLETKQLNVSKKPYHGYVGQYPMIPLYESMGIDDANIFDKVESMTNNFWPDG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             + +  F +   S+S  + +LDQ++ +M+LES G++KY +  + SS+YLLR +KY+ P+ +
Sbjct  121   NQS--FSKTIHSFSDELTKLDQIIRKMILESLGVEKYLEEHLNSSNYLLRVMKYKGPETS  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             +TK G   H D + + I+  N++  LE+ T+DGKWI+++PS +  +V I G++  AWSN 
Sbjct  179   DTKLGLSSHTDRNIVTILYQNEVEGLEVMTKDGKWISYKPSLNSFVVMI-GDSLHAWSNG  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLT-FC  263
             R+++P H+VMM G+E +Y+  LFS  +G   ++ P+ELVD+++PL FKP+DH EFL  + 
Sbjct  238   RLHSPFHQVMMSGNEARYSTGLFSIPKGGYLIKAPKELVDEEHPLLFKPYDHVEFLKYYY  297

Query  262   ANGGGKEESPINAFCGV  212
             +  G +++ P+  FCGV
Sbjct  298   SEKGQRDQFPMRTFCGV  314



>ref|XP_008386022.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Malus domestica]
Length=318

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/316 (41%), Positives = 198/316 (63%), Gaps = 5/316 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T PKLP I+F+ D ++ G++SW +TS +VR  LEEYG F A YD++S +L + +F 
Sbjct  1     MGSLTLPKLPTIDFSVDVLKPGSSSWLSTSKQVRYALEEYGGFVAQYDQISAQLLNDIFG  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
             H K LF++PLE K +N S+    GY G    MPL E   I +  +PE T  F   MWPD 
Sbjct  61    HAKDLFEVPLENKVKNVSNEPYRGYIGPNHLMPLYEGIAIDNVTSPEETQKFKNLMWPDG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
              +  NFCE T S+++L+ +L+  V +M+ ESYG +K ++ +  ++S+LLRF+KY  P+  
Sbjct  121   KS--NFCETTDSFAQLLSELEHKVEQMLFESYGAEKQYESVASANSHLLRFLKYNKPEEA  178

Query  613   ETKTGHIP-HRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSN  437
             ++ T     H D +F  IV  + +G LE++T+DG WI+ +   S+  VF+AG+    WSN
Sbjct  179   DSTTLRFASHTDKNFTTIVVQHDVGGLEVKTKDGDWISVESVPSQ-FVFLAGDGLQVWSN  237

Query  436   RRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCAN  257
              RI A  HRV   G + +Y++ LF+F  G +++P+ELVD+ +PL + P D  E++ F + 
Sbjct  238   DRIKACHHRVKHCGDKTRYSLGLFTFNNGIIQVPQELVDERHPLLYNPLDSLEYIRFHSR  297

Query  256   GGGKE-ESPINAFCGV  212
             G  +   SP+N FCGV
Sbjct  298   GEARNLVSPVNTFCGV  313



>ref|XP_004136074.1| PREDICTED: gibberellin 20 oxidase 1-like [Cucumis sativus]
Length=317

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/309 (40%), Positives = 190/309 (61%), Gaps = 3/309 (1%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRV-GTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLF  956
             +LP+I F+D+ ++  G   WR TS  VR  +EEYGCF A Y+ VS ELR+ + K  K LF
Sbjct  10    RLPVINFSDEKVKAEGGVEWRRTSKNVREAMEEYGCFIAKYEGVSKELREEVLKAVKELF  69

Query  955   QLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNF  776
             +LP+E K+ N  +    GY G   ++PL E  GI D        +FS  MWP   N  +F
Sbjct  70    ELPIERKKMNKYEKPFNGYVGELRTLPLHESLGIDDATNFNQVQSFSHLMWPPEGNH-HF  128

Query  775   CEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGH  596
                  S++K+  +LD++V +M+ ESYG++KY++    S +YLLR +K + P+  +     
Sbjct  129   SATLHSFAKIAEELDKMVTKMIFESYGVEKYYNSHADSITYLLRVLKSKAPQSPDPTLCL  188

Query  595   IPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPV  416
             + H D SF  +V  + I  LE++T++G+WI    SS  + + IAG+A  AWSN RI +P 
Sbjct  189   VDHTDKSFTTMVYQDHINGLELKTKNGQWIQVDNSSPSSFLVIAGDAIKAWSNDRIESPT  248

Query  415   HRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANGGG-KEE  239
             H+V ++G+ED+Y++A+F F  G VE+P+ELVD ++PL++KPFDH   L F  +  G   +
Sbjct  249   HKVTIRGNEDRYSLAMFGFSNGIVEVPKELVDQNHPLRYKPFDHIGLLHFFRSKEGFNSK  308

Query  238   SPINAFCGV  212
             SP+  +C +
Sbjct  309   SPLKDYCAI  317



>ref|XP_004171510.1| PREDICTED: LOW QUALITY PROTEIN: gibberellin 20 oxidase 1-like 
[Cucumis sativus]
Length=317

 Score =   256 bits (655),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/309 (40%), Positives = 190/309 (61%), Gaps = 3/309 (1%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRV-GTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLF  956
             +LP+I F+D+ ++  G   WR TS +VR  +EEYGCF A Y+ VS ELR+ + K  K LF
Sbjct  10    RLPVINFSDEKVKAEGGVEWRRTSKKVREAMEEYGCFIAKYEGVSKELREEVLKAVKELF  69

Query  955   QLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNF  776
             +LP+E K+ N  +    GY G   ++PL E  GI D        +FS  MWP   N  +F
Sbjct  70    ELPIERKKMNKYEKPFNGYVGELRTLPLHESLGIDDATNFNQVQSFSHLMWPPEGNH-HF  128

Query  775   CEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGH  596
                  S++K+  +LD++V +M+ ESYG++KY++    S +YLLR +K + P+  +     
Sbjct  129   SATLHSFAKIAEELDKMVTKMIFESYGVEKYYNSHADSITYLLRVLKSKAPQSPDPTLCL  188

Query  595   IPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPV  416
             + H D SF  +V  + I  LE++T+ G+WI    SS  + + IAG+A  AWSN RI +P 
Sbjct  189   VDHTDKSFTTMVYQDHINGLELKTKXGQWIQVDNSSPSSFLVIAGDAIKAWSNDRIESPT  248

Query  415   HRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANGGG-KEE  239
             H+V ++G+ED+Y++A+F F  G VE+P+ELVD ++PL++KPFDH   L F  +  G   +
Sbjct  249   HKVTIRGNEDRYSLAMFGFSNGIVEVPKELVDQNHPLRYKPFDHIGLLHFFRSKEGFNSK  308

Query  238   SPINAFCGV  212
             SP+  +C +
Sbjct  309   SPLKDYCAI  317



>ref|XP_006306220.1| hypothetical protein CARUB_v10011908mg [Capsella rubella]
 gb|EOA39118.1| hypothetical protein CARUB_v10011908mg [Capsella rubella]
Length=315

 Score =   256 bits (654),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 128/312 (41%), Positives = 193/312 (62%), Gaps = 5/312 (2%)
 Frame = -2

Query  1141  TNPKLPIIEFT-DDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCK  965
             T  K+PI++FT   +++  T++WR+ S E    LEEYGCF AVYD V+ +L D +F   K
Sbjct  7     TTSKVPILDFTSQQDLKPNTSAWRSISREACEALEEYGCFVAVYDGVTQKLEDNVFAAAK  66

Query  964   HLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNT  785
              LF LP ETK +N ++    GY G    +PL E  GI      E    F+  MWP  ++ 
Sbjct  67    DLFHLPTETKMKNVNEKPYHGYVGQMPIIPLHEGLGIDYVTNKEDAQRFTNLMWPQGND-  125

Query  784   PNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETK  605
               FC+   S+S  V +LD++V+RM+ E+YG++K+++  + S +YLL+F+ Y  P  + + 
Sbjct  126   -QFCKTIHSFSNAVAELDKLVVRMIFENYGVEKHYESHVGSKTYLLKFLMYLAPPESISM  184

Query  604   TGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIY  425
                  H D +F+ I+  N +  LE++++DG+WI+ Q    K+ V +AG+  M WSN RI 
Sbjct  185   PAFPQHTDKTFLTILHQNDVNGLEVKSKDGEWISLQ-LPLKSYVVMAGDISMGWSNDRIR  243

Query  424   APVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANGGGK  245
             + VHRV M+G + +Y++ LFSFL G V IPEELVDD++PL +KPFD+   + F A   G+
Sbjct  244   SCVHRVTMEGDKVRYSIGLFSFLTGLVSIPEELVDDEHPLMYKPFDNIALINFFATKEGR  303

Query  244   E-ESPINAFCGV  212
             E  S + A+CGV
Sbjct  304   ETNSTLKAYCGV  315



>gb|KFK35767.1| hypothetical protein AALP_AA4G033600 [Arabis alpina]
Length=313

 Score =   256 bits (654),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 125/316 (40%), Positives = 196/316 (62%), Gaps = 5/316 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFT-DDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMF  977
             M +    K+PI++ T   +++  T++WR+ S E    LEEYGCF AVYD V+ +L D+ F
Sbjct  1     MESILKSKVPILDLTSQQDLKPNTSTWRSISKEACEALEEYGCFVAVYDGVTKQLDDSAF  60

Query  976   KHCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPD  797
                K LF LP ETKR+N ++    GY G    +PL E  GI      E    F+  MWP 
Sbjct  61    AAAKELFDLPTETKRKNVNEKPYHGYVGQMPIIPLHEGLGIDYITNKEDAQRFTHLMWPQ  120

Query  796   ADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKW  617
              ++  +FCE   ++S  V +LD++V+RM+ E+YG++K ++  ++S +YLL+F+KY  P  
Sbjct  121   GNH--HFCETVQAFSTAVAELDKLVVRMIFENYGVEKNYESHVESKTYLLKFLKYLAPPE  178

Query  616   NETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSN  437
             + +      H D +F++I+  N +  LE++++DG+WI+ Q    K+ V +AG+  M WSN
Sbjct  179   STSMQAFPQHTDKTFLSILHQNDVNGLEVKSKDGEWISLQ-LPPKSYVVMAGDISMGWSN  237

Query  436   RRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCAN  257
              RI +  HRV M+G + +YT+ LFSF+ G V +PE+LVDD++PL +KPFD+   + F A 
Sbjct  238   DRIRSCEHRVTMEGDKTRYTLGLFSFVTGMVSVPEDLVDDEHPLMYKPFDNIALINFYAT  297

Query  256   GGGKE-ESPINAFCGV  212
               G+E  S + A+CG+
Sbjct  298   KEGREANSTLKAYCGI  313



>emb|CDP19495.1| unnamed protein product [Coffea canephora]
Length=311

 Score =   256 bits (653),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 130/317 (41%), Positives = 194/317 (61%), Gaps = 9/317 (3%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M   +N +LP+I  T++ +R G  SW      V R  EEYGCF AV+DK   E+RD++F 
Sbjct  1     MECASNIRLPVINLTEEILRSGKDSWTEARNIVTRAFEEYGCFIAVHDKYPSEVRDSIFS  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LPLE K RNTS     GYA    ++ L E   I+D    E+   F+ QMWP  
Sbjct  61    ELQDLFNLPLEIKVRNTSQTPLIGYARPRPNVDLYESMSIEDATNLEAVEKFANQMWPSK  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +N  +FCE    Y+  V +LD++V ++V ESYG++KY +  + S +Y +R I+YR+P+ N
Sbjct  121   NN--HFCELFHWYANQVAELDKMVSKLVFESYGVEKYHESHVGSVTYTVRLIRYRVPEQN  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKW--INFQPSSSKTIVFIAGEAFMAWS  440
             E   G  PH D +F+ I+  N+   LE++ ++G W  I+F PSS   +V +AG+ F AWS
Sbjct  179   EMNVGVPPHTDKNFITILQQNEADGLEVQLKNGSWIPIDFPPSS---VVIMAGDVFSAWS  235

Query  439   NRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCA  260
             N R+++P HRV M G E ++++A F++ +  VE P ELVDD++PL +KP D+F +L F +
Sbjct  236   NGRVHSPFHRVTMNGKE-RHSIAQFAYCKKLVETPTELVDDEHPLLYKPLDNFGYLRFLS  294

Query  259   NGGG-KEESPINAFCGV  212
                     +P+ A+CGV
Sbjct  295   TDDNFNTPNPLKAYCGV  311



>ref|XP_010110314.1| Gibberellin 3-beta-dioxygenase 4 [Morus notabilis]
 gb|EXC25834.1| Gibberellin 3-beta-dioxygenase 4 [Morus notabilis]
Length=312

 Score =   256 bits (653),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 128/307 (42%), Positives = 194/307 (63%), Gaps = 5/307 (2%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQ  953
             K+P+I+FT  N++ GT  W     EVR G EEYGCF AVYDK+  +L +++F   + LF 
Sbjct  9     KIPVIDFTKKNLKPGTDEWVLACKEVRNGFEEYGCFEAVYDKIPVDLHNSVFAAAESLFD  68

Query  952   LPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFC  773
             LPLETK + TS+     Y G F+ +PL E  G+ +  T + +  F+  MWP  +   NF 
Sbjct  69    LPLETKMQKTSERPYHSYYGQFSVVPLYESLGVDNPTTLQGSRKFTNLMWPAGNE--NFR  126

Query  772   EDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHI  593
             E T S SKL+ +L ++  RMV +SYG+ +     +  +SYLLRF KYR  + NET  G  
Sbjct  127   ETTQSMSKLLVELYELATRMVFDSYGVQRLHGSNMALTSYLLRFFKYRTRQPNETDVGLQ  186

Query  592   PHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPVH  413
              H+D +FM+IV+ +QI  L+++++DG+WI+ +PS+S + + IAG+   AWSN R+    H
Sbjct  187   CHKDRTFMSIVNQHQIEGLQVKSKDGQWIDVKPSAS-SFLIIAGDIVGAWSNDRVRPCEH  245

Query  412   RVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANGGGKEESP  233
             +V+MK ++ +Y++ LF+F+ G +++PE+LVD+  PLK+KP DHF +L F      K   P
Sbjct  246   QVIMKENKTRYSIGLFAFINGVIDVPEDLVDEKYPLKYKPIDHFGWLRFQEQ--RKAPYP  303

Query  232   INAFCGV  212
             I  F  +
Sbjct  304   IKVFSAI  310



>ref|XP_010545794.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X1 [Tarenaya hassleriana]
Length=330

 Score =   256 bits (654),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 130/328 (40%), Positives = 196/328 (60%), Gaps = 20/328 (6%)
 Frame = -2

Query  1135  PKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAA-VYDKVSWELRDAMFKHCKHL  959
             P +P ++F+ ++++ GT+ W TTS  +R+ LE+YGCF   +++K  ++L   +F   K L
Sbjct  3     PMIPTLDFSREDLKPGTSYWETTSKNIRQALEQYGCFIVDLHEKAPFDLLARVFDSLKQL  62

Query  958   FQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADN---  788
             F LP  TK +N  D    GY G   ++PL E  GI +  + +ST +F+  MWP  ++   
Sbjct  63    FDLPTPTKMKNKYDKPMNGYVGQIPALPLHESLGIDNATSLQSTRSFTDLMWPRGNDRFW  122

Query  787   --------------TPNFCEDTTS-YSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSY  653
                             +FC D    Y++ V ++D++V RM+  SYG+ KY++P ++S+SY
Sbjct  123   YVLIIRILRYFPEYNVSFCSDCMHRYAEFVAEMDRMVARMIFGSYGVAKYYEPYMKSTSY  182

Query  652   LLRFIKYRMPKWNETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIV  473
             LLR +K R PK        + H D SF  I+  +QI  LEMETR G+ IN   SS    +
Sbjct  183   LLRLLKNRAPKDENPYLAFVTHTDKSFTTILHQDQINGLEMETRLGERINVDLSSPSLFM  242

Query  472   FIAGEAFMAWSNRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKP  293
              IAG+A MAWSN RI +P HRV++ G  D+Y++  F+F  GT+++PEELVD+++PL +KP
Sbjct  243   VIAGDALMAWSNDRILSPRHRVLVSGETDRYSLGQFAFSNGTLQVPEELVDNEHPLMYKP  302

Query  292   FDHFEFLTFC-ANGGGKEESPINAFCGV  212
             FDH   L F   + G + E PI A+CGV
Sbjct  303   FDHIGLLHFYRTDIGYRAECPIKAYCGV  330



>ref|XP_009347560.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Pyrus 
x bretschneideri]
Length=317

 Score =   256 bits (653),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 129/319 (40%), Positives = 199/319 (62%), Gaps = 7/319 (2%)
 Frame = -2

Query  1153  MATHTNPKL-PIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMF  977
             M + T PK+ P+++ +D+N++ GT +W     +V+  LEEY CF AVY+K + E+ +++F
Sbjct  1     MISKTQPKVVPVVDLSDENLKPGTDAWLLACKQVQHALEEYSCFEAVYNKATLEIHNSIF  60

Query  976   KHCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPD  797
                K L  LPLETK +  +D     Y G     P  E  GI+D  + E    F+  MWP 
Sbjct  61    SAIKDLCDLPLETKMQKANDRPFHNYFGQLPLNPRYETLGIQDPASLEGAQRFTNIMWPA  120

Query  796   ADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKW  617
              ++  +F E   S+SK+V +LDQ+V RMV ++YG+ + +D    S++Y LR I Y+    
Sbjct  121   GND--HFRESVHSFSKVVVELDQMVKRMVFDAYGVGRLYDSYKASTTYQLRCINYKSQLT  178

Query  616   NE-TKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWS  440
             NE T  G IPH D +F +I+  N +G L+++T+DG+WI   PSS  + + +A + FMAWS
Sbjct  179   NETTDLGLIPHTDKNFTSILHQNDVGGLQIKTKDGEWIEAAPSSPSSFLVLASDLFMAWS  238

Query  439   NRRIYAPVHRVMMKGSEDKYTVALFSFL-RGTVEIPEELVDDDNPLKFKPFDHFEFLTFC  263
             N RI A  H+V++K  + +Y++ALFS++  G V++PEE VD+ +PLK+KPF HF++L F 
Sbjct  239   NDRISACEHQVVLKEKKARYSLALFSYIGDGVVQVPEEFVDEKHPLKYKPFGHFDYLRFY  298

Query  262   ANG--GGKEESPINAFCGV  212
                    K ++PI A+CGV
Sbjct  299   ETDEEARKSKNPIKAYCGV  317



>gb|KDP37370.1| hypothetical protein JCGZ_06824 [Jatropha curcas]
Length=315

 Score =   255 bits (651),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/318 (40%), Positives = 198/318 (62%), Gaps = 7/318 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRV-GTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMF  977
             M + +N KLP+I+F+ +N+   GT+ W +   +V + LEEYGCF AVYDKV  +L   +F
Sbjct  1     MGSLSNSKLPVIDFSSENLEAAGTSGWVSKCKDVLKALEEYGCFVAVYDKVPLQLHADLF  60

Query  976   KHCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPD  797
                + LF LPLETKR+N SD+   G+  +       E   I    T E   +F+K MWP+
Sbjct  61    NVLQELFDLPLETKRKNVSDVPFTGFIEHVPHRSFIESMAITRTETLEGIQDFTKTMWPN  120

Query  796   ADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPK-  620
              +N  NFC+   SY+K V +L ++V++M+ + YG++KY++  ++S++Y  RF+ Y +P+ 
Sbjct  121   GNN--NFCKIVHSYTKTVEELHKMVVKMIFDGYGMEKYYESHMESTTYFSRFLNYIVPQE  178

Query  619   -WNETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAW  443
               NETK G  PH D SF+ ++  N +  L+++ ++G+W++   +SS  +V +AGE  M W
Sbjct  179   NENETKQGLHPHMDKSFLTMLHQNDVSGLQIKPKNGEWLDVHLASSDFLV-LAGEGIMGW  237

Query  442   SNRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFC  263
             SN RI    HRV +K  E +++V LFSF +G +++P+E VDDD+PL +KPFDH   L F 
Sbjct  238   SNDRIDGCDHRVTIKSKEKRFSVGLFSFDKGIMQVPKEFVDDDHPLMYKPFDHIGLLHFF  297

Query  262   ANGGG-KEESPINAFCGV  212
                 G K+   + A+ G+
Sbjct  298   GTPEGYKQHHSLKAYTGL  315



>ref|XP_002517547.1| Gibberellin 20 oxidase, putative [Ricinus communis]
 gb|EEF44711.1| Gibberellin 20 oxidase, putative [Ricinus communis]
Length=314

 Score =   254 bits (650),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/317 (37%), Positives = 198/317 (62%), Gaps = 6/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T  ++P+++ + +++  G++SWR+   ++R+ LE+YGCF  VY+  S E  + +  
Sbjct  1     MGSETVGQIPLVDLSSEHLNPGSSSWRSACNDIRKALEQYGCFEVVYNNPSIEFHNRVLA  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LFQLP E K +N +     GY G  +  P+ E  GI+     +    F+  MWP+ 
Sbjct  61    LLEKLFQLPQEIKMKNVNPKPAHGYMGKMSIFPIHEGMGIEYANDKDECQKFTNLMWPEG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             ++  +FC+   SY+K+V +L Q++++M+ ESYG++K+ +  I+S++YLLR +KYR  +  
Sbjct  121   ND--HFCDTVHSYAKMVTELQQLLVKMLFESYGIEKHSESHIKSTTYLLRLLKYRRSQ-A  177

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             ET  G   H D SF++I+  N +  LE+  +DG W++++PSS  + V +AG+  MAWSN 
Sbjct  178   ETNLGFKGHTDKSFLSILHQNHVKGLEIRMKDGNWVSYEPSSHTSFVVVAGDVGMAWSND  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANG  254
             RI +  HRV + G E +Y + LFSFL G V++PEEL+D+++PL++KPF+H   L F  + 
Sbjct  238   RIKSCYHRVTVDGEEVRYALGLFSFLTGLVKVPEELIDEEHPLQYKPFEHQGLLDFYQSN  297

Query  253   GGKEESPIN---AFCGV  212
               + +   N   A+CGV
Sbjct  298   NSQNKGDSNMVKAYCGV  314



>ref|XP_009799661.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Nicotiana 
sylvestris]
Length=317

 Score =   254 bits (650),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/316 (40%), Positives = 201/316 (64%), Gaps = 12/316 (4%)
 Frame = -2

Query  1138  NPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHL  959
             +P+L +++F ++ +R GT +W  T  ++R   E +GCF A+YDK+S +L+ ++F+  + L
Sbjct  7     SPQLLVVDFNNEELRPGTATWEFTCKDIRFAFENHGCFIALYDKISPQLQKSIFQASQQL  66

Query  958   FQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPN  779
             F+LPLE K  NT++    GY G    +P  E FGI    T +   +FS  MWP  ++   
Sbjct  67    FELPLEKKILNTNEKPYHGYVGQIPFLPNHEAFGIDYATTSQGIQSFSNLMWPQGNDF--  124

Query  778   FCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTG  599
             F E++ ++SK+V +LDQ V+RM+ ESYG++K  +  ++S++YLLR++KY  P   E    
Sbjct  125   FSENSLTFSKIVAELDQKVVRMLFESYGIEKNCESYLESTTYLLRYLKYDAPNTKENSMV  184

Query  598   HIPHRDNSFMAIVDTNQIGCLEMETRDGKW--INFQPSSSKTIVFIAGEAFMAWSNRRIY  425
               PH D +F  ++  N I  LE++TRDG+W  ++F PSS    V +AGEAF  WSN R+ 
Sbjct  185   FPPHTDKTFTTVLYQNHISGLEIQTRDGQWLTLDFPPSS---FVVMAGEAFRGWSNDRVL  241

Query  424   APVHRVMM--KGSEDKYTVALFSFLRGT--VEIPEELVDDDNPLKFKPFDHFEFLTFC-A  260
              PVH+V+M   G+E +YTV +F+FL+    +E+ EELVD+++PL+F+PF H + + F   
Sbjct  242   TPVHKVIMDISGNETRYTVGIFTFLKDNKMIEVAEELVDEEHPLQFQPFVHIDLIKFFDT  301

Query  259   NGGGKEESPINAFCGV  212
               G + ++ +  FCGV
Sbjct  302   ERGRRSQNLVKDFCGV  317



>ref|XP_008384915.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Malus domestica]
Length=318

 Score =   254 bits (650),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/316 (41%), Positives = 195/316 (62%), Gaps = 5/316 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T P LP I F+ D ++ G++SW +TS +VR  LEEYGCF A Y++VS +L + +F 
Sbjct  1     MGSLTLPNLPTINFSVDALKPGSSSWLSTSKQVRYALEEYGCFVAEYNQVSAQLLNNIFG  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               K LF++PLE K +N S+    GY G    MPL E   I +  +P+ T  F   MWPD 
Sbjct  61    QAKDLFEVPLENKVKNVSNEPYRGYIGPNHLMPLYEGIAIDNVTSPQETQKFKNLMWPDG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
              +  NFCE T S+++L+ +L+  V +M+ ESYG +K ++ +  ++S+LLRF+KY  P+  
Sbjct  121   KS--NFCETTDSFAQLLSELEHKVEQMLFESYGSEKQYESVASANSHLLRFLKYNKPEEA  178

Query  613   ETKTGHIP-HRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSN  437
             +  T     H D +F  IV  + +G LE++T+DG WIN + + S+  +F+AG+    WSN
Sbjct  179   DRATLRFASHTDKNFTTIVVQHDVGGLEVKTKDGDWINIESAPSQ-FLFMAGDGLQVWSN  237

Query  436   RRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCAN  257
              RI A  HRV   G + +Y++ LF+F  G +++PEELVD+ +PL + P D  E++ F + 
Sbjct  238   ERIKACDHRVKHCGDKTRYSLGLFTFNNGKIQVPEELVDERHPLLYNPLDSLEYIRFHSR  297

Query  256   GGGKE-ESPINAFCGV  212
             G  +   SP+  FCGV
Sbjct  298   GEARNLVSPVKTFCGV  313



>ref|XP_009375961.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Pyrus x bretschneideri]
Length=318

 Score =   254 bits (649),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/316 (41%), Positives = 195/316 (62%), Gaps = 5/316 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T PKLP I F+ D ++ G++SW +TS +VR  LEEYGCF A YD+VS +L + +F 
Sbjct  1     MGSLTLPKLPTINFSIDALKPGSSSWLSTSKQVRYALEEYGCFVAQYDQVSAQLLNNIFG  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               K LF++PLE K +N SD    GY G    MPL E   I +  +P+ T  F   MWPD 
Sbjct  61    QAKDLFEVPLENKVKNVSDEPYRGYIGPNHLMPLYEGIAIDNVTSPQETQKFKNLMWPDG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
              +  NFCE T S+++L+ +L++ V +M+ ESYG +K ++ +  ++S+LLRF+KY  P+  
Sbjct  121   KS--NFCETTDSFAQLLSELERKVEQMLFESYGAEKQYESVASANSHLLRFLKYNKPEEA  178

Query  613   ETKTGHIP-HRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSN  437
             +  T     H D +F  IV  + +G LE++T+DG WIN + + S+  +F+AG+    W N
Sbjct  179   DRATLRFASHTDKNFTTIVVQHDVGGLEVKTKDGDWINIESAPSQ-FLFMAGDGLQVWRN  237

Query  436   RRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCAN  257
              RI A  HRV   G + +Y++ LF+F  G +++PEELVD+ +PL + P    E++ F + 
Sbjct  238   DRIKACHHRVKHCGDKTRYSLGLFTFNNGIIQVPEELVDERHPLLYNPLVSLEYMRFHSR  297

