BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c28028_g1_i1 len=1664 path=[1642:0-1663]

Length=1664
                                                                      Score     E

ref|XP_009760074.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    533   0.0      
ref|XP_009592440.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    530   0.0      
ref|XP_006348454.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    522   1e-178   
gb|ABA59556.1|  U-box protein                                           521   3e-178   Capsicum annuum
ref|XP_004228696.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    521   3e-178   
ref|XP_006348457.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    519   1e-177   
ref|XP_010315681.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    516   2e-176   
ref|XP_004228691.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    514   2e-175   
ref|XP_004228690.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    514   2e-175   
ref|XP_006348456.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    511   2e-174   
ref|XP_006348455.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    504   2e-171   
ref|XP_007027990.1|  Plant U-box 23                                     493   3e-167   
gb|EYU38686.1|  hypothetical protein MIMGU_mgv1a020011mg                493   5e-167   
gb|KDP36106.1|  hypothetical protein JCGZ_08750                         491   4e-166   
emb|CDP10593.1|  unnamed protein product                                490   9e-166   
ref|XP_002265439.2|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    484   1e-163   Vitis vinifera
ref|XP_011094237.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    482   1e-162   
ref|XP_002524056.1|  Spotted leaf protein, putative                     482   1e-162   Ricinus communis
ref|XP_002267438.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    481   2e-162   Vitis vinifera
ref|XP_010106989.1|  E3 ubiquitin-protein ligase                        479   9e-162   
ref|XP_009348934.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    476   2e-160   
ref|XP_011077807.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    473   2e-159   
ref|XP_004303406.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    472   4e-159   
ref|XP_002323382.1|  U-box domain-containing family protein             471   1e-158   Populus trichocarpa [western balsam poplar]
ref|XP_011046430.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    470   3e-158   
ref|XP_010247286.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    469   5e-158   
ref|XP_007204425.1|  hypothetical protein PRUPE_ppa1027169mg            468   1e-157   
ref|XP_008365622.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    468   1e-157   
ref|XP_008391980.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    468   2e-157   
ref|XP_009343248.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23       467   6e-157   
ref|XP_011042586.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22       466   1e-156   
ref|XP_006381941.1|  U-box domain-containing family protein             466   1e-156   
ref|XP_006430055.1|  hypothetical protein CICLE_v10011844mg             464   9e-156   
ref|XP_006481606.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    463   2e-155   
ref|XP_010059057.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    462   5e-155   
ref|XP_004494254.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    461   1e-154   
ref|XP_010036593.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23       459   9e-154   
ref|XP_010059046.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    452   3e-151   
ref|XP_006494889.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    451   7e-151   
gb|KEH24248.1|  E3 ubiquitin-protein ligase PUB23-like protein          451   1e-150   
ref|XP_010038928.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    451   2e-150   
gb|KDO46582.1|  hypothetical protein CISIN_1g040073mg                   450   2e-150   
ref|XP_010516800.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    450   4e-150   
ref|XP_006424086.1|  hypothetical protein CICLE_v10028557mg             449   5e-150   
emb|CDX84168.1|  BnaC04g09300D                                          449   6e-150   
ref|XP_010263015.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    449   1e-149   
ref|XP_010509533.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    448   1e-149   
ref|XP_010505120.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23       448   2e-149   
ref|XP_009143630.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    447   3e-149   
ref|XP_010677540.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    447   4e-149   
ref|XP_010036594.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    446   6e-149   
ref|XP_010024549.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    446   9e-149   
ref|XP_007145787.1|  hypothetical protein PHAVU_007G267700g             445   2e-148   
ref|NP_181137.2|  E3 ubiquitin-protein ligase PUB23                     444   6e-148   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881419.1|  hypothetical protein ARALYDRAFT_482563             444   6e-148   
gb|AAD21464.1|  unknown protein                                         444   6e-148   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009141534.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    442   2e-147   
ref|XP_010090504.1|  E3 ubiquitin-protein ligase                        442   2e-147   
ref|XP_010526330.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22       442   4e-147   
emb|CDY59599.1|  BnaCnng35300D                                          441   5e-147   
ref|XP_006410763.1|  hypothetical protein EUTSA_v10016730mg             441   8e-147   
ref|XP_006295808.1|  hypothetical protein CARUB_v10024934mg             440   1e-146   
emb|CDY32070.1|  BnaC04g44960D                                          440   3e-146   
gb|KFK36486.1|  hypothetical protein AALP_AA4G130900                    439   7e-146   
ref|XP_006387887.1|  hypothetical protein POPTR_0497s00200g             439   7e-146   
ref|XP_009803459.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    438   9e-146   
ref|XP_007015662.1|  U-box domain-containing protein 23                 438   9e-146   
ref|XP_009593988.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    436   5e-145   
ref|XP_010677541.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    436   7e-145   
ref|XP_002275500.2|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    436   7e-145   Vitis vinifera
ref|XP_010541793.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    435   3e-144   
ref|XP_009115945.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22       434   1e-143   
emb|CDX95337.1|  BnaC04g28210D                                          430   1e-142   
ref|XP_007162975.1|  hypothetical protein PHAVU_001G196000g             430   2e-142   
ref|XP_006403803.1|  hypothetical protein EUTSA_v10010389mg             429   6e-142   
ref|XP_009136678.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    428   1e-141   
gb|KFK34491.1|  hypothetical protein AALP_AA5G152500                    429   1e-141   
emb|CDX79645.1|  BnaC03g19810D                                          427   2e-141   
ref|XP_002513723.1|  ubiquitin-protein ligase, putative                 426   6e-141   Ricinus communis
ref|XP_007150019.1|  hypothetical protein PHAVU_005G119100g             426   7e-141   
ref|XP_008241067.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    423   3e-140   
ref|XP_004497653.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    425   4e-140   
ref|XP_010426860.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22       424   9e-140   
ref|XP_010515711.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    424   1e-139   
ref|XP_009133058.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23       422   1e-139   
emb|CDX84587.1|  BnaA03g16430D                                          422   2e-139   
ref|XP_003520716.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    422   3e-139   
ref|XP_006293176.1|  hypothetical protein CARUB_v10019493mg             422   6e-139   
ref|XP_003518177.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    421   9e-139   
gb|KEH41883.1|  E3 ubiquitin-protein ligase PUB23-like protein          421   1e-138   
ref|XP_002298264.1|  hypothetical protein POPTR_0001s22370g             420   1e-138   Populus trichocarpa [western balsam poplar]
ref|XP_008230336.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    420   1e-138   
ref|XP_008799715.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    419   4e-138   
gb|EYU18112.1|  hypothetical protein MIMGU_mgv1a007124mg                419   5e-138   
ref|XP_003540287.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    418   6e-138   
ref|XP_004136517.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    418   6e-138   
ref|XP_011006317.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    418   1e-137   
gb|EPS57434.1|  hypothetical protein M569_17384                         417   1e-137   
ref|XP_011021423.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    417   1e-137   
ref|XP_006362641.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    417   2e-137   
emb|CAN82979.1|  hypothetical protein VITISV_023329                     415   2e-137   Vitis vinifera
ref|XP_007207682.1|  hypothetical protein PRUPE_ppa023672mg             417   2e-137   
gb|KHN17981.1|  E3 ubiquitin-protein ligase PUB23                       416   2e-137   
ref|XP_009139452.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    417   4e-137   
ref|XP_003537115.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    416   6e-137   
emb|CDP15556.1|  unnamed protein product                                414   1e-136   
ref|XP_003535700.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    415   2e-136   
ref|XP_010911942.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    414   4e-136   
ref|XP_009368334.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    413   6e-136   
ref|XP_009793462.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    414   7e-136   
ref|XP_008442921.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    412   1e-135   
ref|XP_009337706.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    412   2e-135   
gb|KHN48421.1|  E3 ubiquitin-protein ligase PUB23                       412   2e-135   
ref|XP_009586788.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    412   2e-135   
ref|NP_190813.1|  E3 ubiquitin-protein ligase PUB22                     412   4e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004228461.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    411   7e-135   
ref|XP_008784119.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    410   1e-134   
gb|KHN43695.1|  E3 ubiquitin-protein ligase PUB22                       410   1e-134   
gb|KEH41882.1|  E3 ubiquitin-protein ligase PUB23-like protein          410   1e-134   
ref|XP_002877862.1|  U-box domain-containing protein                    410   2e-134   
ref|XP_004140266.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    409   2e-134   
ref|XP_003554464.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    409   3e-134   
emb|CDY23218.1|  BnaA04g05410D                                          408   4e-134   
ref|XP_010931056.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    409   4e-134   
ref|XP_003554468.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    407   2e-133   
ref|XP_008449598.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    406   3e-133   
emb|CDX78096.1|  BnaA09g32910D                                          405   3e-133   
ref|XP_010912561.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    406   3e-133   
ref|XP_011090297.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    405   4e-133   
gb|KHN36501.1|  E3 ubiquitin-protein ligase PUB23                       403   3e-132   
ref|XP_003543414.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    403   4e-132   
gb|KCW48204.1|  hypothetical protein EUGRSUZ_K01927                     402   5e-132   
ref|XP_003596890.1|  U-box domain-containing protein                    402   6e-132   
ref|XP_004487449.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    402   6e-132   
gb|KCW90449.1|  hypothetical protein EUGRSUZ_A02579                     399   2e-130   
ref|XP_010912070.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    399   3e-130   
ref|XP_004291671.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    399   4e-130   
ref|XP_004251095.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    398   4e-130   
ref|XP_006362850.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    397   9e-130   
ref|XP_010911941.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    392   1e-127   
ref|XP_009415614.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    391   2e-127   
ref|XP_009408289.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    391   3e-127   
ref|XP_006592779.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    390   3e-127   
emb|CBI22782.3|  unnamed protein product                                385   4e-126   
ref|XP_008379758.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    388   7e-126   
ref|XP_010045173.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    388   1e-125   
gb|KCW87327.1|  hypothetical protein EUGRSUZ_B03814                     387   1e-125   
ref|XP_010927379.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    387   2e-125   
emb|CBI22781.3|  unnamed protein product                                384   4e-125   
ref|XP_008441961.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    385   7e-125   
ref|XP_009379827.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    381   1e-123   
ref|XP_009419493.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    382   1e-123   
ref|XP_008793948.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    381   2e-123   
gb|KEH41880.1|  E3 ubiquitin-protein ligase PUB23-like protein          380   4e-123   
ref|XP_011089213.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    380   4e-123   
emb|CBI24432.3|  unnamed protein product                                378   5e-123   
ref|XP_009415651.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    378   4e-122   
ref|XP_009383562.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    377   6e-122   
gb|KGN53961.1|  hypothetical protein Csa_4G194780                       373   4e-120   
gb|ACU18170.1|  unknown                                                 369   3e-119   Glycine max [soybeans]
gb|EPS70404.1|  hypothetical protein M569_04358                         361   1e-115   
ref|XP_006854618.1|  hypothetical protein AMTR_s00030p00159240          360   1e-115   
ref|XP_004172550.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    359   2e-115   
ref|XP_007132500.1|  hypothetical protein PHAVU_011G099400g             359   3e-115   
ref|XP_009399190.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    345   1e-109   
ref|XP_002453950.1|  hypothetical protein SORBIDRAFT_04g022070          334   3e-105   Sorghum bicolor [broomcorn]
ref|XP_004952676.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    335   3e-105   
ref|XP_002453951.1|  hypothetical protein SORBIDRAFT_04g022080          333   9e-105   Sorghum bicolor [broomcorn]
ref|XP_008799744.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    331   5e-104   
ref|XP_004147551.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    328   5e-103   
ref|XP_004163666.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    328   5e-103   
ref|XP_009383555.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    328   5e-103   
ref|XP_003575089.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23       328   8e-103   
ref|XP_010931057.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    327   2e-102   
ref|XP_010685445.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    327   6e-102   
ref|XP_008358017.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    325   1e-101   
ref|XP_008645759.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    325   3e-101   
dbj|BAJ97280.1|  predicted protein                                      323   6e-101   
dbj|BAJ93921.1|  predicted protein                                      322   1e-100   
ref|XP_004959995.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    321   3e-100   
ref|XP_003540288.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    321   5e-100   
ref|NP_001054324.1|  Os04g0686000                                       320   5e-100   Oryza sativa Japonica Group [Japonica rice]
emb|CAH68357.1|  H0723C07.7                                             320   7e-100   Oryza sativa [red rice]
gb|KHN36500.1|  E3 ubiquitin-protein ligase PUB23                       320   1e-99    
ref|XP_003543415.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    320   2e-99    
gb|EMT16670.1|  U-box domain-containing protein 23                      319   2e-99    
gb|ACU20925.1|  unknown                                                 319   3e-99    Glycine max [soybeans]
gb|KHN17980.1|  E3 ubiquitin-protein ligase PUB23                       318   5e-99    
ref|XP_010651653.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    318   5e-99    
gb|EMT15255.1|  U-box domain-containing protein 22                      318   9e-99    
gb|KHN21196.1|  E3 ubiquitin-protein ligase PUB23                       315   1e-98    
ref|XP_007150020.1|  hypothetical protein PHAVU_005G119200g             317   2e-98    
dbj|BAJ90807.1|  predicted protein                                      317   3e-98    
gb|EMS67443.1|  E3 ubiquitin-protein ligase PUB22                       317   4e-98    
gb|KCW89305.1|  hypothetical protein EUGRSUZ_A01596                     312   2e-97    
gb|EYU36030.1|  hypothetical protein MIMGU_mgv1a025656mg                314   2e-97    
ref|XP_004959992.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    313   3e-97    
ref|XP_002524055.1|  Spotted leaf protein, putative                     312   6e-97    Ricinus communis
ref|XP_011008842.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    312   9e-97    
ref|NP_001047057.1|  Os02g0539200                                       313   9e-97    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007203251.1|  hypothetical protein PRUPE_ppa019526mg             311   1e-96    
gb|EAY86187.1|  hypothetical protein OsI_07564                          312   2e-96    Oryza sativa Indica Group [Indian rice]
ref|XP_004303404.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    311   2e-96    
ref|XP_002314258.1|  hypothetical protein POPTR_0009s02140g             310   4e-96    Populus trichocarpa [western balsam poplar]
ref|XP_010247277.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    310   4e-96    
ref|XP_002308324.2|  hypothetical protein POPTR_0006s21920g             310   5e-96    Populus trichocarpa [western balsam poplar]
ref|XP_008241066.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24       310   6e-96    
ref|XP_007132499.1|  hypothetical protein PHAVU_011G099300g             309   1e-95    
gb|EMT03610.1|  U-box domain-containing protein 23                      308   6e-95    
ref|XP_010263014.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    307   9e-95    
ref|XP_008391979.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24       305   3e-94    
ref|XP_008351505.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    305   5e-94    
ref|XP_007015663.1|  Plant U-box 24, putative                           304   7e-94    
ref|XP_011021424.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    303   2e-93    
ref|XP_009348947.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24       303   2e-93    
ref|XP_009630105.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    303   6e-93    
emb|CAN80214.1|  hypothetical protein VITISV_017908                     303   8e-93    Vitis vinifera
ref|XP_009791306.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    302   1e-92    
ref|XP_002299771.2|  hypothetical protein POPTR_0001s22390g             301   2e-92    Populus trichocarpa [western balsam poplar]
ref|XP_009613982.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    300   4e-92    
gb|KEH41885.1|  E3 ubiquitin-protein ligase PUB23-like protein          300   5e-92    
ref|XP_004241334.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    300   6e-92    
ref|XP_004497654.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    299   9e-92    
ref|XP_007145788.1|  hypothetical protein PHAVU_007G267800g             298   2e-91    
dbj|BAF02552.1|  hypothetical protein                                   298   4e-91    Nicotiana benthamiana
ref|XP_007027987.1|  Plant U-box 24                                     297   5e-91    
ref|XP_002323383.1|  U-box domain-containing family protein             297   6e-91    Populus trichocarpa [western balsam poplar]
ref|XP_009601958.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    297   8e-91    
ref|XP_011046429.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24       295   3e-90    
ref|XP_006378980.1|  hypothetical protein POPTR_0009s021501g            291   5e-90    
ref|XP_006361090.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    295   6e-90    
ref|XP_009790743.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    295   6e-90    
gb|ABK25393.1|  unknown                                                 295   6e-90    Picea sitchensis
ref|XP_004293107.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    296   8e-90    
ref|XP_006494890.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    294   9e-90    
ref|XP_009368316.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    294   9e-90    
gb|EYU36029.1|  hypothetical protein MIMGU_mgv1a025035mg                294   1e-89    
ref|XP_006362629.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    293   2e-89    
ref|XP_011090481.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    293   2e-89    
ref|XP_006424087.1|  hypothetical protein CICLE_v10028564mg             292   4e-89    
ref|XP_004506267.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    292   5e-89    
ref|XP_004975598.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    292   7e-89    
ref|XP_002265057.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23       291   8e-89    Vitis vinifera
ref|XP_002448808.1|  hypothetical protein SORBIDRAFT_06g033630          291   3e-88    Sorghum bicolor [broomcorn]
ref|XP_003539150.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    290   3e-88    
gb|ACG41924.1|  ubiquitin-protein ligase                                291   3e-88    Zea mays [maize]
emb|CDP10594.1|  unnamed protein product                                290   4e-88    
ref|XP_003540819.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    289   5e-88    
ref|NP_001142289.1|  ubiquitin-protein ligase                           291   5e-88    Zea mays [maize]
ref|XP_008230326.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    289   6e-88    
ref|XP_007207476.1|  hypothetical protein PRUPE_ppa006455mg             288   1e-87    
ref|XP_006362848.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    288   3e-87    
ref|NP_001141347.1|  hypothetical protein                               288   3e-87    Zea mays [maize]
ref|XP_002447815.1|  hypothetical protein SORBIDRAFT_06g016280          287   4e-87    Sorghum bicolor [broomcorn]
ref|XP_004228871.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    287   6e-87    
gb|EYU28510.1|  hypothetical protein MIMGU_mgv1a007216mg                285   3e-86    
ref|XP_006481860.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    284   6e-86    
ref|XP_006854619.1|  hypothetical protein AMTR_s00030p00161650          283   1e-85    
ref|XP_006430056.1|  hypothetical protein CICLE_v10011847mg             283   2e-85    
ref|XP_008450285.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    282   2e-85    
ref|XP_010254086.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    283   2e-85    
ref|XP_003579719.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    284   3e-85    
gb|KDP33049.1|  hypothetical protein JCGZ_13635                         281   6e-85    
ref|XP_008379129.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    281   7e-85    
gb|KGN66593.1|  hypothetical protein Csa_1G635930                       280   2e-84    
ref|XP_011077919.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24       280   3e-84    
ref|XP_010090506.1|  E3 ubiquitin-protein ligase                        279   6e-84    
dbj|BAJ95467.1|  predicted protein                                      278   8e-84    
ref|XP_010267514.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    278   1e-83    
gb|KCW50925.1|  hypothetical protein EUGRSUZ_J00575                     275   7e-83    
gb|KEH29760.1|  E3 ubiquitin-protein ligase PUB23-like protein          273   2e-81    
gb|EMS47331.1|  E3 ubiquitin-protein ligase PUB23                       273   2e-81    
gb|EAZ23349.1|  hypothetical protein OsJ_07045                          272   2e-81    Oryza sativa Japonica Group [Japonica rice]
emb|CAH67599.1|  OSIGBa0092M08.11                                       273   4e-81    Oryza sativa [red rice]
gb|EYU28509.1|  hypothetical protein MIMGU_mgv1a021492mg                268   4e-81    
ref|XP_011094534.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    271   4e-81    
ref|XP_004251097.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    270   2e-80    
ref|XP_010685444.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23       270   4e-80    
gb|EAY76602.1|  hypothetical protein OsI_04551                          266   2e-79    Oryza sativa Indica Group [Indian rice]
ref|XP_009612318.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    266   3e-79    
ref|NP_001044900.1|  Os01g0865700                                       266   4e-79    
ref|XP_009368324.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    265   4e-79    
ref|XP_008450468.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    266   4e-79    
ref|XP_010934556.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    265   1e-78    
ref|XP_006857831.1|  hypothetical protein AMTR_s00069p00038840          265   2e-78    
ref|XP_004166683.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    263   4e-78    
ref|XP_004139143.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    263   7e-78    
ref|XP_010024590.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    262   2e-77    
ref|XP_004970692.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    261   3e-77    
ref|XP_010107000.1|  E3 ubiquitin-protein ligase                        261   3e-77    
emb|CDY08490.1|  BnaA05g27260D                                          260   2e-76    
emb|CDY47911.1|  BnaAnng09430D                                          259   2e-76    
ref|XP_010024581.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    258   4e-76    
ref|XP_002884868.1|  U-box domain-containing protein 24                 258   1e-75    
emb|CDM85099.1|  unnamed protein product                                256   4e-75    
ref|XP_009786664.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    255   7e-75    
ref|XP_010543866.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24       256   8e-75    
dbj|BAH19773.1|  AT3G11840                                              256   9e-75    
sp|Q9SF15.1|PUB24_ARATH  RecName: Full=E3 ubiquitin-protein ligas...    256   9e-75    
emb|CDY01063.1|  BnaC05g41370D                                          255   1e-74    
ref|XP_006407405.1|  hypothetical protein EUTSA_v10020668mg             256   2e-74    
ref|NP_566402.1|  E3 ubiquitin-protein ligase PUB24                     256   2e-74    
ref|XP_011023142.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    254   2e-74    
gb|EAZ14266.1|  hypothetical protein OsJ_04193                          253   3e-74    
ref|XP_009146677.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    255   3e-74    
ref|XP_003564685.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    253   4e-74    
ref|XP_010486852.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24       254   8e-74    
emb|CDY67531.1|  BnaC01g44930D                                          253   9e-74    
ref|XP_002513722.1|  Spotted leaf protein, putative                     248   8e-73    
emb|CDX73849.1|  BnaA03g31980D                                          251   9e-73    
gb|KFK38549.1|  hypothetical protein AALP_AA3G128300                    251   1e-72    
ref|XP_009135188.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    249   6e-72    
ref|XP_010503987.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    242   7e-72    
emb|CDY53920.1|  BnaC03g73510D                                          248   7e-72    
ref|XP_009121126.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24       248   7e-72    
ref|XP_006299828.1|  hypothetical protein CARUB_v10016030mg             248   9e-72    
gb|KDP36107.1|  hypothetical protein JCGZ_08751                         246   1e-71    
ref|NP_001052769.1|  Os04g0417400                                       247   2e-71    
ref|XP_006348458.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    246   3e-71    
gb|KHN10042.1|  E3 ubiquitin-protein ligase PUB24                       244   3e-71    
ref|XP_011038585.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    243   8e-71    
ref|XP_002320209.2|  hypothetical protein POPTR_0014s09660g             243   2e-70    
ref|XP_010024574.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    243   2e-70    
ref|XP_010464915.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    244   4e-70    
gb|KDO70622.1|  hypothetical protein CISIN_1g041408mg                   242   8e-70    
ref|XP_010498165.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    243   8e-70    
ref|XP_002458817.1|  hypothetical protein SORBIDRAFT_03g040850          239   7e-69    
gb|EYU38687.1|  hypothetical protein MIMGU_mgv1a021867mg                236   3e-68    
ref|XP_008346772.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    237   7e-68    
ref|XP_006847707.1|  hypothetical protein AMTR_s00149p00072640          235   2e-67    
gb|KCW90456.1|  hypothetical protein EUGRSUZ_A02586                     233   3e-67    
ref|XP_004228911.2|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    235   3e-67    
ref|XP_008438233.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    234   6e-67    
ref|XP_004134357.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    229   3e-65    
ref|XP_010269983.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    229   5e-65    
ref|XP_008775085.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    226   2e-64    
ref|XP_010275264.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    227   3e-64    
ref|XP_008674784.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    226   5e-64    
ref|XP_002301421.2|  hypothetical protein POPTR_0002s17510g             224   3e-63    
gb|KCW90453.1|  hypothetical protein EUGRSUZ_A02583                     221   2e-62    
ref|XP_002523306.1|  ubiquitin-protein ligase, putative                 222   2e-62    
ref|XP_004308738.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    221   3e-62    
ref|XP_008232231.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    218   4e-61    
ref|XP_006648707.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    214   2e-60    
ref|XP_008796330.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    208   3e-57    
ref|XP_010911082.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    207   4e-57    
ref|XP_002441865.1|  hypothetical protein SORBIDRAFT_08g003790          207   1e-56    
ref|XP_001764309.1|  predicted protein                                  207   2e-56    
emb|CDP09334.1|  unnamed protein product                                206   3e-56    
gb|KCW76777.1|  hypothetical protein EUGRSUZ_D01133                     205   4e-56    
ref|XP_006653905.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    203   4e-56    
ref|XP_007215376.1|  hypothetical protein PRUPE_ppa005711mg             206   4e-56    
ref|XP_011093978.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    205   6e-56    
ref|XP_002533776.1|  ubiquitin-protein ligase, putative                 204   2e-55    
ref|XP_010497670.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    194   2e-55    
ref|XP_010054528.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    204   4e-55    
ref|XP_003520715.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    199   4e-55    
ref|XP_010271201.1|  PREDICTED: U-box domain-containing protein 2...    203   5e-55    
ref|XP_011086177.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    202   8e-55    
ref|XP_001783217.1|  predicted protein                                  200   2e-54    
ref|XP_009406325.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    198   3e-54    
ref|XP_009794381.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    200   4e-54    
ref|XP_003544976.1|  PREDICTED: U-box domain-containing protein 2...    200   5e-54    
ref|XP_008244313.1|  PREDICTED: U-box domain-containing protein 2...    200   7e-54    
ref|XP_009606431.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    199   7e-54    
gb|EAY96122.1|  hypothetical protein OsI_18000                          198   1e-53    
ref|XP_009770354.1|  PREDICTED: U-box domain-containing protein 2...    199   1e-53    
ref|XP_010097721.1|  E3 ubiquitin-protein ligase                        197   2e-53    
ref|XP_004229574.2|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    197   2e-53    
ref|XP_009393949.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    197   4e-53    
gb|ADI46214.1|  CMPG1b                                                  197   5e-53    
gb|ADI46213.1|  CMPG1a                                                  197   7e-53    
ref|XP_002264927.2|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    196   1e-52    
ref|XP_004977331.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    195   2e-52    
gb|KDP28458.1|  hypothetical protein JCGZ_14229                         194   2e-52    
ref|XP_004236923.1|  PREDICTED: U-box domain-containing protein 2...    196   2e-52    
ref|XP_009380073.1|  PREDICTED: U-box domain-containing protein 2...    195   2e-52    
ref|XP_009592688.1|  PREDICTED: U-box domain-containing protein 2...    196   3e-52    
ref|XP_007152651.1|  hypothetical protein PHAVU_004G147500g             195   5e-52    
gb|AAP03884.1|  Avr9/Cf-9 rapidly elicited protein 74                   194   1e-51    
ref|XP_009378957.1|  PREDICTED: U-box domain-containing protein 2...    194   1e-51    
ref|XP_006354605.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    193   1e-51    
ref|XP_002264761.2|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    193   1e-51    
ref|XP_009781197.1|  PREDICTED: U-box domain-containing protein 2...    193   1e-51    
ref|XP_003631249.1|  PREDICTED: U-box domain-containing protein 2...    193   2e-51    
gb|AIV00617.1|  U-box domain-containing protein                         193   2e-51    
ref|XP_006826592.1|  hypothetical protein AMTR_s00138p00053700          192   3e-51    
ref|XP_010102878.1|  U-box domain-containing protein 20                 192   4e-51    
ref|XP_006577483.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    184   6e-51    
ref|XP_010936891.1|  PREDICTED: U-box domain-containing protein 2...    191   8e-51    
ref|XP_009404142.1|  PREDICTED: U-box domain-containing protein 2...    191   9e-51    
emb|CDY50158.1|  BnaA01g26180D                                          190   2e-50    
ref|XP_006355051.1|  PREDICTED: U-box domain-containing protein 2...    191   2e-50    
ref|XP_010665787.1|  PREDICTED: U-box domain-containing protein 2...    190   3e-50    
ref|XP_011005992.1|  PREDICTED: U-box domain-containing protein 2...    189   4e-50    
ref|XP_004145841.1|  PREDICTED: U-box domain-containing protein 2...    189   5e-50    
ref|XP_009600234.1|  PREDICTED: U-box domain-containing protein 2...    189   5e-50    
ref|XP_004288606.1|  PREDICTED: U-box domain-containing protein 2...    189   6e-50    
ref|NP_001234240.1|  Avr9/Cf-9 rapidly elicited protein                 189   8e-50    
gb|KDP37425.1|  hypothetical protein JCGZ_07952                         189   9e-50    
gb|EMT22992.1|  U-box domain-containing protein 22                      190   9e-50    
gb|KDP32265.1|  hypothetical protein JCGZ_14786                         187   2e-49    
ref|NP_001066218.1|  Os12g0161100                                       187   2e-49    
ref|XP_011038250.1|  PREDICTED: U-box domain-containing protein 2...    187   3e-49    
ref|XP_009789261.1|  PREDICTED: U-box domain-containing protein 2...    187   3e-49    
ref|XP_008457035.1|  PREDICTED: U-box domain-containing protein 2...    187   4e-49    
ref|XP_006364055.1|  PREDICTED: U-box domain-containing protein 2...    186   6e-49    
ref|XP_009370082.1|  PREDICTED: U-box domain-containing protein 21      186   7e-49    
ref|XP_008798516.1|  PREDICTED: U-box domain-containing protein 2...    186   1e-48    
ref|XP_006372525.1|  U-box domain-containing family protein             186   1e-48    
ref|XP_004140703.1|  PREDICTED: U-box domain-containing protein 2...    184   2e-48    
ref|XP_004172231.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    185   2e-48    
gb|ADI46216.1|  CMPG1a                                                  184   2e-48    
ref|XP_009627928.1|  PREDICTED: U-box domain-containing protein 21      184   2e-48    
ref|XP_006469284.1|  PREDICTED: U-box domain-containing protein 2...    184   2e-48    
ref|XP_008456137.1|  PREDICTED: U-box domain-containing protein 2...    184   3e-48    
ref|XP_010107920.1|  U-box domain-containing protein 26                 183   4e-48    
emb|CDP01660.1|  unnamed protein product                                184   4e-48    
ref|XP_007141935.1|  hypothetical protein PHAVU_008G238500g             184   4e-48    
ref|XP_002306161.2|  hypothetical protein POPTR_0004s14720g             183   4e-48    
ref|XP_006448117.1|  hypothetical protein CICLE_v10015253mg             184   6e-48    
ref|XP_008381777.1|  PREDICTED: U-box domain-containing protein 2...    183   7e-48    
ref|XP_001776109.1|  predicted protein                                  182   7e-48    
ref|XP_003530079.1|  PREDICTED: U-box domain-containing protein 2...    183   7e-48    
ref|XP_007042451.1|  Plant U-box 26                                     182   9e-48    
gb|KHN25100.1|  U-box domain-containing protein 21                      182   1e-47    
ref|XP_004309747.1|  PREDICTED: U-box domain-containing protein 2...    182   1e-47    
ref|XP_008460073.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    183   1e-47    
gb|AAK69401.1|AF274564_1  immediate-early fungal elicitor protein...    182   1e-47    
ref|XP_009111906.1|  PREDICTED: U-box domain-containing protein 2...    181   2e-47    
gb|ABV89622.1|  U-box domain-containing protein                         181   2e-47    
ref|XP_009410070.1|  PREDICTED: U-box domain-containing protein 2...    181   3e-47    
gb|KHN39481.1|  U-box domain-containing protein 20                      180   3e-47    
ref|XP_008343072.1|  PREDICTED: U-box domain-containing protein 2...    181   4e-47    
gb|KGN46274.1|  hypothetical protein Csa_6G079190                       181   4e-47    
ref|XP_003519324.1|  PREDICTED: U-box domain-containing protein 2...    181   4e-47    
gb|ABK93469.1|  unknown                                                 180   5e-47    
ref|XP_002313124.2|  U-box domain-containing family protein             180   5e-47    
ref|XP_006299353.1|  hypothetical protein CARUB_v10015518mg             181   5e-47    
ref|XP_009351577.1|  PREDICTED: U-box domain-containing protein 2...    181   5e-47    
dbj|BAF01749.1|  hypothetical protein                                   180   7e-47    
ref|XP_002527537.1|  Spotted leaf protein, putative                     180   7e-47    
ref|NP_566632.1|  U-box domain-containing protein 25                    180   8e-47    
ref|XP_011000686.1|  PREDICTED: U-box domain-containing protein 2...    179   9e-47    
emb|CDX95458.1|  BnaC01g33500D                                          179   1e-46    
ref|XP_010466083.1|  PREDICTED: U-box domain-containing protein 25      179   1e-46    
ref|XP_002305224.1|  U-box domain-containing family protein             180   1e-46    
ref|XP_003616222.1|  U-box domain-containing protein                    180   1e-46    
ref|XP_006653385.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    176   1e-46    
ref|XP_010270217.1|  PREDICTED: U-box domain-containing protein 2...    179   2e-46    
ref|XP_010263503.1|  PREDICTED: U-box domain-containing protein 2...    179   2e-46    
gb|ADI46217.1|  CMPG1b                                                  179   2e-46    
ref|XP_007199948.1|  hypothetical protein PRUPE_ppa006352mg             179   2e-46    
emb|CDX99233.1|  BnaC05g33480D                                          179   2e-46    
ref|XP_006286021.1|  hypothetical protein CARUB_v10007551mg             179   2e-46    
ref|XP_004490855.1|  PREDICTED: U-box domain-containing protein 2...    179   2e-46    
ref|XP_003533316.1|  PREDICTED: U-box domain-containing protein 2...    179   2e-46    
ref|XP_010507691.1|  PREDICTED: U-box domain-containing protein 2...    179   2e-46    
ref|XP_006406505.1|  hypothetical protein EUTSA_v10022190mg             178   3e-46    
ref|XP_011085881.1|  PREDICTED: U-box domain-containing protein 21      179   3e-46    
ref|XP_008795339.1|  PREDICTED: U-box domain-containing protein 21      179   3e-46    
ref|XP_010105562.1|  U-box domain-containing protein 20                 179   4e-46    
ref|XP_010468287.1|  PREDICTED: U-box domain-containing protein 2...    177   4e-46    
ref|XP_003600684.1|  U-box domain-containing protein                    178   4e-46    
gb|KFK39278.1|  hypothetical protein AALP_AA3G223600                    177   5e-46    
ref|XP_010279125.1|  PREDICTED: U-box domain-containing protein 2...    178   6e-46    
ref|XP_010932523.1|  PREDICTED: U-box domain-containing protein 2...    178   6e-46    
ref|XP_002318308.2|  hypothetical protein POPTR_0012s03960g             177   7e-46    
ref|XP_008780992.1|  PREDICTED: U-box domain-containing protein 2...    177   7e-46    
ref|XP_011043911.1|  PREDICTED: U-box domain-containing protein 21      177   8e-46    
ref|XP_009360045.1|  PREDICTED: U-box domain-containing protein 2...    177   1e-45    
ref|XP_007045491.1|  ARM repeat superfamily protein, putative           177   1e-45    
ref|XP_007036951.1|  ARM repeat superfamily protein                     177   1e-45    
ref|XP_011003764.1|  PREDICTED: U-box domain-containing protein 2...    177   2e-45    
gb|KHN43656.1|  U-box domain-containing protein 20                      177   2e-45    
ref|NP_001146521.1|  uncharacterized protein LOC100280112               176   2e-45    
ref|XP_010558593.1|  PREDICTED: U-box domain-containing protein 21      176   2e-45    
ref|XP_008465536.1|  PREDICTED: U-box domain-containing protein 2...    176   2e-45    
ref|XP_009356001.1|  PREDICTED: U-box domain-containing protein 2...    176   2e-45    
gb|KHN24150.1|  U-box domain-containing protein 20                      176   3e-45    
ref|XP_008375014.1|  PREDICTED: U-box domain-containing protein 2...    175   3e-45    
ref|XP_002518745.1|  Spotted leaf protein, putative                     175   3e-45    
ref|XP_011099937.1|  PREDICTED: U-box domain-containing protein 2...    176   3e-45    
ref|XP_010091753.1|  U-box domain-containing protein 21                 176   4e-45    
ref|XP_010440861.1|  PREDICTED: U-box domain-containing protein 2...    176   4e-45    
ref|XP_010906325.1|  PREDICTED: U-box domain-containing protein 2...    175   5e-45    
ref|XP_002991371.1|  hypothetical protein SELMODRAFT_133552             175   5e-45    
ref|NP_001238594.1|  syringolide-induced protein 13-1-1                 175   5e-45    
ref|XP_004250456.1|  PREDICTED: U-box domain-containing protein 2...    174   5e-45    
ref|XP_011024493.1|  PREDICTED: U-box domain-containing protein 2...    175   5e-45    
ref|XP_006379784.1|  hypothetical protein POPTR_0008s13700g             175   5e-45    
ref|XP_004142305.1|  PREDICTED: U-box domain-containing protein 2...    175   6e-45    
gb|KHN08793.1|  U-box domain-containing protein 21                      175   7e-45    
ref|XP_003538386.1|  PREDICTED: U-box domain-containing protein 2...    175   7e-45    
ref|XP_008373128.1|  PREDICTED: U-box domain-containing protein 2...    174   8e-45    
gb|ABK95813.1|  unknown                                                 174   1e-44    
gb|ACU18165.1|  unknown                                                 174   1e-44    
ref|XP_010435581.1|  PREDICTED: U-box domain-containing protein 2...    174   1e-44    
ref|XP_007219082.1|  hypothetical protein PRUPE_ppa014931mg             172   1e-44    
ref|XP_004503116.1|  PREDICTED: U-box domain-containing protein 2...    174   1e-44    



>ref|XP_009760074.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Nicotiana 
sylvestris]
Length=403

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/411 (64%), Positives = 334/411 (81%), Gaps = 22/411 (5%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M+EIQVPPYF+CPISLE+M+DP+T+STGITYDR+NIEKWIFS KN TCPVTKQ+L+GTD 
Sbjct  1     MDEIQVPPYFICPISLEMMRDPITVSTGITYDRENIEKWIFSAKNNTCPVTKQSLTGTD-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN+ LRR+IQSWCTL+ASHG+ERFPTPKPP++K  I+KLL++AKS PEM  K L++
Sbjct  60    --LTPNVTLRRLIQSWCTLNASHGIERFPTPKPPISKPQIMKLLKEAKS-PEMQMKCLKS  116

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSEDN--------PTDDALYVLHNLGLSENG  1062
             LRS+A EN ANKRCMESAG AEFLA II ++ +N          D+AL +L++L LSE+G
Sbjct  117   LRSIASENDANKRCMESAGAAEFLASIIISNRNNEGFGSLKGTKDEALSILYHLKLSEHG  176

Query  1061  LRS-ILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFF  885
             LR+ I+G + +FI+SLTR+MQHGSYESRAYAV+LLK    +  +     +        FF
Sbjct  177   LRTLIMGGNGEFIESLTRIMQHGSYESRAYAVLLLKKGFNSFEILSLKQE--------FF  228

Query  884   HQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEW  705
              QVVQ+L D  S+KASK++L +L NVCQ GRNR+KAAEA A  V+++LLLD+ +K  CE 
Sbjct  229   TQVVQVLSDEISQKASKASLQILVNVCQWGRNRVKAAEADAVRVLVNLLLDSMDKSACEL  288

Query  704   GLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVV  525
              L +L+QLC+ AEGRAE+LKHAAGLA+VS+KILRVS++A+ER ++IL+SI+KFSATPSV+
Sbjct  289   MLMLLDQLCQSAEGRAELLKHAAGLAIVSKKILRVSKLASERAIKILHSISKFSATPSVL  348

Query  524   QEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             QEML LGV AKLCLV+QVDCG  K K+RA EILKLHAK W++SPC+PL+L+
Sbjct  349   QEMLNLGVVAKLCLVLQVDCG-SKTKDRAREILKLHAKAWRSSPCVPLNLL  398



>ref|XP_009592440.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Nicotiana 
tomentosiformis]
Length=403

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/411 (64%), Positives = 332/411 (81%), Gaps = 22/411 (5%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M+EIQVPPYF+CPISLE+M+DP+T+STGITYDR+NIEKWIFS KN TCPVTKQ+L GT+ 
Sbjct  1     MDEIQVPPYFICPISLEMMRDPITVSTGITYDRENIEKWIFSAKNNTCPVTKQSLKGTE-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN+ LRR+IQSWCTL+ASHG+ERFPTPKPP++K  I+KLL++AKS PEM  K L++
Sbjct  60    --LTPNVTLRRLIQSWCTLNASHGIERFPTPKPPISKPQIMKLLKEAKS-PEMQMKCLKS  116

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSEDN--------PTDDALYVLHNLGLSENG  1062
             LRS+A EN ANKRCMESAG AEFLA II ++ ++          D+AL +L++L LSE+G
Sbjct  117   LRSIASENDANKRCMESAGAAEFLASIISSNPNDEGFGSLTGTKDEALSILYHLKLSEHG  176

Query  1061  LRS-ILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFF  885
             LRS I+G + +FI+SLTR+MQ GSYESRAY VMLLK    +  +     +        FF
Sbjct  177   LRSLIMGGNGEFIESLTRIMQPGSYESRAYVVMLLKKAFNSFEILSLKQE--------FF  228

Query  884   HQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEW  705
              QVVQ+L D  S+KASK++L +L NVCQ GRNR+KAAEA A  V+++LLLD+ +KR CE 
Sbjct  229   TQVVQVLSDEISQKASKASLQILVNVCQWGRNRVKAAEADAVRVLVNLLLDSTDKRACEL  288

Query  704   GLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVV  525
              L +L+QLC+ AEGRAE+LKHAAGLA+VS+KILRVS++A+ER ++IL+SI+KFSATP+VV
Sbjct  289   MLMLLDQLCQSAEGRAELLKHAAGLAIVSKKILRVSKLASERAIKILHSISKFSATPTVV  348

Query  524   QEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             QEML LGV AKLCLV+QVDCG  K K+RA EILKLHAK W++SPC+P++L+
Sbjct  349   QEMLNLGVVAKLCLVLQVDCG-SKTKDRAREILKLHAKAWRSSPCVPVNLL  398



>ref|XP_006348454.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Solanum tuberosum]
Length=406

 Score =   522 bits (1345),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 265/410 (65%), Positives = 322/410 (79%), Gaps = 19/410 (5%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             MEEIQVPPYF+CPISLE+MKDPVTISTGITYDR+NIEKWIFS KN TCP TKQ+L+  + 
Sbjct  1     MEEIQVPPYFICPISLEMMKDPVTISTGITYDRENIEKWIFSAKNNTCPATKQSLTCIE-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN+ LRR IQSWCT++ASHG+ERFPTPKPPV+K  I+KLL++AKS P+M  K L+ 
Sbjct  60    --LTPNVTLRRFIQSWCTINASHGIERFPTPKPPVSKPQIIKLLKEAKS-PKMQMKSLKR  116

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSED--------NPTDDALYVLHNLGLSENG  1062
             LRS+A EN ANKRCMESAG  EFLA II  S +        +  D+AL +L+ L LSE G
Sbjct  117   LRSIASENDANKRCMESAGATEFLAFIINNSNEVFEEEGFMSTKDEALSILYQLKLSEQG  176

Query  1061  LRS-ILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFF  885
             LRS I+  + +FI+SLTRVMQHGSYESRAYAVML+K M E +T N  LS         FF
Sbjct  177   LRSLIISGNGEFIESLTRVMQHGSYESRAYAVMLMKDMFEVSTPNLLLSLKQE-----FF  231

Query  884   HQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEW  705
              QVVQ+LRD  S+KA+K++L +L N C  GRN++KAAEAGA  V++DLLLD++EKR CE 
Sbjct  232   IQVVQVLRDEISQKATKASLQVLVNTCPFGRNKVKAAEAGAIRVLVDLLLDSSEKRSCEL  291

Query  704   GLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVV  525
              L +L+QLC+ AEGRAE+L H  GLA+VS+KILRVS+V +ER ++IL+SI+KFS+TPSV+
Sbjct  292   MLILLDQLCQSAEGRAELLNHPGGLAIVSKKILRVSKVGSERAIKILHSISKFSSTPSVI  351

Query  524   QEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDL  375
             QEML LGV AKLCLV+QVDCG  K KERA EILK HAK W NSPC+P +L
Sbjct  352   QEMLSLGVVAKLCLVLQVDCG-SKAKERAKEILKFHAKAWTNSPCIPNNL  400



>gb|ABA59556.1| U-box protein [Capsicum annuum]
Length=407

 Score =   521 bits (1342),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 262/413 (63%), Positives = 328/413 (79%), Gaps = 18/413 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             MEEIQVPPYFLCPISLE+MKDPVTISTGITYDR+NIE+WIFS KN TCPVTKQ+L+  + 
Sbjct  1     MEEIQVPPYFLCPISLEMMKDPVTISTGITYDRENIERWIFSAKNNTCPVTKQSLTSIE-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN+ LRR IQSWCTL+ASHG+ERFPTPKPPV+K+ ILKL+++AKS  EM  K L T
Sbjct  60    --LTPNVTLRRFIQSWCTLNASHGIERFPTPKPPVSKAQILKLMKEAKSR-EMQMKSLNT  116

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSED--------NPTDDALYVLHNLGLSENG  1062
             LRS+A  N ANKRCMESAG AEFLA ++  S D        +  D+AL +L+ L LSE+G
Sbjct  117   LRSIASVNDANKRCMESAGAAEFLASVVIDSSDVLGEEGFMSTKDEALSILYQLKLSEDG  176

Query  1061  LRSIL-GHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFF  885
             LRS++   + +FI+SLTRVMQ GSYESRAYAVML+K M E +TL    S L       FF
Sbjct  177   LRSLITSGNGEFIESLTRVMQRGSYESRAYAVMLMKDMFEASTLPTLFSSLKKE----FF  232

Query  884   HQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEW  705
              QVV++LRD  S+KA+K++L +LA+ C  GRNR+KAAEAGA  V++DLLLD++EKR CE 
Sbjct  233   AQVVRVLRDEISQKATKASLQVLAHACPFGRNRVKAAEAGAVRVLVDLLLDSSEKRTCEL  292

Query  704   GLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVV  525
              L +L+Q+C+ AEGRAE+L H  GLA+VS+KILRVS+V +ER ++IL+SI+KFS+T SVV
Sbjct  293   MLILLDQICQSAEGRAELLNHPGGLAIVSKKILRVSKVGSERAIKILHSISKFSSTQSVV  352

Query  524   QEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIHN  366
             QEML LGV AKLCLV+QVDCG  K K+RA +ILK+HAK W+NSPC+P++L+ +
Sbjct  353   QEMLSLGVVAKLCLVLQVDCG-SKAKDRARDILKIHAKAWRNSPCIPMNLLSS  404



>ref|XP_004228696.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Solanum lycopersicum]
Length=409

 Score =   521 bits (1342),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 266/416 (64%), Positives = 326/416 (78%), Gaps = 22/416 (5%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQAL-SGTD  1401
             MEEIQ+PPYF+CPISLEIMKDPVTISTGITYDR+NIEKWIFS KN TCPVTKQ+L +G +
Sbjct  1     MEEIQIPPYFICPISLEIMKDPVTISTGITYDRENIEKWIFSAKNNTCPVTKQSLITGIE  60

Query  1400  DEFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQ  1221
                LTPN+ LRR+IQSWCT++ASHG+ERFPTPKPP++K  I+KLL++AKS P+M  K L+
Sbjct  61    ---LTPNVTLRRLIQSWCTINASHGIERFPTPKPPISKPQIIKLLKEAKS-PKMQMKSLK  116

Query  1220  TLRSMAPENAANKRCMESAGVAEFLAQIIKTSED----------NPTDDALYVLHNLGLS  1071
             TLRS+A EN ANKRCMESAG  EFLA II  + +          +  D+AL +L+ L LS
Sbjct  117   TLRSIAFENDANKRCMESAGAMEFLASIINNNSNEVFEEEEGFMSIKDEALSILYQLKLS  176

Query  1070  ENGLRS-ILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnl  894
             ENGLRS I+  +  FI+SLTRVMQHGSYESRAYA+ML+K M E +T  P LS        
Sbjct  177   ENGLRSLIMSGNGGFIESLTRVMQHGSYESRAYAIMLMKDMFEVSTPTPLLSLKKE----  232

Query  893   SFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRY  714
              FF QVVQ+LRD  S+KA K++L +L N C  GRNR+KAAEAGA  V++DLLLD++EKR 
Sbjct  233   -FFIQVVQVLRDEISQKAMKASLQVLVNACPFGRNRVKAAEAGAVRVLVDLLLDSSEKRV  291

Query  713   CEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATP  534
             CE  L +L+QLC+ AEGRAE+L H  GLA+VS+KILRVS+V +ER ++IL+SI+KFS+TP
Sbjct  292   CELMLILLDQLCQSAEGRAELLNHPGGLAIVSKKILRVSKVGSERAIKILHSISKFSSTP  351

Query  533   SVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIHN  366
             SVVQEML LGV  KLCLV+QVDCG  K KERA EILK HAK W+NSPC+  +L+ +
Sbjct  352   SVVQEMLSLGVVTKLCLVLQVDCG-SKAKERAREILKFHAKAWRNSPCISNNLLSS  406



>ref|XP_006348457.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Solanum tuberosum]
Length=406

 Score =   519 bits (1337),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 263/413 (64%), Positives = 323/413 (78%), Gaps = 19/413 (5%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             MEEIQVPPYF+CPISLE+MKDPVTISTGITYDR+NIEKWIFS KN  CP TKQ+L+  + 
Sbjct  1     MEEIQVPPYFICPISLEMMKDPVTISTGITYDRENIEKWIFSAKNNICPATKQSLTCIE-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN+ LRR IQSWCT++ASHG+ERFPTPKPPV+K  I+KLL++AKS P+M  K L+ 
Sbjct  60    --LTPNVTLRRFIQSWCTINASHGIERFPTPKPPVSKPQIIKLLKEAKS-PKMQMKSLKR  116

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSED--------NPTDDALYVLHNLGLSENG  1062
             LRS+A EN ANKRCMESAGV EFLA II  S +        +  D+AL +L+ L LSE G
Sbjct  117   LRSIASENDANKRCMESAGVMEFLASIINNSNEVFEEEGFMSIKDEALSILYQLKLSEQG  176

Query  1061  LRS-ILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFF  885
             L+S I+  + +FI+SLTRVMQHGSYESRAYAVML+K M E +T    LS         FF
Sbjct  177   LKSLIMSGNGEFIESLTRVMQHGSYESRAYAVMLMKDMFEVSTPTLLLSLKLE-----FF  231

Query  884   HQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEW  705
              QVVQ+LRD  S KA+K++L +L + C  GRNR+KAAEAGA  V++D+LLD++EKR CE 
Sbjct  232   TQVVQVLRDEISLKATKASLQVLVHACPFGRNRVKAAEAGAIRVLVDVLLDSSEKRVCEL  291

Query  704   GLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVV  525
              L +L+QLC+ AEGRAE+L H  GLA+VS+KILRVS+V +ER ++IL+SI+KFS+TPSVV
Sbjct  292   MLILLDQLCQSAEGRAELLNHPGGLAIVSKKILRVSKVGSERAIKILHSISKFSSTPSVV  351

Query  524   QEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIHN  366
             QEML LGV AKLCLV+QVDCG  K KERA EILK HAK W+NSPC+P +L+ +
Sbjct  352   QEMLSLGVVAKLCLVLQVDCG-SKAKERAREILKFHAKAWRNSPCVPNNLLSS  403



>ref|XP_010315681.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase PUB22-like 
[Solanum lycopersicum]
Length=409

 Score =   516 bits (1330),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 260/415 (63%), Positives = 324/415 (78%), Gaps = 20/415 (5%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             MEEIQ+P YF+CPISLE+MKDPVTISTGITYDR+NIEKW FS KN  CPVTKQ+L  + +
Sbjct  1     MEEIQIPSYFICPISLEMMKDPVTISTGITYDRENIEKWTFSAKNNICPVTKQSLITSIE  60

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN+ LRR+IQSWCT++ASHG+ERFPTPKPPV+K  I+KLL++AKS P+M  K L+T
Sbjct  61    --LTPNVTLRRLIQSWCTINASHGIERFPTPKPPVSKPQIIKLLKEAKS-PKMQMKSLKT  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSED----------NPTDDALYVLHNLGLSE  1068
             LRS+A EN ANKRCMESAG  EFLA II  +            +   +AL +L+ L LSE
Sbjct  118   LRSIASENDANKRCMESAGAMEFLASIINNNSSEVFEEEEGFMSTKXEALSILYQLKLSE  177

Query  1067  NGLRS-ILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlS  891
             NGL+S I+  + +FI+SLTRVMQHGSYESRAY VML+K M E +T  P LS         
Sbjct  178   NGLKSLIMSGNGEFIESLTRVMQHGSYESRAYVVMLMKDMFEVSTPTPLLSLKQE-----  232

Query  890   FFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYC  711
             FF QVVQ+LRD  S+KA+K++L +L + C  GRNR+KAAEAGA  V++DLLLD++EKR C
Sbjct  233   FFTQVVQVLRDEISQKATKASLQVLVHACPFGRNRVKAAEAGAIRVLVDLLLDSSEKRVC  292

Query  710   EWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPS  531
             E  L +L+Q+C+ AEGRAE+L H  GLA+VS+KILRVS+V +ER ++IL+SI+KFS+TPS
Sbjct  293   ELMLILLDQICQSAEGRAELLNHPGGLAIVSKKILRVSKVGSERAIKILHSISKFSSTPS  352

Query  530   VVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIHN  366
             VVQEML LGV AKLCLV+QVDCG  K KERA EILK HAK W+NSPC+P++L+ +
Sbjct  353   VVQEMLSLGVVAKLCLVLQVDCG-SKAKERAREILKFHAKAWRNSPCIPMNLLSS  406



>ref|XP_004228691.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Solanum lycopersicum]
Length=408

 Score =   514 bits (1323),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 263/415 (63%), Positives = 322/415 (78%), Gaps = 21/415 (5%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             MEEIQ+PPYF+CPISLE+MKDPVTISTGITYDR+NIEKWIFS KN TCP TKQAL+  + 
Sbjct  1     MEEIQIPPYFICPISLEMMKDPVTISTGITYDRENIEKWIFSAKNNTCPATKQALTCIE-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN+ LRR IQSWCTL+ SHG+ERFPTPKPPV+K  I+KLL++AKS P++  K L+ 
Sbjct  60    --LTPNVTLRRFIQSWCTLNESHGIERFPTPKPPVSKPQIIKLLKEAKS-PKLQMKSLKR  116

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQII-KTSED---------NPTDDALYVLHNLGLSE  1068
             LRS+A +N ANKRCMESAG  EFLA II K S +         +  D+AL +L+ L LSE
Sbjct  117   LRSIASKNDANKRCMESAGAMEFLASIINKNSSEVFEEEEGIMSIKDEALSILYQLKLSE  176

Query  1067  NGLRS-ILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlS  891
             NGLRS IL  + +FI+SLTRVMQHGSYE RAY VML+K M E +T    LS         
Sbjct  177   NGLRSLILSGNGEFIESLTRVMQHGSYEFRAYTVMLMKDMFEVSTPTLLLSLKKE-----  231

Query  890   FFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYC  711
             FF QVVQ+LRD  S+KA K++L +L + C  GRNR+K AEAGA  V+IDLLLD++EKR C
Sbjct  232   FFTQVVQVLRDEISQKAMKASLQVLVHACPFGRNRVKVAEAGAIRVLIDLLLDSSEKRVC  291

Query  710   EWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPS  531
             E  L +L+Q+C+ AEGRAE+L H  GLA+VS+KILRVS+V +ER ++IL+SI+KFS+TPS
Sbjct  292   ELMLILLDQICQSAEGRAELLNHPGGLAIVSKKILRVSKVGSERAIKILHSISKFSSTPS  351

Query  530   VVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIHN  366
             VVQEML LGV AKLCLV+QVDCG  K KERA EILK+HAK W+NSPC+P +L+ +
Sbjct  352   VVQEMLSLGVVAKLCLVLQVDCG-SKAKERAREILKIHAKTWRNSPCIPNNLLSS  405



>ref|XP_004228690.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Solanum lycopersicum]
Length=408

 Score =   514 bits (1323),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 262/409 (64%), Positives = 319/409 (78%), Gaps = 21/409 (5%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             MEEIQVPPYF+CPISLEIMKDPVTISTG+TYDR+NIEKWIF+ KN TCP TKQ+L+  + 
Sbjct  1     MEEIQVPPYFICPISLEIMKDPVTISTGMTYDRENIEKWIFTAKNNTCPATKQSLTCIE-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN+ LRR IQSWCTL+ SHG+ERFPTPKPPV+K  I+KLL++AKS P++  K L+ 
Sbjct  60    --LTPNVTLRRFIQSWCTLNESHGIERFPTPKPPVSKPQIIKLLKEAKS-PKLQMKSLKR  116

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTS-----EDNP-----TDDALYVLHNLGLSE  1068
             LRS+A EN ANKRCMESAG  EFLA II  +     ED        D+AL +L+ L LSE
Sbjct  117   LRSIASENDANKRCMESAGAMEFLASIINKNVNEVFEDEEGFMSIKDEALSILYQLKLSE  176

Query  1067  NGLRSILG-HDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlS  891
             NGL+S++   + +FI+SLTRVMQHGSYESRAYAVML+K+M E +T  P LS         
Sbjct  177   NGLKSLISIGNGEFIESLTRVMQHGSYESRAYAVMLMKNMFEVSTPTPLLSLKKE-----  231

Query  890   FFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYC  711
             FF QVVQ+L+D  S+KA K++L +L NVC  GRNR+KAAE G   V++DLLLD+ EKR C
Sbjct  232   FFIQVVQVLKDEISQKAKKASLQVLVNVCPFGRNRVKAAEVGTIRVLVDLLLDSYEKRVC  291

Query  710   EWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPS  531
             E  L +L+QLC+ AEGRAE+L H  GLA+VS+KILRVS+V +ER ++IL+SI+KFS+TPS
Sbjct  292   ELMLILLDQLCQSAEGRAELLNHPGGLAIVSKKILRVSKVGSERAIKILHSISKFSSTPS  351

Query  530   VVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLP  384
             VVQEML LGV AKLCLV+QVDCG  K KERA EILK HAK W+NSPC+P
Sbjct  352   VVQEMLSLGVVAKLCLVLQVDCG-SKAKERAREILKFHAKAWRNSPCIP  399



>ref|XP_006348456.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Solanum tuberosum]
Length=411

 Score =   511 bits (1317),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 264/418 (63%), Positives = 323/418 (77%), Gaps = 24/418 (6%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQAL-SGTD  1401
             MEEIQ+PPYF+CPISLE+MKDPVTISTGITYDR+NIEKWIFS KN TCPVTKQ+L +G +
Sbjct  1     MEEIQIPPYFICPISLEMMKDPVTISTGITYDRENIEKWIFSAKNNTCPVTKQSLITGIE  60

Query  1400  DEFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQ  1221
                LTPN+ LRR IQSWCT++ASHG+ERFPTPKPPV+K  I+KLL++AKS P M  K L+
Sbjct  61    ---LTPNVTLRRFIQSWCTINASHGIERFPTPKPPVSKPQIIKLLKEAKS-PMMQMKSLK  116

Query  1220  TLRSMAPENAANKRCMESAGVAEFLAQIIKTSED------------NPTDDALYVLHNLG  1077
             TLRS+A EN ANKRCMESAG  EFLA II  +              +  D+AL +L+ L 
Sbjct  117   TLRSIASENDANKRCMESAGAMEFLASIINNNNSNEVFEEEEEGFMSTKDEALSILYQLK  176

Query  1076  LSENGLRS-ILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttl  900
             LSE GL+S I+  + +FI+SLT VMQHGSYESRAYAVML+K M E +T    LS      
Sbjct  177   LSEQGLKSLIMSGNGEFIESLTHVMQHGSYESRAYAVMLMKDMFEVSTPTLLLSLKQE--  234

Query  899   nlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEK  720
                FF QVVQ+LRD  S+KA+K++L +L + C  GRNR+KAAEAGA  V++DLLLD++EK
Sbjct  235   ---FFTQVVQVLRDEISQKATKASLQVLVHACPFGRNRVKAAEAGAIRVLVDLLLDSSEK  291

Query  719   RYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSA  540
             R CE  L +L+QLC  AEGRAE+L H  GLA+VS+KILRVS+V +ER ++IL+SI+KFS+
Sbjct  292   RVCELMLILLDQLCLSAEGRAELLNHPGGLAIVSKKILRVSKVGSERAIKILHSISKFSS  351

Query  539   TPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIHN  366
             TPSVVQEML LGV AKLCLV+QVDCG  K+KERA EILK HAK W NSPC+P +L+ +
Sbjct  352   TPSVVQEMLSLGVVAKLCLVLQVDCG-SKSKERAREILKFHAKAWSNSPCIPNNLLSS  408



>ref|XP_006348455.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Solanum tuberosum]
Length=410

 Score =   504 bits (1297),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 259/417 (62%), Positives = 321/417 (77%), Gaps = 23/417 (6%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             MEEIQVP YF+CPISLE+MKDPVTISTGITYDR+NIEKW+FS KN TCP TKQ+L+  + 
Sbjct  1     MEEIQVPSYFICPISLEMMKDPVTISTGITYDRENIEKWVFSEKNNTCPATKQSLTCIE-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN+ LRR+IQSWCT++ASHG+ERFPTPKPPV+K  I+KLL++AKS P++  K L+ 
Sbjct  60    --LTPNVTLRRLIQSWCTINASHGIERFPTPKPPVSKPQIIKLLKEAKS-PKLQMKSLKR  116

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSED------------NPTDDALYVLHNLGL  1074
             LRS+A EN ANK CMESAG  EFLA II  +              +  D+AL +L+ L L
Sbjct  117   LRSIASENDANKHCMESAGAMEFLASIINNNNSNEVFEEEEEGFMSTKDEALSILYQLKL  176

Query  1073  SENGLRS-ILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttln  897
             SE GL+S I+  + +FI+SLTRVMQHGSYESRAYAVML+K M E +T    LS       
Sbjct  177   SEQGLKSLIMSGNGEFIESLTRVMQHGSYESRAYAVMLMKDMFEVSTPTLLLSLKQE---  233

Query  896   lSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKR  717
               FF QVVQ+LRD  S+KA+K++L +L + C  GRNR+KAAEAGA  V++DLLLD++EKR
Sbjct  234   --FFTQVVQVLRDEISQKATKASLQVLVHACPFGRNRVKAAEAGAIRVLVDLLLDSSEKR  291

Query  716   YCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSAT  537
              CE  L +L+QLC  AEGRAE+L H  GLA+VS+KILRVS+V +ER ++IL+SI+KFS+T
Sbjct  292   VCELMLILLDQLCLSAEGRAELLNHPGGLAIVSKKILRVSKVGSERAIKILHSISKFSST  351

Query  536   PSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIHN  366
             PSVVQEML LGV AKLCLV+QVDCG  K+KERA EILK HAK W NSPC+P +L+ +
Sbjct  352   PSVVQEMLSLGVVAKLCLVLQVDCG-SKSKERAREILKFHAKAWSNSPCIPNNLLSS  407



>ref|XP_007027990.1| Plant U-box 23 [Theobroma cacao]
 gb|EOY08492.1| Plant U-box 23 [Theobroma cacao]
Length=411

 Score =   493 bits (1269),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 250/418 (60%), Positives = 314/418 (75%), Gaps = 24/418 (6%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M+EI VPP+F+CPISLEIMKDPVT+STGITYDR++IEKW+FSGKN TCPVTKQ ++  D 
Sbjct  1     MDEIDVPPFFICPISLEIMKDPVTVSTGITYDRESIEKWLFSGKNTTCPVTKQVITDCD-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQSWC L+ASHG+ER PTPKPP++K+ I KLL  A S P      L+ 
Sbjct  60    --LTPNHTLRRLIQSWCMLNASHGIERIPTPKPPISKAQITKLLNDATS-PHQQISCLRR  116

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKT--------SEDN------PTDDALYVLHNL  1080
             L+S+A EN  NKRCMES+G  EFLA I+          S DN      PTD+AL +L+NL
Sbjct  117   LQSIASENTTNKRCMESSGAVEFLASIVSNYDFTAAEESFDNEFESTRPTDEALSILYNL  176

Query  1079  GLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttl  900
              LSE  L++++  +  FI SLTRVMQ GSYESRAYA++LLKSMLE       +S      
Sbjct  177   QLSEAALKNLMRKNGDFIVSLTRVMQRGSYESRAYAILLLKSMLEIADPMQLISLRPE--  234

Query  899   nlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEK  720
                 F +++Q+LRD  S++ASK+ L LL ++   GRN+IKAAEAGA +V+IDLLLD++E+
Sbjct  235   ---LFVELIQVLRDQISQQASKATLQLLVSISPWGRNKIKAAEAGAVSVLIDLLLDSSER  291

Query  719   RYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSA  540
             R CE  L+VL+ LC CAEGRAE+L+H AGLA+VS+KILRVS VA+ER +RIL SI+KF A
Sbjct  292   RACEMILTVLDALCGCAEGRAELLRHGAGLAIVSKKILRVSLVASERAVRILLSISKFCA  351

Query  539   TPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIHN  366
             T +V+ EMLQLGV AKLCLV+QVDCG  K KERA E+LKLHAK WKNSPC+P++L+ +
Sbjct  352   TSNVLHEMLQLGVVAKLCLVLQVDCGY-KTKERAREVLKLHAKAWKNSPCIPINLLSS  408



>gb|EYU38686.1| hypothetical protein MIMGU_mgv1a020011mg [Erythranthe guttata]
Length=413

 Score =   493 bits (1268),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 251/418 (60%), Positives = 317/418 (76%), Gaps = 26/418 (6%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M EI++PPYFLCPI+L+IMKDPVT+STGITYDR++IEKWIFS KN+ CPVTKQ L   D 
Sbjct  1     MAEIEIPPYFLCPITLDIMKDPVTVSTGITYDRESIEKWIFSDKNSICPVTKQVLIDPD-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPNI LRR IQSWCTL+A+HGVER PTPK PVT+S +LKLL  AKS+ +M  K LQT
Sbjct  60    --LTPNITLRRFIQSWCTLNATHGVERLPTPKAPVTRSQLLKLLSDAKSSQQMQTKSLQT  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQII----------KTSED------NPTDDALYVLH  1086
             LRS+A +N  N+RCME+AGVAEFLA +I          + SE+        +D+AL +++
Sbjct  118   LRSVANQNQTNRRCMETAGVAEFLAALIVKNTHEASRSEVSEEYLSDLNKSSDEALAIIY  177