Query  256   GGGKE-ESPINAFCGV  212
             G  +   SP+  FCGV
Sbjct  298   GEARNLVSPLKTFCGV  313



>ref|XP_006356186.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Solanum 
tuberosum]
Length=317

 Score =   254 bits (649),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 132/314 (42%), Positives = 197/314 (63%), Gaps = 12/314 (4%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQ  953
             KLP+I+FT +N+  GT SW   S E    LEEYGCF A+YDKVS  + D +F+  + LF 
Sbjct  9     KLPVIDFTMENLEPGTNSWSKASKEAVCALEEYGCFVALYDKVSLNIHDDVFQALEELFD  68

Query  952   LPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFC  773
             LP + K +N S    +GY G    +PL E  GI +  T E   NF+  MWP+  N  +F 
Sbjct  69    LPTQKKVQNKSSKPLYGYVGQIPFIPLYESMGIDNANTLEGIQNFTNFMWPNGHN--DFS  126

Query  772   EDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHI  593
             +   +YSK   +L+++V++MV ESYG++KY++  ++S +YL R +KYR  +  E K G +
Sbjct  127   QALLAYSKASAELEEMVVKMVFESYGVEKYYESHVKSVNYLARVMKYREAQVEEAKLGFV  186

Query  592   PHRDNSFMAIV-DTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPV  416
              H D SFM+ +  TNQ+  LE++ +DG+W   + S S +IV +AG+A MAWSN RI +P 
Sbjct  187   AHTDKSFMSTIHQTNQVNGLEIKGKDGQWFGVELSPS-SIVVMAGDAIMAWSNNRIKSPH  245

Query  415   HRVMM---KGSEDKYTVALFSFLRGT--VEIPEELVDDDNPLKFKPFDHFEFLTFCANGG  251
             HRVMM   KG+  +Y++A FSF+  +  VE P+ELVD+++PL F  F+H ++L F +   
Sbjct  246   HRVMMGEEKGA--RYSIAQFSFMEDSLMVETPKELVDEEHPLLFNSFNHLDYLKFFSKEE  303

Query  250   GKE-ESPINAFCGV  212
              +  E  + ++CG 
Sbjct  304   NRRLECALKSYCGA  317



>ref|XP_004302942.1| PREDICTED: gibberellin 3-beta-dioxygenase 3-like [Fragaria vesca 
subsp. vesca]
Length=320

 Score =   253 bits (647),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 126/315 (40%), Positives = 193/315 (61%), Gaps = 13/315 (4%)
 Frame = -2

Query  1132  KLPIIEFTD-DNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLF  956
             KLP+++F++ +++  GT SW +    V+  LEE+GCF  +YD +S + R+ +    + LF
Sbjct  11    KLPVLDFSNKESLNPGTNSWLSARKHVQGALEEFGCFVVLYDGISPDFRNTLLATMQELF  70

Query  955   QLPLETKRRNTSDIYGF-GYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPN  779
              LP +TK  N  +     GY G    +PL E  GI +  + E T  F++ MWP  ++  N
Sbjct  71    DLPTKTKMTNKYEAKPLNGYVGQIPKLPLHESMGIDNATSLEETQRFTELMWPGGND--N  128

Query  778   FCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTG  599
             FCE   S++K+  +LD++V RM+ ESYG++K +D  + S +YLLR +K ++P+ N+   G
Sbjct  129   FCESVYSFAKVAEELDKMVTRMIFESYGVEKCYDSYVGSITYLLRLLKNKLPQENQPNLG  188

Query  598   HIPHRDNSFMAIV-DTNQIGCLEMETRDGKW--INFQPSSSKTIVFIAGEAFMAWSNRRI  428
              +PH D SF  I+   NQ+  LE+ETR+ +W  + F PSS    + +AG+A MAWSN RI
Sbjct  189   FVPHTDKSFTTILYQNNQVHALEIETRNHEWFKVEFPPSS---FIVMAGDALMAWSNDRI  245

Query  427   YAPVHRVMMKG---SEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCAN  257
              +P HRV+M     +E +Y++A F+F  G + +P+ELVDD +PL++KPFDH   L F   
Sbjct  246   LSPNHRVVMSTGHETEARYSMAQFAFSNGEIRVPDELVDDQHPLRYKPFDHVGLLRFFRT  305

Query  256   GGGKEESPINAFCGV  212
                   S I A+CGV
Sbjct  306   AEDNSNSAIKAYCGV  320



>emb|CDP20247.1| unnamed protein product [Coffea canephora]
Length=312

 Score =   253 bits (646),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 130/317 (41%), Positives = 193/317 (61%), Gaps = 8/317 (3%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M   +N +LP+I  T++ +R G  SW      V R  EEYGCF AV+DK   E+ D++F 
Sbjct  1     MECASNIRLPVINLTEEILRSGKDSWTEARNIVTRAFEEYGCFIAVHDKYPSEVSDSLFS  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LPLE K +NTS     GYA    ++ L E   I+D    E+   F+ QMWP  
Sbjct  61    ELQDLFNLPLEIKVQNTSQTPLSGYARPRPNVNLYESMCIEDATNLEAVEKFANQMWPSK  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +N  +FCE    Y+  V +LD++V ++V ESYG++KY +  + S +Y +RFI+YR+P+ N
Sbjct  121   NN--HFCELFHCYANQVAELDKMVSKLVFESYGVEKYHESHVGSVTYNVRFIRYRVPEQN  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKW--INFQPSSSKTIVFIAGEAFMAWS  440
             E   G  PH D +F+ I+  N+   LE++ ++G W  I+F PSS   +V +AG+ F AWS
Sbjct  179   EMNVGVAPHTDKNFITILQQNETDGLEVQLKNGSWIPIDFPPSS---VVIMAGDVFSAWS  235

Query  439   NRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCA  260
             N R+++P HRV MKG   +Y++A FS+ +  V+ P ELVDD++PL +KPFD F +L F +
Sbjct  236   NGRVHSPFHRVTMKGRGTRYSIAQFSYCKKLVKTPTELVDDEHPLLYKPFDCFGYLRFLS  295

Query  259   -NGGGKEESPINAFCGV  212
              N      + +  +CGV
Sbjct  296   TNEDWNIPNSLKVYCGV  312



>ref|XP_009375959.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Pyrus 
x bretschneideri]
Length=318

 Score =   253 bits (647),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 129/316 (41%), Positives = 192/316 (61%), Gaps = 5/316 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T PKLP I F+ D ++ G++SW +TS +VR  LEEYGCF A YD+VS +L + +F 
Sbjct  1     MGSLTLPKLPTINFSVDALKPGSSSWLSTSKQVRYALEEYGCFVAQYDQVSAQLLNNIFG  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               K LF++PLE K +N SD    GY G    MPL E   I    +P+ T  F   MWPD 
Sbjct  61    QAKDLFEVPLENKVKNVSDEPYRGYIGPNHLMPLYEGIAIDKVTSPQETQKFKNLMWPDG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMP-KW  617
              +  NFCE T S+++L+ +L+  V +M+ ESYG +K ++ +  ++S+LLRF+KY  P + 
Sbjct  121   KS--NFCETTDSFAQLLSELEHKVEQMLFESYGAEKQYESVASANSHLLRFLKYNKPEEA  178

Query  616   NETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSN  437
             +        H D +F  IV  + +G LE++T+ G WIN +   S+  +F+AG+    WSN
Sbjct  179   DRAALRFASHTDKNFTTIVVQHDVGGLEVKTKYGNWINIESVPSQ-FLFMAGDGLQVWSN  237

Query  436   RRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCAN  257
              RI A  HRV   G + +Y++ LF+F  G +++PEELVD+ +PL + P D  E++ F + 
Sbjct  238   DRIKACDHRVKHCGDKTRYSLGLFTFNNGKIQVPEELVDETHPLLYNPLDSLEYIRFHSR  297

Query  256   GGGKE-ESPINAFCGV  212
             G  +   SP+  FCGV
Sbjct  298   GEARNLVSPVKTFCGV  313



>ref|XP_010047771.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Eucalyptus grandis]
 gb|KCW79750.1| hypothetical protein EUGRSUZ_C01096 [Eucalyptus grandis]
Length=313

 Score =   252 bits (644),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/320 (39%), Positives = 188/320 (59%), Gaps = 13/320 (4%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M   + PKLP+I+F  ++M+ G+  W +   EV + LEEYGCF A YDK+S EL D +F+
Sbjct  1     MGALSPPKLPLIDFCKNDMKPGSADWDSVQREVVKALEEYGCFEARYDKISVELHDEVFR  60

Query  973   HCKHLFQLPLETKR-----RNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQ  809
               + LF LP +TKR     R   D    GY  N  ++ L E  GI   +        +  
Sbjct  61    QVEDLFNLPAKTKRLFVDPRKPYD----GYITNLPNLSLYEAIGISGMLDSGGIQKLANL  116

Query  808   MWPDADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYR  629
             MWP  +  P FCE  TSY+  + +L+ ++ RMV +S G++KY D   +S ++ +R ++Y+
Sbjct  117   MWPQGN--PKFCETLTSYAMRLSELESLITRMVFQSLGVEKYLDSHTKSLNHSIRAMRYK  174

Query  628   MPKWNETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFM  449
              P   E + G   H D +F+ I+  N +  LE++T+DG+W    PS+S T+V + GE+ +
Sbjct  175   SPMTQEPQVGASSHCDKNFLTILQQNHVNGLEVQTKDGRWSPVAPSAS-TLVVMVGESLL  233

Query  448   AWSNRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLT  269
              WSN R++ P H+VMM G+E +Y++  FS +RG +E P ELVD+ +PL FKPFD    L 
Sbjct  234   GWSNGRLHCPRHQVMMSGNETRYSIGSFSAIRGVIECPCELVDEQHPLLFKPFDEVGLLR  293

Query  268   FCANGGGKE-ESPINAFCGV  212
             F     G E ES + A+CGV
Sbjct  294   FSLTEQGHEAESTLKAYCGV  313



>gb|KDP37164.1| hypothetical protein JCGZ_06220 [Jatropha curcas]
Length=308

 Score =   252 bits (643),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/310 (39%), Positives = 192/310 (62%), Gaps = 7/310 (2%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQ  953
             K+P+I+   +N++ G+++W +   ++R+  EEYGC   +Y+ ++ E  + +    + LFQ
Sbjct  3     KIPVIDLCSENLKPGSSAWLSACNDIRKAFEEYGCMEVLYN-INIEFHNQVLSALQELFQ  61

Query  952   LPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFC  773
             LP E K +N +     GY G  ++ P+ E  GI+     +    F+  MWPD ++  NFC
Sbjct  62    LPQEIKMKNVNPKPAHGYMGKISTFPIHEGLGIEFATIKDECQKFTNLMWPDGND--NFC  119

Query  772   EDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHI  593
             E   SY+KLV +L ++++RM+ ESYG+DK+ +   +S++YLLR +KYR  +  ET  G  
Sbjct  120   ETVHSYAKLVAELQELLVRMLCESYGIDKHSESRNKSTTYLLRLLKYRRSQ-AETNLGFK  178

Query  592   PHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPVH  413
              H D SF++I+  N +  LE+ T+DG+WI+++PSS  +   +AG+A MAWSN RI +  H
Sbjct  179   GHTDKSFISILHQNHVKGLEIRTKDGEWISYEPSSFSSFAVVAGDACMAWSNDRIKSCYH  238

Query  412   RVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTF--CANGGGKEE  239
             RV + G E +Y + LFSFL G +  PEELVD+++PL +KPF+H   L F    N   K E
Sbjct  239   RVTVGGEEVRYALGLFSFLTGLINPPEELVDEEHPLAYKPFEHQGLLDFYVANNAQNKGE  298

Query  238   SP-INAFCGV  212
             S  +  +CGV
Sbjct  299   SNMVKTYCGV  308



>ref|XP_010462134.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X1 [Camelina sativa]
Length=317

 Score =   252 bits (643),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/309 (40%), Positives = 189/309 (61%), Gaps = 6/309 (2%)
 Frame = -2

Query  1129  LPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQL  950
             LP+I+F+++ ++ G   W  TS +V++ L++YGCF A +D++  ELR  +F+  + LF L
Sbjct  12    LPVIDFSNEYLKPGEPEWDLTSADVQKALQDYGCFEASFDRIPIELRKLVFETLEELFDL  71

Query  949   PLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFCE  770
             PL+TK RN S     GY G +  +PL E  GI+D    E    F+K +WP  +N+  F  
Sbjct  72    PLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIEDPDVAERVNAFTKPLWPQGNNS--FST  129

Query  769   DTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHIP  590
                ++SK +  LD  + RM++ES+GLDKY D  +QS++YLLR +KY+ P   ETK G   
Sbjct  130   RIHTFSKKLSDLDITIRRMIMESFGLDKYIDEHLQSTNYLLRVMKYKGPDTEETKLGLNA  189

Query  589   HRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPVHR  410
             H D + + I+  N +  LE++T+D  WI  +PS    IV I G++  A  N R+++P HR
Sbjct  190   HTDKNIVTILYQNHVEGLEVQTKDNNWIKVKPSKDSFIVMI-GDSLHAMLNGRLHSPNHR  248

Query  409   VMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTF-CANGGGKEE  239
             VMM G+E +Y++ LFS  +    +  PEELVD ++P  FKPFDH EFL F     G + +
Sbjct  249   VMMTGTETRYSLGLFSIPKAGHIISSPEELVDQEHPRLFKPFDHVEFLQFYYTQAGQRSQ  308

Query  238   SPINAFCGV  212
             S +  +CG+
Sbjct  309   SALKTYCGI  317



>emb|CDO98089.1| unnamed protein product [Coffea canephora]
Length=314

 Score =   252 bits (643),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 132/319 (41%), Positives = 199/319 (62%), Gaps = 10/319 (3%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T   L +++FT+  ++ G++ W     ++R  LE +GCF A+YDK+S EL  A+F 
Sbjct  1     MGSVTPTNLLVVDFTNKELKPGSSCWSLACNDIRHALENHGCFIALYDKISQELDKAIFH  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
                 LF LP + K +NT++    GY G    +PL E  GI    T +   +F+  MWP  
Sbjct  61    AADDLFDLPTQLKVQNTNEKPYHGYVGQIPFVPLHEGLGIDYATTLDGVQSFTNLMWPQG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             + + +  E + S++K V +LD++V++M+ ESYG++KY D  ++SS+YLLRF+KYR P+ N
Sbjct  121   NKSFS--ESSFSFAKTVAKLDEMVIKMLFESYGVEKYSDSHVESSTYLLRFLKYRAPEVN  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWI--NFQPSSSKTIVFIAGEAFMAWS  440
             ET      H D SF+ I+  N I  LE+ TRDG+WI  +F P   ++ V +AG+A  AWS
Sbjct  179   ETTMAFPSHTDKSFLTILYQNHISGLEIRTRDGEWITVDFPP---RSFVVMAGDACQAWS  235

Query  439   NRRIYAPVHRVMM--KGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTF  266
             N  + +P H+V M   G E ++T+ALFSFL   V++PEELVDD+ PL+FKPF H + L F
Sbjct  236   NDGVLSPNHKVTMDANGKETRHTIALFSFLSKMVQVPEELVDDEKPLQFKPFVHVDLLNF  295

Query  265   CA-NGGGKEESPINAFCGV  212
              A + G + ++ +  FCGV
Sbjct  296   YATDQGRRSQNILKDFCGV  314



>ref|XP_007135718.1| hypothetical protein PHAVU_010G152400g [Phaseolus vulgaris]
 gb|ESW07712.1| hypothetical protein PHAVU_010G152400g [Phaseolus vulgaris]
Length=320

 Score =   252 bits (643),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/309 (40%), Positives = 194/309 (63%), Gaps = 5/309 (2%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQ  953
             ++P+++FTD  ++ GT  W +    +R  LE++GCF A+YD+V  EL +++F   +  F 
Sbjct  9     EVPVVDFTDKELKPGTRKWGSACEVIRNALEDHGCFYALYDEVPMELYNSVFTLMEEQFD  68

Query  952   LPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFC  773
             LPLETK +  SD    GY G  A +PL E  GI   +T E   NF+K MWP   +  +FC
Sbjct  69    LPLETKMQKISDKPYHGYYGQHAHVPLYESLGINHPLTMEGIQNFTKLMWPAGYD--HFC  126

Query  772   EDTTSYSKLVWQLDQVVMRMVLESYGLD-KYFDPLIQSSSYLLRFIKYRMPKWNETKTGH  596
             E  + Y+KL+ +LD +  RMV + YG++ ++ D L++S++Y+LR  KYR+P+ +E   G 
Sbjct  127   ESMSMYAKLLVELDHMTKRMVFDGYGVEQRHCDSLLESTNYMLRSFKYRLPQKDENDLGL  186

Query  595   IPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPV  416
               H D SF  I+  N +  L+++ ++G WI+  PS    ++ +AG+AF  WSN RI+   
Sbjct  187   HAHTDTSFFTILHQNNVNGLQVKFKNGDWIDIDPSPFMFLI-LAGDAFKVWSNDRIHCCE  245

Query  415   HRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANGGG-KEE  239
             HRV++ G +++Y++ LFS     VE  EELVD+++P  +KPFDH+E+L+FCA     +  
Sbjct  246   HRVIISGKKERYSMGLFSLGGKMVETQEELVDEEHPRCYKPFDHYEYLSFCATKKALQSH  305

Query  238   SPINAFCGV  212
             S I AFCG+
Sbjct  306   SRIKAFCGI  314



>emb|CDP14980.1| unnamed protein product [Coffea canephora]
Length=321

 Score =   252 bits (643),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/319 (40%), Positives = 196/319 (61%), Gaps = 14/319 (4%)
 Frame = -2

Query  1135  PKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLF  956
             PKLP I+F++  ++ G   W +   +VR  LEEYGCF A YD++  +LR ++F     LF
Sbjct  6     PKLPFIDFSNQELKPGFPLWNSLKIQVREALEEYGCFEASYDRIPIQLRKSIFDAVTELF  65

Query  955   QLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNF  776
              LPL+ K +N++     GY G     PL E  GI +    E   +FSK MWP+ ++   F
Sbjct  66    DLPLQVKVKNSNGKPYHGYIGQSPLFPLYEGMGIDEANVLEHAESFSKDMWPEGNS--EF  123

Query  775   CEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGH  596
              +   +Y++ + +LDQ+V +MVLE  G+++Y D  ++S+ YLLR IKY+ P+ NETK G 
Sbjct  124   SKTIQNYAEQLSELDQMVRKMVLEGLGVEQYIDEHLESTHYLLRVIKYKGPQTNETKLGL  183

Query  595   IPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFM---------AW  443
               HRD + + I+  NQ+  LE++ +DG+WI+F+PS +  +V I GE+F          AW
Sbjct  184   PSHRDANLVTILHQNQVQGLELQKKDGQWIDFKPSPNSFVVMI-GESFHASLFNKFCSAW  242

Query  442   SNRRIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLT  269
             +N R++ P HRV+M G+E +Y+V LFSF +    V+ P+ELVD+ +PL FKPF+  ++L 
Sbjct  243   TNGRLHPPNHRVLMTGNEARYSVGLFSFPKDGYMVKAPKELVDETHPLLFKPFNCPDYLA  302

Query  268   FCANGGGKEESPINAFCGV  212
             +    G K +S +  +CG 
Sbjct  303   YIYKRGKKVDSSLKTYCGA  321



>ref|XP_009364342.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Pyrus x bretschneideri]
Length=318

 Score =   252 bits (643),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/316 (41%), Positives = 196/316 (62%), Gaps = 5/316 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T PKLPII+F+ D ++ G++SW +TS +VR  LEEYG F A YD++S +L + +F 
Sbjct  1     MDSLTLPKLPIIDFSVDVLKPGSSSWLSTSKKVRYALEEYGGFVAQYDQISEQLLNDIFG  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               K LF++PLE K ++ S     GY G    MPL E   I +  +PE T  F   MWPD 
Sbjct  61    QAKDLFEVPLENKVKSVSKEPYRGYIGPNHLMPLYEGIAIDNVTSPEETQKFKNLMWPDG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMP-KW  617
              +  NFCE T S+++L+ +L+  V +M+ ESYG +K ++ +  ++S+LLRF+KY  P + 
Sbjct  121   KS--NFCETTDSFAQLLSELEHKVEQMLFESYGAEKQYESVASANSHLLRFLKYNKPEEA  178

Query  616   NETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSN  437
             + T      H D +F  IV  + +G LE++T+DG WI+ +   S+  VF+AG+    WSN
Sbjct  179   DRTTLRFASHTDKNFTTIVVQHDVGGLEVKTKDGDWISIESVPSQ-FVFLAGDGLQVWSN  237

Query  436   RRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCAN  257
              RI A  HRV   G + +Y++ LF+F  G +++P+ELVD+ +PL + P D  E++ F + 
Sbjct  238   DRIKACHHRVKHCGDKTRYSLGLFTFNNGIIQVPQELVDERHPLLYNPLDSLEYIRFHSR  297

Query  256   GGGKE-ESPINAFCGV  212
             G  +   SP+N FCGV
Sbjct  298   GEARNLVSPVNTFCGV  313



>emb|CDY26044.1| BnaC06g05800D [Brassica napus]
Length=317

 Score =   251 bits (642),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/309 (41%), Positives = 189/309 (61%), Gaps = 6/309 (2%)
 Frame = -2

Query  1129  LPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQL  950
             LP+I+F++ N++ G   W  T  +V++ L++YGCF A +DKV  ELR ++FK  + LF L
Sbjct  12    LPVIDFSNQNLKPGEPQWDLTKADVQKALQDYGCFEASFDKVPIELRKSIFKALEELFDL  71

Query  949   PLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFCE  770
             PL+TK RN S     GY G +  +PL E  GI D    +    F++++WP  +N+  F  
Sbjct  72    PLKTKLRNVSKKPFHGYVGQYPMVPLYESMGIDDSDVVDKVEAFTEKLWPQGNNS--FSA  129

Query  769   DTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHIP  590
                S+SK + +LD  + RM++ES+GL KY D  +QS++YLLR +KY  P   ETK G   
Sbjct  130   TIHSFSKKLSELDITIRRMIMESFGLVKYIDEHLQSTNYLLRVMKYTGPDTEETKLGLNA  189

Query  589   HRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPVHR  410
             H D + + I+  N +  LE++T+D  WI  +PS    IV I G++  A  N R+++P HR
Sbjct  190   HTDKNIVTILYQNHVEGLEVQTKDKNWIKVKPSEDSFIVMI-GDSLHALLNGRLHSPYHR  248

Query  409   VMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTF-CANGGGKEE  239
             VMM G+E +Y++ LFS  +    V  P+ELVD+++P  FKPFDH EFL F     G + +
Sbjct  249   VMMTGTETRYSLGLFSIPKAGHIVSSPDELVDEEHPRLFKPFDHVEFLKFYYTEAGQRSQ  308

Query  238   SPINAFCGV  212
             S +  +CG+
Sbjct  309   SALKTYCGM  317



>ref|XP_009616144.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Nicotiana tomentosiformis]
Length=317

 Score =   251 bits (641),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 129/317 (41%), Positives = 197/317 (62%), Gaps = 12/317 (4%)
 Frame = -2

Query  1141  TNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKH  962
              +P+L ++ F ++ +R GT +W +T  E+R   E +G F A+YDK+S +L+ ++F+  + 
Sbjct  6     ASPQLLVVNFNNEELRPGTATWESTCKEIRFAFENHGSFIALYDKISPQLQKSIFQASQQ  65

Query  961   LFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTP  782
             LF+LPLE K  NT++    GY G    +P  E FGI    T +   +FS  MWP  ++  
Sbjct  66    LFELPLEKKVLNTNEKPYHGYVGQIPFLPHHEAFGIDYATTSQGIQSFSNLMWPQGNDF-  124

Query  781   NFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKT  602
              F E++  +SK+V +LDQ V+RM+ ESYG+ K  +  ++S++YLLR++KY  P   E   
Sbjct  125   -FGENSLMFSKIVAELDQKVVRMLFESYGIGKNCESYLESTTYLLRYLKYDAPNTKENSM  183

Query  601   GHIPHRDNSFMAIVDTNQIGCLEMETRDGKWIN--FQPSSSKTIVFIAGEAFMAWSNRRI  428
                PH D +F  I+  N+I  LE++TRDG+WIN  F PSS    V +AGEA   WSN R+
Sbjct  184   VFPPHTDKTFTTILYQNRISGLEVQTRDGQWINMEFPPSS---FVVMAGEACRGWSNDRV  240

Query  427   YAPVHRVMM--KGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTFC-  263
               PVH+V+M   G+E +YTV +F+FL+    +E+ EELVD+++PL+FKPF H + + F  
Sbjct  241   LTPVHKVIMDISGNETRYTVGIFTFLKDDKMIEVAEELVDEEHPLQFKPFVHIDLIKFFD  300

Query  262   ANGGGKEESPINAFCGV  212
                G + +  +  FCGV
Sbjct  301   TERGRRSQDLLKDFCGV  317



>ref|XP_010500907.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X2 [Camelina sativa]
Length=317

 Score =   251 bits (641),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 124/309 (40%), Positives = 189/309 (61%), Gaps = 6/309 (2%)
 Frame = -2

Query  1129  LPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQL  950
             LP+I+F+++ ++ G   W  TS +V++ L++YGCF A +D++  ELR  +F+  + LF L
Sbjct  12    LPVIDFSNEYLKPGEPEWDLTSADVQKALQDYGCFEASFDRIPIELRKLVFETLEELFDL  71

Query  949   PLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFCE  770
             PL+TK RN S     GY G +  +PL E  GI+D    E    F+K +WP  +N+  F  
Sbjct  72    PLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIEDPDVAERVNAFTKPLWPQGNNS--FST  129

Query  769   DTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHIP  590
                ++SK +  LD  + RM++ES+GLDKY D  + S++YLLR +KY+ P   ETK G   
Sbjct  130   RIHTFSKKLSDLDITIRRMIMESFGLDKYIDEHLHSTNYLLRVMKYKEPDTEETKLGLNA  189

Query  589   HRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPVHR  410
             H D + + I+  N +  LE++T+D  WI  +PS    IV I G++  A  N R+++P HR
Sbjct  190   HTDKNIVTILYQNHVEGLEVQTKDNNWIKVKPSKDSFIVMI-GDSLHAMLNGRLHSPNHR  248

Query  409   VMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTF-CANGGGKEE  239
             VMM G+E +Y++ LFS  +    +  PEELVD+++P  FKPFDH EFL F     G + +
Sbjct  249   VMMTGTETRYSLGLFSIPKAGHIISSPEELVDEEHPRLFKPFDHVEFLQFYYTQAGQRSQ  308

Query  238   SPINAFCGV  212
             S +  +CG+
Sbjct  309   SALKTYCGI  317



>ref|XP_004241719.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Solanum lycopersicum]
Length=314

 Score =   251 bits (640),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 126/313 (40%), Positives = 193/313 (62%), Gaps = 7/313 (2%)
 Frame = -2

Query  1138  NPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHL  959
             N KLP I+F+ ++++ GT  W     +V + L EYGCF A + K+   L+ ++F+  + +
Sbjct  5     NIKLPKIDFSHEDLKPGTLVWNQVKSQVHKALVEYGCFEASFYKIPIHLKKSIFESLQEI  64

Query  958   FQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPN  779
             F LPL+TK  N S     GY G F S+PL E  GI D   P     F++ +WP  +  P+
Sbjct  65    FDLPLQTKLENISTKPFHGYVGQFPSLPLFESMGIDDANIPRKADEFAQILWPQGN--PS  122

Query  778   FCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN-ETKT  602
             FC+   SYS+ + +LDQ V RMVLES GL+KY D  + S++++L+ +KY  P+ N ET+ 
Sbjct  123   FCKTIQSYSEQLSELDQTVRRMVLESLGLEKYMDEHMNSTNFVLQLMKYNTPQSNTETEI  182

Query  601   GHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYA  422
             G   H D S   I+  NQI  L++  ++G+WIN +P+     V I G++  AW+N R++A
Sbjct  183   GVSAHTDKSIATILYQNQINGLQVMNKNGQWINVEPTQDTFTVMI-GDSLHAWTNGRMHA  241

Query  421   PVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTFC-ANGG  251
             P HRVMM+G++ +Y+V LFS  +G  T++ P+E+VD++NPL +KPFD    L F     G
Sbjct  242   PYHRVMMRGNKARYSVGLFSVPKGDYTIKAPKEMVDEENPLLYKPFDLHGLLAFTNTEEG  301

Query  250   GKEESPINAFCGV  212
              + ES +  +CG+
Sbjct  302   MRCESALKTYCGL  314



>gb|KDO58208.1| hypothetical protein CISIN_1g044747mg [Citrus sinensis]
Length=322

 Score =   251 bits (641),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 136/323 (42%), Positives = 198/323 (61%), Gaps = 10/323 (3%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T  K+P+I+ +  +++ GT++W +T  +VR   EE+GCF A+Y K+S E R  +  
Sbjct  1     MGSQTKSKIPVIDLSKQDLKSGTSTWLSTCKDVRHAFEEFGCFEAIYQKISQEFRSEVLA  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWP-D  797
               + LF +P+E K +NTS    F Y G +  +PL E   I    T  +T +F+  MWP +
Sbjct  61    STEELFDVPIEIKVKNTSTKPYFEYYGQYTIIPLYESLAIDYPDTRNATQSFTNLMWPAE  120

Query  796   ADNTPNFC-----EDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKY  632
                    C     E + S S+LV +LD++V RM+ ESYG++ Y+D  I S +YLLR+ KY
Sbjct  121   MIAFGMICPYSLLESSLSMSELVVELDKMVTRMLFESYGVEGYYDSYIGSVNYLLRYFKY  180

Query  631   RMPKWNETKTGHIPHRDNSFMAIV-DTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEA  455
             R P+ NETK G  PH D +  +I+   N I  L+++ +DG+WI+ +PS S  IV +AG+A
Sbjct  181   RAPEPNETKMGLTPHTDKTMTSIIHQINHINGLQVQAKDGEWIDVEPSPSSFIV-MAGDA  239

Query  454   FMAWSNRRIYAPVHRVMM-KGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFE  278
              MAW N RI    H+V+M   SE +Y++ LFSF  G V+IP+EL D+  PLK+KPFDHF 
Sbjct  240   LMAWGNDRIRPCRHQVIMDNASETRYSLGLFSFSSGVVDIPKELGDETQPLKYKPFDHFG  299

Query  277   FLTF-CANGGGKEESPINAFCGV  212
             FL F  +  G K  S I A+CG+
Sbjct  300   FLHFNQSEEGKKSASSIKAYCGI  322



>ref|XP_009371496.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Pyrus x bretschneideri]
Length=317

 Score =   251 bits (640),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 128/319 (40%), Positives = 196/319 (61%), Gaps = 7/319 (2%)
 Frame = -2

Query  1153  MATHTNPKL-PIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMF  977
             M + T PK+ P+++ +D+N++ GT +W     +V+  LEEY CF AVY+K + E+ +++F
Sbjct  1     MISKTQPKVVPVVDLSDENLKPGTDAWLLACKQVQHALEEYSCFEAVYNKATLEIHNSIF  60

Query  976   KHCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPD  797
                K L  LPLETK +  S+     Y G     P  E  GI+D  + E    F+  MWP 
Sbjct  61    SAIKDLCDLPLETKMQKASNRPFHNYFGQLPLNPRYETLGIQDPASLEGAQRFTNIMWPA  120

Query  796   ADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKW  617
              ++   F E   S+SK+V +LDQ+V RMV ++YG+ + +D    S++Y LR I Y+    
Sbjct  121   GND--RFRESVHSFSKVVVELDQMVKRMVFDAYGVGRLYDSYKASTTYQLRCINYKSQLT  178

Query  616   NE-TKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWS  440
             NE T  G I H D +F +I+  N +G L+++T+DG+WI   PSS  + + +A + FMAWS
Sbjct  179   NETTDLGLIAHTDKNFTSILHQNDVGGLQIKTKDGEWIEAAPSSPSSFLVLASDLFMAWS  238

Query  439   NRRIYAPVHRVMMKGSEDKYTVALFSFL-RGTVEIPEELVDDDNPLKFKPFDHFEFLTFC  263
             N RI A  H+V++K  + +Y++ALFS++  G V++PEE VD  +PLK+KPF HF++L F 
Sbjct  239   NDRISACEHQVVLKEKKARYSLALFSYIGDGVVQVPEEFVDGKHPLKYKPFGHFDYLRFY  298

Query  262   ANG--GGKEESPINAFCGV  212
                    K ++PI A+CGV
Sbjct  299   ETDEEARKSKNPIKAYCGV  317



>ref|XP_009147658.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Brassica rapa]
Length=317

 Score =   250 bits (639),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 125/309 (40%), Positives = 188/309 (61%), Gaps = 6/309 (2%)
 Frame = -2

Query  1129  LPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQL  950
             LP+I+F++ N++ G   W  T  +V++ L++YGCF A +DKV  ELR ++FK  + LF L
Sbjct  12    LPVIDFSNQNLKPGEPQWDLTKADVQKALQDYGCFEASFDKVPIELRKSIFKALEELFDL  71

Query  949   PLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFCE  770
             PL+TK RN S     GY G +  +PL E  GI D    +    F++++WP  + +  F  
Sbjct  72    PLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIDDSDVVDKVEAFTEKLWPQGNTS--FSA  129

Query  769   DTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHIP  590
                S+SK + +LD  + RM++ES+GL KY D  +QS++YL R +KY  P   ETK G   
Sbjct  130   TIHSFSKKLSELDITIRRMIMESFGLVKYIDEHLQSTNYLFRVMKYTGPDTEETKLGLNA  189

Query  589   HRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPVHR  410
             H D + + I+  N +  LE++T+D  WIN +PS    IV I G++  A  N R+++P HR
Sbjct  190   HTDKNIVTILYQNHVEGLEVQTKDKNWINVKPSEDSFIVMI-GDSLHALLNGRLHSPYHR  248

Query  409   VMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTF-CANGGGKEE  239
             VMM G+E +Y++ LFS  +    V  P+ELVD+++P  FKPFDH EFL F     G + +
Sbjct  249   VMMTGTETRYSLGLFSIPKAGHIVSSPDELVDEEHPRLFKPFDHVEFLKFYYTEAGQRSQ  308

Query  238   SPINAFCGV  212
             S +  +CG+
Sbjct  309   SALKTYCGM  317



>ref|XP_010033902.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Eucalyptus grandis]
 gb|KCW53768.1| hypothetical protein EUGRSUZ_J03021 [Eucalyptus grandis]
Length=314

 Score =   250 bits (638),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 125/317 (39%), Positives = 193/317 (61%), Gaps = 6/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M +     LP+I+F+   ++ GT  W     EV++ LE  GCF A + KV  +L+++M  
Sbjct  1     MGSMAELMLPVIDFSSLRLKPGTAEWTAVRDEVKQALETCGCFEARFKKVPVDLQESMLG  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LPL+TK RN S     GY G +  +PL E  GI D    E     +  +WP+ 
Sbjct  61    SVQELFDLPLQTKLRNVSRKPYHGYVGQYPMVPLYESMGIDDADVYEKVDGLTTILWPEG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
                PNF ++  S+S+ + +LD+++ RM+LES G++KY D  + S++YLLR ++Y  P+  
Sbjct  121   H--PNFSKNIQSFSEKLSELDKMIRRMILESLGVEKYLDEHMNSTNYLLRVMRYAGPQTT  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             +TK G   H D + + I+  N++  LE++T+DG+W + QPS +  IV I G++  AW N 
Sbjct  179   DTKLGLNSHTDKNIVTILCQNEVDGLEVQTKDGEWFSAQPSPNSFIVMI-GDSLYAWVNG  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTF-C  263
             R+++P HRVMM G++ +Y+V LFS  +G   ++ P+ELVD++ PL FKPFDH EFL F  
Sbjct  238   RLHSPHHRVMMSGNKARYSVGLFSIPKGGYMIKAPDELVDEERPLLFKPFDHVEFLGFYY  297

Query  262   ANGGGKEESPINAFCGV  212
                G + ES +  +CGV
Sbjct  298   TEAGQRAESALKTYCGV  314



>ref|XP_010542274.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Tarenaya hassleriana]
Length=314

 Score =   248 bits (634),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/311 (40%), Positives = 188/311 (60%), Gaps = 7/311 (2%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQ  953
             +LP+I+F+  N++ G+  W  T  +VR+ LEE+GCF A +DK+   LR  +F   + LF 
Sbjct  7     QLPVIDFSGKNLKKGSKEWECTRSDVRKALEEFGCFEASFDKIPLHLRREIFGCLEELFD  66

Query  952   LPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFC  773
             LPL+TK RN S     GY G +  +PL E  GI D   P+  ++F++++WP  ++  +F 
Sbjct  67    LPLQTKLRNVSKKPFHGYVGQYPQVPLYESMGIDDADLPDQVLSFTQKLWPHGNH--HFS  124

Query  772   EDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHI  593
                 S+++ + +LD  + RM LES+GL+KY D  ++S++YLLR +KY+ P   ETK G  
Sbjct  125   NTIQSFAEQLSELDITIRRMTLESFGLEKYIDEHLESTNYLLRAMKYKGPDTEETKLGLN  184

Query  592   PHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPVH  413
              H D + + I+  N +  LE++T+D KWI  +PS    I  I G++  A  N R+++P H
Sbjct  185   AHTDKNIVTILYQNHVEGLEVQTKDNKWIKVKPSKDSFIAMI-GDSLYALLNGRVHSPYH  243

Query  412   RVMMKGSEDKYTVALFSFLRG--TVEIPEELVD-DDNPLKFKPFDHFEFLTF-CANGGGK  245
             RVMM G E +Y+  LFS  +    +  PEELVD D+ P  FKPFDH EFL F     G +
Sbjct  244   RVMMTGKEARYSAGLFSIPKAGHIIYAPEELVDGDEYPRLFKPFDHVEFLQFYYTEAGQR  303

Query  244   EESPINAFCGV  212
              +S +  +CG+
Sbjct  304   AQSALKTYCGM  314



>emb|CDP08608.1| unnamed protein product [Coffea canephora]
Length=339

 Score =   249 bits (635),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 133/318 (42%), Positives = 191/318 (60%), Gaps = 8/318 (3%)
 Frame = -2

Query  1156  TMATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMF  977
             T  T  N  +P+I FT +N+  GT SW +T   V   LEE+ CF AVYDKV  E     F
Sbjct  9     TPQTQQNNIVPVIYFTAENLNPGTGSWFSTCKAVSEALEEFSCFVAVYDKVEPEFISDAF  68

Query  976   KHCKHLFQLPLETKRRNT-SDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWP  800
                K LF LP+ETK  NT  D   FGY       P+ E  GI+D  T  +  +F+  +WP
Sbjct  69    ASFKELFNLPMETKLLNTIPDRPAFGYIRPRPETPVHETVGIEDSTTIGAVQSFANVIWP  128

Query  799   DADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPK  620
               ++  +FCE   SY+K V +++++V RM+ ESYG+ KY D  I+S+SYLLR   YR+P 
Sbjct  129   SGND--HFCETIHSYTKQVSEVNRLVSRMIFESYGVGKYSDSHIESTSYLLRANAYRVPH  186

Query  619   WNETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQ-PSSSKTIVFIAGEAFMAW  443
               E   G IPH D SF+++V  + +  L+++ +DG WI    P SS  +  +AG+A +AW
Sbjct  187   EKEPNLGIIPHTDTSFVSVVKQDSVQGLQVQLKDGTWIPVHLPQSSFAV--MAGDAMLAW  244

Query  442   SNRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTF-  266
             SN R++   HRV+MK  + ++++ALFSF +G V++P+EL DD+ PL+FK FDHF  L F 
Sbjct  245   SNGRVHPCFHRVIMK-EKARFSIALFSFHKGVVQVPKELADDNYPLRFKSFDHFGLLNFR  303

Query  265   CANGGGKEESPINAFCGV  212
               N     +  + A+CG+
Sbjct  304   LKNPALSCQERVKAYCGI  321



>ref|XP_006392868.1| hypothetical protein EUTSA_v10011672mg [Eutrema salsugineum]
 gb|ESQ30154.1| hypothetical protein EUTSA_v10011672mg [Eutrema salsugineum]
Length=315

 Score =   248 bits (633),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 120/311 (39%), Positives = 193/311 (62%), Gaps = 5/311 (2%)
 Frame = -2

Query  1141  TNPKLPIIEFT-DDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCK  965
             ++ K+PI++ T   +++  T++WR+ S E    LEE+GCF  V+D V+ +L D++F   +
Sbjct  7     SSSKVPILDLTSQQDLKPNTSTWRSISKEACEALEEFGCFVVVHDGVTQQLDDSIFAAAE  66

Query  964   HLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNT  785
              LF LP ETKR+N ++    GY G    +PL E  GI      E    F+  MWP  ++ 
Sbjct  67    ELFDLPTETKRKNVNEKPYHGYVGQMPVIPLHEGLGIDYVTNKEYAQRFTHLMWPQGNH-  125

Query  784   PNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETK  605
               FC    ++S  V ++DQ+V+RM+ E+YG++K++D  + S +YLL+F+KY  P  + + 
Sbjct  126   -QFCATVHAFSNAVAEIDQLVVRMIFENYGVEKHYDSHVGSKTYLLKFLKYLAPPESISM  184

Query  604   TGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIY  425
                  H D +F++I+  N +  LE++++DG+WI+ Q   SK+ V +AG+  M WSN RI 
Sbjct  185   PAFPQHTDKTFLSILHQNDVNGLEVKSKDGEWISLQ-LPSKSYVVMAGDISMGWSNDRIR  243

Query  424   APVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANGGGK  245
             +  HRV M G + +Y+  LFSF+ G V +P+ELVDD++PL +KPFD+   + F A   G+
Sbjct  244   SCEHRVTMDGGKTRYSFGLFSFVTGMVSVPKELVDDEHPLMYKPFDNIALINFYATKEGR  303

Query  244   E-ESPINAFCG  215
             E +S + A+CG
Sbjct  304   EAKSTLKAYCG  314



>ref|XP_010500906.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X1 [Camelina sativa]
Length=318

 Score =   248 bits (633),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 124/309 (40%), Positives = 189/309 (61%), Gaps = 5/309 (2%)
 Frame = -2

Query  1129  LPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQL  950
             LP+I+F+++ ++ G   W  TS +V++ L++YGCF A +D++  ELR  +F+  + LF L
Sbjct  12    LPVIDFSNEYLKPGEPEWDLTSADVQKALQDYGCFEASFDRIPIELRKLVFETLEELFDL  71

Query  949   PLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFCE  770
             PL+TK RN S     GY G +  +PL E  GI+D    E    F+K +WP  +N+ +   
Sbjct  72    PLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIEDPDVAERVNAFTKPLWPQGNNSFSSTR  131

Query  769   DTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHIP  590
               T +SK +  LD  + RM++ES+GLDKY D  + S++YLLR +KY+ P   ETK G   
Sbjct  132   IHT-FSKKLSDLDITIRRMIMESFGLDKYIDEHLHSTNYLLRVMKYKEPDTEETKLGLNA  190

Query  589   HRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPVHR  410
             H D + + I+  N +  LE++T+D  WI  +PS    IV I G++  A  N R+++P HR
Sbjct  191   HTDKNIVTILYQNHVEGLEVQTKDNNWIKVKPSKDSFIVMI-GDSLHAMLNGRLHSPNHR  249

Query  409   VMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTF-CANGGGKEE  239
             VMM G+E +Y++ LFS  +    +  PEELVD+++P  FKPFDH EFL F     G + +
Sbjct  250   VMMTGTETRYSLGLFSIPKAGHIISSPEELVDEEHPRLFKPFDHVEFLQFYYTQAGQRSQ  309

Query  238   SPINAFCGV  212
             S +  +CG+
Sbjct  310   SALKTYCGI  318



>ref|XP_010462133.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Camelina 
sativa]
Length=310

 Score =   247 bits (631),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 119/309 (39%), Positives = 189/309 (61%), Gaps = 4/309 (1%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAA-VYDKVSWELRDAMFKHCKHLF  956
             K+P ++F+ ++++ GT  W +T   + + LEEYGCF   + DK    L D +F     LF
Sbjct  4     KIPTLDFSREDLKPGTKYWESTRKNITQALEEYGCFIIDLQDKTPLNLLDQVFGSLVDLF  63

Query  955   QLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNF  776
              LP +TK +N  +    GY G   ++PL E  GI +  + E+T +F+  MWP  +   +F
Sbjct  64    DLPTQTKMKNKYNKPLSGYVGQIPTLPLHESLGIDNATSLEATRSFTGLMWPQGNE--HF  121

Query  775   CEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGH  596
                  +Y++   +LDQ+V+++V ESY ++KY++P ++S++YLLR +K   P       G 
Sbjct  122   SACLHNYAEFAAKLDQIVIQIVFESYNVEKYYNPYMESTTYLLRMLKNCAPNIKNPTLGF  181

Query  595   IPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPV  416
             + H D SF  I+  +Q+  LEMETR+G+ I    SS    +  AG+AF AWSN R+++P 
Sbjct  182   VTHTDKSFTTILHQDQVNGLEMETREGERIIINLSSPSLFMVFAGDAFRAWSNDRVWSPR  241

Query  415   HRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFC-ANGGGKEE  239
             H+V++ G  D+Y++A+F+F  GT+++PEEL+D  +PL +KPFDH   L F   + G K E
Sbjct  242   HQVLVSGETDRYSLAMFAFNSGTLQVPEELIDHQHPLMYKPFDHLGLLRFYRTDTGYKSE  301

Query  238   SPINAFCGV  212
              PI A+CG+
Sbjct  302   CPIKAYCGI  310



>emb|CDP14441.1| unnamed protein product [Coffea canephora]
Length=317

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 134/319 (42%), Positives = 187/319 (59%), Gaps = 14/319 (4%)
 Frame = -2

Query  1138  NPKL---PIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHC  968
             NPKL   P+I F  +N++ GT SW     +VR  LEEYGCF AVYD VS++LRD++F   
Sbjct  3     NPKLQNLPVINFDQENLQHGTESWSLARNKVRHALEEYGCFLAVYDAVSFKLRDSVFSAL  62

Query  967   KHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADN  788
             + LF LP+ETK++NTSD   FGY  N  +  + E  GI++    E    FS+ MWP   N
Sbjct  63    EKLFDLPVETKKKNTSDRLFFGYFSNDRNPSIHESLGIENSTNIEEVKKFSELMWPQG-N  121

Query  787   TPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKY-FDPLIQSSSYLLRFIKYRMPKWNE  611
               NF      Y+ LV +L+QVV RMV ESYGL+K   D  I S +YLLRF  Y  P  +E
Sbjct  122   DDNFSGIIHEYANLVAKLEQVVTRMVFESYGLEKLKCDSHIDSITYLLRFNSYEAPGVDE  181

Query  610   TKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWI--NFQPSSSKTIVFIAGEAFMAWSN  437
                   PH D S + I+  +Q+  LE+  +D +WI  +F PSS    + +A +A MAWSN
Sbjct  182   KTVIAPPHTDKSLITILTPSQVNGLEVNLKDEQWIPVDFLPSS---FIVMAADALMAWSN  238

Query  436   RRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTF---  266
              RI   +HRV M  +  + +V + S+ +G + IP+EL+D++NP ++KPFDH  + +F   
Sbjct  239   DRIRPCLHRVHMNANARRSSVLMLSYHKGVLHIPQELIDEENPQRYKPFDHLGYHSFLKK  298

Query  265   -CANGGGKEESPINAFCGV  212
                 G   +   I  +CGV
Sbjct  299   EVQTGQHVQCDAIKRYCGV  317



>ref|NP_175689.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
 gb|AAG52291.1|AC019018_28 putative oxidoreductase; 33116-34434 [Arabidopsis thaliana]
 gb|AAY78650.1| oxidoreductase [Arabidopsis thaliana]
 gb|AEE32853.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
Length=314

 Score =   247 bits (630),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/309 (39%), Positives = 189/309 (61%), Gaps = 5/309 (2%)
 Frame = -2

Query  1132  KLPIIEFTDDN-MRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLF  956
             K+PI++ T    ++  T++WR+ S E    LEEYGCF AVYD V+ +L D++F   + LF
Sbjct  9     KVPILDLTSQQELKPNTSTWRSVSREACEALEEYGCFLAVYDGVTQQLDDSIFAAAEELF  68

Query  955   QLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNF  776
              LP ETK++N ++    GY G    +PL E  G+      E    F+  MWP  ++   F
Sbjct  69    DLPTETKKKNVNEKPYHGYVGQMPVIPLHEGLGVDYVTNKEIAQRFTHLMWPQGND--RF  126

Query  775   CEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGH  596
             C    ++S  V +LD++V+RM+ E+YG++K+++  + S +YLL+F+KY  P  + +    
Sbjct  127   CNTVHTFSNAVAELDRLVVRMIFENYGVEKHYESHVGSKTYLLKFLKYLAPPESISMPAF  186

Query  595   IPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPV  416
               H D +F++I+  N +  LE++++DG+WI+ Q    K+ V +AG+  M WSN RI +  
Sbjct  187   PQHTDKTFLSILHQNDVNGLEVKSKDGEWISLQ-LPPKSYVVMAGDISMGWSNDRIRSCE  245

Query  415   HRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANGGGKE-E  239
             HRV M+G + +YT+ LFSFL   V IPEELVDD +PL +KPFD+   + F     G+E  
Sbjct  246   HRVTMEGDKTRYTLGLFSFLTDLVSIPEELVDDKHPLMYKPFDNIALINFYTTKEGREAN  305

Query  238   SPINAFCGV  212
             S + A+CG+
Sbjct  306   STLKAYCGI  314



>ref|XP_006367749.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Solanum tuberosum]
Length=315

 Score =   246 bits (629),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/314 (39%), Positives = 192/314 (61%), Gaps = 8/314 (3%)
 Frame = -2

Query  1138  NPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHL  959
             N KLP I+F+ ++++  T  W     +V + L EYGCF A +DK+   LR ++F+  + +
Sbjct  5     NIKLPKIDFSQEDLKTDTLVWNQVKSQVHKALVEYGCFEASFDKIPIHLRKSIFESLQQI  64

Query  958   FQLPLETKRRN--TSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNT  785
             F LPL+TK  N  T   +G+  +  F S PL E   + D   P     F++ +WP  +  
Sbjct  65    FDLPLQTKLENISTKPFHGYISSKTFPSFPLFESMCVDDANIPGKAEKFAQILWPQGN--  122

Query  784   PNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETK  605
             P+FC+   SYS+ + +LDQ V RMVLES GL+KY D  + S++++LR +KY  P+ +E++
Sbjct  123   PSFCKTVQSYSEQLSELDQTVRRMVLESLGLEKYMDEHMNSTNFVLRLLKYNTPQSSESE  182

Query  604   TGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIY  425
              G   H D S   I+  N+I  L++ T+DG+WIN +P+     V I G++  AW+N R++
Sbjct  183   IGISAHTDRSIATILYQNEINGLQVMTKDGQWINVEPTQDTFTVMI-GDSLHAWTNGRMH  241

Query  424   APVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTFC-ANG  254
             AP HRVMM+G++ +Y+ ALFS  +G  T++ P ELVD+++PL +K FD  EFL F     
Sbjct  242   APYHRVMMRGNKARYSAALFSLPKGGYTIKAPRELVDEEHPLLYKSFDLHEFLAFSYTEE  301

Query  253   GGKEESPINAFCGV  212
             G + E  +  +CG+
Sbjct  302   GMRCEFALKTYCGL  315



>ref|XP_011045370.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Populus euphratica]
 ref|XP_011013043.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Populus euphratica]
Length=312

 Score =   246 bits (629),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/317 (39%), Positives = 187/317 (59%), Gaps = 8/317 (3%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T  K+ ++  + +N   G++SW     ++RR LEEY  F  VY + S E    +  
Sbjct  1     MGSETASKIHVVHLSKENFEPGSSSWLAACSDIRRALEEYSFFEVVYSEPSMEFYREIIS  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LP ETK RNT    G GY G  +  P  E  GI+     +   NF+  MWPD 
Sbjct  61    VLEELFNLPHETKNRNTHPKLGHGYMGKISGFP--EGLGIEYATKKDECQNFTSLMWPDG  118

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +    FC+   S++K+  +L+Q+V+RM+ ESYG+ K ++P I S++YLLR +KY   +  
Sbjct  119   NE--RFCDVIHSFTKIASELNQMVVRMLFESYGIKKDYEPFINSTNYLLRLLKYGRSQ-G  175

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             ET  G   H D +F+ ++  N +  LE+ T++G+WI ++PSS+ +   IAG+  MAWSN 
Sbjct  176   ETNVGFKAHMDKTFLTLLYQNPVKGLEIRTKEGEWITYEPSSTTSFAVIAGDVCMAWSND  235

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTF--CA  260
             RI +  HRV++   ED+Y + LF+FL G V+ PEELVDD++PL++KPFDH + L F    
Sbjct  236   RIKSSYHRVVVTSEEDRYALGLFTFLDGVVQPPEELVDDEHPLQYKPFDHQKLLDFYQSY  295

Query  259   NGGGKEESPI-NAFCGV  212
             N   K +  I   +CGV
Sbjct  296   NDPNKRDCNIMKTYCGV  312



>ref|XP_006392865.1| hypothetical protein EUTSA_v10011667mg [Eutrema salsugineum]
 gb|ESQ30151.1| hypothetical protein EUTSA_v10011667mg [Eutrema salsugineum]
Length=317

 Score =   246 bits (629),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/309 (39%), Positives = 185/309 (60%), Gaps = 6/309 (2%)
 Frame = -2

Query  1129  LPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQL  950
             LP+I F++ N++ G   W  T   V++ L++YGCF A +D++  ELR ++F   + LF L
Sbjct  12    LPVINFSNKNLKPGEPEWDLTRAHVKKALQDYGCFEASFDRIPSELRKSIFGAMEELFDL  71

Query  949   PLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFCE  770
             PL+TK RN S     GY G +  +PL E  GI D         F++++WP  +N+     
Sbjct  72    PLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIDDSDVAAKVDAFTEKLWPQGNNS--LST  129

Query  769   DTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHIP  590
                S+SK + +LD  + RM++ES+GL KY D  +QS++YLLR +KY+ P   ET+ G   
Sbjct  130   TIQSFSKKLSELDVTIRRMIMESFGLVKYMDEHLQSTNYLLRVMKYKGPDTEETELGLNA  189

Query  589   HRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPVHR  410
             H D + + I+  N +  LE++T+D  WI  +PS    IV I G++  A  N R+Y+P HR
Sbjct  190   HTDKNIVTILYQNHVEGLEVQTKDNNWIKVKPSQDSFIVMI-GDSLHALLNGRLYSPNHR  248

Query  409   VMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTF-CANGGGKEE  239
             VMM G+E +Y++ LFS  +    V  P+ELVD+++P  FKPFDH EFL F     G + +
Sbjct  249   VMMTGTETRYSLGLFSIPKAGYIVNAPDELVDEEHPRMFKPFDHVEFLQFYYTEAGQRSQ  308