Query  1085  NLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltt  906
             +L L+E+GL+  L ++  F++SLT VMQ+GSYESRAYAVMLLKSM+E    +  +S    
Sbjct  178   SLRLTESGLKKAL-NNGDFVESLTFVMQNGSYESRAYAVMLLKSMVEVAEPSLLISLKPE  236

Query  905   tlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTN  726
                  FF +V QIL D  S+K++K+ L +L   C  GRNRIKA EAGA  V++DLLLD+ 
Sbjct  237   -----FFSEVSQILSDQISQKSTKATLKVLIGTCAWGRNRIKAVEAGAVAVLVDLLLDSP  291

Query  725   EKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKF  546
             EKR CE  L+VL+ LC+CAEGRAE+++H AGLAVVS+KILRVSQVA+ERG+RIL SI++F
Sbjct  292   EKRTCEMVLAVLDYLCQCAEGRAELMRHGAGLAVVSKKILRVSQVASERGVRILNSISRF  351

Query  545   SATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             SAT  V+ EMLQ GV AKLCLV+QVDCG  K KERA E+LKLH++ WKNS C+P +L+
Sbjct  352   SATHGVLMEMLQTGVVAKLCLVVQVDCG-SKTKERAREMLKLHSRAWKNSSCIPSNLM  408



>gb|KDP36106.1| hypothetical protein JCGZ_08750 [Jatropha curcas]
Length=417

 Score =   491 bits (1263),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 246/421 (58%), Positives = 318/421 (76%), Gaps = 28/421 (7%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             ME+I VPP+FLCPISL+IMKDPVT+ TGITYDR++IEKW+FSGKN TCPVTKQ +S  + 
Sbjct  1     MEDIDVPPFFLCPISLQIMKDPVTVPTGITYDRESIEKWLFSGKNNTCPVTKQVISDCE-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAK-STPEMLAKVLQ  1221
               LTPN+ L R+IQSWCTL+ASHG+ER PTPKPPV+K+ I KL++ A  S+P+   K L+
Sbjct  60    --LTPNVTLMRLIQSWCTLNASHGIERIPTPKPPVSKAQISKLIKDATMSSPQQQMKCLK  117

Query  1220  TLRSMAPENAANKRCMESAGVAEFLAQIIKT---------SEDNP---------TDDALY  1095
              LRSMA  N  NKRCMESAGV EFLA I+ T         S  N          +D+AL 
Sbjct  118   KLRSMANVNDTNKRCMESAGVVEFLASIVNTYNSLSFEEYSSSNLEEINEAISLSDEALS  177

Query  1094  VLHNLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsq  915
              L+ L LSE+GL+ ++  + + IDSLTR++++G+YESRAY+V+LLKS+LE       ++ 
Sbjct  178   FLYGLQLSESGLKVLISKNAEIIDSLTRILKNGNYESRAYSVLLLKSILEVADPIQLINL  237

Query  914   ltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLL  735
                      F ++VQILRD  S +A+KS+L LL N+C  GRNR+KA  A A +V+I+LLL
Sbjct  238   RQE-----LFVEIVQILRDQISHQATKSSLRLLVNLCPWGRNRVKAVAANAVSVLINLLL  292

Query  734   DTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSI  555
             D++EKR CE  L VL+ +C+CAEGRAE+L H AGLAVVS+KILRVSQVA+E+ +RIL SI
Sbjct  293   DSSEKRVCEMALMVLDLVCQCAEGRAELLGHGAGLAVVSKKILRVSQVASEKAVRILLSI  352

Query  554   AKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDL  375
             +KFSAT +V+QEMLQ+GV AKLCLV+QVDCG+ KNKE+A E+LKLHA+ WKNSPC+P +L
Sbjct  353   SKFSATNNVLQEMLQIGVVAKLCLVLQVDCGI-KNKEKAREVLKLHARAWKNSPCIPANL  411

Query  374   I  372
             +
Sbjct  412   L  412



>emb|CDP10593.1| unnamed protein product [Coffea canephora]
Length=423

 Score =   490 bits (1261),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 252/427 (59%), Positives = 314/427 (74%), Gaps = 36/427 (8%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M+ I+VPP+FLCPISL+IMKDPVT+STGITYDR++IEKW+ SGKN TCPVTKQ L  TD 
Sbjct  1     MDAIEVPPFFLCPISLQIMKDPVTVSTGITYDRESIEKWLISGKNTTCPVTKQVL--TDS  58

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
             E LTPNI LRRVIQSWCT++ASHG+ERFPTPK P++K+ ++K+L +A+S P++  K L+ 
Sbjct  59    E-LTPNITLRRVIQSWCTVNASHGIERFPTPKAPISKAQLVKILNEAQS-PQLQIKCLRR  116

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSED--------------------------N  1116
             LRS+A  N  NKRCME+ G A+FLA II   E+                           
Sbjct  117   LRSIASHNETNKRCMETVGAADFLASIINNIEEVSIPTLASSATDDHHGIFEHNTLESTK  176

Query  1115  PTDDALYVLHNLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEttt  936
              +D+AL +L +L LSE+ L+++   + + IDSL RVMQ G+YESRAYAV+LLKSM E   
Sbjct  177   ASDEALSLLCHLQLSEDRLKTLFQRNAKLIDSLVRVMQRGNYESRAYAVLLLKSMSEVVD  236

Query  935   lnpslsqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAAT  756
                  S  T      FF +++QIL D  SRKASK+ L LL NVC  GRNRIKAAEAGA  
Sbjct  237   PMQLTSLKTE-----FFVELIQILHDQISRKASKATLKLLINVCPEGRNRIKAAEAGAVP  291

Query  755   VVIDLLLDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERG  576
             V+IDLLLD+ EKR  E  L VLEQ+C+CAEGRAE+LKH AGLA++S+KILRVSQVA++R 
Sbjct  292   VLIDLLLDSTEKRATEMILIVLEQVCQCAEGRAELLKHGAGLAIISKKILRVSQVASDRA  351

Query  575   LRILYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNS  396
             ++IL+SI++FSAT SV+QEML LGV +KLCLV+QVDCG  K KERA EILKLHA+ W NS
Sbjct  352   VKILHSISRFSATTSVLQEMLSLGVVSKLCLVLQVDCG-SKTKERAREILKLHARTWNNS  410

Query  395   PCLPLDL  375
             PC+P  L
Sbjct  411   PCIPTSL  417



>ref|XP_002265439.2| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Vitis vinifera]
Length=411

 Score =   484 bits (1245),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 244/418 (58%), Positives = 313/418 (75%), Gaps = 23/418 (6%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             MEEI VPP+FLCPISLEIMKDPVT+STGITYDR++IEKW+FSGKN TCP TKQ LS   D
Sbjct  1     MEEIDVPPFFLCPISLEIMKDPVTVSTGITYDRESIEKWLFSGKNNTCPATKQVLSADSD  60

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WCTLHAS+GVER PTPK P+ K  I+KLL  AKS P++  K +  
Sbjct  61    --LTPNHTLRRLIQAWCTLHASNGVERIPTPKIPINKIQIVKLLNDAKS-PQLQMKCIGK  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIK----TSEDNPTD----------DALYVLHNL  1080
             LR++A E+ ANKRC+ESAG  EFLA I+     T+ +  +D          +AL +LH L
Sbjct  118   LRALAAESDANKRCIESAGAVEFLASIVSKANFTTFEEESDKGLESRSASSEALSILHYL  177

Query  1079  GLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttl  900
              LSE GL+ ++G + +F+  L RV+Q G+YESRAYAVMLL SML+       ++      
Sbjct  178   LLSEAGLKKLVGKNGEFVGCLVRVLQRGNYESRAYAVMLLSSMLQVADPIQLIALKPE--  235

Query  899   nlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEK  720
                FF + VQ+L+D+ S +A+K+ L LL  VC  GRN++KA EAGA +++ +LLL ++EK
Sbjct  236   ---FFVEAVQVLQDHISHQATKATLKLLIEVCPWGRNKVKAVEAGAVSILTELLLASSEK  292

Query  719   RYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSA  540
             R CE  L+VL+QLC CAEGRAE+LKHAAG+A+VS+KILRVS VA+ER +RILYSI+KFSA
Sbjct  293   RACEMILTVLDQLCGCAEGRAELLKHAAGMAIVSKKILRVSHVASERAVRILYSISKFSA  352

Query  539   TPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIHN  366
             TPSV+QEM QLGV AKLCLV+QVDCG  + KE+  +IL+LHA+ WKNSPC+P +L+ +
Sbjct  353   TPSVLQEMSQLGVVAKLCLVLQVDCG-SRTKEKTRDILRLHARAWKNSPCIPTNLLSS  409



>ref|XP_011094237.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Sesamum indicum]
Length=413

 Score =   482 bits (1240),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 248/419 (59%), Positives = 318/419 (76%), Gaps = 27/419 (6%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             +EI+VPPYFLCPI+L+IMKDPVTISTGI+YDRD+IEKWIFS KN TCPVTKQ L  T+  
Sbjct  3     DEIEVPPYFLCPIALDIMKDPVTISTGISYDRDSIEKWIFSQKNNTCPVTKQVLYDTE--  60

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPNI LRR+IQSWCTLHA+HG++R PTPK PV+K  +LKLL  AK TP+M  + L+ L
Sbjct  61    -LTPNITLRRLIQSWCTLHAAHGIQRLPTPKAPVSKPQLLKLLNDAK-TPQMQFECLKRL  118

Query  1214  RSMAPENAANKRCMESAGVAEFLAQII----------KTSEDNPTD------DALYVLHN  1083
             RS+A +N  N+RCME+AG AEFLA ++          + SE++ ++      +AL +L+ 
Sbjct  119   RSIASQNQTNRRCMETAGTAEFLASLVVQKTLQASRDEVSEESLSELRKACEEALSILYG  178

Query  1082  LGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqlttt  903
             L LSE+ L+S+  ++  F++SLTR+MQ GSYESRAYAVMLLKSMLE       L +L   
Sbjct  179   LQLSESSLKSLTNNE--FVESLTRIMQSGSYESRAYAVMLLKSMLEAADPAQVLIKLQPQ  236

Query  902   lnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNE  723
                 FF  + QIL D   +KASK+ L +L +VC   RNRIKA EAGA  V+IDLLL++++
Sbjct  237   ----FFVGLAQILNDQICQKASKATLKVLISVCPWARNRIKAVEAGAVPVLIDLLLESSD  292

Query  722   KRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFS  543
             KR CE  L+VL+ LC+CAEGRAE+LKH AGLA+VS+KILRVSQVA+ER +RIL+S++KFS
Sbjct  293   KRACEMTLTVLDLLCQCAEGRAELLKHGAGLAIVSKKILRVSQVASERAVRILHSVSKFS  352

Query  542   ATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIHN  366
             ATP V+QEMLQ+GV AKL LV+QVDCG  + KERA E+LK +A+ W++SPCLP  LI +
Sbjct  353   ATPGVLQEMLQIGVVAKLGLVLQVDCG-SRTKERAREMLKSYARAWRSSPCLPNSLISS  410



>ref|XP_002524056.1| Spotted leaf protein, putative [Ricinus communis]
 ref|XP_002524059.1| Spotted leaf protein, putative [Ricinus communis]
 gb|EEF38266.1| Spotted leaf protein, putative [Ricinus communis]
 gb|EEF38269.1| Spotted leaf protein, putative [Ricinus communis]
Length=413

 Score =   482 bits (1240),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 245/420 (58%), Positives = 315/420 (75%), Gaps = 26/420 (6%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             ME+I VP +FLCPISL++M DPVT+ TGITYDR +IEKW+F+GKN TCPVTKQ +S  D 
Sbjct  1     MEDIDVPSFFLCPISLQLMTDPVTVPTGITYDRQSIEKWLFAGKNHTCPVTKQLISDCD-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN+ L R+IQSWCTL+ASHGVER PTPKPP++K  I KLL+ AKS P+   K L+ 
Sbjct  60    --LTPNLTLMRLIQSWCTLNASHGVERIPTPKPPISKQQIAKLLKDAKS-PQQQLKCLRK  116

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQII---------KTSEDNP-------TDDALYVLH  1086
             LRS+A  N  NKRCME+AG  EFLA I+         ++S D         +D+AL +L+
Sbjct  117   LRSIANVNDTNKRCMEAAGAVEFLASIVNNFTSLSFEESSLDGAGIEIARLSDEALSILY  176

Query  1085  NLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltt  906
             +L LSE+GLR+++G + + I SLTRVMQ+G+YESRAYAV+LLKS LE       +S    
Sbjct  177   SLQLSESGLRNLIGKNGEVIQSLTRVMQNGNYESRAYAVLLLKSALEVADPMQLVSLRPE  236

Query  905   tlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTN  726
                   F ++VQ+L D  S +ASK+AL LL N+C  GR+R+KA EA A + +IDLLLD++
Sbjct  237   -----LFVEIVQVLSDQISHQASKAALQLLINLCPWGRSRLKATEAKAVSTLIDLLLDSS  291

Query  725   EKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKF  546
             EKR CE  L+VL+ LC+CAEGRAE+LKH AGLAVVS+KILRVSQVA+E+ +RIL SI+KF
Sbjct  292   EKRTCEMALAVLDLLCQCAEGRAELLKHGAGLAVVSKKILRVSQVASEKAVRILLSISKF  351

Query  545   SATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIHN  366
             SAT +V+ EMLQ+GV AKLCLV+QVDCG  K K++A E+LKLHA+ WKNSPC+P +L+ +
Sbjct  352   SATSTVLHEMLQIGVVAKLCLVLQVDCG-SKGKDKAREVLKLHARAWKNSPCIPANLLSS  410



>ref|XP_002267438.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Vitis vinifera]
Length=411

 Score =   481 bits (1238),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 243/418 (58%), Positives = 313/418 (75%), Gaps = 23/418 (6%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             MEEI VPP+FLCPISLEIMKDPVT+STGITYDR++IEKW+FSGKN TCP TKQ LS   D
Sbjct  1     MEEIDVPPFFLCPISLEIMKDPVTVSTGITYDRESIEKWLFSGKNNTCPATKQVLSADSD  60

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WCTL+AS+GVER PTPK P+ K  I+KLL  AKS P++  K +  
Sbjct  61    --LTPNHTLRRLIQAWCTLNASNGVERIPTPKIPINKIQIVKLLNDAKS-PQLQMKCIGK  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIK----TSEDNPTD----------DALYVLHNL  1080
             LR++A E+ ANKRC+ESAG  EFLA I+     T+ +  +D          +AL +LH L
Sbjct  118   LRALATESDANKRCIESAGAVEFLASIVSKANFTTFEEESDKGLESRSASSEALSILHYL  177

Query  1079  GLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttl  900
              LSE GL+ ++G + +F+  L RV+Q G+YESRAYAVMLL SML+       ++      
Sbjct  178   LLSEAGLKKLVGKNGEFVGCLVRVLQRGNYESRAYAVMLLSSMLQVADPIQLIALKPE--  235

Query  899   nlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEK  720
                FF + VQ+L+D+ S +A+K+ L LL  VC  GRN++KA EAGA +++ +LLL ++EK
Sbjct  236   ---FFVEAVQVLQDHISHQATKATLKLLIEVCPWGRNKVKAVEAGAVSILTELLLASSEK  292

Query  719   RYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSA  540
             R CE  L+VL+QLC CAEGRAE+LKHAAG+A+VS+KILRVS VA+ER +RILYSI+KFSA
Sbjct  293   RACEMILTVLDQLCGCAEGRAELLKHAAGMAIVSKKILRVSHVASERAVRILYSISKFSA  352

Query  539   TPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIHN  366
             TPSV+QEM QLGV AKLCLV+QVDCG  + KE+  +IL+LHA+ WKNSPC+P +L+ +
Sbjct  353   TPSVLQEMSQLGVVAKLCLVLQVDCG-SRTKEKTRDILRLHARAWKNSPCIPTNLLSS  409



>ref|XP_010106989.1| E3 ubiquitin-protein ligase [Morus notabilis]
 gb|EXC12987.1| E3 ubiquitin-protein ligase [Morus notabilis]
Length=419

 Score =   479 bits (1234),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 241/421 (57%), Positives = 315/421 (75%), Gaps = 31/421 (7%)
 Frame = -1

Query  1571  EIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEF  1392
             EI VPP+FLCPISLEIMKDPVT+ TGITYDR++IEKW+FSGKN TCPVTKQ LS +D   
Sbjct  4     EIDVPPFFLCPISLEIMKDPVTVLTGITYDRESIEKWLFSGKNDTCPVTKQVLSDSD---  60

Query  1391  LTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTLR  1212
             LTPN  LRR+IQ+WCT++A+ G+ER PTPKPP++KS I KLL  AKS P+   K L+ LR
Sbjct  61    LTPNHTLRRLIQAWCTMNAALGIERIPTPKPPISKSQIAKLLSDAKS-PQSQIKCLRRLR  119

Query  1211  SMAPENAANKRCMESAGVAEFLAQII-------------KTSEDN--------PTDDALY  1095
             S+A E+  NKRC+ESAG  EFL  +I              +SE++         +D+AL 
Sbjct  120   SIAAESETNKRCLESAGAVEFLVSLIANDNNENAVSSPLSSSENDESFDFARSASDEALT  179

Query  1094  VLHNLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsq  915
             +LHNL LSE  L+ ++  + +F+DSLTRVM+ GSY+SRAY++MLLKSM +       +S 
Sbjct  180   ILHNLHLSETVLKKLIDRNGEFVDSLTRVMRQGSYDSRAYSIMLLKSMFDVADPMRMISL  239

Query  914   ltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLL  735
              T      F+ ++VQILRD  S +ASK+AL LL  +C  GRNRIKA EAGA  V+I+LLL
Sbjct  240   RTE-----FYAELVQILRDQISPQASKAALQLLVQLCPWGRNRIKAVEAGAVAVLIELLL  294

Query  734   DTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSI  555
             D+ E+R CE  L+ L+ +C CAEGRAE+++HAAGLAVVS+++LRVS + +E+ +RIL+S+
Sbjct  295   DSVERRPCEMILTGLDLMCGCAEGRAELIRHAAGLAVVSKRVLRVSHIGSEKAMRILFSV  354

Query  554   AKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDL  375
             A+FSATP+V+ EMLQLGV AKLCLV+QVDCG GK KE+A EIL+LHA+ W+NSPC+P+ L
Sbjct  355   ARFSATPAVLAEMLQLGVVAKLCLVLQVDCG-GKTKEKAREILRLHARTWRNSPCVPMRL  413

Query  374   I  372
             +
Sbjct  414   L  414



>ref|XP_009348934.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Pyrus x bretschneideri]
Length=406

 Score =   476 bits (1224),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 235/409 (57%), Positives = 308/409 (75%), Gaps = 14/409 (3%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             +EI VP +FLCPISLEIMKDPVTISTGITYDR++IEKW+FS KN TCPVTKQ +S  +D 
Sbjct  3     QEIDVPSFFLCPISLEIMKDPVTISTGITYDRESIEKWLFSSKNKTCPVTKQVVS--EDS  60

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              +TPN  LRR++Q+WCT++ASHG+ER PTPKPPV KS I +LLR AK +P  LAK L+ L
Sbjct  61    DITPNHTLRRLLQAWCTMNASHGIERIPTPKPPVNKSQIARLLRDAKKSPNGLAKCLREL  120

Query  1214  RSMAPENAANKRCMESAGVAEFLAQII-----KTSEDNPTDDALYVLHNLGLSENGLRSI  1050
             RS++ ++ ANK+ +E+AG  EFLA  I        E+   +DAL +LHNL LSE+ L+++
Sbjct  121   RSISSDSEANKKSIEAAGAVEFLASTIINNIKNDRENVENEDALSILHNLNLSEDVLKTL  180

Query  1049  LGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQ  870
             +G + +F+++L ++MQ GSYESRAYAVMLL+S+ E        +         FF +VVQ
Sbjct  181   IGKEGEFVEALIKLMQRGSYESRAYAVMLLRSIFEVAESTRMANVKPE-----FFAEVVQ  235

Query  869   ILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTN-EKRYCEWGLSV  693
             +L D  S++ASK+ L LL  +C  GRNRIKA EAGA  V+I+LLLDT+ ++R  E  L V
Sbjct  236   VLNDQISQQASKATLQLLIQLCPWGRNRIKAVEAGAVMVLIELLLDTSSDRRTLEMTLMV  295

Query  692   LEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEML  513
             L+ +C CAEGRAE+L H AGLAVVS+KI+RVS+VA+ER +RIL+SI KFSAT SV+QEM+
Sbjct  296   LDMICGCAEGRAELLTHGAGLAVVSKKIMRVSKVASERAVRILFSICKFSATSSVLQEMM  355

Query  512   QLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIHN  366
             QLGV AKLCLV+QVD G  K K++A E+LKLH + WKNS C+P +L+ +
Sbjct  356   QLGVVAKLCLVLQVDSG-SKTKDKAREVLKLHGRTWKNSTCIPSNLVSS  403



>ref|XP_011077807.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Sesamum indicum]
Length=410

 Score =   473 bits (1217),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 245/420 (58%), Positives = 314/420 (75%), Gaps = 30/420 (7%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M EI+VPPYFLCPISL+IMKDPVT+STGITYDRD+IE+WIFS +N TCPVTKQ L    D
Sbjct  1     MAEIEVPPYFLCPISLDIMKDPVTVSTGITYDRDSIEEWIFSQRNNTCPVTKQLLV---D  57

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPNI LRR+IQSWCTLHASHGVER PTPK PV+K  ++KLL+ A S P+   K L+T
Sbjct  58    PELTPNITLRRLIQSWCTLHASHGVERLPTPKAPVSKPQLMKLLKDANS-PQKQIKCLET  116

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQII-------KTSEDN---------PTDDALYVLH  1086
             L+SMA +N  NKRCME+AG  EFLA ++          ED+           D+AL VL+
Sbjct  117   LKSMASQNQTNKRCMEAAGAVEFLASLVVKKALEASRGEDSEFDLSDSRKACDEALSVLY  176

Query  1085  NLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltt  906
             +L LSE+GL+++  ++++FI+SLT VMQ GSY+SRAY+VMLLKSMLE       ++    
Sbjct  177   SLQLSESGLKAL--NNSEFIESLTLVMQSGSYDSRAYSVMLLKSMLEVADPCLLINLRPQ  234

Query  905   tlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTN  726
                  FF ++ QIL D  S+KASK+ L +L   C  GRNRIKA E+    V+IDLLLD+ 
Sbjct  235   -----FFAELAQILNDQISQKASKATLKVLIIACPWGRNRIKAVES--VPVLIDLLLDSY  287

Query  725   EKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKF  546
             +KR CE  L+VL+ LC+CAEGRAE+LKH AGLA+VS+KILRVSQ A+ER +RIL+S+++F
Sbjct  288   DKRACEMMLTVLDLLCQCAEGRAELLKHGAGLAIVSKKILRVSQAASERAVRILHSVSRF  347

Query  545   SATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIHN  366
             SATP V+QEMLQ+G+ AKL LV+QV+CG  K KERA E+LK+HA+ W++SPC+P +LI +
Sbjct  348   SATPRVLQEMLQIGIVAKLWLVVQVECG-SKTKERAREMLKVHARAWRDSPCIPKNLISS  406



>ref|XP_004303406.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Fragaria vesca 
subsp. vesca]
Length=399

 Score =   472 bits (1215),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 237/405 (59%), Positives = 306/405 (76%), Gaps = 10/405 (2%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             MEEI VP +F+CPISL+IMKDPVTISTGITYDR++IEKW+FS KN TCPVTKQ +S  D 
Sbjct  1     MEEIDVPSFFICPISLQIMKDPVTISTGITYDRESIEKWLFSSKNNTCPVTKQVVSDPD-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR++Q+WCTL+ASHGVER PTPKPPV+K+ I KLL  A  +P+ + K L+ 
Sbjct  60    --LTPNHTLRRLLQAWCTLNASHGVERIPTPKPPVSKAQISKLLNDAARSPQSVTKCLRR  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSEDNPTDDALYVLHNLGLSENGLRSILGHD  1038
             LRS+A E+ ANKR MES G  EFLA ++   +     +AL VL+NL +SE+ L+S+LG +
Sbjct  118   LRSIASESEANKRSMESVGAVEFLASVLLKGDTEQQVEALSVLYNLQVSESALQSLLGKE  177

Query  1037  TQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQILRD  858
             ++ I+SL +++Q G+YESRAYAVM+L+SM E      + +     L   FF +VVQ+L+D
Sbjct  178   SELIESLVKLIQRGTYESRAYAVMMLRSMFE-----VADTMKMINLRPEFFCEVVQVLKD  232

Query  857   NFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTN-EKRYCEWGLSVLEQL  681
               S +ASK+ L LL  VC  GRNRIKA EAGA  V+I+LLLD + ++R  E  + VL+  
Sbjct  233   QISTQASKATLQLLIKVCPWGRNRIKAVEAGAVNVLIELLLDASPDRRTHEMAMMVLDMA  292

Query  680   CRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEMLQLGV  501
             C  AEGRAE+LKH AGLAVVS+KI+R+S+VA+ER +RIL+SI KFSAT SV+QEMLQLGV
Sbjct  293   CSSAEGRAELLKHGAGLAVVSKKIMRISKVASERAVRILFSICKFSATSSVLQEMLQLGV  352

Query  500   GAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIHN  366
              AKLCLV+QVD G  K KE+A EILK+HA+ WK+S C+P +LI +
Sbjct  353   VAKLCLVLQVDSG-SKTKEKALEILKMHARTWKSSTCIPNNLISS  396



>ref|XP_002323382.1| U-box domain-containing family protein [Populus trichocarpa]
 gb|EEF05143.1| U-box domain-containing family protein [Populus trichocarpa]
Length=412

 Score =   471 bits (1212),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 240/419 (57%), Positives = 312/419 (74%), Gaps = 25/419 (6%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             ME+I+VP +FLCPISL+IMKDPV + TGITYDR++IEKW+FS KN TCPVTKQ +SG + 
Sbjct  1     MEDIEVPSFFLCPISLQIMKDPVIVPTGITYDRESIEKWLFSSKNDTCPVTKQVISGCE-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               +TPN  LRR+IQSWCTL+AS+GVER PTPKPP++K+ I KLL  AKS PE     L+ 
Sbjct  60    --VTPNHTLRRLIQSWCTLNASYGVERIPTPKPPISKAQIAKLLNDAKS-PEQQVTCLRK  116

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIK---------TSEDN-----PTDDALYVLHNL  1080
             LRS A EN  NKRCME+AG  EFL  ++          TS+D      P+D+AL +L+ L
Sbjct  117   LRSFANENETNKRCMEAAGAVEFLVSMLNNFHSLSFEVTSDDGFEISRPSDEALSILYGL  176

Query  1079  GLSENGLRS-ILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqlttt  903
              +SE+GL++ ++G + +FI++LT+VMQ G+YESRAYAV LLKSMLE       +S     
Sbjct  177   QISESGLKNLVMGRNGEFIETLTKVMQGGNYESRAYAVFLLKSMLEVADTLKLISLKHE-  235

Query  902   lnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNE  723
                  F ++VQ+LRD  S +ASK+ L LL ++C  GRNRIKA EA A  V+IDLLLD+ E
Sbjct  236   ----LFDEIVQVLRDQISHQASKATLQLLISLCPWGRNRIKAIEAKAVPVLIDLLLDSPE  291

Query  722   KRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFS  543
             KR CE  L VL+ LC+CAEGRAE+L H AGLA+VS+KILRVSQVA+ER +RI+ SI+K+S
Sbjct  292   KRTCEMVLMVLDLLCQCAEGRAELLGHGAGLAIVSKKILRVSQVASERAVRIILSISKYS  351

Query  542   ATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIHN  366
              T SV+QEMLQ+G+ AKLCLV+QVDCG  K K++A E+LK+ A+ WK+SPC+P +L+ +
Sbjct  352   ITTSVLQEMLQIGIVAKLCLVLQVDCG-SKIKDKAREVLKMQARVWKSSPCIPANLLSS  409



>ref|XP_011046430.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Populus euphratica]
Length=413

 Score =   470 bits (1210),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 240/420 (57%), Positives = 314/420 (75%), Gaps = 26/420 (6%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             ME+I+VP +FLCPISL+IMKDPV + TGITYDR++IEKW+FSGKN TCPVTKQ +SG + 
Sbjct  1     MEDIEVPSFFLCPISLQIMKDPVIVPTGITYDRESIEKWLFSGKNDTCPVTKQVISGCE-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               +TPN  LRR+IQSWCTL+AS+G+ER PTPKPP+ K+ + KLL  AKS P+   K L+ 
Sbjct  60    --VTPNHTLRRLIQSWCTLNASYGIERIPTPKPPINKTQVAKLLNDAKS-PQQQVKCLRK  116

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQII---------KTSEDN-----PTDDALYVLHNL  1080
             LRS+A EN  NKRCME+AG  EFL  ++         +TS+D      P D+AL +L+ L
Sbjct  117   LRSIANENETNKRCMEAAGAVEFLVSVVNNFNSLSFEETSDDGFEIARPGDEALSILYGL  176

Query  1079  GLSENGLRS-ILGHDTQFI-DSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltt  906
              +SE+GL++ I+G + + I ++LT+VMQ G+YESRAYAV+LLKSMLE       +S    
Sbjct  177   EISESGLKNLIMGRNGELIIETLTKVMQGGNYESRAYAVLLLKSMLEVADPLKLISLKHE  236

Query  905   tlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTN  726
                   F ++VQ+LRD  S KAS + L LL  +C  GRNRIKA EA A +V+IDLLLD++
Sbjct  237   -----LFSEIVQVLRDQISHKASNATLQLLIKLCPWGRNRIKAIEAKAVSVLIDLLLDSS  291

Query  725   EKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKF  546
             E+R CE  L VL+ LC+CAEGRAE+L H AGLAVVS+KILRVSQVA+ER +RI+ SI+KF
Sbjct  292   ERRTCEMVLMVLDLLCQCAEGRAELLGHGAGLAVVSKKILRVSQVASERAVRIILSISKF  351

Query  545   SATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIHN  366
             S T SV+QEMLQ+G+ AKLCLV+QVDCG  K K++A E+LK+ A+ WK+SPC+P +L+ +
Sbjct  352   STTTSVLQEMLQIGIVAKLCLVLQVDCG-SKIKDKAREVLKMQARVWKSSPCIPANLLSS  410



>ref|XP_010247286.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Nelumbo nucifera]
Length=413

 Score =   469 bits (1208),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 238/412 (58%), Positives = 306/412 (74%), Gaps = 25/412 (6%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M++I +PPYF+CPISLEIM+DPVT+STGITYDR+ IEKW+FSGKN TCPVTKQ LS  D 
Sbjct  1     MDQIDIPPYFICPISLEIMRDPVTVSTGITYDRECIEKWVFSGKNKTCPVTKQVLSDVD-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WCTL+AS G+ERFPTPKPPV K+ I K+L  AK  P++  + L+ 
Sbjct  60    --LTPNHTLRRLIQAWCTLNASKGIERFPTPKPPVDKAEIAKILNDAK-LPQLQMRCLRK  116

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSEDNP---------------TDDALYVLHN  1083
             L+ MA E+  NKRCME+AGV +FLA I+K     P               +D+AL +L++
Sbjct  117   LKLMASESDRNKRCMEAAGVVQFLASIVKNGSSTPVEDVVEDGVLEFTTASDEALSLLYH  176

Query  1082  LGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqlttt  903
             L +S++ L+S++  + +F+  LTRV+Q G+Y+SRAYA +LLKSM E    N  +S  T  
Sbjct  177   LQISQSSLKSLMNREGEFVGCLTRVLQRGNYQSRAYASLLLKSMFEVADPNQLISLRTE-  235

Query  902   lnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNE  723
                  F ++V +LRD  S +ASK+AL +L  +C  GRNRIKA EAGA +VVI+LLLD +E
Sbjct  236   ----LFVEIVNLLRDQISHQASKAALKVLIELCPWGRNRIKAVEAGAVSVVIELLLDASE  291

Query  722   KRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFS  543
             KR  E  L VL+QLC CAEGRAE+LKHAAGLAVVS+KILRVS +A ERG+RIL SI+++S
Sbjct  292   KRASEMMLVVLDQLCGCAEGRAELLKHAAGLAVVSKKILRVSHLATERGVRILSSISRYS  351

Query  542   ATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCL  387
             ATPSV+QEML LGV +KLCLV+QVDCGV K  E+  EIL+LH++ WK SPC+
Sbjct  352   ATPSVLQEMLNLGVVSKLCLVLQVDCGV-KTMEKVREILRLHSRAWKKSPCI  402



>ref|XP_007204425.1| hypothetical protein PRUPE_ppa1027169mg [Prunus persica]
 gb|EMJ05624.1| hypothetical protein PRUPE_ppa1027169mg [Prunus persica]
Length=405

 Score =   468 bits (1205),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 231/408 (57%), Positives = 311/408 (76%), Gaps = 13/408 (3%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             +EI VP +F+CPISLEIMKDPVTI+TGITYDR++IEKW+F  KN TCPVTKQ +S +D  
Sbjct  3     QEIDVPSFFICPISLEIMKDPVTITTGITYDRESIEKWLFLSKNNTCPVTKQVVSDSD--  60

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              +TPN  LRR++Q+WCTL+ASHG+ER PTPKPPV K+ I KL R+AK +P+ L++ L  +
Sbjct  61    -ITPNHTLRRLLQAWCTLNASHGIERIPTPKPPVNKTQIAKLFREAKKSPQCLSRCLGEI  119

Query  1214  RSMAPENAANKRCMESAGVAEFLAQII----KTSEDNPTDDALYVLHNLGLSENGLRSIL  1047
             RSMA  + ANKR +++AG +EFL+ +I    + + +  +++AL +L+NL LSE+ L++++
Sbjct  120   RSMASHSEANKRSIKAAGASEFLSSMIINNVRNNNNFESEEALSILYNLNLSEDALKTLV  179

Query  1046  GHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQI  867
             G + +FID+L ++MQ GSYESRAYAVML +SM E       ++ L       FF +VVQ+
Sbjct  180   GKEGEFIDALIKLMQRGSYESRAYAVMLFRSMFEVADDPMKMTNLRPE----FFIEVVQV  235

Query  866   LRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTN-EKRYCEWGLSVL  690
             L D  S++ASK+ L LL  +C  GRNRIKA EAGA  V+I+LLLDT+ ++R  E  L VL
Sbjct  236   LNDQISQQASKATLQLLIKLCPWGRNRIKAVEAGAVNVLIELLLDTSADRRTLEMTLMVL  295

Query  689   EQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEMLQ  510
             + +C CAEGRA++L H AGLAV+S+KI+RVS+V +ER +RIL+SI KFSATPSV+QEM+Q
Sbjct  296   DMICACAEGRADLLNHGAGLAVISKKIMRVSKVGSERAVRILFSICKFSATPSVLQEMMQ  355

Query  509   LGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIHN  366
             LGV AKLCLV+QVD G  K KE+A EILKLHA+ WKNS C+P  L+ +
Sbjct  356   LGVVAKLCLVLQVDSG-SKTKEKAREILKLHARTWKNSTCIPSSLVSS  402



>ref|XP_008365622.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Malus domestica]
Length=406

 Score =   468 bits (1205),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 234/409 (57%), Positives = 303/409 (74%), Gaps = 14/409 (3%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             EEI VP +FLCPISLEIMKDPVTISTGITYDR++IEKW+FS KN TCPVTKQ +S  +D 
Sbjct  3     EEIDVPSFFLCPISLEIMKDPVTISTGITYDRESIEKWLFSSKNKTCPVTKQVVS--EDS  60

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPN  LRR++Q+WCT++ASHG+ER PTPKPPV KS I KLLR AK +P  LAK L  L
Sbjct  61    DLTPNHTLRRLLQAWCTMNASHGIERIPTPKPPVNKSQIDKLLRDAKKSPNGLAKCLSEL  120

Query  1214  RSMAPENAANKRCMESAGVAEFLAQII-----KTSEDNPTDDALYVLHNLGLSENGLRSI  1050
             RS++ ++ ANKR +E+AG  EFLA  I        E+   ++AL +L+NL L E+ L+++
Sbjct  121   RSISSQSEANKRSIEAAGAGEFLASTIINNIKNDRENVENEEALSILYNLNLXEDVLKTL  180

Query  1049  LGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQ  870
             +G + +F+++L ++MQ GS ESR YAVMLL+SM E        +         FF QVVQ
Sbjct  181   IGKEGEFVEALIKLMQRGSDESRTYAVMLLRSMFEVADSMRMTNVKPA-----FFVQVVQ  235

Query  869   ILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTN-EKRYCEWGLSV  693
             +L D  S++ASK+ L LL   CQ GRNR KA E+GA  V+I+LLLDT+ ++R  E  L V
Sbjct  236   VLNDQISQQASKATLQLLIQFCQWGRNRTKAVESGAVMVLIELLLDTSSDRRTLEMTLLV  295

Query  692   LEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEML  513
             L+ LC CAEGRAE+L H+AGLAVVS+KI+RVS+VA+ER ++IL+SI KFS T +V+QEM+
Sbjct  296   LDMLCSCAEGRAELLTHSAGLAVVSKKIMRVSKVASERAVKILFSICKFSPTSNVLQEMM  355

Query  512   QLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIHN  366
             Q G+ AKLCLV+QVD G  K KE+A EILKLHA+ WKNS C+P +L+ +
Sbjct  356   QXGIVAKLCLVLQVDSG-SKTKEKAREILKLHARTWKNSTCIPSNLVSS  403



>ref|XP_008391980.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Malus domestica]
 ref|XP_008360600.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Malus domestica]
Length=406

 Score =   468 bits (1205),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 233/409 (57%), Positives = 306/409 (75%), Gaps = 14/409 (3%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             +EI VP +FLCPISLEIM DPVTISTGITYDR++IEKW+FS KN TCPVTKQ +S  +D 
Sbjct  3     QEIDVPSFFLCPISLEIMXDPVTISTGITYDRESIEKWLFSSKNKTCPVTKQVVS--EDS  60

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              +TPN  LRR++Q+WCT++ASHG+ER PTPKPPV KS I KLLR AK +P  LAK L+ L
Sbjct  61    DITPNHTLRRLLQAWCTMNASHGIERIPTPKPPVNKSQIAKLLRDAKKSPXGLAKCLREL  120

Query  1214  RSMAPENAANKRCMESAGVAEFLAQII-----KTSEDNPTDDALYVLHNLGLSENGLRSI  1050
             RS++ ++ ANK+ +E+AG  EFLA  I        E+   ++AL +LHNL LSE+ L+++
Sbjct  121   RSISSDSEANKKSIEAAGAGEFLASTIINNIKNDRENVENEEALXILHNLNLSEDVLKTL  180

Query  1049  LGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQ  870
             +G + +F+++L ++MQ GSYESRAYAVMLL+S+ E        +          F +VVQ
Sbjct  181   IGKEGEFVEALIKLMQRGSYESRAYAVMLLRSIFEVADSTRMANVKPEX-----FAEVVQ  235

Query  869   ILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTN-EKRYCEWGLSV  693
             +L D  S++ASK+ L LL  +C  GRNRIKA EAGA  V+I+LLLDT+ ++R  E  L V
Sbjct  236   VLNDQISQQASKATLQLLIXLCPWGRNRIKAXEAGAVMVLIELLLDTSSDRRTXEMTLMV  295

Query  692   LEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEML  513
             L+ +C CAEGRAE+L H AGLAVVS+KI+RVS+VA+ER +RIL+SI KFSAT SV+QEM+
Sbjct  296   LDMICGCAEGRAELLNHGAGLAVVSKKIMRVSKVASERAVRILFSICKFSATSSVLQEMM  355

Query  512   QLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIHN  366
             QLGV AKLCLV+QVD G  K K++A E+LKLH + WKNS C+P +L+ +
Sbjct  356   QLGVVAKLCLVLQVDSG-SKTKDKAREVLKLHGRTWKNSTCIPSNLVSS  403



>ref|XP_009343248.1| PREDICTED: E3 ubiquitin-protein ligase PUB23 [Pyrus x bretschneideri]
Length=406

 Score =   467 bits (1201),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 234/409 (57%), Positives = 305/409 (75%), Gaps = 14/409 (3%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             +EI VP +FLCPISLEIMKDPVTISTGITYDR++IEKW+FS KN TCPVTKQ +S  +D 
Sbjct  3     QEIDVPSFFLCPISLEIMKDPVTISTGITYDRESIEKWLFSSKNKTCPVTKQVVS--EDS  60

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              +TPN  LRR++Q+WCT++ASHG+ER PTPKPPV KS I KLLR AK +P  LAK L  L
Sbjct  61    DITPNHTLRRLLQAWCTMNASHGIERIPTPKPPVNKSQIDKLLRDAKKSPNGLAKCLSEL  120

Query  1214  RSMAPENAANKRCMESAGVAEFLAQII-----KTSEDNPTDDALYVLHNLGLSENGLRSI  1050
             RS++ ++ ANKR +E+AG  EFLA  I        E+   ++AL +L+NL LSE+ L+++
Sbjct  121   RSISSQSEANKRSIEAAGAGEFLASTIINNIKNDRENVENEEALSILYNLNLSEDVLKTL  180

Query  1049  LGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQ  870
             +G + +F+++L ++MQ GS ESR YAVMLL+SM E        +         FF QVV+
Sbjct  181   IGKEGEFVEALIKLMQRGSDESRTYAVMLLRSMFEVADSMRMTNVKPG-----FFVQVVR  235

Query  869   ILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTN-EKRYCEWGLSV  693
             +L D  S++ASK+ L LL  +C  GRNRIKA E+GA  V+IDLLLDT+ ++R  E  L V
Sbjct  236   VLNDQISQQASKATLQLLIQLCPWGRNRIKAVESGAVMVLIDLLLDTSSDRRTLEMTLLV  295

Query  692   LEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEML  513
             L+ LC CAEGRAE+L H AGLAVVS+KI+RVS+VA+ER ++IL+ I KFSAT +V+QEM+
Sbjct  296   LDMLCGCAEGRAELLTHGAGLAVVSKKIMRVSKVASERAVKILFFICKFSATSNVLQEMM  355

Query  512   QLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIHN  366
             QLG+ AKLCLV+QVD G  K KE+A EILKLHA+ WKNS C+P +L+ +
Sbjct  356   QLGIVAKLCLVLQVDSG-SKTKEKAREILKLHARTWKNSTCIPSNLVSS  403



>ref|XP_011042586.1| PREDICTED: E3 ubiquitin-protein ligase PUB22 [Populus euphratica]
Length=412

 Score =   466 bits (1200),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 236/419 (56%), Positives = 312/419 (74%), Gaps = 25/419 (6%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             ME+I+VP +FLCPISL+IMKDPV + TGITYDR++IEKW+FS KN TCPVTKQ +SG + 
Sbjct  1     MEDIEVPSFFLCPISLQIMKDPVIVPTGITYDRESIEKWMFSSKNDTCPVTKQLISGCE-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               +TPN  LRR+IQSWCTL+AS+GVER PTP+PP++K+ + KLL  AKS PE     L+ 
Sbjct  60    --VTPNHTLRRLIQSWCTLNASYGVERIPTPRPPISKAQVAKLLNDAKS-PEQQVTCLRK  116

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIK---------TSEDN-----PTDDALYVLHNL  1080
             LRS A EN  NKRCME+AG  EFL  ++          TS+D      P+D+AL +L+ L
Sbjct  117   LRSFANENETNKRCMEAAGAVEFLVSMLNNFHSLSFEVTSDDGFEISRPSDEALSILYGL  176

Query  1079  GLSENGLRS-ILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqlttt  903
              +SE+GL++ ++G + +FI++LT+VMQ G+YESRAYAV LLKSMLE       +S     
Sbjct  177   QISESGLKNLVMGRNGEFIETLTKVMQGGNYESRAYAVFLLKSMLEVADTLKLISLKHE-  235

Query  902   lnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNE  723
                  F ++VQ+LRD  S +ASK+ L LL ++C  GRNRIKA EA A  V+IDLLLD+ E
Sbjct  236   ----LFDEIVQVLRDQISHQASKATLQLLISLCPWGRNRIKAIEAKAVPVLIDLLLDSPE  291

Query  722   KRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFS  543
             +R CE  L VL+ LC+CAEGRAE+L H AGLA+VS+KILRVSQ+A+ER +RI+ SI+K+S
Sbjct  292   RRTCEMVLMVLDLLCQCAEGRAELLGHGAGLAIVSKKILRVSQMASERAVRIILSISKYS  351

Query  542   ATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIHN  366
              T SV+QEMLQ+G+ AKLCLV+QVDCG  K K++A E+LK+ A+ WK+SPC+P +L+ +
Sbjct  352   ITTSVLQEMLQIGIVAKLCLVLQVDCG-SKIKDKAREVLKMQARVWKSSPCIPANLLSS  409



>ref|XP_006381941.1| U-box domain-containing family protein [Populus trichocarpa]
 gb|ERP59738.1| U-box domain-containing family protein [Populus trichocarpa]
Length=413

 Score =   466 bits (1199),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 237/420 (56%), Positives = 315/420 (75%), Gaps = 26/420 (6%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             ME+I+VP +FLCPISL+IMKDPV + TGITYDR++IEKW+FSGKN TCP+TK  +SG + 
Sbjct  1     MEDIEVPSFFLCPISLQIMKDPVIVPTGITYDRESIEKWLFSGKNDTCPITKLVISGCE-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               +TPN  LRR+IQSWCTL+AS+G+ER PTPKPP+ K+ + KLL  AKS P+   K ++ 
Sbjct  60    --VTPNHTLRRLIQSWCTLNASYGIERIPTPKPPINKTQVAKLLNDAKS-PQQQVKCIRK  116

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQII---------KTSEDN-----PTDDALYVLHNL  1080
             LRS+A EN  NKRCME+AG  EFL  ++         +TS+D      P D+AL +L+ L
Sbjct  117   LRSIANENETNKRCMEAAGAVEFLVSVVNNFNSLSFEETSDDGFEIARPGDEALSILYGL  176

Query  1079  GLSENGLRS-ILGHDTQFI-DSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltt  906
              +SE+GL++ I+G + + I ++LT+VMQ G+YESRAYAV+LLKSMLE       +S    
Sbjct  177   EISESGLKNLIMGINGELIIETLTKVMQGGNYESRAYAVLLLKSMLEVADPLKLISLKHE  236

Query  905   tlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTN  726
                   F ++VQ+LRD  S KAS ++L LL N+C  GRNRIKA EA A +V+IDLLLD++
Sbjct  237   -----LFSEIVQVLRDQISHKASNASLQLLINLCPWGRNRIKAIEAKAVSVLIDLLLDSS  291

Query  725   EKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKF  546
             E+R CE  L VL+ LC+CAEGRAE+L H AGLAVVS+KILRVSQVA+ER +RI+ SI+K+
Sbjct  292   ERRTCEMVLMVLDLLCQCAEGRAELLGHGAGLAVVSKKILRVSQVASERAVRIILSISKY  351

Query  545   SATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIHN  366
             S T SV+QEMLQ+G+ AKLCLV+QVDCG  K K++A E+LK+HA+ WK+S C+P +L+ +
Sbjct  352   STTTSVLQEMLQIGIVAKLCLVLQVDCG-SKTKDKAREVLKIHARVWKSSRCIPANLLSS  410



>ref|XP_006430055.1| hypothetical protein CICLE_v10011844mg [Citrus clementina]
 gb|ESR43295.1| hypothetical protein CICLE_v10011844mg [Citrus clementina]
 gb|KDO70623.1| hypothetical protein CISIN_1g014913mg [Citrus sinensis]
Length=416

 Score =   464 bits (1194),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 247/418 (59%), Positives = 314/418 (75%), Gaps = 25/418 (6%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             MEEI VP +FLCPISL IMKDPVT+ TGITYDR++IEKW+F+GKN TCP+TKQ LS   +
Sbjct  1     MEEIDVPTFFLCPISLAIMKDPVTVPTGITYDRESIEKWLFAGKNNTCPMTKQVLSSECE  60

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQSWCTL+AS+G+ER PTPKPP+ K+ I KLL +A  +P+M  K L+ 
Sbjct  61    --LTPNHTLRRLIQSWCTLNASYGIERIPTPKPPINKAQITKLLNEAAKSPQMQIKCLKK  118

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSE---------DN------PTDDALYVLHN  1083
             LRS+A EN  NKRC+ESAG  EFLA  +  S          DN      P D+AL +L N
Sbjct  119   LRSIAAENETNKRCLESAGAVEFLASFVTNSNAMEESPEGFDNLHESSRPVDEALSILCN  178

Query  1082  LGLSENGLRS-ILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltt  906
             L +SE GL+S ++G +  F+DSLT++MQ G+YESRAYAV+LLKSMLE       +S    
Sbjct  179   LKISELGLKSLVMGRNGTFVDSLTQIMQRGTYESRAYAVLLLKSMLEVAEPMQLISLRQE  238

Query  905   tlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTN  726
                   F +V+Q+L D+ S++ASKSAL +L N+C  GRNRIK  EAGA +++IDLLLD++
Sbjct  239   -----LFVEVIQVLHDHISQQASKSALEVLVNICPWGRNRIKGVEAGAVSILIDLLLDSS  293

Query  725   -EKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAK  549
              E+R  E  L+VL+ LC+CAEGRAE+LKH AGLA+VS+KILRVSQVA+ER +RIL SI+K
Sbjct  294   LERRASEMILTVLDLLCQCAEGRAELLKHGAGLAIVSKKILRVSQVASERAVRILLSISK  353

Query  548   FSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDL  375
             FSAT SV+QEMLQ+GV AKLCLV+QVD  + K K++A E+LKLHA+ WKNSPC+P +L
Sbjct  354   FSATNSVLQEMLQIGVVAKLCLVLQVDNSM-KTKDKAREVLKLHARAWKNSPCVPENL  410



>ref|XP_006481606.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Citrus sinensis]
Length=416

 Score =   463 bits (1192),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 247/419 (59%), Positives = 314/419 (75%), Gaps = 25/419 (6%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             MEEI VP +FLCPISL IMKDPVT+ TGITYDR++IEKW+F+GKN TCP+TKQ LS   +
Sbjct  1     MEEIDVPTFFLCPISLAIMKDPVTVPTGITYDRESIEKWLFAGKNNTCPMTKQVLSSECE  60

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQSWCTL+AS+G+ER PTPKPP+ K+ I KLL +A  +P+M  K L+ 
Sbjct  61    --LTPNHTLRRLIQSWCTLNASYGIERIPTPKPPINKAQITKLLNEAAKSPQMQIKCLKK  118

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSE---------DN------PTDDALYVLHN  1083
             LRS+A EN  NKRC+ESAG  EFLA  +  S          DN      P D+AL +L N
Sbjct  119   LRSIAAENETNKRCLESAGAVEFLASFVTNSNAMEESPEGFDNLHESSRPVDEALSILCN  178

Query  1082  LGLSENGLRS-ILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltt  906
             L +SE GL+S ++G +  F+DSLT++MQ G+YESRAYAV+LLKSMLE       +S    
Sbjct  179   LKISELGLKSLVMGRNGTFVDSLTQIMQRGTYESRAYAVLLLKSMLEVAEPMQLISLRQE  238

Query  905   tlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTN  726
                   F +V+Q+L D+ S++ASKSAL +L N+C  GRNRIK  EAGA +++IDLLLD++
Sbjct  239   -----LFVEVIQVLHDHISQQASKSALEVLVNICPWGRNRIKGVEAGAVSILIDLLLDSS  293

Query  725   -EKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAK  549
              E+R  E  L+VL+ LC+CAEGRAE+LKH AGLA+VS+KILRVS VA+ER +RIL SI+K
Sbjct  294   LERRASEMILTVLDLLCQCAEGRAELLKHGAGLAIVSKKILRVSHVASERAVRILLSISK  353

Query  548   FSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             FSAT SV+QEMLQ+GV AKLCLVIQVD  + K K++A E+LKLHA+ WKNSPC+P +L+
Sbjct  354   FSATNSVLQEMLQIGVVAKLCLVIQVDNSM-KTKDKAREVLKLHARAWKNSPCVPENLL  411



>ref|XP_010059057.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Eucalyptus 
grandis]
 gb|KCW90452.1| hypothetical protein EUGRSUZ_A02582 [Eucalyptus grandis]
Length=419

 Score =   462 bits (1189),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 232/424 (55%), Positives = 310/424 (73%), Gaps = 30/424 (7%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             MEE+++P +FLCPISL++MKDPVT+ TGITYDR++IEKW+FS K++TCPVTKQA+   + 
Sbjct  3     MEEVEIPSFFLCPISLQLMKDPVTVPTGITYDRESIEKWLFSAKSSTCPVTKQAIPDCE-  61

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQSWCTL+A+HG+ER PTP+PP++KS I KLL +A+S P+M  K L+ 
Sbjct  62    --LTPNHTLRRLIQSWCTLNAAHGIERIPTPRPPISKSQIAKLLHEAES-PDMRNKCLKR  118

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSED--------------------NPTDDAL  1098
             LRS+A ENA N+ CME+AG A+FLA ++K                         P D+AL
Sbjct  119   LRSIATENATNRCCMEAAGAADFLATLVKNETSVSSTLLDETLSDCLSFEVTTRPLDEAL  178

Query  1097  YVLHNLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpsls  918
              VL++L LS+  L++++G+D  F+DSLTR+M+ G+ +SRAYAVMLLKSM E   +     
Sbjct  179   AVLYHLQLSKASLKNLIGNDGVFVDSLTRIMRSGTCDSRAYAVMLLKSMFEVADIIQLSR  238

Query  917   qltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLL  738
                       F +VV++LRD  S+KA+KSAL LL   C  GRNR+KA +A A  V+IDLL
Sbjct  239   LRKE-----LFVEVVRLLRDQVSQKATKSALKLLILACPMGRNRVKAVKASAVPVLIDLL  293

Query  737   LDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYS  558
             LD+  KR  E  L +L+ LC+CAEGRA++L+H AG+A+VS++ILRVS+ ANER +RIL S
Sbjct  294   LDSCNKRQSETILLLLDVLCQCAEGRAKLLEHGAGIAIVSKRILRVSETANERCVRILLS  353

Query  557   IAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLD  378
             I+KFSATPS+VQEMLQ+GV  KLCLV+QV+ G  + KE+A EILKLHA+ WKNSPC+P D
Sbjct  354   ISKFSATPSIVQEMLQVGVATKLCLVLQVE-GRRETKEKAREILKLHARAWKNSPCIPAD  412

Query  377   LIHN  366
              + +
Sbjct  413   FLSS  416



>ref|XP_004494254.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Cicer arietinum]
Length=419

 Score =   461 bits (1186),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 238/415 (57%), Positives = 308/415 (74%), Gaps = 23/415 (6%)
 Frame = -1

Query  1571  EIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEF  1392
             EI+VP +F+CPISLEIMKDPVT+STGITYDR++IEKW+FS KN TCPVTKQ L  + D  
Sbjct  6     EIEVPSFFVCPISLEIMKDPVTVSTGITYDRESIEKWLFSKKNITCPVTKQQLQDSTD--  63

Query  1391  LTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQA---KSTPEMLAKVLQ  1221
             LTPN  LRR+IQ+WCTL+AS G+ER PTPKPP+ K+ I KL+ +A    S+P M  K L+
Sbjct  64    LTPNHTLRRLIQAWCTLNASQGIERIPTPKPPINKTQITKLINEASSHNSSPLMQIKSLK  123

Query  1220  TLRSMAPENAANKRCMESAGVAEFLAQIIKT----------SEDNPTDDALYVLHNLGLS  1071
              LRS+A  +  NKR ME AGV EFLA ++            +E+NP D++L +LHNL +S
Sbjct  124   RLRSIASGSETNKRIMEDAGVVEFLASVVIDNIDHNSASLLTENNPVDESLSILHNLHVS  183

Query  1070  ENGLRSIL-GHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnl  894
             E+GL+++L   + +FI+SLT+VMQ G +ESRAYAV LLKSM E       L Q T     
Sbjct  184   ESGLKTLLCFRNGEFIESLTKVMQKGFFESRAYAVFLLKSMTEVAEPVQLLHQKTE----  239

Query  893   SFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDT-NEKR  717
               F ++VQ+L+D  S K SK+ L  L  +C  GRNRIK  EAG  +V+I+LLLD   +++
Sbjct  240   -LFMELVQVLKDQISIKVSKATLQTLIVLCPWGRNRIKGVEAGTVSVLIELLLDNCKDRK  298

Query  716   YCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSAT  537
               E  L +LE LC+CAEGRAE+L+H AGLAVVS+KILRVS VAN+RG+RIL S+++FSAT
Sbjct  299   PNEMMLVLLENLCQCAEGRAELLRHGAGLAVVSKKILRVSSVANDRGVRILLSVSRFSAT  358

Query  536   PSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             P+VVQEML+LGV AKLCLV+QVDCG  K KE+A+EILK+HA+ W+NSPC+P +L+
Sbjct  359   PNVVQEMLKLGVVAKLCLVLQVDCG-SKTKEKASEILKMHARVWRNSPCIPSNLL  412



>ref|XP_010036593.1| PREDICTED: E3 ubiquitin-protein ligase PUB23 [Eucalyptus grandis]
 gb|KCW48203.1| hypothetical protein EUGRSUZ_K01926 [Eucalyptus grandis]
Length=414

 Score =   459 bits (1180),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 235/417 (56%), Positives = 311/417 (75%), Gaps = 25/417 (6%)
 Frame = -1

Query  1571  EIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEF  1392
             E++VPP+FLCPISLEIM+DPVT+STGITYDR++IE W+ S KN+ CPVTKQ +S  D   
Sbjct  5     EVEVPPFFLCPISLEIMRDPVTVSTGITYDRESIETWLASSKNSLCPVTKQPISDMD---  61

Query  1391  LTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTLR  1212
             LTPN  LRR++QSWCTL++SHG+ER PTPK PV+K+ I ++LR A + P++  K L+ LR
Sbjct  62    LTPNHTLRRLLQSWCTLNSSHGIERIPTPKAPVSKAQITEILRDA-NKPQLQQKCLRRLR  120

Query  1211  SMAPENAANKRCMESAGVAEFLAQIIKT--------SED-------NPTDDALYVLHNLG  1077
             S+A  N + KRCME+AG  EFLA +I T        SED       +P+DDAL +L++L 
Sbjct  121   SIASHNTSAKRCMEAAGAIEFLASVINTTSQDQASASEDGSLLDIKSPSDDALCILYHLQ  180

Query  1076  LSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttln  897
             LS  GL+S++  D +FI SLTR+MQ G YESRAYAV+LLKSM E       ++       
Sbjct  181   LSAPGLKSLVAKDGEFIKSLTRIMQCGPYESRAYAVLLLKSMFEVAEPMQIITLRQE---  237

Query  896   lSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKR  717
               FF +V Q+L D  S++A+K+ L LL N+C  GRNRIKA E+GA +++++LLL  +++R
Sbjct  238   --FFTEVAQVLHDQISQQATKATLKLLINLCPWGRNRIKAVESGAVSILVELLLGCSDRR  295

Query  716   YCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSAT  537
               E  L +LE LC+CAEGRAE+L+H AG+AVVS++ILRVSQVA+ER +RIL S++KFSAT
Sbjct  296   TSELILMLLEMLCQCAEGRAELLRHGAGIAVVSKRILRVSQVASERAVRILLSVSKFSAT  355

Query  536   PSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIHN  366
              S+ QEMLQLGV AKLCLV+QVDCG  K KE+A EILKLHA+ WK+SPC+P +L+ +
Sbjct  356   TSLAQEMLQLGVAAKLCLVLQVDCG-RKTKEKAIEILKLHARVWKHSPCIPSNLLSS  411



>ref|XP_010059046.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Eucalyptus 
grandis]
 gb|KCW90451.1| hypothetical protein EUGRSUZ_A02581 [Eucalyptus grandis]
Length=408

 Score =   452 bits (1163),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 236/413 (57%), Positives = 309/413 (75%), Gaps = 21/413 (5%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             MEE+++P +F+CPISL++MKDP+T+ TGITYDR++IEKW FS K +TCPVTKQA+   + 
Sbjct  1     MEEVEIPSFFVCPISLQLMKDPITVPTGITYDRESIEKWFFSVKKSTCPVTKQAIPDCE-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQSWCTL+A+HG+ER PTP+ P++KS I KLLR+AKS PEM  K L+ 
Sbjct  60    --LTPNHTLRRLIQSWCTLNAAHGIERIPTPRSPISKSQIAKLLREAKS-PEMQNKCLKR  116

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIK--TSEDN---------PTDDALYVLHNLGLS  1071
             LRS+A ENA N+ CME+AG A+FLA ++K  TS  N         P D+AL +L++L LS
Sbjct  117   LRSIATENATNRCCMEAAGAADFLAALVKNETSASNCGSLEVTSRPLDEALALLYHLQLS  176

Query  1070  ENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlS  891
             E  L++++     F+DSLTR+MQ G+ +SRAYAVMLLKSM E   +    S         
Sbjct  177   EASLKNLISDGGVFVDSLTRIMQSGTCDSRAYAVMLLKSMFEVADIIQLSSLRME-----  231

Query  890   FFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYC  711
              F +VV++LRD  S+KA+KSAL LL   CQ GRNR+KA EA A  V+IDLLLD+  +   
Sbjct  232   LFVEVVRLLRDQVSQKATKSALKLLIRACQMGRNRVKAGEASAVPVLIDLLLDSRNEWQS  291

Query  710   EWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPS  531
             E  L +L+ LC+CAEGRAE+L+H AG+ +VS+KILRVS+ A+ERG+RIL SI+KFSATPS
Sbjct  292   EMILMLLDVLCQCAEGRAELLEHGAGITIVSKKILRVSETASERGVRILLSISKFSATPS  351

Query  530   VVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             +VQEMLQ+GV AKLCLV+QV+ G  K KE+A EILKLHA+ WK+SPC+P + +
Sbjct  352   IVQEMLQVGVAAKLCLVLQVE-GTSKTKEKAREILKLHARAWKSSPCIPAEFL  403



>ref|XP_006494889.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Citrus sinensis]
Length=407

 Score =   451 bits (1161),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 225/407 (55%), Positives = 305/407 (75%), Gaps = 11/407 (3%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             MEEI+VP +FLCPISL++M+DPVT+STGITYDR NIE+W+F+ KN TCPVTKQ L  TD 
Sbjct  1     MEEIEVPAHFLCPISLQLMRDPVTVSTGITYDRVNIERWLFTCKNNTCPVTKQVLQETDL  60

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
                TPN  LRR+IQ+WCT++A HG+ER PTP+PPV K+ I+K+L  AK +P    K L+ 
Sbjct  61    TSTTPNHTLRRLIQAWCTINACHGIERIPTPQPPVDKTQIVKILNDAKKSPSTGRKCLRR  120

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSED--NPTDDALYVLHNLGLSENGLRSI-L  1047
             LRS+  ++  N+ C+E+AG  EFLA  I  S+D  +  D+AL +L++L +SE+ L+SI +
Sbjct  121   LRSITLQSERNRSCLEAAGAIEFLATTITKSDDGSDECDEALSILYHLNVSESYLKSIVI  180

Query  1046  GHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQI  867
              +  +F++SL RV++ G+Y+SR+YA+MLLKS+ E      +      ++   FF ++V +
Sbjct  181   NNGEEFLESLMRVLKCGNYQSRSYAIMLLKSIFE-----VADPFQLISVKQEFFTEIVNV  235

Query  866   LRDN--FSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLSV  693
             LRD+  FS++ASK+AL LL  +C  GRNRIKA E G  +V++DLLLD  E+R CE  L+V
Sbjct  236   LRDHHQFSQQASKAALKLLVELCPWGRNRIKAVEGGGVSVLVDLLLDVTERRVCELMLNV  295

Query  692   LEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEML  513
             L+ LCRCAEGRAE+LKH AGLAVVS+KILRVS  A++R +RIL S+ KFSAT  V+QEML
Sbjct  296   LDLLCRCAEGRAELLKHGAGLAVVSKKILRVSHAASDRAVRILCSVCKFSATARVLQEML  355

Query  512   QLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             Q+GV +KLCLV+QVD  V K KERA EILKL+A+ W++SPC+P  L+
Sbjct  356   QVGVVSKLCLVLQVDASV-KTKERAREILKLNARAWRDSPCVPAHLL  401



>gb|KEH24248.1| E3 ubiquitin-protein ligase PUB23-like protein [Medicago truncatula]
Length=421

 Score =   451 bits (1161),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 234/418 (56%), Positives = 303/418 (72%), Gaps = 24/418 (6%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             +E++VP +F+CPISLEIMKDPVT+STGITYDR++IEKW+FS KN TCPVTKQ LS   D 
Sbjct  4     DEVEVPSFFVCPISLEIMKDPVTVSTGITYDRESIEKWLFSKKNMTCPVTKQLLSDYTD-  62

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAK-STPEMLAKVLQT  1218
               TPN  LRR+IQ+WCTL+AS G+ER PTPKPP+ K+ I KL+++A  S+  +  K L+ 
Sbjct  63    LTTPNHTLRRLIQAWCTLNASQGIERIPTPKPPINKTQITKLIKEASHSSLTVQLKCLKR  122

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQII--------------KTSEDNPTDDALYVLHNL  1080
             LRSMA  +  NKRC+E AG  EF+A I+                SE N  D+AL +LHNL
Sbjct  123   LRSMASGSETNKRCIEDAGAVEFIASIVINNSCNIDFVNNSGSLSETNTVDEALSILHNL  182

Query  1079  GLSENGLRSILG-HDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqlttt  903
              +SE GL+ +L   + +FI+SLT+VMQ G +ESRAYAV LLKSM E       L Q    
Sbjct  183   HVSEAGLKKLLAFRNGEFIESLTKVMQKGFFESRAYAVFLLKSMSEVAEPVQLLHQKIE-  241

Query  902   lnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDT-N  726
                  F ++VQ+L+D  S+K SK+AL  L  +C  GRNRIK  EAG   V+I+LLL+   
Sbjct  242   ----LFVELVQVLKDQISQKVSKAALQTLIALCPWGRNRIKGVEAGTVPVLIELLLENCK  297