Query  238   SPINAFCGV  212
             S +  +CG+
Sbjct  309   SALKTYCGM  317



>gb|KDP37380.1| hypothetical protein JCGZ_06834 [Jatropha curcas]
Length=316

 Score =   246 bits (629),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/318 (38%), Positives = 191/318 (60%), Gaps = 6/318 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMR-VGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMF  977
             M + +N KLP+I+F+ +N+   GT+ W +   ++ + LEEYGCF AVY+ V  +L   +F
Sbjct  1     MGSLSNSKLPVIDFSSENLESAGTSGWVSKCKDILKALEEYGCFVAVYNNVPLQLHVDLF  60

Query  976   KHCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPD  797
                + LF LPLETKR+N SDI   GY     + P  E  GI      E   +F+K MWP 
Sbjct  61    NVLEELFDLPLETKRKNVSDIPFTGYVEIEPTRPFYESMGISHVEMLEGNKDFTKTMWPK  120

Query  796   ADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKW  617
              ++  NFC+   S+SK V  L ++ ++M+ + YG++K +   ++ ++Y  R + Y +P+ 
Sbjct  121   GND--NFCKIVHSFSKAVEDLHKMAVKMIFDGYGMEKNYQSHMELTTYFSRLVNYIIPQL  178

Query  616   NE--TKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAW  443
             NE  TK G  PH D SF+ I+  N +  LE++T++G+W++   SSS   + +AGE  M W
Sbjct  179   NENETKLGLYPHTDKSFLTILHQNDVNGLEIQTKNGEWVDVDLSSSSNFLVMAGEGIMGW  238

Query  442   SNRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFC  263
             SN RI A  HRV +   E + ++ LFS+++G +++PEE VD+++PL +KPFDH   + F 
Sbjct  239   SNNRIDACDHRVTINRKEKRLSIGLFSYVKGIIKVPEEFVDEEHPLMYKPFDHIGLVHFF  298

Query  262   AN-GGGKEESPINAFCGV  212
                 G K+   + A+ G+
Sbjct  299   GTPEGHKQHRTLKAYSGL  316



>emb|CDP10327.1| unnamed protein product [Coffea canephora]
Length=314

 Score =   246 bits (628),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/317 (41%), Positives = 196/317 (62%), Gaps = 6/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M +    KL +++FT++ ++ G++SW +   +++R LE +GCF A+Y+KVS EL  A+F+
Sbjct  1     MGSPAPRKLLVVDFTNEELKPGSSSWASACNDIQRALENHGCFIALYNKVSPELDKAIFQ  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
                 LF LP E K +N ++    GY G    +PL E  GI    T +   +F+  MW   
Sbjct  61    AADDLFDLPTELKVQNINEKPYHGYIGQIPFVPLHEGLGIDYATTLDGVQSFTNLMWSKG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             + + +  E + S++K V +LD++V++M+ ESYG++KY D  I S+ YLLRF+KYR P+ N
Sbjct  121   NKSFS--ESSFSFAKTVAKLDEMVIKMLFESYGVEKYSDSHIDSTRYLLRFLKYRAPEMN  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             ET      H D SF+ I+  N I  LE+ TRD +WI       K+ V +AG+A  AWSN 
Sbjct  179   ETTMAFPSHTDKSFLTILYQNHISGLEIRTRDDEWIKVD-FPQKSFVVMAGDACQAWSND  237

Query  433   RIYAPVHRVMM--KGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCA  260
             R+ +  H+V M   G E +YT+ALFSFL   V++PEELV+D+ PL+FKPF H + L F A
Sbjct  238   RVLSSNHKVTMDANGKETRYTIALFSFLSKMVQVPEELVNDEKPLQFKPFVHIDLLNFYA  297

Query  259   -NGGGKEESPINAFCGV  212
              + G K ++ +  FCGV
Sbjct  298   TDQGRKSQNILKDFCGV  314



>ref|XP_009147660.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Brassica rapa]
Length=315

 Score =   246 bits (627),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/307 (39%), Positives = 189/307 (62%), Gaps = 5/307 (2%)
 Frame = -2

Query  1126  PIIEFTD-DNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQL  950
             P+++ T   ++   T++WR+ S E    LEEYGCF A+YD V+ EL D++F   + LF L
Sbjct  12    PVLDLTSRQDLNPNTSTWRSISREACEALEEYGCFVALYDGVTQELDDSIFAAAEELFDL  71

Query  949   PLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFCE  770
             P +TKR+N ++    GY G    +PL E  GI      E    F+  MWP  ++   FCE
Sbjct  72    PTDTKRKNVNEKPYHGYVGQMPVIPLHEGLGIDYVTNKEEAQRFTHLMWPQGNH--QFCE  129

Query  769   DTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHIP  590
                 +S  V +LD++V+RM+ ++YG++K++D  + S +YLL+F+KY  P  + +      
Sbjct  130   TAHGFSNAVAELDRLVVRMIFDNYGVEKHYDSHVGSKTYLLKFLKYLAPPESISMAAFPQ  189

Query  589   HRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPVHR  410
             H D +F++I+  N +  LE++++DG WI+      K+ V +AG+  M WSN RI +  HR
Sbjct  190   HTDKTFLSILHQNGVNGLEVKSKDGGWISLH-LPPKSYVVMAGDISMGWSNDRIRSCEHR  248

Query  409   VMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANGGGKE-ESP  233
             V M+G + +YT+ LFSF++G V +PEELVDD++PL +KPFD+   + F A   G+E +S 
Sbjct  249   VTMEGDKTRYTLGLFSFIKGLVSVPEELVDDEHPLMYKPFDNIALINFYATKEGREAKST  308

Query  232   INAFCGV  212
             + A+C +
Sbjct  309   LKAYCCI  315



>ref|XP_010033901.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Eucalyptus grandis]
 gb|KCW53767.1| hypothetical protein EUGRSUZ_J03020 [Eucalyptus grandis]
Length=314

 Score =   245 bits (626),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 122/317 (38%), Positives = 192/317 (61%), Gaps = 6/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M +    KLP+I+F+   +  GT  W     EV++ LE YGCF A ++KV  EL+ +M  
Sbjct  1     MGSMAELKLPVIDFSSPRLEPGTAEWTAVRDEVKQALETYGCFEAWFEKVPVELQKSMLG  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LPL+TK RN S     GY G +  +PL E  GI D    E     +  +WP+ 
Sbjct  61    SVQELFDLPLQTKLRNVSRKPYHGYVGQYPMVPLYESIGIDDADIYEKVDGLTTTLWPEG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +   NF +   S+++ + +LD++  RM+LES+G++KY D  + S++YL R +KY  P+  
Sbjct  121   NM--NFSKTIHSFTEKLSELDKMSRRMILESFGVEKYLDEHMNSTNYLFRLMKYAGPQTT  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             + K G +PH D + + I+  N++  L+++T+ G+WI+ +PS++  +V I GE+  AW N 
Sbjct  179   DPKLGLVPHTDQNTVTILCQNEVDGLQVQTKHGEWISTRPSTNSFVVMI-GESLNAWLNG  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTF-C  263
             R++ P H+VMM G+  +Y+  LF+  +G   V+ P ELVD+++PL FKPFDH EFL F  
Sbjct  238   RLHTPYHQVMMSGNRARYSAGLFTVPKGGYIVKAPNELVDEEHPLLFKPFDHVEFLDFYY  297

Query  262   ANGGGKEESPINAFCGV  212
                G + +S + A+CGV
Sbjct  298   TETGQRAKSALKAYCGV  314



>ref|XP_003547720.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2-like [Glycine max]
Length=312

 Score =   245 bits (626),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 125/316 (40%), Positives = 197/316 (62%), Gaps = 6/316 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T  +LP+++FT+ N++ GT +W + S  VR  LE++G F A+YDKVS E  D+++ 
Sbjct  1     MESQTQSELPVVDFTNKNLKPGTDAWVSASQVVRGALEDHGGFLALYDKVSLETYDSVYS  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
                + F L +ETKRR T++   F Y+G    +PL E  GI + ++ +    ++  MWP  
Sbjct  61    EMMNFFDLSIETKRRKTTEKPIFSYSGQRPGIPLYESVGIMNPLSFQDCQKYTHVMWPQE  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLD-KYFDPLIQSSSYLLRFIKYRMPKW  617
             ++  +FCE   SY+K + +LD +V RMV ESYGL+ K F+ L++S+ Y+LR  KYR+P+ 
Sbjct  121   NH--HFCESVNSYAKQLVELDHIVKRMVFESYGLETKKFETLLESTEYVLRGYKYRIPRE  178

Query  616   NETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSN  437
              E+  G  PH D +F+ I++  ++  L ++ +DGKW+    S S  +V + G+A M WSN
Sbjct  179   GESNLGVAPHCDTAFLTILN-QKVEGLGVKLKDGKWLEVGASPSLYLV-MGGDALMVWSN  236

Query  436   RRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLT-FCA  260
              RI A  HRV+M    D+Y++ L S+    +E  EELVD++ PL++KPFDH+ +L  F  
Sbjct  237   DRIPACEHRVLMNSKIDRYSMGLLSYAAKIMEPQEELVDEEYPLRYKPFDHYGYLRFFLT  296

Query  259   NGGGKEESPINAFCGV  212
                 K +S I A+CG+
Sbjct  297   EEAIKSDSRIKAYCGI  312



>ref|XP_006305391.1| hypothetical protein CARUB_v10009783mg [Capsella rubella]
 gb|EOA38289.1| hypothetical protein CARUB_v10009783mg [Capsella rubella]
Length=317

 Score =   245 bits (626),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 118/310 (38%), Positives = 188/310 (61%), Gaps = 6/310 (2%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQ  953
             +LP+I+F++ N++ G   W  T  +V++ L++YGCF A +D +  ELR ++F   + LF 
Sbjct  11    RLPVIDFSNKNLKPGEPEWDLTRADVKKALQDYGCFEAAFDGIPVELRKSVFGALEELFD  70

Query  952   LPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFC  773
             LPL+TK RN S     GY G +  +PL E  GI+D    E   +F+ ++WP  +N+  F 
Sbjct  71    LPLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIEDADVAEKVDDFTGKLWPQGNNS--FS  128

Query  772   EDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHI  593
                 S+S+ + +LD  + RM++ES+ LDKY D  + S++YL+R +KY+ P   +TK G  
Sbjct  129   TTIHSFSEKLSELDITIRRMIMESFRLDKYIDEHLHSTNYLMRVMKYKEPDTEDTKLGLN  188

Query  592   PHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPVH  413
              H D + + I+  N +  LE++T+D  WI  +PS    IV I G++     N R+++P H
Sbjct  189   AHTDKNIVTILYQNHVEGLEVQTKDNNWIKVKPSQDSFIVMI-GDSLYGMLNGRLHSPYH  247

Query  412   RVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTF-CANGGGKE  242
             RVMM G+E +Y++ LFS  +    +  P+ELVD+++P  FKPFDH EFL F     G + 
Sbjct  248   RVMMTGTETRYSLGLFSIPKAGHIISSPDELVDEEHPRLFKPFDHVEFLQFYYTEAGQRS  307

Query  241   ESPINAFCGV  212
             +S +  +CG+
Sbjct  308   QSALKTYCGI  317



>gb|KHN27538.1| Gibberellin 20 oxidase 1 [Glycine soja]
Length=312

 Score =   244 bits (624),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 125/316 (40%), Positives = 196/316 (62%), Gaps = 6/316 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T  +LP+++FT+ N++ GT +W + S  VR  LE++G F A+YDKVS E  D+ + 
Sbjct  1     MESQTQSELPVVDFTNKNLKPGTDAWVSASQVVRGALEDHGGFLALYDKVSLETYDSAYS  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
                + F L +ETKRR T++   F Y+G    +PL E  GI + ++ +    ++  MWP  
Sbjct  61    EMMNFFDLSIETKRRKTTEKPIFSYSGQRPGIPLYESVGIMNPLSFQDCQKYTHVMWPQE  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLD-KYFDPLIQSSSYLLRFIKYRMPKW  617
             ++  +FCE   SY+K + +LD +V RMV ESYGL+ K F+ L++S+ Y+LR  KYR+P+ 
Sbjct  121   NH--HFCESVNSYAKQLVELDHIVKRMVFESYGLETKKFETLLESTEYVLRGYKYRIPRE  178

Query  616   NETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSN  437
              E+  G  PH D +F+ I++  ++  L ++ +DGKW+    S S  +V + G+A M WSN
Sbjct  179   GESNLGVAPHCDTAFLTILN-QKVEGLGVKLKDGKWLEVGASPSLYLV-MGGDALMVWSN  236

Query  436   RRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLT-FCA  260
              RI A  HRV+M    D+Y++ L S+    +E  EELVD++ PL++KPFDH+ +L  F  
Sbjct  237   DRIPACEHRVLMNSKIDRYSMGLLSYAAKIMEPQEELVDEEYPLRYKPFDHYGYLRFFLT  296

Query  259   NGGGKEESPINAFCGV  212
                 K +S I A+CG+
Sbjct  297   EEAIKSDSRIKAYCGI  312



>ref|XP_006365982.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Solanum tuberosum]
Length=314

 Score =   244 bits (624),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/292 (41%), Positives = 183/292 (63%), Gaps = 5/292 (2%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQ  953
             KLP I+F  ++++ GT  W     +V + L EYGCF A +DK+S  L+ ++F+  + LF 
Sbjct  3     KLPEIDFFHEDLKSGTLVWNQVKSQVHKALVEYGCFEASFDKISIHLKKSIFEVSQELFD  62

Query  952   LPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFC  773
             LPL+TK +N S     GY G    +PL E   I+D         F++ +WP   ++  FC
Sbjct  63    LPLQTKLKNISTRPLHGYIGPCPQIPLYESLCIEDANIHNKAEKFTQTLWPQGKSS--FC  120

Query  772   EDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHI  593
             +   SYS+ + +LDQ+V RM+LES G++KY D  + S++YLLR +KY+ P+ +ET+ G  
Sbjct  121   KTIQSYSEKLSELDQIVNRMILESLGMEKYMDEHMNSTNYLLRLMKYKAPQSSETEMGMN  180

Query  592   PHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPVH  413
              H D S + I+  NQ+  L++ T+DG+WIN  P+    IV I G+   AW+N R++AP H
Sbjct  181   VHTDTSNLTILYQNQVNGLQILTKDGQWINADPTPDTFIVMI-GDPLHAWTNGRLHAPYH  239

Query  412   RVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTFC  263
             RV+M+G E +Y++  FS  +    ++ P+ELVD+D+PL FKPF H E+L FC
Sbjct  240   RVIMRGKEARYSIGFFSRPKAGHIIKTPKELVDEDHPLLFKPFVHAEYLDFC  291



>ref|XP_010110321.1| Gibberellin 20 oxidase 1 [Morus notabilis]
 gb|EXC25841.1| Gibberellin 20 oxidase 1 [Morus notabilis]
Length=313

 Score =   244 bits (624),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 125/316 (40%), Positives = 193/316 (61%), Gaps = 5/316 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T+ K+P+I+FTD N++ G+ SW +    +R GLEEYGCF AVYDKV  EL  ++F 
Sbjct  1     MGSQTDHKIPVIDFTDKNLKPGSDSWVSACKLIRYGLEEYGCFEAVYDKVPTELHTSIFS  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               K LF LP+ETK + TSD  G  Y G    +PL E  G+ +  + E+  +F+K MWP  
Sbjct  61    AAKELFDLPIETKEQKTSDRPGANYVGQDPFVPLYESLGLDNPTSFEAAESFTKFMWPAG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             ++T  F E   S+SK   +L    +R+V +SYGL + +   I+S+ Y LRF KY +PK N
Sbjct  121   NDT--FREIVRSFSKPAAELYGTAIRIVFDSYGLGRLYGSHIESAFYRLRFFKYSVPKPN  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             E+  G   H D +F+ I+  +Q+  L++ T+D ++I+ +   S + + IAGE  MAWSN 
Sbjct  179   ESNVGLPNHTDKTFVTILHQHQVEGLQIRTKDDQYIDVKAKPS-SFLCIAGEGLMAWSND  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLT--FCA  260
             RI    HRV++K ++ +Y++  ++ + G + +PEE++D++ PL +KP D+ +FL   F  
Sbjct  238   RIRPCEHRVIIKENKGRYSLGFYTLVNGVIHVPEEMIDEEYPLAYKPIDYLDFLLHFFTN  297

Query  259   NGGGKEESPINAFCGV  212
             +       PI AF GV
Sbjct  298   DIVRYAACPIKAFAGV  313



>ref|XP_010500899.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X1 [Camelina sativa]
Length=320

 Score =   244 bits (624),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/308 (40%), Positives = 191/308 (62%), Gaps = 5/308 (2%)
 Frame = -2

Query  1132  KLPIIEFT-DDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLF  956
             K+PI++FT + +++  T++WR+ S +    LEEYGCF AVYD ++ +L D++F   K LF
Sbjct  13    KVPILDFTREQDLKPRTSAWRSISRDACEALEEYGCFVAVYDGITQQLDDSVFAAAKDLF  72

Query  955   QLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNF  776
              LP ETK +N ++    GY G    +PL E  GI      E    F+  MWP  ++   F
Sbjct  73    DLPTETKMKNVNEKPYHGYVGQMPIIPLHEGLGIDYVTNKEDAKKFTNLMWPQGND--QF  130

Query  775   CEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGH  596
             C+   S+S  V +LD++V+RM+ E+Y ++KY++   +S +YLL+F+ Y  P  + +    
Sbjct  131   CKTIHSFSNAVAELDRLVVRMLFENYDVEKYYESHFESKTYLLKFLMYLAPPESVSMPAF  190

Query  595   IPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPV  416
               H D +F+ I+  N +  LE++++DG+WI+ Q    ++ V +AG+  M WSN RI +  
Sbjct  191   PQHTDKTFLTILHQNDVNGLEVKSKDGEWISLQ-LPLQSYVVMAGDISMGWSNDRIRSCE  249

Query  415   HRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANGGGKE-E  239
             HRV M G + +YT+ LFSFL G+V IPEELVDD++PL +KPF++   + F A   G+E  
Sbjct  250   HRVTMVGDKVRYTIGLFSFLTGSVSIPEELVDDEHPLMYKPFNNIALINFFATKEGREAN  309

Query  238   SPINAFCG  215
             S + A+CG
Sbjct  310   STLKAYCG  317



>emb|CDP19784.1| unnamed protein product [Coffea canephora]
Length=317

 Score =   244 bits (624),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 131/314 (42%), Positives = 185/314 (59%), Gaps = 11/314 (4%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQ  953
             KLP++ F  +N++ GT SW     EVR  LEEYGCF AVYD VS++LRD++F   + LF 
Sbjct  8     KLPVVNFGQENLQHGTKSWSLARNEVRHALEEYGCFLAVYDAVSFKLRDSVFSALEKLFD  67

Query  952   LPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFC  773
             LP+ETK++NTSD   FGY  +     + E  GI++    E    FSK MWP   N  NF 
Sbjct  68    LPVETKKKNTSDTLFFGYICDDRDPSIRENMGIENSTDIEEVKKFSKLMWPQG-NDDNFS  126

Query  772   EDTTSYSKLVWQLDQVVMRMVLESYGLDKY-FDPLIQSSSYLLRFIKYRMPKWNETKTGH  596
                   + L+ +L+QVV+RMV ESYG++K   D  I S  Y+LRF  Y+ P  +E     
Sbjct  127   GIIHECANLLSELEQVVIRMVFESYGVEKLKCDSHIDSIMYVLRFNNYKAPGVDEKTVIA  186

Query  595   IPHRDNSFMAIVDTNQIGCLEMETRDGKWI--NFQPSSSKTIVFIAGEAFMAWSNRRIYA  422
              PH D   ++I+  +Q+  LE+  +D +WI  +F PSS    V +AG+A MAWSN RI  
Sbjct  187   PPHTDKCLISILAPSQVNGLEVNLKDEQWIPVDFLPSS---FVVMAGDALMAWSNDRIRP  243

Query  421   PVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTF----CANG  254
              +HRV M  +  + +V + S+ +G V IP+EL+D++NP ++KPFDH E+  F       G
Sbjct  244   CLHRVQMNANARRSSVLMSSYHKGVVHIPQELIDEENPQRYKPFDHLEYHNFLKKELQTG  303

Query  253   GGKEESPINAFCGV  212
                +   I  +CGV
Sbjct  304   QHLQCDAIKRYCGV  317



>ref|XP_003555065.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Glycine 
max]
 gb|KHN05760.1| Gibberellin 20 oxidase 1 [Glycine soja]
Length=312

 Score =   244 bits (622),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/312 (39%), Positives = 196/312 (63%), Gaps = 6/312 (2%)
 Frame = -2

Query  1141  TNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKH  962
             T  +LPI++FT++N++ GT +W + S  VR  LE++G F A+YDKVS E  D+++    +
Sbjct  5     TQSQLPIVDFTNENLKPGTDAWVSASQVVRSALEDHGGFLALYDKVSLETYDSVYSEMMN  64

Query  961   LFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTP  782
              F L ++TKRR T++   F Y+G    +PL E  GI + ++ +    ++  MWP  ++  
Sbjct  65    FFDLSIKTKRRKTTEKPIFSYSGQLPGIPLYESVGIMNPLSFQDCQKYTHVMWPQGND--  122

Query  781   NFCEDTTSYSKLVWQLDQVVMRMVLESYGLD-KYFDPLIQSSSYLLRFIKYRMPKWNETK  605
             +FCE   SY+K + +LD +V RMV E+YG++ K FD L++S+ Y+LR  KYR+P+  E+ 
Sbjct  123   HFCESVNSYAKKLVELDHIVKRMVFENYGIETKKFDTLLESTEYVLRAYKYRIPQVGESN  182

Query  604   TGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIY  425
              G  PH D +F+ I++  ++  L ++ +DGKW     S S  +V + G+A M WSN RI 
Sbjct  183   LGVAPHSDTAFITILN-QKVEGLGVKLKDGKWFEVGASPSLYLV-MGGDALMVWSNDRIP  240

Query  424   APVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLT-FCANGGG  248
             A  HRV++    D+Y++ L S+    +E  EELVD+++PL++KPFDH+ +L  F      
Sbjct  241   ACEHRVLINSKIDRYSMGLLSYAAKIMEPQEELVDEEHPLRYKPFDHYGYLRFFLTEEAI  300

Query  247   KEESPINAFCGV  212
             K +S I A+CG+
Sbjct  301   KSDSRIKAYCGI  312



>ref|NP_175691.1| putative 2-oxoglutarate-dependent dioxygenase [Arabidopsis thaliana]
 gb|AAG52269.1|AC019018_6 putative oxidoreductase; 38288-39393 [Arabidopsis thaliana]
 gb|AEE32855.1| putative 2-oxoglutarate-dependent dioxygenase [Arabidopsis thaliana]
Length=317

 Score =   244 bits (622),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/310 (39%), Positives = 188/310 (61%), Gaps = 6/310 (2%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQ  953
             +LP+I+F++ N++ G   W  T  +V++ L++YG F A +D++ +ELR ++F   + LF 
Sbjct  11    RLPVIDFSNKNLKPGEPEWDLTRADVQKALQDYGYFEASFDRIPFELRKSVFGALEELFD  70

Query  952   LPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFC  773
             LPL+TK RN S     GY G +  +PL E  GI D    E    F++++WP  + +  F 
Sbjct  71    LPLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIDDSDIAEKVDAFTEKLWPQGNIS--FS  128

Query  772   EDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHI  593
                 S+SK + +LD  + RM++ES+GLDKY D  + S++YLLR +KY+ P   ETK G  
Sbjct  129   TTIQSFSKKLSELDITIRRMIMESFGLDKYIDEHLHSTNYLLRVMKYKGPDTEETKVGLN  188

Query  592   PHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPVH  413
              H D + + I+  N +  LE++T+D  WI  +P+     V I G++  A  N R+++P H
Sbjct  189   AHTDKNIVTILYQNHVEGLEVQTKDKNWIKVKPTQDSFTVMI-GDSLYALLNGRLHSPYH  247

Query  412   RVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTF-CANGGGKE  242
             RVMM G+E +Y++ LFS  +    V  P+ELVD+++P  FKPFDH EFL F     G + 
Sbjct  248   RVMMTGTETRYSLGLFSIPKAGHIVSSPDELVDEEHPRLFKPFDHVEFLQFYYTEAGQRS  307

Query  241   ESPINAFCGV  212
             +S +  +CG+
Sbjct  308   QSALKTYCGI  317



>ref|XP_004293154.1| PREDICTED: gibberellin 3-beta-dioxygenase 4-like [Fragaria vesca 
subsp. vesca]
Length=316

 Score =   244 bits (622),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/317 (39%), Positives = 194/317 (61%), Gaps = 6/317 (2%)
 Frame = -2

Query  1153  MATHTNPK-LPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMF  977
             M + T PK +P I F+  +++ G++SW +T  +VR  LEEYGCF A+Y +VS EL D +F
Sbjct  1     MGSMTLPKEIPTINFSLQDLKPGSSSWTSTCKQVRNALEEYGCFVALYPQVSQELMDNIF  60

Query  976   KHCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPD  797
                + LF++PLE K +NTS+    GY G    +PL E   I +  +P+ T  F   MWP+
Sbjct  61    GQSRDLFEVPLENKVKNTSEEPYRGYIGPNPLLPLYEGIAIDNVTSPQETQKFRDLMWPN  120

Query  796   ADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLD-KYFDPLIQSSSYLLRFIKYRMPK  620
                   FCE T  ++KL+ +L+  V +M+ ESYG+  + ++ L  S+S+LLRF+KY++P+
Sbjct  121   GKT--QFCEITDLFAKLLGELENTVEKMIFESYGIPLEQYETLASSNSHLLRFLKYKIPE  178

Query  619   WNETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWS  440
               +       H D +F  I+  + +G LE++T+DG WI+ + +SS+  +F+A +    WS
Sbjct  179   ERDAALRFPSHTDKNFTTIIVQHDVGGLEVQTKDGDWISVESASSQ-FLFMACDELQVWS  237

Query  439   NRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCA  260
             N R+ AP HRV   G + +Y++ +F+F  G  E+P+ELVDD +PL +  FD   F+ F  
Sbjct  238   NDRVKAPHHRVKHCGDKTRYSLGMFTFNNGVFEVPKELVDDSHPLLYNQFDSLGFVRFYT  297

Query  259   NGGGKE-ESPINAFCGV  212
                 K+ ESPI A+CGV
Sbjct  298   TPEAKKAESPIKAYCGV  314



>ref|XP_006367751.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Solanum tuberosum]
Length=314

 Score =   243 bits (621),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 118/294 (40%), Positives = 187/294 (64%), Gaps = 6/294 (2%)
 Frame = -2

Query  1138  NPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHL  959
             N KLP I F+ ++++  T  W     +V + L EYGCF A +DK+   L+ ++F+  + +
Sbjct  5     NIKLPKINFSHEDLKPDTLVWNQVKSQVYKALVEYGCFEAFFDKIPINLQKSIFEVSQEI  64

Query  958   FQLPLETKRRNTSDIYGFGYAGNF-ASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTP  782
             F LPL+TK +N S    +GY G +  S+PL E  GI D    +    +++ +WP  +  P
Sbjct  65    FDLPLQTKLKNISTEPFYGYVGQYHPSIPLFESMGIIDSNILQKVEKYTQLLWPQGN--P  122

Query  781   NFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKT  602
             +FC+   SYS+ + +LDQ + RM++ES G++KY D  + S++Y LR IKY+ P+ NETK 
Sbjct  123   SFCKTIQSYSEQLSKLDQTIRRMIVESLGVEKYMDEHMNSTNYRLRLIKYKEPQSNETKI  182