Query  725   EKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKF  546
             +++  E  L +LE LC+CAEGRAE+L+HAAGLAVVS+KILRVS +AN+R +RIL S+++F
Sbjct  298   DRKPNEMMLVLLENLCQCAEGRAELLRHAAGLAVVSKKILRVSTLANDRAVRILLSVSRF  357

Query  545   SATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             SATP+VVQEML+LGV AKLCLV+QVDCG  K KE+A EILK+HA+ W+NSPC+P +L+
Sbjct  358   SATPNVVQEMLKLGVVAKLCLVLQVDCG-SKTKEKAREILKMHARAWRNSPCIPSNLL  414



>ref|XP_010038928.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Eucalyptus 
grandis]
 gb|KCW48205.1| hypothetical protein EUGRSUZ_K01928 [Eucalyptus grandis]
Length=415

 Score =   451 bits (1159),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 227/415 (55%), Positives = 305/415 (73%), Gaps = 25/415 (6%)
 Frame = -1

Query  1571  EIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEF  1392
             E++VPP+FLCPISLEIM+DPV++STGITYDR++IE W+ + KN+ CP+TK+ +S  D   
Sbjct  6     EVEVPPFFLCPISLEIMRDPVSLSTGITYDRESIETWLSTSKNSLCPITKRPISDMD---  62

Query  1391  LTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTLR  1212
             LTPN  LRR+IQSWCTL++SHG+ER PTPK P++K+ I K+LR A+  P++  K L+ LR
Sbjct  63    LTPNHNLRRLIQSWCTLNSSHGIERIPTPKSPISKAKIAKILRDAEK-PQLQQKCLRWLR  121

Query  1211  SMAPENAANKRCMESAGVAEFLAQIIKTSEDN---------------PTDDALYVLHNLG  1077
             S+   N + KRCME+ G  EFL+ +I T+  N                +DDALY+L++L 
Sbjct  122   SIVSHNTSAKRCMEATGAVEFLSSLINTTSQNQSLALEVGSLIDIKTTSDDALYILYHLQ  181

Query  1076  LSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttln  897
             LSE GL+S++  D+ F +SLTR+MQ G YESRAY V+LLKSM E       ++       
Sbjct  182   LSELGLKSLVAKDSAFTESLTRIMQRGPYESRAYGVLLLKSMFEVAEPMQIITLRQE---  238

Query  896   lSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKR  717
               FF + VQ+L D  S +A+K+ L LL N+C  GRNRIKA E+GA +V+I+LL D +++R
Sbjct  239   --FFAEAVQVLHDQISHQATKATLKLLINLCPCGRNRIKAVESGAVSVLIELLFDCSDRR  296

Query  716   YCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSAT  537
               E  L +LE LC+CAEGR+E+L+H AG+AVVS++ILRVSQ+A+ER +RIL S++KFSAT
Sbjct  297   TSELMLMLLEMLCQCAEGRSELLRHGAGIAVVSKRILRVSQMASERAVRILLSVSKFSAT  356

Query  536   PSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
              SV QEMLQLGV AKLCLV+QVDCG  K KE+A EILKLHA+ WK+SPC+P +L+
Sbjct  357   ASVAQEMLQLGVAAKLCLVLQVDCG-RKIKEKAIEILKLHARVWKHSPCIPSNLL  410



>gb|KDO46582.1| hypothetical protein CISIN_1g040073mg [Citrus sinensis]
Length=407

 Score =   450 bits (1158),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 225/407 (55%), Positives = 305/407 (75%), Gaps = 11/407 (3%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             MEEI+VP +FLCPISL++M+DPVT+STGITYDR NIE+W+F+ KN TCPVTKQ L  TD 
Sbjct  1     MEEIEVPAHFLCPISLQLMRDPVTVSTGITYDRVNIERWLFTCKNNTCPVTKQVLQETDL  60

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
                TPN  LRR+IQ+WCT++A HG+ER PTP+PPV K+ I+K+L  AK +P    K L+ 
Sbjct  61    TSTTPNHTLRRLIQAWCTINACHGIERIPTPQPPVDKTQIVKILNDAKKSPSTGRKCLRR  120

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSE--DNPTDDALYVLHNLGLSENGLRSI-L  1047
             LRS+  ++  N+ C+E+AG  EFLA II  S+   +  D+AL +L++L +SE+ L+SI +
Sbjct  121   LRSITLQSERNRSCLEAAGAIEFLATIITKSDAGSDECDEALSILYHLNVSESYLKSIVI  180

Query  1046  GHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQI  867
              +  +F++SL RV++ G+Y+SR+YA+MLLKS+ E      +      ++   FF ++V +
Sbjct  181   NNGEEFLESLMRVLKCGNYQSRSYAIMLLKSIFE-----VADPFQLISVKQEFFTEIVNV  235

Query  866   LRDN--FSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLSV  693
             LRD+  FS++ASK+AL LL  +C  GRNRIKA E G  +V++DLLLD  E+R CE  L+V
Sbjct  236   LRDHHQFSQQASKAALKLLVELCPWGRNRIKAVEGGGVSVLVDLLLDVTERRVCELMLNV  295

Query  692   LEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEML  513
             L+ LCRCAEGRAE+LKH AGLAVVS+KILRVS  A++R +RIL S+ KFSAT  V+QEML
Sbjct  296   LDLLCRCAEGRAELLKHGAGLAVVSKKILRVSHAASDRAVRILCSVCKFSATARVLQEML  355

Query  512   QLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             Q+GV +KLCLV+QVD  V K KERA EILKL+A+ W++SPC+P  L+
Sbjct  356   QVGVVSKLCLVLQVDASV-KTKERAREILKLNARAWRDSPCVPAHLL  401



>ref|XP_010516800.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Camelina sativa]
Length=416

 Score =   450 bits (1157),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 227/413 (55%), Positives = 304/413 (74%), Gaps = 21/413 (5%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             EEI++PP+FLCPISLEIMKDPV +STGITYDRD+IEKW+FSGK  +CPVTKQ ++  D  
Sbjct  8     EEIEIPPFFLCPISLEIMKDPVIVSTGITYDRDSIEKWLFSGKKNSCPVTKQDITDAD--  65

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPN  LRR+IQSWCTL+AS+GVER PTP+PP+ K+ I KL+R + S+ +  AK L+ L
Sbjct  66    -LTPNHTLRRLIQSWCTLNASYGVERIPTPRPPICKAEIEKLIRDSASSHQNQAKCLKRL  124

Query  1214  RSMAPENAANKRCMESAGVAEFLAQIIKTSEDNP-------TDDALYVLHNLGLSENGLR  1056
             R +  ENA NKRC+E+AGV EFLA I+    +N        TD++L +L++L  SE  L+
Sbjct  125   RQIMSENATNKRCLEAAGVPEFLANIVSNDSENGFQSLGSLTDESLNLLYHLETSETVLK  184

Query  1055  SILGHD--TQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFH  882
             ++L +      + SLT++MQ G YESRAYA +LLK++LE      +      TL    F 
Sbjct  185   NLLNNKKGNDIVKSLTKIMQRGIYESRAYATLLLKNILE-----VADPMQIMTLKPEVFT  239

Query  881   QVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLD---TNEKRYC  711
             +VV+IL D  SRKA+K+A+H+L N+C  GRNR KA EAG  +V+I+LL+D   ++++R  
Sbjct  240   EVVEILDDRISRKATKAAMHILVNICPWGRNRHKAVEAGVISVIIELLMDESFSSDRRGP  299

Query  710   EWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPS  531
             E  + VL+ LC+CAEGRAE LKH A +AVV +KILRVSQ A++R +R+L S+ KF ATP+
Sbjct  300   EMAMVVLDLLCQCAEGRAEFLKHGAAIAVVCKKILRVSQTASDRAVRVLLSVGKFCATPA  359

Query  530   VVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             ++ EMLQLGV AKLCLV+QV CG GK KE+A E+LKLHA+ WK+SPCLP +++
Sbjct  360   LLNEMLQLGVVAKLCLVLQVSCG-GKTKEKAKELLKLHARVWKDSPCLPKNMV  411



>ref|XP_006424086.1| hypothetical protein CICLE_v10028557mg [Citrus clementina]
 gb|ESR37326.1| hypothetical protein CICLE_v10028557mg [Citrus clementina]
Length=407

 Score =   449 bits (1155),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 225/407 (55%), Positives = 304/407 (75%), Gaps = 11/407 (3%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             MEEI+VP +FLCPISL++M+DPVT+STGITYDR NIE+W+F  KN TCPVTKQ L  TD 
Sbjct  1     MEEIEVPAHFLCPISLQLMRDPVTVSTGITYDRVNIERWLFLCKNNTCPVTKQVLQETDL  60

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
                TPN  LRR+IQ+WCT++A HG+ER PTP+PPV K+ I+K+L  AK +P    K L+ 
Sbjct  61    TSTTPNHTLRRLIQAWCTINACHGIERIPTPQPPVDKTQIVKILNDAKKSPSTGRKCLRR  120

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSE--DNPTDDALYVLHNLGLSENGLRSI-L  1047
             LRS+  ++  N+ C+E+AG  EFLA II  S+   +  D+AL +L++L +SE+ L+SI +
Sbjct  121   LRSITLQSERNRSCLEAAGAIEFLATIITKSDAGSDECDEALSILYHLNISESYLKSIVI  180

Query  1046  GHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQI  867
              +  +F++SL RV++ G+Y+SR+YA+MLLKS+ E      +      ++   FF ++V +
Sbjct  181   NNGEEFLESLMRVLKCGNYQSRSYAIMLLKSIFE-----VADPFQLISVKQEFFTEIVNV  235

Query  866   LRDN--FSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLSV  693
             LRD+  FS++ASK+AL LL  +C  GRNRIKA E G  +V++DLLLD  E+R CE  L+V
Sbjct  236   LRDHHQFSQQASKAALKLLVELCPWGRNRIKAVEGGGVSVLVDLLLDVTERRVCELMLNV  295

Query  692   LEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEML  513
             L+ LCRCAEGRAE+LKH AGLAVVS+KILRVS  A++R +RIL S+ KFSAT  V+QEML
Sbjct  296   LDLLCRCAEGRAELLKHGAGLAVVSKKILRVSHAASDRAVRILCSVCKFSATARVLQEML  355

Query  512   QLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             Q+GV +KLCLV+QVD  V K KERA EILKL+A+ W++SPC+P  L+
Sbjct  356   QVGVVSKLCLVLQVDASV-KTKERAREILKLNARAWRDSPCVPAHLL  401



>emb|CDX84168.1| BnaC04g09300D [Brassica napus]
Length=406

 Score =   449 bits (1154),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 227/410 (55%), Positives = 305/410 (74%), Gaps = 20/410 (5%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             EEI++PP+F+CPISLEIMKDPV +STGITYDRD+IEKW+FS K  +CPVTKQ ++  D  
Sbjct  3     EEIEIPPFFICPISLEIMKDPVIVSTGITYDRDSIEKWLFSAKKNSCPVTKQDITDAD--  60

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPN  LRR+IQSWCTL+ASHGVER PTP+PP++KS I KLL+ + S+ + LAK L+ L
Sbjct  61    -LTPNHTLRRLIQSWCTLNASHGVERIPTPRPPISKSEIEKLLKDSASSHQNLAKCLKRL  119

Query  1214  RSMAPENAANKRCMESAGVAEFLAQIIKTSEDNP--TDDALYVLHNLGLSENGLRSIL--  1047
             R +  ENA+NKRC+E+AGV EFLA ++   + +   TD+AL +L++L  SE GL+++L  
Sbjct  120   RHIVSENASNKRCLEAAGVPEFLATVVSNKDSSMILTDEALSLLYHLDTSETGLKNLLNS  179

Query  1046  --GHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVV  873
               G+D   ++SL ++MQ G YESRAYA  LLK++LE      +      TL  + F +VV
Sbjct  180   KKGND--IVNSLMKIMQRGIYESRAYATFLLKNILE-----VADPMQIMTLKPAVFTEVV  232

Query  872   QILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLD---TNEKRYCEWG  702
             QIL D  S KA+KSALH+L NVC  GRNR KA EAG  +++I+LL+D   ++++R  E  
Sbjct  233   QILDDRISHKATKSALHILVNVCPWGRNRHKAVEAGVISMIIELLMDESFSSDRRGPEMA  292

Query  701   LSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQ  522
             + VL+ LC+CAEGRAE L H A +AVV +KILRVSQ A++R +R+L+S+ +F ATP+++ 
Sbjct  293   MVVLDLLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLFSVGRFCATPALLN  352

Query  521   EMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             EMLQLGV AKLCLV+QV CG  K K++A E+LKLHA+ WK SPCL  ++I
Sbjct  353   EMLQLGVVAKLCLVLQVSCG-SKTKDKAKELLKLHARAWKESPCLTRNMI  401



>ref|XP_010263015.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Nelumbo nucifera]
Length=415

 Score =   449 bits (1154),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 244/416 (59%), Positives = 303/416 (73%), Gaps = 31/416 (7%)
 Frame = -1

Query  1577  MEEIQ--VPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGT  1404
             MEEI   VPPYFLCPISLEIM+DPVT+STGITYDR  IE+WIF+ KN TCPVTKQ LS  
Sbjct  1     MEEIDIDVPPYFLCPISLEIMRDPVTVSTGITYDRQCIERWIFTVKNNTCPVTKQILSDV  60

Query  1403  DDEFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVL  1224
             D   L PN  LRR+IQ+WC L+AS G+ERFPTPKPPV K+ I K+L+ AK  P+   + L
Sbjct  61    D---LIPNHTLRRLIQAWCILNASKGIERFPTPKPPVDKAEIAKILKDAK-LPQSQMRCL  116

Query  1223  QTLRSMAPENAANKRCMESAGVAEFLAQIIKTSEDNPT----------------DDALYV  1092
             +TLRS+A E+  NKRCME+AGV EFLA I+K   DN T                D+AL +
Sbjct  117   RTLRSIASESDRNKRCMEAAGVVEFLAAIVKN--DNSTSMEDSVEDELEFTRASDEALSI  174

Query  1091  LHNLGLSENGLRS-ILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsq  915
             L +L +S+  L+S ++  +++F++SL RV+Q G+Y+SRAYA +LLKSM E    N  +S 
Sbjct  175   LCHLQISQASLKSLVMSRNSEFVESLLRVLQRGNYQSRAYAALLLKSMFEVADPNQLISL  234

Query  914   ltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLL  735
                      F ++V +LRD  S +ASK+AL +L  VC  GRNRIKA EA A  VVIDLLL
Sbjct  235   KPK-----LFVEIVNVLRDQISTQASKAALQVLIEVCPWGRNRIKAVEADAVAVVIDLLL  289

Query  734   DTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSI  555
             DT EKR CE  L VL+QLC CAEGR+E+LKH+AG+AVVS+KILRVS +A ERG+RIL SI
Sbjct  290   DTFEKRACEMMLVVLDQLCGCAEGRSELLKHSAGIAVVSKKILRVSHLATERGVRILSSI  349

Query  554   AKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCL  387
             ++FSAT  VVQEML LGV +KLCLV+QVDCGV K  ERA +IL+LH++ WKNSPC+
Sbjct  350   SRFSATSGVVQEMLHLGVVSKLCLVLQVDCGV-KTMERARDILRLHSRAWKNSPCI  404



>ref|XP_010509533.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Camelina sativa]
Length=416

 Score =   448 bits (1153),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 224/413 (54%), Positives = 302/413 (73%), Gaps = 21/413 (5%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             EEI++PP+FLCPISLEIMKDPV +STGITYDRD+IEKW+FSGK  +CPVTKQ ++  D  
Sbjct  8     EEIEIPPFFLCPISLEIMKDPVIVSTGITYDRDSIEKWLFSGKKNSCPVTKQDITDAD--  65

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPN  LRR+IQSWCTL+AS+GVER PTP+PP+ K+ I KL+R + S+ +   K L+ L
Sbjct  66    -LTPNHTLRRLIQSWCTLNASYGVERIPTPRPPICKAEIEKLIRDSASSHQNQVKCLKRL  124

Query  1214  RSMAPENAANKRCMESAGVAEFLAQIIKTSEDNP-------TDDALYVLHNLGLSENGLR  1056
             R +  ENA NKRC+E+AGV EFLA I+    +N        TD++L +L++L  SE  L+
Sbjct  125   RQIMSENATNKRCLEAAGVPEFLANIVSNESENEFQSLGSLTDESLNLLYHLETSETVLK  184

Query  1055  SILGHD--TQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFH  882
             ++L +      + SLT++MQ G YESRAYA +LLK++LE       ++          F 
Sbjct  185   NLLNNKKGNDIVKSLTKIMQRGIYESRAYATLLLKNILEVADPMQIMTLKPE-----VFT  239

Query  881   QVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLD---TNEKRYC  711
             +VV+IL D  SRKA+K+A+H+L N+C  GRNR KA EAG  +V+I+LL+D   ++++R  
Sbjct  240   EVVEILDDRISRKATKAAMHILVNICPWGRNRHKAVEAGVISVIIELLMDESFSSDRRGP  299

Query  710   EWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPS  531
             E  + VL+ LC+CAEGRAE LKH A +AVV +KILRVSQ A++R +R+L S+ KF ATP+
Sbjct  300   EMAMVVLDLLCQCAEGRAEFLKHGAAIAVVCKKILRVSQTASDRAVRVLLSVGKFCATPA  359

Query  530   VVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             ++ EMLQLGV AKLCLV+QV CG GK KE+A E+LKLHA+ WK+SPCLP +++
Sbjct  360   LLNEMLQLGVVAKLCLVLQVSCG-GKTKEKAKELLKLHARVWKDSPCLPKNMV  411



>ref|XP_010505120.1| PREDICTED: E3 ubiquitin-protein ligase PUB23 [Camelina sativa]
Length=416

 Score =   448 bits (1152),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 224/413 (54%), Positives = 302/413 (73%), Gaps = 21/413 (5%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             EEI++PP+FLCPISLEIMKDPV +STGITYDRD+IEKW+FSGK  +CPVTKQ ++  D  
Sbjct  8     EEIEIPPFFLCPISLEIMKDPVIVSTGITYDRDSIEKWLFSGKKNSCPVTKQDITDAD--  65

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPN  LRR+IQSWCTL+AS+GVER PTP+PP+ K+ I KL+R + S+ +   K L+ L
Sbjct  66    -LTPNHTLRRLIQSWCTLNASYGVERIPTPRPPICKAEIEKLIRDSASSHQNQVKCLKRL  124

Query  1214  RSMAPENAANKRCMESAGVAEFLAQIIKTSEDNP-------TDDALYVLHNLGLSENGLR  1056
             R +  ENA NKRC+E+AGV EFLA I+    +N        TD++L +L++L  SE  L+
Sbjct  125   RQIMSENATNKRCLEAAGVPEFLANIVSNDSENGFQSLGSLTDESLNLLYHLETSETVLK  184

Query  1055  SILGHD--TQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFH  882
             ++L +      + SLT++MQ G YESRAYA +LLK++LE       ++          F 
Sbjct  185   NLLNNKKGNDIVKSLTKIMQRGIYESRAYATLLLKNILEVADPMQIMTLKPE-----VFT  239

Query  881   QVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLD---TNEKRYC  711
             +VV+IL D  SRKA+K+A+H+L N+C  GRNR KA EAG  +V+I+LL+D   ++++R  
Sbjct  240   EVVEILDDRISRKATKAAMHILVNICPWGRNRHKAVEAGVISVIIELLMDESFSSDRRGP  299

Query  710   EWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPS  531
             E  + VL+ LC+CAEGRAE LKH A +AVV +KILRVSQ A++R +R+L S+ KF ATP+
Sbjct  300   EMAMVVLDLLCQCAEGRAEFLKHGAAIAVVCKKILRVSQTASDRAVRVLLSVGKFCATPA  359

Query  530   VVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             ++ EMLQLGV AKLCLV+QV CG GK KE+A E+LKLHA+ WK+SPCLP +++
Sbjct  360   LLNEMLQLGVVAKLCLVLQVSCG-GKTKEKAKELLKLHARVWKDSPCLPKNMV  411



>ref|XP_009143630.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Brassica rapa]
 emb|CDX75084.1| BnaA05g08300D [Brassica napus]
Length=406

 Score =   447 bits (1149),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 226/408 (55%), Positives = 304/408 (75%), Gaps = 16/408 (4%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             EEI++PP+FLCPISLEIMKDPV +STGITYDRD+IEKW+FS K  +CPVTKQ ++  D  
Sbjct  3     EEIEIPPFFLCPISLEIMKDPVIVSTGITYDRDSIEKWLFSAKKNSCPVTKQDITDAD--  60

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPN  LRR+IQSWCT++ASHGVER PTP+PP++KS I KLL+ + S+ + LAK  + L
Sbjct  61    -LTPNHTLRRLIQSWCTVNASHGVERIPTPRPPISKSEIEKLLKDSASSHQNLAKCFKRL  119

Query  1214  RSMAPENAANKRCMESAGVAEFLAQII--KTSEDNPTDDALYVLHNLGLSENGLRSILGH  1041
             R +  ENA+NKRC+E+AGV EFLA I+  K S  + TD+AL +L++L  SE  L+++L +
Sbjct  120   RHIVSENASNKRCLEAAGVPEFLATIVSNKDSSMSLTDEALSLLYHLDTSETCLKNLLNN  179

Query  1040  D--TQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQI  867
                   ++SLT++M  G YESRAYA +LLK++LE      +      TL  + F +VVQI
Sbjct  180   KKGNDIVNSLTKIMNRGIYESRAYATLLLKNILE-----VADPMQIMTLKPAIFTEVVQI  234

Query  866   LRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLD---TNEKRYCEWGLS  696
             L D  S KA+KSALH+L NVC  GRNR KA EAG  +++I+LL+D   ++++R  E  + 
Sbjct  235   LDDRISHKATKSALHILVNVCPWGRNRHKAVEAGVISMIIELLMDESFSSDRRGPEMAMV  294

Query  695   VLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEM  516
             VL+ LC+CAEGRAE L H A +AVV +KILRVSQ A++R +R+L+S+ +F ATP+++ EM
Sbjct  295   VLDLLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLFSVGRFCATPALLNEM  354

Query  515   LQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             LQLGV AKLCLV+QV CG  K KE+A E+LKLHA+ W++SPCL  ++I
Sbjct  355   LQLGVVAKLCLVLQVSCG-SKTKEKAKELLKLHARIWRDSPCLTRNMI  401



>ref|XP_010677540.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Beta vulgaris 
subsp. vulgaris]
Length=419

 Score =   447 bits (1150),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 232/414 (56%), Positives = 301/414 (73%), Gaps = 23/414 (6%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALS-GTDD  1398
             EEI VPP+FLCPISLEIMKDPVTISTGITYDR+NIEKW+F   N TCP TKQAL+  T D
Sbjct  5     EEIDVPPFFLCPISLEIMKDPVTISTGITYDRENIEKWVFINNNTTCPTTKQALNVDTVD  64

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKST-PEMLAKVLQ  1221
              FLTPN  LRR+IQSWCTL+AS+G+ERFPTPKPP TK+ ILKL+ +A +T P  L K L 
Sbjct  65    SFLTPNHTLRRLIQSWCTLNASYGIERFPTPKPPATKAQILKLIDEASNTSPLGLVKNLN  124

Query  1220  TLRSMAPENAANKRCMESA-GVAEFLAQIIKTSEDNP------------TDDALYVLHNL  1080
              ++SMA E++ANKRC+E+  GVAEFLA+++   E+              +D AL +L +L
Sbjct  125   KIKSMAVESSANKRCLETTPGVAEFLARLVILGENEEERCSMSLMVSTVSDQALSILTHL  184

Query  1079  GLSENGLRSILGHDTQ--FIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltt  906
              +S+  +   L  D +   + SL R+MQ  +YESRAYA+ L+K +++      +++    
Sbjct  185   QISDEMVLKKLLKDNEGALVGSLVRIMQKSNYESRAYAIELMKKLVQVAEPTQAVALKRE  244

Query  905   tlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTN  726
                   F +VVQ+++D+ S KA+++AL +LA  C  GRN+++ AEAGA  V++DLLL+ N
Sbjct  245   -----HFVEVVQLIKDDVSPKATRAALKVLALACPWGRNKVRIAEAGAVRVMVDLLLECN  299

Query  725   EKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKF  546
             +KR  E  L+VL+QL  CAEGRAE+L HAAGLAVVS+KILRVS  A ERG+RILY+I++F
Sbjct  300   DKRTSEMVLAVLDQLSGCAEGRAELLDHAAGLAVVSKKILRVSHFATERGVRILYAISRF  359

Query  545   SATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLP  384
             SA  SV+QEMLQLGV  KLCLV+QVDC   K KERA EILK+HA+ W+NSPC P
Sbjct  360   SANASVIQEMLQLGVVIKLCLVLQVDCE-AKTKERAREILKMHARAWRNSPCAP  412



>ref|XP_010036594.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Eucalyptus 
grandis]
 gb|KCW48206.1| hypothetical protein EUGRSUZ_K01929 [Eucalyptus grandis]
Length=414

 Score =   446 bits (1148),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 231/414 (56%), Positives = 306/414 (74%), Gaps = 25/414 (6%)
 Frame = -1

Query  1571  EIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEF  1392
             E++VPP+FLCPISL IM+DPVT+STGITYDRD+IE W+ + K + CPVTKQ +S  D   
Sbjct  5     EVEVPPFFLCPISLGIMRDPVTVSTGITYDRDSIETWLSTSKISLCPVTKQPISDMD---  61

Query  1391  LTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTLR  1212
             LTPN  LRR+IQSWCTL++SHGVER PTPKP ++K+ I ++LR A+  P    K L+ LR
Sbjct  62    LTPNHTLRRLIQSWCTLNSSHGVERIPTPKPVISKAQITEILRDAEK-PHHQQKCLRRLR  120

Query  1211  SMAPENAANKRCMESAGVAEFLAQIIKTSEDN---------------PTDDALYVLHNLG  1077
             S+A  + + KRCME+AGV EFLA +I T+  +               P+DDAL +L++L 
Sbjct  121   SIASHHTSAKRCMEAAGVIEFLASVINTTSQDHSLASENGSLLEVKTPSDDALCILYHLQ  180

Query  1076  LSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttln  897
             LSE GL+S++  D++FI+SLTR+MQ GSY+S+A+AV+LLKSM E       ++       
Sbjct  181   LSERGLKSLVAKDSKFIESLTRIMQCGSYKSKAFAVLLLKSMFEVAEPMQIITLRQE---  237

Query  896   lSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKR  717
               FF + VQ+L D  SR+A+K+ L LL N+C  GRNRIKA E+G  +V+I+LLLD ++ R
Sbjct  238   --FFAKAVQVLHDQISRQATKATLKLLINLCPWGRNRIKAVESGVVSVLIELLLDCSDWR  295

Query  716   YCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSAT  537
              CE  L +LE LC+ AEGR+E+L+H AG+AVVS++ILRVS VA+ER +RIL S++KFSAT
Sbjct  296   TCELMLMLLEMLCQWAEGRSELLRHGAGIAVVSKRILRVSHVASERAVRILLSVSKFSAT  355

Query  536   PSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDL  375
              SV+QEMLQLGV AKLC V+QVDCG  K KE+A EILKLHA+ WK+SPC+P +L
Sbjct  356   ASVLQEMLQLGVAAKLCSVLQVDCG-RKIKEKAIEILKLHARVWKHSPCIPSNL  408



>ref|XP_010024549.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Eucalyptus 
grandis]
 gb|KCW90450.1| hypothetical protein EUGRSUZ_A02580 [Eucalyptus grandis]
Length=408

 Score =   446 bits (1147),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 236/418 (56%), Positives = 306/418 (73%), Gaps = 21/418 (5%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             MEE+++P +F+CPISL++MKDPV + TGITYDR++IEKW+FS K  TCPVTKQA+   + 
Sbjct  1     MEEVEIPSFFVCPISLQLMKDPVAVPTGITYDRESIEKWLFSTKKGTCPVTKQAIPDCE-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQSWCTL+A+HG+ER  TP+PP++KS I KLLR+AKS PEM  K L+ 
Sbjct  60    --LTPNHTLRRLIQSWCTLNAAHGIERISTPRPPISKSQIAKLLREAKS-PEMRNKCLKR  116

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIK--TSEDN---------PTDDALYVLHNLGLS  1071
             LR +A ENA N+ CME+AG A+FLA ++K  TS  N         P D+AL VL +L LS
Sbjct  117   LRLIATENATNRCCMEAAGAADFLAALVKNETSAFNCGSLEVTSRPLDEALAVLFHLQLS  176

Query  1070  ENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlS  891
             E  L++++     F+DSLTR+MQ G+ ESR YAVMLLKSM E   +    S         
Sbjct  177   EASLKNLISDGGVFVDSLTRIMQSGTCESRVYAVMLLKSMFEVADIIHLSSLRME-----  231

Query  890   FFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYC  711
              F +VV++LRD  S KA+KSAL LL   C  GRNR+KA EA A  V+IDLLLD+ ++R  
Sbjct  232   LFVEVVRLLRDQVSLKATKSALKLLIRACLVGRNRVKAVEACAVPVLIDLLLDSCDRRQS  291

Query  710   EWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPS  531
             E  L +L++LCRCAEGRAE+L+H  G+A+VS+KILRVS  A+ER +RIL SI+KFSATPS
Sbjct  292   EVILILLDELCRCAEGRAELLEHEMGIAIVSKKILRVSATASERCVRILLSISKFSATPS  351

Query  530   VVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIHNTIG  357
             +VQEMLQ+GV AKLCLV+QV+ G  K +E+A EILKLHA+ WKNSPC+P + + + + 
Sbjct  352   IVQEMLQVGVAAKLCLVLQVE-GTSKTREKAKEILKLHARAWKNSPCIPAEFLSSYLA  408



>ref|XP_007145787.1| hypothetical protein PHAVU_007G267700g [Phaseolus vulgaris]
 gb|ESW17781.1| hypothetical protein PHAVU_007G267700g [Phaseolus vulgaris]
Length=411

 Score =   445 bits (1144),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 227/411 (55%), Positives = 295/411 (72%), Gaps = 24/411 (6%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M+EI VPP+FLCPISLE+MKDPVT+STGITYDR +IEKW+F+  NATCPVTKQ L     
Sbjct  1     MDEIDVPPFFLCPISLELMKDPVTVSTGITYDRHSIEKWLFASNNATCPVTKQPLLPD--  58

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WCT++ASHG++R PTPKPPV K+ I  LL+ A  +P +  + L+T
Sbjct  59    --LTPNHTLRRLIQAWCTVNASHGIQRIPTPKPPVDKTIIQNLLKDASGSPNLQLQCLRT  116

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSEDNPTDD-------------ALYVLHNLG  1077
             L+S+A E+  NKR +ESAG  +FLA +I  + ++  DD             AL +LHN+ 
Sbjct  117   LKSIASESQTNKRSIESAGAVKFLASVITNTINSCLDDDVELELKASVADEALSLLHNIQ  176

Query  1076  LSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttln  897
             LSE GL+++L H  +F  SLT+VMQ G YESRAYAV LLKS+ E       ++       
Sbjct  177   LSEPGLKTLLSHP-EFTHSLTKVMQKGIYESRAYAVFLLKSLSEVADPVQLINLKPE---  232

Query  896   lSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKR  717
                F ++VQ+L+D  S+KASK+ L  L  VC   RNR+KA EAGA  V+++LLL+  E++
Sbjct  233   --LFIELVQVLKDQISQKASKATLQTLIQVCPWARNRVKAVEAGAVPVIVELLLECRERK  290

Query  716   YCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSAT  537
              CE  L +LE LC+ A+GRAE+L HAAG+A+V++KILRVS  AN+R  +IL ++ +FSAT
Sbjct  291   PCEMMLVLLEILCQSADGRAELLAHAAGVAIVAKKILRVSTTANDRAAKILLAVCRFSAT  350

Query  536   PSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLP  384
             PSVVQEM+QLGV AKLCLV+QVD G  K KE+A EILKLHAK WKNSPC+P
Sbjct  351   PSVVQEMVQLGVVAKLCLVLQVDSG-NKAKEKAREILKLHAKAWKNSPCIP  400



>ref|NP_181137.2| E3 ubiquitin-protein ligase PUB23 [Arabidopsis thaliana]
 sp|Q84TG3.1|PUB23_ARATH RecName: Full=E3 ubiquitin-protein ligase PUB23; AltName: Full=Plant 
U-box protein 23; AltName: Full=U-box domain-containing 
protein 23 [Arabidopsis thaliana]
 gb|AAO64764.1| At2g35930 [Arabidopsis thaliana]
 dbj|BAE99354.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC09178.1| E3 ubiquitin-protein ligase PUB23 [Arabidopsis thaliana]
Length=411

 Score =   444 bits (1142),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 228/411 (55%), Positives = 299/411 (73%), Gaps = 16/411 (4%)
 Frame = -1

Query  1583  IVMEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGT  1404
             I+ EEI++PP+FLCPISLEIMKDPV +STGITYDRD+IEKW+F+GK  +CPVTKQ ++  
Sbjct  5     IMDEEIEIPPFFLCPISLEIMKDPVIVSTGITYDRDSIEKWLFAGKKNSCPVTKQDITDA  64

Query  1403  DDEFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVL  1224
             D   LTPN  LRR+IQSWCTL+AS+GVER PTP+PP+ KS I KL+R + S+ E   K L
Sbjct  65    D---LTPNHTLRRLIQSWCTLNASYGVERIPTPRPPICKSEIEKLIRDSASSHENQVKCL  121

Query  1223  QTLRSMAPENAANKRCMESAGVAEFLAQIIKTSEDNP--TDDALYVLHNLGLSEN--GLR  1056
             + LR +  ENA NKRC+E+AGV EFLA I+    +N   TD+AL +L++L  SE      
Sbjct  122   KRLRQIVSENATNKRCLEAAGVPEFLANIVSNDSENGSLTDEALNLLYHLETSETVLKNL  181

Query  1055  SILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQV  876
                  D   + SLT++MQ G YESR YA +LLK++LE      +    + TL    F +V
Sbjct  182   LNNKKDNNIVKSLTKIMQRGMYESRVYATLLLKNILE-----VADPMQSMTLKPEVFTEV  236

Query  875   VQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLD---TNEKRYCEW  705
             VQIL D  S+KA+K+A+H+L N+C  GRNR KA EAG  +V+I+LL+D   T+E+R  E 
Sbjct  237   VQILDDRISQKATKAAMHILVNICPWGRNRHKAVEAGVISVIIELLMDESFTSERRGPEM  296

Query  704   GLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVV  525
              + VL+ LC+CAEGRAE L H A +AVV +KILRVSQ A++R +R+L S+ +F ATP+++
Sbjct  297   AMVVLDLLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGRFCATPALL  356

Query  524   QEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
              EMLQLGV AKLCLV+QV CG GK KE+A E+LKLHA+ WK+SPCLP ++I
Sbjct  357   HEMLQLGVVAKLCLVLQVSCG-GKTKEKAKELLKLHARVWKDSPCLPKNMI  406



>ref|XP_002881419.1| hypothetical protein ARALYDRAFT_482563 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57678.1| hypothetical protein ARALYDRAFT_482563 [Arabidopsis lyrata subsp. 
lyrata]
Length=407

 Score =   444 bits (1141),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 225/408 (55%), Positives = 301/408 (74%), Gaps = 15/408 (4%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             EEI++PP+FLCPISLEIMKDPV +STGITYDRD+IEKW+F+GK  +CPVTKQ +    D 
Sbjct  3     EEIEIPPFFLCPISLEIMKDPVIVSTGITYDRDSIEKWLFAGKKNSCPVTKQDI--ITDA  60

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPN  LRR+IQSWCTL+AS+GVER PTP+PP+ KS I KL+R + S+ +   K L+ L
Sbjct  61    DLTPNHTLRRLIQSWCTLNASYGVERIPTPRPPICKSEIEKLIRDSASSHQNQVKSLKRL  120

Query  1214  RSMAPENAANKRCMESAGVAEFLAQIIKTSEDNP--TDDALYVLHNLGLSENGLRSILGH  1041
             R +  ENA NKRC+E+AGV EFLA+I+    +N   TD+AL +L++L  SE  L+++L +
Sbjct  121   RQIVSENANNKRCLEAAGVPEFLAKIVSNESENESLTDEALNLLYHLETSETVLKNLLNN  180

Query  1040  D--TQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQI  867
                   + SLT++MQ G YESR YA +LLK++LE      +      TL    F +VVQI
Sbjct  181   KKGNDIVKSLTKIMQGGIYESRVYATLLLKNILE-----VADPMQIMTLKPEVFTEVVQI  235

Query  866   LRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLD---TNEKRYCEWGLS  696
             L D  S+KA+K+A+H+L N+C  GRNR KA EAG  +V+I+LL++   T+E+R  E  + 
Sbjct  236   LDDRISQKATKAAMHILVNICPWGRNRHKAVEAGVISVIIELLMEESFTSERRGPEMAMV  295

Query  695   VLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEM  516
             VL+ LC+CAEGRA+ L H A +AVV +KILRVSQ A++R +R+L S+ +F ATP+++ EM
Sbjct  296   VLDLLCQCAEGRADFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGRFCATPALLHEM  355

Query  515   LQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             LQLGV AKLCLV+QV CG GK KE+A E+LKLHA+ WK+SPCLP ++I
Sbjct  356   LQLGVVAKLCLVLQVSCG-GKTKEKAKELLKLHARVWKDSPCLPKNMI  402



>gb|AAD21464.1| unknown protein [Arabidopsis thaliana]
Length=406

 Score =   444 bits (1141),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 227/408 (56%), Positives = 297/408 (73%), Gaps = 16/408 (4%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             EEI++PP+FLCPISLEIMKDPV +STGITYDRD+IEKW+F+GK  +CPVTKQ ++  D  
Sbjct  3     EEIEIPPFFLCPISLEIMKDPVIVSTGITYDRDSIEKWLFAGKKNSCPVTKQDITDAD--  60

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPN  LRR+IQSWCTL+AS+GVER PTP+PP+ KS I KL+R + S+ E   K L+ L
Sbjct  61    -LTPNHTLRRLIQSWCTLNASYGVERIPTPRPPICKSEIEKLIRDSASSHENQVKCLKRL  119

Query  1214  RSMAPENAANKRCMESAGVAEFLAQIIKTSEDNP--TDDALYVLHNLGLSEN--GLRSIL  1047
             R +  ENA NKRC+E+AGV EFLA I+    +N   TD+AL +L++L  SE         
Sbjct  120   RQIVSENATNKRCLEAAGVPEFLANIVSNDSENGSLTDEALNLLYHLETSETVLKNLLNN  179

Query  1046  GHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQI  867
               D   + SLT++MQ G YESR YA +LLK++LE      +    + TL    F +VVQI
Sbjct  180   KKDNNIVKSLTKIMQRGMYESRVYATLLLKNILE-----VADPMQSMTLKPEVFTEVVQI  234

Query  866   LRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLD---TNEKRYCEWGLS  696
             L D  S+KA+K+A+H+L N+C  GRNR KA EAG  +V+I+LL+D   T+E+R  E  + 
Sbjct  235   LDDRISQKATKAAMHILVNICPWGRNRHKAVEAGVISVIIELLMDESFTSERRGPEMAMV  294

Query  695   VLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEM  516
             VL+ LC+CAEGRAE L H A +AVV +KILRVSQ A++R +R+L S+ +F ATP+++ EM
Sbjct  295   VLDLLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGRFCATPALLHEM  354

Query  515   LQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             LQLGV AKLCLV+QV CG GK KE+A E+LKLHA+ WK+SPCLP ++I
Sbjct  355   LQLGVVAKLCLVLQVSCG-GKTKEKAKELLKLHARVWKDSPCLPKNMI  401



>ref|XP_009141534.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Brassica rapa]
 emb|CDY40422.1| BnaA04g20950D [Brassica napus]
Length=412

 Score =   442 bits (1138),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 224/414 (54%), Positives = 301/414 (73%), Gaps = 22/414 (5%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             EEI++PP+FLCPISLEIMKDPV +STGITYDRD+IEKW+FSGK  +CPVTKQ ++  D  
Sbjct  3     EEIEIPPFFLCPISLEIMKDPVIVSTGITYDRDSIEKWLFSGKKNSCPVTKQDITDAD--  60

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPN  LRR+IQSWCTL+AS+GVERFPTP+PP+ KS I KL++ + S+ +   K L+ L
Sbjct  61    -LTPNHTLRRLIQSWCTLNASYGVERFPTPRPPICKSEIEKLIKDSASSHQNQVKCLKRL  119

Query  1214  RSMAPENAANKRCMESAGVAEFLAQIIKTSEDNP--------TDDALYVLHNLGLSENGL  1059
             R +  EN  NKRC+E+AGV EFLA I+  +E           TD+AL +L++L  SE  L
Sbjct  120   RQIVSENKTNKRCLEAAGVPEFLATIVSNNESENVFDSSMSLTDEALSLLYHLETSETVL  179

Query  1058  RSILGHDT--QFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFF  885
             +++L +      + SL ++MQ G YESRAYA +LLK++LE      +       L  S F
Sbjct  180   KNLLNNKKGRDIVSSLIKIMQRGMYESRAYATLLLKNILE-----VAEPMHIMNLKPSVF  234

Query  884   HQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLD---TNEKRY  714
              +VVQIL D  S KA+K+ALH+L N+C  GRNR KA EAGA +++I+LL+D   ++++R 
Sbjct  235   TEVVQILDDRISNKATKAALHILVNICPWGRNRHKAVEAGAISMMIELLMDESFSSDRRG  294

Query  713   CEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATP  534
              E  + VL+ LC+CAEGRAE L H A +AVV +KILR+SQ A++R +R+L S+ +F ATP
Sbjct  295   PEMAMVVLDLLCQCAEGRAEFLNHGAAIAVVCKKILRISQTASDRAVRVLLSVGRFCATP  354

Query  533   SVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             S++ EMLQLGV +KLCLV+QV+CG  K KE+A E+LKLHA+ WK+SPCLP ++I
Sbjct  355   SLLHEMLQLGVVSKLCLVLQVNCG-SKTKEKAKELLKLHARVWKDSPCLPRNMI  407



>ref|XP_010090504.1| E3 ubiquitin-protein ligase [Morus notabilis]
 gb|EXB39653.1| E3 ubiquitin-protein ligase [Morus notabilis]
Length=404

 Score =   442 bits (1137),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 228/405 (56%), Positives = 300/405 (74%), Gaps = 10/405 (2%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             MEEI VP  FLCPISL++M+DPVT+STGITYDR+NIE W+FS KN TCPVTKQ L+ TD 
Sbjct  1     MEEIDVPYLFLCPISLQLMRDPVTVSTGITYDRENIENWLFSCKNDTCPVTKQPLNDTD-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ WCTLHAS G+ER PTPKPPV +S I+KLL +AK+ P    K LQ 
Sbjct  60    LMLTPNHTLRRLIQVWCTLHASSGIERIPTPKPPVDESQIVKLLNEAKNVPGSQIKCLQR  119

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSEDNPT--DDALYVLHNLGLSENGLRSILG  1044
             L+S+A +   NK+ +ESAG  E+LA I+K +       D A+ +L +L  SE  L++++ 
Sbjct  120   LKSIASKGERNKKYLESAGAIEYLASIVKKNGSTTVILDTAVEILFHLKSSETHLKNLVT  179

Query  1043  HDTQFIDSLTRVMQH-GSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQI  867
             ++++ IDSL  V++  G+Y+SRAYA +++KS+L+       ++  T       F +VV +
Sbjct  180   NESEIIDSLVMVLRTCGNYQSRAYATVVMKSILDLADPVQLITVKTE-----LFVEVVNV  234

Query  866   LRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLSVLE  687
             LRD  S++ASK+AL LL  VC  GRNRIKA + GA +V+I+LLL T+EKR+CE  L VL+
Sbjct  235   LRDQISQQASKAALKLLLEVCPWGRNRIKAVQGGAVSVLIELLLGTSEKRFCELALVVLD  294

Query  686   QLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEMLQL  507
             QLC CAEGRAE+LKH AG+AVVS+KILRVS VA+ER +RIL S+ +FSATP VV EML +
Sbjct  295   QLCGCAEGRAELLKHGAGIAVVSKKILRVSHVASERAVRILSSVCRFSATPRVVHEMLSV  354

Query  506   GVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             GV AKLCLV+QV+ G+ K KERA EILKLH++ WK+S C+P+ L+
Sbjct  355   GVVAKLCLVLQVNSGL-KAKERAKEILKLHSRVWKSSNCIPVHLL  398



>ref|XP_010526330.1| PREDICTED: E3 ubiquitin-protein ligase PUB22 [Tarenaya hassleriana]
Length=434

 Score =   442 bits (1138),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 229/434 (53%), Positives = 306/434 (71%), Gaps = 42/434 (10%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             +EI+VPP+FLCPISLEIMKDPV +S+GITYDRD+IE W+FSGKN TCPV+K  +    D 
Sbjct  3     KEIEVPPFFLCPISLEIMKDPVILSSGITYDRDSIETWLFSGKNRTCPVSKHVVPADSD-  61

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPN  LRR+IQSWC L+ASHGVER PTPKPP++KS I KL+R++ S+ +   K+L+ L
Sbjct  62    -LTPNHTLRRLIQSWCILNASHGVERIPTPKPPISKSEIEKLIRESGSSHQDQVKILKRL  120

Query  1214  RSMAPENAANKRCMESAGVAEFLAQIIKTSED------NPT-------------------  1110
             R +  EN AN+RC+E+AGV  FLA+I+  S D      +P+                   
Sbjct  121   RQILSENTANRRCLEAAGVPGFLAKIVGESIDCYQSSPSPSTSNLDDLCHSNMENGFDHS  180

Query  1109  ----DDALYVLHNLGLSENGLRSILG--HDTQFIDSLTRVMQHGSYESRAYAVMLLKSML  948
                 D+AL +L+NL +SE+GL+++L   +    ++SLT++MQ G YESRAYA +LLK++L
Sbjct  181   RSLIDEALSLLYNLEISESGLKNLLNSKNGIYIVESLTKIMQRGIYESRAYASLLLKNIL  240

Query  947   EtttlnpslsqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEA  768
             E       ++          F +VVQIL D  S KA+KSAL +L N+C  GRNR KA EA
Sbjct  241   EVADPMQIITLKPD-----IFAEVVQILHDQISNKATKSALRILVNICPWGRNRHKAVEA  295

Query  767   GAATVVIDLLLD---TNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVS  597
             GA +V+I+LL+D   ++E+R  E  + VL+ LC+CAEGRAE L H AG+AVVS+KILRVS
Sbjct  296   GAISVIIELLMDETFSSERRIPEMAMVVLDLLCQCAEGRAEFLNHGAGIAVVSKKILRVS  355

Query  596   QVANERGLRILYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLH  417
             Q A+ER +R+L S+ +F ATP ++QEMLQLGV AKLCLV+QV CG  K KE+A E+L+LH
Sbjct  356   QTASERAVRVLLSVGRFCATPFLLQEMLQLGVVAKLCLVLQVSCG-NKTKEKARELLRLH  414

Query  416   AKEWKNSPCLPLDL  375
             A+ W+ SPCLP++L
Sbjct  415   ARVWRESPCLPINL  428



>emb|CDY59599.1| BnaCnng35300D [Brassica napus]
Length=409

 Score =   441 bits (1135),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 219/410 (53%), Positives = 295/410 (72%), Gaps = 19/410 (5%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             +EI++P +FLCPISL+IMKDPV +STGITYDRD+IEKW+F+GK  TCPVTKQ ++ TD  
Sbjct  3     QEIEIPTFFLCPISLDIMKDPVIVSTGITYDRDSIEKWLFTGKKNTCPVTKQVITETD--  60

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPN  LRR+IQSWCTL+ASHG+ER PTPKPP++KS I KL++ + S+ +   K L+ L
Sbjct  61    -LTPNHTLRRLIQSWCTLNASHGIERIPTPKPPISKSEIEKLIKDSSSSHQNQVKCLKRL  119

Query  1214  RSMAPENAANKRCMESAGVAEFLAQIIKTSEDNPT-----DDALYVLHNLGLSENGLRSI  1050
             R +  EN  NKRC+E+A V EFLA+I+  S    +     D+AL +L++L  SE   +S+
Sbjct  120   RQIVSENTTNKRCLEAANVPEFLAKIVSNSNRFDSSRSLMDEALSLLYHLDTSETARKSL  179

Query  1049  LGHD--TQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQV  876
             L +   T  + +LT++MQ G YESRAYA  LLK +LE       +           F++V
Sbjct  180   LNNKKGTNLVKTLTKIMQRGIYESRAYATFLLKKILEVADPMQIILLERE-----LFNEV  234

Query  875   VQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLD---TNEKRYCEW  705
             VQIL D  S KA+KSA+ +L  +C  GRNR KA EAGA +++I+LL+D   ++E+R  E 
Sbjct  235   VQILHDQISHKATKSAMQILVIICPWGRNRHKAVEAGAISMIIELLMDETFSSERRTLEM  294

Query  704   GLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVV  525
              + VL+ LC+CAEGRAE L H A +AVVS+KILRVSQ+ +ER +R+L SI +F ATPS++
Sbjct  295   AMVVLDMLCQCAEGRAEFLNHCAAIAVVSKKILRVSQITSERAVRVLLSIGRFCATPSLL  354

Query  524   QEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDL  375
             Q+MLQLGV AK+CLV+QV CG  K KE+A E+LKLHA+ W+ SPC+P +L
Sbjct  355   QDMLQLGVVAKMCLVLQVSCG-NKTKEKAKELLKLHARVWRESPCVPRNL  403



>ref|XP_006410763.1| hypothetical protein EUTSA_v10016730mg [Eutrema salsugineum]
 gb|ESQ52216.1| hypothetical protein EUTSA_v10016730mg [Eutrema salsugineum]
Length=412

 Score =   441 bits (1134),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 223/414 (54%), Positives = 303/414 (73%), Gaps = 22/414 (5%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             EEIQ+PP+FLCPISLEIMKDPV +STGITYDRD+IEKW+FSGK  +CPVTKQ +S  D  
Sbjct  3     EEIQIPPFFLCPISLEIMKDPVIVSTGITYDRDSIEKWLFSGKKNSCPVTKQDISDAD--  60

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPN  LRR+IQSWCTL+AS+GVER PTP+PP+ KS I KL++++ S+ +   K L+ L
Sbjct  61    -LTPNHTLRRLIQSWCTLNASYGVERIPTPRPPICKSEIEKLIKESASSHQNQVKCLKRL  119

Query  1214  RSMAPENAANKRCMESAGVAEFLAQIIKT--------SEDNPTDDALYVLHNLGLSENGL  1059
             R +  ENA NKRC+E+AGV EFLA I+          S ++ TD+AL +L++L  SE  L
Sbjct  120   RQIVSENATNKRCLEAAGVPEFLATIVSNNDLENGFDSSNSLTDEALSLLYHLETSETVL  179

Query  1058  RSILGHDTQ--FIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFF  885
             +++  ++ +   ++SL ++M+ G YESRAYA +LLK++LE      +      TL  + F
Sbjct  180   KNLFNNNKENDIVNSLIKIMERGIYESRAYATLLLKNILE-----VADPMQIMTLKPTVF  234

Query  884   HQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLD---TNEKRY  714
              +VVQIL D  S KA+K+A+H+L N+C  GRNR KA EAGA +V+I+LL+D   ++++R 
Sbjct  235   TEVVQILDDQISHKATKAAMHILVNICPWGRNRHKAVEAGAISVIIELLMDDSFSSDRRG  294

Query  713   CEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATP  534
              E  + VL+ LC+CAEGRAE L H A +AVV +KILRVSQ A++R +R+L S+ KF ATP
Sbjct  295   PEMAMVVLDLLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGKFCATP  354

Query  533   SVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             +++ EMLQLGV  KLCLV+QV CG  K KE+A E+LKLHA+ W++SPCL  ++I
Sbjct  355   ALLNEMLQLGVVTKLCLVLQVSCG-SKTKEKAKELLKLHARVWRDSPCLSRNMI  407



>ref|XP_006295808.1| hypothetical protein CARUB_v10024934mg [Capsella rubella]
 gb|EOA28706.1| hypothetical protein CARUB_v10024934mg [Capsella rubella]
Length=408

 Score =   440 bits (1132),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 223/410 (54%), Positives = 299/410 (73%), Gaps = 18/410 (4%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             EEI++PP+FLCPISLEIMKDPV +STGITYDRD+IEKW+FS K   CPVTK  ++  D  
Sbjct  3     EEIEIPPFFLCPISLEIMKDPVIVSTGITYDRDSIEKWLFSSKKNLCPVTKLDITDAD--  60

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPN  LRR+IQSWCTL+AS+GVER PTP+PP+ K+ I KLLR + S+ +   K L+ L
Sbjct  61    -LTPNHTLRRLIQSWCTLNASYGVERIPTPRPPICKAEIEKLLRDSASSHQNQVKCLKRL  119

Query  1214  RSMAPENAANKRCMESAGVAEFLAQIIKTSEDNP----TDDALYVLHNLGLSENGLRSIL  1047
             R +  ENA NKRC+E+AGV EFLA I+    +N     TD+AL +L++L  SE  L+++L
Sbjct  120   RQIVSENATNKRCLEAAGVPEFLANIVSNDSENGLGSFTDEALNLLYHLETSEAVLKNLL  179

Query  1046  GHD--TQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVV  873
              +      + SLT++MQ G YESR YA +LLK++LE      +      TL    F +VV
Sbjct  180   NNKKGNDIVKSLTKIMQRGIYESRVYATLLLKNILE-----VADPMQIMTLKPEVFTEVV  234

Query  872   QILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLD---TNEKRYCEWG  702
             +IL D  SRKA+K+A+H+L N+C  GRNR KA EAG  +V+I+LL+D   ++++R  E  
Sbjct  235   EILDDRISRKATKAAMHILVNICPWGRNRHKAVEAGVISVIIELLMDESFSSDRRGPEMA  294

Query  701   LSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQ  522
             + VL+ LC+CAEGRAE LKH A +AVV +KILRVSQ A++R +R+L S+ K+ ATP+++ 
Sbjct  295   MVVLDLLCQCAEGRAEFLKHGAAIAVVCKKILRVSQTASDRAVRVLLSVGKYCATPALLN  354

Query  521   EMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             EMLQLGV +KLCLV+QV CG GK KE+A E+LKLHA+ WK+SPCLP +++
Sbjct  355   EMLQLGVVSKLCLVLQVSCG-GKTKEKAKELLKLHARVWKDSPCLPRNMV  403



>emb|CDY32070.1| BnaC04g44960D [Brassica napus]
Length=412

 Score =   440 bits (1131),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 225/416 (54%), Positives = 299/416 (72%), Gaps = 26/416 (6%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             EEI++PP+FLCPISLEIMKDPV +STGITYDRD+IEKW+FSGK  +CPVTKQ ++  D  
Sbjct  3     EEIEIPPFFLCPISLEIMKDPVIVSTGITYDRDSIEKWLFSGKKNSCPVTKQDITDAD--  60

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPN  LRR+IQSWCTL+AS+GVERFPTP+PP+ KS I KL++ + S+ +   K L+ L
Sbjct  61    -LTPNHTLRRLIQSWCTLNASYGVERFPTPRPPICKSEIEKLIKDSASSHQNQVKCLKRL  119

Query  1214  RSMAPENAANKRCMESAGVAEFLAQIIKTSEDNP--------TDDALYVLHNLGLSENGL  1059
             R +  EN  NKRC+E+AGV EFLA I+  +E           TD+AL +L++L  SE  L
Sbjct  120   RQIVSENKTNKRCLEAAGVPEFLATIVSNNESQNVFDSSMSLTDEALSLLYHLETSETVL  179

Query  1058  RSIL----GHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlS  891
             +++L    G D   + SL  +MQ G YESRAYA +LLK++LE      +       L   
Sbjct  180   KNLLNKKKGRD--IVSSLINIMQRGMYESRAYATLLLKNILE-----VAEPMHIMNLKPL  232

Query  890   FFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLD---TNEK  720
              F +VVQIL D  S KA+K+ALH+L N+C  GRNR KA EAGA  V+I+LL+D   ++++
Sbjct  233   VFTEVVQILEDRISHKATKAALHILVNICPWGRNRHKAVEAGAIYVMIELLMDESFSSDR  292

Query  719   RYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSA  540
             R  E  + VL+ LC+CAEGRAE L H A +AVV +KILR+SQ A++R +R+L S+ +F A
Sbjct  293   RGPEMAMVVLDLLCQCAEGRAEFLNHGAAIAVVCKKILRISQTASDRAVRVLLSVGRFCA  352

Query  539   TPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             TP+++ EMLQLGV +KLCLV+QV+CG  K KE+A E+LKLHA+ WK+SPCLP ++I
Sbjct  353   TPALLHEMLQLGVVSKLCLVLQVNCG-SKTKEKAKELLKLHARVWKDSPCLPRNMI  407



>gb|KFK36486.1| hypothetical protein AALP_AA4G130900 [Arabis alpina]
Length=412

 Score =   439 bits (1128),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 223/414 (54%), Positives = 299/414 (72%), Gaps = 22/414 (5%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             +EI++PP+FLCPISLEIMKDPV +STGITYDRD+IEKW+FSGK  +CPVTKQ +S  D  
Sbjct  3     DEIEIPPFFLCPISLEIMKDPVIVSTGITYDRDSIEKWLFSGKKNSCPVTKQDISDAD--  60

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPN  LRR+IQSWCTL+AS+GVER PTP+PP+ KS I KL++ + S+ +   K L+ L
Sbjct  61    -LTPNHTLRRLIQSWCTLNASYGVERIPTPRPPICKSEIEKLIKVSASSHQNQVKCLKRL  119

Query  1214  RSMAPENAANKRCMESAGVAEFLAQIIKT--------SEDNPTDDALYVLHNLGLSENGL  1059
             R +  ENA NKRC+E+AGV EFLA I+          S  + TD+AL +L++L  SE  L
Sbjct  120   RQIVSENATNKRCLEAAGVPEFLATIVSNNDLENGFDSSRSMTDEALSLLYHLETSETVL  179

Query  1058  RSILGHD--TQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFF  885
             +++L +      ++SLT++MQ G YESRAYA +LLK++LE       +S          F
Sbjct  180   KNLLNNKKCNDIVNSLTKIMQRGIYESRAYATLLLKNILEVADPMQIMSLKPE-----VF  234

Query  884   HQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLD---TNEKRY  714
              +VVQIL D  S KA K+A+H+L N+C  GRNR KA +A A +V+I+LL+D   ++E+R 
Sbjct  235   IEVVQILDDQISHKAMKAAMHILVNICPWGRNRHKAVDAAAISVIIELLMDESFSSERRG  294

Query  713   CEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATP  534
              E  L VL+ LC+CAEGRAE L H A +AVV +KILRVSQ A++R +R+L S+ KF ATP
Sbjct  295   PEMALVVLDLLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGKFCATP  354

Query  533   SVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             +++ EMLQLGV AK+CLV+QV CG  K K++A E+LKLHA+ WK+SPC+P ++I
Sbjct  355   NLLNEMLQLGVVAKMCLVLQVSCG-SKTKDKAKELLKLHARVWKDSPCIPRNMI  407



>ref|XP_006387887.1| hypothetical protein POPTR_0497s00200g [Populus trichocarpa]
 gb|ERP46801.1| hypothetical protein POPTR_0497s00200g [Populus trichocarpa]
Length=415

 Score =   439 bits (1128),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 227/418 (54%), Positives = 303/418 (72%), Gaps = 25/418 (6%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M++I VP +FLCPISL++M+DPVTISTGITYDR+NIE+W+FS KN TCPVTKQ L G D 
Sbjct  1     MDQIDVPYHFLCPISLQLMRDPVTISTGITYDRENIERWLFSCKNNTCPVTKQELFGKD-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WCTL+AS G+ER PTPKPP+ ++ I KLL  AK  P +  K L+ 
Sbjct  60    --LTPNHTLRRLIQAWCTLNASFGIERIPTPKPPIERAQIAKLLNDAKKFPHLQLKSLRR  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKT---------SEDN------PTDDALYVLHN  1083
             LRS+  E+  N+ C+E AG  +FLA I+K          S+DN       +D+AL +L++
Sbjct  118   LRSITLESERNRICLEEAGAVDFLATILKNGDSTSVDIASDDNESEFSRASDEALNILYH  177

Query  1082  LGLSENGLRSILGHD-TQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltt  906
             L +S+  L++++ +D  QF++SL ++++H SY+SRAYA MLLKS+ E       +S    
Sbjct  178   LKISQRKLKNLITNDGDQFLESLLQILKHSSYQSRAYATMLLKSVFEVADPMHLISIRPE  237

Query  905   tlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTN  726
                   F ++V++L D  S+++SK+AL LL  VC  GRNRIKA E  A +V+I+LLLD +
Sbjct  238   -----MFVELVRVLNDQISQQSSKAALKLLVEVCPWGRNRIKAVEGSAVSVLIELLLDKS  292

Query  725   EKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKF  546
             EKR CE  L+VL+ LC CAEGRAE+LKH AGLAVVS+KILRVS VA+++ +RILYSI +F
Sbjct  293   EKRACELVLAVLDLLCGCAEGRAELLKHGAGLAVVSKKILRVSHVASDKAVRILYSICRF  352

Query  545   SATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             SAT  V+QEMLQ+GV AKLCLV+QVD    K+KERA EILKLH++ W+NS C+P  L+
Sbjct  353   SATSRVLQEMLQVGVVAKLCLVLQVDSSF-KSKERAREILKLHSRVWRNSACVPAYLM  409



>ref|XP_009803459.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Nicotiana 
sylvestris]
Length=407

 Score =   438 bits (1127),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 221/411 (54%), Positives = 292/411 (71%), Gaps = 18/411 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             MEE++VP YFLCPIS+E+M+DPVTISTGITYDR+NIEKW+FS K+ TCPVTKQ L  TD 
Sbjct  1     MEEVEVPSYFLCPISMEVMRDPVTISTGITYDRENIEKWLFSCKHTTCPVTKQELQITD-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQSWC L++ HG++R PTPKP V K+H++K+L +AK  PEM  K L+ 
Sbjct  60    --LTPNHNLRRLIQSWCILNSCHGIQRIPTPKPQVHKTHVVKILNEAKKCPEMQLKCLRR  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSE---------DNPTDDALYVLHNLGLSEN  1065
             LRS+A  N +NK+C+ESAGV  FLA +IK  E            +D+AL +L +L  S+ 
Sbjct  118   LRSIAHANESNKKCLESAGVVAFLASVIKKREVALVEDSEFTKASDEALNILFHLNPSDE  177

Query  1064  GLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFF  885
              L+  +  D QF+DSL   ++ G+++SRAYA+MLLKS          +          +F
Sbjct  178   ELKRFISQDEQFLDSLLHFLKCGNFQSRAYAIMLLKSAFNVADPAQLIGIKPE-----YF  232

Query  884   HQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEW  705
               +V IL D  S +A+K+AL +L  +C  GRNRIKAAE GA   +I+LLLDT E+R CE 
Sbjct  233   KAIVGILNDKISEQATKAALKILVELCPWGRNRIKAAENGAVLALIELLLDTKERRGCEL  292

Query  704   GLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVV  525
              L+VL+ LC CAEGRAE+L H AG+A+VS+KILRVS VA++R +RIL SI+KFSAT  V+
Sbjct  293   ILAVLDHLCSCAEGRAELLSHGAGIAIVSKKILRVSHVASDRAVRILCSISKFSATSKVL  352

Query  524   QEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             QEMLQ+GV +KLCLV+QVD    K KE+  EIL+LH++ W++S C+P  L+
Sbjct  353   QEMLQVGVVSKLCLVLQVDTS-PKTKEKTKEILRLHSRVWRDSLCIPSHLL  402



>ref|XP_007015662.1| U-box domain-containing protein 23 [Theobroma cacao]
 gb|EOY33281.1| U-box domain-containing protein 23 [Theobroma cacao]
Length=413

 Score =   438 bits (1127),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 221/418 (53%), Positives = 300/418 (72%), Gaps = 23/418 (6%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M+EI++PP+FLCPISL++M+DPVTISTGITYDRD+IEKW+FS KN TCPV+KQAL  +D 
Sbjct  1     MDEIEIPPHFLCPISLQLMRDPVTISTGITYDRDSIEKWLFSCKNNTCPVSKQALHDSD-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WC L+ASHG+ER PTPKP V K+ I KLL+ AK  PEM  K L+ 
Sbjct  60    --LTPNHTLRRLIQAWCILNASHGIERIPTPKPLVDKTQISKLLKDAKKFPEMQLKCLKR  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSEDN--------------PTDDALYVLHNL  1080
             LRS+  E   N+  +E+AG  +FL  +IK+++                 +D+AL +L+++
Sbjct  118   LRSITLEGERNRSYLEAAGAVQFLVSMIKSNDSTLLEVESNEGSELLKASDEALSILYHI  177

Query  1079  GLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttl  900
              +S++ L+SI+ +D +F++SL +VM++G+Y+SRAYA MLLK + E       +S      
Sbjct  178   KVSQSCLKSIISNDQEFVESLVQVMKYGNYQSRAYATMLLKDVFEVADPIQLMSATPV--  235

Query  899   nlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEK  720
                FF ++V+ LRD  S++ASK++L LL  +C  GRNRIKA E GA  V+I+ LL T+EK
Sbjct  236   ---FFAEMVRTLRDQISQQASKASLKLLVELCPWGRNRIKAVEGGAVFVLIEFLLKTSEK  292

Query  719   RYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSA  540
             R CE  L +L+QLC CAEGRAE+LKH AGLA+VS+KI RVS VA++R +RIL SI + SA
Sbjct  293   RACELALILLDQLCACAEGRAELLKHGAGLAIVSKKIFRVSHVASDRAVRILSSICRCSA  352

Query  539   TPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIHN  366
             T  V+QEMLQ+GV +KLCLV+Q+D    K KERA EILKLH++ W+N  C+P  L  +
Sbjct  353   TSWVLQEMLQVGVVSKLCLVLQLDSSY-KTKERAREILKLHSRVWRNPSCIPSHLFSS  409



>ref|XP_009593988.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Nicotiana 
tomentosiformis]
Length=407