Query  601   GHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYA  422
             G   H D + + I+  NQ+  LE+ T+DG+WIN  P+     + I G++  AW+N R++A
Sbjct  183   GLHAHTDKNIVTILYQNQVNGLEILTKDGQWINVDPTPDNFTIMI-GDSLHAWTNGRMHA  241

Query  421   PVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTF  266
             P HRVM++G+E +Y++ LFS  +    ++ P+ELVD+D+PL F PFD+ EFL+F
Sbjct  242   PFHRVMVRGNEARYSIGLFSIPKAGCIIKTPKELVDEDHPLLFTPFDYHEFLSF  295



>ref|XP_004241718.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Solanum lycopersicum]
Length=314

 Score =   243 bits (620),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 122/313 (39%), Positives = 190/313 (61%), Gaps = 7/313 (2%)
 Frame = -2

Query  1138  NPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHL  959
             N  LP I+F+   ++  T  W     +V + L EYGCF A +DK    L+ ++F+  + L
Sbjct  5     NINLPKIDFSHKELKPHTLVWNQVKSQVHKALVEYGCFEASFDKFPISLQKSIFESSQEL  64

Query  958   FQLPLETKRRNTSDIYGFGYAGNF-ASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTP  782
             F LP +TK ++       GY G +  S+PL E  GI D   P     F++ +WP  + T 
Sbjct  65    FDLPSQTKLKSIRTKPFNGYVGFYHPSIPLYESMGIDDANIPHKAEKFTQILWPQGNTT-  123

Query  781   NFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKT  602
              FC+   SYS+ + +LDQ++ RM+LES G++ Y D  + S++YLLR +KY+ P+ +E + 
Sbjct  124   -FCKTIQSYSEQLSELDQMIRRMILESLGVENYMDEHMNSTNYLLRLMKYKTPQSSENEM  182

Query  601   GHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYA  422
             G   H D S + I+  NQ+  L++ T+DG+WIN  P+    IV I G++  AW+N R++A
Sbjct  183   GLSSHTDKSNITILYQNQVNGLQVLTKDGQWINVDPTPDTFIVLI-GDSLHAWTNGRMHA  241

Query  421   PVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTFCANGGG  248
             P HRVMMKG+E +Y++ LF+  +    ++ P+ELVD+++PL +KPF H EF+TF     G
Sbjct  242   PFHRVMMKGNEARYSIGLFTIPKTGYMIKAPKELVDEEHPLLYKPFTHLEFITFSYTEEG  301

Query  247   KE-ESPINAFCGV  212
              + ES +  +CGV
Sbjct  302   MQCESALKTYCGV  314



>ref|XP_010479801.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Camelina 
sativa]
Length=310

 Score =   243 bits (619),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 119/309 (39%), Positives = 188/309 (61%), Gaps = 4/309 (1%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAA-VYDKVSWELRDAMFKHCKHLF  956
             K+  ++F+ ++++ GT  W +TS  + + LE+YGCF   + +K   +L D +F     LF
Sbjct  4     KILTLDFSREDLKPGTKYWESTSKNITQALEKYGCFIIDLQNKTPLDLLDQVFGSLVDLF  63

Query  955   QLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNF  776
              LP  TK +N  D    GY G   ++ L E  GI +  + E+T +F+  MWP  +   +F
Sbjct  64    DLPTHTKMKNKYDKPLSGYVGQIPTLHLHESLGIDNATSLEATRSFTGLMWPQGNE--HF  121

Query  775   CEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGH  596
              E    Y++   +LDQ+V++MV ESY ++KY++P ++S++YLLR +K   P       G 
Sbjct  122   SECLHKYAEFAAKLDQMVIQMVFESYNVEKYYNPYMESTTYLLRMLKNCAPNNENPTLGF  181

Query  595   IPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPV  416
             + H D SF  I+  +Q+  LEMETR+G+ I    SS    +  AG+AF AWSN R+++P 
Sbjct  182   VTHTDKSFTTILHQDQVNGLEMETREGERIKINLSSPSLFMVFAGDAFKAWSNDRVWSPR  241

Query  415   HRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFC-ANGGGKEE  239
             H+V++ G  D+Y++A+F+F  GT+++PEEL+D  +PL +KPFDH   L F   + G K E
Sbjct  242   HQVLVSGETDRYSLAMFAFNNGTLQVPEELIDHQHPLLYKPFDHLGLLRFYRTDTGFKSE  301

Query  238   SPINAFCGV  212
              PI A+CG+
Sbjct  302   CPIKAYCGI  310



>ref|XP_008227260.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Prunus mume]
Length=317

 Score =   242 bits (618),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 125/317 (39%), Positives = 191/317 (60%), Gaps = 5/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T PKLP I F+ ++++ G+ SW++T+ +VR  LEEYGCF A+Y+++S EL + MF 
Sbjct  1     MGSVTVPKLPTINFSIEDLKPGSASWQSTAKQVRFALEEYGCFVALYEQISAELLNNMFG  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               K LF++P E K +N  +    G+ G    +PL E   I +  +P+ T  F   MWP+ 
Sbjct  61    QAKDLFEVPKENKVKNVGEEPYRGHMGPNPGLPLYESLCIDNVTSPQETQKFKNLMWPEG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
                 NFCE T S+ +L+  L+  V +++ ESYG+ K ++ +  S+ +LLRFIKY +P+ N
Sbjct  121   KT--NFCETTDSFGQLLADLEHTVEQLLFESYGIGKQYESVGSSNGHLLRFIKYTVPEDN  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKT-IVFIAGEAFMAWSN  437
             +T      H D +F  IV  + I  LE++T++G WIN +   S+  +VF+AG+    WSN
Sbjct  179   DTTLRFPSHTDINFTTIVVQHDIAGLEVKTKEGDWINVECKPSQVQLVFMAGDGLQVWSN  238

Query  436   RRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCAN  257
              R+ A  HRV   G++ +Y++ LF+F  G  ++PEELVD+ +PL +  FD   F+   A 
Sbjct  239   DRVKACHHRVKHCGNKTRYSIGLFTFNNGVFQVPEELVDESHPLLYNAFDSRAFIRKYAT  298

Query  256   GG--GKEESPINAFCGV  212
                  KE SPI AF GV
Sbjct  299   TPELKKEASPIKAFAGV  315



>ref|XP_010463426.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Camelina sativa]
Length=320

 Score =   242 bits (618),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 119/308 (39%), Positives = 192/308 (62%), Gaps = 5/308 (2%)
 Frame = -2

Query  1132  KLPIIEFT-DDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLF  956
             K+PI++FT + +++  T++WR+ S      LEEYGCF AVYD V+ +L +++F   K LF
Sbjct  13    KVPILDFTREQDLKPRTSAWRSISRAACEALEEYGCFVAVYDGVTQQLDNSVFAAAKDLF  72

Query  955   QLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNF  776
              LP ETK +N ++    GY G    +PL E  GI      E    F+  MWP  ++   F
Sbjct  73    DLPTETKMKNVNEKPYHGYVGQMPIIPLHEGLGIDYVTNKEDAKKFTNLMWPQGND--QF  130

Query  775   CEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGH  596
             C+    +S  V +LD++V+R++ E+YG++K+++  +++ +YLL+F+ Y  P  + +    
Sbjct  131   CKTIHRFSNAVAELDRLVVRIIFENYGVEKHYESHVKAKTYLLKFLMYLAPPESISMPAF  190

Query  595   IPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPV  416
               H D +F+ I+  N +  LE++++DG+WI+ Q    K+ V +AG+  M WSN RI +  
Sbjct  191   PQHTDKTFLTILHQNDVNGLEVKSKDGEWISLQ-LPLKSYVVMAGDISMGWSNDRIRSCE  249

Query  415   HRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANGGGKE-E  239
             HRV M+G + +YT+ LFSF+ G+V IPEELVDD++PL +KPF++   + F A   G+E  
Sbjct  250   HRVTMEGDKVRYTIGLFSFVTGSVSIPEELVDDEHPLMYKPFNNIALINFFATKEGREAN  309

Query  238   SPINAFCG  215
             S + A+CG
Sbjct  310   STLKAYCG  317



>emb|CDP21179.1| unnamed protein product [Coffea canephora]
 emb|CDP17333.1| unnamed protein product [Coffea canephora]
Length=315

 Score =   242 bits (617),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/317 (39%), Positives = 188/317 (59%), Gaps = 10/317 (3%)
 Frame = -2

Query  1150  ATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKH  971
             A+ +  KLPI++   DN++ GT+SW  T   VR  LEEYGCF  V D VS +    +F  
Sbjct  3     ASQSRCKLPIVDLKKDNLKPGTSSWTATCDSVRHALEEYGCFLVVQDHVSAQFEKEVFDV  62

Query  970   CKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDAD  791
              + LF LP ETK +N+ D++  GY G     PL E   I +  T +    F+  MWP  +
Sbjct  63    VRELFDLPTETKSQNSLDMF-LGYVGQLPHAPLHESMEIPNATTIDGVQAFTDLMWPSGN  121

Query  790   NTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKW-N  614
                 FCE   +Y+KLV +++Q V +MV  SYG   + +  I+SS+Y+LR +KY  P+  N
Sbjct  122   K--RFCETMLTYAKLVAEVEQTVDKMVFASYGAMDHLESHIESSTYILRPLKYTPPEMHN  179

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWIN--FQPSSSKTIVFIAGEAFMAWS  440
                 G   H D SF+ ++  NQ+  L+++ R+ +WI+  F P+S    + +AG+A+ AWS
Sbjct  180   NVDVGADVHTDKSFITMLHQNQVNALKVQARNEEWIDVDFSPAS---FLVLAGDAYQAWS  236

Query  439   NRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLT-FC  263
             N RI+ P H+V+MK ++++Y +ALF++  G V +PE L+D+ +PL FKPFD+F+ L  F 
Sbjct  237   NDRIHPPRHQVIMKENKERYCIALFAYNYGMVNVPEILIDEKHPLAFKPFDNFDLLRFFL  296

Query  262   ANGGGKEESPINAFCGV  212
             +       S   A+CG+
Sbjct  297   SRTTDMSSSTAKAYCGI  313



>ref|XP_003625060.1| Gibberellin 20 oxidase [Medicago truncatula]
 gb|ABD33293.1| Immunoglobulin/major histocompatibility complex; 2OG-Fe(II) oxygenase 
[Medicago truncatula]
 gb|AES81278.1| 2-oxoglutarate-dependent dioxygenase [Medicago truncatula]
 gb|AFK39209.1| unknown [Medicago truncatula]
Length=321

 Score =   241 bits (616),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/310 (40%), Positives = 192/310 (62%), Gaps = 7/310 (2%)
 Frame = -2

Query  1129  LPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQL  950
             +P+++ +D NM+ GT +W +    V+  LE+YGCF A YDK+  EL D +    +  F+L
Sbjct  10    IPVVDLSDQNMKPGTDTWVSACNVVKTSLEDYGCFVAHYDKIGKELCDNVIFGIEEFFKL  69

Query  949   PLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFCE  770
             PLETK +  SD    GY+G   ++PL E   I+D +T      F++ +WP  +N   FCE
Sbjct  70    PLETKAQKISDRPFHGYSGQLLTLPLYESLDIQDPLTMLGCQIFTQIIWPQGNN--RFCE  127

Query  769   DTTSYSKLVWQLDQVVMRMVLESYGLD-KYFDPLIQSSSYLLRFIKYRMPKWNETKTGHI  593
                 YSKL+ +LD +  RMV ESYG+D K  + LI+SS+YL+R +KYR  + +E   G  
Sbjct  128   SFNEYSKLLGELDHIAKRMVFESYGVDTKICESLIESSNYLIRCLKYRTREMDENDLGLT  187

Query  592   PHRDNSFMAIV-DTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPV  416
             PH D + +++V   N +  L+++ ++G+W   + S S + V +AG+AF  WSN RI A  
Sbjct  188   PHSDLTIISVVHQLNNLNGLQIKLKNGEWTEVEASPS-SFVVLAGDAFTIWSNGRIRACE  246

Query  415   HRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKP-FDHFEFLTFCANGGGKEE  239
             HRV+M  ++ +Y  ALFSF    +EIPEELV++++PL++KP FDH+++L F      KE 
Sbjct  247   HRVIMNATKTRYAAALFSFASKIMEIPEELVNEEHPLRYKPTFDHYDYLRFFQKEKMKEP  306

Query  238   -SPINAFCGV  212
              S +  +CG+
Sbjct  307   ISRMEVYCGI  316



>ref|XP_010481152.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Camelina sativa]
Length=404

 Score =   244 bits (622),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 123/307 (40%), Positives = 187/307 (61%), Gaps = 5/307 (2%)
 Frame = -2

Query  1132  KLPIIEFT-DDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLF  956
             K+PI++FT   +++  T+ WR+ S +    LEEYGCF AVYD V+ +L D++F   K LF
Sbjct  99    KVPILDFTSQQDLKPNTSVWRSISRDACEALEEYGCFVAVYDGVTQQLDDSVFAAAKDLF  158

Query  955   QLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNF  776
              LP ETK +N ++    GY G    +PL E  GI      E    F+  MWP  ++   F
Sbjct  159   DLPAETKMKNVNEKPYHGYVGQMPIIPLHEGLGIDYVTNKEDAKKFTNLMWPQGND--RF  216

Query  775   CEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGH  596
             C+   ++S  V +LD++V+RM+ E YG+ KY++   +S +YLL+F+ Y  P  + +    
Sbjct  217   CKTIHAFSNAVAELDRLVVRMIFEIYGVKKYYESHFESKTYLLKFLMYLAPPESVSMPAF  276

Query  595   IPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPV  416
               H D +F+ I+  N +  LE++++DG+WI+ Q    K+ V +AG+  M WSN RI +  
Sbjct  277   PQHTDKTFLTILHQNDVNGLEVKSKDGEWISLQ-LPLKSYVVMAGDISMGWSNDRIRSCE  335

Query  415   HRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANGGGKE-E  239
             HRV M+G + +YT+ LFSFL G+V IPEELVDD++PL +KPF +   + F A   G+E  
Sbjct  336   HRVTMEGDKVRYTIGLFSFLTGSVSIPEELVDDEHPLMYKPFTNIALINFFATKEGREAN  395

Query  238   SPINAFC  218
             S + A+C
Sbjct  396   STLKAYC  402


 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 49/74 (66%), Gaps = 1/74 (1%)
 Frame = -2

Query  1132  KLPIIEFT-DDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLF  956
             K+PI++FT   +++  T+ WR+ S +    LEEYGCF AVYD V+ +L D++F   K LF
Sbjct  9     KVPILDFTSQQDLKPNTSVWRSISRDACEALEEYGCFVAVYDGVTQQLDDSVFAAAKDLF  68

Query  955   QLPLETKRRNTSDI  914
              LP ETK +N + +
Sbjct  69    DLPAETKMKNVNXV  82



>ref|XP_010535123.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Tarenaya hassleriana]
Length=314

 Score =   241 bits (615),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/316 (39%), Positives = 190/316 (60%), Gaps = 5/316 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + +  K+P+++FT+ ++   T  W +TS E  + LEEYGCF AVY      L  A F 
Sbjct  1     MGSISTTKIPVLDFTNQDLIPDTPLWVSTSVEACKALEEYGCFVAVYGGAPPHLAGAAFS  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LP ETKR+N +D    GY G  + +PL E  GI      +    F++ MWP  
Sbjct  61    AAEELFCLPTETKRKNVNDKPYHGYVGQMSVIPLHEGLGIDYVTDRDHVRKFTELMWPQG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             ++   FCE   S+S  + +LD++V+RM+ E+Y + KY++  I S +YLL+F+KY  P   
Sbjct  121   NDP--FCETVYSFSNAIAELDRLVVRMIFENYRVGKYYESHIGSKTYLLKFLKYSPPPEA  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
                     H D +F++I+  N +  LE++++DG+WI  +   +  +V +AG+  M WSN 
Sbjct  179   NPTPAFPMHTDKTFLSILRQNDVNGLEVKSKDGEWIALELPPNSYVV-MAGDVSMGWSND  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDD-DNPLKFKPFDHFEFLTFCA-  260
             RI +  HRV M G++ +YT+ LFSF+ GT+ +PEELVD+ D PLK+KPFD+   + F A 
Sbjct  238   RIRSCEHRVTMSGNKKRYTLGLFSFVTGTISVPEELVDEKDYPLKYKPFDNISLIEFYAT  297

Query  259   NGGGKEESPINAFCGV  212
             + G K E+ + A+CGV
Sbjct  298   DEGRKAENTLKAYCGV  313



>emb|CDY26054.1| BnaC06g05700D [Brassica napus]
Length=315

 Score =   241 bits (614),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 119/308 (39%), Positives = 188/308 (61%), Gaps = 5/308 (2%)
 Frame = -2

Query  1129  LPIIEFTD-DNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQ  953
             +P+++ T   ++   T++WR+ S E    LEEYGCF A+YD V+ EL D++F   + LF 
Sbjct  11    VPVLDLTSRQDLNPNTSTWRSISREACEALEEYGCFVALYDGVTQELDDSIFAAAEELFD  70

Query  952   LPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFC  773
             LP +TKR+N ++    GY G    +PL E  GI      E    F+  MWP  ++   FC
Sbjct  71    LPTDTKRKNVNEKPYHGYVGQMPVIPLHEGLGIDYVTNKEEAQRFTHLMWPRGNH--QFC  128

Query  772   EDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHI  593
             E    +S  V +LD++V+RM+ E+YG++K++D    S +YLL+F+KY  P  + +     
Sbjct  129   ETAHGFSNSVAELDRLVVRMIFENYGVEKHYDSHEGSKTYLLKFLKYLAPPESISMPAFP  188

Query  592   PHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPVH  413
              H D +F++I+  N +  LE++++DG WI+      K+ V +AG+  M WSN RI +  H
Sbjct  189   QHTDKTFLSILHQNGVNGLEVKSKDGGWISLH-LPPKSYVVMAGDISMGWSNDRIRSCEH  247

Query  412   RVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANGGGKE-ES  236
             RV M+G + +YT+ LFSF++G V +P ELVDD++PL +KPFD+   + F A   G+E +S
Sbjct  248   RVTMEGDKTRYTLGLFSFIKGLVSVPGELVDDEHPLMYKPFDNIALINFYATKEGREAKS  307

Query  235   PINAFCGV  212
              + A+C +
Sbjct  308   TLKAYCCI  315



>ref|XP_010479810.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Camelina sativa]
Length=317

 Score =   240 bits (612),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 119/309 (39%), Positives = 186/309 (60%), Gaps = 6/309 (2%)
 Frame = -2

Query  1129  LPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQL  950
             LP+I+F+++ ++ G   W  T  +V++ L++YGCF A + ++  ELR  +F+  + LF L
Sbjct  12    LPVIDFSNEYLKPGEPEWDLTRADVQKALQDYGCFEASFKRIPTELRKLVFETLEELFDL  71

Query  949   PLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFCE  770
             PL+TK RN S     GY G +  +PL E  GI+D    E    F+K +WP  +N+  F  
Sbjct  72    PLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIEDPDVAERVNAFTKPLWPQGNNS--FST  129

Query  769   DTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHIP  590
                +++K +  LD  + RM++ES+GLDKY +  + S++YLLR +KY+ P   ETK G   
Sbjct  130   RIHTFAKKLSDLDITIRRMIMESFGLDKYIEEHLHSTNYLLRVMKYKGPDTKETKLGLNA  189

Query  589   HRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPVHR  410
             H D + + I+  N +  LE++T+D  WI  +PS    IV I G++  A  N R+++P HR
Sbjct  190   HTDKNIVTILYQNHVEGLEVQTKDNNWIKVKPSKDSFIVMI-GDSLHAMLNGRLHSPNHR  248

Query  409   VMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTF-CANGGGKEE  239
             VMM G+E +Y++ LFS  +    +  PEELV +++P  FKPFDH EFL F     G + +
Sbjct  249   VMMTGTETRYSLGLFSIPKAEHIISSPEELVGEEHPRLFKPFDHVEFLQFYYTQAGQRSQ  308

Query  238   SPINAFCGV  212
             S +  +CG+
Sbjct  309   SALKTYCGM  317



>ref|XP_002298128.2| hypothetical protein POPTR_0001s17630g [Populus trichocarpa]
 gb|EEE82933.2| hypothetical protein POPTR_0001s17630g [Populus trichocarpa]
Length=311

 Score =   239 bits (610),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 124/317 (39%), Positives = 186/317 (59%), Gaps = 9/317 (3%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T  K+P++  + +N   G++SW     ++RR LE+Y  F  VY + S E    +  
Sbjct  1     MGSETVSKIPVVHLSKENFEPGSSSWLAACNDIRRALEKYSFFEVVYSEPSMEFYREIIS  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LP ETK RNT    G GY G     P  E  GI+     +    F+  MWPD 
Sbjct  61    VLEELFNLPHETKNRNTHPKLGHGYMGKIPGFP--EGLGIEYATKKDECQKFTSLMWPDG  118

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +    FC+   S++K+  +L+Q+V+RM+ ESYG+ K  +PL+ S++YLLR +KY   +  
Sbjct  119   NE--RFCDVIHSFTKIASELNQMVVRMLFESYGIKKD-EPLVNSTNYLLRLLKYGRSQ-G  174

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             ET  G   H D +F  ++  N +  LE+ T++G+WI ++PSS+ +   IAG+  MAWSN 
Sbjct  175   ETNVGFKAHMDKTFFTLLYQNPVKGLEIRTKEGEWITYEPSSTTSFAVIAGDVCMAWSND  234

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTF--CA  260
             RI +  HRV++   ED+Y + LF+FL G V+ PEELVDD++PL++KPF+H + L F    
Sbjct  235   RIKSSYHRVVVSSEEDRYALGLFTFLDGVVQPPEELVDDEHPLQYKPFEHQKLLDFYQSY  294

Query  259   NGGGKEESPI-NAFCGV  212
             N   K +  I  A+CGV
Sbjct  295   NDPNKRDCNIMKAYCGV  311



>emb|CDP10138.1| unnamed protein product [Coffea canephora]
Length=314

 Score =   239 bits (610),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/319 (40%), Positives = 193/319 (61%), Gaps = 10/319 (3%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + +   LPI+ FT + ++ GT SW +T  +VR  LE++ CF A Y+++  EL  A+F 
Sbjct  1     MGSQSQANLPIVYFTRETLKPGTGSWLSTCKKVRDALEKHSCFLAQYERIPSELISAIFL  60

Query  973   HCKHLFQLPLETKRRNTSDIYG-FGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPD  797
                 LF LP ETK +N +   G FGY G   + P  E  GI+D   PE+ + F+  MWP 
Sbjct  61    QLGELFDLPTETKVQNITTTDGLFGYFGQQPTNPTYEGMGIEDVNNPEAVLKFTNLMWPS  120

Query  796   ADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKW  617
              +++  FCE   SY   V  L+++VMR + ES+G++K +    +S + +LRF K+R P+ 
Sbjct  121   GNDS--FCELMESYKNHVSDLEKLVMRTIFESFGVEKLYSSHDESCNRMLRFNKHRPPQM  178

Query  616   NETKTGHIPHRDNSFMAIVDTNQIGCLEMETR-DGKWI--NFQPSSSKTIVFIAGEAFMA  446
             +E   G   H D +F+ I+  NQ   LE++++ DG WI  +F PSS    + +AG+  +A
Sbjct  179   SENLGGVPEHTDPTFVTIIQRNQYSSLEVKSKEDGSWIAVDFPPSS---FLVMAGDCLVA  235

Query  445   WSNRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTF  266
             WSN R+++ VHR+ M+  E +++ ALFS+  G V +PEELVDD++PL+FKPFD   F  F
Sbjct  236   WSNGRVHSTVHRIRMRPGETRFSTALFSYHSGMVHVPEELVDDEHPLQFKPFDQMGFFRF  295

Query  265   C-ANGGGKEESPINAFCGV  212
               A     +ES I A+CG+
Sbjct  296   TFAYYPLSDESKIKAYCGI  314



>ref|XP_008344774.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Malus 
domestica]
Length=317

 Score =   239 bits (610),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/319 (38%), Positives = 190/319 (60%), Gaps = 7/319 (2%)
 Frame = -2

Query  1153  MATHTNPKL-PIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMF  977
             M + T P + P+++ + +NM+ GT +W     +V+  LEE+GCF AVY K + E ++++F
Sbjct  1     MGSETQPPVVPVVDLSSENMKPGTDAWLLACKKVQHALEEFGCFEAVYKKDTLETQNSIF  60

Query  976   KHCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPD  797
                K    LPLETK + TSD     Y G     P     GI++  T E    F+  MWP 
Sbjct  61    SAIKDFCDLPLETKMQKTSDKPLHSYFGRNPLFPHDFSTGIENPETVEGXQKFTSIMWPA  120

Query  796   ADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKW  617
              +    F E   S+S+++ +LDQ+V RMV + YG+++ +D    S++Y LR I+Y++   
Sbjct  121   GNX--RFRESVHSFSRMLVELDQMVTRMVFDIYGVZRLYDSHKASTTYQLRCIEYQIQAI  178

Query  616   NETKTGHI---PHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMA  446
              +T    +   PH D  F  I+  N++  L+++TR G+ I++ PSS  + +  A +  MA
Sbjct  179   QQTDKSDVRLFPHTDKGFTTILHQNEVNGLQIKTRAGQRIDYAPSSPSSFIVFAADVLMA  238

Query  445   WSNRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLT-  269
             WSN R+YA  H+V+MK  + +Y+VALFS+  G V++PEELVDD +PL++KPFD F++L  
Sbjct  239   WSNDRVYASEHQVIMKEEKTRYSVALFSYKNGIVQVPEELVDDKHPLRYKPFDQFDYLRF  298

Query  268   FCANGGGKEESPINAFCGV  212
             F      K + PI A+CG+
Sbjct  299   FQTEEAXKIKHPIKAYCGI  317



>ref|XP_006356185.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Solanum tuberosum]
Length=314

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/313 (39%), Positives = 190/313 (61%), Gaps = 7/313 (2%)
 Frame = -2

Query  1138  NPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHL  959
             N KLP I F+ ++++  T  W     +V + L EYGCF A +DK+   L+ ++F+  +  
Sbjct  5     NIKLPKINFSHEDLKPDTLEWNQVKSQVYKALVEYGCFEAFFDKIPINLQKSIFEVSQEF  64

Query  958   FQLPLETKRRNTSDIYGFGYAGNF-ASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTP  782
             F LPL+TK +N S     GY G +  S+PLAE  GI D   P     +++ +WP  +  P
Sbjct  65    FDLPLQTKLKNISTKPFSGYVGQYHPSIPLAESMGIIDSNIPHKVEKYTQLLWPQGN--P  122

Query  781   NFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKT  602
             +FC+   SY + + +LDQ + RM++ES G++KY D  + S +Y LR +KY+ P+ +ETK 
Sbjct  123   SFCKTIQSYLEQLSKLDQTIRRMIVESLGIEKYMDEHMNSINYSLRLMKYKEPQSDETKI  182

Query  601   GHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYA  422
             G   H D + + I+  NQ+  LE+ T+DG+WIN  P+     V I G++  AW+N R++A
Sbjct  183   GLHAHTDKNIVTILYQNQVKGLEILTKDGQWINVDPTPDTFTVMI-GDSLHAWTNGRMHA  241

Query  421   PVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTFC-ANGG  251
               HRVMM+G++ +Y++ LFS  +    ++ P+ELVD+D+PL FKPFD  EFL F      
Sbjct  242   TFHRVMMRGNKARYSIGLFSKPKDGYIIKAPKELVDEDHPLLFKPFDFHEFLAFGYTEQD  301