 Score =   436 bits (1121),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 219/411 (53%), Positives = 291/411 (71%), Gaps = 18/411 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             MEE++VP YFLCPIS+E+M+DPVTISTGITYDR+NIEKW+FS K+ TCPVTKQ L  TD 
Sbjct  1     MEEVEVPSYFLCPISMEVMRDPVTISTGITYDRENIEKWLFSCKHTTCPVTKQELQITD-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQSWCTL++ HG++R PTPKP V K+H++K+L +AK  PEM  K L+ 
Sbjct  60    --LTPNHNLRRLIQSWCTLNSCHGIQRIPTPKPQVHKTHVVKILNEAKKCPEMQLKCLRR  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSE---------DNPTDDALYVLHNLGLSEN  1065
             LRS+A  N +NK+C+ESAG  +FLA +IK  E            +D+AL +L +L  S+ 
Sbjct  118   LRSIAHANESNKKCLESAGAVDFLASMIKKREVALVEDSEFTKASDEALNILFHLNPSDE  177

Query  1064  GLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFF  885
              L+     D QF+DSL   ++ G+++SRAYA+MLLKS          +          +F
Sbjct  178   ELKRFTSQDEQFLDSLLHFLKCGNFQSRAYAIMLLKSAFNVADPAQLIGMKPE-----YF  232

Query  884   HQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEW  705
               +V IL D  S++A+K+AL +L  +C  GRNRIKA E GA   +I+LLLDT E+R CE 
Sbjct  233   KAIVGILNDKISQQATKAALKILVELCPWGRNRIKATENGAVLALIELLLDTKERRGCEL  292

Query  704   GLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVV  525
              LS+L+ LC CAEGRAE+L H AG+A+VS+KILRVS VA+++ +RIL SI+KFSAT  V+
Sbjct  293   ILSILDHLCSCAEGRAELLSHGAGIAIVSKKILRVSHVASDKAVRILCSISKFSATSKVL  352

Query  524   QEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             QEMLQ+GV +KLCLV+QVD    K KE+  EIL LH++ W++S C+P  L+
Sbjct  353   QEMLQVGVVSKLCLVLQVDTS-PKTKEKTKEILSLHSRVWRDSICIPSHLL  402



>ref|XP_010677541.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Beta vulgaris 
subsp. vulgaris]
Length=407

 Score =   436 bits (1121),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 233/402 (58%), Positives = 306/402 (76%), Gaps = 11/402 (3%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQAL-SGTDD  1398
             EEI VPP+FLCPISL+IMKDPVTISTGITYDR+NIEKW+F+  N TCP TKQAL   T D
Sbjct  5     EEIDVPPFFLCPISLDIMKDPVTISTGITYDRENIEKWVFTNNNTTCPTTKQALIFDTVD  64

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQA-KSTPEMLAKVLQ  1221
              FLTPN  LRR+IQSWCTL+AS+G+ERFPTPKPP TK+ ILKL+ +A  S+P  L K L 
Sbjct  65    SFLTPNHTLRRLIQSWCTLNASYGIERFPTPKPPATKAQILKLIDEASNSSPLRLVKCLD  124

Query  1220  TLRSMAPENAANKRCMESA-GVAEFLAQIIKTSEDNPTDDALYVLHNLGLS-ENGLRSIL  1047
              ++S+A +++ANKRC+E+  GVAEFLA+++   E N +D+AL ++ +L +S E  L+ +L
Sbjct  125   KIKSIAFQSSANKRCLETTPGVAEFLARLVTVGESNVSDEALRIVAHLQISNEMILKKLL  184

Query  1046  GH-DTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQ  870
                ++  +DSL R+MQ  SYESRAYA+ L+K +++      +++          F +VVQ
Sbjct  185   KEKESALVDSLVRIMQKSSYESRAYAIELMKKLVQVAEPTQAVTLKRE-----HFVEVVQ  239

Query  869   ILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLSVL  690
             ++ DN S KA+++AL LLA  C  GRN+++  EAGA  ++++LLL++N+KR CE  L+VL
Sbjct  240   LINDNVSPKATRAALKLLALACPWGRNKVRIVEAGAVPMMVNLLLESNDKRMCEMVLAVL  299

Query  689   EQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEMLQ  510
             + LC CAEGRAE+L H AGLAVVS+KILRVS  A+ERG+RIL++I+K+S +PSVVQEMLQ
Sbjct  300   DHLCGCAEGRAELLGHGAGLAVVSKKILRVSHFASERGIRILFAISKYSGSPSVVQEMLQ  359

Query  509   LGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLP  384
             LGV  KLCLV+QVDC   K KERA EILKLHA+ WKNSPC P
Sbjct  360   LGVVIKLCLVLQVDCE-AKTKERAREILKLHARAWKNSPCAP  400



>ref|XP_002275500.2| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Vitis vinifera]
Length=414

 Score =   436 bits (1121),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 222/419 (53%), Positives = 292/419 (70%), Gaps = 24/419 (6%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M+EI VP +F+CPISL++M+DPVT++TGITYDR+NIE+W+FS KN TCP TKQ L  TD 
Sbjct  1     MDEIDVPSHFMCPISLQLMRDPVTVATGITYDRENIERWLFSCKNNTCPFTKQVLVDTD-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WC ++A HGVER PTPKPP+ K+ I+KLL  A   P+M  K LQ 
Sbjct  60    --LTPNHTLRRLIQAWCIVNACHGVERIPTPKPPIDKAQIIKLLNDAIKFPQMQLKCLQR  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSED---------------NPTDDALYVLHN  1083
             LRS+A E+  NK+C+E+AG  EFLA IIK  E                  +D+AL +L+ 
Sbjct  118   LRSIAFESDRNKKCLEAAGAVEFLASIIKKDESAVIEVVLEDGSREFTRASDEALSILYQ  177

Query  1082  LGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqlttt  903
             L  SE  L+S++  +  FI+SL  V++ G+Y+SRAYA MLLKS+ +       ++     
Sbjct  178   LETSEAALKSLVSSNYGFIESLVHVLKCGNYQSRAYAAMLLKSIFQVADPIQLINASPE-  236

Query  902   lnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNE  723
                  F ++V +LRD  S++ASK+AL LL  +C  GRNRIKA  AG + V+I+ LLDT+E
Sbjct  237   ----LFTEIVHVLRDGISQQASKAALKLLVELCPWGRNRIKAVVAGVSHVLIEHLLDTSE  292

Query  722   KRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFS  543
             KR CE  L VL+QLC CAEGRAE+LKH AGLA+VS+KILRVSQV  +R ++IL S++KFS
Sbjct  293   KRTCELILVVLDQLCSCAEGRAELLKHGAGLAIVSKKILRVSQVGTDRAVKILASVSKFS  352

Query  542   ATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIHN  366
             AT  V+QEMLQ+GV +KLCLV+QVD    K KE+  EIL LH++ WKN  C+P  L  +
Sbjct  353   ATSRVLQEMLQVGVVSKLCLVLQVDSS-KKTKEKTREILNLHSRVWKNPSCIPARLFSS  410



>ref|XP_010541793.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Tarenaya hassleriana]
Length=433

 Score =   435 bits (1119),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 227/434 (52%), Positives = 302/434 (70%), Gaps = 43/434 (10%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             +EI+VPP+FLCPISLEIMKDPV +STGITYDR++IEKW+FSGKN TCPVTKQA++ TD  
Sbjct  3     QEIEVPPFFLCPISLEIMKDPVIVSTGITYDRESIEKWLFSGKNKTCPVTKQAVTDTDP-  61

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
               TPN  LRR+IQSWCTL+AS+G+ER PTPKPP+ KS I KL+R + S+ +   K L+ L
Sbjct  62    --TPNHTLRRLIQSWCTLNASYGIERIPTPKPPICKSEIEKLIRDSASSYQNQVKTLKRL  119

Query  1214  RSMAPENAANKRCMESAGVAEFLAQIIKT-----------------------------SE  1122
             R +  ENA N+RC+E+AGV EFLA+I++                              S 
Sbjct  120   RQILLENATNRRCLEAAGVPEFLAKILRDSIDSYNSSSSPSASNLNDLCYSNMENGFDSS  179

Query  1121  DNPTDDALYVLHNLGLSENGLRSILGHDT--QFIDSLTRVMQHGSYESRAYAVMLLKSML  948
              + TD+AL +L+NL  SE+ L++++ ++     +  LT++MQ G YESRAYA +LLK++L
Sbjct  180   KSLTDEALSLLYNLETSESVLKNLVNNENGIDIVQLLTKIMQCGIYESRAYASLLLKNIL  239

Query  947   EtttlnpslsqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEA  768
             E       +   T       F +V QIL D  S KA+KSAL +L N+C  GRNR KA EA
Sbjct  240   EVADPMQIIVLKTE-----IFTEVFQILHDQISHKATKSALQILVNICPWGRNRHKAVEA  294

Query  767   GAATVVIDLLLD---TNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVS  597
             GA +V+I+LL+D   ++ +R  E  + VL+ LC+CAEGRAE L H A +AVVS+KILRVS
Sbjct  295   GAISVIIELLMDETFSSVRRIIEMVMVVLDLLCQCAEGRAEFLNHGAAIAVVSKKILRVS  354

Query  596   QVANERGLRILYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLH  417
             Q A+ER +R+L S+ +F AT S++QEMLQLGV AKLCLV+QV CG  K KE+A E+L+LH
Sbjct  355   QTASERAVRVLLSVGRFCATASLLQEMLQLGVVAKLCLVLQVSCG-NKTKEKAKELLRLH  413

Query  416   AKEWKNSPCLPLDL  375
             A+ W++SPCLP +L
Sbjct  414   ARVWRDSPCLPRNL  427



>ref|XP_009115945.1| PREDICTED: E3 ubiquitin-protein ligase PUB22 [Brassica rapa]
Length=435

 Score =   434 bits (1115),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 220/436 (50%), Positives = 296/436 (68%), Gaps = 45/436 (10%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             +EI++P +FLCPISL+IMKDPV +STGITYDRD+IEKW+F+GK  TCPVTKQ ++ TD  
Sbjct  3     QEIEIPTFFLCPISLDIMKDPVIVSTGITYDRDSIEKWLFTGKKNTCPVTKQVITETD--  60

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPN  LRR+IQSWCTL+ASHG+ER PTPKPP++KS I KL++ + S+ +   K L+ L
Sbjct  61    -LTPNHTLRRLIQSWCTLNASHGIERIPTPKPPISKSEIEKLIKDSSSSHQNQVKCLKRL  119

Query  1214  RSMAPENAANKRCMESAGVAEFLAQIIKTSEDNPT-------------------------  1110
             R +  EN  NKRC+E+A V EFLA+I+  S D+                           
Sbjct  120   RQIVSENTTNKRCLEAANVPEFLAKIVSNSVDSYNSPSPSLSSSNLNDLCQSNMLENRFD  179

Query  1109  ------DDALYVLHNLGLSENGLRSILGHD--TQFIDSLTRVMQHGSYESRAYAVMLLKS  954
                   D+AL +L++L  SE   +S+L +   T  + +LT++MQ G YESRAYA  LLK 
Sbjct  180   SSRSLMDEALSLLYHLDTSETARKSLLNNKKGTNLVKTLTKIMQRGIYESRAYATFLLKK  239

Query  953   MLEtttlnpslsqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAA  774
             +LE       +           F++VVQIL D  S KA+KSA+ +L  +C  GRNR KA 
Sbjct  240   ILEVADPMQIILLERE-----LFNEVVQILHDQISHKATKSAMQILVIICPWGRNRHKAV  294

Query  773   EAGAATVVIDLLLD---TNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILR  603
             EAGA +++I+LL+D   ++E+R  E  + VL+ LC+CAEGRAE L H A +AVVS+KILR
Sbjct  295   EAGAISMIIELLMDETFSSERRTLEMAMVVLDMLCQCAEGRAEFLNHCAAIAVVSKKILR  354

Query  602   VSQVANERGLRILYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILK  423
             VSQ+ +ER +R+L SI +F ATPS++Q+MLQLGV AK+CLV+QV CG  K KE+A E+LK
Sbjct  355   VSQITSERAVRVLLSIGRFCATPSLLQDMLQLGVVAKMCLVLQVSCG-NKTKEKAKELLK  413

Query  422   LHAKEWKNSPCLPLDL  375
             LHA+ W+ SPC+P +L
Sbjct  414   LHARVWRESPCVPRNL  429



>emb|CDX95337.1| BnaC04g28210D [Brassica napus]
Length=409

 Score =   430 bits (1106),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 217/410 (53%), Positives = 292/410 (71%), Gaps = 19/410 (5%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             +EI++P +FLCPISL+IMKDPV +STGITYDR++IEKW+F+GK  +CPVTKQ ++ TD  
Sbjct  3     QEIEIPSFFLCPISLDIMKDPVIVSTGITYDRNSIEKWLFTGKENSCPVTKQVITETD--  60

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPN  LRR+IQSWC+L+ASHG+E  PTPKPP++KS I +L++ + S+ +   K L+ L
Sbjct  61    -LTPNHTLRRLIQSWCSLNASHGIETIPTPKPPISKSEIERLIKDSSSSHKNQVKCLKRL  119

Query  1214  RSMAPENAANKRCMESAGVAEFLAQIIKT-----SEDNPTDDALYVLHNLGLSENGLRSI  1050
             R +A EN  NKRC+E+A V EFLA II       S  +  D+AL +L++L  SE   +S+
Sbjct  120   RQIASENNTNKRCLEAAEVPEFLANIISNLNRFDSSRSLMDEALSLLYHLNASETARKSL  179

Query  1049  LGHD--TQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQV  876
             L +   T  + +LT++MQ G YESRAYA +LLK +LE       +           F +V
Sbjct  180   LNNKKGTNLVKTLTKIMQRGIYESRAYATLLLKKILEVADPMQIILLERE-----LFTEV  234

Query  875   VQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLD---TNEKRYCEW  705
             VQIL D  S KA+KSA+ +L   C  GRNR KA EAGAA+++I+LLLD   ++E+R  E 
Sbjct  235   VQILHDQISHKATKSAMQILMITCPWGRNRHKAVEAGAASMIIELLLDESFSSERRNVEM  294

Query  704   GLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVV  525
              + VL+ LC+CAEGRAE L H A +AVVS+KILRVSQ+ +ER +R+L S+ +F ATP ++
Sbjct  295   AMVVLDVLCQCAEGRAEFLNHGAAIAVVSKKILRVSQITSERAVRVLLSVGRFCATPCLL  354

Query  524   QEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDL  375
             QEMLQLGV AKLCLV+Q  CG  K KE+A E+LKLHA+ W+ SPC+P +L
Sbjct  355   QEMLQLGVVAKLCLVLQASCG-NKTKEKAKELLKLHARVWRESPCVPRNL  403



>ref|XP_007162975.1| hypothetical protein PHAVU_001G196000g [Phaseolus vulgaris]
 gb|ESW34969.1| hypothetical protein PHAVU_001G196000g [Phaseolus vulgaris]
Length=418

 Score =   430 bits (1106),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 226/421 (54%), Positives = 290/421 (69%), Gaps = 30/421 (7%)
 Frame = -1

Query  1571  EIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEF  1392
             +I VP +FLCPISL+IMKDPVT+STGITYDR+ IE W+FS KN TCP+TKQ L+   D  
Sbjct  4     DIDVPSFFLCPISLQIMKDPVTVSTGITYDRECIETWLFSRKNTTCPITKQPLTDYTD--  61

Query  1391  LTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTLR  1212
             LTPN  LRR+IQ+WCT++ASHG+ER PTPKPPV K+ I KLL+ A  +P      L+ L+
Sbjct  62    LTPNHTLRRLIQAWCTMNASHGIERIPTPKPPVNKTQISKLLKDASHSP---LTCLRRLK  118

Query  1211  SMAPENAANKRCMESAGVAEFLAQIIKTS------------------EDNPTDDALYVLH  1086
             S+A  +  NKRCME+AG  EFLA I+  +                  +   +D+AL +LH
Sbjct  119   SIASGSETNKRCMEAAGAVEFLASIVVNNNNDSSNGVDPNDGSGFELKTTASDEALSLLH  178

Query  1085  NLGLSENGLRSILG-HDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqlt  909
              L LSE GL++++   +  FI+SLTRVMQ G +ESRAYAV LLKSM E       L    
Sbjct  179   TLDLSEQGLKTLISFRNGDFIESLTRVMQKGFFESRAYAVFLLKSMSEVADPVKLLHLRQ  238

Query  908   ttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDT  729
                    F ++VQ+L+D  S K SK  +  L      GRNRIKA EAG   V+I+LLLD 
Sbjct  239   E-----LFVELVQVLKDQISTKTSKDIIQTLIQFSPWGRNRIKAVEAGTVPVLIELLLDC  293

Query  728   NEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAK  549
              +++ CE  L +LE LC+CAEGRAE+L H AGLA+VS+KILRVS +AN+R +RIL  ++K
Sbjct  294   KDRKPCEMMLVLLEILCQCAEGRAELLSHGAGLAIVSKKILRVSTLANDRAVRILLCVSK  353

Query  548   FSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIH  369
             FSATP VVQEML+LGV AKLCLV+QVD G  K KE+A EILKLHA+ WKN+PC+P +++ 
Sbjct  354   FSATPHVVQEMLKLGVVAKLCLVLQVDSG-NKAKEKAREILKLHARVWKNTPCIPNNMLS  412

Query  368   N  366
             +
Sbjct  413   S  413



>ref|XP_006403803.1| hypothetical protein EUTSA_v10010389mg [Eutrema salsugineum]
 dbj|BAJ34414.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45256.1| hypothetical protein EUTSA_v10010389mg [Eutrema salsugineum]
Length=435

 Score =   429 bits (1104),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 218/436 (50%), Positives = 296/436 (68%), Gaps = 45/436 (10%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             +EI++P +FLCPISL+IMKDPV +STGITYDRD+IEKW+F+GK  +CPVTKQA++ TD  
Sbjct  3     QEIEIPSFFLCPISLDIMKDPVIVSTGITYDRDSIEKWLFTGKKNSCPVTKQAITETD--  60

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPN  LRR+IQSWCTL+AS+G+ER PTPKPP+ K  I KL++ + S+ +   K L+ L
Sbjct  61    -LTPNHTLRRLIQSWCTLNASYGIERIPTPKPPICKYEIEKLIKDSSSSHQNQVKCLKRL  119

Query  1214  RSMAPENAANKRCMESAGVAEFLAQIIKTSEDNPT-------------------------  1110
             R +  EN  NKRC+E+A V EFLA+I+ +S D                            
Sbjct  120   RQIVTENTTNKRCLEAAEVPEFLAKIVSSSVDTYNSPSPSLSSSNLNDLCQSNMLENRFD  179

Query  1109  ------DDALYVLHNLGLSENGLRSILGH--DTQFIDSLTRVMQHGSYESRAYAVMLLKS  954
                   D+AL +L++L  SE   +S+L +  +T  + +LT++MQ G YESRAYA +LLK 
Sbjct  180   SSRSLMDEALSLLYHLDTSETARKSLLNNKKETNLVKTLTKIMQRGIYESRAYATLLLKK  239

Query  953   MLEtttlnpslsqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAA  774
             +LE       +           F++VVQIL D  S KA+KSA+ +L  +C  GRNR KA 
Sbjct  240   ILEVADPMQIILLERE-----LFNEVVQILHDQISHKATKSAMQILVIICPWGRNRHKAV  294

Query  773   EAGAATVVIDLLLD---TNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILR  603
             EAGA +++I+LL+D   ++E+R  E  + VL+ LC+CAEGRAE L H A +AVVS+KILR
Sbjct  295   EAGAISMIIELLMDETFSSERRNSEMAMVVLDMLCQCAEGRAEFLNHGAAIAVVSKKILR  354

Query  602   VSQVANERGLRILYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILK  423
             VSQ+ +ER +R+L SI +F ATP ++QEMLQLGV AK+CLV+QV CG  K KE+A E+LK
Sbjct  355   VSQITSERAVRVLLSIGRFCATPCLLQEMLQLGVVAKMCLVLQVSCG-NKTKEKAKELLK  413

Query  422   LHAKEWKNSPCLPLDL  375
             LHA+ W+ SPC+P +L
Sbjct  414   LHARVWRESPCVPRNL  429



>ref|XP_009136678.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Brassica rapa]
Length=423

 Score =   428 bits (1101),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 217/424 (51%), Positives = 291/424 (69%), Gaps = 33/424 (8%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             +EI +P +FLCPISL+IMKDPV +STGITYDRDNIEKW+F+GKN +CPVTKQ ++ TD  
Sbjct  3     QEIDIPCFFLCPISLDIMKDPVIVSTGITYDRDNIEKWLFTGKNNSCPVTKQVITETD--  60

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPN  LRR+IQSWCTL+AS+G+ER  TPKP ++KS I KL++ + S+ +   K L+ L
Sbjct  61    -LTPNHTLRRLIQSWCTLNASYGIERIATPKPLISKSEIEKLIKDSSSSYQNQVKCLKRL  119

Query  1214  RSMAPENAANKRCMESAGVAEFLAQIIKTSEDNPTD-------------------DALYV  1092
             R +  EN  NKRC+E+AGV EFLA I+  S D   D                   +AL +
Sbjct  120   RQIVSENPTNKRCLEAAGVPEFLANIVSNSVDTSNDLCQSNMLENRFDSSRSLMDEALSI  179

Query  1091  LHNLGLSENGLRSILGHD--TQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpsls  918
             L++L  SE   +S+L +   T  + +LT++MQ G+YESRAYA  LLK +LE       + 
Sbjct  180   LYHLDTSEEARKSLLNNKKGTNLVMTLTKIMQRGNYESRAYAAFLLKKILEVADPMQIIL  239

Query  917   qltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLL  738
                       F++VVQIL D  S KA+ SA+ +L  +C  GRNR KA  AGA +++I+LL
Sbjct  240   LERE-----LFNEVVQILSDQISHKATTSAMQILVIICPWGRNRHKAVAAGAVSMIIELL  294

Query  737   LD---TNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRI  567
             +D   ++E+R  E  + VL+ LC+CAEGRAE L H A +AVVS+KILRVSQ+ +ER +R+
Sbjct  295   MDETFSSERRNSEMAMVVLDMLCQCAEGRAEFLNHGAAIAVVSKKILRVSQITSERAVRV  354

Query  566   LYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCL  387
             L SI +F ATP ++QEMLQLGV AK+CLV+QV CG  K KE+A E+LKLHA+ W+ SPC+
Sbjct  355   LLSIGRFCATPCLLQEMLQLGVVAKMCLVLQVSCG-NKTKEKAKELLKLHARVWRESPCV  413

Query  386   PLDL  375
             P +L
Sbjct  414   PRNL  417



>gb|KFK34491.1| hypothetical protein AALP_AA5G152500 [Arabis alpina]
Length=439

 Score =   429 bits (1102),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 218/436 (50%), Positives = 296/436 (68%), Gaps = 45/436 (10%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             +EI++P +FLCPISL+IMKDPV +STGITYDR++IEKW+F+GK  +CPVTKQ ++ TD  
Sbjct  3     QEIEIPSFFLCPISLDIMKDPVIVSTGITYDRESIEKWLFTGKKNSCPVTKQIITETD--  60

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPN  LRR++QSWCTL+AS+G+ER PTPKPP+ KS I KL++ + S+ +   K L+ L
Sbjct  61    -LTPNHTLRRLVQSWCTLNASYGIERIPTPKPPICKSEIDKLIKDSSSSHQNQVKCLKRL  119

Query  1214  RSMAPENAANKRCMESAGVAEFLAQIIKTSEDNPT-------------------------  1110
             R +  EN  NKRC+E+A V EFLA I+  S D                            
Sbjct  120   RQIVSENTTNKRCLEAAQVPEFLANIVSNSVDTYNSPSSSLSSSNLNDLCQSNMLENRFD  179

Query  1109  ------DDALYVLHNLGLSENGLRSILGHD--TQFIDSLTRVMQHGSYESRAYAVMLLKS  954
                   D+AL +L++L  SE GL+++L +   T  + +LT++MQ G YESRAYA +LLK 
Sbjct  180   SSRSLMDEALSLLYHLDASETGLKTLLNNKKGTNLVKTLTKIMQRGIYESRAYATLLLKK  239

Query  953   MLEtttlnpslsqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAA  774
             +LE       +           F +V+QIL D  S+KA+KSA+ +L  +C  GRNR KA 
Sbjct  240   ILEVADPMQIILLERE-----LFVEVIQILHDQISQKATKSAMQILVIICPWGRNRHKAV  294

Query  773   EAGAATVVIDLLLD---TNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILR  603
             EAGA +++I+LL+D   ++E+R  E  + VL+ LC+CAEGRAE L H A +AVVS+KILR
Sbjct  295   EAGAISMIIELLMDDTFSSERRNSEMAMVVLDMLCQCAEGRAEFLHHGAAIAVVSKKILR  354

Query  602   VSQVANERGLRILYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILK  423
             VSQ+ +ER +R+L SI +F ATPS++QEMLQLGV AKLCLV+QV CG  K KE+A E+LK
Sbjct  355   VSQITSERAVRVLLSIGRFCATPSLLQEMLQLGVVAKLCLVLQVSCG-NKTKEKAKELLK  413

Query  422   LHAKEWKNSPCLPLDL  375
             LHA+ W+ SPC+P +L
Sbjct  414   LHARVWRESPCVPRNL  429



>emb|CDX79645.1| BnaC03g19810D [Brassica napus]
Length=408

 Score =   427 bits (1099),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 219/410 (53%), Positives = 294/410 (72%), Gaps = 18/410 (4%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             EEI++PP+FLCPISLEIMKDPV +STGITYDRD+IEKW+FSGK  +CPVTKQ ++  D  
Sbjct  3     EEIEIPPFFLCPISLEIMKDPVIVSTGITYDRDSIEKWLFSGKKNSCPVTKQDITDAD--  60

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPN  LRR+IQSWCTL+AS+GVER PTP+ P+ KS I KL++ + S+ +     L+ L
Sbjct  61    -LTPNHTLRRLIQSWCTLNASYGVERIPTPRSPICKSEIEKLIKDSASSHKNQVMCLKRL  119

Query  1214  RSMAPENAANKRCMESAGVAEFLAQIIKT----SEDNPTDDALYVLHNLGLSENGLRSIL  1047
             R +  ENA NKRC+E AGV EFLA II      S  + +D+AL +L++L  SE  L+++L
Sbjct  120   RQIVSENATNKRCLEVAGVPEFLATIISNNGFDSSMSLSDEALSLLYHLESSETVLKNLL  179

Query  1046  GHDT--QFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVV  873
              +      + SLT++MQ G YESRAYA +LLK++LE       ++   +      F +VV
Sbjct  180   NNKKGGNIVKSLTKIMQRGIYESRAYATLLLKNILEVADPMQIMTLKPS-----VFTEVV  234

Query  872   QILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLD---TNEKRYCEWG  702
             QIL D  S KA+K+A+H+L   C  GRNR KA EAG  +V+I+LLLD   ++++R  E  
Sbjct  235   QILDDRISHKATKAAMHILVTTCPWGRNRHKAVEAGVISVIIELLLDESFSSDRRGPEMA  294

Query  701   LSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQ  522
             + VL+ LC+CAEGRAE L H A +AVV +KILRVSQ A++R +R+L S+ +F ATP+++Q
Sbjct  295   MVVLDMLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGRFCATPALLQ  354

Query  521   EMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             EMLQLGV  K+ LV+QV CG  K KE+A E+LKLHA+ WK+SPCLP ++I
Sbjct  355   EMLQLGVVEKMFLVLQVSCG-SKTKEKAKELLKLHARVWKDSPCLPRNMI  403



>ref|XP_002513723.1| ubiquitin-protein ligase, putative [Ricinus communis]
 gb|EEF48670.1| ubiquitin-protein ligase, putative [Ricinus communis]
Length=414

 Score =   426 bits (1095),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 214/411 (52%), Positives = 296/411 (72%), Gaps = 23/411 (6%)
 Frame = -1

Query  1571  EIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEF  1392
             EI +P +FLCPISL++M+DPVT+STGITYDR+NIE+W+F+ KN TCPVTKQ +   +DE 
Sbjct  2     EIDIPCHFLCPISLQLMRDPVTVSTGITYDRENIERWLFACKNNTCPVTKQVI--LNDED  59

Query  1391  LTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTLR  1212
             LTPN  LRR+IQ+WCTL+ASHG+ER PTPKPP+ K+ I +LL    + P +  K L+ +R
Sbjct  60    LTPNHTLRRLIQAWCTLNASHGIERIPTPKPPIDKTQIAELLNDCNTFPHLQLKYLRRIR  119

Query  1211  SMAPENAANKRCMESAGVAEFLAQIIKTS---------EDNP-----TDDALYVLHNLGL  1074
             S+  E+  N+  +E+AG  + LA I+            +D+P     +D+AL +L+ L +
Sbjct  120   SITLESERNRSFLEAAGAVDILASIVVNDNSTSVEISIDDDPEFTRASDEALSILYLLKI  179

Query  1073  SENGLRSILGHDTQ-FIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttln  897
             S++ L++++  D   F++SL ++++H +Y+SRAY+ MLLKS+ E       ++       
Sbjct  180   SDSKLKNLIAKDRGVFVESLIQILKHSNYQSRAYSTMLLKSIFEVADPIQLITIRPE---  236

Query  896   lSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKR  717
                  +VV +LRD  S++ SK+AL LL  VC  GRNRIKA E GA TV+I+LLL+T+++R
Sbjct  237   --ILTEVVHVLRDQISQQTSKAALKLLVEVCPWGRNRIKAVEGGAVTVLIELLLETSDRR  294

Query  716   YCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSAT  537
              CE  L +L+ LC CAEGRAE LKH AGLA+VS+KILRVS VA++R +RIL SI +FSAT
Sbjct  295   SCELTLIILDLLCGCAEGRAEFLKHGAGLAIVSKKILRVSHVASDRAVRILCSICRFSAT  354

Query  536   PSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLP  384
             P V+QEMLQ+GV AKLCLV+QVD G  K+KERA EIL+LH++ WKNSPC+P
Sbjct  355   PRVLQEMLQVGVVAKLCLVLQVDSGC-KSKERAREILRLHSRVWKNSPCVP  404



>ref|XP_007150019.1| hypothetical protein PHAVU_005G119100g [Phaseolus vulgaris]
 gb|ESW22013.1| hypothetical protein PHAVU_005G119100g [Phaseolus vulgaris]
Length=403

 Score =   426 bits (1094),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 224/408 (55%), Positives = 298/408 (73%), Gaps = 15/408 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M+E+++P +FLCPISL++M+DPVT+ TGITYDR+NIEKW+FS KN TCPVTKQ+L   D 
Sbjct  1     MDEVEIPAHFLCPISLQLMRDPVTVCTGITYDRENIEKWLFSCKNNTCPVTKQSLLDHD-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQSWCTL+AS GVER PTPK P+ ++ I+KLL +AK  PE   K L  
Sbjct  60    --LTPNHTLRRLIQSWCTLNASLGVERIPTPKSPIDRTQIVKLLAEAKRFPEKQLKCLTR  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIK-TSEDNPT----DDALYVLHNLGLSENGLRS  1053
             LRS+A E   NK C+ESAGV EFLA  +K  +E+N T    + A+ VL +L  SE  L++
Sbjct  118   LRSIAFEGQRNKTCLESAGVVEFLASTMKHKTEENSTVLLCEAAIEVLFHLNPSEAQLKA  177

Query  1052  ILGHDT-QFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQV  876
             ++ ++  QFI+SL  V++ G+Y+SRAYA MLL+S LE       +S  T       F ++
Sbjct  178   LIYNEGFQFIESLFHVLRLGNYQSRAYATMLLRSALEVADPIQLISVKTV-----LFVEI  232

Query  875   VQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLS  696
             +++LRD  S++ASK+AL L+  +   GRNRIK  E GA +V+I+LLL T+E+R CE  L 
Sbjct  233   LRVLRDQISQQASKAALKLIVELFPWGRNRIKGVEGGAVSVLIELLLCTSERRTCELILI  292

Query  695   VLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEM  516
              L+QLC CAEGRAE+L HAAGLA+VS+KILRVS VA++RG+RI  SI ++SA   V+ EM
Sbjct  293   ALDQLCGCAEGRAELLNHAAGLAIVSKKILRVSLVASDRGVRIFASICRYSANARVLHEM  352

Query  515   LQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             LQ+G  +KLCLV+QV+CG  K +ERA EILKLH+  WKNSPC+P+ L+
Sbjct  353   LQVGAVSKLCLVLQVNCGF-KTRERAKEILKLHSSVWKNSPCIPVPLL  399



>ref|XP_008241067.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase PUB23-like 
[Prunus mume]
Length=378

 Score =   423 bits (1087),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 214/407 (53%), Positives = 288/407 (71%), Gaps = 38/407 (9%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             +EI VP +F+CPISLEIMKDPVTI+TGITYDR++IEKW+F  KN TCPVTKQ +S +D  
Sbjct  3     QEIDVPSFFICPISLEIMKDPVTITTGITYDRESIEKWLFLSKNNTCPVTKQVVSDSD--  60

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              +TPN  LRR++Q+WCTL+ASHG+ER PTPKPPV+K+ I KL R+AK +P+ L+K L+ +
Sbjct  61    -ITPNHTLRRLLQAWCTLNASHGIERIPTPKPPVSKTQIAKLFREAKKSPQCLSKCLREI  119

Query  1214  RSMAPENAANKRCMESAGVAEFLAQII----KTSEDNPTDDALYVLHNLGLSENGLRSIL  1047
             RSMA  + ANKR +E+AG +EFL+ +I    + + +  +++AL +L+NL LS + L++ +
Sbjct  120   RSMASHSEANKRSIEAAGASEFLSSMIINNVRNNNNVESEEALSILYNLNLSADALKTFV  179

Query  1046  GHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQI  867
             G + +FI++L ++MQ GSYESRAYAVML +SM E            T L   FF +VVQ+
Sbjct  180   GKEGEFIEALIKLMQRGSYESRAYAVMLFRSMFE----VADDPMKMTNLRPEFFIEVVQV  235

Query  866   LRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLSVLE  687
             L D  S++ASK+ L LL  +C  GRNR+KA EAGA  V+I+LLLDT+  R          
Sbjct  236   LNDQISQQASKATLQLLIKLCPWGRNRVKAVEAGAVKVLIELLLDTSADRR---------  286

Query  686   QLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEMLQL  507
                               L ++S+KI+RVS+V +ER +RIL+SI KFSATPSV+QEM+QL
Sbjct  287   -----------------TLEMISKKIMRVSKVGSERAVRILFSICKFSATPSVLQEMMQL  329

Query  506   GVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIHN  366
             GV AKLCLV+QVD G  K KE+A EILKLHA+ WKNS C+P  L+ +
Sbjct  330   GVVAKLCLVLQVDSG-SKTKEKAREILKLHARTWKNSTCIPSSLVSS  375



>ref|XP_004497653.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Cicer arietinum]
Length=441

 Score =   425 bits (1092),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 219/439 (50%), Positives = 302/439 (69%), Gaps = 44/439 (10%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFS---GKNATCPVTKQALS--  1410
             +EI V P+F+CPISL++MKDPVT+STGITYDR+NIEKW+FS     N TCPVTKQ LS  
Sbjct  3     QEIDVSPFFMCPISLQLMKDPVTVSTGITYDRENIEKWLFSSNNNNNKTCPVTKQQLSHD  62

Query  1409  --GTDDEFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKST---P  1245
                 D   LTPN  LRR+IQ+WCT+++SHG++R PTPKPP T + I K++++A  +   P
Sbjct  63    NQNNDLIILTPNHTLRRLIQAWCTINSSHGIQRIPTPKPPTTINLIQKIIKEASDSLDSP  122

Query  1244  EMLAKVLQTLRSMAPENAANKRCMESAGVAEFLAQIIKTS------------EDNPTDD-  1104
              +L + L+ L+S+A E+  N+RC+ESAG  EFLA+II  +            ED   DD 
Sbjct  123   HLLIQSLKRLKSIASESETNRRCIESAGAVEFLAEIITKNTNSSASSSSTEFEDTLYDDF  182

Query  1103  --------------ALYVLHNLGLSENGLRSILGH-DTQFIDSLTRVMQHGSYESRAYAV  969
                           A+ +LHNL LSE GL+++L   + +F+DSL +++Q G Y+SR YAV
Sbjct  183   EGFAFEFKVEAEDEAISILHNLHLSEQGLKTLLNFKNGEFLDSLIKLLQKGIYDSRTYAV  242

Query  968   MLLKSMLEtttlnpslsqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRN  789
             +LLKS+ E        +  T      FF ++VQ+L+D  S+KASK+ L  L  V + GRN
Sbjct  243   LLLKSISEVAEPAKLSNLKTE-----FFVELVQLLKDQISKKASKATLQTLIQVVEHGRN  297

Query  788   RIKAAEAGAATVVIDLLLDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKI  609
             R++  E+G   V+I+LLLD  E++ CE  L VLE LC+CA+GRAE+LKH  GL +VS+KI
Sbjct  298   RVRLVESGCVCVLIELLLDCKERKPCEMILVVLEMLCQCADGRAEILKHGCGLGIVSKKI  357

Query  608   LRVSQVANERGLRILYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEI  429
             LRVS +AN+R +RIL S+++FSATP VVQEML++G+ AKLCL++QVD G  K K++A EI
Sbjct  358   LRVSNMANDRAVRILLSVSRFSATPLVVQEMLEIGIVAKLCLILQVDSG-NKAKDKAREI  416

Query  428   LKLHAKEWKNSPCLPLDLI  372
             LKLHAK W++S C+P +L+
Sbjct  417   LKLHAKSWRHSHCIPTNLL  435



>ref|XP_010426860.1| PREDICTED: E3 ubiquitin-protein ligase PUB22 [Camelina sativa]
Length=435

 Score =   424 bits (1089),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 215/436 (49%), Positives = 293/436 (67%), Gaps = 45/436 (10%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             +EI++P +FLCPISL+IMKDPV +STGITYDRD+IEKW+FSGK  TCPVTKQ ++ +D  
Sbjct  3     QEIEIPSFFLCPISLDIMKDPVIVSTGITYDRDSIEKWLFSGKKNTCPVTKQVITESD--  60

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPN  LRR+IQSWCTL+AS+G+ER PTPKPP+ K+ I KL++ + S+ +   K L+ L
Sbjct  61    -LTPNHTLRRLIQSWCTLNASYGIERIPTPKPPICKAEIEKLIKDSSSSHQNQVKCLKRL  119

Query  1214  RSMAPENAANKRCMESAGVAEFLAQIIKTSEDNPT-------------------------  1110
             R +  EN  NKRC+E+A V EFLA I+  S D                            
Sbjct  120   RQIVSENTTNKRCLEAAEVPEFLANIVSNSVDTYNSPSSSLSSSNLNDMCQSNMLENRFD  179

Query  1109  ------DDALYVLHNLGLSENGLRSILGHD--TQFIDSLTRVMQHGSYESRAYAVMLLKS  954
                   D+AL +L++L  SE  L+S+L +   T  + +LT++MQ G YESRAYA +LLK 
Sbjct  180   SSRSLMDEALSLLYHLETSETALKSLLNNKKGTNLVKTLTKIMQRGIYESRAYAALLLKK  239

Query  953   MLEtttlnpslsqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAA  774
             +LE       +           F +V+QIL D  S KA++SA+ +L  +C  GRNR KA 
Sbjct  240   ILEVADPMQIILLERE-----LFAEVLQILHDQISHKATRSAMQILVIICPWGRNRHKAV  294

Query  773   EAGAATVVIDLLLD---TNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILR  603
             EAG  +++I+LL+D   ++E+R  E  + VL+ LC+CAEGR+E L H A +A+VS+KILR
Sbjct  295   EAGVISMIIELLMDETFSSERRNLEMAMVVLDMLCQCAEGRSEFLNHGAAIALVSKKILR  354

Query  602   VSQVANERGLRILYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILK  423
             VSQ+ +ER +R+L S+ +F ATPS++QEMLQLGV AKLCLV+QV CG  K KE+A E+LK
Sbjct  355   VSQITSERAVRVLLSVGRFCATPSLLQEMLQLGVVAKLCLVLQVSCG-NKTKEKAKELLK  413

Query  422   LHAKEWKNSPCLPLDL  375
             LHA+ W+ SPC+P +L
Sbjct  414   LHARVWRESPCVPRNL  429



>ref|XP_010515711.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Camelina sativa]
Length=435

 Score =   424 bits (1089),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 215/436 (49%), Positives = 294/436 (67%), Gaps = 45/436 (10%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             +EI++P +FLCPISL+IMKDPV +STGITYDRD+IEKW+FSGK  TCPVTKQ ++ +D  
Sbjct  3     QEIEIPSFFLCPISLDIMKDPVIVSTGITYDRDSIEKWLFSGKKNTCPVTKQVITESD--  60

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPN  LRR+IQSWCTL+AS+G+ER PTPKPP+ K+ I KL++ + S+ +   K L+ L
Sbjct  61    -LTPNHTLRRLIQSWCTLNASYGIERIPTPKPPICKAEIEKLIKDSSSSHQNQVKCLKRL  119

Query  1214  RSMAPENAANKRCMESAGVAEFLAQIIKTSED----------------------------  1119
             R +  EN  NKRC+E+A V EFLA I+  S D                            
Sbjct  120   RQIVSENTTNKRCLEAAEVPEFLANIVSKSVDTYNSPSSSLSSSNLNDMCQSNMLENRFD  179

Query  1118  ---NPTDDALYVLHNLGLSENGLRSILGHD--TQFIDSLTRVMQHGSYESRAYAVMLLKS  954
                +  D+AL +L++L  SE  L+S+L +   T  + +LT++MQ G YESRAYA +LLK 
Sbjct  180   SSRSLMDEALSLLYHLETSETALKSLLNNKKGTNLVKTLTKIMQRGIYESRAYAALLLKK  239

Query  953   MLEtttlnpslsqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAA  774
             +LE       +           F +V+QIL D  S KA++SA+ +L  +C  GRNR KA 
Sbjct  240   ILEVADPMQIILLERE-----LFAEVLQILHDQISHKATRSAMQILVIICPWGRNRHKAV  294

Query  773   EAGAATVVIDLLLD---TNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILR  603
             EAG  +++I+LL+D   ++E+R  E  + VL+ LC+CAEGR+E L H A +A+VS+KILR
Sbjct  295   EAGVISMIIELLMDETFSSERRNLEMAMVVLDMLCQCAEGRSEFLNHGAAIALVSKKILR  354

Query  602   VSQVANERGLRILYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILK  423
             VSQ+ +ER +R+L S+ +F ATPS++QEMLQLGV AKLCLV+QV CG  K KE+A E+LK
Sbjct  355   VSQITSERAVRVLLSVGRFCATPSLLQEMLQLGVVAKLCLVLQVSCG-NKTKEKAKELLK  413

Query  422   LHAKEWKNSPCLPLDL  375
             LHA+ W+ SPC+P +L
Sbjct  414   LHARVWRESPCVPRNL  429



>ref|XP_009133058.1| PREDICTED: E3 ubiquitin-protein ligase PUB23 [Brassica rapa]
Length=409

 Score =   422 bits (1086),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 219/411 (53%), Positives = 296/411 (72%), Gaps = 19/411 (5%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             EEI++PP+FLCPISLEIMKDPV +STGITYDR++IEKW+FSGK  +CPVTKQ ++  D  
Sbjct  3     EEIEIPPFFLCPISLEIMKDPVIVSTGITYDRESIEKWLFSGKKNSCPVTKQDITDAD--  60

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPN  LRR+IQSWCTL+AS+GVER PTP+ P+ KS I KL++ + S+ +   K L+ L
Sbjct  61    -LTPNHTLRRLIQSWCTLNASYGVERIPTPRSPICKSEIEKLIKDSASSHKNKVKCLKRL  119

Query  1214  RSMAPENAANKRCMESAGVAEFLAQIIK-----TSEDNPTDDALYVLHNLGLSENGLRSI  1050
             R +  EN  NKRC+E AGV EFLA II      +S  + +D+AL +L++L  SE  L+++
Sbjct  120   RQIVSENTTNKRCLEVAGVPEFLATIISNNGVDSSMVSLSDEALSLLYHLESSERVLKNL  179

Query  1049  LGHDT--QFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQV  876
             L +      + SL ++MQ G YESRAYA +LLK++LE      +      TL  S F +V
Sbjct  180   LNNKKGGNIVKSLIKIMQRGIYESRAYATLLLKNILE-----VADPMQIMTLKPSVFTEV  234

Query  875   VQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLD---TNEKRYCEW  705
             VQIL D  S KA+K+A+H+L  +C  GRNR KA EAGA +V+I+LL+D   ++++R  E 
Sbjct  235   VQILDDRISHKATKAAMHVLVTICPWGRNRHKAVEAGAISVIIELLMDESFSSDRRGPEM  294

Query  704   GLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVV  525
              + VL+ LC+CAEGRAE L H A +AVV +KILRVSQ A++R +R+L S+ +F ATP+++
Sbjct  295   AMVVLDMLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGRFCATPALL  354

Query  524   QEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
              EMLQLGV  KL LV+Q+ CG  K KE+A E+LKLHA+ WK+SPCLP ++I
Sbjct  355   HEMLQLGVVEKLFLVLQISCG-SKTKEKAKELLKLHARVWKDSPCLPRNMI  404



>emb|CDX84587.1| BnaA03g16430D [Brassica napus]
Length=409

 Score =   422 bits (1085),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 216/411 (53%), Positives = 294/411 (72%), Gaps = 19/411 (5%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             EEI++PP+FLCPISLEIMKDPV +STGITYDRD+IEKW+FSGK  +CPVTKQ ++  D  
Sbjct  3     EEIEIPPFFLCPISLEIMKDPVIVSTGITYDRDSIEKWLFSGKKNSCPVTKQDITDAD--  60

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPN  LRR+IQSWCTL+AS+GVER PTP+ P+ KS I KL++ + S+ +   K L+ L
Sbjct  61    -LTPNHTLRRLIQSWCTLNASYGVERIPTPRSPICKSEIEKLIKDSASSHKNKVKCLKRL  119

Query  1214  RSMAPENAANKRCMESAGVAEFLAQIIK-----TSEDNPTDDALYVLHNLGLSENGLRSI  1050
             R +  E   NKRC+E AGV EFLA II      +S  + +D+AL +L++L  SE  L+++
Sbjct  120   RQIVSETTTNKRCLEVAGVPEFLATIISNNGVDSSMVSLSDEALSLLYHLESSERVLKNL  179

Query  1049  LGHDT--QFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQV  876
             L +      + SL ++MQ G YESRAYA +LLK++LE       ++   +      F +V
Sbjct  180   LNNKKGGNIVKSLIKIMQRGIYESRAYATLLLKNILEVADPMQIMTLKPS-----VFTEV  234

Query  875   VQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLD---TNEKRYCEW  705
             VQIL D  S KA+K+A+H+L  +C  GRNR KA EAGA +V+I+LL+D   ++++R  E 
Sbjct  235   VQILDDRISHKATKAAMHVLVTICPWGRNRHKAVEAGAISVIIELLMDESFSSDRRGPEM  294

Query  704   GLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVV  525
              + VL+ LC+CAEGRAE L H A +AVV +KILRVSQ A++R +R+L S+ +F ATP+++
Sbjct  295   AMVVLDMLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGRFCATPALL  354

Query  524   QEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
              EMLQLGV  KL LV+Q+ CG  K KE+A E+LKLHA+ WK+SPCLP ++I
Sbjct  355   HEMLQLGVVEKLFLVLQISCG-SKTKEKAKELLKLHARVWKDSPCLPRNMI  404



>ref|XP_003520716.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Glycine max]
 gb|KHN33151.1| E3 ubiquitin-protein ligase PUB22 [Glycine soja]
Length=420

 Score =   422 bits (1085),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 230/424 (54%), Positives = 297/424 (70%), Gaps = 31/424 (7%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             + EI VP +FLCPISLEIMKDPVT+STGITYDR++IE W+FS KN TCP+TKQ L    D
Sbjct  3     INEIDVPSFFLCPISLEIMKDPVTVSTGITYDRESIETWLFSKKNTTCPMTKQPLIDYTD  62

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WCT++ SHG+ER PTPKPP+ K+ I KLL+ A  +P      L+ 
Sbjct  63    --LTPNHTLRRLIQAWCTMNTSHGIERIPTPKPPINKNQISKLLKDASHSP---LTCLRR  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTS-------------------EDNPTDDALY  1095
             L+S+A  +  NKRCME++GV EFLA I+  +                     + +D+AL 
Sbjct  118   LKSIASGSETNKRCMEASGVVEFLASIVINNNNIVSSNEADSNEGSGFELRTSASDEALS  177

Query  1094  VLHNLGLSENGLRSILGHDT-QFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpsls  918
             +LHNL LS+ GL+++L   T  FI+SLTRVMQ G +ESRAYAV LLKSM E       L 
Sbjct  178   LLHNLHLSDQGLKTLLSFKTGDFIESLTRVMQKGFFESRAYAVFLLKSMSEVAEPVQLLH  237

Query  917   qltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLL  738
                       F ++VQ+L+D  S+K SK+ L  L      GRNRIKA EAG   V+++LL
Sbjct  238   LRQD-----LFVELVQVLKDQISQKTSKATLQTLIQFSPWGRNRIKAVEAGTVPVLVELL  292

Query  737   LDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYS  558
             LD  E++ CE  L +LE LC+CAEGRAE+L HAAGLA+VS+KILRVS +AN+R ++IL S
Sbjct  293   LDCKERKPCEMMLVLLEILCQCAEGRAELLNHAAGLAIVSKKILRVSTLANDRAVKILLS  352

Query  557   IAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLD  378
             +++FSATP VVQEML+LGV AKLCLV+QVD G  K KE+A EILKLHA+ W+NSPC+P +
Sbjct  353   VSRFSATPHVVQEMLKLGVVAKLCLVLQVDSG-NKAKEKAREILKLHARAWRNSPCIPNN  411

Query  377   LIHN  366
             L+++
Sbjct  412   LLNS  415



>ref|XP_006293176.1| hypothetical protein CARUB_v10019493mg [Capsella rubella]
 gb|EOA26074.1| hypothetical protein CARUB_v10019493mg [Capsella rubella]
Length=435

 Score =   422 bits (1084),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 215/436 (49%), Positives = 293/436 (67%), Gaps = 45/436 (10%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             +EI++P +FLCPISL+IMKDPV +STGIT+DRD+IEKW+FSGK  +CPVTKQ ++ +D  
Sbjct  3     QEIEIPSFFLCPISLDIMKDPVIVSTGITFDRDSIEKWLFSGKKNSCPVTKQVITESD--  60

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPN  LRR+IQSWCTL+AS+GVER PTPKPP+ K+ I KL++ + S+ +   K L+ L
Sbjct  61    -LTPNHTLRRLIQSWCTLNASYGVERIPTPKPPICKAEIEKLIKDSSSSHQNQVKCLKRL  119

Query  1214  RSMAPENAANKRCMESAGVAEFLAQIIKTSEDNPT-------------------------  1110
             R +  EN  NKRC+E+A V EFLA I+  S D                            
Sbjct  120   RQIVSENTTNKRCLEAAEVPEFLANIVTNSVDTYNSPSSSLSSSNLNDMCQSNMLENRFD  179

Query  1109  ------DDALYVLHNLGLSENGLRSILGHD--TQFIDSLTRVMQHGSYESRAYAVMLLKS  954
                   D+AL +L++L  SE  L+S+L +   T  + +LT++MQ G YESRAYA +LLK 
Sbjct  180   SSRSLMDEALSLLYHLEASETALKSLLNNKKGTNLVKTLTKIMQRGIYESRAYAALLLKK  239

Query  953   MLEtttlnpslsqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAA  774
             +LE       +           F +V+QIL D  S KA++SA+ +L  +C  GRNR KA 
Sbjct  240   ILEVADPMQIILLERE-----LFAEVLQILHDQISHKATRSAMQILVIICPWGRNRHKAV  294

Query  773   EAGAATVVIDLLLD---TNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILR  603
             EAG  +++I+LL+D   ++E+R  E  + VL+ LC+CAEGR+E L H A +A+VS+KILR
Sbjct  295   EAGFISMIIELLMDETFSSERRNTEMAMVVLDMLCQCAEGRSEFLNHGAAIALVSKKILR  354

Query  602   VSQVANERGLRILYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILK  423
             VSQ+ +ER +R+L S+ KF ATPS++QEMLQLGV AKLCLV+QV CG  K KE+A E+LK
Sbjct  355   VSQITSERAVRVLLSVGKFCATPSLLQEMLQLGVVAKLCLVLQVSCG-NKTKEKAKELLK  413

Query  422   LHAKEWKNSPCLPLDL  375
             LHA+ W+ SPC+P +L
Sbjct  414   LHARVWRESPCVPRNL  429



>ref|XP_003518177.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Glycine max]
Length=418

 Score =   421 bits (1081),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 227/425 (53%), Positives = 300/425 (71%), Gaps = 37/425 (9%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSG-KNATCPVTKQALSGTD  1401
             M+EI VPP+F+CPISLE+MKDPVT+STGITYDRD+IEKW+F+  KN TCPVTKQ L    
Sbjct  1     MDEIDVPPFFVCPISLELMKDPVTVSTGITYDRDSIEKWLFAEVKNDTCPVTKQPLLPD-  59

Query  1400  DEFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQ--AKSTPEMLAKV  1227
                LTPN  LRR+IQ+WCT++ASHGV+R PTPKPPV K+ I KLLR   A  +P +  + 
Sbjct  60    ---LTPNHTLRRLIQAWCTVNASHGVQRIPTPKPPVDKTLIEKLLRNTSASDSPSLQLRS  116

Query  1226  LQTLRSMAPENAANKRCMESA-GVAEFLAQI-------------------IKTSEDNPTD  1107
             L+TL+S+A E+ +NKRC+ESA G   FLA I                   IKTS  +   
Sbjct  117   LRTLKSIASESQSNKRCIESAEGAVNFLATIITTTTTTTTNLLDDDIELEIKTSTAH---  173

Query  1106  DALYVLHNLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnp  927
             +AL +LH++ LSE+GL+++L H  +FI+SLT++MQ G YESRAYAV LL S+ E      
Sbjct  174   EALSLLHSIQLSESGLKALLNH-PEFINSLTKMMQRGIYESRAYAVFLLNSLSEVADPAQ  232

Query  926   slsqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVI  747
              ++  T       F ++VQ+L+D  S K SK+ L  L  VC  GRNR+KA EAGA  V++
Sbjct  233   LINLKTD-----LFTELVQVLKDQVSEKVSKATLQALIQVCSWGRNRVKAVEAGAVPVLV  287

Query  746   DLLLDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRI  567
             +LLL+ NE++  E  L +LE LC+ A+GRA +L HAAG+ +V++KILRVS +AN+R  +I
Sbjct  288   ELLLECNERKPIEMVLVLLEILCQSADGRAGLLAHAAGVVIVAKKILRVSTMANDRAAKI  347

Query  566   LYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCL  387
             L S+ +FS TP +VQEM+QLGV AKLCLV+QVD G  K KE+A EILKLHA+ W+NSPC+
Sbjct  348   LLSVCRFSPTPGLVQEMVQLGVVAKLCLVLQVDSG-NKAKEKAREILKLHARAWRNSPCI  406

Query  386   PLDLI  372
             P +L+
Sbjct  407   PHNLL  411



>gb|KEH41883.1| E3 ubiquitin-protein ligase PUB23-like protein [Medicago truncatula]
Length=437

 Score =   421 bits (1083),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 215/434 (50%), Positives = 300/434 (69%), Gaps = 39/434 (9%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             ++I+V P+FLCPISL++MKDPVT+STGITYDR++IEKW+FS +N TCPVTKQ L+   + 
Sbjct  3     QDIEVTPFFLCPISLQLMKDPVTVSTGITYDRESIEKWLFSSENKTCPVTKQLLTHDANH  62

Query  1394  F--LTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQ  1221
                LTPN  LRR+IQ+WCT+++S+G+ER PTPKPP TK  I KLL++A  +P +L + L+
Sbjct  63    LIILTPNHTLRRLIQAWCTMNSSYGIERIPTPKPPTTKILIEKLLKEASDSPHLLIQTLK  122

Query  1220  TLRSMAPENAANKRCMESAGVAEFLAQI-----------------IKTSEDN--------  1116
              L+++A E+  N+RC+ESAG  EFLA I                 I+ S D+        
Sbjct  123   KLKTIASESETNRRCIESAGAVEFLASIVTQNNTSCSSSCSATELIEASFDDDDVEGFAF  182

Query  1115  -----PTDDALYVLHNLGLSENGLRSILGH-DTQFIDSLTRVMQHGSYESRAYAVMLLKS  954
                    D+A+ +L+NL LSE GL+++L   + +F+DSL R++Q G+Y+SR YAV LLKS
Sbjct  183   DFKIGAEDEAINILYNLQLSEQGLKTLLNFKNGEFLDSLMRLLQKGNYDSRTYAVCLLKS  242

Query  953   MLEtttlnpslsqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAA  774
             +        +       L   +F ++VQ+L+D  S+KASK+ L  L  + + GRNR+KA 
Sbjct  243   I-----SKVADPSKLANLKTEYFVELVQLLKDQISKKASKATLQTLIQLVEFGRNRVKAI  297

Query  773   EAGAATVVIDLLLDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQ  594
             E+G    +I+LLLD  E++ CE  L +LE LC+CA+GR E+L H  GLA+VS+KILRVS 
Sbjct  298   ESGCVYALIELLLDCKERKPCEMILVLLEMLCQCADGRFELLNHGCGLAIVSKKILRVST  357

Query  593   VANERGLRILYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHA  414
             +AN+R +RIL S+++FSAT  VVQEML++GV AKLCLV+QVD G  K KE+A EILKLH+
Sbjct  358   MANDRAVRILLSVSRFSATHFVVQEMLRIGVVAKLCLVLQVDSG-NKAKEKAREILKLHS  416

Query  413   KEWKNSPCLPLDLI  372
             K W NS C+P +L+
Sbjct  417   KSWMNSHCIPFNLL  430



>ref|XP_002298264.1| hypothetical protein POPTR_0001s22370g [Populus trichocarpa]
 gb|EEE83069.1| hypothetical protein POPTR_0001s22370g [Populus trichocarpa]
Length=415

 Score =   420 bits (1080),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 223/414 (54%), Positives = 303/414 (73%), Gaps = 25/414 (6%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M++I VP +FLCPISL++M+DPVT+STGITYDR+NIEKW+FS KN TCPVTKQ L   D 
Sbjct  1     MDQIDVPYHFLCPISLQLMRDPVTVSTGITYDRENIEKWLFSCKNKTCPVTKQELFTKD-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WCTL+AS G+ER PTPKP   ++ I KLL  AK  P +L K L+ 
Sbjct  60    --LTPNHTLRRLIQAWCTLNASFGIERIPTPKPLADRAQISKLLNDAKKFPHLLLKSLRR  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKT---------SEDN------PTDDALYVLHN  1083
             LRS+  E+  N+ C+E AGV +FLA I+KT         S+DN       +D+AL +L++
Sbjct  118   LRSITLESERNRSCLEEAGVVDFLASILKTDNSTSVQIDSDDNESEFTRASDEALNILYH  177

Query  1082  LGLSENGLRSILGHDT-QFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltt  906
             L +S+  L++++ +D+ +F++SL ++++H SY+SRAYA MLLKS+ E       +S    
Sbjct  178   LKISQRQLKNLIINDSDRFLESLLQILKHSSYQSRAYATMLLKSVFEVADPTHLISIRPE  237

Query  905   tlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTN  726
                   F ++V++L D  S++ASK+AL LL  +C  GRNRIKA E GA +V+I+LLLDT+
Sbjct  238   -----MFVEIVRVLDDQISQQASKAALKLLVEICPWGRNRIKAVEGGAVSVLIELLLDTS  292

Query  725   EKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKF  546
             +KR CE  L+VLE LC CA+GRAE+LKH AGLAVVS+KILRVS VA+++ +RIL SI +F
Sbjct  293   DKRACELILAVLELLCGCADGRAELLKHGAGLAVVSKKILRVSHVASDKAVRILCSICRF  352

Query  545   SATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLP  384
             SAT  V+QEMLQ+G  AKLCL++QVD  + K+KERA EILK+H+K W++S C+P
Sbjct  353   SATSRVLQEMLQVGAVAKLCLILQVDSSL-KSKERAREILKVHSKVWRSSACIP  405



>ref|XP_008230336.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Prunus mume]
Length=408

 Score =   420 bits (1079),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 221/409 (54%), Positives = 296/409 (72%), Gaps = 16/409 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQAL-SGTD  1401
             MEE+ +P +FLCPISLEIM+DPVTISTGITYDR++IE+W+F+GKN  CP+TKQ L  GTD
Sbjct  1     MEEVDIPSHFLCPISLEIMRDPVTISTGITYDRESIERWLFAGKNKACPITKQPLFDGTD  60

Query  1400  DEFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQ  1221
                LTPN  LRR+IQ+WCTL+ASHGVER PTPK P+ KS I+KL+ QAK  P      L+
Sbjct  61    ---LTPNHTLRRIIQAWCTLNASHGVERIPTPKSPLEKSQIVKLIEQAKKLPNTNLHCLR  117

Query  1220  TLRSMA-PENAANKRCMESAGVAEFLAQII-KTSEDNPT--DDALYVLHNLGLSENGLRS  1053
              LRS+A  ++  NK C+E+AG  E++A II K   D+P+  + A+ VL  L  SE GL+ 
Sbjct  118   RLRSIAITQSERNKSCLEAAGAVEYVASIINKAPSDDPSIIEVAVEVLFLLKGSEAGLKD  177

Query  1052  ILGHD--TQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQ  879
             ++ +D     ++SL + ++  +++SRA+A++LLKS+ +       +S          FH+
Sbjct  178   LISNDGDNNIVESLVKALKFKNFQSRAHAIILLKSVFKVADPIQLMSVKVEC-----FHE  232

Query  878   VVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGL  699
             +V +L D  S++ASK+AL LL  +C  GRNRIKA E GA  V+I+ LL+T+EKR  E  L
Sbjct  233   IVHVLDDRISQQASKAALKLLVELCPWGRNRIKAVEGGAVAVLIEALLETHEKRASELIL  292

Query  698   SVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQE  519
              +L+QLC CAEGRAE+LKH AGLA+VS+KILRVS VA++R +RIL SI +FSAT  V+QE
Sbjct  293   ILLDQLCGCAEGRAELLKHGAGLAIVSKKILRVSHVASDRAVRILSSICRFSATCGVLQE  352

Query  518   MLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             MLQ+GV AKLCLV+QVDC   K KE+A E+LKLH++ WKNS C+P  L+
Sbjct  353   MLQVGVVAKLCLVLQVDCRF-KTKEKAREVLKLHSRVWKNSSCIPGHLL  400



>ref|XP_008799715.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Phoenix dactylifera]
Length=416

 Score =   419 bits (1077),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 210/416 (50%), Positives = 293/416 (70%), Gaps = 29/416 (7%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             MEE+++P YFLCPISL+IM+DPVT++TG+T+DR++IE+WIFSGK+ TCPVT+Q LS   D
Sbjct  1     MEEVEIPSYFLCPISLQIMRDPVTLTTGMTFDRESIERWIFSGKHKTCPVTRQPLS---D  57

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WCT +AS+G+ERFPTP+PPV K+ I  LL +AK  P  L   L+ 
Sbjct  58    LELTPNHTLRRLIQAWCTANASYGIERFPTPRPPVCKAQIAALLDEAK-LPHSLMSALRK  116

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSEDNP-------------------TDDALY  1095
             L+++  E+  NKRC+E++G  +FLA +IK S+ NP                   +D+AL 
Sbjct  117   LKAIVSESERNKRCVEASGAVDFLASLIKKSKSNPREQQQEGLINDGIELDASASDEALN  176

Query  1094  VLHNLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsq  915
             +L++L +SE  L  ++  +  FI+SLT +++  +Y+SRAYA++LLKS+L         S 
Sbjct  177   ILYSLQISEQSLLHLIERNDGFIESLTAILRRSNYQSRAYAILLLKSLLSVIAPARLTSF  236

Query  914   ltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLL  735
                     FF +VV +LRD  S +A+++AL +L  +   GRN++KA EAGA  VVI+LLL
Sbjct  237   SQE-----FFEEVVNVLRDQISHQATRAALQVLGLLSPWGRNKVKAVEAGAVPVVIELLL  291

Query  734   DTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSI  555
             D  EKR CE  L VL++LC CAEGRAE+  HAAG AVVS+K+L VS  A+ER +RILY +
Sbjct  292   DETEKRACEMMLVVLDRLCGCAEGRAEMAGHAAGFAVVSKKVLGVSPAASERAVRILYWV  351

Query  554   AKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCL  387
             A+FS TP+V+ EM+ +GV  KLC+++QV CG  K KE+A EIL+LH++ W+NSPCL
Sbjct  352   ARFSPTPAVLHEMVLVGVVTKLCILLQVHCG-EKAKEKAKEILRLHSRVWRNSPCL  406



>gb|EYU18112.1| hypothetical protein MIMGU_mgv1a007124mg [Erythranthe guttata]
Length=418

 Score =   419 bits (1076),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 240/425 (56%), Positives = 299/425 (70%), Gaps = 31/425 (7%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M EI+VP YF+CPISLEIMKDPVT+STGITYDR++IEKWIFS  N TCPVTKQ L  +D 
Sbjct  1     MAEIEVPHYFICPISLEIMKDPVTVSTGITYDRESIEKWIFSQNNQTCPVTKQLLVSSDA  60

Query  1397  EF----LTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQ-AKSTPEMLA  1233
                   LTPNI +RR+IQSWCTLHA   VER PTPKPP TK  ILKLLR  AKS P+   
Sbjct  61    AAAAADLTPNITVRRLIQSWCTLHA---VERLPTPKPPATKPQILKLLRDAAKSPPQAQI  117

Query  1232  KVLQTLRSMAPENAANKRCMESAGVAEFLAQII--------KTSED-NPTDDALYVLHNL  1080
             K LQ LRS+A +N  NKRCME+AG AEFLA  +           ED    D+A+ VLH L
Sbjct  118   KCLQKLRSIAAQNETNKRCMETAGAAEFLAAFVVGKSNLQSGLEEDLKACDEAMAVLHGL  177

Query  1079  GLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttl  900
              L+E+GL++ L  + +F+ SLT +MQ GS ESRAY++MLL+ ++E      +       L
Sbjct  178   RLTESGLKT-LSLNGEFVGSLTPLMQRGSDESRAYSIMLLQQIVE-----VAEPSHLINL  231

Query  899   nlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVI-----DLLL  735
                FF +  QIL+D    KASKSAL +L NVC  GRNRIKA EAG   V+I         
Sbjct  232   RPDFFVETTQILKDQICEKASKSALKVLINVCAWGRNRIKAVEAGLVAVIIDLLLDLPSS  291

Query  734   DTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSI  555
              + +K  CE  L+ L+ +C+CAEGRAEV+ HAAGLAVVS+KILRVS +A+ERG+RILYSI
Sbjct  292   SSEKKSACEMMLTALDLVCQCAEGRAEVVNHAAGLAVVSKKILRVSPLASERGVRILYSI  351

Query  554   AKFSA--TPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPL  381
             ++FSA     ++QEMLQ+GV AKLCL++QVDCGV + KERA E+LKLH++ W+NSPCLP 
Sbjct  352   SRFSAGGNNGILQEMLQIGVVAKLCLIMQVDCGV-RTKERAREMLKLHSRAWRNSPCLPR  410

Query  380   DLIHN  366
             +L+ +
Sbjct  411   NLLSS  415



>ref|XP_003540287.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like isoform X1 
[Glycine max]
Length=403

 Score =   418 bits (1074),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 221/408 (54%), Positives = 292/408 (72%), Gaps = 15/408 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M+EI++P +FLCPISL++M+DPVT+ TGITYDR+NIE+W+FS KN TCPVTKQ L    D
Sbjct  1     MDEIEIPAHFLCPISLQLMRDPVTVCTGITYDRENIERWLFSCKNNTCPVTKQCLL---D  57

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQSWCTL+AS GVER PTPK P+ K+ I+KLL +AK  PE   K L  
Sbjct  58    HGLTPNHTLRRLIQSWCTLNASLGVERIPTPKSPIDKTQIVKLLTEAKRFPEKQLKCLTR  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIK---TSEDNP--TDDALYVLHNLGLSENGLRS  1053
             LRS+A E   NK C+ESAGV EFLA  +K   T ED+   ++ A+ VL +L LSE  L++
Sbjct  118   LRSVAFEGQRNKTCLESAGVIEFLATTMKNNNTQEDSTVLSEAAIEVLFHLNLSEARLKT  177

Query  1052  ILGHDT-QFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQV  876
             ++ ++   FI+SL  V++ G+Y+SR YA MLL+S  E       +S  T       F ++
Sbjct  178   LINNEEFHFIESLFHVLRLGNYQSRVYATMLLRSAFEVADPIQLISVKTA-----LFVEI  232

Query  875   VQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLS  696
             +++L D  S +ASK+AL L+  +   GRNRIK  E G  +V+I+LLL T+E+R CE  L 
Sbjct  233   MRVLCDQISHQASKAALKLIVELFPWGRNRIKGVEDGTVSVLIELLLGTSERRTCELILI  292

Query  695   VLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEM  516
              L+QLC CAEGRAE+L H AG+A+VS+KILRVS VA+ERG+RIL SI ++SA   V+ EM
Sbjct  293   ALDQLCGCAEGRAELLNHGAGVAIVSKKILRVSHVASERGVRILASICRYSANARVLHEM  352

Query  515   LQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             LQ+G  +KLCLV+QV+CG  K KERA E+LKLH+  WKNSPC+P+ L+
Sbjct  353   LQVGAVSKLCLVLQVNCGF-KTKERAKEVLKLHSVVWKNSPCIPVPLL  399



>ref|XP_004136517.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Cucumis sativus]
 gb|KGN59215.1| hypothetical protein Csa_3G782630 [Cucumis sativus]
Length=406

 Score =   418 bits (1074),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 208/404 (51%), Positives = 293/404 (73%), Gaps = 11/404 (3%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             E+I+VP YFLCPISL+IMKDPVT+ +GITYDR +IE W+FSGKN++CPVTK  +S +D +
Sbjct  3     EQIEVPHYFLCPISLQIMKDPVTLPSGITYDRHSIETWLFSGKNSSCPVTKLPVSDSDSD  62

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPN  LRR+IQ+WCTL++SHGVERFPTPKPP+ KS IL ++  + ++P      ++ L
Sbjct  63    LLTPNHTLRRLIQAWCTLNSSHGVERFPTPKPPIHKSQILHIISTSNTSPSSQISSIRRL  122

Query  1214  RSMAPENAANKRCMESAGVAEFLAQIIKTSEDNPTDDALYVLHNLGLSENGLRSILGHDT  1035
             RS++ E+  N+RC+E AG  EFL  +I  S+ + + +AL  LHNL LS++  +S L    
Sbjct  123   RSISAESETNRRCVEFAGAPEFLVSVIVGSDSSASHEALSTLHNLRLSDSTFKS-LATRP  181

Query  1034  QFIDSLTRVM--QHGSYE-SRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQIL  864
             +F++SLT  M  Q G++E SR YAV++LKS++E      +     + L    F Q+V+IL
Sbjct  182   EFLESLTDFMKLQQGTHESSRTYAVLILKSIIE-----VAEPIQLSFLKPELFVQIVEIL  236

Query  863   RD-NFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLSVLE  687
             +D + S++  K+AL +L  V   GRNR+KA EAG    ++++LL + EKR CE  L+ ++
Sbjct  237   KDRSSSQQIFKAALGILIAVSPLGRNRLKAVEAGGVRALVEILLSSPEKRVCEMTLTAMD  296

Query  686   QLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEMLQL  507
              LC CA+GRA +L H  G+AVVS+KILRVSQ+ +ER +RILYS+AKFS +P+V+ EM QL
Sbjct  297   ILCGCADGRAALLAHGGGMAVVSKKILRVSQLGSERAVRILYSVAKFSGSPAVLMEMAQL  356

Query  506   GVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDL  375
             G+ AKLCLV+Q++ G GK KE+A EILK+H++ WKNSPC+P  L
Sbjct  357   GIVAKLCLVLQIENG-GKTKEKAKEILKMHSRLWKNSPCIPSKL  399



>ref|XP_011006317.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Populus euphratica]
Length=415

 Score =   418 bits (1074),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 220/418 (53%), Positives = 296/418 (71%), Gaps = 25/418 (6%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M++I VP +FLCPI  ++M+D VTISTGITYDR+NIE+W+FS KN TCPVTKQ L   D 
Sbjct  1     MDQIDVPYHFLCPIPRQLMRDQVTISTGITYDRENIERWLFSCKNNTCPVTKQELFAKDP  60

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
                TPN  LRR+IQ+WCTL+AS G+ER PTPKP   ++ I KLL  AK  P +  K L+ 
Sbjct  61    ---TPNHTLRRLIQAWCTLNASFGIERIPTPKPLADRAQISKLLNDAKKFPHLQLKSLRR  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIK----TSEDNPTDD-----------ALYVLHN  1083
             LRS+  E+  N+ C+E AG  +FLA I+K    TS D  +DD           AL +L++
Sbjct  118   LRSITLESERNRSCLEEAGAVDFLATILKNGDSTSIDIASDDGESEFSRASDEALNILYH  177

Query  1082  LGLSENGLRSILGHD-TQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltt  906
             L +S+  L++++ +D  QF++SL ++++H SY+SRAYA MLLKS+ E       +S    
Sbjct  178   LKISQRKLKNLITNDGDQFLESLLQILKHSSYQSRAYATMLLKSVFEVADPMHLISIRPE  237

Query  905   tlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTN  726
                   F ++V++L D  S+++SK+AL LL  VC  GRNRIKA E  A +V+I+LLLD +
Sbjct  238   -----MFVELVRVLNDQISQQSSKAALKLLVEVCPWGRNRIKAVEGSAVSVLIELLLDKS  292

Query  725   EKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKF  546
             +KR CE  L+VL+ LC CAEGRA++LKH AGLAVVS+KILRVS VA+++ +RILYSI++F
Sbjct  293   DKRACELVLAVLDLLCGCAEGRAQLLKHGAGLAVVSKKILRVSHVASDKAVRILYSISRF  352

Query  545   SATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             SAT  V+QEMLQ+GV AKLCLV+QVD    K+KERA EILKLH++ W+NS C+P  L+
Sbjct  353   SATTRVLQEMLQVGVVAKLCLVLQVDSSF-KSKERAREILKLHSRVWRNSACVPAYLM  409



>gb|EPS57434.1| hypothetical protein M569_17384, partial [Genlisea aurea]
Length=397

 Score =   417 bits (1072),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 222/409 (54%), Positives = 285/409 (70%), Gaps = 26/409 (6%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M EI++PPYFLCPISLEIMKDPVT+STGITYDRD+IEKWIFS  N TCPVT+Q LS   D
Sbjct  1     MAEIEIPPYFLCPISLEIMKDPVTVSTGITYDRDSIEKWIFSDGNLTCPVTRQPLS---D  57

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN+ LRRVIQSW    A + +ER PTP+ PV KS ILK+L +A+S P+  A  L  
Sbjct  58    PELTPNVTLRRVIQSW---SAYNALERLPTPRAPVGKSEILKILGEARS-PDAHANCLVK  113

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQII---------KTSEDN--PTDDALYVLHNLGLS  1071
              +S+A  + +N+R ME+AGV EFLA +I           S+D+    D+AL +L  L LS
Sbjct  114   FQSIASASQSNRRAMEAAGVVEFLASLIIRNTLELSRTISQDSIEAIDEALSILFTLQLS  173

Query  1070  ENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlS  891
             E  L S+   D  FI SLTR M +GS+ESRAY++MLL   LE       +          
Sbjct  174   EKSLASLSNAD--FISSLTRSMLNGSFESRAYSIMLLNQTLEFADPATLIGLKPD-----  226

Query  890   FFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYC  711
             FF Q   IL+D+ S+KASKSAL  L      GRNRIKA E+G   ++++ LLD  E+R C
Sbjct  227   FFQQSTLILKDDISKKASKSALSALITSAPWGRNRIKAVESGIVPILVEQLLDQPERRAC  286

Query  710   EWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPS  531
             E  L++L+ LC+CAEGRAE L HA+GLAVVS+KILRVSQ A+E+G+RI++S+AK+SAT  
Sbjct  287   EAILALLDLLCQCAEGRAEFLSHASGLAVVSKKILRVSQAASEKGVRIIHSVAKYSATKG  346

Query  530   VVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLP  384
             ++QEM+Q GV AKLCLV+QVD G+ + KE+A +ILK+H + W+NSPC P
Sbjct  347   ILQEMIQFGVVAKLCLVLQVDSGI-RTKEKALDILKMHHRTWRNSPCRP  394



>ref|XP_011021423.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Populus euphratica]
Length=415

 Score =   417 bits (1073),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 222/414 (54%), Positives = 303/414 (73%), Gaps = 25/414 (6%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M++I VP +FLCPISL++M+DPVT+STGITYDR+NIEKW+FS KN TCPVTKQ L   D 
Sbjct  1     MDQIDVPYHFLCPISLQLMRDPVTVSTGITYDRENIEKWLFSCKNETCPVTKQELFTKD-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WCTL+AS G+ER PTPKP   ++ I KLL  AK  P +L K L+ 
Sbjct  60    --LTPNHTLRRLIQAWCTLNASFGIERIPTPKPLADRAQISKLLNDAKKFPHLLLKSLRR  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKT---------SEDN------PTDDALYVLHN  1083
             LRS+  E+  N+ C+E AGV +FLA I+KT         S+DN       +D+AL +L++
Sbjct  118   LRSITLESERNRSCLEEAGVVDFLASILKTDDSTSVEIDSDDNESEFTRASDEALNILYH  177

Query  1082  LGLSENGLRSILGHD-TQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltt  906
             L +S+  L++++ +D  +F++SL ++++H SY+SRAYA MLLKS+ E       +S    
Sbjct  178   LKISQRQLKNLIINDGDRFLESLLQILKHSSYQSRAYATMLLKSVFEVADPTHLISIRPE  237

Query  905   tlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTN  726
                   F ++V++L D  S++ASK+AL LL  +C  GRNRIKA E GA +V+I+LLLDT+
Sbjct  238   -----MFVEIVRVLDDQISQQASKAALKLLMEICPWGRNRIKAVEGGAVSVLIELLLDTS  292

Query  725   EKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKF  546
             +KR CE  L+VLE LC CA+GRAE+LKH AGLAVVS+KILRVS VA+++ +RIL SI +F
Sbjct  293   DKRACELILAVLELLCGCADGRAELLKHGAGLAVVSKKILRVSHVASDKAVRILCSICRF  352

Query  545   SATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLP  384
             SAT +V+QEMLQ+G  AKLCL++QV+  + K+KERA EILK+H+K W++S C+P
Sbjct  353   SATSTVLQEMLQVGAVAKLCLILQVNSSL-KSKERAREILKVHSKVWRSSACIP  405



>ref|XP_006362641.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Solanum tuberosum]
Length=405

 Score =   417 bits (1072),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 212/411 (52%), Positives = 290/411 (71%), Gaps = 16/411 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             ME+++VP YFLCPIS+++M+DPVT STGITYDR+NIEKW+F  KN TCP+TKQ L   D 
Sbjct  1     MEDVEVPDYFLCPISMQLMRDPVTTSTGITYDRENIEKWLFKCKNTTCPITKQELLTMD-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRRVIQSWC +++SHGVER PTPK  VTKS++LKLL+QA  + EM    L+ 
Sbjct  60    --LTPNHTLRRVIQSWCIMNSSHGVERIPTPKSQVTKSYVLKLLKQAMQSQEMQLSCLRK  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSEDNPT---DDALYVLHNLGLSENGLRSIL  1047
             L+S+   + +NK+C+ES  V +FLA II   E   T   D+AL +L +L  S+  L+ ++
Sbjct  118   LKSIVHASESNKKCLESCEVVDFLASIIMKQEMTSTKTSDEALDILFHLNPSDETLKKLI  177

Query  1046  GHDTQ---FIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQV  876
               D     F+DSL   ++ G+Y+SR YA+MLLKS          +          +F ++
Sbjct  178   SKDNGDELFLDSLLYFLKCGNYQSRDYAIMLLKSAFNVADPCQLIGAKQE-----YFKEI  232

Query  875   VQILRDNF-SRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGL  699
             +  L +   S++A+K++L LL  +C  GRNRIKA E GA + +I+LL+DT E+R CE  L
Sbjct  233   LLFLNNKLISQQATKASLKLLVELCPWGRNRIKAIEVGAISTLIELLIDTIERRSCELIL  292

Query  698   SVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQE  519
             ++L QLC CAEGRAE+L H AG+A++S+K+LRVSQVA++RG+RIL SI+KFSAT  V+QE
Sbjct  293   TILHQLCSCAEGRAELLNHGAGIAIISKKVLRVSQVASDRGVRILCSISKFSATCKVLQE  352

Query  518   MLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIHN  366
             MLQ+GV +KLCLVIQVD    K KE+A EIL+LH++ W++S CLP  L+ +
Sbjct  353   MLQVGVVSKLCLVIQVD-SCSKTKEKAKEILRLHSRVWRDSSCLPPQLLSS  402



>emb|CAN82979.1| hypothetical protein VITISV_023329 [Vitis vinifera]
Length=364

 Score =   415 bits (1067),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 217/418 (52%), Positives = 281/418 (67%), Gaps = 70/418 (17%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             MEEI VPP+FLCPISLEIMKDPVT+STGITYDR++IEKW+FSGKN TCP TKQ LS   D
Sbjct  1     MEEIDVPPFFLCPISLEIMKDPVTVSTGITYDRESIEKWLFSGKNNTCPATKQVLSADSD  60

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WCTL+AS+GVER PTPK P+ K  I+KLL  AKS P++  K +  
Sbjct  61    --LTPNHTLRRLIQAWCTLNASNGVERIPTPKIPINKVQIVKLLNDAKS-PQLQMKCIGK  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIK----TSEDNPTD----------DALYVLHNL  1080
             LR++A E+ ANKRC+ESAG  EFLA I+     T+ +  +D          +AL +LH L
Sbjct  118   LRALAAESDANKRCIESAGAVEFLASIVSKANFTTFEEESDKGLESRSASSEALSILHYL  177

Query  1079  GLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttl  900
              +SE GL  ++G + +F+  L  +                                    
Sbjct  178   QVSEAGLEKLVGKNGEFVGCLDHI------------------------------------  201

Query  899   nlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEK  720
                             S +A+K+ L LL  VC  GRN++KA EAGA +++ +LLL ++EK
Sbjct  202   ----------------SHQATKATLKLLIEVCPWGRNKVKAVEAGAVSILTELLLASSEK  245

Query  719   RYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSA  540
             R CE  L+VL+QLC CAEGRAE+LKHAAG+A+VS+KILRVS VA+ER ++ILYSI+KFSA
Sbjct  246   RACEMILTVLDQLCGCAEGRAELLKHAAGMAIVSKKILRVSHVASERAVKILYSISKFSA  305

Query  539   TPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIHN  366
             TPSV+QEM QLGV AKLCLV+QVDCG  + KE++ +IL+LHA+ WKNSPC+P +L+ +
Sbjct  306   TPSVLQEMSQLGVVAKLCLVLQVDCG-SRTKEKSRDILRLHARAWKNSPCIPTNLLSS  362



>ref|XP_007207682.1| hypothetical protein PRUPE_ppa023672mg [Prunus persica]
 gb|EMJ08881.1| hypothetical protein PRUPE_ppa023672mg [Prunus persica]
Length=408

 Score =   417 bits (1071),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 221/409 (54%), Positives = 295/409 (72%), Gaps = 16/409 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQAL-SGTD  1401
             MEE+ +P +FLCPISLEIM+DPVTISTGITYDR++IE+W+FSGKN  CPVTKQ L  GTD
Sbjct  1     MEEVDIPSHFLCPISLEIMRDPVTISTGITYDRESIERWLFSGKNKACPVTKQPLFDGTD  60

Query  1400  DEFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQ  1221
                LTPN  LRR+IQ+WCTL+AS GVER PTPK P+ KS I+KL+ QAK  P      L+
Sbjct  61    ---LTPNHTLRRIIQAWCTLNASQGVERIPTPKSPLDKSQIVKLIEQAKKLPNTNLHCLR  117

Query  1220  TLRSMA-PENAANKRCMESAGVAEFLAQII-KTSEDNPT--DDALYVLHNLGLSENGLRS  1053
              LRS+A  ++   K C+E+AG  E++A II K   D+P+  + A+ VL  L  SE GL+ 
Sbjct  118   RLRSIAITQSERTKSCLEAAGAVEYVASIINKAPSDDPSIIEVAVEVLFLLKGSEAGLKD  177

Query  1052  ILGHD--TQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQ  879
             ++ +D     ++SL + ++  +++SRA+A++LLKS+ +       +S          FH+
Sbjct  178   LISNDGDNNIVESLVKALKFKNFQSRAHAIILLKSVFKVADPIQLMSAKVEC-----FHE  232

Query  878   VVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGL  699
             ++ +L D  S++ASK+AL LL  +C  GRNRIKA E GA  V+I+ LL+T+EKR  E  L
Sbjct  233   ILHVLDDRISQQASKAALKLLVELCPWGRNRIKAVEGGAVAVLIEALLETHEKRASELIL  292

Query  698   SVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQE  519
              +L+QLC CAEGRAE+LKHAAGLA+VS+KILRVS VA++R +RIL SI +FSAT  V+QE
Sbjct  293   ILLDQLCGCAEGRAELLKHAAGLAIVSKKILRVSHVASDRAVRILSSICRFSATCGVLQE  352

Query  518   MLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             MLQ+GV AKLCLV+QVDC   K KE+A E+LKLH++ WKNS C+P  L+
Sbjct  353   MLQVGVVAKLCLVLQVDCRF-KTKEKAREVLKLHSRVWKNSSCIPGHLL  400



>gb|KHN17981.1| E3 ubiquitin-protein ligase PUB23 [Glycine soja]
Length=403

 Score =   416 bits (1070),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 221/408 (54%), Positives = 292/408 (72%), Gaps = 15/408 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M+EI++P +FLCPISL++M+DPVT+  GITYDR+NIE+W+FS KN TCPVTKQ L    D
Sbjct  1     MDEIEIPAHFLCPISLQLMRDPVTVCIGITYDRENIERWLFSCKNNTCPVTKQCLL---D  57

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQSWCTL+AS GVER PTPK P+ K+ I+KLL +AK  PE   K L  
Sbjct  58    HGLTPNHTLRRLIQSWCTLNASLGVERIPTPKSPIDKTQIVKLLTEAKRFPEKQLKCLTR  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIK---TSEDNP--TDDALYVLHNLGLSENGLRS  1053
             LRS+A E   NK C+ESAGV EFLA  +K   T ED+   ++ A+ VL +L LSE  L++
Sbjct  118   LRSVAFEGQRNKTCLESAGVIEFLATTMKNNNTQEDSTVLSEAAIEVLFHLNLSEARLKT  177

Query  1052  ILGHDT-QFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQV  876
             ++ ++   FI+SL  V++ G+Y+SR YA MLL+S  E       +S  TT      F ++
Sbjct  178   LINNEEFHFIESLFHVLRLGNYQSRVYATMLLRSAFEVADPIQLISVKTT-----LFVEI  232

Query  875   VQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLS  696
             +++L D  S +ASK+AL L+  +   GRNRIK  E G  +V+I+LLL T+E+R CE  L 
Sbjct  233   MRVLCDQISHQASKAALKLIVELFPWGRNRIKGVEGGTVSVLIELLLGTSERRTCELILI  292

Query  695   VLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEM  516
              L+QLC CAEGRAE+L H AG+A+VS+KILRVS VA+ERG+RIL SI ++SA   V+ EM
Sbjct  293   ALDQLCGCAEGRAELLNHGAGVAIVSKKILRVSHVASERGVRILASICRYSANARVLHEM  352

Query  515   LQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             LQ+G  +KLCLV+QV+CG  K KERA E+LKLH+  WKNSPC+P+ L+
Sbjct  353   LQVGAVSKLCLVLQVNCGF-KTKERAKEVLKLHSVVWKNSPCIPVPLL  399



>ref|XP_009139452.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Brassica rapa]
Length=424

 Score =   417 bits (1071),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 212/425 (50%), Positives = 289/425 (68%), Gaps = 34/425 (8%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             +EI++P +FLCPISL+IMKDPV +STGITYDRD+IEKW+F+GK  +CPVTKQ ++ TD  
Sbjct  3     QEIEIPSFFLCPISLDIMKDPVIVSTGITYDRDSIEKWLFTGKKNSCPVTKQVITETD--  60

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPN  LRR+IQSWC+L+ASHG+E  PTPKPP++KS I +L++ + S+ +   K L+ L
Sbjct  61    -LTPNHTLRRLIQSWCSLNASHGIETIPTPKPPISKSEIERLIKDSSSSHKNQVKYLKRL  119

Query  1214  RSMAPENAANKRCMESAGVAEFLAQIIKT--------------------SEDNPTDDALY  1095
             R +  EN  N RC+E+A V EFLA II                      S  +  D+AL 
Sbjct  120   RQIVTENNTNTRCLEAAEVPEFLANIISNLVGTSSSLNDISNILENRFDSSRSLMDEALS  179

Query  1094  VLHNLGLSENGLRSILGHD--TQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpsl  921
             +L++L  SE   +S+L +   T  + +LT++MQ G YESR YA +LLK +LE       +
Sbjct  180   LLYHLDASETARKSLLNNKKVTNIVKTLTKIMQRGIYESRTYATLLLKKILEVADPMQII  239

Query  920   sqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDL  741
                        F++VVQIL D  S KA+KSA+ +L  +C  GRNR KA EAGA +++I+L
Sbjct  240   LLERD-----LFNEVVQILHDQISHKATKSAMQILMIICPWGRNRHKAVEAGAVSMIIEL  294

Query  740   LLD---TNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLR  570
             LLD   ++E+R  E  + VL+ LC+CAEGRA+ L H A +AVVS+KILRVSQ+ +ER  R
Sbjct  295   LLDESFSSERRNVEMTMVVLDMLCQCAEGRADFLNHGAAIAVVSKKILRVSQITSERAAR  354

Query  569   ILYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPC  390
             +L S+ +F ATP ++QEMLQLGV AKLCLV+QV CG  K K +A E+L+LHA+ W+ SPC
Sbjct  355   VLLSVGRFCATPCLLQEMLQLGVVAKLCLVLQVSCG-NKTKGKAKELLQLHARVWRESPC  413

Query  389   LPLDL  375
             +P +L
Sbjct  414   VPRNL  418



>ref|XP_003537115.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Glycine max]
Length=420

 Score =   416 bits (1069),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 223/424 (53%), Positives = 299/424 (71%), Gaps = 33/424 (8%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSG--KNATCPVTKQALSGT  1404
             M+EI VPP+F+CPISLE+MKDPVT+STGITYDR +IEKW+F+   KN TCPVTKQ L   
Sbjct  1     MDEIDVPPFFVCPISLELMKDPVTVSTGITYDRHSIEKWLFAAVPKNNTCPVTKQPLLPD  60

Query  1403  DDEFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKST--PEMLAK  1230
                 LTPN  LRR+IQ+WCT++ASHGV+R PTPKPPV K+ I KLLR A ++  P +  +
Sbjct  61    ----LTPNHTLRRLIQAWCTVNASHGVQRIPTPKPPVDKTLIEKLLRDASASDSPSLQLR  116

Query  1229  VLQTLRSMAPENAANKRCMESAGVA-EFLAQIIKTS-----------------EDNPTDD  1104
              L+TL+S+A E+ +NKRC+ESA  A  FLA  I T+                 + +   +
Sbjct  117   SLRTLKSIASESQSNKRCIESAKDAVSFLASFITTTVTVTTTTVLLDDVELEIKTSIAHE  176

Query  1103  ALYVLHNLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnps  924
             AL +LH++ LSE+GL++++ H  +FI+SLT++MQ G YESRAYAV LL S+ E       
Sbjct  177   ALSLLHSIQLSESGLKALMNH-PEFINSLTKIMQSGIYESRAYAVFLLNSLSEVADPALL  235

Query  923   lsqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVID  744
             ++          F ++VQ+L+D  S KASK+ L  L  VC  GRNR+KA EAGA  V+++
Sbjct  236   VNLKID-----LFTELVQVLKDQVSEKASKATLRALIQVCPWGRNRVKAVEAGAVPVLVE  290

Query  743   LLLDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRIL  564
             LLL+  E++  E  L +LE LC+ A+GRA +L HAAG+A+V++KILRVS +AN+R  +IL
Sbjct  291   LLLECKERKPIEMMLVLLEILCQSADGRAGLLAHAAGVAIVAKKILRVSTMANDRAAKIL  350

Query  563   YSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLP  384
              S+ +FSAT  VVQEMLQLGV AK+CLV+QVD G  K KE+A EILKLHA+ W+NSPC+P
Sbjct  351   LSVCRFSATHGVVQEMLQLGVVAKMCLVLQVDSG-NKAKEKAREILKLHARAWRNSPCIP  409

Query  383   LDLI  372
              +L+
Sbjct  410   HNLL  413



>emb|CDP15556.1| unnamed protein product [Coffea canephora]
Length=397

 Score =   414 bits (1064),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 208/404 (51%), Positives = 296/404 (73%), Gaps = 10/404 (2%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M+EI++P +FLCPIS+++M+DPV ++TG+TYDR++IEKW+F+ KN+TCP+TKQ L  TD 
Sbjct  1     MDEIEIPSHFLCPISMQLMRDPVIVATGMTYDRESIEKWLFTCKNSTCPMTKQELQSTD-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WCTL++S+G+ER PTPKPPV KS ILKL+ +AK++     K LQ 
Sbjct  60    --LTPNHNLRRLIQAWCTLNSSNGIERIPTPKPPVEKSQILKLINEAKNSTNTQIKCLQR  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSEDNPTDDALYVLHNLGLSENGLRSILGHD  1038
             LRS++  + +N++ +E+AG  EFLA II+ + D   D+AL +L++L  S+  L+ ++  D
Sbjct  118   LRSISEGSQSNRKSLEAAGAVEFLASIIEKN-DEAYDEALNLLYHLDASDADLKKLMSDD  176

Query  1037  TQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQILRD  858
              +F ++L  V++ GS +SRAYA+M+LKS          ++          F ++V IL+D
Sbjct  177   GKFAETLMPVLKCGSCQSRAYAIMMLKSAFRVADPVQLMTAKPE-----IFIEIVHILKD  231

Query  857   NFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLSVLEQLC  678
               S++ASK+AL LL ++C  GRNRIKA EAGA  V+I+LLLD++E+R  E  L++L+QLC
Sbjct  232   QISQQASKAALKLLVDLCPWGRNRIKAIEAGAVLVLIELLLDSSERRASELILTLLDQLC  291

Query  677   RCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEMLQLGVG  498
             R A+GRAE+LKH AGLA+VS+KI RVSQVA+ R + IL+SI K+S T   +QEMLQ+GV 
Sbjct  292   RTADGRAELLKHGAGLAIVSKKIFRVSQVASHRAVGILFSICKYSPTSRALQEMLQVGVV  351

Query  497   AKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIHN  366
             AKLCLV+QV+    K   RA EIL LHA+ WK+SPC+P  L+ +
Sbjct  352   AKLCLVLQVE-NNQKTIARAKEILYLHARIWKDSPCIPPALLSS  394



>ref|XP_003535700.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Glycine max]
Length=421

 Score =   415 bits (1066),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 232/425 (55%), Positives = 297/425 (70%), Gaps = 32/425 (8%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M EI VP +FLCPISLEIMKDPVT+STGITYDR++IE W+FS KN TCP+TKQ L    D
Sbjct  3     MNEIDVPSFFLCPISLEIMKDPVTVSTGITYDRESIETWLFSKKNTTCPITKQPLIDYTD  62

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQSWCT++ASHG+ER PTPKPPV K+ I KLL+ A  +P      L+ 
Sbjct  63    --LTPNHTLRRLIQSWCTMNASHGIERIPTPKPPVNKNQISKLLKDASHSP---LTCLRR  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKT------------SED--------NPTDDAL  1098
             L+S+A  +  NKRCME++G  EFLA I+              S D        + +D+AL
Sbjct  118   LKSIASGSETNKRCMEASGAVEFLASIVINNNSNIDSSNEADSNDGSGFELKTSASDEAL  177

Query  1097  YVLHNLGLSENGLRSILG-HDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpsl  921
              +LHNL LSE GL+++L   + +FI+SLTRVMQ G +ESRAYAV LLKS  E       L
Sbjct  178   SLLHNLHLSEQGLKTLLSFRNGEFIESLTRVMQKGFFESRAYAVFLLKSTSEVAEPVQLL  237

Query  920   sqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDL  741
                        F ++VQ+L+D  S+K SK+ L  L      GRNRIKA EA    V+++L
Sbjct  238   HLRQE-----LFVELVQVLKDQISQKTSKATLQTLIQFSPWGRNRIKAVEADTVPVLVEL  292

Query  740   LLDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILY  561
             LLD  E++ CE  L +LE LC+CAEGRAE+L HAAGLA+VS+KILRVS +AN+R ++I+ 
Sbjct  293   LLDCKERKPCEMMLVLLELLCQCAEGRAELLSHAAGLAIVSKKILRVSTLANDRAVKIIL  352

Query  560   SIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPL  381
             S+++FSATP VVQEML+LGV AKLCLV+QVD G  K KE+A EILKLHA+ W+NSPC+P 
Sbjct  353   SLSRFSATPHVVQEMLKLGVVAKLCLVLQVDSG-NKAKEKAREILKLHARAWRNSPCIPN  411

Query  380   DLIHN  366
             +L+++
Sbjct  412   NLLNS  416



>ref|XP_010911942.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Elaeis guineensis]
Length=415

 Score =   414 bits (1063),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 212/414 (51%), Positives = 286/414 (69%), Gaps = 27/414 (7%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M E+++P YFLCPISL+IM+DPV + TGITYDRD+IE+WIFSGK+ TCPVTKQ+L   D 
Sbjct  1     MAEVEIPSYFLCPISLQIMRDPVILPTGITYDRDSIERWIFSGKHNTCPVTKQSLPECD-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WC L+ S G+ERFPTPKPP+  + I KL+  AK  P +    L+ 
Sbjct  60    --LTPNHTLRRLIQAWCALNPSDGIERFPTPKPPIDNAQIAKLIDDAK-LPHLQLSSLRK  116

Query  1217  LRSMAPENAANKRCMESA-GVAEFLAQIIKTSEDNP----------------TDDALYVL  1089
             L+ +  E+  NKRC+E+  GV +FLA I+K +   P                 D+AL +L
Sbjct  117   LKEIVSESERNKRCVEATPGVLDFLASIVKKNSFTPGEEGILIRDDVESTTACDEALSIL  176

Query  1088  HNLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqlt  909
             + L +SE  L      +   I+SLT ++Q  +Y+SRAYA +LLKS+L             
Sbjct  177   YLLQISEQRLHDFAIKNEDIIESLTSILQQQNYQSRAYATLLLKSIL-----GVIAHAKL  231

Query  908   ttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDT  729
               +    F ++V +LRD  S +A K+AL +L+ +C+ GRNR+KAA AGA  V+I+LLLD 
Sbjct  232   AGVREELFQEIVNVLRDRISHRADKAALQVLSLLCRWGRNRVKAAHAGAVPVLIELLLDE  291

Query  728   NEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAK  549
             NEKR CE  L VL  +C CAEGR+E++ HAAG+A+VS+KILR+S+VA+E  +RIL S+AK
Sbjct  292   NEKRVCELALVVLAWVCGCAEGRSELVGHAAGIAIVSKKILRISEVASEGAVRILNSVAK  351

Query  548   FSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCL  387
             FSAT +V+QEMLQ+GV +KLCLV+QVDCG+ K KE+A EIL+LH++ WK SPCL
Sbjct  352   FSATTAVLQEMLQIGVVSKLCLVLQVDCGM-KTKEKAREILRLHSRVWKKSPCL  404



>ref|XP_009368334.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Pyrus x bretschneideri]
Length=414

 Score =   413 bits (1062),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 218/407 (54%), Positives = 290/407 (71%), Gaps = 12/407 (3%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             MEEI +PP+FLCPISLEIM+DPVTISTGITYDR++IE+W F+ KN TCPV+K++LS  D 
Sbjct  1     MEEIVIPPHFLCPISLEIMRDPVTISTGITYDRESIEQWWFTSKNNTCPVSKKSLSDVDA  60

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
             + LTPN  LRR+IQ+WCTL++SHGVER PTPK  + KS ++KL+ QAK  P      LQ 
Sbjct  61    D-LTPNHTLRRIIQAWCTLNSSHGVERIPTPKSALDKSQVVKLIEQAKKVPYTNLHCLQR  119

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQII-KTSEDNPT-DDALYVLHNLGLSENGLRSILG  1044
             LRS+A +   NK  +E+AG  E++A II K+  D+ T + A+ VL +   SE+ L+ ++ 
Sbjct  120   LRSIAIQGERNKNYLEAAGAIEYVASIINKSHSDSSTVEAAIEVLFHFKSSESRLKDLMS  179

Query  1043  HDTQ---FIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVV  873
             +D+      +SL RV+  G+ +SRA+A++LLKS  E       ++    +     F Q+V
Sbjct  180   NDSNNNNITESLVRVLDCGNSQSRAHAIILLKSFFEVADPIQLINVDVES-----FRQIV  234

Query  872   QILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLSV  693
              +L    S+ ASK+AL LL  +C  GRNRIKA E  A +V+ + LL T EKR CE  L +
Sbjct  235   HVLNGRISQPASKAALKLLVELCPWGRNRIKAVEGSAVSVLTEALLGTQEKRACELILII  294

Query  692   LEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEML  513
             LEQLCRCAEGRAE+LKH AGLA+VS+KILRVS VA++R +RIL SI +FSAT +V+QEML
Sbjct  295   LEQLCRCAEGRAELLKHGAGLAIVSKKILRVSHVASDRAVRILSSICRFSATCAVLQEML  354

Query  512   QLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             ++G  AKLCLV+QVDC   K KE+A EILKLH++ WKNS C+P  L+
Sbjct  355   RVGAVAKLCLVLQVDCRF-KTKEKAREILKLHSRVWKNSSCIPDHLL  400



>ref|XP_009793462.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Nicotiana 
sylvestris]
Length=425

 Score =   414 bits (1063),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 213/425 (50%), Positives = 286/425 (67%), Gaps = 36/425 (8%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M E++VP YFLCPIS+++M+DPVT S+GITYDR+NIEKW+   KN TCPVTKQ L   D 
Sbjct  1     MAEVEVPDYFLCPISMQMMRDPVTTSSGITYDRENIEKWLIKFKNTTCPVTKQELLTID-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQSWC +++SHGVE  PTPKP VTK H+LKLL++AK + EM    L+ 
Sbjct  60    --LTPNHTLRRLIQSWCIMNSSHGVEPIPTPKPQVTKIHVLKLLKEAKKSQEMQLSCLRK  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTS------EDN--------------------  1116
             LRS+A  + +NK+C+ES GV +FLA IIK        ED+                    
Sbjct  118   LRSIAYSSESNKKCLESVGVIDFLASIIKKKDVLAFVEDSKHVSSDIVSPKILHTPLEFT  177

Query  1115  -PTDDALYVLHNLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtt  939
                D AL +L +L LS   L+  +  D  F+DSL   +++G+Y+SRAYA+ LLKS     
Sbjct  178   KAGDVALDILFHLNLSNEDLKKSILRDEFFLDSLLHFLKYGNYQSRAYAITLLKSAFNVA  237

Query  938   tlnpslsqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAA  759
                  +          +F +++ +L+   S++A+K+AL LL  +C  GRNRIKA E GA 
Sbjct  238   DPGFLIGVKQE-----YFKEILFVLKTKISQQATKAALKLLVELCPWGRNRIKAIEVGAV  292

Query  758   TVVIDLLLDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANER  579
             + +I+LLLDTNE+R CE  L++L QLC CAEGRAE+  H AG+A+VS+KILRVSQ+A+ER
Sbjct  293   STLIELLLDTNERRSCELILAILHQLCSCAEGRAELSSHGAGVAIVSKKILRVSQMASER  352

Query  578   GLRILYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKN  399
              +RIL SI+KFSA   V+QEMLQ+GV +KLCLV+QVD    K K+R  EIL+LH++ W++
Sbjct  353   AVRILSSISKFSANSRVLQEMLQVGVVSKLCLVLQVD-SCSKTKDRVKEILRLHSRVWRD  411

Query  398   SPCLP  384
             S C+P
Sbjct  412   SSCIP  416



>ref|XP_008442921.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Cucumis melo]
Length=406

 Score =   412 bits (1059),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 205/404 (51%), Positives = 291/404 (72%), Gaps = 11/404 (3%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             E+I+VP YFLCPISL+IMKDPVT+ +GITYDR +IE W+FSGKN++CP+TK  +S +D +
Sbjct  3     EQIEVPHYFLCPISLQIMKDPVTLPSGITYDRHSIETWLFSGKNSSCPITKLPVSLSDSD  62

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPN  LRR+IQ+WCTL++S+GVERFPTPKPP+ KS IL ++  + ++P  L   ++ L
Sbjct  63    LLTPNHTLRRLIQAWCTLNSSYGVERFPTPKPPIHKSQILHIISTSNTSPSSLISSIRRL  122

Query  1214  RSMAPENAANKRCMESAGVAEFLAQIIKTSEDNPTDDALYVLHNLGLSENGLRSILGHDT  1035
             RS++ E+  N+RC+E AG  EFL  +I  S+ + + +AL  LHNL LS++  +S+  H  
Sbjct  123   RSISAESETNRRCVEFAGAPEFLVSVIVDSDSSASHEALSTLHNLRLSDSTFKSLATHP-  181

Query  1034  QFIDSLTRVM--QHGSYE-SRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQIL  864
             + ++SLT  M  Q G++E SR YAV++LKS++E      +     + L    F Q+V+IL
Sbjct  182   EVLESLTDFMKLQQGTHESSRTYAVLILKSIVE-----VADPIQLSFLKPELFVQIVEIL  236

Query  863   RDNFSR-KASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLSVLE  687
             +D  S  +  K+AL +L  V   GRNR+KA EAG    ++++LL + EKR CE  L+ ++
Sbjct  237   KDRSSSLQIFKAALGILIAVSPLGRNRLKAVEAGGVGALVEILLSSPEKRVCEMTLTAMD  296

Query  686   QLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEMLQL  507
              LC CA+GRA +L H  G+AVVS+KILRVSQ+ +ER +RILYS+AKFS +P+V+ EM QL
Sbjct  297   LLCGCADGRAALLAHGGGMAVVSKKILRVSQLGSERAVRILYSVAKFSGSPAVLMEMAQL  356

Query  506   GVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDL  375
             G+ AKLCLV+Q++ G  K KE+A EILK+H++ WKNSPC+P  L
Sbjct  357   GIVAKLCLVMQIENG-SKTKEKAKEILKMHSRVWKNSPCIPSKL  399



>ref|XP_009337706.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Pyrus x bretschneideri]
 ref|XP_009337713.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Pyrus x bretschneideri]
Length=414

 Score =   412 bits (1059),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 218/407 (54%), Positives = 289/407 (71%), Gaps = 12/407 (3%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             MEEI +PP+FLCPISLEIM+DPVTISTGITYDR++IE+W F+ KN TCPV+K++LS  D 
Sbjct  1     MEEIVIPPHFLCPISLEIMRDPVTISTGITYDRESIEQWWFTSKNNTCPVSKKSLSDVDA  60

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
             + LTPN  LRR+IQ+WCTL++SHGVER PTPK  + KS ++KL+ QAK  P      LQ 
Sbjct  61    D-LTPNHTLRRIIQAWCTLNSSHGVERIPTPKSALDKSQVVKLIEQAKKVPYTNLHCLQR  119

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQII-KTSEDNPT-DDALYVLHNLGLSENGLRSILG  1044
             LRS+A +   NK  +E+AG  E++A II K+  D+ T + A+ VL +   SE+ L+ ++ 
Sbjct  120   LRSIAIQGERNKNYLEAAGAIEYVASIINKSHSDSSTVEAAIEVLFHFKSSESRLKDLMS  179

Query  1043  HDTQ---FIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVV  873
             +D+      +SL RV+  G+ +SRA A++LLKS  E       ++    +     F Q+V
Sbjct  180   NDSNNNNITESLVRVLDCGNSQSRAQAIILLKSFFEVADPIQLINVDVES-----FRQIV  234

Query  872   QILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLSV  693
              +L    S+ ASK+AL LL  +C  GRNRIKA E  A +V+ + LL T EKR CE  L +
Sbjct  235   HVLNGRISQPASKAALKLLVELCPWGRNRIKAVEGSAVSVLTEALLGTQEKRACELILII  294

Query  692   LEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEML  513
             LEQLCRCAEGRAE+LKH AGLA+VS+KILRVS VA++R +RIL SI +FSAT +V+QEML
Sbjct  295   LEQLCRCAEGRAELLKHGAGLAIVSKKILRVSHVASDRAVRILSSICRFSATCAVLQEML  354

Query  512   QLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             ++G  AKLCLV+QVDC   K KE+A EILKLH++ WKNS C+P  L+
Sbjct  355   RVGAVAKLCLVLQVDCRF-KTKEKAREILKLHSRVWKNSSCIPDHLL  400



>gb|KHN48421.1| E3 ubiquitin-protein ligase PUB23 [Glycine soja]
Length=416

 Score =   412 bits (1059),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 221/422 (52%), Positives = 298/422 (71%), Gaps = 33/422 (8%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M+EI VPP+F+CPISLE+MKDPVT+STGITYDR +IEKW+F+  + TCPVTKQ L     
Sbjct  1     MDEIDVPPFFVCPISLELMKDPVTVSTGITYDRHSIEKWLFA--DDTCPVTKQPLLPD--  56

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKST--PEMLAKVL  1224
               LTPN  LRR+IQ+WCT++ASHGV+R PTPKPPV K+ I KLLR A ++  P +  + L
Sbjct  57    --LTPNHTLRRLIQAWCTVNASHGVQRIPTPKPPVDKTLIEKLLRDASASDSPSLQLRSL  114

Query  1223  QTLRSMAPENAANKRCMESAGVA-EFLAQIIKTS-----------------EDNPTDDAL  1098
             +TL+S+A E+ +NKRC+ESA  A  FLA  I T+                 + +   +AL
Sbjct  115   RTLKSIASESQSNKRCIESAKDAVSFLASFITTTVTVTTTTVLLDDVELEIKTSIAHEAL  174

Query  1097  YVLHNLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpsls  918
              +LH++ LSE+GL++++ H  +FI+SLT++MQ G YESRAYAV LL S+ E       ++
Sbjct  175   SLLHSIQLSESGLKALMNH-PEFINSLTKIMQSGIYESRAYAVFLLNSLSEVADPALLVN  233

Query  917   qltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLL  738
                       F ++VQ+L+D  S KASK+ L  L  VC  GRNR+KA EAGA  V+++LL
Sbjct  234   LKID-----LFTELVQVLKDQVSEKASKATLRALIQVCPWGRNRVKAVEAGAVPVLVELL  288

Query  737   LDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYS  558
             L+  E++  E  L +LE LC+ A+GRA +L HAAG+A+V++KILRVS +AN+R  +IL S
Sbjct  289   LECKERKPIEMMLVLLEILCQSADGRAGLLAHAAGVAIVAKKILRVSTMANDRAAKILLS  348

Query  557   IAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLD  378
             + +FSAT  VVQEMLQLGV AK+CLV+QVD G  K KE+A EILKLHA+ W+NSPC+P +
Sbjct  349   VCRFSATHGVVQEMLQLGVVAKMCLVLQVDSG-NKAKEKAREILKLHARAWRNSPCIPHN  407

Query  377   LI  372
             L+
Sbjct  408   LL  409



>ref|XP_009586788.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Nicotiana 
tomentosiformis]
Length=424

 Score =   412 bits (1059),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 209/424 (49%), Positives = 283/424 (67%), Gaps = 35/424 (8%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M E++VP YFLCPIS+++M+DPVT STGITYDR+NIEKW+   KN TCPVTKQ L   D 
Sbjct  1     MAEVEVPDYFLCPISMQMMRDPVTTSTGITYDRENIEKWLIKFKNTTCPVTKQELLTID-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQSWC +++S+GVE  PTPKP VTK H+LKLL++A  +PE+    L+ 
Sbjct  60    --LTPNHTLRRLIQSWCIMNSSNGVEPIPTPKPQVTKIHVLKLLKKAMESPEIQLSCLRK  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSE--------------------------DN  1116
             LRS+A  + +NK+C+ES GV +FLA IIK  E                            
Sbjct  118   LRSIAHSSESNKKCLESVGVIDFLASIIKKKEVAFVEDSEYVSYDIVSRKILHTPMELTK  177

Query  1115  PTDDALYVLHNLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEttt  936
              +D+AL +L +L  S   L+  +  D  F+DSL   ++ G+Y+SRAYA+ LLKS      
Sbjct  178   ASDEALDILFHLNPSNEDLKKFISQDELFLDSLLHFLKCGNYQSRAYAITLLKSAFNVAD  237

Query  935   lnpslsqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAAT  756
                 +          +F  ++ +L+   +++A+K+AL LL  +C  GRNRIKA E GA +
Sbjct  238   PGFLIGVKQE-----YFKGILSVLKTKITQQATKAALKLLVELCPWGRNRIKAIEVGAVS  292

Query  755   VVIDLLLDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERG  576
              +I+LLLDTNE+R CE  L++L QLC CAEGRAE+  H AG+A+VS+KILRVSQVA++R 
Sbjct  293   TLIELLLDTNERRSCELILAILHQLCSCAEGRAELSSHGAGVAIVSKKILRVSQVASDRA  352

Query  575   LRILYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNS  396
             +RIL SI+KFSA   V+QEMLQ+GV +KLCLV+QVD    K K+R  EIL+LH++ W++S
Sbjct  353   VRILSSISKFSANSRVLQEMLQVGVVSKLCLVLQVD-SCSKTKDRVKEILRLHSRVWRDS  411

Query  395   PCLP  384
              C+P
Sbjct  412   SCIP  415



>ref|NP_190813.1| E3 ubiquitin-protein ligase PUB22 [Arabidopsis thaliana]
 sp|Q9SVC6.1|PUB22_ARATH RecName: Full=E3 ubiquitin-protein ligase PUB22; AltName: Full=Plant 
U-box protein 22; AltName: Full=U-box domain-containing 
protein 22 [Arabidopsis thaliana]
 emb|CAB43434.1| putative protein [Arabidopsis thaliana]
 gb|AAU90053.1| At3g52450 [Arabidopsis thaliana]
 gb|AAV59269.1| At3g52450 [Arabidopsis thaliana]
 dbj|BAF00881.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE78947.1| E3 ubiquitin-protein ligase PUB22 [Arabidopsis thaliana]
Length=435

 Score =   412 bits (1059),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 217/436 (50%), Positives = 291/436 (67%), Gaps = 45/436 (10%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             +EI++P +FLCPISL+IMKDPV +STGITYDR++IEKW+FSGK  +CPVTKQ ++ TD  
Sbjct  3     QEIEIPSFFLCPISLDIMKDPVIVSTGITYDRESIEKWLFSGKKNSCPVTKQVITETD--  60

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPN  LRR+IQSWCTL+AS+G+ER PTPKPP+ KS I KL++++ S+     K L+ L
Sbjct  61    -LTPNHTLRRLIQSWCTLNASYGIERIPTPKPPICKSEIEKLIKESSSSHLNQVKCLKRL  119

Query  1214  RSMAPENAANKRCMESAGVAEFLAQIIKTSEDNPT-------------------------  1110
             R +  EN  NKRC+E+A V EFLA I+  S D                            
Sbjct  120   RQIVSENTTNKRCLEAAEVPEFLANIVSNSVDTYNSPSSSLSSSNLNDMCQSNMLENRFD  179

Query  1109  ------DDALYVLHNLGLSENGLRSILGHD--TQFIDSLTRVMQHGSYESRAYAVMLLKS  954
                   D+AL VL++L  SE  L+S+L +   T  + +LT++MQ G YESRAYA +LLK 
Sbjct  180   SSRSLMDEALSVLYHLDTSETALKSLLNNKKGTNLVKTLTKIMQRGIYESRAYAALLLKK  239

Query  953   MLEtttlnpslsqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAA  774
             +LE       +           F +V+QIL D  S KA++SA+ +L   C  GRNR KA 
Sbjct  240   LLEVADPMQIILLERE-----LFGEVIQILHDQISHKATRSAMQILVITCPWGRNRHKAV  294

Query  773   EAGAATVVIDLLLD---TNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILR  603
             E G  +++I+LL+D   ++E+R  E  + VL+ LC+CAEGRAE L H A +AVVS+KILR
Sbjct  295   EGGTISMIIELLMDDTFSSERRNSEMAMVVLDMLCQCAEGRAEFLNHGAAIAVVSKKILR  354

Query  602   VSQVANERGLRILYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILK  423
             VSQ+ +ER +R+L S+ +F ATPS++QEMLQLGV AKLCLV+QV CG  K KE+A E+LK
Sbjct  355   VSQITSERAVRVLLSVGRFCATPSLLQEMLQLGVVAKLCLVLQVSCG-NKTKEKAKELLK  413

Query  422   LHAKEWKNSPCLPLDL  375
             LHA+ W+ SPC+P +L
Sbjct  414   LHARVWRESPCVPRNL  429



>ref|XP_004228461.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Solanum lycopersicum]
Length=426

 Score =   411 bits (1056),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 216/432 (50%), Positives = 293/432 (68%), Gaps = 37/432 (9%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             ME+++VP YFLCPIS+++M+DPVT STGITYDR+NIEKW+F  KN TCP+TKQ L   D 
Sbjct  1     MEDVEVPNYFLCPISMQLMRDPVTTSTGITYDRENIEKWLFKCKNTTCPITKQELLTMD-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRRVIQSWC +++SHGVER P+PKP VTKS++LKLL+QA  + EM    L++
Sbjct  60    --LTPNHTLRRVIQSWCIMNSSHGVERIPSPKPQVTKSYVLKLLKQAMQSQEMQLSCLRS  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSE-----------DNP-------------T  1110
             L+S+A  + +NK+C+ES  V +FLA II   E           DN              +
Sbjct  118   LKSIAHASESNKKCLESCEVVDFLASIIMKKEVAFIQDSELSCDNSQTPLVLEYITTKAS  177

Query  1109  DDALYVLHNLGLSENGLRSILGHDTQ---FIDSLTRVMQHGSYESRAYAVMLLKSMLEtt  939
             D+AL +L +L  S+  L+  +  D     F+DSL   ++ G+ +SR YA+MLLKS     
Sbjct  178   DEALDILFHLNPSDETLKRFVSKDNGDELFLDSLLYFLKCGNCQSRDYAIMLLKSAFNVA  237

Query  938   tlnpslsqltttlnlSFFHQVVQILRDNF-SRKASKSALHLLANVCQGGRNRIKAAEAGA  762
                  +          +F ++   L++   S++A+K++L LL  +C  GRNRIKA E GA
Sbjct  238   DPCQLIGVKKE-----YFKEIFLFLKNKLISQQATKASLKLLVELCPWGRNRIKAIEVGA  292

Query  761   ATVVIDLLLDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANE  582
              + +I+LLLDT E+R CE  L++L QLC CAEGRAE+L H AG+A+VS+KILRVSQVA++
Sbjct  293   ISTLIELLLDTIERRSCELILTILHQLCSCAEGRAELLNHGAGIAIVSKKILRVSQVASD  352

Query  581   RGLRILYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWK  402
             RG+RIL SI+KFSAT  V+QEMLQ+GV +KLCLVIQVD    K KE+A EIL+LH++ W+
Sbjct  353   RGVRILCSISKFSATCKVLQEMLQVGVVSKLCLVIQVD-SCSKTKEKAKEILRLHSRVWR  411

Query  401   NSPCLPLDLIHN  366
             +S CLP  L+ +
Sbjct  412   DSSCLPPHLLSS  423



>ref|XP_008784119.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Phoenix dactylifera]
Length=419

 Score =   410 bits (1054),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 209/424 (49%), Positives = 292/424 (69%), Gaps = 32/424 (8%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             MEE+ VP YFLCPISLEIM+DPVT++TGITYDR++IE+WIF+GK+ TCPV+KQ L    D
Sbjct  1     MEEVDVPSYFLCPISLEIMRDPVTLATGITYDRESIERWIFAGKHETCPVSKQPLP---D  57

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WCT +ASHG+ERFPTP+PPV K+ I  LL +AK  P      L+ 
Sbjct  58    LELTPNHTLRRLIQAWCTANASHGIERFPTPRPPVDKAQIAALLDEAK-LPRSRMSALRK  116

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSEDNPT----------------------DD  1104
             L+++  E+  NKRC+E+AG  +FLA +I+ S  NP                       D+
Sbjct  117   LKAIISESDRNKRCVEAAGAVDFLASVIEESRSNPREREQEQDEGLFDDVTGSVSAAHDE  176

Query  1103  ALYVLHNLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnps  924
             AL +L++L +SE  L  ++  +  F++SL  +++  +Y+SR +A++L+KS+L     +  
Sbjct  177   ALNILYSLQVSEQSLLHLIERNNDFMESLATILRRSNYQSRTHAMLLIKSLL-----SVM  231

Query  923   lsqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVID  744
                     +   F +VV++LRD  S  A+K+A+ +L  +   GRNR+KA EAGA  VVI+
Sbjct  232   APARLKGFSKELFGEVVKVLRDQISYPATKAAVQVLGGLSPWGRNRVKAVEAGAVRVVIE  291

Query  743   LLLDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRIL  564
             LLLD  E+R CE  L VL+QLCRCAEGRAE++ HAAG+AVV++K+LRVS+VA+ER + IL
Sbjct  292   LLLDKTERRACEMMLVVLDQLCRCAEGRAEMVGHAAGIAVVTKKLLRVSRVASERVVGIL  351

Query  563   YSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLP  384
             YS A+FS T +V+QEM Q+G  AKLC+++QVDCG  K KE+  E+L+LH+K W+NS CL 
Sbjct  352   YSAARFSPTRAVLQEMKQVGAVAKLCMLLQVDCG-EKAKEKVKEMLRLHSKVWRNSLCLA  410

Query  383   LDLI  372
               L+
Sbjct  411   PSLL  414



>gb|KHN43695.1| E3 ubiquitin-protein ligase PUB22 [Glycine soja]
Length=415

 Score =   410 bits (1053),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 225/425 (53%), Positives = 298/425 (70%), Gaps = 40/425 (9%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M+EI VPP+F+CPISLE+MKDPVT+STGITYDR +IEKW+F+    TCPVTKQ L     
Sbjct  1     MDEIDVPPFFVCPISLELMKDPVTVSTGITYDRHSIEKWLFAD---TCPVTKQPLLPD--  55

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKST--PEMLAKVL  1224
               LTPN  LRR+IQ+WCT++ASHGV+R PTPKPPV K+ I KLLR A ++  P +  + L
Sbjct  56    --LTPNHTLRRLIQAWCTVNASHGVQRIPTPKPPVDKTLIEKLLRDASASDSPSLQLRSL  113

Query  1223  QTLRSMAPENAANKRCMESA-GVAEFLAQI-------------------IKTSEDNPTDD  1104
             +TL+S+A E+ +NKRC+ESA G   FLA I                   IKTS  +   +
Sbjct  114   RTLKSIASESQSNKRCIESAEGAVNFLATIITTTTTTTTNLLDDDIELEIKTSTAH---E  170

Query  1103  ALYVLHNLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnps  924
             AL +LH++ LSE+GL+++L H  +FI+SLT++MQ G YESRAYAV LL S+ E       
Sbjct  171   ALSLLHSIQLSESGLKALLNH-PEFINSLTKMMQRGIYESRAYAVFLLNSLSEVADPAQL  229

Query  923   lsqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVID  744
             ++  T       F ++VQ+L+D  S K SK+ L  L  VC  GRNR+KA EAGA  V+++
Sbjct  230   INLKTD-----LFTELVQVLKDQVSEKVSKATLQALIQVCSWGRNRVKAVEAGAVPVLVE  284

Query  743   LLLDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLA-VVSRKILRVSQVANERGLRI  567
             LLL+ NE++  E  L +LE LC+ A+GRA +L HAAG+  VV++KILRVS +AN+R  +I
Sbjct  285   LLLECNERKPIEMVLVLLEILCQSADGRAGLLAHAAGVVIVVAKKILRVSTMANDRAAKI  344

Query  566   LYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCL  387
             L S+ +FS TP +VQEM+QLGV AKLCLV+QVD G  K KE+A EILKLHA+ W+NSPC+
Sbjct  345   LLSVCRFSPTPGLVQEMVQLGVVAKLCLVLQVDSG-NKAKEKAREILKLHARAWRNSPCI  403

Query  386   PLDLI  372
             P +L+
Sbjct  404   PHNLL  408



>gb|KEH41882.1| E3 ubiquitin-protein ligase PUB23-like protein [Medicago truncatula]
Length=437

 Score =   410 bits (1055),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 213/434 (49%), Positives = 294/434 (68%), Gaps = 39/434 (9%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             ++I+V P+FLCPISL++M DPVT+STGITYDR++IEKW+FS +N TCPVTKQ L+   + 
Sbjct  3     QDIEVTPFFLCPISLQLMNDPVTVSTGITYDRESIEKWLFSSENKTCPVTKQLLTHDANH  62

Query  1394  F--LTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQ  1221
                LTPN  LRR+IQ+WCT+++S G+ER PTPKPP TK  I KLL++A  +P +L + L+
Sbjct  63    LIILTPNHTLRRLIQAWCTMNSSFGIERIPTPKPPTTKILIEKLLKEASDSPHLLIQTLK  122

Query  1220  TLRSMAPENAANKRCMESAGVAEFLAQI-----------------IKTSEDN--------  1116
              L+++A E+  N+RC+ESAG  EFLA I                 I+ S D+        
Sbjct  123   KLKTIASESETNRRCIESAGAVEFLASIVTQNNTSCSSSCSATELIEASFDDDDVEGFAF  182

Query  1115  -----PTDDALYVLHNLGLSENGLRSILGH-DTQFIDSLTRVMQHGSYESRAYAVMLLKS  954
                    D+A+ +L+NL LSE GL+++L   + +F+DSL      G+Y+SR YAV LLKS
Sbjct  183   DFKIGAEDEAINILYNLQLSEQGLKTLLNFKNGEFLDSLILFFHKGNYDSRTYAVFLLKS  242

Query  953   MLEtttlnpslsqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAA  774
             +        +       LN  FF ++VQ+L+D  S+KASK+ L  L  + + GRNR+KA 
Sbjct  243   I-----SKVADPSNLANLNTEFFVELVQLLKDQISKKASKATLQTLIQLVEFGRNRVKAI  297

Query  773   EAGAATVVIDLLLDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQ  594
             E+G    +I+LLLD  E++ CE  L +LE LC+CA+GR E+L H  GLA+VS+KILRVS 
Sbjct  298   ESGCVFALIELLLDCKERKPCEMILVLLEMLCQCADGRFELLIHGCGLAIVSKKILRVST  357

Query  593   VANERGLRILYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHA  414
             +AN+R + IL S+++FSAT  VVQEML++GV AKLCLV+QVD G  K KE+A EILKLH+
Sbjct  358   MANDRAVSILLSVSRFSATHFVVQEMLRIGVVAKLCLVLQVDSG-NKAKEKAREILKLHS  416

Query  413   KEWKNSPCLPLDLI  372
             K W NS C+P +L+
Sbjct  417   KSWMNSHCIPFNLL  430



>ref|XP_002877862.1| U-box domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54121.1| U-box domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=435

 Score =   410 bits (1054),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 217/436 (50%), Positives = 292/436 (67%), Gaps = 45/436 (10%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             +EI++P +F+CPISL+IMKDPV +STGITYDR++IEKW+FSGK  +CPVTKQ ++ TD  
Sbjct  3     QEIEIPSFFVCPISLDIMKDPVIVSTGITYDRESIEKWLFSGKKNSCPVTKQVITETD--  60

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPN  LRR+IQSWCTL+AS+G+ER PTPKPP+ KS I KL++ + ++     K L+ L
Sbjct  61    -LTPNHTLRRLIQSWCTLNASYGIERIPTPKPPICKSEIEKLIKDSSTSHLNQVKCLKRL  119

Query  1214  RSMAPENAANKRCMESAGVAEFLAQIIKTSEDNPT-------------------------  1110
             R +  EN  NKRC+E+A V EFLA I+  S D  +                         
Sbjct  120   RQIVSENTTNKRCLEAAEVPEFLANIVSNSVDTYSSPSSSLSSSNYNDMCQSNMLENRFD  179

Query  1109  ------DDALYVLHNLGLSENGLRSILGHD--TQFIDSLTRVMQHGSYESRAYAVMLLKS  954
                   D+AL VL++L  SE  L+S+L +   T  + +LT++MQ G YESRAYA +LLK 
Sbjct  180   SSRSLMDEALSVLYHLDTSETALKSLLNNKKGTNLVKTLTKIMQRGIYESRAYAALLLKK  239

Query  953   MLEtttlnpslsqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAA  774
             +LE       +           F +VVQIL D  S KA++SA+ +L   C  GRNR KA 
Sbjct  240   LLEVADPMQIILLERE-----LFAEVVQILHDQISHKATRSAMQILVITCPWGRNRHKAV  294

Query  773   EAGAATVVIDLLLD---TNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILR  603
             EAGA +++I+LL+D   ++E+R  E  + VL+ LC+CAEGRAE L H A +AVVS+KILR
Sbjct  295   EAGAISMIIELLMDDTFSSERRNSEMAMVVLDMLCQCAEGRAEFLNHGAAIAVVSKKILR  354

Query  602   VSQVANERGLRILYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILK  423
             VSQ+ +ER +R+L  + +F ATPS++QEMLQLGV AKLCLV+QV CG  K KE+A E+LK
Sbjct  355   VSQITSERAVRVLLLVGRFCATPSLLQEMLQLGVVAKLCLVLQVSCG-NKTKEKAKELLK  413

Query  422   LHAKEWKNSPCLPLDL  375
             LHA+ W+ SPC+P +L
Sbjct  414   LHARVWRESPCVPRNL  429



>ref|XP_004140266.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Cucumis sativus]
 ref|XP_004156108.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Cucumis sativus]
 gb|KGN48051.1| hypothetical protein Csa_6G426370 [Cucumis sativus]
Length=412

 Score =   409 bits (1051),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 208/404 (51%), Positives = 293/404 (73%), Gaps = 11/404 (3%)
 Frame = -1

Query  1571  EIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEF  1392
             EI+VP YFLCPISL++M+DPVTISTGITYDR +IE W+FS     CP+TKQ LS +D + 
Sbjct  10    EIEVPSYFLCPISLQLMRDPVTISTGITYDRSSIEMWLFSFNKTVCPITKQPLS-SDPDL  68

Query  1391  LTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTLR  1212
             LTPN  LRR+IQSWCTL+AS+G+ER PTPK P+ K+HI K+L+QA+S P+   K L  L+
Sbjct  69    LTPNHTLRRLIQSWCTLNASNGIERIPTPKSPIDKTHIAKILKQAQSFPDSTHKCLLALK  128

Query  1211  SMAPENAANKRCM-ESAGVAEFLAQIIKTSEDN---PTDDALYVLHNLGLSENGLRSILG  1044
             ++A EN  N+  + +S G  +FLA +IK+   N     + A+ +L ++  S+  L++++ 
Sbjct  129   AIALENERNRNLVAQSDGAFDFLAMVIKSGGSNNIASIELAVEILFHIKSSQTHLKNLVN  188

Query  1043  HDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQIL  864
              D  FI+SLT V+Q+G+ +SRAYAVMLLKS LE       +S            ++V+++
Sbjct  189   GDVDFINSLTFVLQNGNCQSRAYAVMLLKSSLELADPIRLMSIERE-----LLREIVRVI  243

Query  863   RDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLSVLEQ  684
              D+ S +ASKSAL +LA VC  GRNR+KA E GA  V+++LLL++ E+R+ E GL +L+Q
Sbjct  244   HDHISHQASKSALKVLAEVCPWGRNRVKAVEGGAVGVLVELLLNSTERRWSELGLVILDQ  303

Query  683   LCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEMLQLG  504
             LC CAEGR +++ HAAGLAVVS+KILRVS +A++R +RIL SI +FSA+  V+QEML++G
Sbjct  304   LCGCAEGREKLVAHAAGLAVVSKKILRVSAMASDRAVRILSSICRFSASAKVMQEMLEVG  363