Query  250   GKEESPINAFCGV  212
              K +  + A+CGV
Sbjct  302   MKCDFSLKAYCGV  314



>ref|XP_010462135.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X2 [Camelina sativa]
Length=299

 Score =   237 bits (604),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 120/309 (39%), Positives = 180/309 (58%), Gaps = 24/309 (8%)
 Frame = -2

Query  1129  LPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQL  950
             LP+I+F+++ ++ G   W  TS +V++ L++YGCF A +D++  ELR  +F+  + LF L
Sbjct  12    LPVIDFSNEYLKPGEPEWDLTSADVQKALQDYGCFEASFDRIPIELRKLVFETLEELFDL  71

Query  949   PLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFCE  770
             PL+TK RN S     GY G +  +PL E  GI+D    E    F+K +WP  +N+     
Sbjct  72    PLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIEDPDVAERVNAFTKPLWPQGNNS-----  126

Query  769   DTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHIP  590
                              RM++ES+GLDKY D  +QS++YLLR +KY+ P   ETK G   
Sbjct  127   ---------------FRRMIMESFGLDKYIDEHLQSTNYLLRVMKYKGPDTEETKLGLNA  171

Query  589   HRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPVHR  410
             H D + + I+  N +  LE++T+D  WI  +PS    IV I G++  A  N R+++P HR
Sbjct  172   HTDKNIVTILYQNHVEGLEVQTKDNNWIKVKPSKDSFIVMI-GDSLHAMLNGRLHSPNHR  230

Query  409   VMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTF-CANGGGKEE  239
             VMM G+E +Y++ LFS  +    +  PEELVD ++P  FKPFDH EFL F     G + +
Sbjct  231   VMMTGTETRYSLGLFSIPKAGHIISSPEELVDQEHPRLFKPFDHVEFLQFYYTQAGQRSQ  290

Query  238   SPINAFCGV  212
             S +  +CG+
Sbjct  291   SALKTYCGI  299



>ref|XP_006348005.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Solanum 
tuberosum]
Length=315

 Score =   237 bits (605),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 124/316 (39%), Positives = 194/316 (61%), Gaps = 11/316 (3%)
 Frame = -2

Query  1141  TNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKH  962
             ++ K+PII  T   +   + SW     EVR  LEE+G F A+Y+  + ++   +F   + 
Sbjct  2     SDSKIPIINLT--KLDKYSNSWVPLCNEVRHALEEHGYFIALYEDANNKISKEIFDVMEE  59

Query  961   LFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTP  782
             LF LP+ETK++NTSDIY + Y G   + PL E FGI      E+  +F+  MWP  +   
Sbjct  60    LFDLPIETKKKNTSDIYFYRYKGQLVTAPLHESFGIPHPNDIEALQSFTTLMWPQGNQ--  117

Query  781   NFCEDTTSYSKLVWQLDQVVMRMVLESYGL-DKYFDPLIQSSSYLLRFIKYRM-PKWNET  608
              FCE  TSY K+  +++Q+V +MV ESYGL +++++  + +++YLLR  KYR  P   E 
Sbjct  118   RFCETMTSYIKVGAEIEQLVDKMVFESYGLPERHYESHVAATTYLLRPTKYRAAPAGAED  177

Query  607   KTGHIP---HRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSN  437
               G++    H D  F A++  NQI  L++ET+ G+WI      S   V++AG+A+ AWSN
Sbjct  178   GIGNVGSNIHTDKGFSAVLFQNQINALQIETKSGEWIPIDVPPS-AFVYVAGDAYEAWSN  236

Query  436   RRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCAN  257
              RIY+P H+V+MK  +++YT+ALF+F +G  +IPEELVD+ +PL++KPFD+F+ + + + 
Sbjct  237   GRIYSPRHKVLMKEDKERYTLALFTFNKGITDIPEELVDETHPLQYKPFDNFDLVMYYST  296

Query  256   GGGK-EESPINAFCGV  212
             G           +CG+
Sbjct  297   GASSMAHGTAKPYCGI  312



>ref|XP_004229768.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Solanum 
lycopersicum]
Length=315

 Score =   236 bits (603),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 127/317 (40%), Positives = 193/317 (61%), Gaps = 19/317 (6%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQ  953
             K+P I  T   +   + SW     EVR  LEE+G F A+Y+  + ++   +F   + LF 
Sbjct  5     KIPKINLT--KLDKHSNSWVPLCNEVRHALEEHGYFIALYEDANNKISKEIFDVMEELFD  62

Query  952   LPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFC  773
             LP+ETKR+NTSD+Y + Y G   + PL E FGI      E+  +F+  MWP  +    FC
Sbjct  63    LPIETKRKNTSDVYFYRYKGQLLTAPLHESFGIPHPTDVEALQSFTTLMWPQGNQ--RFC  120

Query  772   EDTTSYSKLVWQLDQVVMRMVLESYGL-DKYFDPLIQSSSYLLRFIKYRM-PKWNETKTG  599
             E  TSY K+  +++Q+V +MV ESYGL +K+++  + +++YLLR  KYR  P   E   G
Sbjct  121   ETMTSYIKVGAEIEQLVDKMVFESYGLPEKHYESHVAATTYLLRPTKYRAAPAGAEDGIG  180

Query  598   HIP---HRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRI  428
             ++    H D  F A++  NQI  L++ET+ G+WI      S   VF+AG+A+ AWSN RI
Sbjct  181   NVGSNIHTDKGFSAVLFQNQINALQIETKSGEWIPIDVPPS-AFVFVAGDAYEAWSNGRI  239

Query  427   YAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANGGG  248
             Y+P H+V+MK  + +YT+ALF+F +G  +IPEELVD+ +PL++KPFD+F+ + + + G  
Sbjct  240   YSPRHQVLMKEDKQRYTLALFTFNKGITDIPEELVDETHPLQYKPFDNFDLVMYYSTGA-  298

Query  247   KEESPI-----NAFCGV  212
                SP+       +CG+
Sbjct  299   ---SPMAYGTAKPYCGI  312



>ref|XP_008227259.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Prunus mume]
Length=315

 Score =   236 bits (603),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/316 (38%), Positives = 190/316 (60%), Gaps = 5/316 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T P LP I F+ ++++ G+ SW +T+ +VR  LEEYGCF A Y+++S EL +++F 
Sbjct  1     MGSQTKPTLPAINFSIEDLKPGSASWLSTAKQVRFALEEYGCFVAQYEQISGELLNSIFG  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               K LF++P E K +N  +    G+ G    +PL E   I +  +P+ T  F   MWP+ 
Sbjct  61    QAKDLFEVPKENKVKNVGEEPYRGHMGPNPLLPLYESLCIDNVTSPQETQKFKNLMWPEG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
                 NFCE T S+ +L+  L++ V +++ E YG+ K ++ +  S+ +LLRFIKY +P+  
Sbjct  121   KT--NFCETTDSFGQLLADLERTVEQLIFEGYGIGKQYESVGNSNGHLLRFIKYTVPEDK  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             +       H D +F  IV  ++I  LE++T++G WI+ + + S+  VF+AG+ F  WSN 
Sbjct  179   DATVRFPSHTDINFTTIVVQHEIPGLEVKTKEGDWIDVECAPSQ-FVFMAGDGFQVWSND  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANG  254
             R+ A  HRV   G++ +Y++ LF+F  G  ++PEELVD+ +PL + PFD   F+   A  
Sbjct  238   RVKACHHRVKHCGNKTRYSIGLFTFNNGIFQVPEELVDESHPLLYNPFDSRAFIRKYATT  297

Query  253   G--GKEESPINAFCGV  212
                 KE SPI AF GV
Sbjct  298   PELKKEPSPIKAFAGV  313



>gb|KHN14924.1| Gibberellin 20 oxidase 3 [Glycine soja]
Length=310

 Score =   236 bits (602),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/316 (37%), Positives = 187/316 (59%), Gaps = 8/316 (3%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T  KLPII+F+ + +   +  W +   +V + L EYGCF AV+DKV  +LR A+F 
Sbjct  1     MGSETELKLPIIDFSIEYLESNSDQWESVKSQVHKALVEYGCFEAVFDKVPLDLRKAIFL  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LPL+TK+R  S     GY G    + L E  GI D    +   +  K +WP  
Sbjct  61    EVEELFDLPLQTKQRVVSSKPYHGYVG---PLQLYESMGIDDVDVHDKVESLIKILWPQG  117

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
                P F ++  S+++ V +LDQ++ +M+LES G++KY D  + S++YL R IKY+ P+ N
Sbjct  118   K--PGFSKNLQSFTEQVTRLDQIIRKMILESLGIEKYMDEHMNSTNYLARLIKYQGPQTN  175

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             E K G   H D + +  +  NQI  LE++T+ G+WI  +PS+  + V + G+   AW+N 
Sbjct  176   EAKVGIGEHTDKNILTTLCQNQIDGLEVQTKSGEWIKCKPSTPSSFVVVTGDTLYAWTNG  235

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTFCA  260
             R++ P HRVMM G+E ++++ LF+  +    ++ P+ELV +++PL FKPF   EF+ F  
Sbjct  236   RVHTPAHRVMMSGNETRFSIGLFTVPKPGFIIKAPDELVTEEHPLLFKPFVQSEFMKFLR  295

Query  259   NGGGKEESPINAFCGV  212
             +    + + +  +CGV
Sbjct  296   SSESTKNA-LKVYCGV  310



>ref|XP_010500908.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X3 [Camelina sativa]
Length=299

 Score =   236 bits (601),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/309 (39%), Positives = 180/309 (58%), Gaps = 24/309 (8%)
 Frame = -2

Query  1129  LPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQL  950
             LP+I+F+++ ++ G   W  TS +V++ L++YGCF A +D++  ELR  +F+  + LF L
Sbjct  12    LPVIDFSNEYLKPGEPEWDLTSADVQKALQDYGCFEASFDRIPIELRKLVFETLEELFDL  71

Query  949   PLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFCE  770
             PL+TK RN S     GY G +  +PL E  GI+D    E    F+K +WP  +N+     
Sbjct  72    PLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIEDPDVAERVNAFTKPLWPQGNNS-----  126

Query  769   DTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHIP  590
                              RM++ES+GLDKY D  + S++YLLR +KY+ P   ETK G   
Sbjct  127   ---------------FRRMIMESFGLDKYIDEHLHSTNYLLRVMKYKEPDTEETKLGLNA  171

Query  589   HRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPVHR  410
             H D + + I+  N +  LE++T+D  WI  +PS    IV I G++  A  N R+++P HR
Sbjct  172   HTDKNIVTILYQNHVEGLEVQTKDNNWIKVKPSKDSFIVMI-GDSLHAMLNGRLHSPNHR  230

Query  409   VMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTF-CANGGGKEE  239
             VMM G+E +Y++ LFS  +    +  PEELVD+++P  FKPFDH EFL F     G + +
Sbjct  231   VMMTGTETRYSLGLFSIPKAGHIISSPEELVDEEHPRLFKPFDHVEFLQFYYTQAGQRSQ  290

Query  238   SPINAFCGV  212
             S +  +CG+
Sbjct  291   SALKTYCGI  299



>ref|XP_008227273.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Prunus mume]
Length=317

 Score =   235 bits (600),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 122/317 (38%), Positives = 189/317 (60%), Gaps = 5/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T+PKLP I F+ ++++ G+ SW +T+ +VR  LEEYG F A Y+++S +L + MF 
Sbjct  1     MGSLTSPKLPTINFSVEDLKPGSASWLSTAKQVRFALEEYGSFVAQYEQISAKLLNNMFG  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               K LF++P E K +N  +    G+ G    MPL E   I +  +P+ T  F   MWP+ 
Sbjct  61    QAKDLFEVPKENKVKNVGEEPYRGHMGPNPGMPLYESLCIDNVTSPQETQKFKNLMWPEG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
              +  NFCE T S+ +L+  L++ V +++ ESYG+ K ++ +  S+ +LLRFI+Y +P+  
Sbjct  121   KS--NFCETTDSFGQLLSNLERTVEQLLFESYGIGKQYESVGSSNGHLLRFIRYTVPEDK  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKT-IVFIAGEAFMAWSN  437
             +       H D +F  IV  + +  LE+ T++G WIN +   S+   VF+AG+    WSN
Sbjct  179   DATVRFPSHTDINFTTIVVQHDVAGLEVRTKEGDWINVECKPSQVQFVFMAGDGLQVWSN  238

Query  436   RRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCAN  257
              R+ A  HRV   G++ +Y++ LF+F  G V++PEELVD+ +PL + PFD   F+   A 
Sbjct  239   DRVKACHHRVKHCGNKTRYSIGLFTFNNGIVQVPEELVDESHPLLYNPFDSRAFIRKYAA  298

Query  256   GG--GKEESPINAFCGV  212
                  KE SPI AF GV
Sbjct  299   TPELKKEPSPIKAFAGV  315



>ref|XP_003554143.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Glycine max]
Length=310

 Score =   235 bits (599),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 116/316 (37%), Positives = 187/316 (59%), Gaps = 8/316 (3%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T  KLPII+F+ + +   +  W +   +V + L EYGCF AV+DKV  +LR A+F 
Sbjct  1     MGSETELKLPIIDFSIEYLESNSDQWESVKSQVHKALVEYGCFEAVFDKVPLDLRKAIFL  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LPL+TK+R  S     GY G    + L E  GI D    +   +  K +WP  
Sbjct  61    EVEELFDLPLQTKQRVVSSKPYHGYVG---PLQLYESMGIDDVDVHDKVESLIKILWPQG  117

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
                P F ++  S+++ V +LDQ++ +M+LES G++KY D  + S++YL R +KY+ P+ N
Sbjct  118   K--PGFSKNLQSFTEQVTRLDQIIRKMILESLGIEKYMDEHMNSTNYLARLMKYQGPQTN  175

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             E K G   H D + +  +  NQI  LE++T+ G+WI  +PS+  + V + G+   AW+N 
Sbjct  176   EAKVGIREHTDKNILTTLCQNQIDGLEVQTKSGEWIKCKPSTPNSFVVVTGDTLYAWTNG  235

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTFCA  260
             R++ P HRVMM G+E ++++ LF+  +    ++ P+ELV +++PL FKPF   EF+ F  
Sbjct  236   RVHTPAHRVMMSGNETRFSIGLFTVPKPGFIIKAPDELVTEEHPLLFKPFVQSEFMKFLR  295

Query  259   NGGGKEESPINAFCGV  212
             +    + + +  +CGV
Sbjct  296   SSESTKNA-LKVYCGV  310



>ref|XP_002515914.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
 gb|EEF46334.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
Length=314

 Score =   234 bits (598),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 124/317 (39%), Positives = 187/317 (59%), Gaps = 6/317 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T  KLP I+F+   ++ G   W T   +VR+  EEYGCF A++  +S ELR AM  
Sbjct  1     MGSETTFKLPAIDFSSTELKPGNPLWETVKSQVRKAAEEYGCFEALFQDISQELRKAMDG  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + +F LPLE K+ N SD    GY G+ + + L E  G  D        +F+  MWP  
Sbjct  61    ALEEIFALPLEIKKLNVSDRPFHGYIGSSSPLSLYESIGFDDPDNFHKVESFTNIMWPQG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +   NF     S+SK + +LDQ++ +M++ES+G++KY D  + S+  + R  KY  P+  
Sbjct  121   N--INFSTTVHSFSKTLTELDQMIRKMIVESFGMEKYLDEHMNSAYNIFRVTKYAAPETT  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             + KTG   H D +  +I+  NQI  LE++T+DG+WIN + S    IV I GE+  AW+N 
Sbjct  179   DKKTGLRAHTDKNTTSILYQNQIDGLEIQTKDGEWINVEFSPYSFIVII-GESLNAWTNG  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTF-C  263
             R+++P HRVMM GS+ +Y+  LF+  +    ++  EELVDD++PL+FKPF++ E+L    
Sbjct  238   RLHSPCHRVMMSGSKTRYSAVLFTVPKEGYVIKAVEELVDDEHPLQFKPFEYLEYLKLRY  297

Query  262   ANGGGKEESPINAFCGV  212
             A  G   ESP+ A+ G 
Sbjct  298   AEVGKNFESPLKAYFGA  314



>ref|XP_010110319.1| Protein SRG1 [Morus notabilis]
 gb|EXC25839.1| Protein SRG1 [Morus notabilis]
Length=313

 Score =   234 bits (598),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 114/316 (36%), Positives = 190/316 (60%), Gaps = 5/316 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M +    K+P+I F +++++ G+ SW +   +VR G EEYGC   V D+  +EL +++F 
Sbjct  1     MGSLAEQKIPVINFKEEHLKPGSDSWISALKQVRYGFEEYGCLEIVCDQFPFELHNSIFD  60

Query  973   HCKHLFQLPLETKRRNTSDIYG-FGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPD  797
               + +F LP ETK + TS   G  GY      +PL E   +    T E    F+  MWP 
Sbjct  61    AAEDVFNLPKETKMQKTSTRPGKIGYIAGLPELPLYESIALDSATTLEEVEYFTNIMWPA  120

Query  796   ADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMP-K  620
              +N+  F +   S+SK +  L ++V RMV E+YG++  F+   +   Y+ RF KY+ P +
Sbjct  121   GNNS--FRDSVHSFSKRIEVLHEMVTRMVFENYGVEGLFNSFWEKRFYVCRFFKYKAPHQ  178

Query  619   WNETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWS  440
              NE++ G   H D++F++I+  +Q+  L+++T+DG+WI+ +P  S   V IAG+    WS
Sbjct  179   TNESEVGIGAHTDSTFLSILHQHQVKGLQIKTKDGQWIDVKPKPSSLFV-IAGDVLKVWS  237

Query  439   NRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCA  260
             N R+ +  H+VM+   + +Y+  LF+F++G +++PEEL+DD+ PL++KPFDH E+  +  
Sbjct  238   NDRVRSCEHQVMVSEDKIRYSAGLFTFIKGVMQVPEELIDDEYPLRYKPFDHAEYNRYLL  297

Query  259   NGGGKEESPINAFCGV  212
             +    +  PINAFCG+
Sbjct  298   SEDRDKNCPINAFCGI  313



>ref|XP_003553391.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Glycine 
max]
 gb|KHN14923.1| Gibberellin 20 oxidase 3 [Glycine soja]
Length=320

 Score =   234 bits (598),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 133/319 (42%), Positives = 189/319 (59%), Gaps = 8/319 (3%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T  +L +++FTD+NM+ GT +W +    VR  LE  G F A YDKV  EL D++  
Sbjct  1     MGSQTQSQLHVVDFTDENMKPGTDAWLSACSVVRTELENNGFFMARYDKVGKELCDSVVF  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               +  F LP+ETK + TSD    GY G  + +PL E  GI D +T +    F+  MWP+ 
Sbjct  61    AVEEFFGLPVETKAQKTSDKPFHGYLGQVSWLPLYESVGIDDPLTLQGCQKFAHIMWPEG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLD-KYFDPLIQSSSYLLRFIKYRMPKW  617
             +    FCE    Y+KL+ +LD +  RMV ESYG+D +  D  I+S+ YLLR +KYR P+ 
Sbjct  121   NG--RFCESINEYAKLLGELDHMAKRMVFESYGVDMQRCDSFIESNDYLLRCMKYRTPQM  178

Query  616   NETKTGHIPHRDNSFMAIV-DTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWS  440
             +E   G  PH D +  +IV   N +  LE++ +DG+W     S S  +V +AG+AF  WS
Sbjct  179   DENDLGLQPHSDLTITSIVHQLNNLNGLEIKLKDGEWKEIDASPSLFVV-MAGDAFNVWS  237

Query  439   NRRIYAPVHRVMMKGSEDKYTVALFSF-LRGTVEIPEELVDDDNPLKFKP-FDHFEFLTF  266
             N RI    HRV M G + +Y++ LFSF     + IP+ELV+D +PL++KP FDH+E+L F
Sbjct  238   NGRIRPCEHRVTMNGKKSRYSMGLFSFGGNKMMRIPDELVNDQHPLRYKPIFDHYEYLRF  297

Query  265   CANGGGKEE-SPINAFCGV  212
                   KE  S I A+CG+
Sbjct  298   YDKEKIKEPYSRIQAYCGI  316



>gb|KHN06108.1| Gibberellin 3-beta-dioxygenase 3 [Glycine soja]
Length=313

 Score =   233 bits (594),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 118/299 (39%), Positives = 184/299 (62%), Gaps = 8/299 (3%)
 Frame = -2

Query  1153  MATHT--NPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAM  980
             MAT T     LP+++F ++NM+ GT +W      VRRG E+YGCF A + KV  EL +++
Sbjct  1     MATQTLCESPLPVVDFINENMKPGTDTWLGACQLVRRGFEDYGCFLARFSKVGPELLNSV  60

Query  979   FKHCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWP  800
             +   + LF LPLETKRR TSD    GY G   + PL E F I +  + E    F++ MWP
Sbjct  61    YYAMEELFSLPLETKRRKTSDKPNHGYTGQVPTSPLFESFAIDNPSSIEDCQKFARIMWP  120

Query  799   DADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKY-FDPLIQSSSYLLRFIKYRMP  623
               ++  + CE    Y+K++ +LDQ V RMV +SYGLDK   +  ++S++Y  R  KY++P
Sbjct  121   TGND--HLCESVNEYTKMLKELDQTVKRMVFDSYGLDKLKCESFLESTNYAFRSYKYKIP  178

Query  622   KWNETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAW  443
               +E+  G   H D++F+ I+   ++  LE++ +DG+W  F   +S     +AG+AFM W
Sbjct  179   ATDESSVGVNSHTDSTFITILH-QRVDGLEVKLKDGEW--FGVDASPLFCVMAGDAFMVW  235

Query  442   SNRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTF  266
             S+ RI A  HRV++K    +Y++ L S+    V+  E+LVD+D+P+++KPFDH+ ++ F
Sbjct  236   SSERIRACEHRVILKAKVTRYSLGLLSYSSKMVQTLEDLVDEDHPIRYKPFDHYAYVGF  294



>ref|XP_009395077.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Musa acuminata subsp. malaccensis]
Length=320

 Score =   233 bits (594),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 126/301 (42%), Positives = 180/301 (60%), Gaps = 9/301 (3%)
 Frame = -2

Query  1123  IIEFTDDNMR-VGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQLP  947
             +I+F+  +M   GT +W     +V   LE +GCF AVY++V+ ELR ++    K L  LP
Sbjct  1     MIDFSGVSMACAGTPAWDAVQEQVMPALEFHGCFEAVYNRVASELRLSLLGIAKDLLSLP  60

Query  946   LETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFCED  767
             L+TK RNTSD    GY G F  +   E   I+D   P +  NF+  MWP   N PNFCE 
Sbjct  61    LQTKLRNTSDAPYGGYLGQFPGLAY-ESLAIRDATLPHAIPNFASLMWPSGSN-PNFCEK  118

Query  766   TTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMP-KWNET--KTGH  596
               S+++ V +L+++V RMVLES G+ KY +  +QS+ YLLRF +Y    +W E   K  H
Sbjct  119   ARSFTEQVAELEEMVRRMVLESLGVAKYAEEQMQSTYYLLRFTEYGAAGEWEEEKRKLAH  178

Query  595   IPHRDNSFMAIV-DTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAP  419
             + HRD + ++IV   N++  L++E  DG+W    P S  +   IAGEAF AWSN R+YA 
Sbjct  179   MAHRDTNMLSIVCQLNEVDGLQVEAMDGEWHLAAPRSVASFFVIAGEAFHAWSNGRVYAS  238

Query  418   VHRVMMKGSEDKYTVALFS--FLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANGGGK  245
             +H V M G+  +Y+  LFS      T++ P ELVD D P  F+PF++ +FL FCA+  G+
Sbjct  239   MHGVAMDGTVARYSAILFSRPMSEQTIQAPAELVDGDRPSLFRPFEYGDFLHFCASAEGR  298

Query  244   E  242
             +
Sbjct  299   K  299



>ref|XP_010061958.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Eucalyptus grandis]
Length=310

 Score =   233 bits (593),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 124/312 (40%), Positives = 182/312 (58%), Gaps = 10/312 (3%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQ  953
             ++P+I F+ ++M   T SW     E+ + LE +GCF A Y+    E RD +F   K LF 
Sbjct  4     EVPVIVFSQESMEPATKSWTRACDEIVQALEHHGCFVAEYEDFPGEFRDPIFGVAKELFD  63

Query  952   LPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFC  773
             LP ETK R+ S  Y  GY       PL E   I      E+   F+  MWP  +    FC
Sbjct  64    LPQETKVRSPSSAYSNGYIAKCPGTPLLEGLNIDGAEKLEAFEKFTALMWPSGN--ARFC  121

Query  772   EDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHI  593
             +   SY+K + ++++VV RMV E YG+ KY +   +S++YLLR +KY+ P  +E     I
Sbjct  122   KTAHSYAKEIAKVEKVVTRMVFEGYGVGKYCNSHFESTTYLLRILKYKKPGEDEGNINPI  181

Query  592   PHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPVH  413
              H D +F++I+  N +  LE+ T+DG+W+ FQPS S  +V +AG+A M WSN RI A  H
Sbjct  182   AHTDKTFLSILYPNDVRGLEVMTKDGEWVVFQPSPSSFMV-MAGDACMGWSNGRIKACYH  240

Query  412   RVMMKGSED---KYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFC--ANGGG  248
             R  ++  ED   +Y + +FS+  GT+EIP+EL+D D+P +FK F+H +FL F   + G  
Sbjct  241   RTNVR--EDGSVRYALGVFSYNTGTIEIPKELIDQDHPQQFKSFNHLDFLRFYDKSQGRT  298

Query  247   KEESPINAFCGV  212
             K +  I A+CGV
Sbjct  299   KSQCLIKAYCGV  310



>ref|XP_007214111.1| hypothetical protein PRUPE_ppa017120mg [Prunus persica]
 gb|EMJ15310.1| hypothetical protein PRUPE_ppa017120mg [Prunus persica]
Length=296

 Score =   232 bits (591),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 113/294 (38%), Positives = 182/294 (62%), Gaps = 3/294 (1%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T P LP I F+ ++++ G+ SW +T+ +VR GLEEYGCF A Y+++S EL +++F 
Sbjct  1     MGSQTKPTLPTINFSIEDLKPGSASWLSTAKQVRFGLEEYGCFVAQYEQISGELLNSIFG  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               K LF++P E K +N  +    G+ G    +PL E   I +  +P+ T  F   MWP+ 
Sbjct  61    QAKDLFEVPKENKVKNVGEEPYRGHMGPNPLLPLYESLCIDNVTSPQETQKFKNLMWPEG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
                 NFCE T S+ +L+  L++ V +++ ESYG+ K ++ +  S+ +LLRFIKY +P+ N
Sbjct  121   KT--NFCETTDSFGQLLADLERTVEQLIFESYGIGKQYESVGSSNGHLLRFIKYTVPEDN  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             +T      H D +F  IV  + I  LE++T++G WI+ + + S+  VF+AG+    WSN 
Sbjct  179   DTTLRFPSHTDINFTTIVVQHDIPGLEVKTKEGDWIDVECAPSQ-FVFMAGDGLQVWSND  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFL  272
             R+ A  HRV   G++ +Y++ LF+F  G  ++P+ELVD+ +PL + PFD  + L
Sbjct  238   RVKACHHRVKHCGNKTRYSIGLFTFNNGIFQVPQELVDESHPLLYNPFDSHKLL  291