Query  503   VGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             V AKLCLV+Q+DC + K +E+A + LKLH++ W NS C+P  L+
Sbjct  364   VVAKLCLVLQMDCSM-KTREKARDTLKLHSRVWSNSSCIPPHLL  406



>ref|XP_003554464.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Glycine max]
 gb|KHN08600.1| E3 ubiquitin-protein ligase PUB22 [Glycine soja]
Length=419

 Score =   409 bits (1051),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 227/425 (53%), Positives = 297/425 (70%), Gaps = 32/425 (8%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M EI VP +FLCPISL+IMKDPVT+STGITYDR++IE W+FS KN TCP+TK  L    D
Sbjct  1     MNEIDVPSFFLCPISLDIMKDPVTVSTGITYDRESIETWLFSKKNTTCPITKLPLIDYTD  60

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WC+++ASHG+ER PTPKPPV K+ I KLL+ A  +P      L+ 
Sbjct  61    --LTPNHTLRRLIQAWCSMNASHGIERIPTPKPPVNKNQISKLLKDASHSP---LTCLRR  115

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSEDN--------------------PTDDAL  1098
             L+S++  +  NKRCME++G  EFLA I+  +  N                      D+AL
Sbjct  116   LKSISSGSETNKRCMEASGAVEFLASIVINTNRNIDSSHEADSNDGSGFELKTSACDEAL  175

Query  1097  YVLHNLGLSENGLRSILG-HDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpsl  921
              +LHNL LSE GL+++L   + +FI+SLTRVMQ G +ESRAYAV LLKS+ E       L
Sbjct  176   SLLHNLHLSEQGLKTLLSFRNGEFIESLTRVMQKGFFESRAYAVFLLKSISEVAEPVQLL  235

Query  920   sqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDL  741
                        F ++VQ+L+D  S+K SK+ L  L      GRNRI+A EAGA  V+I+L
Sbjct  236   HLRQE-----LFVELVQVLKDQISQKTSKATLQTLIQFSPWGRNRIRAVEAGAVPVLIEL  290

Query  740   LLDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILY  561
             LLD  E++ CE  L +LE LC+CAEGRAE+L HAAGLA+VS+KILRVS +AN+R ++I+ 
Sbjct  291   LLDCKERKPCEMMLVLLELLCQCAEGRAELLSHAAGLAIVSKKILRVSTLANDRAVKIIL  350

Query  560   SIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPL  381
             S+++FSATP VVQEML+LGV AKLCLV+QVD G  + KE+A EILKLHA+ W+NSPC+P 
Sbjct  351   SLSRFSATPHVVQEMLKLGVVAKLCLVLQVDSG-NRAKEKAREILKLHARAWRNSPCIPN  409

Query  380   DLIHN  366
             +L+++
Sbjct  410   NLLNS  414



>emb|CDY23218.1| BnaA04g05410D [Brassica napus]
Length=396

 Score =   408 bits (1048),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 208/410 (51%), Positives = 283/410 (69%), Gaps = 32/410 (8%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             +EI++P +FLCPISL+IMKDPV +STGITYDRD+IEKW+F+GK  +CPVTKQ ++ TD  
Sbjct  3     QEIEIPSFFLCPISLDIMKDPVIVSTGITYDRDSIEKWLFTGKKNSCPVTKQVITETD--  60

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPN  LRR+IQSWC+L+ASHG+E  PTPKPP++KS I +L++ + S            
Sbjct  61    -LTPNHTLRRLIQSWCSLNASHGIETIPTPKPPISKSEIERLIKDSSS------------  107

Query  1214  RSMAPENAANKRCMESAGVAEFLAQIIKT-----SEDNPTDDALYVLHNLGLSENGLRSI  1050
              S   +N  N RC+E+A V EFLA II       S  +  D+AL +L++L  SE   +S+
Sbjct  108   -SHKNQNNTNTRCLEAAEVPEFLANIISNLNRFDSSRSLMDEALSLLYHLDASETARKSL  166

Query  1049  LGHD--TQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQV  876
             L +   T  + +LT++MQ G YESR YA +LLK +LE       +           F++V
Sbjct  167   LNNKKVTNIVKTLTKIMQRGIYESRTYATLLLKKILEVADPMQIILLERD-----LFNEV  221

Query  875   VQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLD---TNEKRYCEW  705
             VQIL D  S KA+KSA+ +L  +C  GRNR KA EAGA +++I+LLLD   ++E+R  E 
Sbjct  222   VQILHDQISHKATKSAMQILMIICPWGRNRHKAVEAGAVSMIIELLLDESFSSERRNVEM  281

Query  704   GLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVV  525
              + VL+ LC+CAEGRA+ L H A +AVVS+KILRVSQ+ +ER +R+L S+ +F ATP ++
Sbjct  282   TMVVLDMLCQCAEGRADFLNHGAAIAVVSKKILRVSQITSERAVRVLLSVGRFCATPCLL  341

Query  524   QEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDL  375
             QEMLQLGV AKLCLV+QV CG  K K +A E+L+LHA+ W+ SPC+P +L
Sbjct  342   QEMLQLGVVAKLCLVLQVSCG-NKTKGKAKELLQLHARVWRESPCVPRNL  390



>ref|XP_010931056.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Elaeis guineensis]
Length=421

 Score =   409 bits (1050),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 206/421 (49%), Positives = 295/421 (70%), Gaps = 34/421 (8%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             MEE+++P YFLCPISL+IM+DPVT++TGI+Y+R++IE+WIFSGK+  CPVTKQ L    D
Sbjct  1     MEEVEIPSYFLCPISLQIMRDPVTLTTGISYERESIERWIFSGKHEICPVTKQPLP---D  57

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WC  +AS+G+ERFPTP+PPV K+ I  LL +AK  P      L+ 
Sbjct  58    LELTPNHTLRRLIQAWCAANASYGIERFPTPRPPVDKAQIAALLDEAK-LPHSQMSALRK  116

Query  1217  LRSMAPENAANKRCM-ESAGVAEFLAQIIKTSEDNP-----------------------T  1110
             L+++  E+  NKRC+ E++G  +FLA +IK S+ NP                       +
Sbjct  117   LKAIVSESERNKRCVVEASGAVDFLASLIKKSKSNPREHEQEGIISINDAIDQSSQNTAS  176

Query  1109  DDALYVLHNLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttln  930
             D+AL +L++L +SE  L  ++  +   I+SLT +++  +Y SRAYA++LLKS++     +
Sbjct  177   DEALSILYSLQISEQSLLHLIESNNDIIESLTTILRRSNYRSRAYAILLLKSLV-----S  231

Query  929   pslsqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVV  750
                    T+ +  FF +VV +LRD  S +A+++AL +L  +   GRN++KA EAGA  VV
Sbjct  232   VIAPSRLTSFSQEFFEEVVSVLRDQISHQAARAALQVLGVLSPWGRNKVKAVEAGAVQVV  291

Query  749   IDLLLDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLR  570
             I+LLLD  E+R CE  L VL++LC CAEGRAE++ HAAGLAVVS+K++ V+QVA+ER +R
Sbjct  292   IELLLDETERRACEVMLVVLDRLCGCAEGRAEMVGHAAGLAVVSKKVVGVTQVASERAVR  351

Query  569   ILYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPC  390
             ILYS+A+FS TP+V+ EM+Q+GV  KLC+ +Q++ G  K KE+A EIL+LH+K W+NSPC
Sbjct  352   ILYSVARFSPTPAVLHEMVQVGVVTKLCMFLQMESG-EKAKEKAKEILRLHSKVWRNSPC  410

Query  389   L  387
             L
Sbjct  411   L  411



>ref|XP_003554468.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Glycine max]
Length=419

 Score =   407 bits (1046),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 226/425 (53%), Positives = 296/425 (70%), Gaps = 32/425 (8%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M EI VP +FLCPISL+IMKDPVT+STGITYDR++IE W+FS KN TCP+TK  L    D
Sbjct  1     MNEIDVPSFFLCPISLDIMKDPVTVSTGITYDRESIETWLFSKKNTTCPITKLPLIDYTD  60

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WC+++ASHG+ER PTPKPPV K+ I KLL+ A  +P      L+ 
Sbjct  61    --LTPNHTLRRLIQAWCSMNASHGIERIPTPKPPVNKNQISKLLKDASHSP---LTCLRR  115

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSEDN--------------------PTDDAL  1098
             L+S++  +  NKRCME++G  EFLA I+  +  N                      D+AL
Sbjct  116   LKSISSGSETNKRCMEASGAVEFLASIVINTNRNIDSSHEADSNDGSGFELKTSACDEAL  175

Query  1097  YVLHNLGLSENGLRSILG-HDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpsl  921
              +LHNL LSE GL+++L   + +FI+SLTRVMQ G +ESRAYAV LLKS+ E       L
Sbjct  176   SLLHNLHLSEQGLKTLLSFRNGEFIESLTRVMQKGFFESRAYAVFLLKSISEVAEPVQLL  235

Query  920   sqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDL  741
                        F ++VQ+L+D  S+K SK+ L  L      GRNRI+A EA A  V+I+L
Sbjct  236   HLRQE-----LFVELVQVLKDQISQKTSKATLQTLIQFSPWGRNRIRAVEAAAVPVLIEL  290

Query  740   LLDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILY  561
             LLD  E++ CE  L +LE LC+CAEGRAE+L HAAGLA+VS+KILRVS +AN+R ++I+ 
Sbjct  291   LLDCKERKPCEMMLVLLELLCQCAEGRAELLSHAAGLAIVSKKILRVSTLANDRAVKIIL  350

Query  560   SIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPL  381
             S+++FSATP VVQEML+LGV AKLCLV+QVD G  + KE+A EILKLHA+ W+NSPC+P 
Sbjct  351   SLSRFSATPHVVQEMLKLGVVAKLCLVLQVDSG-NRAKEKAREILKLHARAWRNSPCIPN  409

Query  380   DLIHN  366
             +L+++
Sbjct  410   NLLNS  414



>ref|XP_008449598.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Cucumis melo]
Length=414

 Score =   406 bits (1044),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 208/403 (52%), Positives = 292/403 (72%), Gaps = 11/403 (3%)
 Frame = -1

Query  1568  IQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEFL  1389
             I+VP YFLCPISL++M+DPVTISTGITYDR +IEKW+FS     CP+TKQ LS +D + L
Sbjct  13    IEVPSYFLCPISLQLMRDPVTISTGITYDRSSIEKWLFSFNKTVCPITKQPLS-SDPDLL  71

Query  1388  TPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTLRS  1209
             TPN  LRR+IQSWCTL+AS+G+ER PTPK P+ K+HI K+L+QA++ P    K L  L++
Sbjct  72    TPNHTLRRLIQSWCTLNASNGIERIPTPKSPIDKTHIAKILKQAQNFPNSNHKCLLALKA  131

Query  1208  MAPENAANKRCM-ESAGVAEFLAQIIKTSEDN---PTDDALYVLHNLGLSENGLRSILGH  1041
             +A EN  N+  + +S G  +FLA +IK+   N     + A+ +L ++  S+  L++++  
Sbjct  132   IALENERNRNLVAQSDGAFDFLAMVIKSGGSNNIASIELAVEILFHIKSSQAHLKNLVNG  191

Query  1040  DTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQILR  861
             D  FI+SLT V+Q+G+ +SRAYAVMLLKS LE       +S            + V+++ 
Sbjct  192   DVDFINSLTFVLQNGNCQSRAYAVMLLKSSLELADPIRLMSIERE-----LLRETVRVIH  246

Query  860   DNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLSVLEQL  681
             D+ S +ASKSAL +LA VC  GRNR+KA E GA  V+++LLL++ E+R+ E GL VL+QL
Sbjct  247   DHISHQASKSALKVLAEVCPWGRNRVKAVEGGAVGVLVELLLNSTERRWSELGLVVLDQL  306

Query  680   CRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEMLQLGV  501
             C CAEGR ++++HAAGLAVVS+KILRVS +A++R +RIL SI +FSA+  V+QEML++GV
Sbjct  307   CGCAEGREKLVEHAAGLAVVSKKILRVSAMASDRAVRILSSICRFSASAKVLQEMLEVGV  366

Query  500   GAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
              AKLCLV+Q+DC + K +E+A + LKLH++ W NS C+P  L+
Sbjct  367   VAKLCLVLQMDCSL-KTREKARDTLKLHSRVWSNSSCIPPHLL  408



>emb|CDX78096.1| BnaA09g32910D [Brassica napus]
Length=389

 Score =   405 bits (1041),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 208/410 (51%), Positives = 282/410 (69%), Gaps = 39/410 (10%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             +EI++P +FLCPISL+IMKDPV +STGITYDRD+IEKW+F+GK  TCPVTKQ ++ TD  
Sbjct  3     QEIEIPTFFLCPISLDIMKDPVIVSTGITYDRDSIEKWLFTGKKNTCPVTKQVITETD--  60

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPN  LRR+IQSWCTL+ASHG+ER PTPKPP++KS I KL++ + S+ +   K L+ L
Sbjct  61    -LTPNHTLRRLIQSWCTLNASHGIERIPTPKPPISKSEIEKLIKDSSSSHQNQVKCLKRL  119

Query  1214  RSMAPENAANKRCMESAGVAEFLAQIIKTSEDNPT-----DDALYVLHNLGLSENGLRSI  1050
                                 +FLA+I+  S    +     D+AL +L++L  SE   +S+
Sbjct  120   --------------------QFLAKIVSNSNRFDSSRSLMDEALSLLYHLDTSETARKSL  159

Query  1049  LGHD--TQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQV  876
             L +   T  + +LT++MQ G YESRAYA  LLK +LE       +           F++V
Sbjct  160   LNNKKGTNLVKTLTKIMQRGIYESRAYATFLLKKILEVADPMQIILLERE-----LFNEV  214

Query  875   VQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLD---TNEKRYCEW  705
             VQIL D  S KA+KSA+ +L  +C  GRNR KA EAGA +++I+LL+D   ++E+R  E 
Sbjct  215   VQILHDQISHKATKSAMQILVIICPWGRNRHKAVEAGAISMIIELLMDETFSSERRTLEM  274

Query  704   GLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVV  525
              + VL+ LC+CAEGRAE L H A +AVVS+KILRVSQ+ +ER +R+L SI +F ATPS++
Sbjct  275   AMVVLDMLCQCAEGRAEFLNHCAAIAVVSKKILRVSQITSERAVRVLLSIGRFCATPSLL  334

Query  524   QEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDL  375
             Q+MLQLGV AK+CLV+QV CG  K KE+A E+LKLHA+ W+ SPC+P +L
Sbjct  335   QDMLQLGVVAKMCLVLQVSCG-NKTKEKAKELLKLHARVWRESPCVPRNL  383



>ref|XP_010912561.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Elaeis guineensis]
Length=419

 Score =   406 bits (1044),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 215/423 (51%), Positives = 297/423 (70%), Gaps = 30/423 (7%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             ME+++VP YFLCPISLEIM+DPVT++TGITYDR++IE+WIFS K+ TCP TKQ L    D
Sbjct  1     MEQVEVPSYFLCPISLEIMRDPVTLATGITYDRESIERWIFSEKHETCPATKQPLP---D  57

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WCT +ASHG+ERFPTP+PPV K+ I  LL +AK  P      L+ 
Sbjct  58    LELTPNHTLRRLIQAWCTANASHGIERFPTPRPPVDKAQIAALLDEAK-LPRSQMNSLRK  116

Query  1217  LRSMAPENAANKRC-MESAGVAEFLAQIIKTSEDN-------------------PTDDAL  1098
             L+++  E+  NKRC +E+AG  +FLA +IK S  N                    TD+AL
Sbjct  117   LKAIISESDRNKRCVIEAAGAVDFLASLIKESRSNEREQEQEQHVFDDGTGSTTATDEAL  176

Query  1097  YVLHNLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpsls  918
              +L++L +SE  L  ++  +  FI+SLT V++  +Y+SRA+A++L+KS++    L  + +
Sbjct  177   SILYSLQISEQSLLHLIERNNGFIESLTTVLRRSNYQSRAHAMLLMKSLV----LVMAPA  232

Query  917   qltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLL  738
             +L        F +VV++LRD  S +A+K+AL +L  +   GRNR+KA E GA  VVI+LL
Sbjct  233   RLKKGFGKELFEEVVKVLRDQISYQATKAALRVLRELSPWGRNRVKAVEGGAVGVVIELL  292

Query  737   L-DTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILY  561
             L    E R CE  + VLEQLCRCAEGRAE++ HAAG+AVVS+K+LRVS+VANER +RIL+
Sbjct  293   LLGKRETRECEMMVVVLEQLCRCAEGRAEMVGHAAGIAVVSKKLLRVSRVANERVVRILH  352

Query  560   SIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPL  381
             S+A++S TP+V+QEM Q+G   KLC+++Q+DCG  K KE+A EIL+LH+K W+NS CL  
Sbjct  353   SVARYSPTPAVLQEMKQVGAVGKLCMLLQMDCG-EKAKEKAKEILRLHSKVWRNSLCLAS  411

Query  380   DLI  372
              L+
Sbjct  412   PLL  414



>ref|XP_011090297.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Sesamum indicum]
Length=400

 Score =   405 bits (1042),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 207/401 (52%), Positives = 287/401 (72%), Gaps = 13/401 (3%)
 Frame = -1

Query  1571  EIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEF  1392
             E+++P +FLCPIS+++MKDPVT+STGITYDR++IEKW+FS KN TCPVTKQ L  TD   
Sbjct  6     EVEIPCHFLCPISMQLMKDPVTVSTGITYDRESIEKWLFSRKNPTCPVTKQELFNTD---  62

Query  1391  LTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTLR  1212
             LTPN  LRR+IQ+WCTL+A    ER PTPKPPV +S I+KLL +AK++P+     LQ LR
Sbjct  63    LTPNHTLRRLIQAWCTLNA---FERIPTPKPPVDRSQIVKLLNEAKNSPKSQLVCLQRLR  119

Query  1211  SMAPENAANKRCMESAGVAEFLAQIIKTSEDNPT-DDALYVLHNLGLSENGLRSILGHDT  1035
             S+A  N + K  +++AG   FL  +++ +ED  + D+AL +L  + LS++ L++ L  + 
Sbjct  120   SIARRNESGKNHLQAAGAVHFLLSVVRKNEDAFSRDEALSLLQEMELSDSDLKTFLSENG  179

Query  1034  QFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQILRDN  855
               +DSL +V++ G  ++R  A+MLLKS         +            F  +V ILRD 
Sbjct  180   GILDSLIQVLETGDCQNRTVAMMLLKSAF-----YVADPADLIGSRPELFTHIVHILRDR  234

Query  854   FSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLSVLEQLCR  675
              S++A+K+AL LL  +C  GRNRIKA +AGA   +I+LLL+T ++R CE  L+VL+QLC 
Sbjct  235   ISQQATKAALKLLVELCPWGRNRIKAVDAGAVAALIELLLETADRRACELVLTVLDQLCG  294

Query  674   CAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEMLQLGVGA  495
             CAEGRAE+L+H  GLAVVS+KILRVS  A+ERG+RIL SI+K+SA   V+QEMLQ+GV +
Sbjct  295   CAEGRAELLRHGCGLAVVSKKILRVSHAASERGVRILSSISKYSANSWVLQEMLQVGVAS  354

Query  494   KLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             KLCLV+QV+  + K KERA EIL+LH++ W++SPC+P  L+
Sbjct  355   KLCLVLQVEASL-KTKERAKEILRLHSRVWRDSPCIPPHLL  394



>gb|KHN36501.1| E3 ubiquitin-protein ligase PUB23 [Glycine soja]
Length=403

 Score =   403 bits (1036),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 216/408 (53%), Positives = 293/408 (72%), Gaps = 15/408 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M+EI++P +FLCPISL++M+DPVT+ TGITYDR+NIE+W+FS KN TCPVTKQ L   D 
Sbjct  1     MDEIEIPAHFLCPISLQLMRDPVTVCTGITYDRENIERWLFSCKNNTCPVTKQCLLNHD-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQSWCTL+AS GVER PTPK P+ ++ I+KLL +AK  PE   K L  
Sbjct  60    --LTPNHTLRRLIQSWCTLNASLGVERIPTPKSPIDRTQIVKLLTEAKRFPEKQLKCLTR  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIK---TSEDNP--TDDALYVLHNLGLSENGLRS  1053
             LRS+A E   NK C+ESAGV EFL   +K   T ED+   ++ A+ VL +L LSE  +++
Sbjct  118   LRSIAFEGQRNKTCLESAGVIEFLVSTMKNNNTQEDSTVLSEAAIEVLFHLNLSEARIKA  177

Query  1052  ILGHDT-QFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQV  876
             ++ ++   FI+SL  V++ G+Y+SRA+A MLL+S  E       +S  T       F ++
Sbjct  178   LINNEEFHFIESLFHVLRLGNYQSRAFATMLLRSAFEVADPIQLISVKTA-----LFVEI  232

Query  875   VQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLS  696
             +++LRD  S++ASK+AL L+  +   GRNRIK  E GA  V+++LLL  +E+R CE  L 
Sbjct  233   MRVLRDQISQQASKAALKLIVELFPWGRNRIKGVEGGAVLVLVELLLGASERRTCELILI  292

Query  695   VLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEM  516
              L+QLC CAEGRAE+L H AG+A+VS+KILRVS VA++RG+RIL SI ++SA   V+ EM
Sbjct  293   ALDQLCGCAEGRAELLNHGAGVAIVSKKILRVSHVASDRGVRILASICRYSANARVLHEM  352

Query  515   LQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             LQ+G  +KLCLV+QV+C + K KERA EIL+LH+  WKNSPC+P+ L+
Sbjct  353   LQVGAVSKLCLVLQVNCSL-KTKERAKEILQLHSVVWKNSPCIPVPLL  399



>ref|XP_003543414.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Glycine max]
Length=403

 Score =   403 bits (1036),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 216/408 (53%), Positives = 293/408 (72%), Gaps = 15/408 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M+EI++P +FLCPISL++M+DPVT+ TGITYDR+NIE+W+FS KN TCPVTKQ L   D 
Sbjct  1     MDEIEIPAHFLCPISLQLMRDPVTVCTGITYDRENIERWLFSCKNNTCPVTKQCLLNHD-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQSWCTL+AS GVER PTPK P+ ++ I+KLL +AK  PE   K L  
Sbjct  60    --LTPNHTLRRLIQSWCTLNASLGVERIPTPKSPIDRTQIVKLLTEAKRFPEKQLKCLTR  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIK---TSEDNP--TDDALYVLHNLGLSENGLRS  1053
             LRS+A E   NK C+ESAGV EFL   +K   T ED+   ++ A+ VL +L LSE  +++
Sbjct  118   LRSIAFEGQRNKTCLESAGVIEFLVSTMKNNNTQEDSTVLSEAAIEVLFHLNLSEARVKA  177

Query  1052  ILGHDT-QFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQV  876
             ++ ++   FI+SL  V++ G+Y+SRA+A MLL+S  E       +S  T       F ++
Sbjct  178   LINNEEFHFIESLFHVLRLGNYQSRAFATMLLRSAFEVADPIQLISVKTA-----LFVEI  232

Query  875   VQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLS  696
             +++LRD  S++ASK+AL L+  +   GRNRIK  E GA  V+++LLL  +E+R CE  L 
Sbjct  233   MRVLRDQISQQASKAALKLIVELFPWGRNRIKGVEGGAVLVLVELLLGASERRTCELILI  292

Query  695   VLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEM  516
              L+QLC CAEGRAE+L H AG+A+VS+KILRVS VA++RG+RIL SI ++SA   V+ EM
Sbjct  293   ALDQLCGCAEGRAELLNHGAGVAIVSKKILRVSHVASDRGVRILASICRYSANARVLHEM  352

Query  515   LQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             LQ+G  +KLCLV+QV+C + K KERA EIL+LH+  WKNSPC+P+ L+
Sbjct  353   LQVGAVSKLCLVLQVNCSL-KTKERAKEILQLHSVVWKNSPCIPVPLL  399



>gb|KCW48204.1| hypothetical protein EUGRSUZ_K01927 [Eucalyptus grandis]
Length=383

 Score =   402 bits (1033),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 212/417 (51%), Positives = 284/417 (68%), Gaps = 56/417 (13%)
 Frame = -1

Query  1571  EIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEF  1392
             E++VPPYFLCPISLEIM+DPV +STGITYDR++IE W+++ KN  CPVTKQ +S  D   
Sbjct  5     EVEVPPYFLCPISLEIMRDPVIVSTGITYDRESIETWLYTSKNNLCPVTKQPISDVD---  61

Query  1391  LTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTLR  1212
             LTPN  LRR+IQSWCTL++S G+ER PTP+ P++K+ I K+LR  +  P++  K L  LR
Sbjct  62    LTPNHTLRRLIQSWCTLNSSDGIERIPTPRAPISKAQITKILRDTEK-PQLQQKCLGRLR  120

Query  1211  SMAPENAANKRCMESAGVAEFLAQIIKTS--------ED-------NPTDDALYVLHNLG  1077
             S+A  N + KRCME+AG  EFLA  I T+        ED        P+DDAL++L++L 
Sbjct  121   SIAFYNTSAKRCMEAAGAVEFLASAINTTSQVQLSALEDESLLDIKKPSDDALFILYHLQ  180

Query  1076  LSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttln  897
             LSE GL+S+L  +                 +    ++ L+                    
Sbjct  181   LSEPGLKSLLMFEV----------------AEPIQIITLR--------------------  204

Query  896   lSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKR  717
               FF +V Q+L D  S++A+K+ L LL NVC  GRNRIKA E+GA +V+++LLLD +++R
Sbjct  205   REFFTEVAQVLHDQISQQATKATLKLLINVCPWGRNRIKAVESGAVSVLVELLLDCSDRR  264

Query  716   YCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSAT  537
              CE  L +LE LC+CAEGR+E+L+H  G+AVVS++ILRVSQVA+ER +RIL S++KFSAT
Sbjct  265   TCELILMLLEMLCQCAEGRSELLRHGVGIAVVSKRILRVSQVASERAVRILLSVSKFSAT  324

Query  536   PSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIHN  366
             PSVVQEMLQLGV  KLCLV+Q DCG  K KE+A EILKLHA+ WK+SPC+P + + +
Sbjct  325   PSVVQEMLQLGVATKLCLVLQEDCG-RKIKEKAIEILKLHARVWKHSPCIPSNFLSS  380



>ref|XP_003596890.1| U-box domain-containing protein [Medicago truncatula]
 gb|AES67141.1| E3 ubiquitin-protein ligase PUB22-like protein [Medicago truncatula]
Length=403

 Score =   402 bits (1034),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 214/405 (53%), Positives = 288/405 (71%), Gaps = 9/405 (2%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M+EI VP +FLCPISL++MKDPVT+STGITYDR+NIEKW+FS +N TCPVTKQ L  TD 
Sbjct  1     MDEIDVPSHFLCPISLQLMKDPVTLSTGITYDRENIEKWLFSFQNNTCPVTKQTLLETDL  60

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               L PN  LRR+IQSWCTL+AS GVER PTPK P+ ++ ILKLL +AK  PE     L  
Sbjct  61    NNLIPNHTLRRLIQSWCTLNASFGVERIPTPKSPIDRTQILKLLNEAKKFPEKQLNCLVK  120

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSEDNP--TDDALYVLHNLGLSENGLRSILG  1044
             LRS+  E+  NK+C+ESAG  EFLA  +K + ++   ++ A+ +L +L  SE  +++++ 
Sbjct  121   LRSIVFESERNKKCLESAGAIEFLALTMKNNLNSSSLSEAAIEILFHLNPSEEHVKNLIN  180

Query  1043  HDT-QFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQI  867
             +++ QFI+SL  V++ GSY+SR YA MLLKS  E      S      ++  + F +++++
Sbjct  181   NESIQFIESLFHVLKLGSYQSRGYATMLLKSAFE-----VSDPIQLISVKKAIFEEIMRV  235

Query  866   LRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLSVLE  687
             L D  S++ASK+AL LL  +   GRNRIKA E G   V+I+LL D +E+R CE  L  L+
Sbjct  236   LVDKISQQASKAALKLLLELLPWGRNRIKAVEGGVVLVLIELLFDVSERRVCELMLIGLD  295

Query  686   QLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEMLQL  507
             Q+C CAEGRAE+L H AGLA+VS+KILRVS VA++RG+RI+ SI ++SA   V+ EML +
Sbjct  296   QICGCAEGRAELLNHGAGLAIVSKKILRVSHVASDRGVRIMSSICRYSANSRVLHEMLHV  355

Query  506   GVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             G  +KLCLV+QVD    K KERA EILKLH+  WKNS C+P+ L+
Sbjct  356   GAVSKLCLVLQVDSNF-KTKERAKEILKLHSTVWKNSTCIPVPLL  399



>ref|XP_004487449.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Cicer arietinum]
Length=399

 Score =   402 bits (1034),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 209/403 (52%), Positives = 282/403 (70%), Gaps = 12/403 (3%)
 Frame = -1

Query  1574  EEIQVPPYFLCPIS-LEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             E I VP +FLC    L++MKDPVT++TGITYDRDNIEKW+FS KN TCPVTKQ +    D
Sbjct  3     EIIDVPTHFLCXXXXLQLMKDPVTVTTGITYDRDNIEKWLFSFKNKTCPVTKQHI----D  58

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPNI LRR+IQSWCTL++S G++R PTPK P+ K+ ILKL  +AK +PE     L  
Sbjct  59    LNLTPNITLRRLIQSWCTLNSSLGIQRIPTPKSPIDKTQILKLFSEAKKSPEKQLNCLLK  118

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSEDNPTDDALYVLHNLGLSENGLRSILGHD  1038
             +RS   E+  NK C+ESAG  EFLA  +K +  +  + A+ +L +L  SE  +++++ ++
Sbjct  119   IRSFVFESQRNKNCLESAGTIEFLASTMKNNSISVIESAIEILFHLYPSEQHIKNLVKNE  178

Query  1037  T-QFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQILR  861
             T QFI+SL  V+++G+Y+SRAYA MLLKS  E       +S          F ++ ++L 
Sbjct  179   TIQFIESLFHVLKNGNYQSRAYATMLLKSAFEVADPIQLISVKKA-----LFEEITRVLT  233

Query  860   DNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLSVLEQL  681
             D  S++ASK+AL L+  +   GRNRIKA E GA  V+I+LL+D +E+R CE  L  L+QL
Sbjct  234   DKISQQASKAALKLIVELLPWGRNRIKAVEGGAVLVLIELLIDVSERRACELMLIGLDQL  293

Query  680   CRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEMLQLGV  501
             C CAEGRAE+L H AG+A+VS+KILRVS VA++RG+RIL S+ ++SA   V+ EMLQ+G 
Sbjct  294   CGCAEGRAELLNHGAGVAIVSKKILRVSHVASDRGIRILNSVCRYSANSRVLNEMLQVGG  353

Query  500   GAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
              +KLCLV+QVD    K KERA EILKLH+  WKNS C+P+ L+
Sbjct  354   VSKLCLVLQVDSSF-KTKERAKEILKLHSGVWKNSRCIPVSLL  395



>gb|KCW90449.1| hypothetical protein EUGRSUZ_A02579 [Eucalyptus grandis]
Length=395

 Score =   399 bits (1024),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 206/382 (54%), Positives = 275/382 (72%), Gaps = 19/382 (5%)
 Frame = -1

Query  1523  MKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEFLTPNIILRRVIQSWCT  1344
             MKDP+T+ TGITYDR+NIEKW+FS KN TCPVTKQA+   +   LTPN  LR++IQSWCT
Sbjct  1     MKDPITVPTGITYDRENIEKWLFSAKNGTCPVTKQAIPDCE---LTPNHTLRQLIQSWCT  57

Query  1343  LHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTLRSMAPENAANKRCMESA  1164
             L+A+HG++R PTP+PP+++S I KLL +AKS P+M  K L+ LRS+A ENAAN+ CME+A
Sbjct  58    LNAAHGIQRIPTPRPPISESQIAKLLHEAKS-PDMRNKCLKRLRSIATENAANRCCMEAA  116

Query  1163  GVAEFLAQIIKTS--------EDNPTDDALYVLHNLGLSENGLRSILGHDTQFIDSLTRV  1008
             G A+FLA ++K          ++  ++   + +    L E  L + +G D  F+DSLTR+
Sbjct  117   GAADFLATLVKNETSASSALLDETSSNCRSFEVTTRPLDET-LANPIGDDGVFVDSLTRI  175

Query  1007  MQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQILRDNFSRKASKSA  828
             MQ G+ + RAYAVMLLKSM +   +    S         FF +VV +LRD  SRKA+KSA
Sbjct  176   MQSGNCDPRAYAVMLLKSMFQVVDIIQLSSLRME-----FFVEVVCLLRDQVSRKATKSA  230

Query  827   LHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLSVLEQLCRCAEGRAEVL  648
             L LL   C+ G+N +KA EA A  V+IDLLLD+ +KR  E  L +L+ LC+CAEGRAE+L
Sbjct  231   LKLLIRACRMGQNHVKAVEAYAVPVLIDLLLDSCDKRQSEMILILLDVLCQCAEGRAELL  290

Query  647   KHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVD  468
             +H AG+ +VS++ILR S+ A+ERG+RIL SI+KF ATPS+VQEMLQ+GV AKLCLV+QV+
Sbjct  291   RHRAGITIVSKRILRASETASERGVRILSSISKFLATPSIVQEMLQVGVAAKLCLVLQVE  350

Query  467   CGVGKNKERAAEILKLHAKEWK  402
              G  K +E+A + LKLHA+ WK
Sbjct  351   -GTSKTREKAKQTLKLHARPWK  371



>ref|XP_010912070.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Elaeis guineensis]
Length=417

 Score =   399 bits (1024),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 209/414 (50%), Positives = 284/414 (69%), Gaps = 27/414 (7%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M EI++P YFLCPISL+IM+DPVT+ TGITYDRD+IE WIFSGK+ TCPVTKQ+L   D 
Sbjct  1     MAEIEIPSYFLCPISLQIMRDPVTLPTGITYDRDSIESWIFSGKHNTCPVTKQSLPECD-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WC L+ S G+ERFPTPKPP+ K+ I KL+  A+  P +    L+ 
Sbjct  60    --LTPNHTLRRLIQAWCALNPSDGIERFPTPKPPMDKAQIAKLIDDAR-LPHLQLTSLRK  116

Query  1217  LRSMAPENAANKRCMESA-GVAEFLAQIIKTSEDNP----------------TDDALYVL  1089
             L+ +  E+  NKRC+E+  GV +FLA I+K +   P                 D+AL +L
Sbjct  117   LKDIVSESERNKRCVEATPGVLDFLASIMKKNSSTPGEEGILIRDGAESTTACDEALSIL  176

Query  1088  HNLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqlt  909
             + L +SE  LR     +   I+SLT ++Q  +Y+SRAYA +LLKS+L             
Sbjct  177   YLLQISEQRLRDFAVKNEAIIESLTSILQQSNYQSRAYATLLLKSIL-----GVIAPAKL  231

Query  908   ttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDT  729
               +    F ++V +LRD  S +A K+AL +L+ +C+  RNR+KAA AGA  V+I+LL D 
Sbjct  232   AGVREELFQEIVNVLRDRISHRAGKAALQVLSLLCRWRRNRVKAAHAGAVPVLIELLPDE  291

Query  728   NEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAK  549
             NEKR CE  L VL  +C CAEGR+E++ H+AG+A+VS+KIL +S+VA+E  +RIL S+AK
Sbjct  292   NEKRVCELVLVVLALVCGCAEGRSELVGHSAGIAIVSKKILSISEVASEAAVRILNSVAK  351

Query  548   FSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCL  387
             FSAT +V+QEMLQ+GV +KLCLV+Q+DCG+ K KE+A EIL+LH++ WK SP L
Sbjct  352   FSATAAVLQEMLQIGVVSKLCLVLQIDCGM-KTKEKAREILRLHSRVWKKSPSL  404



>ref|XP_004291671.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Fragaria vesca 
subsp. vesca]
Length=429

 Score =   399 bits (1025),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 205/402 (51%), Positives = 280/402 (70%), Gaps = 10/402 (2%)
 Frame = -1

Query  1571  EIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEF  1392
             E  +P +FLCPISLE+M+DPVT+STGITYDR++I+KW+FSGKN  CPVTKQ L    D  
Sbjct  17    EFDIPSHFLCPISLEVMRDPVTVSTGITYDRESIQKWLFSGKNKACPVTKQPLLLDAD--  74

Query  1391  LTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTLR  1212
             LTPN  LRR+IQ+WCTL+ASHGVER PTP   + K+ I+KL+ QA+  P    + L+ LR
Sbjct  75    LTPNHTLRRIIQAWCTLNASHGVERIPTPTSQLDKTQIVKLINQARKLPHTQLECLKRLR  134

Query  1211  SMAPENAANKR-CMESAGVAEFLAQIIKTSEDNPTDDALYVLHNLGLSENGLRSILGHD-  1038
             SMA  +    R  +E+AG  E++A +I  ++ +  + A+ VL  L   E+ L+ ++  D 
Sbjct  135   SMAAIHGEKHRNSLEAAGAVEYVASLISNTDQSTMEVAVEVLFYLRSLESRLKQLMSKDG  194

Query  1037  TQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQILRD  858
              + IDSL +V++ G Y+SRA+A +LL+S+ E    N  +S          F + + ++RD
Sbjct  195   EKIIDSLVQVLKRGDYQSRAHATILLRSVFELADPNRMMSPTVE-----LFIETMNVVRD  249

Query  857   NFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLSVLEQLC  678
               S +ASK+AL LL  +C  GRNRIKA E GA +V+I+ LL+  EKR CE  L  L+QLC
Sbjct  250   QVSHQASKAALKLLVELCPWGRNRIKAVEGGAVSVLIEALLEAQEKRACELILISLDQLC  309

Query  677   RCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEMLQLGVG  498
              C EGRAE+L+HAAGLA+VS+KI R+S +A +R +RIL+SI++FSAT +VV EML +G  
Sbjct  310   GCTEGRAELLRHAAGLAIVSKKIFRISHMATDRAVRILFSISRFSATSAVVMEMLHVGAV  369

Query  497   AKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             AKLCLV+QVDC   K KE+A EILKLH++ WKNS C+P  L+
Sbjct  370   AKLCLVLQVDCKF-KTKEKAREILKLHSRVWKNSSCVPAHLL  410



>ref|XP_004251095.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Solanum lycopersicum]
Length=404

 Score =   398 bits (1022),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 201/409 (49%), Positives = 286/409 (70%), Gaps = 16/409 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             MEEI +P YFLCPIS+E+M+DPVTI TGITYDR NIEKW+FS K+ TCPVT Q L   D 
Sbjct  1     MEEIDIPSYFLCPISMEVMRDPVTILTGITYDRQNIEKWLFSCKHTTCPVTNQDLKFKD-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQSWC L++S+G++R PTPKP V ++H++++L +A+  P+M    L+ 
Sbjct  60    --LTPNHNLRRLIQSWCMLNSSNGIQRMPTPKPQVQRAHVVRILNEAQKNPDMELDCLRR  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSEDNP--TDDALYVLHNLGLSENGLRSILG  1044
             ++S+A  + +NK C+ESAGV +FL  I+   ++ P  +D+AL +L +L  S+  L+ ++ 
Sbjct  118   IKSIARVSESNKMCLESAGVVDFLTSIVMKKKEEPEASDEALNILFHLNPSDTELKKLIN  177

Query  1043  --HDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQ  870
               +D QF+DSL + + +G  +SR  A+ LL+S L        +          +   +V 
Sbjct  178   SHNDNQFLDSLLQFLNNGHVQSRTNAIALLRSTLSMADPAQLIGIQPV-----YIKGIVC  232

Query  869   ILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLSVL  690
             IL D  S++A+K AL LL  +C  GRNRIKA E GA   +I+LLLDTNE+R CE  L+ L
Sbjct  233   ILNDKVSQQATKLALKLLVELCPWGRNRIKAIENGAVFALIELLLDTNERRVCELILTAL  292

Query  689   EQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSAT---PSVVQE  519
             + LC CA+GR+E+L+H  G+A+VS+KILRVS +A++RG+RILYSI+KF AT     V+QE
Sbjct  293   DHLCTCADGRSELLRHGGGIAIVSKKILRVSHLASDRGVRILYSISKFLATCYSTKVLQE  352

Query  518   MLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             MLQ+G+ +KLCLV+QVD    K KE+A EIL+LH++ W++S C+P  L+
Sbjct  353   MLQVGIVSKLCLVLQVDVS-PKTKEKAKEILRLHSRVWRDSSCIPPHLL  400



>ref|XP_006362850.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Solanum tuberosum]
Length=404

 Score =   397 bits (1020),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 202/409 (49%), Positives = 286/409 (70%), Gaps = 16/409 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             MEEI +P YFLCPIS+E+M+DPVTISTGITYDR NIEKW+FS K+ TCPVT Q L   D 
Sbjct  1     MEEIDIPSYFLCPISMEVMRDPVTISTGITYDRQNIEKWLFSCKHTTCPVTNQDLKFKD-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQSWC L++S+G++R PTPKP V ++H++++L +A+  P+M    L+ 
Sbjct  60    --LTPNHNLRRLIQSWCMLNSSNGIQRMPTPKPQVQRAHVVRILNEAQKYPDMEFSCLRR  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQII--KTSEDNPTDDALYVLHNLGLSENGLRSILG  1044
             ++S+A  + +NK C+ESAGV +FL  I+  K  E   +D+AL +L +L  S+  L+ ++ 
Sbjct  118   IKSIARVSESNKMCLESAGVVDFLTSIMMKKKEESEASDEALNILFHLNPSDTELKKLIN  177

Query  1043  --HDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQ  870
               +D  F+DSL + + +G  +SR  A+ LL+S L     +  +          +   +V 
Sbjct  178   SQNDHHFLDSLLQFLNNGHVQSRTNAIALLRSTLNVADPSQLIGIQPV-----YIKGIVC  232

Query  869   ILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLSVL  690
             IL D  S++A+K AL LL  +C  GRN+IKA E GA   +I+LLLDTNE+R CE  L+ L
Sbjct  233   ILNDKISQQATKVALKLLVELCPWGRNKIKAVENGAVFALIELLLDTNERRVCELILTAL  292

Query  689   EQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSAT---PSVVQE  519
             + LC CA+GR+E+L+H  G+A+VS+KILRVS +A++RG+RILYSI+KF AT     V+QE
Sbjct  293   DHLCTCADGRSELLRHGGGIAIVSKKILRVSHLASDRGVRILYSISKFLATCYSTKVLQE  352

Query  518   MLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             MLQ+GV +KLCLV+QVD    K KE+A EIL+LH++ W++S C+P  L+
Sbjct  353   MLQVGVVSKLCLVLQVDVS-PKTKEKAKEILRLHSRVWRDSSCIPPHLL  400



>ref|XP_010911941.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Elaeis guineensis]
Length=415

 Score =   392 bits (1007),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 205/414 (50%), Positives = 283/414 (68%), Gaps = 27/414 (7%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M E+++P +FLCPISL+IM+DPVT+ TGITYDRD+IE+WI+SGK+ TCPVTKQ+L   D 
Sbjct  1     MAEVEIPSHFLCPISLQIMRDPVTLPTGITYDRDSIERWIYSGKHNTCPVTKQSLPECD-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               L PN  LRR+IQ+WC L+ S  +ERFPTPKPP+  + I KL+  AK  P +    L+ 
Sbjct  60    --LIPNHTLRRLIQAWCALNQSDDIERFPTPKPPIDNAQIAKLIDDAK-LPHLQLSSLRK  116

Query  1217  LRSMAPENAANKRCMESA-GVAEFLAQIIKTSEDNP----------------TDDALYVL  1089
             L+ +  E+  NK C+E+  GV +FLA I+K +   P                 D+AL +L
Sbjct  117   LKEIVSESERNKLCVEATPGVLDFLASIVKKNSFTPGEEGILIRDDVESTTACDEALSIL  176

Query  1088  HNLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqlt  909
             + L +SE  L      +   I+SLT ++Q  +Y+SRAYA +LLKS+L             
Sbjct  177   YLLQISEQRLHDFAIKNEDIIESLTSILQQQNYQSRAYATLLLKSIL-----GVIAPAKL  231

Query  908   ttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDT  729
               +    F ++V +L D  S +A K+AL +L+ +C+ GRNR+KAA AGA  V+I+LLLD 
Sbjct  232   AGVREELFQEIVNVLGDRISHRADKAALQVLSLLCRWGRNRVKAAHAGAVPVLIELLLDE  291

Query  728   NEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAK  549
             NEKR CE  L VL  +C CAEGR+E++ HAAG+A+VS+KILR+S+VA++  +RIL S+AK
Sbjct  292   NEKRVCELVLVVLALVCGCAEGRSELVGHAAGIAIVSKKILRISEVASDGAVRILNSVAK  351

Query  548   FSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCL  387
             FSAT +V+QEMLQ+GV +KLCLV+Q+DCG+ K KE+A EIL+LH++ WK SPCL
Sbjct  352   FSATAAVLQEMLQIGVVSKLCLVLQLDCGM-KTKEKAKEILRLHSRVWKKSPCL  404



>ref|XP_009415614.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Musa acuminata 
subsp. malaccensis]
Length=415

 Score =   391 bits (1005),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 198/411 (48%), Positives = 285/411 (69%), Gaps = 24/411 (6%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             ME +++P YFLCP+SL++MKDPVT+STGITYDRD+IE+WIF+ +  TCPVT Q L   + 
Sbjct  1     MEGVEIPSYFLCPVSLQLMKDPVTLSTGITYDRDSIERWIFAARKTTCPVTNQTLPDCE-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WCT +A  GVERFPTPK PV K+ I  L+  AK  P+     L+ 
Sbjct  60    --LTPNHTLRRLIQAWCTANADVGVERFPTPKAPVDKAQIEMLVGDAK-LPQSQLGSLRK  116

Query  1217  LRSMAPENAANKRCMESA-GVAEFLAQII---KTSED----------NPTDDALYVLHNL  1080
             LR+   E+  NKRC+E+A G  + LA I+    + ED             D+AL++L +L
Sbjct  117   LRAFVSESERNKRCVEAATGAVDLLASIVDRNSSGEDIDDDCLESTSAACDEALHILCSL  176

Query  1079  GLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttl  900
              +SE GLR ++  +   ++SLT +++  +Y SRA+A +LL  +L   + +  ++      
Sbjct  177   QISEEGLRDLVAKNAGMVESLTTILRRSNYNSRAHATLLLNQILRVMSQDQLINLSDQ--  234

Query  899   nlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEK  720
                 F ++V ++ D  S +A+K+ALH+L + C  GRNRIKAA AGA  V+++LLL+  ++
Sbjct  235   ---LFQEIVSVIHDRISHQATKAALHVLVDACPRGRNRIKAANAGAVHVLVELLLEEPDR  291

Query  719   RYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSA  540
             R CE  L  +++LC CAEGRAE++ HAAG+ VVS+KILRVSQVA+ER +R+L+S+A  SA
Sbjct  292   RVCELVLVAMDRLCGCAEGRAELVGHAAGIPVVSKKILRVSQVASERAVRVLHSVAMHSA  351

Query  539   TPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCL  387
             TP ++QEM+Q+GV +KLCL++Q+DC V K KE+A+EIL+LH++ WK SPCL
Sbjct  352   TPGLLQEMMQVGVVSKLCLMLQLDCNV-KTKEQASEILRLHSRVWKTSPCL  401



>ref|XP_009408289.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Musa acuminata 
subsp. malaccensis]
Length=412

 Score =   391 bits (1004),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 206/411 (50%), Positives = 288/411 (70%), Gaps = 24/411 (6%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             ME +++PPYFLCPISL++MKDPVT+STGITYDR++IE+WIFSG + TCPVTK+AL    D
Sbjct  1     MEGVEIPPYFLCPISLQLMKDPVTLSTGITYDRESIERWIFSGGHNTCPVTKRALP---D  57

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               +TPN  LRR+IQ+WCT++AS GVER PTPK PV +  I+KLL +AK  P+   + L  
Sbjct  58    CEVTPNHTLRRLIQAWCTVNASSGVERVPTPKAPVEQGQIVKLLDEAK-LPQSQLRSLAR  116

Query  1217  LRSMAPENAANKRCME-SAGVAEFLAQIIKT---SEDNPTDD----------ALYVLHNL  1080
             LR++  E+  NKRC+E +AGV +FLA +I     S +   DD          AL +LH+L
Sbjct  117   LRAIVSESERNKRCVEATAGVVDFLASVIANDGYSSNEEVDDGLESTGACDEALNILHSL  176

Query  1079  GLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttl  900
              +SE GL  ++      I+SLT +++  SY+SRAYA +LL+SML          +    L
Sbjct  177   TISEGGLLDLVTRHAGMIESLTTILRRSSYQSRAYATLLLRSML-----GVLTQEKLINL  231

Query  899   nlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEK  720
                 F ++V ++ D  S + +++ALH L   C   RNRIKA  AGA  V+I+LLL+ +++
Sbjct  232   GEELFQEIVNVIHDRISNQETRAALHALIEACPCARNRIKAVNAGAVHVLIELLLEEDDR  291

Query  719   RYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSA  540
             R CE  L  +++LC CAEGRAE++ HAAG+ VVS+KILRVS++A+ER +RIL+S+A+ SA
Sbjct  292   RICELALVAMDRLCGCAEGRAELVGHAAGITVVSKKILRVSEMASERAVRILHSVARHSA  351

Query  539   TPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCL  387
             TP ++QEM+Q+GV +KLCLV+QVDC   K KE+A EIL +H++ W++SPCL
Sbjct  352   TPRLLQEMMQMGVVSKLCLVLQVDC-KAKTKEKAKEILSMHSRVWRSSPCL  401



>ref|XP_006592779.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like isoform X2 
[Glycine max]
Length=387

 Score =   390 bits (1001),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 209/388 (54%), Positives = 275/388 (71%), Gaps = 15/388 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M+EI++P +FLCPISL++M+DPVT+ TGITYDR+NIE+W+FS KN TCPVTKQ L    D
Sbjct  1     MDEIEIPAHFLCPISLQLMRDPVTVCTGITYDRENIERWLFSCKNNTCPVTKQCLL---D  57

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQSWCTL+AS GVER PTPK P+ K+ I+KLL +AK  PE   K L  
Sbjct  58    HGLTPNHTLRRLIQSWCTLNASLGVERIPTPKSPIDKTQIVKLLTEAKRFPEKQLKCLTR  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIK---TSEDNP--TDDALYVLHNLGLSENGLRS  1053
             LRS+A E   NK C+ESAGV EFLA  +K   T ED+   ++ A+ VL +L LSE  L++
Sbjct  118   LRSVAFEGQRNKTCLESAGVIEFLATTMKNNNTQEDSTVLSEAAIEVLFHLNLSEARLKT  177

Query  1052  ILGHDT-QFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQV  876
             ++ ++   FI+SL  V++ G+Y+SR YA MLL+S  E       +S  T       F ++
Sbjct  178   LINNEEFHFIESLFHVLRLGNYQSRVYATMLLRSAFEVADPIQLISVKTA-----LFVEI  232

Query  875   VQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLS  696
             +++L D  S +ASK+AL L+  +   GRNRIK  E G  +V+I+LLL T+E+R CE  L 
Sbjct  233   MRVLCDQISHQASKAALKLIVELFPWGRNRIKGVEDGTVSVLIELLLGTSERRTCELILI  292

Query  695   VLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEM  516
              L+QLC CAEGRAE+L H AG+A+VS+KILRVS VA+ERG+RIL SI ++SA   V+ EM
Sbjct  293   ALDQLCGCAEGRAELLNHGAGVAIVSKKILRVSHVASERGVRILASICRYSANARVLHEM  352

Query  515   LQLGVGAKLCLVIQVDCGVGKNKERAAE  432
             LQ+G  +KLCLV+QV+CG  K KERA E
Sbjct  353   LQVGAVSKLCLVLQVNCGF-KTKERAKE  379



>emb|CBI22782.3| unnamed protein product [Vitis vinifera]
Length=338

 Score =   385 bits (989),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 202/371 (54%), Positives = 257/371 (69%), Gaps = 52/371 (14%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             MEEI VPP+FLCPISLEIMKDPVT+STGITYDR++IEKW+FSGKN TCP TKQ LS   D
Sbjct  1     MEEIDVPPFFLCPISLEIMKDPVTVSTGITYDRESIEKWLFSGKNNTCPATKQVLSADSD  60

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WCTL+AS+G                         +P++  K +  
Sbjct  61    --LTPNHTLRRLIQAWCTLNASNG-------------------------SPQLQMKCIGK  93

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSEDNPTDDALYVLHNLGLSENGLRSILGHD  1038
             LR++A E+ ANKRC+ESA                    AL +LH L LSE GL+ ++G +
Sbjct  94    LRALATESDANKRCIESA--------------------ALSILHYLLLSEAGLKKLVGKN  133

Query  1037  TQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQILRD  858
              +F+  L RV+Q G+YESRAYAVMLL SML+      +       L   FF + VQ+L+D
Sbjct  134   GEFVGCLVRVLQRGNYESRAYAVMLLSSMLQ-----VADPIQLIALKPEFFVEAVQVLQD  188

Query  857   NFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLSVLEQLC  678
             + S +A+K+ L LL  VC  GRN++KA EAGA +++ +LLL ++EKR CE  L+VL+QLC
Sbjct  189   HISHQATKATLKLLIEVCPWGRNKVKAVEAGAVSILTELLLASSEKRACEMILTVLDQLC  248

Query  677   RCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEMLQLGVG  498
              CAEGRAE+LKHAAG+A+VS+KILRVS VA+ER +RILYSI+KFSATPSV+QEM QLGV 
Sbjct  249   GCAEGRAELLKHAAGMAIVSKKILRVSHVASERAVRILYSISKFSATPSVLQEMSQLGVV  308

Query  497   AKLCLVIQVDC  465
             AKLCLV+Q+ C
Sbjct  309   AKLCLVLQLAC  319



>ref|XP_008379758.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Malus domestica]
Length=443

 Score =   388 bits (997),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 204/398 (51%), Positives = 276/398 (69%), Gaps = 12/398 (3%)
 Frame = -1

Query  1550  FLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEFLTPNIIL  1371
             F  PISLEIM+DPVTISTGITYDR++IE+W F+ KN TCPV+K++LS  D + LTPN  L
Sbjct  39    FSAPISLEIMRDPVTISTGITYDRESIEQWWFTSKNNTCPVSKKSLSDVDAD-LTPNHTL  97

Query  1370  RRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTLRSMAPENA  1191
             RR+IQ+WCTL++SHGVE  PTPK  + KS ++ L+ QAK  P      LQ LRS+A +  
Sbjct  98    RRIIQAWCTLNSSHGVELIPTPKSALDKSQVVMLIEQAKKIPHTNLHCLQRLRSIAIQGE  157

Query  1190  ANKRCMESAGVAEFLAQIIKTSEDNPT--DDALYVLHNLGLSENGLRSILGHDTQ---FI  1026
              NK C+E+ G  E++A II  S+ + +  + A+ VL +   SE+ L+ ++ +D+      
Sbjct  158   RNKNCLEAXGAIEYVASIINKSQSDSSTVEAAIEVLFHFKSSESRLKDLMSNDSNNNNIT  217

Query  1025  DSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQILRDNFSR  846
             +SL RV+  G+Y+SRA+A+ LLKS  E       ++    +     F Q+V +L    S+
Sbjct  218   ESLVRVLDCGNYQSRAHAIXLLKSFFEVADPIQLINVDVES-----FRQIVHVLNGRISQ  272

Query  845   KASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLSVLEQLCRCAE  666
              ASK+AL LL  +C  GRNRIKA ++GA +V+ + LL T EKR CE  L +LEQLC CAE
Sbjct  273   AASKAALKLLVELCPWGRNRIKAVQSGAVSVLTEALLGTQEKRTCELILIILEQLCGCAE  332

Query  665   GRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEMLQLGVGAKLC  486
             GRAE+LKH AGLA+VS+KILRVS VA++R +RIL SI +FSAT  V+Q+MLQ+G  AKLC
Sbjct  333   GRAELLKHGAGLAIVSKKILRVSHVASDRAVRILSSICRFSATCGVLQDMLQVGAVAKLC  392

Query  485   LVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             LV+QVDC   K KE+A  +LKLH++ WKNS C+P  L+
Sbjct  393   LVLQVDCRF-KTKEKARVVLKLHSRVWKNSSCIPDHLL  429



>ref|XP_010045173.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Eucalyptus 
grandis]
Length=437

 Score =   388 bits (996),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 212/424 (50%), Positives = 289/424 (68%), Gaps = 36/424 (8%)
 Frame = -1

Query  1571  EIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEF  1392
             ++ VP +FLCPISL++M+DPVT STGITYDR++IE+W+   K++TCPVTKQ LS   D  
Sbjct  18    DVDVPVHFLCPISLQLMRDPVTASTGITYDRESIERWLLVFKSSTCPVTKQPLSSDAD--  75

Query  1391  LTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTLR  1212
             LTPN  LRR+IQ+WCTL+A    ER PTPKPP+ K+ I+K+L  AK TP      LQ LR
Sbjct  76    LTPNHTLRRLIQAWCTLNA---FERIPTPKPPLDKAAIVKILDDAKKTPRARLACLQRLR  132

Query  1211  SMAPEN--AANKRCME--SAGVAEFLAQIIKTSEDN---------------PTDDALYVL  1089
             S+A E   A NK+C++  SAGV EFLA IIK  E                  +D+AL VL
Sbjct  133   SIALEGDGARNKKCLDQVSAGVVEFLASIIKNDESTLVEVIDSSDGTELARASDEALNVL  192

Query  1088  HNLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqlt  909
              +L +S + L+ ++ +D     SL RV++ GSY+SRAYA M+LKS  E       ++  +
Sbjct  193   CHLNVSGSDLKRLMIND-DLTGSLMRVLRSGSYQSRAYATMILKSAYEAADPIQLMNVGS  251

Query  908   ttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDT  729
                   FF ++V++L+D  S++ASK+AL LL  +C  GRNRIKA E GA  V+++LLLDT
Sbjct  252   E-----FFGELVRVLKDQISQQASKAALKLLVELCPWGRNRIKAVEGGAVPVLVELLLDT  306

Query  728   NE-----KRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRIL  564
             N      KR CE  L VL+ LC  AEGRAE++ H AGLAVV++K+LRVS  A++R +RIL
Sbjct  307   NSASADSKRACELILMVLDLLCGSAEGRAELVAHGAGLAVVAKKVLRVSHAASDRAVRIL  366

Query  563   YSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLP  384
              S+++FSA+  V+QEMLQ+G  AKLCLV+QVD G  + +ERA +IL+ H++ W++SPC+P
Sbjct  367   ASVSRFSASARVLQEMLQVGAVAKLCLVLQVDSG-SRTRERARDILRWHSRVWRSSPCVP  425

Query  383   LDLI  372
             L L+
Sbjct  426   LHLL  429



>gb|KCW87327.1| hypothetical protein EUGRSUZ_B03814 [Eucalyptus grandis]
Length=428

 Score =   387 bits (995),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 212/424 (50%), Positives = 289/424 (68%), Gaps = 36/424 (8%)
 Frame = -1

Query  1571  EIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEF  1392
             ++ VP +FLCPISL++M+DPVT STGITYDR++IE+W+   K++TCPVTKQ LS   D  
Sbjct  9     DVDVPVHFLCPISLQLMRDPVTASTGITYDRESIERWLLVFKSSTCPVTKQPLSSDAD--  66

Query  1391  LTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTLR  1212
             LTPN  LRR+IQ+WCTL+A    ER PTPKPP+ K+ I+K+L  AK TP      LQ LR
Sbjct  67    LTPNHTLRRLIQAWCTLNA---FERIPTPKPPLDKAAIVKILDDAKKTPRARLACLQRLR  123

Query  1211  SMAPEN--AANKRCME--SAGVAEFLAQIIKTSEDN---------------PTDDALYVL  1089
             S+A E   A NK+C++  SAGV EFLA IIK  E                  +D+AL VL
Sbjct  124   SIALEGDGARNKKCLDQVSAGVVEFLASIIKNDESTLVEVIDSSDGTELARASDEALNVL  183

Query  1088  HNLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqlt  909
              +L +S + L+ ++ +D     SL RV++ GSY+SRAYA M+LKS  E       ++  +
Sbjct  184   CHLNVSGSDLKRLMIND-DLTGSLMRVLRSGSYQSRAYATMILKSAYEAADPIQLMNVGS  242

Query  908   ttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDT  729
                   FF ++V++L+D  S++ASK+AL LL  +C  GRNRIKA E GA  V+++LLLDT
Sbjct  243   E-----FFGELVRVLKDQISQQASKAALKLLVELCPWGRNRIKAVEGGAVPVLVELLLDT  297

Query  728   NE-----KRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRIL  564
             N      KR CE  L VL+ LC  AEGRAE++ H AGLAVV++K+LRVS  A++R +RIL
Sbjct  298   NSASADSKRACELILMVLDLLCGSAEGRAELVAHGAGLAVVAKKVLRVSHAASDRAVRIL  357

Query  563   YSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLP  384
              S+++FSA+  V+QEMLQ+G  AKLCLV+QVD G  + +ERA +IL+ H++ W++SPC+P
Sbjct  358   ASVSRFSASARVLQEMLQVGAVAKLCLVLQVDSG-SRTRERARDILRWHSRVWRSSPCVP  416

Query  383   LDLI  372
             L L+
Sbjct  417   LHLL  420



>ref|XP_010927379.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Elaeis guineensis]
Length=417

 Score =   387 bits (993),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 206/415 (50%), Positives = 286/415 (69%), Gaps = 29/415 (7%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M E+++P YFLCPISL+IM+DPVT+ TGITYDRD+IE+W+FSGK+ TCPVTKQ L   D 
Sbjct  1     MAEVEIPSYFLCPISLQIMRDPVTLPTGITYDRDSIERWMFSGKHDTCPVTKQHLPDCD-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WC L++S+ +ERFPTPKPP+ K+ I+KLL  A+  P +    L+ 
Sbjct  60    --LTPNHTLRRLIQAWCALNSSNDIERFPTPKPPIDKAQIIKLLDDAR-LPHLQLHSLRK  116

Query  1217  LRSMAPENAANKRCMES-AGVAEFLAQIIKT--------------SED----NPTDDALY  1095
             LR +  E+  N+RC+E+ +GV + L  II                S+D    N  D+AL 
Sbjct  117   LREIVSESERNRRCIETTSGVVDMLISIIHNNNSGTASGEEGKPISDDVESTNARDEALS  176

Query  1094  VLHNLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsq  915
             +L+ L LS+  L  +   +  F+ SLT ++Q  ++++RAYA +LLKSML           
Sbjct  177   ILYLLQLSDQQLLDLAVGNGDFVGSLTSILQQSNHQTRAYATLLLKSMLRVIAPARLAGV  236

Query  914   ltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLL  735
                      F +VV +LRD  S +A+K+AL +LA +C  GRN IKAA AGA  V+++LLL
Sbjct  237   RKE-----LFQEVVGVLRDRVSHQATKAALQVLAWLCPWGRNHIKAANAGAVRVLVELLL  291

Query  734   DTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSI  555
             D  E+R CE  L VL+++C CAEGRAE++ H AG+A+VS+K+LRVS+ A+ER ++IL S+
Sbjct  292   DEPERRVCELVLVVLDRVCGCAEGRAELVGHGAGIAIVSKKMLRVSEAASERAVKILNSV  351

Query  554   AKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPC  390
             A+FSAT +V+QEMLQ+GV +KLCLV+QVDCG+ K KE+A EIL+LH++ W  SPC
Sbjct  352   ARFSATKAVLQEMLQIGVVSKLCLVLQVDCGM-KTKEKAREILRLHSRVWNKSPC  405



>emb|CBI22781.3| unnamed protein product [Vitis vinifera]
Length=366

 Score =   384 bits (985),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 202/368 (55%), Positives = 255/368 (69%), Gaps = 52/368 (14%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             MEEI VPP+FLCPISLEIMKDPVT+STGITYDR++IEKW+FSGKN TCP TKQ LS   D
Sbjct  1     MEEIDVPPFFLCPISLEIMKDPVTVSTGITYDRESIEKWLFSGKNNTCPATKQVLSADSD  60

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WCTLHAS+G                         +P++  K +  
Sbjct  61    --LTPNHTLRRLIQAWCTLHASNG-------------------------SPQLQMKCIGK  93

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSEDNPTDDALYVLHNLGLSENGLRSILGHD  1038
             LR++A E+ ANKRC+ESA                    AL +LH L LSE GL+ ++G +
Sbjct  94    LRALAAESDANKRCIESA--------------------ALSILHYLLLSEAGLKKLVGKN  133

Query  1037  TQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQILRD  858
              +F+  L RV+Q G+YESRAYAVMLL SML+      +       L   FF + VQ+L+D
Sbjct  134   GEFVGCLVRVLQRGNYESRAYAVMLLSSMLQ-----VADPIQLIALKPEFFVEAVQVLQD  188

Query  857   NFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLSVLEQLC  678
             + S +A+K+ L LL  VC  GRN++KA EAGA +++ +LLL ++EKR CE  L+VL+QLC
Sbjct  189   HISHQATKATLKLLIEVCPWGRNKVKAVEAGAVSILTELLLASSEKRACEMILTVLDQLC  248

Query  677   RCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEMLQLGVG  498
              CAEGRAE+LKHAAG+A+VS+KILRVS VA+ER +RILYSI+KFSATPSV+QEM QLGV 
Sbjct  249   GCAEGRAELLKHAAGMAIVSKKILRVSHVASERAVRILYSISKFSATPSVLQEMSQLGVV  308

Query  497   AKLCLVIQ  474
             AKLCLV+Q
Sbjct  309   AKLCLVLQ  316



>ref|XP_008441961.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Cucumis melo]
Length=426

 Score =   385 bits (989),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 215/412 (52%), Positives = 284/412 (69%), Gaps = 28/412 (7%)
 Frame = -1

Query  1559  PPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEFLTPN  1380
             PPYFLCPISL+IMKDPVTI++GITYDR++IEKW+FS K+ TCPV+   LS  D   +TPN
Sbjct  14    PPYFLCPISLQIMKDPVTIASGITYDRESIEKWLFSDKHKTCPVSHIVLSDFD---VTPN  70

Query  1379  IILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTLRSMAP  1200
               LRRVIQ+WCT++AS GVER PTPKPPV +  ++++L  AK +P      L  LRS+A 
Sbjct  71    HTLRRVIQAWCTVNASKGVERIPTPKPPVDREQVVRILADAKLSPFSQKNCLCRLRSIAA  130

Query  1199  ENAANKRCMESAGVAEFLAQIIKTS--------ED--------NPTDDALYVLHNLGLSE  1068
              N +NKRCMESAGV EFLA ++  S        ED        N  D+AL +LH L +SE
Sbjct  131   ANESNKRCMESAGVVEFLAGVVCNSTTNMEYGLEDYAFDDMSANSADEALIILHKLQISE  190

Query  1067  NGLRSILGHDTQ-FIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlS  891
             + L+ +L ++   FI +LT+++Q+ SY SR+Y+VMLL SM E        +         
Sbjct  191   SSLKFLLSNNGGIFISTLTKILQNRSYSSRSYSVMLLNSMFEVADQIQIQNLTAD-----  245

Query  890   FFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLL---DTNEK  720
             FF +++QIL+D  S++ASKSAL LL  V    RNR+KA +AGA  V+IDLLL    +  K
Sbjct  246   FFIEIIQILKDQISKQASKSALKLLIAVSSSFRNRVKAVQAGAVPVLIDLLLDLDSSENK  305

Query  719   RYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSA  540
             R CE  L +L+QLC CA+GRAE+L HAAG+AVVS+KILR+S V +E+ + IL+SIA+FS 
Sbjct  306   RLCEMILVLLDQLCGCADGRAELLNHAAGIAVVSKKILRISTVGSEKAVGILWSIARFSG  365

Query  539   TPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLP  384
             + SVVQEM+++GV  KLC ++QV     K KE+A EILKLH + W+NS CLP
Sbjct  366   SQSVVQEMVRIGVVTKLCFLLQVVGAGVKAKEKAKEILKLHGRTWRNSSCLP  417



>ref|XP_009379827.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Musa acuminata 
subsp. malaccensis]
Length=399

 Score =   381 bits (979),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/396 (50%), Positives = 278/396 (70%), Gaps = 10/396 (3%)
 Frame = -1

Query  1568  IQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEFL  1389
             ++VP Y+LCPISL++M+DPVT++TGITYDR++IE+W+FSGK+  CPVTKQ L    D  L
Sbjct  5     LEVPEYYLCPISLQMMRDPVTVTTGITYDRESIERWLFSGKHRDCPVTKQPLPPELD--L  62

Query  1388  TPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTLRS  1209
             TPN  LRR+IQ+WC  HAS GVERFPTP+P V KS I  +L +    P+     LQ L+S
Sbjct  63    TPNHTLRRLIQAWCVEHASDGVERFPTPRPTVDKSQIAAILDEV-VIPQTRMSALQRLKS  121

Query  1208  MAPENAANKRCMESAGVAEFLAQIIKTSED-NPTDDALYVLHNLGLSENGLRSILGHDTQ  1032
             +  E+  N+R +E +G A+ L  II+  E+ N  D+AL +L +L +S   L  +L  +  
Sbjct  122   VVLESDRNRRFVEESGAADLLVSIIREQEECNDGDEALAILCSLQISGERLLDLLRRNDD  181

Query  1031  FIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQILRDNF  852
              I +LT ++   + +S+AYA++LLKS++   + +             FF  +V+ L+D  
Sbjct  182   LIGTLTSILSQRNDQSQAYALLLLKSLVPVMSPSKMSDLREE-----FFSGIVKGLQDKV  236

Query  851   SRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLSVLEQLCRC  672
             SR+A+K+AL +LA VC   RN++KA  AGA  V+I+LLL   E+R CE  L+VL+QLC C
Sbjct  237   SRQATKAALQILAGVCCCKRNKVKAVRAGAVFVLIELLLGETERRRCEMLLAVLDQLCGC  296

Query  671   AEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEMLQLGVGAK  492
             AEGRAEV+ HAAG++VVS+KILRVS++A+    RIL S+AK S +P V+QEMLQ+G  +K
Sbjct  297   AEGRAEVVAHAAGISVVSKKILRVSKLASAMSARILCSVAKLSPSPPVLQEMLQVGAVSK  356

Query  491   LCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLP  384
             LCL++QVDCGV + K++A EILKLH++ W++SPCLP
Sbjct  357   LCLLLQVDCGV-RLKDKAQEILKLHSRVWRSSPCLP  391



>ref|XP_009419493.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   382 bits (980),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 191/409 (47%), Positives = 287/409 (70%), Gaps = 22/409 (5%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             ME ++VP YFLCPISLE+M+DPVT++TGITYDRD+IE+WIF  K +TCP TKQ L   +D
Sbjct  1     MEGVEVPSYFLCPISLELMRDPVTLTTGITYDRDSIERWIFDRKQSTCPATKQPL---ED  57

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WCTL++S+GV+R PTP+PP+ K+ I KLL +A+  P+     L+ 
Sbjct  58    RELTPNHTLRRLIQAWCTLNSSNGVDRIPTPRPPIDKAQIAKLLEEAR-LPQFRLGSLRE  116

Query  1217  LRSMAPENAANKRCMESA-GVAEFLAQII-----------KTSEDNPTDDALYVLHNLGL  1074
             LR++  E+  N+RC+E+  GV +FLA +I            +   +  D+AL +L  L +
Sbjct  117   LRTIVSESDRNRRCVEATPGVVDFLASVIVNYGSEGETGDGSESASACDEALVLLQTLEI  176

Query  1073  SENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnl  894
             SE GL  +   +   ++SL+ +++  +Y+SR+ A+++L S+L            +  L  
Sbjct  177   SEEGLLDVFVKNGGIMESLSMILRRSNYQSRSNAMLILNSLL-----GVIPPARSIGLGG  231

Query  893   SFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRY  714
               F ++V ++RD  S++A+K+ALH L  +C  G++R+KA EAGA   +++LLL++ +KR 
Sbjct  232   ELFQEIVNVVRDRISQQATKAALHALLRLCLYGKSRVKAVEAGAVHALVELLLESPQKRV  291

Query  713   CEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATP  534
             CE  L+ L+ LC CA+GRAE+++H A +  VS+KILRVSQ+A+E+ +RIL+S+A+ SAT 
Sbjct  292   CELALAGLDWLCGCADGRAELVRHRAAIPAVSKKILRVSQLASEKAVRILHSVARHSATA  351

Query  533   SVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCL  387
             +V+QEM+ +GV +KLCLV+QV CG GK +E+A EILKLH++ WK+SPCL
Sbjct  352   AVLQEMMNVGVVSKLCLVLQVGCG-GKMEEKAREILKLHSRVWKDSPCL  399



>ref|XP_008793948.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Phoenix dactylifera]
Length=401

 Score =   381 bits (978),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 203/400 (51%), Positives = 271/400 (68%), Gaps = 31/400 (8%)
 Frame = -1

Query  1523  MKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEFLTPNIILRRVIQSWCT  1344
             M+DPVT+ TGITYDRD+IE+WIFSGK+ TCPVTKQ L   D   LTPN  LRR+IQ+WC 
Sbjct  1     MRDPVTLPTGITYDRDSIERWIFSGKHDTCPVTKQYLPDCD---LTPNHTLRRLIQAWCA  57

Query  1343  LHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTLRSMAPENAANKRCMESA  1164
             L++S+ +ERFPTPKPP+ K+ I KLL  A+  P +    L+ L+ +  E+  N+RC+E+A
Sbjct  58    LNSSNDIERFPTPKPPIDKAEIAKLLDDAR-LPHLQLGSLRKLKELVSESERNRRCVEAA  116

Query  1163  -GVAEFLAQIIKTSED--------------------NPTDDALYVLHNLGLSENGLRSIL  1047
              GV   LA II  S                      N  D+AL +L+ L LSE  L  + 
Sbjct  117   PGVVGILASIIDNSSSGTPSGDQDGILIGDDDVESTNARDEALSILYLLQLSEQHLLDLA  176

Query  1046  GHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQI  867
               +  FI+SLT +++  +Y SRAYA++LLKS+L               +    F  VV +
Sbjct  177   VRNGDFIESLTSILRQSNYRSRAYAILLLKSLL-----GVIAPAHLAGVREELFQDVVGV  231

Query  866   LRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLSVLE  687
             LRD  S +A+K+AL +LA +C  G NRIKAA AGA  V+++LLLD  E+R CE  L  L 
Sbjct  232   LRDRISHQANKAALQVLAGLCLWGSNRIKAANAGAVPVLVELLLDEPERRICELVLMALG  291

Query  686   QLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEMLQL  507
             ++C CAEGRAE++ HAAG+AVVS+KILRVS+VA+ERG++ILYS+A+FSAT +V+QEMLQ+
Sbjct  292   RVCGCAEGRAELVGHAAGIAVVSKKILRVSEVASERGVKILYSVARFSATTAVLQEMLQI  351

Query  506   GVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCL  387
             GV +KLCLV+Q DCG+ K KE+A EIL+LH++ WK SPCL
Sbjct  352   GVVSKLCLVLQFDCGM-KMKEKAREILRLHSRVWKKSPCL  390



>gb|KEH41880.1| E3 ubiquitin-protein ligase PUB23-like protein [Medicago truncatula]
Length=411

 Score =   380 bits (976),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 200/434 (46%), Positives = 283/434 (65%), Gaps = 65/434 (15%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             ++I+V P+FLCPISL++MKDPVT+STGITYDR++IEKW+FS +N TCPVTKQ L+   + 
Sbjct  3     QDIEVTPFFLCPISLQLMKDPVTVSTGITYDRESIEKWLFSSENKTCPVTKQQLTHDANH  62

Query  1394  F--LTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQ  1221
                LTPN  LRR+IQ+WCT+++S+G+ER PTPKPP TK+ I KLL++A  +P +L + L+
Sbjct  63    LIILTPNHTLRRLIQAWCTMNSSYGIERIPTPKPPTTKNLIEKLLKEASDSPHLLIQTLK  122

Query  1220  TLRSMAPENAANKRCMESAGVAEFLAQI-----------------IKTSEDN--------  1116
              L+++A E+  N+RC+ESAG  EFLA I                 I+ S D+        
Sbjct  123   KLKTIASESETNRRCIESAGAVEFLASIVTQNNTSCSSSCSATELIEASFDDDDVEGFAF  182

Query  1115  -----PTDDALYVLHNLGLSENGLRSILGH-DTQFIDSLTRVMQHGSYESRAYAVMLLKS  954
                    D+A+ +L+NL LSE GL+++L   + +FIDSL +++Q G+YESR YAV ++KS
Sbjct  183   DFKIGAEDEAINILYNLQLSEQGLKTLLNFKNGEFIDSLIKLLQKGNYESRTYAVYMMKS  242

Query  953   MLEtttlnpslsqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAA  774
             +        +       L   +F ++VQ+L+D  S+KASK+ L  L  + + GRNR+KA 
Sbjct  243   I-----SKVADPSKLANLKTEYFVELVQLLKDQISKKASKATLQTLIQLVEFGRNRVKAI  297

Query  773   EAGAATVVIDLLLDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQ  594
             E+G    +I+LLLD  E++ C                          LA+VS+KILRVS 
Sbjct  298   ESGCVYALIELLLDCKERKPC--------------------------LAIVSKKILRVST  331

Query  593   VANERGLRILYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHA  414
             +AN+R +RIL S+++FSAT  VVQEML++GV AKLCLV+QVD G  K KE+A EILKLH+
Sbjct  332   MANDRAVRILLSVSRFSATHFVVQEMLRIGVVAKLCLVLQVDSG-NKAKEKAREILKLHS  390

Query  413   KEWKNSPCLPLDLI  372
             K W NS C+P +L+
Sbjct  391   KSWMNSHCIPFNLL  404



>ref|XP_011089213.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Sesamum indicum]
Length=405

 Score =   380 bits (975),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 202/400 (51%), Positives = 280/400 (70%), Gaps = 16/400 (4%)
 Frame = -1

Query  1571  EIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIF-SGKNATCPVTKQALSGTDDE  1395
             EI++P YFLCPIS+++MKDPVT+STGITYDR+NIEKW+F S K  TCPVT+Q LS TD  
Sbjct  8     EIEIPCYFLCPISMQLMKDPVTVSTGITYDRENIEKWLFISCKKTTCPVTQQDLSATD--  65

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPN  LRR+IQ+WCTL+ +H  ER P+PK PV +S ILKLL QAK++P+     L+ L
Sbjct  66    -LTPNHTLRRLIQAWCTLN-TH--ERIPSPKTPVDRSLILKLLNQAKNSPKCRLSCLRRL  121

Query  1214  RSMAPENAANKRCMESAGVAEFLAQIIKTSEDNPT-DDALYVLHNLGLSENGLRSILGHD  1038
             RS+   N +++  + +AG  EFLA + K +ED  + D+AL VL  + LS++ LR +L  +
Sbjct  122   RSVVNRNESSRNHLRAAGAVEFLASVFKENEDPFSRDEALNVLRQIELSDSDLRKLLLEN  181

Query  1037  TQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQILRD  858
              +F++SL  V++ GS  SRA A++LLKS  +       +           F  +  IL D
Sbjct  182   DEFLESLIVVLETGSSHSRAQAIILLKSAFDVADPEYIIGSRPE-----LFRAITNILGD  236

Query  857   NF--SRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLSVLEQ  684
                 S +A+K+AL LL  +C  GRN++KA E+GA  V+I+LLL+T E+R CE  L+VL+Q
Sbjct  237   KIKISAQATKAALKLLVELCPWGRNKVKAVESGAVAVLIELLLETPERRACELALTVLDQ  296

Query  683   LCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEMLQLG  504
             LC CAEGR  +L+H  GLAVVS+KILRVSQ A+E+ +RIL SI+K+S    V++EM+++G
Sbjct  297   LCGCAEGRTALLRHGGGLAVVSKKILRVSQGASEKAVRILSSISKYSGNSRVLEEMMEVG  356

Query  503   VGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLP  384
             V +KLCLV+QV C   K KERA EIL+ H++ W++S C+P
Sbjct  357   VVSKLCLVLQVRCS-EKTKERAKEILRRHSRVWRDSACVP  395



>emb|CBI24432.3| unnamed protein product [Vitis vinifera]
Length=367

 Score =   378 bits (971),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 201/402 (50%), Positives = 267/402 (66%), Gaps = 41/402 (10%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M+EI VP +F+CPISL++M+DPVT++TGITYDR+NIE+W+FS KN TCP TKQ L  TD 
Sbjct  1     MDEIDVPSHFMCPISLQLMRDPVTVATGITYDRENIERWLFSCKNNTCPFTKQVLVDTD-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WC                      I+KLL  A   P+M  K LQ 
Sbjct  60    --LTPNHTLRRLIQAWCI---------------------IIKLLNDAIKFPQMQLKCLQR  96

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSEDNPTDDALYVLHNLGLSENGLRSILGHD  1038
             LRS+A E+  NK+C+E+AG           +    +D+AL +L+ L  SE  L+S++  +
Sbjct  97    LRSIAFESDRNKKCLEAAG-----------AFTRASDEALSILYQLETSEAALKSLVSSN  145

Query  1037  TQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQILRD  858
               FI+SL  V++ G+Y+SRAYA MLLKS+ +       ++          F ++V +LRD
Sbjct  146   YGFIESLVHVLKCGNYQSRAYAAMLLKSIFQVADPIQLINASPE-----LFTEIVHVLRD  200

Query  857   NFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLSVLEQLC  678
               S++ASK+AL LL  +C  GRNRIKA  AG + V+I+ LLDT+EKR CE  L VL+QLC
Sbjct  201   GISQQASKAALKLLVELCPWGRNRIKAVVAGVSHVLIEHLLDTSEKRTCELILVVLDQLC  260

Query  677   RCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEMLQLGVG  498
              CAEGRAE+LKH AGLA+VS+KILRVSQV  +R ++IL S++KFSAT  V+QEMLQ+GV 
Sbjct  261   SCAEGRAELLKHGAGLAIVSKKILRVSQVGTDRAVKILASVSKFSATSRVLQEMLQVGVV  320

Query  497   AKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             +KLCLV+QVD    K KE+  EIL LH++ WKN  C+P  L 
Sbjct  321   SKLCLVLQVDSS-KKTKEKTREILNLHSRVWKNPSCIPARLF  361



>ref|XP_009415651.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Musa acuminata 
subsp. malaccensis]
Length=414

 Score =   378 bits (970),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 201/413 (49%), Positives = 280/413 (68%), Gaps = 26/413 (6%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             ME  +VPPYFLCP+SLEIM+DPVT++TGITYDR+NIE+WIFS  +  CPVTKQ L   D 
Sbjct  1     MEGAEVPPYFLCPVSLEIMRDPVTLATGITYDRENIERWIFSHNHEICPVTKQPLPNLD-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               +TPN  LRR+IQ+WC  +AS+GVERFPTP+PPV  + I  LL +A+  P+     L  
Sbjct  60    --VTPNHTLRRLIQAWCAANASNGVERFPTPRPPVNMTRIAALLDEAR-LPQTQVTALGK  116

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSEDNPTD----------------DALYVLH  1086
             L+++  E+  N+RC+ES+G  + LA II+ S  N TD                +A  +L 
Sbjct  117   LKAIVAESDRNRRCVESSGAVDVLASIIEKSVSNSTDLEEEVCDGVGSSSATDEAFTILC  176

Query  1085  NLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltt  906
             +L LS+  L  +L  D   I+SLT+V++  SY SRAY+++LL+S+     L+        
Sbjct  177   SLQLSDKSLLGLLQRDDNVIESLTKVLERSSYPSRAYSLLLLESL-----LSVVAPARLL  231

Query  905   tlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTN  726
             +L    F ++ ++LRD  S +A+K+ALH L  VC  G+NR+KA +AGA  V+I+LLLD  
Sbjct  232   SLREELFRELTKVLRDQISYQATKAALHALGAVCPWGQNRLKAVQAGAVRVLIELLLDEP  291

Query  725   EKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKF  546
             EKR CE  L +L QLC CAEGRAE++ HAAG+AVVS+K+ RVSQ A+   ++ILY++AK 
Sbjct  292   EKRMCEMILGILHQLCTCAEGRAELIGHAAGIAVVSKKMHRVSQPASRMAVKILYTVAKS  351

Query  545   SATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCL  387
             S + +V+ EMLQ+G  +KLCL++Q+DC + K KE+   IL+LH+K W+NSPCL
Sbjct  352   SPSLAVLHEMLQVGAVSKLCLMLQMDCDM-KAKEKIQGILRLHSKVWRNSPCL  403



>ref|XP_009383562.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Musa acuminata 
subsp. malaccensis]
Length=420

 Score =   377 bits (969),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 201/416 (48%), Positives = 285/416 (69%), Gaps = 29/416 (7%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             ME ++VPPYFLCPISLEIM+DPVT+STGITYDR++IE+WIFS K+  CPVTKQAL+  D 
Sbjct  1     MEGVEVPPYFLCPISLEIMRDPVTLSTGITYDRESIERWIFSDKHEICPVTKQALTNLD-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               +TPN  LRR+IQ+WC+ +AS GVERFPTP+PPV  + I+ LL +AK  P+     L+ 
Sbjct  60    --VTPNHTLRRLIQAWCSANASDGVERFPTPRPPVDMTQIVALLDEAK-LPQTQMTALRR  116

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSEDNPT-------------------DDALY  1095
             L+++A E+  NKRC+E++G  + LA I++ S    T                   D+AL 
Sbjct  117   LKAIASESDRNKRCVEASGAVDVLASIMEKSIHGSTGVLEEELIVCDGLESASAPDEALA  176

Query  1094  VLHNLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsq  915
             +L +L LSE  L  ++  D  F++ LT+V+   SY  RAY+++LLKS+     ++     
Sbjct  177   ILCSLQLSEKSLLGLIHRDVNFVELLTKVLGRSSYRIRAYSLLLLKSL-----VSVIAPA  231

Query  914   ltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLL  735
                +L   FF ++ +++RD  S +A+K+AL +LA V   G NR+KA +AGA  V+I+ LL
Sbjct  232   RALSLREEFFEELAKVVRDEISHQATKAALQVLAAVSPWGNNRLKAVKAGAVRVLIEQLL  291

Query  734   DTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSI  555
             D  EKR CE  + +L QLC CAEGRAE+++HAAG+AVVS+KI RVS++ +   ++IL S+
Sbjct  292   DEPEKRTCEMIMVILCQLCGCAEGRAELVEHAAGIAVVSKKIHRVSRLVSRMAVKILCSV  351

Query  554   AKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCL  387
             AK S +P+V+QEMLQLG  +K+C V+Q+DC   + +ER  EIL+LH+K W+NSPCL
Sbjct  352   AKSSPSPAVLQEMLQLGAVSKMCYVLQMDCD-AQARERVREILRLHSKAWRNSPCL  406



>gb|KGN53961.1| hypothetical protein Csa_4G194780 [Cucumis sativus]
Length=424

 Score =   373 bits (958),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 210/416 (50%), Positives = 280/416 (67%), Gaps = 29/416 (7%)
 Frame = -1

Query  1559  PPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEFLTPN  1380
             PPYFLCPIS +IMKDPVT+++GITYDR++IEKW+ S K+ TCPV+   LS      +TPN
Sbjct  11    PPYFLCPISFQIMKDPVTVASGITYDRESIEKWLLSHKHNTCPVSHIVLSHFH---ITPN  67

Query  1379  IILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTLRSMAP  1200
               LRRVIQ+WCTL+AS GVER PTPKPPV +  ++++L  A  +P      L  LRS+A 
Sbjct  68    HTLRRVIQAWCTLNASKGVERIPTPKPPVDREQVVRILAHANLSPFSQKNSLCRLRSIAT  127

Query  1199  ENAANKRCMESAGVAEFLAQIIKTS---------ED--------NPTDDALYVLHNLGLS  1071
              N +NKRCMESAGV EFLA ++  +         ED        N  D+AL +LH L +S
Sbjct  128   ANESNKRCMESAGVVEFLAGVVCNNSTTNMEYGLEDYAFDDMSANSADEALLILHKLQVS  187

Query  1070  ENGLRSILGHDTQ-FIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnl  894
             E+ L+ +L ++   F+ +LT+++Q+ SY SR+Y+VMLL SM +        +        
Sbjct  188   ESSLKFLLSNNGGIFVSTLTKILQNRSYSSRSYSVMLLNSMFQVADQIQIQNLTAD----  243

Query  893   SFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLL---DTNE  723
              FF +++QIL+D  S++ASKSAL LL  V    RNR+KA +AGA  V+IDLLL    +  
Sbjct  244   -FFTEIIQILKDQISKQASKSALKLLIAVSSSFRNRVKAVQAGAVPVLIDLLLDLDSSEN  302

Query  722   KRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFS  543
             KR CE  L +L+ LC CA+GRAE+L HAAG+AVVS+KILRVS V +E+ + IL+S+AKFS
Sbjct  303   KRLCEMILVLLDLLCSCADGRAELLNHAAGIAVVSKKILRVSSVGSEKAVGILWSVAKFS  362

Query  542   ATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDL  375
              + SVVQEM+++GV  KLC V+QV     K KE+A EILKLH + W+NS CLP  L
Sbjct  363   GSQSVVQEMVRIGVVTKLCFVLQVVGAGVKAKEKAKEILKLHGRTWRNSSCLPSTL  418



>gb|ACU18170.1| unknown [Glycine max]
Length=385

 Score =   369 bits (948),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 203/390 (52%), Positives = 274/390 (70%), Gaps = 15/390 (4%)
 Frame = -1

Query  1523  MKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEFLTPNIILRRVIQSWCT  1344
             M+DPVT+ TGITYDR+NIE+W+FS KN TCPVTKQ L   D   LTPN  LRR+IQSWCT
Sbjct  1     MRDPVTVCTGITYDRENIERWLFSCKNNTCPVTKQCLLNHD---LTPNHTLRRLIQSWCT  57

Query  1343  LHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTLRSMAPENAANKRCMESA  1164
             L+AS GVER PTPK P+ ++ I+KLL +AK  PE   K L  LRS+A E   NK C+ESA
Sbjct  58    LNASLGVERIPTPKSPIDRTQIVKLLTEAKRFPEKQLKCLTRLRSIAFEGQRNKTCLESA  117

Query  1163  GVAEFLAQIIK---TSEDNP--TDDALYVLHNLGLSENGLRSILGHDT-QFIDSLTRVMQ  1002
             GV EFL   +K   T ED+   ++ A+ VL +L LSE  +++++ ++   FI+SL  V++
Sbjct  118   GVIEFLVSTMKSNNTQEDSTVLSEAAIEVLFHLNLSEARVKALINNEEFHFIESLFHVLR  177

Query  1001  HGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQILRDNFSRKASKSALH  822
              G+Y+SRA+A MLL+S  E       +S  T       F +++++LRD  S++ASK+AL 
Sbjct  178   LGNYQSRAFATMLLRSAFEVADPIQLISVKTA-----LFVEIMRVLRDQISQQASKAALK  232

Query  821   LLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKH  642
             L+  +   GRNRIK  E GA  V+++LLL  +E+R CE  L  L+QLC CAEGRAE+L H
Sbjct  233   LIVELFPWGRNRIKGVEGGAVLVLVELLLGASERRTCELILIALDQLCGCAEGRAELLNH  292

Query  641   AAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCG  462
              A +A+VS+KILRVS VA++RG+RIL SI ++SA   V+ EMLQ+G  +KLCLV+QV+C 
Sbjct  293   GAEVAIVSKKILRVSHVASDRGVRILASICRYSANARVLHEMLQVGAVSKLCLVLQVNCS  352

Query  461   VGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             + K KERA  IL+LH+  WKNSPC+P+ L+
Sbjct  353   L-KTKERAKAILQLHSVVWKNSPCIPVPLL  381



>gb|EPS70404.1| hypothetical protein M569_04358, partial [Genlisea aurea]
Length=406

 Score =   361 bits (926),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 198/422 (47%), Positives = 271/422 (64%), Gaps = 41/422 (10%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSG------KNATCPVTKQA  1416
             M EI+VPP+FLCPI+LEIM DPV +STGITY+ ++I KWI S       +NA CPVTK  
Sbjct  1     MAEIEVPPFFLCPITLEIMNDPVIVSTGITYESESILKWILSSSKKTRKRNAICPVTKLP  60

Query  1415  LSGTDDEFLTPNIILRRVIQSWCTLHASHGVERFPTPK-PPVTKSHILKLLRQAKSTP--  1245
             +S  D   LTPNIILR +IQSW    A + VE F  P   PV+KS +LKL  + ++ P  
Sbjct  61    ISAVD---LTPNIILRSMIQSWV---AVNHVEGFQKPSLGPVSKSQLLKLFNEGRNNPAG  114

Query  1244  EMLAKVLQTLRSMAPENAANKRCMESAGVAEFLAQII-----------KTSEDNPTDDAL  1098
             E   + L TLRS+A     N++ MESAG A FL  +I             +E+   ++AL
Sbjct  115   ETQIRCLSTLRSIASSGEGNRKSMESAGAAHFLESLIVRKALHLAGDEDAAENRVCEEAL  174

Query  1097  YVLHNLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpsls  918
              +L +L + E+ +      + +FI+SLT++M+ GS ESR+++ +LLKSM +         
Sbjct  175   AILCSLQIPESII------NVEFIESLTKIMKSGSKESRSHSAILLKSMFQVDPSVHLKP  228

Query  917   qltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLL  738
             +        FF Q+ +IL D  S KAS++AL +L  VC  GRNRI A EAG   ++IDLL
Sbjct  229   E--------FFRQLARILSDRISTKASRAALKILIAVCPLGRNRITAVEAGTVKILIDLL  280

Query  737   LDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYS  558
             +D ++ R CE  L+ L  LC+CA+GRA +++H  GLAVV RKILRVS V +ER + IL+S
Sbjct  281   IDCSDSRGCEIMLTALNLLCQCADGRAHLVEHDGGLAVVCRKILRVSHVGSERAVSILHS  340

Query  557   IAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLD  378
             ++K+S  P VV EMLQ+GV  KLC V+QVDCG  K +E+A EIL LH K W+NSPC+P++
Sbjct  341   VSKYSPAPPVVAEMLQIGVVEKLCTVLQVDCG-EKTREKAREILLLHGKAWRNSPCIPIN  399

Query  377   LI  372
             L+
Sbjct  400   LV  401



>ref|XP_006854618.1| hypothetical protein AMTR_s00030p00159240 [Amborella trichopoda]
 gb|ERN16085.1| hypothetical protein AMTR_s00030p00159240 [Amborella trichopoda]
Length=405

 Score =   360 bits (925),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 191/409 (47%), Positives = 275/409 (67%), Gaps = 17/409 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M+ I+VPPYFLCPISL+IM+DPVT+ TGI+YDR+++EKWI++ KN +CPVT Q LS   D
Sbjct  1     MDTIEVPPYFLCPISLQIMRDPVTVCTGISYDRESMEKWIYTYKNTSCPVTNQTLS---D  57

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
             + LTPN  LRR+IQ+WCT ++S+G+ERFPTPKPPV    + +LL  A+     L+  L+ 
Sbjct  58    QELTPNHTLRRLIQAWCTANSSNGIERFPTPKPPVCLERVNQLLAVARLNDPKLSS-LRE  116

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSEDN------PTDDALYVLHNLGLSENGLR  1056
             LR +A  +  N+R + SAG    +A +I   +D         ++AL ++H L + E+ ++
Sbjct  117   LRDLAIASEMNRRRIGSAGAIPVMAHLILGQKDRGDESMATIEEALSIIHVLQVLEDTVK  176

Query  1055  SILGHDT-QFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQ  879
             SI+  D   FIDSL+ V+ +GSY SR Y+V +LK++L+        S          F  
Sbjct  177   SIVASDNGAFIDSLSWVLLNGSYRSRLYSVSILKTVLKLVEPTIITSLKPE-----LFRA  231

Query  878   VVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGL  699
             +V+++ +  S +A+K  L +L  VC  GRNR+KA E GA  V+I +L+++ E+R  E  L
Sbjct  232   MVRVMNNQVSSQATKCVLQILMEVCSLGRNRVKACEEGAMPVIIQMLIESTERRERELLL  291

Query  698   SVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQE  519
              VL+ LC CAEGRAE+L+H AG+AVVS+KI RVS  A ER ++IL+S+ K+SAT  V+ E
Sbjct  292   GVLDLLCGCAEGRAELLRHGAGVAVVSKKIFRVSTTATERAVKILWSLCKYSATHGVLME  351

Query  518   MLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             ML +G  +KLC+V+Q DC   K KE+A E L++HAK WK+SPC+P  L+
Sbjct  352   MLNIGAVSKLCMVVQTDCSF-KAKEKAKEALRMHAKTWKSSPCVPSHLL  399



>ref|XP_004172550.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Cucumis sativus]
Length=389

 Score =   359 bits (922),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 190/404 (47%), Positives = 261/404 (65%), Gaps = 28/404 (7%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             E+I+VP YFLCPISL+IMKDPVT+ +GITYDR +IE W+FSGKN++CPVTK  +S +D +
Sbjct  3     EQIEVPHYFLCPISLQIMKDPVTLPSGITYDRHSIETWLFSGKNSSCPVTKLPVSDSDSD  62

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPN  LRR+IQ+WCTL++SHGVERFPTPKPP        L           +      
Sbjct  63    LLTPNHTLRRLIQAWCTLNSSHGVERFPTPKPPFINPKSFTLFPLPTLPLLPKSPPFAVS  122

Query  1214  RSMAPENAANKRCMESAGVAEFLAQIIKTSEDNPTDDALYVLHNLGLSENGLRSILGHDT  1035
                 P                   ++I  + ++P    L  LHNL LS++  +S L    
Sbjct  123   APFPPS-----------------LKLIADALNSPVRRTLSTLHNLRLSDSTFKS-LATRP  164

Query  1034  QFIDSLTRVM--QHGSYES-RAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQIL  864
             +F++SLT  M  Q G++ES R YAV++LKS++E                   F Q+V+IL
Sbjct  165   EFLESLTDFMKLQQGTHESSRTYAVLILKSIIEVAEPIQLSFLKPE-----LFVQIVEIL  219

Query  863   RD-NFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLSVLE  687
             +D + S++  K+AL +L  V   GRNR+KA EAG    ++++LL + EKR CE  L+ ++
Sbjct  220   KDRSSSQQIFKAALGILIAVSPLGRNRLKAVEAGGVRALVEILLSSPEKRVCEMTLTAMD  279

Query  686   QLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEMLQL  507
              LC CA+GRA +L H  G+AVVS+KILRVSQ+ +ER +RILYS+AKFS +P+V+ EM QL
Sbjct  280   ILCGCADGRAALLAHGGGMAVVSKKILRVSQLGSERAVRILYSVAKFSGSPAVLMEMAQL  339

Query  506   GVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDL  375
             G+ AKLCLV+Q++ G GK KE+A EILK+H++ WKNSPC+P  L
Sbjct  340   GIVAKLCLVLQIENG-GKTKEKAKEILKMHSRLWKNSPCIPSKL  382



>ref|XP_007132500.1| hypothetical protein PHAVU_011G099400g [Phaseolus vulgaris]
 gb|ESW04494.1| hypothetical protein PHAVU_011G099400g [Phaseolus vulgaris]
Length=399

 Score =   359 bits (922),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 195/404 (48%), Positives = 280/404 (69%), Gaps = 11/404 (3%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKN-ATCPVTKQALSGTD  1401
             MEE++VP  FLCP+SL++M+DPVT+ TGITYDR+NIE+W+FS KN  TCPVT+Q+LS TD
Sbjct  1     MEEMEVPALFLCPVSLQLMRDPVTVCTGITYDRENIERWLFSCKNNKTCPVTRQSLSHTD  60

Query  1400  DEFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQ  1221
                LTPN  L+R+IQ+WC  +A  G+E F +PK  + ++ I+KLL +AK  PE     L 
Sbjct  61    ---LTPNHTLQRLIQAWCIHNAWLGLETFSSPKTTIDQTQIVKLLLEAKKFPEKQLNCLS  117

Query  1220  TLRSMAPENAANKRCMESAGVAEFLAQIIKTSEDNPTDDALYVLHNLGLSENGLRSILGH  1041
              L+ +A E+ +NK C+ESAG  +FLA  +  +    ++ A+ V+ +L  SE+ L++++ +
Sbjct  118   RLQYIAFESESNKICLESAGAIDFLASTMMINSTVMSEAAIEVMFHLNPSESQLKNLMNN  177

Query  1040  D-TQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQIL  864
             + TQF+ SL  V++ G+ +SR Y  +LLKS  +  +     +          F +++++L
Sbjct  178   EGTQFVVSLLHVLKLGNCQSRGYTTLLLKSAFKVASPTQLNNVTAE-----VFVEIIRVL  232

Query  863   RDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLSVLEQ  684
             RD  S +ASK+AL LL  +C  GRN+IKA E G   V+++LLLD +E+R CE  L  LE+
Sbjct  233   RDQISVEASKAALKLLVELCSWGRNKIKAVECGGVLVLVELLLDVSERRACELMLIALEK  292

Query  683   LCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEMLQLG  504
             LC CAEGRAE++ H AG+AVV++KILRVS VA++RG++IL SI + SATP V+ EML LG
Sbjct  293   LCGCAEGRAELVNHGAGVAVVAKKILRVSPVASDRGVKILTSICRHSATPRVLHEMLLLG  352

Query  503   VGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
               +KLCLV+QV+ G  K KERA E LKLH+  W+NS C+P  L+
Sbjct  353   AVSKLCLVLQVE-GCFKAKERARETLKLHSLVWRNSTCIPAPLL  395



>ref|XP_009399190.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Musa acuminata 
subsp. malaccensis]
Length=408

 Score =   345 bits (886),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 181/407 (44%), Positives = 269/407 (66%), Gaps = 20/407 (5%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             ME +++P YFLCPISLEIM+DPVT+ TGIT+DRD+IE+WI   K++TCPVT++ L   + 
Sbjct  1     MEPLEIPCYFLCPISLEIMRDPVTLPTGITFDRDSIERWILDAKHSTCPVTRRPLPDCE-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  L R+IQ+WC LH+  GVE FPTP+ PV K  I +LL +A   P+     L+ 
Sbjct  60    --LTPNHTLPRLIQAWCALHSPSGVEMFPTPRTPVGKRQIAELL-EAAMAPQSRLTSLRK  116

Query  1217  LRSMAPENAANKRCMESA-GVAEFLAQIIKTSEDNPTDD---------ALYVLHNLGLSE  1068
             L+++  E+  NKR +E+  GV +F A +I     N  +D         AL +L  L +S+
Sbjct  117   LKAVVSESHRNKRYVETTPGVIDFAAFVIVNYASNSVEDEEETRACDEALIILQTLEISQ  176

Query  1067  NGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSF  888
              GL  +L  +   I+SLT +++  + +SR+YA +LL+S+L            +  L+   
Sbjct  177   EGLLDLLAKNANIIESLTTILRRSNGQSRSYATLLLRSLL-----GVFSPARSIGLHAEL  231

Query  887   FHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCE  708
             F ++V +LRD  S +A+K+ALH L  +C  G NR KA EAGA  V+++LLL+  E+R  E
Sbjct  232   FQEMVNVLRDRISHQATKAALHALVRLCPWGTNRTKAVEAGAVHVLVELLLEDPERRVTE  291

Query  707   WGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSV  528
               L+ L++LC CAEGR E+++H A +  VS+KIL+VSQ+A+E+ +RIL+++A+ S    +
Sbjct  292   LVLAALDRLCGCAEGRTELVRHRAAIPAVSKKILQVSQLASEKAVRILHTLARHSPAAEL  351

Query  527   VQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCL  387
             ++EMLQLGV  KLCLV++V CG GK +E+A +IL+LH++ W +S CL
Sbjct  352   LEEMLQLGVVTKLCLVLRVGCG-GKTEEKARQILRLHSRVWMHSLCL  397



>ref|XP_002453950.1| hypothetical protein SORBIDRAFT_04g022070 [Sorghum bicolor]
 gb|EES06926.1| hypothetical protein SORBIDRAFT_04g022070 [Sorghum bicolor]
Length=418

 Score =   334 bits (857),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 184/408 (45%), Positives = 268/408 (66%), Gaps = 25/408 (6%)
 Frame = -1

Query  1565  QVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEFLT  1386
             +VP YFLCPISLE+M+DPVT++TGITYDR +IE+W+F+  +ATCPVT++AL+  + +  T
Sbjct  11    EVPHYFLCPISLEVMRDPVTLATGITYDRASIERWLFADGHATCPVTRRALAPAEMDA-T  69

Query  1385  PNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPE-MLAKVLQTLRS  1209
             PN  LRR+IQ+WC   A+H VERFPTP+PP+    +  LL + +   +   A  L+ +++
Sbjct  70    PNHTLRRLIQAWC---AAHQVERFPTPRPPLDSCRVAALLDEGRHGGDRQAAAALREIKA  126

Query  1208  MAPENAANKRCMESA-GVAEFLAQIIK-------TSEDNPTDD------ALYVLHNLGLS  1071
             +  E+  N+RC+E+  G  +FLA ++        +S+ +  DD      AL VL++L  S
Sbjct  127   VVAESERNRRCVEATPGAVDFLASLVAKHSSKRASSQQDAADDFLAGGDALGVLYSLKPS  186

Query  1070  ENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlS  891
             E  L  IL  D  F+D+L  V++  SY SRAY ++LLK+M              TT++  
Sbjct  187   ERSLAQILERDGDFLDTLACVLRRPSYRSRAYGILLLKAM-----TAVMTPARLTTVSAD  241

Query  890   FFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYC  711
                +VV+++ D  S KA ++ALH+L  +C  GRNR+KA EAGA   +++LLLD   +R  
Sbjct  242   LVQEVVRVVSDRVSSKAVRAALHVLCRLCPWGRNRVKAVEAGAMAALVELLLDAGGRRVT  301

Query  710   EWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPS  531
             E  +  ++ LC CAEGR+E++ H AGLAVVS+K++RVS  A E  +R L+++A+ S TPS
Sbjct  302   ELAVVAIDHLCGCAEGRSELVAHPAGLAVVSKKVMRVSTAATESAVRALHAVARHSPTPS  361

Query  530   VVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCL  387
             V+QEML +GV AKL LV+QV+ G  +   RA EILK HA+ WK+SPCL
Sbjct  362   VLQEMLAVGVVAKLLLVLQVNAG-ERAGLRAKEILKTHARVWKDSPCL  408



>ref|XP_004952676.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Setaria italica]
Length=428

 Score =   335 bits (858),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 184/419 (44%), Positives = 267/419 (64%), Gaps = 38/419 (9%)
 Frame = -1

Query  1565  QVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEFLT  1386
             +VP YFLCPISLE+M+DPVT++TGITYDR +IE+W+F+  +ATCPVT++AL+  + +  T
Sbjct  13    EVPHYFLCPISLEVMRDPVTLATGITYDRASIERWLFTDGHATCPVTRRALAPEEMDA-T  71

Query  1385  PNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTLRSM  1206
             PN  LRR+IQ+WC   A+H VERFPTP+PP+    +  LL + +   E  A  L+ +++ 
Sbjct  72    PNHTLRRLIQAWC---AAHQVERFPTPRPPLDSCRVAALLDEGRHGRE--AAALREIKAA  126

Query  1205  APENAANKRCMESA-GVAEFLAQIIK-------------------------TSEDNPTDD  1104
             A E+  N+RC+E+  G  EFL  ++                          TS  +P +D
Sbjct  127   AAESDRNRRCVEATPGAVEFLVSVVTKHSSAISTSKSFSKRADDEFLLESPTSTSSPAED  186

Query  1103  ALYVLHNLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnps  924
             AL VL++L  SE  L  IL  + +F+++LT V++  SY SR Y ++LLK+M+        
Sbjct  187   ALSVLYSLKPSERSLTQILEREPEFLNTLTYVLRRPSYRSRTYGILLLKAMV-----AAM  241

Query  923   lsqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVID  744
                   T++     +VV+++ D  S KA K+ALH+L  +C  GRNR+KA EAGA   +++
Sbjct  242   EPARLATVSAGLVQEVVRVVSDRVSSKAVKAALHVLCRLCPWGRNRVKAVEAGAVAALVE  301

Query  743   LLLDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRIL  564
             LLLD   +R  E  +  ++ LC CAEGR+E++ H AGLAVVS+K +RVS  A E  +R L
Sbjct  302   LLLDEGGRRVTELAVVAIDHLCGCAEGRSELVAHPAGLAVVSKKAMRVSLAATESTVRAL  361

Query  563   YSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCL  387
             +++A+ S TP+V+QEML +GV AKL LV+QVD    K + RA E+LK HA+ WK+SPCL
Sbjct  362   HAVARHSPTPAVLQEMLAVGVVAKLMLVLQVDAN-EKARLRAKEMLKAHARVWKDSPCL  419



>ref|XP_002453951.1| hypothetical protein SORBIDRAFT_04g022080 [Sorghum bicolor]
 gb|EES06927.1| hypothetical protein SORBIDRAFT_04g022080 [Sorghum bicolor]
Length=424

 Score =   333 bits (855),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 182/420 (43%), Positives = 269/420 (64%), Gaps = 34/420 (8%)
 Frame = -1

Query  1565  QVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEFLT  1386
             +VP YFLCPISLE+M+DPVT++TGITYDR +IE+W+F+  +ATCPVT++AL+  + +  T
Sbjct  11    EVPHYFLCPISLEVMRDPVTLATGITYDRASIERWLFADGHATCPVTRRALAPAEMDA-T  69

Query  1385  PNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPE-MLAKVLQTLRS  1209
             PN  LRR+IQ+WC   A+H VERFPTP+PP+    +  LL + +   +   A  L+ +++
Sbjct  70    PNHTLRRLIQAWC---AAHQVERFPTPRPPLDSCRVAALLDEGRHGGDRQAAAALREIKA  126

Query  1208  MAPENAANKRCMESA-GVAEFLAQIIK----------------------TSEDNPTDDAL  1098
             +  E+  N+RC+E+  G  +FLA ++                       TS  +P +DAL
Sbjct  127   VVAESERNRRCVEATPGAVDFLASLVAKHSSKRASSQQDAADDFVLDSPTSTSSPAEDAL  186

Query  1097  YVLHNLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpsls  918
              VL++L  SE  L  IL  D  F+D+L  V++  SY SRAY ++LLK++           
Sbjct  187   GVLYSLKPSERSLAQILERDADFLDTLACVLRRPSYRSRAYGILLLKAI-----TAVMTP  241

Query  917   qltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLL  738
                 T++     +VV+++ D  S KA ++ALH+L  +C  GRNR+KA EAGA   +++LL
Sbjct  242   ARLMTVSADLVQEVVRVVSDRVSSKAVRAALHVLCRLCPWGRNRVKAVEAGAVATLVELL  301

Query  737   LDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYS  558
             LD   +R  E  +  ++ LC CAEGR+E++ H AGLAVVS+K++RVS VA E  +R L++
Sbjct  302   LDEGGRRVTELAVVAIDHLCGCAEGRSELVAHPAGLAVVSKKVMRVSVVATESAVRALHA  361

Query  557   IAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLD  378
             +A+ S TPSV+Q+ML +GV AKL LV+QV+ G  +   RA ++LK HA+ WK+SPCL  D
Sbjct  362   VARHSPTPSVLQDMLAVGVVAKLLLVLQVNAG-DRAGIRAKDMLKTHARVWKDSPCLQRD  420



>ref|XP_008799744.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Phoenix dactylifera]
Length=404

 Score =   331 bits (848),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 177/409 (43%), Positives = 264/409 (65%), Gaps = 16/409 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M+ I+VP Y++CPISL+IM+DPVT  TGITYDR++IE+W+F     TCPVTKQ +    D
Sbjct  1     MDSIEVPQYYICPISLQIMRDPVTAITGITYDRESIERWLFLDNKMTCPVTKQPIPKDSD  60

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WCT +AS+GV+R PTP+ P+ K  +L+LL      P +    L+ 
Sbjct  61    --LTPNHSLRRLIQAWCTANASNGVDRIPTPRAPIDKPGVLELLDNLL-VPRLQLDSLRL  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQII----KTSEDNPTDDALYVLHNLGLSENGLRSI  1050
             + ++  E+  N+RCM  +G A  L Q+I    K ++ N  + AL V+ +L +    L+ +
Sbjct  118   IAALVSESECNRRCMVQSGAANSLIQLIISCSKNNQINHIEVALSVVRSLRVPPEDLKPL  177

Query  1049  LGHDTQFIDSLTRVMQH--GSYES-RAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQ  879
             +  +   I+SLT V++H  GS+   R+  +++LKS++E  + +             FF  
Sbjct  178   VTDNHDLIESLTWVLRHDSGSHRGIRSATILVLKSIIEAASSSLRARLKLD-----FFQA  232

Query  878   VVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGL  699
             V   +RD  S++A+K+ALH+L + C  GRNR K  EAGA + +I+L L   +KR  E  L
Sbjct  233   VTLAIRDRISQQATKAALHVLLHACSWGRNRTKIIEAGALSEIIELELSFPDKRTTELNL  292

Query  698   SVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQE  519
             +VL+QLC CA GRAE++ HAAG+AV+S++ILRVS VA++  +RIL S+ K SAT  V+QE
Sbjct  293   AVLDQLCSCAGGRAELVGHAAGIAVISKRILRVSPVADDWAVRILSSVCKHSATKEVLQE  352

Query  518   MLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             ML++G  +KLC V+Q DC     KE+A  +L+ H+  WK+SPC+   ++
Sbjct  353   MLRVGAVSKLCFVLQADCS-SSVKEKARWVLRSHSGVWKDSPCINFQML  400



>ref|XP_004147551.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Cucumis sativus]
Length=393

 Score =   328 bits (840),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 194/398 (49%), Positives = 259/398 (65%), Gaps = 30/398 (8%)
 Frame = -1

Query  1559  PPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEFLTPN  1380
             PPYFLCPIS +IMKDPVT+++GITYDR++IEKW+ S K+ TCPV+   LS      +TPN
Sbjct  11    PPYFLCPISFQIMKDPVTVASGITYDRESIEKWLLSHKHNTCPVSHIVLSHFH---ITPN  67

Query  1379  IILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL-RSMA  1203
               LRRVIQ+WCTL+AS GVER PTPKPPV +              E+L      L R M 
Sbjct  68    HTLRRVIQAWCTLNASKGVERIPTPKPPVDR--------------EILFVAFDLLLRQMK  113

Query  1202  PENAA-NKRCMESAGVAEFLAQIIKTSEDNPTDDALYVLHNLGLSENGLRSILGHDTQ-F  1029
               N A N   + S+ +  + A        N  D+AL +LH L +SE+ L+ +L ++   F
Sbjct  114   VINVAWNLLELWSSWLGLYYA--FDDMSANSADEALLILHKLQVSESSLKFLLSNNGGIF  171

Query  1028  IDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQILRDNFS  849
             + +LT+++Q+ SY SR+Y+VMLL SM +        +         FF +++QIL+D  S
Sbjct  172   VSTLTKILQNRSYSSRSYSVMLLNSMFQVADQIQIQNLTAD-----FFTEIIQILKDQIS  226

Query  848   RKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLL---DTNEKRYCEWGLSVLEQLC  678
             ++ASKSAL LL  V    RNR+KA +AGA  V+IDLLL    +  KR CE  L +L+ LC
Sbjct  227   KQASKSALKLLIAVSSSFRNRVKAVQAGAVPVLIDLLLDLDSSENKRLCEMILVLLDLLC  286

Query  677   RCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEMLQLGVG  498
              CA+GRAE+L HAAG+AVVS+KILRVS V +E+ + IL+S+AKFS + SVVQEM+++GV 
Sbjct  287   SCADGRAELLNHAAGIAVVSKKILRVSSVGSEKAVGILWSVAKFSGSQSVVQEMVRIGVV  346

Query  497   AKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLP  384
              KLC V+QV     K KE+A EILKLH + W+NS CLP
Sbjct  347   TKLCFVLQVVGAGVKAKEKAKEILKLHGRTWRNSSCLP  384



>ref|XP_004163666.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Cucumis sativus]
Length=393

 Score =   328 bits (840),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 195/398 (49%), Positives = 258/398 (65%), Gaps = 30/398 (8%)
 Frame = -1

Query  1559  PPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEFLTPN  1380
             PPYFLCPIS +IMKDPVT+++GITYDR++IEKW+ S K+ TCPV+   LS      +TPN
Sbjct  11    PPYFLCPISFQIMKDPVTVASGITYDRESIEKWLLSHKHNTCPVSHIVLSHFH---ITPN  67

Query  1379  IILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL-RSMA  1203
               LRRVIQ+WCTL+AS GVER PTPKPPV +              E+L      L R M 
Sbjct  68    HTLRRVIQAWCTLNASKGVERIPTPKPPVDR--------------EILFVAFDLLLRQMK  113

Query  1202  PENAA-NKRCMESAGVAEFLAQIIKTSEDNPTDDALYVLHNLGLSENGLRSILGHDTQ-F  1029
               N A N   + S+ +  + A        N  D+AL +LH L +SE  L+ +L ++   F
Sbjct  114   VINVAWNLLELWSSWLGLYYA--FDDMSANSADEALLILHKLQVSEPSLKFLLSNNGGIF  171

Query  1028  IDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQILRDNFS  849
             + +LT+++Q+ SY SR+Y+VMLL SM E        +         FF +++QIL+D  S
Sbjct  172   VSTLTKILQNRSYSSRSYSVMLLNSMFEVADQIQIQNLTAD-----FFTEIIQILKDQIS  226

Query  848   RKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLL---DTNEKRYCEWGLSVLEQLC  678
             ++ASKSAL LL  V    RNR+KA +AGA  V+IDLLL    +  KR CE  L +L+ LC
Sbjct  227   KQASKSALKLLIAVSSSFRNRVKAVQAGAVPVLIDLLLDLDSSENKRLCEMILVLLDLLC  286

Query  677   RCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEMLQLGVG  498
              CA+GRAE+L HAAG+AVVS+KILRVS V +E+ + IL+S+AKFS + SVVQEM+++GV 
Sbjct  287   SCADGRAELLNHAAGIAVVSKKILRVSSVGSEKAVGILWSVAKFSGSQSVVQEMVRIGVV  346

Query  497   AKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLP  384
              KLC V+QV     K KE+A EILKLH + W+NS CLP
Sbjct  347   TKLCFVLQVVGAGVKAKEKAKEILKLHGRTWRNSSCLP  384



>ref|XP_009383555.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Musa acuminata 
subsp. malaccensis]
Length=404

 Score =   328 bits (841),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 174/404 (43%), Positives = 255/404 (63%), Gaps = 16/404 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M+ ++VP YF CPISL+IM DPVT  TG+TYDR++IE+W+    +  CPVTKQ L    D
Sbjct  1     MDSVEVPQYFTCPISLQIMTDPVTTITGMTYDRESIERWLLVDDHPMCPVTKQPLPRDSD  60

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WC ++AS GVER PTP+ PV    I KL+    S P +    L  
Sbjct  61    --LTPNHTLRRLIQAWCVVNASRGVERIPTPRAPVDGPGIRKLV-HGLSAPRLQLDSLNL  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSED----NPTDDALYVLHNLGLSENGLRSI  1050
             + ++A EN +N+RCM   GVA  +  +I T  +    +  D AL VL +L  S + L+ I
Sbjct  118   IAALARENESNRRCMLQYGVAGAMVDVINTCTERKQMDRIDVALGVLDSLRASPDDLKPI  177

Query  1049  LGHDTQFIDSLTRVMQHGSYESR---AYAVMLLKSMLEtttlnpslsqltttlnlSFFHQ  879
             +  D + IDS+T ++ HG+ + R   + A+++LKS++E                  FF  
Sbjct  178   VDGDRRIIDSMTWILHHGAGDDRDVRSTAIVVLKSVIEAADSRVLEQLTPD-----FFQA  232

Query  878   VVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGL  699
             V+ ++RD  S++ +K+AL +L +    GRNRIK  EAG    +++L L   +KR  E  L
Sbjct  233   VLSLVRDRISQRGTKAALQVLLHAAAWGRNRIKIVEAGGVKEIVELELTAPDKRTTEINL  292

Query  698   SVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQE  519
              +L QLC  A+GRAE++ HAA +A VS++ILRVS +A+++G+RIL+S+ ++SAT  V+QE
Sbjct  293   GLLNQLCTTADGRAELVGHAASIATVSKRILRVSSLADDQGVRILWSLCRYSATTEVLQE  352

Query  518   MLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCL  387
             M+ LG  +KLCLV+Q +C     KE+A  +L+LH+  WK+SPCL
Sbjct  353   MMSLGAVSKLCLVLQANCP-DSVKEKARLVLRLHSGVWKDSPCL  395



>ref|XP_003575089.1| PREDICTED: E3 ubiquitin-protein ligase PUB23 [Brachypodium distachyon]
Length=429

 Score =   328 bits (842),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 178/425 (42%), Positives = 269/425 (63%), Gaps = 42/425 (10%)
 Frame = -1

Query  1571  EIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGK-----NATCPVTKQALSG  1407
             ++ VPPYFLCPISLEIM+DPVT++TGITYDR +IE+W+F        +ATCPVT+Q L+ 
Sbjct  7     QVDVPPYFLCPISLEIMRDPVTLATGITYDRGSIERWLFDKAAGGQGHATCPVTRQKLA-  65

Query  1406  TDDEFL--TPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLA  1233
             T DE +  TPN  LRR+IQ+WC +HA   VERFPTP+PPV    +  L+ + +   E+ A
Sbjct  66    TADELVEATPNHTLRRLIQAWCAMHA---VERFPTPRPPVDACRVAALVDEGRHQ-ELAA  121

Query  1232  KVLQTLRSMAPENAANKRCMESA-GVAEFLAQIIK---------------------TSED  1119
               L+ L+++A E+  N+R +ES  G  +FL  ++K                     +   
Sbjct  122   --LRELKAIAAESDRNRRLVESTPGALDFLVSVVKNHVGATALTSNKSAQDLLELDSPRS  179

Query  1118  NPTDDALYVLHNLGLSENGLRSILGHDTQFIDS-LTRVMQHGSYESRAYAVMLLKSMLEt  942
             +P +DAL V+++L  S+  L  I+  ++ F+D+ L  V++  SY+SR Y ++LLKS++  
Sbjct  180   SPAEDALGVIYSLKPSKKSLARIIESNSDFLDTTLVSVLRRPSYQSRTYGILLLKSLVSA  239

Query  941   ttlnpslsqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGA  762
                   ++  +         + V+++ D  S KA K+AL +L  VC  GRNR+KA EAGA
Sbjct  240   MEPAQLMALRSEA----LLVEAVRVVSDRVSTKAVKAALQVLCRVCPWGRNRVKAVEAGA  295

Query  761   ATVVIDLLLDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANE  582
              T +++LLLD   +   E  ++ ++ LC CAEGR+E++ H AGLAVV++K +RVS  A E
Sbjct  296   VTALVELLLDEGSRHPTELAVAAIDHLCGCAEGRSELVAHPAGLAVVAKKAMRVSLAATE  355

Query  581   RGLRILYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWK  402
               +R ++++A+ S T +V+QEML +GV AKL LV+QVD G  + + +A E+L+ HA+ WK
Sbjct  356   SAVRAIHAVARHSPTAAVLQEMLAVGVVAKLLLVLQVDAG-ERARAKAKELLRAHARVWK  414

Query  401   NSPCL  387
             +SPCL
Sbjct  415   DSPCL  419



>ref|XP_010931057.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Elaeis guineensis]
Length=426

 Score =   327 bits (839),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 177/409 (43%), Positives = 262/409 (64%), Gaps = 16/409 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M+ I+VP Y++CPISL+IMKDPVT  TGITYDR++IE+W+F   N TCPVTKQ L    D
Sbjct  23    MDSIEVPQYYICPISLQIMKDPVTAITGITYDRESIERWLFIDNNMTCPVTKQPLPKDSD  82

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WCT +AS+G++R PTP+ P+ K  +L+LL      P +    L+ 
Sbjct  83    --LTPNHSLRRLIQAWCTANASNGIDRIPTPRAPIDKPGVLQLLDNLL-VPHLQLNSLKL  139

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQ-IIKTSEDNPTD---DALYVLHNLGLSENGLRSI  1050
             + ++A E+  N+RCM  +G    L Q II  S +N  +    AL  +H+L +    L+  
Sbjct  140   IAALASESECNRRCMVQSGATSSLIQSIISCSNNNQINLIEVALSAIHSLRVPPEDLKPT  199

Query  1049  LGHDTQFIDSLTRVMQHGSYES---RAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQ  879
             +  +   I+SLT V+ H S +    R+  ++ LKS++E T+ +             FF  
Sbjct  200   VTDNHDLIESLTWVLLHDSGDHCHIRSATLVFLKSVIEVTSSSLRERLKLD-----FFRA  254

Query  878   VVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGL  699
             +   +RD  S++A+K+AL +L + C  GRNR K  EAGA + +I+L L  ++KR  E  L
Sbjct  255   LTLAIRDRISQQATKAALQVLWHACSWGRNRTKIIEAGALSEIIELELAFSDKRTTELNL  314

Query  698   SVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQE  519
             ++L+QLC CA GRAE++ HAAG+AV+S++ILRVS VA++R +RIL S+ ++SAT  V+QE
Sbjct  315   AILDQLCACAGGRAELVGHAAGIAVISKRILRVSPVADDRAVRILSSVCRYSATKEVLQE  374

Query  518   MLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             ML++G  +KLC V+Q DC     K +A  +L+ H+  WK+SPC+   L+
Sbjct  375   MLRVGAVSKLCFVLQADCS-SSVKGKARWVLRSHSGVWKDSPCINFQLL  422



>ref|XP_010685445.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Beta vulgaris 
subsp. vulgaris]
Length=442

 Score =   327 bits (837),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 187/443 (42%), Positives = 277/443 (63%), Gaps = 50/443 (11%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQAL-----  1413
             +  I++P +F+CPISL++M+DPVTISTGITYDR++IEKW+F+ KN  CPVTKQ L     
Sbjct  3     VHNIEIPSHFVCPISLQLMRDPVTISTGITYDRESIEKWLFTCKNTICPVTKQPLINSFS  62

Query  1412  -------------SGTDDEF---LTPNIILRRVIQSWCTLHASHGVERFPTPKPP--VTK  1287
                          +  DD+    +TPN  LRR+IQSWC LHAS GVER PTPK P  VT+
Sbjct  63    SSSSLDNNHHHDSTDNDDDLTMMITPNHTLRRLIQSWCILHASDGVERIPTPKQPPRVTR  122

Query  1286  SHILKLLRQAKSTPE-MLAKVLQTLRSMAPENAANKRCMESAGVAEFLAQIIKTSEDNPT  1110
             S+I KL+  AK +P+ M    L  +R+M   ++  K+ +E++G  E++  ++  ++D+ T
Sbjct  123   SNICKLISDAKKSPQTMRYTCLLRIRAMI-SHSRTKKLLEASGGFEYVVSVL--TDDDTT  179

Query  1109  ----DDALYVLHNLGLSENGLRSIL----GHDTQFIDSLTRVMQHGSY--------ESRA  978
                 ++AL +L  +   +   + ++     H   FIDSL  ++ +           E R 
Sbjct  180   RREKEEALSILAQIEGCDQEFKGVIFKNDDHAMLFIDSLLGLLHNNGKNNNGSSCNEERE  239

Query  977   YAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQG  798
              A+ +L+ +          S          F+++V +LRD+ S  A+K+AL LL  +   
Sbjct  240   NAIKVLRLVYSVADPTHMGSVKCE-----MFNEIVCVLRDHISNMATKNALKLLIELNPW  294

Query  797   GRNRIKAAEAGAATVVIDLLLDTN-EKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVV  621
             GRNR+KA  +GA  ++++LL++ + ++R  E  L VL+QLC CAEGRA+++ H AGLAVV
Sbjct  295   GRNRVKAVGSGAIHMLVELLINGSVDRRISELALVVLDQLCGCAEGRADLVGHGAGLAVV  354

Query  620   SRKILRVSQVANERGLRILYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKER  441
             S+KILRVS + ++R +R+L SI+++  TP VV EM+++GV  KLCLVIQVDC   K KER
Sbjct  355   SKKILRVSHLGSDRAVRVLSSISRYVGTPKVVAEMMEVGVVTKLCLVIQVDCS-SKTKER  413

Query  440   AAEILKLHAKEWKNSPCLPLDLI  372
             A E+LKLH++ WKNSPC+P  LI
Sbjct  414   AKEMLKLHSRVWKNSPCIPPHLI  436



>ref|XP_008358017.1| PREDICTED: E3 ubiquitin-protein ligase PUB24-like [Malus domestica]
Length=403

 Score =   325 bits (832),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 174/409 (43%), Positives = 254/409 (62%), Gaps = 17/409 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M++I+VP YF+CPISL+IMKDPVT  TGITYDR++IE W+F  KN TCP TKQ L    D
Sbjct  1     MDDIEVPQYFICPISLQIMKDPVTTITGITYDRESIEHWLFQSKNITCPATKQPLP--KD  58

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WCT +AS+G++R PTPKPP+ K+ +LKLL+     P++   +++ 
Sbjct  59    SELTPNHTLRRLIQAWCTDNASYGIDRIPTPKPPLNKAQVLKLLKDXWH-PQLQLNIIRK  117

Query  1217  LRSMAPENAANKRCMESAGVAE----FLAQI-IKTSEDNPTDDALYVLHNLGLSENGLRS  1053
             L  +A EN  N++ M  AGVA+    F+  I  K  + +  ++AL +LH + +S   L  
Sbjct  118   LEFLAVENEGNRKYMVEAGVAKAMLLFIXNICYKNGQVDGLEEALSILHFVRISSEELNR  177

Query  1052  ILGHDTQFIDSLTRVM---QHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFH  882
             +   + Q I+SLT V             +AV++LK +++        +         FF 
Sbjct  178   LFMENDQIINSLTWVFGCETENQIAVSTHAVLVLKYIIQKANSTVLETLDRN-----FFK  232

Query  881   QVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWG  702
             ++V ILR+  +++   +ALH++ + C  GRNRIK   AGA   +I+L     EKR  E  
Sbjct  233   KLVGILRNGVTQQGVNAALHVMLDACPWGRNRIKMVXAGAVYELIELEFCAPEKRTTELI  292

Query  701   LSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQ  522
               +L  LC CA+GRA+ + H  G++VVS+++LRVS   N+R + IL  ++K+S T SV+Q
Sbjct  293   FGILFHLCSCADGRAQFISHKGGISVVSKRLLRVSPTTNDRAVLILSMVSKYSGTNSVLQ  352

Query  521   EMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDL  375
             EML++G   KLC ++QVDC     K++A EILK H +EWKN PCL + L
Sbjct  353   EMLEVGAVPKLCTLLQVDCA-PYLKDKAREILKSHYEEWKNCPCLGMSL  400



>ref|XP_008645759.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Zea mays]
 gb|AFW71712.1| hypothetical protein ZEAMMB73_141409 [Zea mays]
Length=436

 Score =   325 bits (832),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 175/427 (41%), Positives = 261/427 (61%), Gaps = 46/427 (11%)
 Frame = -1

Query  1565  QVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEFLT  1386
             ++P YFLCPISLE+M+DPVT++TGITYDR +IE+W+F+  +ATCPVT++AL+  + +  T
Sbjct  13    EIPHYFLCPISLEVMRDPVTLATGITYDRASIERWLFTDGHATCPVTRRALAPAEMDA-T  71

Query  1385  PNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTLRSM  1206
             PN  LRR+IQ+WC   A+H VERFPTP+ P+    +  LL Q +      A  L+ ++++
Sbjct  72    PNHTLRRLIQAWC---AAHQVERFPTPRQPLDSCRVAALLDQGRHGGA--AAALREIKAV  126

Query  1205  APENAANKRCMESA-GVAEFLAQII--KTSED----------------------------  1119
               E+  N+RC+E+  G  +FLA ++   +S D                            
Sbjct  127   IAESERNRRCVEATPGAVDFLASLVAKDSSADRSPSKRASSQQDADDGDSLGEEVLDSPT  186

Query  1118  ---NPTDDALYVLHNLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSML  948
                +P +DAL VL++L  SE  L  I+  +  F+D+L  V++  SY +RAY ++LLK+M 
Sbjct  187   FMSSPAEDALGVLYSLKPSERSLAQIMEREGNFLDTLASVLRRPSYRTRAYGILLLKAMT  246