>ref|XP_010061956.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Eucalyptus grandis]
 gb|KCW69002.1| hypothetical protein EUGRSUZ_F02562 [Eucalyptus grandis]
Length=313

 Score =   232 bits (592),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 121/311 (39%), Positives = 189/311 (61%), Gaps = 8/311 (3%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQ  953
             ++P+I F+++  + GT+SW      + + LE++GCF   +  V   L D+ F   + L  
Sbjct  4     QIPVITFSEECTKPGTSSWEKACKVIVQALEDHGCFIVEHPNVPLGLHDSAFSVTEDLLD  63

Query  952   LPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTP-ESTMNFSKQMWPDADNTPNF  776
             LP ETK +NT+     GY       PL E   I DGV   E    F+  MWP  ++  +F
Sbjct  64    LPHETKIKNTNLKPSHGYIAKVPGTPLLEGMNI-DGVEKLEECEKFTSLMWPSGND--HF  120

Query  775   CEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGH  596
             C+    Y KL+ ++++VV RMV ESYG++K +DP I+S +YLLRF+KY+ P   +T    
Sbjct  121   CKTVHDYGKLMVEIEKVVFRMVCESYGVEKCYDPYIKSCTYLLRFLKYKKPADLDTSVNP  180

Query  595   IPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPV  416
             + H D SF++ +  N I  LE+ T+DG+W  F+PS+S T + +AG+A +AWSN RI A  
Sbjct  181   VAHTDKSFLSYLHQNNIRGLEVRTKDGEWFAFEPSAS-TFMVMAGDACVAWSNGRIKACY  239

Query  415   HRVMMK-GSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTF--CANGGGK  245
             HRV+++  ++ +Y +  FS++ G +E P+E +D+ +P ++KPF+H +FL +   +NG  K
Sbjct  240   HRVLVREQNQVRYCLGTFSYVPGMIETPKEFIDEAHPQQYKPFNHIDFLRYYDSSNGPIK  299

Query  244   EESPINAFCGV  212
              ES I  FCGV
Sbjct  300   AESLIKTFCGV  310



>ref|XP_003553825.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Glycine max]
Length=313

 Score =   231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/299 (39%), Positives = 184/299 (62%), Gaps = 8/299 (3%)
 Frame = -2

Query  1153  MATHT--NPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAM  980
             MAT T     LP+++F ++NM+ GT +W      VRRG E+YGCF A + KV  EL +++
Sbjct  1     MATQTLCESPLPVVDFINENMKPGTDTWLGACQLVRRGFEDYGCFLARFSKVGPELLNSV  60

Query  979   FKHCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWP  800
             +   + LF LPLETKRR TSD    GY G   + PL E F I +  + E    F++ MWP
Sbjct  61    YYAMEELFSLPLETKRRKTSDKPNHGYTGQVPTSPLFESFAIDNPSSIEDCQKFARIMWP  120

Query  799   DADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKY-FDPLIQSSSYLLRFIKYRMP  623
               ++  + CE    Y+K++ +LDQ V RMV +SYGLDK   +  ++S++Y  R  KY++P
Sbjct  121   TGND--HLCESVNEYTKMLKELDQTVKRMVFDSYGLDKLKCESFLESTNYAFRSYKYKIP  178

Query  622   KWNETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAW  443
               +E+  G   H D++F+ I+   ++  LE++ +DG+W  F   +S     +AG+AFM W
Sbjct  179   ATDESSVGVNSHTDSTFITILH-QRVDGLEVKLKDGEW--FGVDASPLFCVMAGDAFMVW  235

Query  442   SNRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTF  266
             S+ RI A  HRV++K    +Y++ L S+    V+  E+LVD+++P+++KPFDH+ ++ F
Sbjct  236   SSERIRACEHRVILKSKVTRYSLGLLSYSSKMVQTLEDLVDEEHPIRYKPFDHYAYVGF  294



>ref|XP_007145555.1| hypothetical protein PHAVU_007G248500g [Phaseolus vulgaris]
 gb|ESW17549.1| hypothetical protein PHAVU_007G248500g [Phaseolus vulgaris]
Length=309

 Score =   231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/308 (38%), Positives = 186/308 (60%), Gaps = 7/308 (2%)
 Frame = -2

Query  1129  LPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQL  950
             LP+++F+ +NM+ GT +W      VRRG E++GCF A ++KV+ +L +++F   + LF L
Sbjct  7     LPVVDFSTENMKPGTDTWLAACQMVRRGFEDHGCFLANFNKVTPKLLNSLFSAMEQLFGL  66

Query  949   PLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFCE  770
             P+ETKRR TSD    GY G   + PL E F I +    +    FS+ MWP  ++    CE
Sbjct  67    PVETKRRKTSDKPNHGYTGQVPTSPLFESFAIHNPSNIQDCQKFSRVMWPTGNH--QLCE  124

Query  769   DTTSYSKLVWQLDQVVMRMVLESYGLDKY-FDPLIQSSSYLLRFIKYRMPKWNETKTGHI  593
                 Y+KL+ +LDQ V RMV +SYGLDK   +  ++S+ Y  R  KY++P  +E+  G  
Sbjct  125   SVNEYAKLLQELDQSVKRMVFDSYGLDKVKCEMFLESTDYSFRSYKYKIPAVDESNVGVN  184

Query  592   PHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPVH  413
              H D++F+ I+   ++  LE++ +DG+W  F   +S     IAG+AFM WS+ RI A  H
Sbjct  185   SHTDSTFITILH-QRVDGLEVQLKDGEW--FGIDASPLFCVIAGDAFMVWSSERIRACEH  241

Query  412   RVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTF-CANGGGKEES  236
             RV++     +Y++ L S+    V+  E+LVD+++P+++KPFDH+ ++ F       K  S
Sbjct  242   RVILNSKVTRYSLGLLSYSTKMVQTLEDLVDEEHPIRYKPFDHYSYVGFRFTEEAVKCTS  301

Query  235   PINAFCGV  212
              I A+CG+
Sbjct  302   RIKAYCGI  309



>ref|XP_002517543.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
 gb|EEF44707.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
Length=322

 Score =   231 bits (590),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/298 (40%), Positives = 179/298 (60%), Gaps = 7/298 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFT--DDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAM  980
             M+  T   +P+I+F+  D N    T  W +   +V + LEE+GCF A  +K+S ELR A+
Sbjct  1     MSPKTYLAVPVIDFSRLDLNPDNNTEEWESVRTQVVKALEEHGCFKASSNKISLELRQAI  60

Query  979   FKHCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWP  800
                 + LF LPLE K RNTS++   GY G     PL E  GI D +T E+  + +  +WP
Sbjct  61    LSDLEELFALPLENKMRNTSELPNCGYIGKSPFTPLHESLGIIDPITLENVESLTNVLWP  120

Query  799   DADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPK  620
                  P+F E+  SYSK + ++++++ RM+LE+ G+DKY D  + S++  LR ++Y  P 
Sbjct  121   GGK--PSFSENIQSYSKQILEVEKIIRRMILENLGVDKYLDEHMNSTASSLRVMRYEAPN  178

Query  619   WNETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWS  440
               ET+ G   H D   +AI+  NQI  LE+ET++G+W N +      +V I GE+F AW 
Sbjct  179   TTETQLGLAAHTDQGIIAILYQNQIDGLEVETKNGEWANIKLEPDHFLV-IFGESFNAWV  237

Query  439   NRRIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFL  272
             N R+YAP HRV M G+E +Y+   FS  +    ++ PEELVD+++PL+++PFD  E L
Sbjct  238   NGRLYAPFHRVTMIGNEVRYSFGTFSAFKPGYLIKAPEELVDEEHPLQYRPFDFIEVL  295



>ref|XP_010041295.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Eucalyptus grandis]
Length=316

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/291 (39%), Positives = 172/291 (59%), Gaps = 5/291 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTD-DNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMF  977
             M +    +LP I+F+   +   G+  W +    VRR LEEYGCF A+YDKV+ EL D +F
Sbjct  1     MGSGPALELPSIDFSGLGDSEPGSGGWDSVQDAVRRALEEYGCFLALYDKVTVELHDEVF  60

Query  976   KHCKHLFQLPLETKRRNTSDIYGF-GYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWP  800
                + +F LP ETKR+       + GY  N    PL E  G++D +   +    +  +WP
Sbjct  61    HQMEEMFGLPAETKRQFVDPTRPYDGYLANLPLNPLHEAMGMRDALNSGAIERLAGLLWP  120

Query  799   DADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPK  620
             + +    FCE   +Y + + +LD  + +MV  S+G+++Y D    S+ + LR ++Y  P+
Sbjct  121   EGN--AKFCELLNTYLRRLSELDYTIQKMVFRSFGVERYLDSHTASTLHALRLLRYGAPE  178

Query  619   WNETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWS  440
               E + G I H D +F+ ++  N +  LE+ET+ G WI  +PS+S TIV + GE+F  WS
Sbjct  179   TEEARPGGITHYDTTFVTMLQQNHVNGLEVETKHGDWIKVRPSASSTIVML-GESFHGWS  237

Query  439   NRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFD  287
             N R+Y P HRVMM+G E + ++ +FS + GTV  P+ELVD+ +PL FKPFD
Sbjct  238   NGRLYCPRHRVMMRGHEARLSIGIFSGVEGTVRCPDELVDEQHPLLFKPFD  288



>ref|XP_009621185.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Nicotiana tomentosiformis]
Length=321

 Score =   231 bits (588),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 126/313 (40%), Positives = 189/313 (60%), Gaps = 11/313 (4%)
 Frame = -2

Query  1132  KLPIIEFTD-DNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLF  956
             K PII+    +  + G+ SW      VR  LE++G F A+YDKVS E+   +F     LF
Sbjct  7     KAPIIDLNKLEKSKRGSNSWLELCNGVRLALEDHGYFIALYDKVSSEVEKEIFDVMDELF  66

Query  955   QLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNF  776
              LP+ETK++N+SD Y + + G   + PL E FGI      ++  +F+  MWP  +    F
Sbjct  67    DLPIETKKKNSSDFYFYRWVGQLEAAPLHESFGIVYPTHIQALQSFTTLMWPQGNQ--RF  124

Query  775   CEDTTSYSKLVWQLDQVVMRMVLESYGL-DKYFDPLIQSSSYLLRFIKYRMPK-WNETKT  602
              E  TSY K+  +L+Q+V +MV ESYG+ +++++  I +++YLLR  KY  P   N    
Sbjct  125   SETVTSYVKVAAELEQLVDKMVFESYGVAERHYESHIAATTYLLRPTKYAAPPPSNINNV  184

Query  601   GHIPHRDNSFMAIVDTNQIGCLEMETRDGKWI--NFQPSSSKTIVFIAGEAFMAWSNRRI  428
             G   H D SF  ++  NQI  L++E++ G WI  N  PS+    VF+AG+A+ AWSN RI
Sbjct  185   GANIHTDKSFSTLLFQNQINGLQVESKSGDWIAVNVPPSA---FVFMAGDAYEAWSNGRI  241

Query  427   YAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANGGG  248
             YAP H+V++K  + +YT+ALF+F +G  +IPEELVD+ +PL++KPFD+F    +  +G  
Sbjct  242   YAPRHQVLLKEEKQRYTLALFTFNKGITDIPEELVDETHPLQYKPFDNFGLAWYYLSGAN  301

Query  247   KE-ESPINAFCGV  212
                 S   A+CG+
Sbjct  302   SMIHSTAKAYCGI  314



>ref|XP_010032029.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Eucalyptus grandis]
 gb|KCW51414.1| hypothetical protein EUGRSUZ_J00951 [Eucalyptus grandis]
Length=313

 Score =   230 bits (587),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 118/310 (38%), Positives = 183/310 (59%), Gaps = 6/310 (2%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQ  953
             ++P+I F+++  + GT+SW      + + LE++GCF   +  V   L D +F   + LF 
Sbjct  4     QIPVIVFSEECTKPGTSSWEKACKVIVQALEDHGCFIVDHPNVPLGLHDTVFSVAEDLFD  63

Query  952   LPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFC  773
             LP ETK +NT+     GY       PL E   I      E    F+  MWP  ++  +FC
Sbjct  64    LPHETKIKNTNFKPSHGYIAKVPGTPLLEGMNIDGAEKLEECEKFTSIMWPSGND--HFC  121

Query  772   EDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHI  593
             +    YSK + ++++VV RMV ESYG++K FDP I+S +YLLRF+KY+ P   +     I
Sbjct  122   KTVHDYSKFIAEIEKVVFRMVCESYGVEKCFDPYIESCTYLLRFLKYKKPADLDANVNPI  181

Query  592   PHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPVH  413
              H D SF++ +  N I  LE+ T+DG+W  F+P S+ T + +AG+A +AWSN RI A  H
Sbjct  182   AHTDKSFLSYLHQNNIRGLEVRTKDGEWFTFEP-SALTFMVMAGDACVAWSNGRIKACYH  240

Query  412   RVMMK-GSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTF--CANGGGKE  242
             RV ++  S+ +Y++  FS++ G +E PEE +D  +P ++KPF+H +FL +   ++   K 
Sbjct  241   RVAVREESQVRYSLGTFSYISGMIETPEEFIDKAHPRQYKPFNHIDFLCYYDSSDNRIKA  300

Query  241   ESPINAFCGV  212
             ES I  +CGV
Sbjct  301   ESLIKTYCGV  310



>ref|XP_008382989.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Malus domestica]
Length=316

 Score =   230 bits (587),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 118/315 (37%), Positives = 189/315 (60%), Gaps = 4/315 (1%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M +   PKLP I F+   ++ G++SW +T+ +VR  LEEYG F A YD++S EL++ +F 
Sbjct  1     MGSLAPPKLPTINFSAQGLKPGSSSWLSTAKQVRYALEEYGSFVAQYDQISPELQNNIFG  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
                 LF++P+E K +N  +    GY G    MPL E   I +  +P++T  F   MWP  
Sbjct  61    QAADLFEVPVENKVKNVGEQPYRGYIGPNPFMPLYESLCIDNVTSPQATHKFKNLMWPAG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
                 NFCE T S+ +L+  L++ V +M+ +S+G+   ++ +   +S+LLRFIKY++P+  
Sbjct  121   KK--NFCETTDSFGQLLGDLERTVGQMLFDSFGVGNEYECVANCNSHLLRFIKYKVPEDT  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             +T      H DNSF  IV  + +  LE++T++G WIN +   S+  +F+A +    WSN 
Sbjct  179   DTTLRFPMHTDNSFTTIVVQHDVSGLEVKTKEGDWINIESVPSQ-FLFMAADGLQMWSND  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANG  254
             RI A  HRV   G++ +Y++ LF+F  G +++P+ELVDD++PL + P D   +  F A+ 
Sbjct  238   RIKACQHRVKHCGNKTRYSLGLFTFNNGVLQVPKELVDDEHPLLYNPCDGRGYTRFHASA  297

Query  253   GGKE-ESPINAFCGV  212
               K+  S I A+CG+
Sbjct  298   ESKKAASRIKAYCGI  312



>ref|XP_004301787.1| PREDICTED: gibberellin 3-beta-dioxygenase 4-like [Fragaria vesca 
subsp. vesca]
Length=344

 Score =   231 bits (589),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 127/320 (40%), Positives = 189/320 (59%), Gaps = 11/320 (3%)
 Frame = -2

Query  1153  MATHTNPK-LPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMF  977
             M + T PK LP I+F+  +++ G++SW  T  +VR  LEEYGCF A+Y +VS +L D +F
Sbjct  1     MGSMTLPKELPTIDFSLQDLKPGSSSWTKTCKQVRYALEEYGCFVALYQQVSPQLIDNIF  60

Query  976   KHCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPD  797
              H K LF+LPLETK +NTS     GY G    MP  E  GI++  +P++T  F   MWP+
Sbjct  61    GHSKDLFELPLETKVKNTSKEPYRGYIGPIPLMPHYEGMGIENVTSPQATQKFKDLMWPN  120

Query  796   ADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDK-YFDPLIQSSSYLLRFIKYRMPK  620
                   FCE T  ++KLV  L+  V +M+ ES+G+ K  ++ L  S+S+L+RF+KY  P+
Sbjct  121   GKT--EFCETTDLFAKLVGDLEHTVEKMMFESFGIPKGQYESLASSNSHLIRFLKYMTPE  178

Query  619   WNETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWS  440
               +       H D +F  IV  + +G LE++T+DG WI+ + + S+  +F+AG+    WS
Sbjct  179   ERDAVERFPSHTDKNFTTIVAQHDVGGLEVQTKDGDWISVESAPSQ-FLFMAGDGLQVWS  237

Query  439   NRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPL----KFKPFDHFEFL  272
             N R+ A  HRV     + +Y++A+F+F  G  ++P+ELVDD +PL    +         L
Sbjct  238   NGRVKASHHRVKHCEDKTRYSLAMFTFNNGVFQVPKELVDDSHPLVCIKEEAKKAESPLL  297

Query  271   TFCANGGGKEESPINAFCGV  212
              FC  G    ESP+  FCGV
Sbjct  298   LFC--GVDNSESPLLLFCGV  315



>ref|XP_008390710.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Malus domestica]
Length=316

 Score =   230 bits (586),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 116/315 (37%), Positives = 188/315 (60%), Gaps = 4/315 (1%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M +   P+LP I F+ ++++ G++SW +T+ +VR  LEEYG F A YD++S EL + +F 
Sbjct  1     MGSLAPPQLPTINFSAEDLKPGSSSWLSTAKQVRCALEEYGSFVAXYDQISPELHNNIFG  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
                 LF++PLE K +N  +    GY G   ++PL E   I +  +P++T  F   MWP  
Sbjct  61    QAADLFEVPLENKVKNVGEQPYHGYMGPNPAIPLYESLCIDNVTSPQATHKFKNLMWPAG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
                 NF E T S+ +L+  LD+ V +M+ +S+G+   ++ +   +S+LLRFIKY++P+  
Sbjct  121   KK--NFSETTDSFGQLLADLDRTVGQMIFDSFGVGNEYESVACCNSHLLRFIKYKVPEDP  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             +       H DN+F  IV  + +  LE++T++G WIN + S     +F+A E    WSN 
Sbjct  179   DITLRFPMHTDNNFTTIVVQHDVSGLEVKTKEGDWINIE-SVPSHFLFMAAEGLQVWSND  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANG  254
             RI A  HRV  +G + +Y++ LF+F  G +++P+ELVDD++PL + P D   +  F A+ 
Sbjct  238   RIKACQHRVKHRGDKTRYSLGLFTFNNGVIQVPKELVDDEHPLLYNPCDSRGYTRFHASA  297

Query  253   GGKE-ESPINAFCGV  212
               K+  S I A+CG+
Sbjct  298   ESKKAASRIKAYCGI  312



>ref|XP_010050517.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Eucalyptus 
grandis]
Length=316

 Score =   229 bits (585),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 117/292 (40%), Positives = 173/292 (59%), Gaps = 5/292 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTD-DNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMF  977
             M + +  KLP+I+ ++ D  + GT  W +   +VR  LEE+GCF A+ D+++ EL + +F
Sbjct  1     MDSISTLKLPLIDLSELDGSKPGTVQWDSLQSQVREALEEFGCFEALTDRMTLELHNDVF  60

Query  976   KHCKHLFQLPLETKRRNTSDIYGF-GYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWP  800
             +  + L +LP + KRR +     + GY GN    PL E FGI       S   F+  +WP
Sbjct  61    QEMEALLELPTDVKRRFSDPNKPYDGYRGNLPHSPLYEAFGINYAPNSGSIEGFANLIWP  120

Query  799   DADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPK  620
             + +    FCE   +Y   V +LD +V ++VL S G+DKY + L +S  Y LR I+Y  P 
Sbjct  121   EGNT--RFCETMKTYVTRVLELDSLVKKLVLGSLGVDKYLESLAKSVGYNLRLIRYAAPG  178

Query  619   WNETKT-GHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAW  443
               E+K  G   HRD +F+ I+  N +  LE++T+DG W     SS+ + +  AGE+F  W
Sbjct  179   TKESKKLGAWCHRDANFVTILHHNHVKGLEVQTKDGCWFEVASSSATSFIVFAGESFYGW  238

Query  442   SNRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFD  287
             SN R+Y+P HRVMM G E +Y +  FS  +GT++ P+ELVDD +PL FKPFD
Sbjct  239   SNGRLYSPCHRVMMSGHEARYCIGFFSNGQGTMQCPDELVDDQHPLLFKPFD  290



>emb|CDP21163.1| unnamed protein product [Coffea canephora]
Length=268

 Score =   228 bits (581),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 115/273 (42%), Positives = 174/273 (64%), Gaps = 9/273 (3%)
 Frame = -2

Query  1021  AVYDKVSWELRDAMFKHCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGV  842
             AV+DK   E+ D++F   + LF LPLE K +NTS    FGY     ++PL E   I+D +
Sbjct  2     AVHDKYPSEVSDSIFSVLQDLFNLPLEIKVQNTSQTPLFGYYAPNPNVPLYESTSIEDAI  61

Query  841   TPESTMNFSKQMWPDADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQS  662
               E    F+ QMWP  ++  + CE    Y+  V +LD++V ++V ESYG++KY +  + S
Sbjct  62    NLEPVQEFTNQMWPSKNS--HICELLHCYANQVAELDKMVSKLVFESYGVEKYHESHVGS  119

Query  661   SSYLLRFIKYRMPKWNETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWI--NFQPSS  488
              +Y LR  KYR P+ NET  G  PH D +F+ I+  N++  LE++ ++G WI  +F PSS
Sbjct  120   VTYFLRLAKYRAPEQNETNLGVRPHTDKNFITILQQNEVDGLEVQLKNGSWIPVDFPPSS  179

Query  487   SKTIVFIAGEAFMAWSNRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNP  308
                +V +AG+AF  WSN R+++P HRV MKG + +Y++A FS+ +  VE P ELVDD++P
Sbjct  180   ---VVIMAGDAFSVWSNGRVHSPFHRVTMKG-KGRYSIAQFSYCKKLVEAPTELVDDEHP  235

Query  307   LKFKPFDHFEFLTFCANGGGKE-ESPINAFCGV  212
             L +KP D+F FL F + G  +E ++P+ A+CG+
Sbjct  236   LLYKPLDNFGFLRFLSKGERREIQNPLKAYCGI  268



>ref|XP_009354842.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Pyrus x bretschneideri]
Length=316

 Score =   229 bits (585),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 117/315 (37%), Positives = 186/315 (59%), Gaps = 4/315 (1%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M +   P+LP I F+ ++++ G++SW +T+ +VR  LEEYG F A YD++S EL + +F 
Sbjct  1     MGSLAPPQLPTINFSAEDLKPGSSSWLSTAKQVRCALEEYGSFVAQYDQISPELHNNIFG  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
                 LF++PLE K +N  D    GY G    +PL E   I +  +P++T  F   MWP  
Sbjct  61    QAADLFEVPLENKVKNVGDQPYHGYMGPNPGIPLYESLCIDNVTSPQATHKFKNLMWPAG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
                 NF E T S+ +L+  L++ V +M+ +S G+   ++ +   +S+LLRFIKY++P+  
Sbjct  121   KK--NFSETTDSFGQLLADLERTVGQMIFDSLGVGNEYESVACCNSHLLRFIKYKVPEDT  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
              T      H DNSF  IV  + +  LE++T++G WIN + S     +F+A +    WSN 
Sbjct  179   NTTLRFPMHTDNSFTTIVVQHDVSGLEVKTKEGDWINIE-SVPSHFLFMAADGLQVWSND  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANG  254
             RI A  HRV  +G + +Y++ LF+F  G +++P+ELVDD++PL + P D   +  F A+ 
Sbjct  238   RIKACQHRVKHRGDKTRYSLGLFTFNNGVIQVPKELVDDEHPLLYNPCDSRGYTRFHASA  297

Query  253   GGKE-ESPINAFCGV  212
               K+  S I A+CG+
Sbjct  298   ESKKAASRIKAYCGI  312



>ref|XP_009344329.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Pyrus x bretschneideri]
Length=316

 Score =   229 bits (585),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 118/315 (37%), Positives = 186/315 (59%), Gaps = 4/315 (1%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M +   PKLP I F+   ++ G++SW  T+ +VR  LEEYG F A YD++S EL++ +F 
Sbjct  1     MGSLAPPKLPTINFSAKGLKPGSSSWLPTAKQVRYALEEYGSFVAQYDQISPELQNNIFG  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
                 LF++P+E K +N  +    GY G    MPL E   I +  +P++T  F   MWP  
Sbjct  61    QAADLFEVPVENKVKNVGEQPYHGYIGPNPFMPLYESLCIDNVTSPQATHKFKNLMWPAG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
                 NFCE T S+ +L+  L++ V +M+ +S+G+   ++ +   +S+LLRFIKY +P+  
Sbjct  121   KK--NFCETTDSFGQLLGDLERTVGQMLFDSFGVGNEYESVANCNSHLLRFIKYEVPEDT  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             +T      H DNSF  IV  + +  LE++T++G WIN +   S+  +F+A +    WSN 
Sbjct  179   DTTLRFPMHTDNSFTTIVVQHDVSGLEVKTKEGDWINIESVPSQ-FLFMAADGLQMWSND  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANG  254
             RI A  HRV   G + +Y++ LF+F  G +++P+ELVDD++PL + P D   +  F A+ 
Sbjct  238   RIKACQHRVKHCGDKTRYSLGLFTFNNGVLQVPKELVDDEHPLLYNPCDSRGYTRFHASA  297

Query  253   GGKE-ESPINAFCGV  212
               K+  S I A+CG+
Sbjct  298   ESKKAASRIKAYCGI  312



>gb|EYU21580.1| hypothetical protein MIMGU_mgv1a010552mg [Erythranthe guttata]
Length=309

 Score =   229 bits (583),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/319 (38%), Positives = 189/319 (59%), Gaps = 16/319 (5%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + +  KLP+I+F+  N++  T +W +   +V   L EYGCF A++    + L + +  
Sbjct  1     MGSESRMKLPVIDFS--NLKQETATWESVKTQVSEALAEYGCFEAIFSNPKYSLVNVL--  56

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               + LF LPL+TK  N S+    GY G  A +PL E  GI D + P +   F + MW   
Sbjct  57    --QQLFDLPLQTKLLNKSNTTYHGYIGQHAVVPLYESLGISDALVPGNIEAFVELMWSHN  114

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
              N P FCE   S S+ + +L+++V  MVLE+ G+ KY D  I S++Y++RF KY  PK N
Sbjct  115   GN-PTFCESVRSISEELLELNKIVRTMVLENNGIKKYLDEHIDSTNYVVRFQKYDGPKTN  173

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDG-KWINFQPSSSKTIVFIAGEAFMAWSN  437
             ET+ G +PH D + + I+  + +  LEM+ +DG  WI   P+S    + +AGE+  AW+N
Sbjct  174   ETELGLVPHIDMNTLTILFQDDVTGLEMQKKDGDDWIETSPNS---FIVMAGESLRAWTN  230

Query  436   RRIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTFC  263
              R++AP HRVMM G + +Y++ LF+  +    V  P+E+VD+++PL +KP+D+ EFL + 
Sbjct  231   GRVHAPFHRVMMTGDKARYSIGLFAVPKSGYIVTAPKEMVDEEHPLLYKPYDYVEFLNYY  290

Query  262   ANGGGKEESP--INAFCGV  212
               G   + SP  +  +CGV
Sbjct  291   Y-GEASKTSPNALKDYCGV  308



>gb|AFK44600.1| unknown [Lotus japonicus]
Length=336

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 126/335 (38%), Positives = 194/335 (58%), Gaps = 11/335 (3%)
 Frame = -2

Query  1195  AQLLSLAINQSRKTMATHTNPK--LPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFA  1022
             +QL+        + M + T  +  LP I+F+D++++ GT  W +T   VR  +E++G F 
Sbjct  6     SQLVHTDFQGLGRIMGSQTESQVPLPAIDFSDEHLKPGTHKWVSTCQAVRSAMEDHGGFL  65

Query  1021  AVYDKVSWELRDAMFKHCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGV  842
             A+YDKV   L D++F   K LF LP ETK + T+D   F YA    ++PL E   I + V
Sbjct  66    ALYDKVDPLLYDSVFSAMKRLFDLPSETKGQKTTDKPIFSYAAQCPNIPLYESIAIDNAV  125

Query  841   TPESTMNFSKQMWPDADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLD-KYFDPLIQ  665
             +      ++  MWP  ++  +F E   SY+K V +LD +V +MV ESYG+D +  + +  
Sbjct  126   SAGDCQKYTTIMWPQGND--HFSESVNSYAKKVAELDYIVKKMVFESYGVDNQKHESMHA  183

Query  664   SSSYLLRFIKYRMPKWNETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSS  485
             S+ Y+LR  KYR P   ET  G +PH D+ F+ I++  ++  LE++ +DGKW   + S S
Sbjct  184   STDYVLRCYKYRTPLVGETNIGVLPHTDSGFLTIIN-QRLNGLEIKLQDGKWFPVEASPS  242

Query  484   KTIVFIAGEAFMAWSNRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPL  305
                V +AGEA   WSN RI A +HRV M    D+Y++ L S+    +E  EELVD+++PL
Sbjct  243   MFAV-LAGEALTVWSNDRISACLHRVFMNEKVDRYSLGLLSYAGKLMEPQEELVDEEHPL  301

Query  304   KFKPFDHFEFLTFCANGGG----KEESPINAFCGV  212
             ++KPFDH+ +L F  +  G    K  + I  +CG+
Sbjct  302   RYKPFDHYGYLRFYVSEEGVKAFKNGTRIKTYCGI  336



>gb|KCW67512.1| hypothetical protein EUGRSUZ_F01241, partial [Eucalyptus grandis]
Length=299

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/291 (40%), Positives = 168/291 (58%), Gaps = 6/291 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTD-DNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMF  977
             M++   PKLP+I+ ++ D  + G   W +   +VR+ LEE+GCF A+YDK++ EL D +F
Sbjct  1     MSSIPTPKLPLIDLSELDGSKPGIGRWDSLQSQVRQALEEFGCFEALYDKMTLELHDDVF  60

Query  976   KHCKHLFQLPLETKRRNTSDIYGF-GYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWP  800
             +  K L +LP + K R       F GY  N    PL E FGI       S   F+  MWP
Sbjct  61    QESKELHELPADVKHRFVVPDKPFNGYIANRPLAPLHEVFGIP--YVQGSIERFADLMWP  118

Query  799   DADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPK  620
             + +    FCE    Y   V +LD +V ++VL S+ +D + + L  S  Y  R IKY  P 
Sbjct  119   EGNT--RFCETMNKYITKVLELDSLVRKLVLRSFCIDNHGNLLGASIRYNFRLIKYAAPA  176

Query  619   WNETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWS  440
                 K G + HRD + + I+  N +  LE++T+DG+WI   PSS+ + + + GE+F  WS
Sbjct  177   TESKKLGVMCHRDGNSVTILHQNHVNGLEVQTKDGRWIEVAPSSASSFIVLTGESFYGWS  236

Query  439   NRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFD  287
             N R+ +P HRVMM G E +Y +  FS  RGT++ P+ELVD+ +PL FKPFD
Sbjct  237   NGRLQSPCHRVMMSGHEPRYCIGFFSIDRGTIQCPQELVDEQHPLLFKPFD  287



>ref|XP_007162138.1| hypothetical protein PHAVU_001G127300g [Phaseolus vulgaris]
 gb|ESW34132.1| hypothetical protein PHAVU_001G127300g [Phaseolus vulgaris]
Length=314

 Score =   229 bits (583),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 122/309 (39%), Positives = 192/309 (62%), Gaps = 8/309 (3%)
 Frame = -2

Query  1129  LPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQL  950
             LPII+F+D+N+++GT +W +TS  VR  LE++G F A Y+KV   + D++F   + LF L
Sbjct  11    LPIIDFSDENLKLGTQTWISTSDAVRGALEDHGGFLAHYNKVEPLVNDSVFSAMEQLFDL  70

Query  949   PLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFCE  770
             PLETK ++T++   + YAG    +PL E   I + +  +S   ++  MWP  ++   F E
Sbjct  71    PLETKMQHTTEKPIYSYAGQRRDIPLYESMAIDNPLNAKSCHKYTTTMWPQGND--QFSE  128

Query  769   DTTSYSKLVWQLDQVVMRMVLESYGLD-KYFDPLIQSSSYLLRFIKYRMPKWNETKTGHI  593
                SY K V +LD +V RMV  SYGL+ +  + L++S+ Y+LR  KYR P+  ET  G  
Sbjct  129   IVNSYGKKVAELDYIVKRMVFGSYGLENEKCECLLESTDYVLRCYKYRTPEAGETNLGVH  188

Query  592   PHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTI-VFIAGEAFMAWSNRRIYAPV  416
             PH D+ F+ I++  ++  LE++ ++G+W  FQ  +S +I   +AG+AFM WSN RI   V
Sbjct  189   PHTDSGFLTILN-QRLNGLEIQLKNGEW--FQVDASPSIFAVLAGDAFMVWSNDRIRGCV  245

Query  415   HRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLT-FCANGGGKEE  239
             HRV+M    ++Y++ L S+    +E  E+LVD+++PL++KPFD + +L  F      K  
Sbjct  246   HRVLMNSKVERYSLGLLSYAGKVMEPEEKLVDEEHPLRYKPFDQYGYLRFFLTEEAVKAA  305

Query  238   SPINAFCGV  212
             S I A+CG+
Sbjct  306   SRIKAYCGI  314



>ref|XP_007024016.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
 gb|EOY26638.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
Length=319

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/319 (38%), Positives = 191/319 (60%), Gaps = 11/319 (3%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M++ T  +LP+I+ +  +++ G+  W     +VR+ L+EYGCF A++DKV  EL   +  
Sbjct  7     MSSETPVRLPVIDSSKQDLKPGSADWELVKVQVRQALQEYGCFEALFDKV-LELGKPLIG  65

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPEST-MNFSKQMWPD  797
               + LF LPL+TK R  S+    GY G  A  PL E   I +    E+     +  +WP 
Sbjct  66    ALEELFDLPLQTKTRYVSEKVFRGYYGPKA--PLHESMVIDEANVAENVEQRLTNILWPQ  123

Query  796   ADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKW  617
              +++  F E   S+S L   L++ + RM+LES+GL+KY D  ++S++Y+LR +KY  P  
Sbjct  124   GNSS--FSETLLSFSSLASGLEKTIRRMILESFGLEKYMDKHMESTNYILRVMKYEGPHT  181

Query  616   NETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSN  437
             +E   G   H D + + ++  N++  LE++T+DG+WIN +PS +  IV I GE+   W N
Sbjct  182   SEPTIGARAHSDQNMVTLLHQNEVNGLEIQTKDGEWINVKPSPASFIVMI-GESLSVWLN  240

Query  436   RRIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTFC  263
              R+ +P HRVM+ G++ +Y+  LF+  +G   V++PEELVD++NPL FKPFD+ EFL F 
Sbjct  241   GRLPSPYHRVMITGNKARYSSGLFATTKGGYKVKVPEELVDEENPLLFKPFDYEEFLEFY  300

Query  262   ANGG--GKEESPINAFCGV  212
             +     G   S + A+C V
Sbjct  301   STEAARGALGSGLKAYCSV  319



>ref|XP_008372275.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Malus domestica]
Length=316

 Score =   228 bits (582),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/314 (37%), Positives = 187/314 (60%), Gaps = 4/314 (1%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M +   P+LP I F+ ++++ G++SW +T+ +VR  LEEYG F A YD++S EL + +F 
Sbjct  1     MGSLAPPQLPTINFSAEDLKPGSSSWLSTAKQVRCALEEYGSFVAQYDQISPELHNNIFG  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
                 LF++PLE K +N  +    GY G   ++PL E   I +  +P++T  F   MWP  
Sbjct  61    QAADLFEVPLENKVKNVGEQPYHGYMGPNPAIPLYESLCIDNVTSPQATHKFKNLMWPAG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
                 NF E T S+ +L+  LD+ V +M+ +S+G+   ++ +   +S+LLRFIKY++P+  
Sbjct  121   KK--NFSETTDSFGQLLADLDRTVGQMIFDSFGVGNEYESVACCNSHLLRFIKYKVPEDP  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             +       H DN+F  IV  + +  LE++T++G WIN + S     +F+A E    WSN 
Sbjct  179   DITLRFPMHTDNNFTTIVVQHDVSGLEVKTKEGDWINIE-SVPSHFLFMAAEGLQVWSND  237

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTFCANG  254
             RI A  HRV  +G + +Y++ LF+F  G +++P+ELVDD++PL + P D   +  F A+ 
Sbjct  238   RIKACQHRVKHRGDKTRYSLGLFTFNNGVIQVPKELVDDEHPLLYNPCDSRGYTRFHASA  297

Query  253   GGKE-ESPINAFCG  215
               K+  S I A+CG
Sbjct  298   ESKKAASRIKAYCG  311



>ref|XP_010060704.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Eucalyptus grandis]
Length=313

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/291 (40%), Positives = 168/291 (58%), Gaps = 6/291 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTD-DNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMF  977
             M++   PKLP+I+ ++ D  + G   W +   +VR+ LEE+GCF A+YDK++ EL D +F
Sbjct  1     MSSIPTPKLPLIDLSELDGSKPGIGRWDSLQSQVRQALEEFGCFEALYDKMTLELHDDVF  60

Query  976   KHCKHLFQLPLETKRRNTSDIYGF-GYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWP  800
             +  K L +LP + K R       F GY  N    PL E FGI       S   F+  MWP
Sbjct  61    QESKELHELPADVKHRFVVPDKPFNGYIANRPLAPLHEVFGIP--YVQGSIERFADLMWP  118

Query  799   DADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPK  620
             + +    FCE    Y   V +LD +V ++VL S+ +D + + L  S  Y  R IKY  P 
Sbjct  119   EGNT--RFCETMNKYITKVLELDSLVRKLVLRSFCIDNHGNLLGASIRYNFRLIKYAAPA  176

Query  619   WNETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWS  440
                 K G + HRD + + I+  N +  LE++T+DG+WI   PSS+ + + + GE+F  WS
Sbjct  177   TESKKLGVMCHRDGNSVTILHQNHVNGLEVQTKDGRWIEVAPSSASSFIVLTGESFYGWS  236

Query  439   NRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFD  287
             N R+ +P HRVMM G E +Y +  FS  RGT++ P+ELVD+ +PL FKPFD
Sbjct  237   NGRLQSPCHRVMMSGHEPRYCIGFFSIDRGTIQCPQELVDEQHPLLFKPFD  287



>ref|XP_004229769.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2 isoform 
X1 [Solanum lycopersicum]
Length=323

 Score =   228 bits (581),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 129/327 (39%), Positives = 195/327 (60%), Gaps = 20/327 (6%)
 Frame = -2

Query  1159  KTMATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYD-----KVSWE  995
             K     ++ K+PII+     +   + SW      VR  LEEYG F A+YD     K+S E
Sbjct  3     KNTLIMSDSKIPIIDLF--KLDEYSNSWVPLCNNVRHALEEYGYFIALYDDDKKNKISTE  60

Query  994   LRDAMFKHCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFS  815
             + D M    + LF LP+ETK++NTSD Y + + G     PL E FGI      E+  +F+
Sbjct  61    IFDVM----EELFDLPIETKKKNTSDFYFYQWNGLLKKAPLHESFGIPHPTDVEALQSFT  116

Query  814   KQMWPDADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGL-DKYFDPLIQSSSYLLRFI  638
               MWP  +    FCE  TSY K+  +++Q+V +MV ESYG+ +++++  + +++YLLR I
Sbjct  117   TLMWPQGNR--RFCETVTSYVKVAAEVEQLVDKMVFESYGVAERHYESHVAATTYLLRPI  174

Query  637   KYRMP-KWNETKTGHI---PHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVF  470
             KYR P +  E  +G+I    H D SF  ++  NQI  L++ET+ G+WI+     S   VF
Sbjct  175   KYRPPLQGAEDGSGNIGCNAHTDKSFSTLLFQNQINALQVETKSGEWIDVDVPPS-AFVF  233

Query  469   IAGEAFMAWSNRRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPF  290
             +AG+A+ AWSN RIYA  H+V+MK  +++YT+ALF+F +G  EIPEELVD+ +P+++KPF
Sbjct  234   LAGDAYEAWSNGRIYAARHQVLMKEDKERYTLALFTFNKGITEIPEELVDETHPIQYKPF  293

Query  289   DHFEFLTFCANGGGK-EESPINAFCGV  212
             D+F    +  +G           +CG+
Sbjct  294   DNFGLAWYYLSGASSMAHGTAKPYCGI  320



>ref|XP_002298124.1| hypothetical protein POPTR_0001s17580g [Populus trichocarpa]
 gb|EEE82929.1| hypothetical protein POPTR_0001s17580g [Populus trichocarpa]
Length=317

 Score =   228 bits (580),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/319 (36%), Positives = 187/319 (59%), Gaps = 7/319 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M+  T  +LP I+F   +++ GT+ W     +V + + E+GCF A++DK+   +  +   
Sbjct  1     MSQETPFQLPSIDFCKSDLKPGTSEWDLVKSQVWKAISEHGCFKALFDKIPLHVEKSCLG  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
               K LF LPL+TKR++ S+I    Y          E FGI+D    E+  NF+  +WP  
Sbjct  61    EVKELFDLPLQTKRQHVSEIPFNSYFWKSPPPLQYESFGIEDPSIFENCNNFTNVLWPHG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWN  614
             +  P+F ++   +S  V + ++++ RM+LES GLD Y D  + S++ +LR +KY++P+  
Sbjct  121   N--PDFRKNINYFSTKVSEFEKLIRRMILESMGLDNYLDEHMSSTTCVLRVMKYQVPQIT  178

Query  613   ETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNR  434
             E      PH D + + I+  NQ+  LE++T+ G+WI  + S   + V + GE+F AW+N 
Sbjct  179   EPTYTSKPHTDKNLITILYQNQVDGLEVQTKHGEWIGVELSHDHSFVILIGESFRAWTNG  238

Query  433   RIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTFCA  260
             R++ P HRV M GSE +Y+  LFSF +     + PE+L+D+D+PL +KPFD+FEFL F +
Sbjct  239   RLHPPYHRVRMSGSEARYSAGLFSFFKAGYKTKTPEDLIDEDHPLLYKPFDYFEFLKFFS  298

Query  259   NGGGK---EESPINAFCGV  212
                 K    +  + A+CGV
Sbjct  299   AWAPKAQPNQCALKAYCGV  317



>ref|XP_007162139.1| hypothetical protein PHAVU_001G127400g [Phaseolus vulgaris]
 gb|ESW34133.1| hypothetical protein PHAVU_001G127400g [Phaseolus vulgaris]
Length=313

 Score =   227 bits (579),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 117/318 (37%), Positives = 181/318 (57%), Gaps = 8/318 (3%)
 Frame = -2

Query  1159  KTMATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAM  980
             K M + T  KLPII+F+   +      W +   +V + L EYGCF AV+D+V   +R A+
Sbjct  2     KKMGSETEVKLPIIDFSVVELESNVAEWESVKSQVHKALVEYGCFEAVFDEVPLHIRKAI  61

Query  979   FKHCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWP  800
             F     LF LPLETK+   S     GY G    + L E  GI D    E   +    +WP
Sbjct  62    FFEVDELFNLPLETKKLAVSSKPFRGYVG---PIQLYESIGIDDADVYEKVESLINILWP  118

Query  799   DADNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPK  620
                ++  F ++   +++ V +LD+++ +M LES G++KY D  + S+ YL R IKY  P+
Sbjct  119   QGKSS--FSKNLQFFTEKVSRLDRMIRKMCLESLGVEKYLDEHMNSTYYLARLIKYTAPQ  176

Query  619   WNETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWS  440
              NE K     H D +   I+  NQI  LE++T++G+WI ++PSSS + V + G+ F AW+
Sbjct  177   TNEPKVAIAEHTDKNIFTILCQNQIDGLEIQTKNGEWIKYKPSSSNSFVVVTGDTFYAWT  236

Query  439   NRRIYAPVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTF  266
             N R++ P+H+VMM G+E + TV LF+  +    ++ P ELV +++PL FKPF   EF+ F
Sbjct  237   NGRVHTPIHQVMMTGNETRLTVGLFTVPKPGFIIKAPNELVTEEHPLLFKPFVQSEFMKF  296

Query  265   CANGGGKEESPINAFCGV  212
               +    + + +  +CGV
Sbjct  297   LRSSQNTKNA-LKVYCGV  313



>emb|CDP21546.1| unnamed protein product [Coffea canephora]
Length=325

 Score =   228 bits (580),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 117/315 (37%), Positives = 186/315 (59%), Gaps = 10/315 (3%)
 Frame = -2

Query  1147  THTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHC  968
             T  +  +P+I FT +N+++GT+SW +T   VR  LE++GCF AVYDK   E +  +F   
Sbjct  13    TQKSKTIPVIYFTTENLKLGTSSWLSTCKAVREALEDFGCFIAVYDKAESECKIDVFASL  72

Query  967   KHLFQLPLETKRRNTS-DIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDAD  791
             K  F LP+ETK  N   D   FGY G   + PL E   I+D  T E+  +F+   WP  +
Sbjct  73    KEFFNLPMETKLLNVHPDKDAFGYFGPKPNFPLLEAISIEDSTTIEAVQSFANLAWPSGN  132

Query  790   NTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNE  611
             +  +FCE   + ++ + +++++V +M+ ESYG+ +Y D  I+S+SYL R   YR+ +  E
Sbjct  133   D--HFCETICACTRQLSEVNRMVSKMIFESYGVGRYSDSHIESTSYLFRANAYRVSQEKE  190

Query  610   TKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWI--NFQPSSSKTIVFIAGEAFMAWSN  437
                G  PH D SF++++  + +  L+++++DG WI  +F PSS   +  +AG+A +AWSN
Sbjct  191   PNLGISPHTDTSFVSVLKQDSVQGLQIQSKDGTWIPVDFPPSS---VAIMAGDAMLAWSN  247

Query  436   RRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTF-CA  260
              R+    HRVM+   + + ++ LFSF  G V++P+EL DD+ P +F  FDH+  L F   
Sbjct  248   GRVRPCFHRVMVT-EKARTSIGLFSFHTGIVQVPKELADDNYPSQFTSFDHWGLLKFRSK  306

Query  259   NGGGKEESPINAFCG  215
             N        + A+CG
Sbjct  307   NPALSSNERVKAYCG  321



>ref|XP_007145557.1| hypothetical protein PHAVU_007G248700g [Phaseolus vulgaris]
 gb|ESW17551.1| hypothetical protein PHAVU_007G248700g [Phaseolus vulgaris]
Length=312

 Score =   227 bits (579),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 114/316 (36%), Positives = 193/316 (61%), Gaps = 6/316 (2%)
 Frame = -2

Query  1153  MATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFK  974
             M + T  +L +++FT+ N++ GT +W +T   VR  LE++G F A+YD +S +  D+++ 
Sbjct  1     MGSETQSQLQVVDFTNQNLKEGTETWVSTCQVVRSALEDHGAFLALYDNISLQTYDSIYS  60

Query  973   HCKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDA  794
                 LF L  ETKRR T++   F Y+G   S+PL E  GI + ++ +    ++  MWP  
Sbjct  61    EMSKLFDLSTETKRRKTTEKPIFSYSGQRPSIPLYESAGIINPLSFQDCQKYTHVMWPQG  120

Query  793   DNTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLD-KYFDPLIQSSSYLLRFIKYRMPKW  617
             ++  +FC+   SY+K + +LD +V RM+ ESYG++ K  + L++S+ Y+LR  KYR P+ 
Sbjct  121   NH--HFCKSVNSYAKNLVELDHIVKRMMFESYGVERKKLESLLESTEYVLRGYKYRKPEV  178

Query  616   NETKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSN  437
              E+  G  PH D + + I++  ++  L ++ + G+W     S S  +V + G+A M WSN
Sbjct  179   GESNLGVPPHSDTALLTILN-QKVEGLGVKLKGGEWFEVGVSPSLYLV-MGGDALMVWSN  236

Query  436   RRIYAPVHRVMMKGSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLT-FCA  260
              RI A  HRV++K  +++Y++ L S++   +E  E LVD+++PL++KP DH+ +L  F  
Sbjct  237   GRIPACEHRVLVKSKKERYSMGLLSYVNKIMEPEEGLVDEEHPLRYKPLDHYGYLRFFIT  296

Query  259   NGGGKEESPINAFCGV  212
                 K +S INA+CG+
Sbjct  297   EEALKSDSRINAYCGI  312



>ref|XP_010061957.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Eucalyptus grandis]
Length=321

 Score =   227 bits (579),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 117/316 (37%), Positives = 184/316 (58%), Gaps = 6/316 (2%)
 Frame = -2

Query  1150  ATHTNPKLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKH  971
              T    ++P+I  +++ M+ GT+SW      + + LE++GCF   +  V   L D +F  
Sbjct  3     GTKVASQIPVIVLSEECMKPGTSSWEKACKVIVQALEDHGCFIVDHPNVPLGLHDTVFSV  62

Query  970   CKHLFQLPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDAD  791
              + LF LP ETK +NT+     GY       PL E   I      E    F+  MWP  +
Sbjct  63    TEDLFDLPHETKIKNTNFKPSHGYIPKVPGTPLLEGTNIDGAEKLEECEKFTSLMWPSGN  122

Query  790   NTPNFCEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNE  611
             +  +FC+    Y K + ++++VV RMV ESYG++K +DP I+S +YLLRF+KY+ P   +
Sbjct  123   D--HFCKTVHDYGKFIAEIEKVVFRMVCESYGVEKCYDPYIESCTYLLRFLKYKKPADLD  180

Query  610   TKTGHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRR  431
                  I H D SF++ +  N I  LE+ T+DG+W  F+PS+S T + +AG+A +AWSN R
Sbjct  181   ASVNPIAHTDKSFLSYLHQNNIRGLEVRTKDGEWFTFEPSAS-TFMVMAGDACVAWSNGR  239

Query  430   IYAPVHRVMMK-GSEDKYTVALFSFLRGTVEIPEELVDDDNPLKFKPFDHFEFLTF--CA  260
             I A  HRV ++  S+ +Y++  FS++ G +E PEE ++  +P ++KPF+H +FL +   +
Sbjct  240   IKACYHRVAVREESQVRYSLGTFSYVSGMIETPEEFINKAHPRQYKPFNHIDFLCYYDSS  299

Query  259   NGGGKEESPINAFCGV  212
             +   K ES I  +CGV
Sbjct  300   DNRIKAESLIKTYCGV  315



>ref|XP_006339306.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Solanum tuberosum]
Length=310

 Score =   227 bits (578),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 120/314 (38%), Positives = 186/314 (59%), Gaps = 12/314 (4%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQ  953
             K+P I+F    ++ GT  W +T  +V + L+EYGCF A YDK+  E  +AMF   K +F+
Sbjct  2     KVPTIDFCKPELKPGTIQWDSTKSQVFQALQEYGCFEATYDKLRNETLEAMFGRSKEIFE  61

Query  952   LPLETKRRNTSDIYGF-GYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNF  776
              PLETK +N S    F GY G   ++PL E   I D +  E    F+   WP+     N 
Sbjct  62    FPLETKMKNLSKKLPFNGYIGKLPTLPLYESVCIDDLLQLEIVETFANIFWPEG----NP  117

Query  775   CEDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNE--TKT  602
              +   SYSK + +LD++V RMVLES GL  Y D  +  +S+LLR  KY   +  +   K 
Sbjct  118   YKVVKSYSKPLVELDEMVKRMVLESLGLQNYIDEFLDLTSFLLRLTKYNATQDEDMGNKL  177

Query  601   GHIPHRDNSFMAIVDTNQIGCLEMETRDGKWINFQPSSSKTIVFIAGEAFMAWSNRRIYA  422
             G   H D +F+ I+  NQ+  L++  ++G+WI+   SS+ + V ++G++FMAW+N R+++
Sbjct  178   GIGDHTDGNFLTIISQNQVNGLQILKKNGEWIDVDISSN-SFVVLSGDSFMAWTNGRLHS  236

Query  421   PVHRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTFCANGGG  248
             P+HRV M G  D++++ LF+  +   T++ P+ELVD+++PL FKP+D   +  F     G
Sbjct  237   PLHRVTMAGENDRFSIQLFADPKTDCTIKAPKELVDEEHPLLFKPYDMLGYFEFFGTEAG  296

Query  247   KEESP--INAFCGV  212
             +E  P  + A+CGV
Sbjct  297   REAGPNVLKAYCGV  310



>gb|EYU21579.1| hypothetical protein MIMGU_mgv1a010719mg [Erythranthe guttata]
Length=304

 Score =   226 bits (577),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 120/311 (39%), Positives = 185/311 (59%), Gaps = 14/311 (5%)
 Frame = -2

Query  1132  KLPIIEFTDDNMRVGTTSWRTTSYEVRRGLEEYGCFAAVYDKVSWELRDAMFKHCKHLFQ  953
             KLP+I+F+  N++  T +W +   +V   L EYGCF A++    + L + +    + LF 
Sbjct  2     KLPVIDFS--NLKQETETWESVKTQVSEALAEYGCFEAIFSNRKYSLVNVL----QQLFD  55

Query  952   LPLETKRRNTSDIYGFGYAGNFASMPLAEYFGIKDGVTPESTMNFSKQMWPDADNTPNFC  773
             LPL+TK  N SD    GY G  A +PL E   I D + P +   F++ MW D  N P FC
Sbjct  56    LPLQTKLLNKSDTTYHGYIGQDAVVPLYESLAINDALVPGNIEAFAELMWSDNGN-PTFC  114

Query  772   EDTTSYSKLVWQLDQVVMRMVLESYGLDKYFDPLIQSSSYLLRFIKYRMPKWNETKTGHI  593
             E   S S+ + +L+++V  MVLE+ G+ KY D  I S++Y++R  KY  PK NET+ G I
Sbjct  115   ESIRSISEELLELNKIVRTMVLENIGIKKYLDEHIDSTNYVVRVQKYDGPKTNETELGLI  174

Query  592   PHRDNSFMAIVDTNQIGCLEMETRDG-KWINFQPSSSKTIVFIAGEAFMAWSNRRIYAPV  416
             PH D + + I+  + +  LEM+T+DG  WI   P+S    + +AGE+  AW+N R++AP 
Sbjct  175   PHIDMNTLTILFQDDVTGLEMQTKDGDNWIETSPNS---FIVMAGESLRAWTNGRVHAPF  231

Query  415   HRVMMKGSEDKYTVALFSFLRG--TVEIPEELVDDDNPLKFKPFDHFEFLTFCANGGGKE  242
             HRVMM G + +Y++ LF+  +    V+ P+E+VD+++PL +KP+D+ +FL F      K 
Sbjct  232   HRVMMTGDKARYSIGLFASPKSGYIVKAPKEMVDEEHPLLYKPYDYVQFLNFYYVEATKT  291

Query  241   E-SPINAFCGV  212
               + +   CGV
Sbjct  292   SPNALKDHCGV  302



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3215844022030