Query  947   EtttlnpslsqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEA  768
             E  T    +             +VV ++ D  S KA ++ALH+L  +C  GRNR+KA +A
Sbjct  247   EVMTPAQFMMVSAD-----LVQEVVLVVSDRVSSKAVRAALHVLCRLCPWGRNRVKAVQA  301

Query  767   GAATVVIDLLLDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVA  588
             GA   +++LLLD    R  E  +  ++ LC CAEGR++++ H AGLAV+S+K++RVS  A
Sbjct  302   GAVAALVELLLDEGGSRVTELAVVAIDHLCGCAEGRSDLVAHPAGLAVLSKKVMRVSAAA  361

Query  587   NERGLRILYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKE  408
              E  +R L+++A+ S TPSV QEML +GV AKL LV+Q + G  +   R  E+LK HA+ 
Sbjct  362   TESAVRALHAVARHSPTPSVRQEMLAVGVVAKLLLVLQTNAG-ERAGLRVKEMLKTHARV  420

Query  407   WKNSPCL  387
             WK+SPCL
Sbjct  421   WKDSPCL  427



>dbj|BAJ97280.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=420

 Score =   323 bits (828),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 180/422 (43%), Positives = 272/422 (64%), Gaps = 37/422 (9%)
 Frame = -1

Query  1568  IQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEFL  1389
             ++VPPYFLCPISLEIM+DPVT++TGITYDR +IE+WI  G +ATCPVT+Q ++  D +  
Sbjct  6     VEVPPYFLCPISLEIMRDPVTLATGITYDRTSIERWISDG-HATCPVTQQKIAEADRDA-  63

Query  1388  TPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQ---AKSTPEMLAKVLQT  1218
             TPN  LRR+ Q+WC+LHA   VERFPTP+PP+  S + +++++   A    E+ A  L+ 
Sbjct  64    TPNHTLRRLTQAWCSLHA---VERFPTPRPPLDTSRVAEIVQEGHGAGRQQELAA--LRE  118

Query  1217  LRSMAPENAANKRCMESA-GVAEFLAQIIK--------------------TSEDNPTDDA  1101
             ++++  E+  N+RC+E+  G  EFL  ++                     TS  +P +DA
Sbjct  119   IKAIVAESDRNRRCVEATPGAVEFLVSVVTNHATTSKSAQDLLELSLDSPTSTSSPEEDA  178

Query  1100  LYVLHNLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpsl  921
             L V+ +L  S+  L  IL  +  F+D+L  +++  SY SR Y ++LLK+M+        +
Sbjct  179   LSVICSLKPSKKSLLRILEKNVDFLDTLVCMLRRPSYRSRCYGIILLKAMVSVMEPARLM  238

Query  920   sqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDL  741
             +  T         +VV+++ D  S KA K+AL++L  +C  GRNR+KA EAGA TV+++L
Sbjct  239   TVRTE-----LVQEVVRVVSDRVSAKAVKAALNVLCRLCPWGRNRVKAVEAGAVTVLVEL  293

Query  740   LLDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILY  561
             LLD   +   E  +  ++ LC CAEGR++++ H AGLAVV++K +RVS    E  +R L+
Sbjct  294   LLDEGGRHPTELAVVAIDHLCGCAEGRSDLVAHPAGLAVVAKKAMRVSPTTTESAVRALH  353

Query  560   SIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPL  381
             ++A+ S TP+V+QEML +GV AKL LV+QVD G  + + +A E+LK+HA+ WK+SPCL +
Sbjct  354   AVARHSPTPAVLQEMLAVGVVAKLLLVLQVDAG-ERARAKAKELLKMHARVWKDSPCLQV  412

Query  380   DL  375
              L
Sbjct  413   HL  414



>dbj|BAJ93921.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=420

 Score =   322 bits (826),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 179/418 (43%), Positives = 270/418 (65%), Gaps = 37/418 (9%)
 Frame = -1

Query  1568  IQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEFL  1389
             ++VPPYFLCPISLEIM+DPVT++TGITYDR +IE+WI  G +ATCPVT+Q ++  D +  
Sbjct  6     VEVPPYFLCPISLEIMRDPVTLATGITYDRTSIERWISDG-HATCPVTQQKIAEADRDA-  63

Query  1388  TPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQ---AKSTPEMLAKVLQT  1218
             TPN  LRR+ Q+WC+LHA   VERFPTP+PP+  S + +++++   A    E+ A  L+ 
Sbjct  64    TPNHTLRRLTQAWCSLHA---VERFPTPRPPLDTSRVAEIVQEGHGAGRQQELAA--LRE  118

Query  1217  LRSMAPENAANKRCMESA-GVAEFLAQIIK--------------------TSEDNPTDDA  1101
             ++++  E+  N+RC+E+  G  EFL  ++                     TS  +P +DA
Sbjct  119   IKAIVAESDRNRRCVEATPGAVEFLVSVVTNHATTSKSAQDLLELSLDSPTSTSSPEEDA  178

Query  1100  LYVLHNLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpsl  921
             L V+ +L  S+  L  IL  +  F+D+L  +++  SY SR Y ++LLK+M+        +
Sbjct  179   LSVICSLKPSKKSLLRILEKNVDFLDTLVCMLRRPSYRSRCYGIILLKAMVSVMEPARLM  238

Query  920   sqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDL  741
             +  T         +VV+++ D  S KA K+AL++L  +C  GRNR+KA EAGA TV+++L
Sbjct  239   TVRTE-----LVQEVVRVVSDRVSAKAVKAALNVLCRLCPWGRNRVKAVEAGAVTVLVEL  293

Query  740   LLDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILY  561
             LLD   +   E  +  ++ LC CAEGR++++ H AGLAVV++K +RVS    E  +R L+
Sbjct  294   LLDEGGRHPTELAVVAIDHLCGCAEGRSDLVAHPAGLAVVAKKAMRVSPTTTESAVRALH  353

Query  560   SIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCL  387
             ++A+ S TP+V+QEML +GV AKL LV+QVD G  + + +A E+LK+HA+ WK+SPCL
Sbjct  354   AVARHSPTPAVLQEMLAVGVVAKLLLVLQVDAG-ERARAKAKELLKMHARVWKDSPCL  410



>ref|XP_004959995.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Setaria italica]
Length=413

 Score =   321 bits (823),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 176/413 (43%), Positives = 255/413 (62%), Gaps = 26/413 (6%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             MEE++VP YFLCPISL++M+DPVT+ +GITYDRD IE+W+ +    TCP+TKQ +    D
Sbjct  1     MEEVEVPCYFLCPISLQMMRDPVTLPSGITYDRDGIERWLLTA--GTCPLTKQPVPA--D  56

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQ--------AKSTPE  1242
                TPN  LRR+IQSW  LHA+ GVER PTPKPP  ++ +  L+ +        + +T E
Sbjct  57    CEPTPNHTLRRLIQSWSALHAADGVERVPTPKPPTDRARVSALVSRIGATATSRSTATQE  116

Query  1241  MLAKVLQTLRSMAPENAANKRCMESA-GVAEFLAQIIKTSEDNPT------DDALYVLHN  1083
             +LA  L+ LR +A E+  +++ + +  G  + LA +   S    +      DDAL ++ +
Sbjct  117   ILA-ALRELRDVAAESERSRKLVAAVPGAVDVLAAVFVASAATKSQSVAVCDDALEIISS  175

Query  1082  LGLSENGL-RSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltt  906
             L LSE  L R I   +   +D+L  V+Q  +  SRA A +LL+++               
Sbjct  176   LQLSEQCLARVIFEANEALVDALVSVLQRSNTASRARAALLLQNV-----TAAMSPSRLV  230

Query  905   tlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTN  726
             +L+   F +VVQ++RD  S+ A+K+ALH+L      GRNR+KA +AGA  V++D+LLD  
Sbjct  231   SLSEQVFREVVQLIRDKVSKAATKAALHVLVGATLWGRNRVKAVDAGAVVVLVDMLLDAP  290

Query  725   EKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKF  546
             E+R CE  L  L++LC CAEGRAE++ H AG+A V  K +RVS VA ++ +R+L S+A+ 
Sbjct  291   ERRACELALGALDRLCGCAEGRAELVAHGAGVAAVGGKAVRVSDVATDKAVRVLRSVARH  350

Query  545   SATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCL  387
             +A  +VVQEM Q GV   LC V   +    + +ERA EIL+ HA  W+ SPCL
Sbjct  351   AAKAAVVQEMAQTGVVGTLCAVALSEHYGERTRERAQEILRRHAMSWRTSPCL  403



>ref|XP_003540288.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Glycine max]
Length=427

 Score =   321 bits (823),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 180/422 (43%), Positives = 264/422 (63%), Gaps = 28/422 (7%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M EI++P +FLCPISL+IMKDPVT  TGITYDR++IEKW+   K+ TCP+TKQ L  +  
Sbjct  9     MTEIEIPQFFLCPISLQIMKDPVTTVTGITYDRESIEKWLLKAKDCTCPITKQPLPRSP-  67

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
             EFLTPN  LRR+IQ+WC+ + ++GV++ PTPK P++ S+  KL++  + +     K L+ 
Sbjct  68    EFLTPNHTLRRLIQAWCSANEANGVDQIPTPKSPLSNSNAEKLVKDLEVSSR-FQKALEK  126

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKT--SEDNPT----DDALYVLHNLGLSEN---  1065
             L ++A EN  N+RCM SAGVAE +  +I     + N T    ++AL +L  L  S N   
Sbjct  127   LHALAMENERNRRCMASAGVAEAMVHVITKIFKQGNKTTPCVEEALRILRLLWSSANMVD  186

Query  1064  -------GLRSILGHDTQFIDSLTRVMQ---HGSYESRAYAVMLLKSMLEtttlnpslsq  915
                     ++ ++G +  F++SLT  +Q     + +    A+ +LK ++E     P  + 
Sbjct  187   SNNNNNNKIKRMVGENFDFLNSLTWALQLQTKNNVKLTNEAMPILKLVIEAKDSTPLGNL  246

Query  914   ltttlnlSFFHQVVQILRD-NFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLL  738
                     FF  VV ++++   S++A KSALH+L   C  GRNR+K  EAGA   +I+L 
Sbjct  247   KLE-----FFKVVVSVMKNRELSQQAVKSALHVLIETCPLGRNRMKIVEAGAVIELIELA  301

Query  737   LDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYS  558
             L+  EK   E    +L  LC CA+GR + L+HAAG+AVVS++ILRVS   N+R L I   
Sbjct  302   LEKPEKNMTELVFILLANLCSCADGREQFLQHAAGIAVVSKRILRVSPTTNDRALHIFSL  361

Query  557   IAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLD  378
             ++KFSA+  VVQEML++G  +KLC+V+Q DC     KE+A  +L+LH+K W NSPC+ + 
Sbjct  362   VSKFSASNEVVQEMLRVGAVSKLCMVLQADCA-SYLKEKARGVLRLHSKTWNNSPCIQVY  420

Query  377   LI  372
             L+
Sbjct  421   LL  422



>ref|NP_001054324.1| Os04g0686000 [Oryza sativa Japonica Group]
 emb|CAD41926.1| OSJNBa0070M12.4 [Oryza sativa Japonica Group]
 dbj|BAF16238.1| Os04g0686000 [Oryza sativa Japonica Group]
 gb|EAZ32482.1| hypothetical protein OsJ_16699 [Oryza sativa Japonica Group]
 dbj|BAG98399.1| unnamed protein product [Oryza sativa Japonica Group]
Length=413

 Score =   320 bits (821),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 178/400 (45%), Positives = 258/400 (65%), Gaps = 20/400 (5%)
 Frame = -1

Query  1559  PPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEFLTPN  1380
             P YF+CPISL+IM+DPVT+ TGITYDRD IE+W+ +    TCP+TKQ +    D   TPN
Sbjct  14    PSYFVCPISLQIMRDPVTLPTGITYDRDGIERWLLTA--GTCPLTKQPVPPDCDP--TPN  69

Query  1379  IILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKL---LRQAKSTPEMLAKVLQTLRS  1209
               LRR+IQSWC LHA HGV+  PTPKPP  ++ +  L   LR A S+  +L   L+ LR 
Sbjct  70    HTLRRLIQSWCALHADHGVDLVPTPKPPADRARVADLVSRLRAATSSAALL-DALRELRD  128

Query  1208  MAPENAANKRCMESA-GVAEFLAQIIKTS---EDNPTDDALYVLHNLGLSENGLRSILGH  1041
             +A E+  N++ + +  G  + LA ++  S        D+AL ++ +L LSE  L  ++  
Sbjct  129   VAAESERNRKLLAAVPGAVDVLAAVVVASCRDAKAACDEALEIVCSLELSERCLARLVER  188

Query  1040  DTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQILR  861
             + + +D+L   +Q  +  SRA+A +LL+++          S    +L    F + VQ+LR
Sbjct  189   NEELVDALVATLQRTNTTSRAHAALLLEAV-----TAVMPSNRLVSLPEEVFGEAVQLLR  243

Query  860   DNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTN-EKRYCEWGLSVLEQ  684
             D  S  A+++ALH+L      GRNR+KA +AGA  V++D+LLD   E+R CE  L+ L++
Sbjct  244   DRVSSPATRAALHVLVGTTSWGRNRVKAVDAGAVAVLVDMLLDGPVERRGCELALAALDR  303

Query  683   LCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEMLQLG  504
             +C CAEGRA ++ H AG+AVV RK+LRVS+VA+E+ +R+L S+A+ +AT +VVQEM Q G
Sbjct  304   MCGCAEGRAALVSHGAGVAVVGRKVLRVSEVASEKAVRVLRSVARHAATAAVVQEMGQTG  363

Query  503   VGAKLCLVIQVD-CGVGKNKERAAEILKLHAKEWKNSPCL  387
                KLC+V Q + CG  + +ERA E L+LHA+ W+NSPCL
Sbjct  364   AVEKLCVVAQSEQCG-ERTRERARETLRLHARAWRNSPCL  402



>emb|CAH68357.1| H0723C07.7 [Oryza sativa Indica Group]
Length=413

 Score =   320 bits (821),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 177/400 (44%), Positives = 258/400 (65%), Gaps = 20/400 (5%)
 Frame = -1

Query  1559  PPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEFLTPN  1380
             P YF+CPISL+IM+DPVT+ TGITYDRD IE+W+ +    TCP+TKQ +    D   TPN
Sbjct  14    PSYFVCPISLQIMRDPVTLPTGITYDRDGIERWLLTA--GTCPLTKQPVPPDCDP--TPN  69

Query  1379  IILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKL---LRQAKSTPEMLAKVLQTLRS  1209
               LRR+IQSWC LHA HGV+  PTPKPP  ++ +  L   LR A S+  +L   L+ LR 
Sbjct  70    HTLRRLIQSWCALHADHGVDLVPTPKPPADRARVADLVSRLRAATSSAALL-DALRELRD  128

Query  1208  MAPENAANKRCMESA-GVAEFLAQIIKTS---EDNPTDDALYVLHNLGLSENGLRSILGH  1041
             ++ E+  N++ + +  G  + LA ++  S        D+AL ++ +L LSE  L  ++  
Sbjct  129   VSAESERNRKLLAAVPGAVDVLAAVVVASCRDAKAACDEALEIVCSLELSERCLARLVER  188

Query  1040  DTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQILR  861
             + + +D+L   +Q  +  SRA+A +LL+++          S    +L    F + VQ+LR
Sbjct  189   NEELVDALVATLQRTNTTSRAHAALLLEAV-----TAVMPSNRLVSLPEEVFGEAVQLLR  243

Query  860   DNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTN-EKRYCEWGLSVLEQ  684
             D  S  A+++ALH+L      GRNR+KA +AGA  V++D+LLD   E+R CE  L+ L++
Sbjct  244   DRVSSPATRAALHVLVGTTSWGRNRVKAVDAGAVAVLVDMLLDGPVERRGCELALAALDR  303

Query  683   LCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEMLQLG  504
             +C CAEGRA ++ H AG+AVV RK+LRVS+VA+E+ +R+L S+A+ +AT +VVQEM Q G
Sbjct  304   MCGCAEGRAALVSHGAGVAVVGRKVLRVSEVASEKAVRVLRSVARHAATAAVVQEMAQTG  363

Query  503   VGAKLCLVIQVD-CGVGKNKERAAEILKLHAKEWKNSPCL  387
                KLC+V Q + CG  + +ERA E L+LHA+ W+NSPCL
Sbjct  364   AVEKLCVVAQSEQCG-ERTRERARETLRLHARAWRNSPCL  402



>gb|KHN36500.1| E3 ubiquitin-protein ligase PUB23 [Glycine soja]
Length=422

 Score =   320 bits (819),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 177/419 (42%), Positives = 265/419 (63%), Gaps = 24/419 (6%)
 Frame = -1

Query  1580  VMEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTD  1401
             +M EI+ P +FLCPISL+IMKDPVT  TGITYDR++IE+W+   K+ TCP+TKQ L  + 
Sbjct  7     IMTEIETPQFFLCPISLQIMKDPVTTVTGITYDRESIEQWLLKAKDCTCPITKQRLPRST  66

Query  1400  DEFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQ  1221
              EFLTPN  LRR+IQ+WC+ + ++GV++ PTPK P++ +++ KL++  + +     + L+
Sbjct  67    -EFLTPNHTLRRLIQAWCSANEANGVDQIPTPKSPLSIANVEKLVKDLEVSSR-FQRALE  124

Query  1220  TLRSMAPENAANKRCMESAGVAEFLAQIIKTS--EDNPT----DDALYVLHNLGLSENGL  1059
              L  +A EN  N+RCM SAGVAE +  +I  S  + N T    ++AL +L  L  S N +
Sbjct  125   KLHDLAIENGRNRRCMASAGVAEAMVHVITKSFIQGNKTTSCVEEALKILGLLWSSANNM  184

Query  1058  ------RSILGHDTQFIDSLTRVMQ---HGSYESRAYAVMLLKSMLEtttlnpslsqltt  906
                   + ++G +  F++SLT V+Q     + +    A+ +LK  +E     P  +    
Sbjct  185   VDNDNMKRMVGENFDFLNSLTWVLQLQTKNNVKVINEAMPILKLTIEAKDSTPLGNLKLE  244

Query  905   tlnlSFFHQVVQILRD-NFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDT  729
                  FF  VV ++++   +++A KSALH+L   C  GRNR+K  EAGA   +I+L L+ 
Sbjct  245   -----FFKVVVSVMKNRELTQQAVKSALHVLIETCPLGRNRMKIVEAGAVVELIELALEK  299

Query  728   NEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAK  549
              EK   E    +L  LC CA+GR + L+HAAG+AVVS++ILRVS   ++R L I   ++K
Sbjct  300   PEKNMTELIFILLAHLCSCADGREQFLQHAAGIAVVSKRILRVSPTTDDRALHIFSLVSK  359

Query  548   FSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             FSA+  VVQEML++G  +KLC+V+Q DC     KE+A  +L+LH+K W NSPC+ + L+
Sbjct  360   FSASNEVVQEMLRVGAVSKLCMVLQADCA-SYLKEKARGVLRLHSKTWNNSPCIQVYLL  417



>ref|XP_003543415.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Glycine max]
Length=422

 Score =   320 bits (819),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 177/419 (42%), Positives = 265/419 (63%), Gaps = 24/419 (6%)
 Frame = -1

Query  1580  VMEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTD  1401
             +M EI+ P +FLCPISL+IMKDPVT  TGITYDR++IE+W+   K+ TCP+TKQ L  + 
Sbjct  7     IMTEIETPQFFLCPISLQIMKDPVTTVTGITYDRESIEQWLLKAKDCTCPITKQRLPRST  66

Query  1400  DEFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQ  1221
              EFLTPN  LRR+IQ+WC+ + ++GV++ PTPK P++ +++ KL++  + +     + L+
Sbjct  67    -EFLTPNHTLRRLIQAWCSANEANGVDQIPTPKSPLSIANVEKLVKDLEVSSR-FQRALE  124

Query  1220  TLRSMAPENAANKRCMESAGVAEFLAQIIKTS--EDNPT----DDALYVLHNLGLSENGL  1059
              L  +A EN  N+RCM SAGVAE +  +I  S  + N T    ++AL +L  L  S N +
Sbjct  125   KLHDLAIENGRNRRCMASAGVAEAMVHVITKSFIQGNKTTSCVEEALRILGLLWSSANNM  184

Query  1058  ------RSILGHDTQFIDSLTRVMQ---HGSYESRAYAVMLLKSMLEtttlnpslsqltt  906
                   + ++G +  F++SLT V+Q     + +    A+ +LK  +E     P  +    
Sbjct  185   VDNDNMKRMVGENFDFLNSLTWVLQLQTKNNVKVINEAMPILKLTIEAKDSTPLGNLKLE  244

Query  905   tlnlSFFHQVVQILRD-NFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDT  729
                  FF  VV ++++   +++A KSALH+L   C  GRNR+K  EAGA   +I+L L+ 
Sbjct  245   -----FFKVVVSVMKNRELTQQAVKSALHVLIETCPLGRNRMKIVEAGAVVELIELALEK  299

Query  728   NEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAK  549
              EK   E    +L  LC CA+GR + L+HAAG+AVVS++ILRVS   ++R L I   ++K
Sbjct  300   PEKNMTELIFILLAHLCSCADGREQFLQHAAGIAVVSKRILRVSPTTDDRALHIFSLVSK  359

Query  548   FSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             FSA+  VVQEML++G  +KLC+V+Q DC     KE+A  +L+LH+K W NSPC+ + L+
Sbjct  360   FSASNEVVQEMLRVGAVSKLCMVLQADCA-SYLKEKARGVLRLHSKTWNNSPCIQVYLL  417



>gb|EMT16670.1| U-box domain-containing protein 23 [Aegilops tauschii]
Length=423

 Score =   319 bits (818),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 176/425 (41%), Positives = 268/425 (63%), Gaps = 40/425 (9%)
 Frame = -1

Query  1568  IQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEFL  1389
             ++VPPYFLCPISLEIM+DPVT++TGITYDR +IE+W+  G +ATCPVT+Q L+  D E  
Sbjct  6     VEVPPYFLCPISLEIMRDPVTLATGITYDRCSIERWLSDG-HATCPVTQQKLTDADREA-  63

Query  1388  TPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKST---PEMLAKVLQT  1218
             TPN  LRR+ Q+WC LHA   VERFPTP+PP+   H+ +++ + +      E+ A  L+ 
Sbjct  64    TPNHTLRRLTQAWCALHA---VERFPTPRPPLDTCHVAEIVEEGRGAGLQQELAA--LRE  118

Query  1217  LRSMAPENAANKRCMESA-GVAEFLAQII----------KTSED-------------NPT  1110
             ++++  E+  N+RC+E+  G  EFL  ++          K++ED             +P 
Sbjct  119   IKAIVDESDRNRRCVEATPGAVEFLVSVVNNYATNNSASKSAEDLSELSLDSPTSTSSPE  178

Query  1109  DDALYVLHNLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttln  930
             ++AL V+ +L  S+  L  IL  +  F+D+L  +++  SY SR Y ++LLK+M+      
Sbjct  179   EEALSVICSLKPSKKSLVRILEENVNFLDTLVCMLRRPSYRSRCYGILLLKAMVSVMEPA  238

Query  929   pslsqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVV  750
               ++  T  +         +      S KA K+ALH+L  +C  GRNR+KA EAGA TV+
Sbjct  239   RLMAVRTEVVLEVVRVVSDR-----VSAKAVKAALHVLCRLCPWGRNRVKAVEAGAMTVL  293

Query  749   IDLLLDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLR  570
             ++LLLD   +   E  +  ++ LC CAEGR++++ H AGLA++++K +RVS    E  +R
Sbjct  294   VELLLDEGGRHPTELAVVAIDHLCGCAEGRSDLVAHPAGLAIMAKKAMRVSLTTTESAVR  353

Query  569   ILYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPC  390
              L+++A+ S TP+V+QEML +GV AKL LV+QVD G  + + +A E+LK+HA+ WK+SPC
Sbjct  354   ALHAVARHSPTPAVLQEMLAVGVVAKLLLVLQVDAG-ERARAKAKELLKMHARVWKDSPC  412

Query  389   LPLDL  375
             L + L
Sbjct  413   LQVHL  417



>gb|ACU20925.1| unknown [Glycine max]
Length=422

 Score =   319 bits (817),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 177/419 (42%), Positives = 264/419 (63%), Gaps = 24/419 (6%)
 Frame = -1

Query  1580  VMEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTD  1401
             +M EI+ P +FLCPISL+IMKDPVT  TGITYDR+ IE+W+   K+ TCP+TKQ L  + 
Sbjct  7     IMTEIETPQFFLCPISLQIMKDPVTTVTGITYDREGIEQWLLKAKDCTCPITKQRLPRST  66

Query  1400  DEFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQ  1221
              EFLTPN  LRR+IQ+WC+ + ++GV++ PTPK P++ +++ KL++  + +     + L+
Sbjct  67    -EFLTPNHTLRRLIQAWCSANEANGVDQIPTPKSPLSIANVEKLVKDLEVSSR-FQRALE  124

Query  1220  TLRSMAPENAANKRCMESAGVAEFLAQIIKTS--EDNPT----DDALYVLHNLGLSENGL  1059
              L  +A EN  N+RCM SAGVAE +  +I  S  + N T    ++AL +L  L  S N +
Sbjct  125   KLHDLAIENGRNRRCMASAGVAEAMVHVITKSFIQGNKTTSCVEEALRILGLLWSSANNM  184

Query  1058  ------RSILGHDTQFIDSLTRVMQ---HGSYESRAYAVMLLKSMLEtttlnpslsqltt  906
                   + ++G +  F++SLT V+Q     + +    A+ +LK  +E     P  +    
Sbjct  185   VDNDNMKRMVGENFDFLNSLTWVLQLQTKNNVKVINEAMPILKLTIEAKDSTPLGNLKLE  244

Query  905   tlnlSFFHQVVQILRD-NFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDT  729
                  FF  VV ++++   +++A KSALH+L   C  GRNR+K  EAGA   +I+L L+ 
Sbjct  245   -----FFKVVVSVMKNRELTQQAVKSALHVLIETCPLGRNRMKIVEAGAVVELIELALEK  299

Query  728   NEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAK  549
              EK   E    +L  LC CA+GR + L+HAAG+AVVS++ILRVS   ++R L I   ++K
Sbjct  300   PEKNMTELIFILLAHLCSCADGREQFLQHAAGIAVVSKRILRVSPTTDDRALHIFSLVSK  359

Query  548   FSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             FSA+  VVQEML++G  +KLC+V+Q DC     KE+A  +L+LH+K W NSPC+ + L+
Sbjct  360   FSASNEVVQEMLRVGAVSKLCMVLQADCA-SYLKEKARGVLRLHSKTWNNSPCIQVYLL  417



>gb|KHN17980.1| E3 ubiquitin-protein ligase PUB23 [Glycine soja]
Length=420

 Score =   318 bits (816),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 178/423 (42%), Positives = 261/423 (62%), Gaps = 29/423 (7%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M EI++P +FLCPISL+IMKDPVT   GITYDR++IEKW+   K+ TCP+TKQ L  +  
Sbjct  1     MTEIEIPQFFLCPISLQIMKDPVTTVRGITYDRESIEKWLLKAKDCTCPITKQPLPRSP-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
             EFLTPN  LRR+IQ+WC+ + ++GV++ PTPK P++ S+  KL++  + +     K L+ 
Sbjct  60    EFLTPNHTLRRLIQAWCSANEANGVDQIPTPKSPLSNSNAEKLVKDLEVSSR-FQKALEK  118

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKT--SEDNPT----DDALYVLHNLGLSEN---  1065
             L ++A EN  N+RCM SAGVAE +  +I     + N T    ++AL +L  L  S N   
Sbjct  119   LHALAMENERNRRCMASAGVAEAMVHVITKIFKQGNKTTPCVEEALRILRLLWSSANMVD  178

Query  1064  --------GLRSILGHDTQFIDSLTRVMQ---HGSYESRAYAVMLLKSMLEtttlnpsls  918
                      ++ ++G +  F++SLT  +Q     + +    A+ +LK ++E        +
Sbjct  179   SNNNNNNNNIKRMVGENFDFLNSLTWALQLQTKNNVKLTNEAMPILKLVIEAKDSTALGN  238

Query  917   qltttlnlSFFHQVVQILRD-NFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDL  741
                      FF  VV +L++   S++A KSALH+L   C  GRNR+K  E GA   +I+L
Sbjct  239   LKLE-----FFKVVVSVLKNRELSQQAVKSALHVLIETCPLGRNRMKIVEGGAVIELIEL  293

Query  740   LLDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILY  561
              L+  EK   E    +L  LC CA+GR + L+HAAG+AVVS++ILRVS   N+R L I  
Sbjct  294   ALEKPEKNMTELVFILLANLCSCADGREQFLQHAAGIAVVSKRILRVSPTTNDRALHIFS  353

Query  560   SIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPL  381
              ++KFSA+  VVQEML++G  +KLC+V+Q DC     KE+A  +L+LH+K W NSPC+ +
Sbjct  354   LVSKFSASNEVVQEMLRVGAVSKLCMVLQADCA-SYLKEKARGVLRLHSKTWNNSPCIQV  412

Query  380   DLI  372
              L+
Sbjct  413   YLL  415



>ref|XP_010651653.1| PREDICTED: E3 ubiquitin-protein ligase PUB24-like [Vitis vinifera]
Length=411

 Score =   318 bits (815),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 167/409 (41%), Positives = 266/409 (65%), Gaps = 16/409 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M++I++P YFLCPISL+IMKDPVT  TGITYDR++IE+W+ + K+ TCPVTKQ L    D
Sbjct  7     MDDIEIPQYFLCPISLQIMKDPVTAMTGITYDRESIEQWLLTAKDTTCPVTKQPLER--D  64

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WC  +A++GV+R PTPK P+ ++H++KL+R      ++  K LQ 
Sbjct  65    FVLTPNHTLRRLIQAWCADNATNGVDRIPTPKTPLDRTHVVKLIRDL-GVAQLYLKTLQK  123

Query  1217  LRSMAPENAANKRCMESAGVAE-FLAQIIKTSEDNPT---DDALYVLHNLGLSENGLRSI  1050
             + ++  +N  N+ CM  AG A+  +  IIK  ++N T   ++ L +LH +    + ++ +
Sbjct  124   MEALTRDNERNRNCMADAGAAKAIVLLIIKCFKENKTTGVEEGLRILHLIWSPTSEMKLL  183

Query  1049  LGHDTQFIDSLTRVM--QHGSYES-RAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQ  879
             L  +  F+D++T  +  +  +Y + R+ AV++LK+++E  + N             F ++
Sbjct  184   LKENYDFVDAVTWALGCETDNYVAVRSNAVLVLKNIVEVASPNLLERLKFE-----FLNR  238

Query  878   VVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGL  699
             +++ +R+  S+ A K+AL++L  VC  GRN+ +  EAGA   +I++ L+  EK+  E   
Sbjct  239   LIRTMREKISQAAMKAALYVLMEVCPWGRNKWQMIEAGAVFQLIEMELENPEKKITEIIF  298

Query  698   SVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQE  519
              +L  LC CA+GRA+ L HA  +A++S++ILRVS   ++R L I+  I+KFS T  V+ E
Sbjct  299   CLLGHLCSCADGRAQFLAHAGSMAMLSKRILRVSNTTDDRALHIIALISKFSGTNEVLME  358

Query  518   MLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             ML++G  +KLC+V+Q DC     KE+A EIL+LH+K W NSPC+ + L+
Sbjct  359   MLRVGAVSKLCMVLQADCA-KYLKEKAREILRLHSKVWNNSPCIAVYLL  406



>gb|EMT15255.1| U-box domain-containing protein 22 [Aegilops tauschii]
Length=431

 Score =   318 bits (815),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 168/424 (40%), Positives = 249/424 (59%), Gaps = 38/424 (9%)
 Frame = -1

Query  1571  EIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEF  1392
             +++VP YFLCPIS+EIM+DPVT+S+GITYDR++IE+W+F+  +  CP+TKQ L   D E 
Sbjct  7     QVEVPSYFLCPISMEIMRDPVTLSSGITYDRESIERWVFTDGHGECPMTKQQLGAADREP  66

Query  1391  LTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTLR  1212
              TPN  LRR+IQ WC +HA   VERFPTP+ P+  + +  ++  A+   ++L   L+ L 
Sbjct  67    -TPNHTLRRLIQGWCAVHA---VERFPTPRAPIDAARVETIVDAARRGHDLLVASLRELA  122

Query  1211  SMAPENAANKRCMESA-GVAEFLAQIIK------------TSED-------------NPT  1110
              +  E+  N+RC+ES  G   FL  ++K            + ED             +P 
Sbjct  123   DIVAESDCNRRCVESTPGAVAFLVSVVKKHAADDTPKPLESQEDQMFGSVVDPPKASSPE  182

Query  1109  DDALYVLHNLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttln  930
             D AL +L++L LSE   + +L     F+D++  V++  SY SR + + LLK+ +      
Sbjct  183   DVALSILYSLRLSEGSWKRVLERGDNFLDTMASVLRRPSYLSRTHGIQLLKAAVSEMPPA  242

Query  929   pslsqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVV  750
                S             VV ++ D  S KA K AL +L  +C  GRNR+KA EAGA   +
Sbjct  243   QLTSASAE-----LVEGVVSVVTDKLSGKAVKIALQVLCRLCLWGRNRVKAVEAGAVGAL  297

Query  749   IDLLLDT---NEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANER  579
             ++LLLD      KR  E  + V++ LC CAEGR E++ H AGLAV++R + RVS    E 
Sbjct  298   VELLLDECCGGSKRASELAIVVMDHLCGCAEGRLELVAHPAGLAVMARAVTRVSAAGTES  357

Query  578   GLRILYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKN  399
              +R L+++A+ SATP+V+QEML +GV  +L  ++Q      + +ERA E+LK+HA+ W+ 
Sbjct  358   AVRALHAVARHSATPTVLQEMLAVGVVGRLLFLVQTGAAGDRPRERAREMLKMHARVWRG  417

Query  398   SPCL  387
             SPC 
Sbjct  418   SPCF  421



>gb|KHN21196.1| E3 ubiquitin-protein ligase PUB23 [Glycine soja]
Length=365

 Score =   315 bits (808),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 181/408 (44%), Positives = 255/408 (63%), Gaps = 53/408 (13%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSG--KNATCPVTKQALSGT  1404
             M+EI+VP  FLCPISL++M DPVT+ TGITYDR+NIE+W+FS   KN TCPVT+Q+L  T
Sbjct  1     MDEIEVPTLFLCPISLQLMSDPVTVCTGITYDRENIERWLFSSCKKNKTCPVTRQSLPHT  60

Query  1403  DDEFLTPNIILRRVIQSWCTLH--ASHGVERF-PTPKPPVTKSHILKLLRQAKSTPEMLA  1233
             D   LTPN  L+R+IQ+WCT +  A  G+E    +PKP + ++ I+KLL +AK  PE   
Sbjct  61    D---LTPNHTLQRLIQAWCTNNNNAWFGIETIISSPKPTIDQTQIVKLLMEAKKFPEKQL  117

Query  1232  KVLQTLRSMAPENAANKRCMESAGVAEFLAQIIKTSEDNPTDDALYVLHNLGLSENGLRS  1053
             K L+ L+S+A E+ +NK  +ESAG  +FLA  + +      + A+ +L +L  SE+ L++
Sbjct  118   KCLRRLQSIAFESESNKIYLESAGAIDFLASSVMS------EAAIELLFHLNPSESHLKN  171

Query  1052  ILGHD-TQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQV  876
             ++  +  QFI+SL  V++HG  +SRAYA +LLKS  E        +  +       F ++
Sbjct  172   LVNSEGIQFIESLFHVLKHGKCQSRAYATVLLKSSFEVAGPTQLSNVTSE-----MFVEM  226

Query  875   VQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLS  696
              ++LRD  S++ASK+AL LL  +C   RNRIKA E G                       
Sbjct  227   FRVLRDQISQEASKAALKLLVELCSWSRNRIKAVEGG-----------------------  263

Query  695   VLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEM  516
                      EGR E++ H AG+AVV++KILRVS VA++RG++IL SI + SATP V+ EM
Sbjct  264   ---------EGREELMNHGAGVAVVAKKILRVSHVASDRGVKILTSICRHSATPRVLSEM  314

Query  515   LQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             L  G  +KLCLV+Q++ G    KERA E LKLH+  W+NS C+P  L+
Sbjct  315   LLFGAVSKLCLVLQME-GSCNAKERARETLKLHSMVWRNSTCIPFSLL  361



>ref|XP_007150020.1| hypothetical protein PHAVU_005G119200g [Phaseolus vulgaris]
 gb|ESW22014.1| hypothetical protein PHAVU_005G119200g [Phaseolus vulgaris]
Length=413

 Score =   317 bits (811),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 174/416 (42%), Positives = 261/416 (63%), Gaps = 22/416 (5%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M EI++P +F CPISL+IMKDPVT  TGITYDR++IE W+   KN TCP+T+Q L   + 
Sbjct  1     MTEIEIPQFFACPISLQIMKDPVTTVTGITYDRESIEYWLLKAKNCTCPITQQPLPR-NS  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
             EFLTPN  LRR+IQ+WC+ + ++GV++ PTPK P++ +++ KL++  +  P      ++ 
Sbjct  60    EFLTPNHTLRRLIQAWCSANEANGVDQIPTPKSPLSNANVEKLVKDLE-VPPRFQNAIEK  118

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTS--EDNPT---DDALYVLHNLG-----LSE  1068
             L  +A EN  N+RCM SAGVAE + Q+I  S  +D  +   ++AL +L  L      +  
Sbjct  119   LHDLAVENERNRRCMASAGVAEAMVQVITKSFTQDKTSSCIEEALRILRLLWSSANVMDS  178

Query  1067  NGLRSILGHDTQFIDSLTRVMQ---HGSYESRAYAVMLLKSMLEtttlnpslsqltttln  897
             N ++ +LG +  F++SLTRV+Q     + +    A+ +LK  +E     P  +       
Sbjct  179   NYMKRLLGQNFDFLNSLTRVLQLQTKNNVKVINEAMPILKLTIEAKDSTPLGNLGLE---  235

Query  896   lSFFHQVVQILRD-NFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEK  720
               FF  VV+++++   S++A KSAL++L   C  GRNR K  +AGA   +++L L+  EK
Sbjct  236   --FFRVVVKVMKNRELSQQAIKSALYVLIETCPLGRNRTKIVDAGAVEELVELALENPEK  293

Query  719   RYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSA  540
                E    +L  LC CA+GR + L+HAA +AVVS++ILRVS   ++R L I   I+KFSA
Sbjct  294   NLTELVFILLAHLCSCADGRDQFLQHAASIAVVSKRILRVSPTIDDRALHIFSLISKFSA  353

Query  539   TPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             +  VVQEML++G  +KLC+V+Q D      KE+A  +L+LH+K W NSPC+ + L 
Sbjct  354   SHEVVQEMLRVGAVSKLCMVLQAD-SASYLKEKARSVLRLHSKTWNNSPCIQVYLF  408



>dbj|BAJ90807.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=431

 Score =   317 bits (811),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 168/424 (40%), Positives = 249/424 (59%), Gaps = 38/424 (9%)
 Frame = -1

Query  1571  EIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEF  1392
             +++VP YFLCPIS+EIM+DPVT+S+GITYDR++IE+W+F+  +  CP+TKQ L   D E 
Sbjct  7     QVEVPSYFLCPISMEIMRDPVTLSSGITYDRESIERWVFTDGHGECPMTKQQLGAADREP  66

Query  1391  LTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTLR  1212
              TPN  LRR+IQ WC +HA   VERFPTP+ P+  + +  ++  A+   ++L   L+ L 
Sbjct  67    -TPNHTLRRLIQGWCAVHA---VERFPTPRAPIDAARVETIVDAARRGHDLLVASLRELA  122

Query  1211  SMAPENAANKRCMESA-GVAEFLAQIIK------------TSED-------------NPT  1110
              +  E+  N+RC+ES  G   FL  +IK            + ED             +P 
Sbjct  123   DIVAESDCNRRCVESTPGAVAFLVSVIKKHAADDTPKPLESQEDQMFGAVVDSPKATSPE  182

Query  1109  DDALYVLHNLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttln  930
             D AL +L++L LSE   + +L     F+D++  V++  SY SR + + LLK+ +      
Sbjct  183   DVALSILYSLRLSEGSWKRVLERGDNFLDTMASVLRRPSYLSRTHGIQLLKAAVSEMPPA  242

Query  929   pslsqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVV  750
                S             VV ++ D  S KA K AL +L  +C  GRNR+KA EAGA   +
Sbjct  243   QLTSASAE-----LVEGVVSVVTDKLSGKAVKIALQVLCRLCLWGRNRVKAVEAGAVGAL  297

Query  749   IDLLLDT---NEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANER  579
             ++LLLD      KR  +  + V++ LC CAEGR E++ H AGLAV++R + RVS    E 
Sbjct  298   VELLLDECCGGSKRASQLAIVVMDHLCGCAEGRLELVAHKAGLAVMARAVTRVSAAGTES  357

Query  578   GLRILYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKN  399
              +R L+++A+ SATP+V+QEML +GV  +L  ++Q      + +ERA E+LK+HA+ W+ 
Sbjct  358   AVRALHAVARHSATPAVLQEMLAVGVVERLLFLVQAGAAGDRPRERAREMLKMHARVWRG  417

Query  398   SPCL  387
             SPC 
Sbjct  418   SPCF  421



>gb|EMS67443.1| E3 ubiquitin-protein ligase PUB22 [Triticum urartu]
Length=431

 Score =   317 bits (811),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 167/424 (39%), Positives = 248/424 (58%), Gaps = 38/424 (9%)
 Frame = -1

Query  1571  EIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEF  1392
             +++VP YFLCPIS+EIM+DPVT+S+GITYDR++IE+W+F+  +  CP+TKQ L   D E 
Sbjct  7     QVEVPSYFLCPISMEIMRDPVTLSSGITYDRESIERWVFTDGHGECPMTKQKLGAADREP  66

Query  1391  LTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTLR  1212
              TPN  LRR+IQ WC +HA   VERFPTP+ P+  + +  ++  A+   ++L   L+ L 
Sbjct  67    -TPNHTLRRLIQGWCAVHA---VERFPTPRAPIDAARVETIVDAARRGQDLLVASLRELA  122

Query  1211  SMAPENAANKRCMESA-GVAEFLAQIIK------------TSED-------------NPT  1110
              +  E+  N+RC+ES  G   FL  ++K            + ED             +P 
Sbjct  123   DIVAESDCNRRCVESTPGAVAFLVSVVKKHAADDTRKPLESQEDQMFGSVVDPPKASSPE  182

Query  1109  DDALYVLHNLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttln  930
             D AL +L++L LSE   + +L     F+D++   ++  SY SR + + LLK+ +      
Sbjct  183   DVALSILYSLRLSEGSWKRVLERGDNFLDTMASALRRPSYLSRTHGIQLLKAAVSEMPPA  242

Query  929   pslsqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVV  750
                S             VV ++ D  S KA K AL +L  +C  GRNR+KA EAGA   +
Sbjct  243   QLTSASAE-----LVEGVVSVVTDKLSGKAVKIALQVLCRLCLWGRNRVKAVEAGAVGAL  297

Query  749   IDLLLDT---NEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANER  579
             ++LLLD      KR  E  + V++ LC CAEGR E++ H AGLAV++R + RVS    E 
Sbjct  298   VELLLDECCGGSKRASELAIVVMDHLCGCAEGRLELVAHPAGLAVMARAVTRVSAAGTES  357

Query  578   GLRILYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKN  399
              +R L+++A+ SATP+V+QEML +GV  +L  ++Q      + +ERA E+LK+HA+ W+ 
Sbjct  358   AVRALHAVARHSATPAVLQEMLAVGVVVRLLFLVQTGAAGDRPRERAREMLKMHARVWRG  417

Query  398   SPCL  387
             SPC 
Sbjct  418   SPCF  421



>gb|KCW89305.1| hypothetical protein EUGRSUZ_A01596 [Eucalyptus grandis]
Length=371

 Score =   312 bits (800),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 189/390 (48%), Positives = 256/390 (66%), Gaps = 58/390 (15%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             MEE+++P +F+C IS ++MKDPVT+ T   Y++             T P+TKQA+   + 
Sbjct  1     MEEVKIPSFFVCLISSQLMKDPVTVPT--RYNK------------GTGPMTKQAIPDCE-  45

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN+ LRR+IQSWCTL+A+HG+E  PTP+PP++KS I KLLR+AKS PEM +K L+ 
Sbjct  46    --LTPNLTLRRLIQSWCTLNAAHGIETIPTPRPPISKSQIAKLLREAKS-PEMRSKCLKR  102

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIK--TSEDN---------PTDDALYVLHNLGLS  1071
             LRS+A ENA N+ C+E+AG A+FLA ++K  TS  N         P D+ L VL++L LS
Sbjct  103   LRSIAKENATNRCCIEAAGAADFLAALVKNETSASNCGSLEVTNGPFDEVLAVLYHLQLS  162

Query  1070  ENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlS  891
             E  L++++ +   F+DSLTR+M+ G+ ESRAYAVMLLKS  E T                
Sbjct  163   ETSLKNLISNGGVFVDSLTRIMRSGTCESRAYAVMLLKSTFEVTD---------------  207

Query  890   FFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYC  711
               H  +  LR     +A+KSAL LL  VC+  +NR+KA EA A  V+IDL LD+ +KR  
Sbjct  208   IIH--LSSLRMELFVEATKSALKLLIRVCRMCQNRLKAVEACAVPVLIDLFLDSYDKRQS  265

Query  710   EWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPS  531
             E  L +L+ LC+ AEGRAE+LKH AG+A+VS+           R +RIL SI+KFSATP+
Sbjct  266   EMILILLDVLCQWAEGRAELLKHGAGIAIVSK-----------RCVRILLSISKFSATPN  314

Query  530   VVQEMLQLGVGAKLCLVIQVDCGVGKNKER  441
             +VQEMLQ+GV AKLCLV+Q + G  K +ER
Sbjct  315   IVQEMLQVGVAAKLCLVLQFE-GTSKTRER  343



>gb|EYU36030.1| hypothetical protein MIMGU_mgv1a025656mg [Erythranthe guttata]
Length=418

 Score =   314 bits (804),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 185/420 (44%), Positives = 268/420 (64%), Gaps = 26/420 (6%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNA-----TCPVTKQAL  1413
             M ++++P YFLCPIS+++MKDPVT+STGITYDR NI+KW+FS  +A      CPVT+Q L
Sbjct  1     MPKVEIPCYFLCPISMDLMKDPVTLSTGITYDRLNIQKWLFSSSSAAACMYVCPVTRQPL  60

Query  1412  SGTDD--EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVT---KSHILKLLRQAK--  1254
             S  +D    LTPN  LRR+IQ+WCTL++    ER PTPKP      KS IL LL QAK  
Sbjct  61    SDEEDGGRRLTPNHTLRRMIQAWCTLNS---FERIPTPKPAAAAADKSQILNLLEQAKNS  117

Query  1253  STPEMLAKVLQTL-RSMAPENAANKRCMESAGVAEFLAQIIKTSEDN-PTDDALYVLHNL  1080
             +T   L   L+ +  S+A  N + +  +   G  +FL  +++ +ED   T++AL +L  +
Sbjct  118   TTNRQLISCLRRIGTSLAAGNVSCRNNLHFGGGVDFLLSVVRKNEDPISTEEALKILQQM  177

Query  1079  GLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttl  900
              LS++ L+     + + ++ L R+++ G+ E+R  A+ LL S         +        
Sbjct  178   ELSDSDLKLFFSDNARILNPLIRLLESGNSENRGKAITLLYSAF-----CVADPAHLIGS  232

Query  899   nlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNE-  723
                 F Q V+ILRD  S  A+K+AL LL  +   G+NRIKA + GA + +++LLL     
Sbjct  233   KPEVFTQTVKILRDRISEPATKAALKLLLELSPWGKNRIKAVKYGAVSALVELLLHQTGD  292

Query  722   --KRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAK  549
               +R CE  L VLEQLC CAEGRAE++ H AGLAVVS+KILRVS VA++R +R++ S++K
Sbjct  293   ECRRVCELTLVVLEQLCGCAEGRAELVSHGAGLAVVSKKILRVSHVASDRAVRVIGSVSK  352

Query  548   FSATPS-VVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             +SA  + V++EML++GV +KLCLV+Q +    K KERA EIL+LH++ W+ S C+P  L+
Sbjct  353   YSANNTRVLREMLKVGVVSKLCLVVQAESTQKKTKERAEEILRLHSRVWRCSSCIPPHLL  412



>ref|XP_004959992.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Setaria italica]
Length=416

 Score =   313 bits (803),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 169/408 (41%), Positives = 250/408 (61%), Gaps = 22/408 (5%)
 Frame = -1

Query  1571  EIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEF  1392
             +++VP YFLCPISL++M+DPVT+ +GITYDRD IE+W+ +    TCP+TKQ +    D  
Sbjct  8     KVEVPCYFLCPISLQMMRDPVTLPSGITYDRDGIERWLLTA--GTCPLTKQPVPA--DCE  63

Query  1391  LTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKST-----PEMLAKV  1227
              TPN  LRR+IQSW  LHA+ GVER PTPKPP+ ++ + +L+ +  +T     P+ L   
Sbjct  64    PTPNHTLRRLIQSWSALHAAAGVERVPTPKPPIDRARVAELVSRIAATSRTTAPQELLAA  123

Query  1226  LQTLRSMAPENAANKRCMESAGVAE------FLAQIIKTSEDNPT-DDALYVLHNLGLSE  1068
             L+ LR +  E+  N++ + +   A       F+A     +E     D+AL ++ +L LSE
Sbjct  124   LRELRDVVAESERNRKLVAAVPAAVDVLATVFVASAATKAESVAVCDEALEIISSLQLSE  183

Query  1067  NGL-RSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlS  891
               L R I   +   +D+L  V+Q  +  SRA+A ++L+++               +L   
Sbjct  184   QCLARVIFETNEALVDALVSVLQRSNTASRAHAALILQNV-----TAAMSPSRLVSLPEQ  238

Query  890   FFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYC  711
              F +VVQ++RD  S+ A+K+ALH+L      GRNR+KA +AGA  V++D+LLD  ++R C
Sbjct  239   VFGEVVQLIRDEVSKAATKAALHVLVGTTSWGRNRVKAVDAGAVPVLVDILLDAPQRRAC  298

Query  710   EWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPS  531
             E  L  L++LC CAEGRA +L H AG+A V  K  RVS VA ++ +R+L S+A+ +ATP+
Sbjct  299   ELALGALDRLCGCAEGRAALLAHGAGVATVGWKAFRVSDVATDKAVRVLRSVARHAATPA  358

Query  530   VVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCL  387
             VVQEM   GV   LC V   +    + +ERA E L+ HA+ W+ SPCL
Sbjct  359   VVQEMAHTGVVGTLCAVALSEYCAERTRERARETLRRHARAWRTSPCL  406



>ref|XP_002524055.1| Spotted leaf protein, putative [Ricinus communis]
 gb|EEF38265.1| Spotted leaf protein, putative [Ricinus communis]
Length=403

 Score =   312 bits (800),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 169/405 (42%), Positives = 253/405 (62%), Gaps = 17/405 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M++I++P YF+CPISL+IMKDPVTI TGITYDRD+IE+W+F+ KN  CPVTKQ+L    D
Sbjct  1     MDDIEIPQYFICPISLQIMKDPVTIITGITYDRDSIEQWLFTTKNTICPVTKQSLPKDFD  60

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WC  +AS G++R PTPKP + K H+LKL++     P +  K L  
Sbjct  61    --LTPNHTLRRLIQAWCIDNASSGIDRIPTPKPCLDKFHLLKLIKDLH-LPRLQMKTLVQ  117

Query  1217  LRSMAPENAANKRCMESAGVAE----FLAQIIKTSEDNPTDDALYVLHNLGLSENGLRSI  1050
             L  +A EN  N++ M   GV +    F+    K    +   +A+ +L  + +     R++
Sbjct  118   LELLAAENDRNRKYMAETGVPKALLLFIVTCFKKGRFDGIQEAVSILRLIRIPPQESRAL  177

Query  1049  LGHDTQFIDSLTRVMQHGSYES----RAYAVMLLKSMLEtttlnpslsqltttlnlSFFH  882
             L  + Q I+SLT V++  S ++    +++AV +LK + E  + +             FF 
Sbjct  178   LSENDQIIESLTWVLRWCSSDNHITIKSHAVSVLKMVSEDASSSVLERLKPE-----FFE  232

Query  881   QVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWG  702
              +V ++R+  +++   +AL +L++ C  GRNRI   +AGA   +I+L     EK+  E  
Sbjct  233   TIVGVIREKITQQGINAALKVLSHACPWGRNRIMMVDAGAVFELIELEWRYPEKKTTELI  292

Query  701   LSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQ  522
             L +L  LC CA+GRA+ L H  G+AVV+++IL+VS  A++R + IL  I KFS T  V+Q
Sbjct  293   LGILFHLCSCADGRAKFLSHRGGIAVVAKRILKVSPAADDRAVLILSLICKFSGTSMVLQ  352

Query  521   EMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCL  387
             EML +   +KLC+++Q DC V   K++A EIL+LH+ EWKNSPC+
Sbjct  353   EMLNVKAVSKLCMMLQADCAVYL-KDKAREILRLHSDEWKNSPCI  396



>ref|XP_011008842.1| PREDICTED: E3 ubiquitin-protein ligase PUB24-like [Populus euphratica]
Length=410

 Score =   312 bits (799),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 175/418 (42%), Positives = 261/418 (62%), Gaps = 19/418 (5%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGK-NATCPVTKQALSGTD  1401
             M+EI+VP YFLCPISL+I+KDPVT  TGITY+R++IE+W+ + K NATCPVTKQ+L    
Sbjct  1     MDEIEVPEYFLCPISLQILKDPVTTITGITYERESIEQWLKAAKSNATCPVTKQSLPR--  58

Query  1400  DEFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEML-AKVL  1224
             D  LTPN  LRR+IQSWCT++A  GV+R PTPK P+ KS I +LL+   +  + L  K +
Sbjct  59    DSELTPNHTLRRLIQSWCTVNAICGVDRIPTPKSPIKKSQIFRLLKDLDAPDDHLRTKAV  118

Query  1223  QTLRSMAPENAANKRCMESAGVAE----FLAQIIKTSEDNPTDDALYVLHNLGLSENGLR  1056
             + + ++A EN  N+ CM  AGV +    F+ +  K  +    ++ L +L+ +      ++
Sbjct  119   RRMEALAKENERNRTCMVEAGVTKAAVLFIIKCFKEGKTAGLEEILRILYLIWNPSQEIK  178

Query  1055  SILGHDTQFIDSLTRVMQHGSYES----RAYAVMLLKSMLEtttlnpslsqltttlnlSF  888
              ++  +  FIDSLT ++     ++    + +A++LL    E        S         F
Sbjct  179   LLVRENQDFIDSLTWILSCDQIDNHVAVKTHAMLLLHKTTEIVCQKLLGSLKVD-----F  233

Query  887   FHQVV-QILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYC  711
             F +++ ++LR   S++A KS+L +LA VC  GRNR+K  EA A   +I+L L+  EK   
Sbjct  234   FKEIITRVLRKRISKQAIKSSLLVLAEVCPWGRNRMKIVEANAVFELIELELEKPEKNIT  293

Query  710   EWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPS  531
             E   ++L QLC CA+GR + LKHA  +A++S+++LRVS   ++R +RIL SI+KFSA   
Sbjct  294   ELIFNILAQLCSCADGRQQFLKHAGSIAMLSKRVLRVSPATDDRAVRILDSISKFSAGDE  353

Query  530   VVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIHNTIG  357
              V EML++G  +KLC+VIQ DC     K++A EIL+LH+  W NSPC+ + L+    G
Sbjct  354   AVLEMLRVGAVSKLCMVIQADCA-PYLKKKAREILRLHSHMWNNSPCIAVYLLTRYPG  410



>ref|NP_001047057.1| Os02g0539200 [Oryza sativa Japonica Group]
 dbj|BAD28838.1| putative immediate-early fungal elicitor protein [Oryza sativa 
Japonica Group]
 dbj|BAF08971.1| Os02g0539200 [Oryza sativa Japonica Group]
Length=442

 Score =   313 bits (802),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 184/442 (42%), Positives = 269/442 (61%), Gaps = 55/442 (12%)
 Frame = -1

Query  1577  MEEI--QVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNA-----TCPVTKQ  1419
             MEE   +VP YFLCPISLEIM+DPVT++TGITYDR +IE+W+F G        TCPVT++
Sbjct  1     MEEAAAEVPSYFLCPISLEIMRDPVTLATGITYDRSSIERWMFGGGGGDGGKGTCPVTRR  60

Query  1418  ALSGTDDEFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEM  1239
              L+  + E  TPN  LRR+IQ+WC   A+H VERFPTP+PPV    +  L+ +  +T   
Sbjct  61    QLAPAEREA-TPNHTLRRLIQAWC---AAHAVERFPTPRPPVDSCRVAALVDEGTTTMLG  116

Query  1238  LAK------VLQTLRSMAPENAANKRCMESA-GVAEFLAQII------------------  1134
                       L+ ++++A E+  NKRC+E+  G  EFL  ++                  
Sbjct  117   GGGRQRQLAALREIKAIAAESDRNKRCVEATPGAVEFLVSVVVQSHAAASTSASSDDDDL  176

Query  1133  -------KTSEDNPTDDALYVLHNLGLSENGLRSILGHD--TQFIDSLTRVMQHGSYESR  981
                      S  +P ++AL VL++L  SE  LR +LG D    F+D+L  V++  SY SR
Sbjct  177   FDSVIDSPMSTSSPEEEALGVLYSLKPSEPTLRRVLGKDNGVGFLDTLASVLRRPSYRSR  236

Query  980   AYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQ  801
             AYA++LLK++      +    +    ++     +VV+++ D  S KA K+ALH+L  +C 
Sbjct  237   AYAILLLKAV-----TSAMPPERLMAVSPELVEEVVRVVSDGVSSKAVKAALHVLCRLCP  291

Query  800   GGRNRIKAAEAGAATVVIDLLLDT----NEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAG  633
              GRNR+KA EAGA   +++LLLD       +R  E  +  ++ LC CAEGR+E++ H AG
Sbjct  292   WGRNRVKAVEAGAVAALVELLLDEEGGGGRRRAAELAVVAIDHLCGCAEGRSELVAHPAG  351

Query  632   LAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGK  453
             LAVVS++ +RVS  A E  +R L+++A+ +ATP+V+QEML +GV AKL LV+Q D G  +
Sbjct  352   LAVVSKRAMRVSPAATESAVRALHAVARNAATPAVLQEMLAVGVVAKLLLVLQADGG-ER  410

Query  452   NKERAAEILKLHAKEWKNSPCL  387
              + RA E+L+ +A+ WK+SPCL
Sbjct  411   ARARAREMLRANARVWKDSPCL  432



>ref|XP_007203251.1| hypothetical protein PRUPE_ppa019526mg [Prunus persica]
 gb|EMJ04450.1| hypothetical protein PRUPE_ppa019526mg [Prunus persica]
Length=403

 Score =   311 bits (798),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 167/409 (41%), Positives = 257/409 (63%), Gaps = 17/409 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M++I+VP YF+CPISL+IM+DPVT  TGITYDRD+IE W+F  KN TCPVTKQ L    D
Sbjct  1     MDDIEVPQYFVCPISLQIMQDPVTAITGITYDRDSIEHWLFQSKNTTCPVTKQPLP--RD  58

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WCT +AS+G++R PTPKPP+ K+ +LKLL+   + P++  K+++ 
Sbjct  59    SELTPNHTLRRLIQAWCTENASYGIDRIPTPKPPLDKAQVLKLLKDFWN-PKLQLKIIRK  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQII-----KTSEDNPTDDALYVLHNLGLSENGLRS  1053
             +  +A ++  N++ +  AGVA+ +   I     K    +  ++AL +LH + +S   L  
Sbjct  118   IEFLATKSEGNRKYLVDAGVAKAMLLFIANRCYKEGLVDGLEEALSILHFVRISSEELSL  177

Query  1052  ILGHDTQFIDSLTRVMQ---HGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFH  882
             +   + Q IDSLT V             +AV++LKS+++  T +   +         FF 
Sbjct  178   LFMENDQIIDSLTWVFGCKLQNQISVSTHAVLVLKSIIQKATSSVLETLNPD-----FFK  232

Query  881   QVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWG  702
             ++V +LR+  +++ + +ALH++ + C  GRNRIK  +AGA   +I+L  +  EK+  E  
Sbjct  233   KLVGVLRNGVTQQGTNAALHIMLDACPWGRNRIKMVDAGAVYQLIELEFEAPEKKITELI  292

Query  701   LSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQ  522
               +L  LC CA+GRA+ + H  G+ VVS ++L+VS  A++R + IL  I K+S T  V+Q
Sbjct  293   FGILFHLCSCADGRAQFVSHKGGIFVVSNRLLKVSPSADDRVVLILSLICKYSGTNMVLQ  352

Query  521   EMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDL  375
             EML++G   +LC ++QVDC     K++A +IL+ H +EWK  PCL + L
Sbjct  353   EMLEVGAVYRLCTLLQVDCA-PYLKDKARQILRSHYEEWKKCPCLGISL  400



>gb|EAY86187.1| hypothetical protein OsI_07564 [Oryza sativa Indica Group]
Length=442

 Score =   312 bits (800),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 181/436 (42%), Positives = 266/436 (61%), Gaps = 53/436 (12%)
 Frame = -1

Query  1565  QVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNA-----TCPVTKQALSGTD  1401
             +VP YFLCPISLEIM+DPVT++TGITYDR +IE+W+F G        TCPVT++ L+  +
Sbjct  7     EVPSYFLCPISLEIMRDPVTLATGITYDRSSIERWMFGGGGGDGGKGTCPVTRRQLAPAE  66

Query  1400  DEFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAK---  1230
              E  TPN  LRR+IQ+WC   A+H VERFPTP+PPV    +  L+ +  +T         
Sbjct  67    REA-TPNHTLRRLIQAWC---AAHAVERFPTPRPPVDSCRVAALVDEGTTTMLGGGGRQR  122

Query  1229  ---VLQTLRSMAPENAANKRCMESA-GVAEFLAQII------------------------  1134
                 L+ ++++A E+  NKRC+E+  G  EFL  ++                        
Sbjct  123   QLAALREIKAIAAESDRNKRCVEATPGAVEFLVSVVVQSHAAASTSASSDDDDLFDSVID  182

Query  1133  -KTSEDNPTDDALYVLHNLGLSENGLRSILGHD--TQFIDSLTRVMQHGSYESRAYAVML  963
                S  +P ++AL VL++L  SE  LR +LG D    F+D+L  V++  SY SRAYA++L
Sbjct  183   SPMSTSSPEEEALGVLYSLKPSEPTLRRVLGKDNGVGFLDTLASVLRRPSYRSRAYAILL  242

Query  962   LKSMLEtttlnpslsqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRI  783
             LK++      +    +    ++     +VV+++ D  S KA K+ALH+L  +C  GRNR+
Sbjct  243   LKAV-----TSAMPPERLMAVSPELVEEVVRVVSDGVSSKAVKAALHVLCRLCPWGRNRV  297

Query  782   KAAEAGAATVVIDLLLDT----NEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSR  615
             KA EAGA   +++LLLD       +R  E  +  ++ LC CAEGR+E++ H AGLAVVS+
Sbjct  298   KAVEAGAVAALVELLLDEEGGGGRRRAAELAVVAIDHLCGCAEGRSELVAHPAGLAVVSK  357

Query  614   KILRVSQVANERGLRILYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAA  435
             + +RVS  A E  +R L+++A+ +ATP+V+QEML +GV AKL LV+Q D G  + + RA 
Sbjct  358   RAMRVSPAATESAVRALHAVARNAATPAVLQEMLAVGVVAKLLLVLQADGG-ERARARAR  416

Query  434   EILKLHAKEWKNSPCL  387
             E+L+ +A+ WK+SPCL
Sbjct  417   EMLRANARVWKDSPCL  432



>ref|XP_004303404.1| PREDICTED: E3 ubiquitin-protein ligase PUB24-like [Fragaria vesca 
subsp. vesca]
Length=410

 Score =   311 bits (796),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 173/407 (43%), Positives = 248/407 (61%), Gaps = 19/407 (5%)
 Frame = -1

Query  1574  EEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDE  1395
             E+I VP YF+CPISL+IM DPVT  TGITYDRD+IE W+F  KN TCPVTKQ L    D 
Sbjct  3     EDIDVPQYFVCPISLQIMTDPVTAITGITYDRDSIEHWLFHAKNTTCPVTKQRLP--KDS  60

Query  1394  FLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTL  1215
              LTPN  LRR+IQ+WCT +AS GV R PTPKPP++K+ ++KLL+     P+   K+++ L
Sbjct  61    ELTPNHTLRRLIQAWCTDNASKGVNRIPTPKPPLSKAQVVKLLKDFPD-PQFQLKIVRKL  119

Query  1214  RSMAPENAANKRCMESAGVAE----FLAQIIKTSEDNPTDDALYVLHNLGLSENGLRSIL  1047
               +A EN  N + M  AGVA+    F+    K    +  ++AL VLH + +  + L  +L
Sbjct  120   ELLATENEGNLKYMAEAGVAKTMLLFIVTCYKNGRVDGLEEALSVLHFVRIPPDELNHLL  179

Query  1046  GHDTQFIDSLTRVMQ---HGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQV  876
               +   +DSLT V+            + +++LKSM++  + +   +         FF  +
Sbjct  180   LENNHIMDSLTWVLSREMENQIAVNTHVMLVLKSMIQKVSSSVLETLNPE-----FFRNI  234

Query  875   VQILRDN-FSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLD--TNEKRYCEW  705
             + +LR+   +++   +AL ++ + C+ G NRIK  E+GA   +++L L    +EK+  E 
Sbjct  235   LGVLRNGAVTQQGINAALQVMLDTCRCGSNRIKLVESGAVYELVELELGGAVHEKKTTEL  294

Query  704   GLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVV  525
              L +L  LC CAEGRA+ L H A + VVS +IL+ SQ A++R + ILY I+K+S    V+
Sbjct  295   VLGILFHLCSCAEGRAQFLGHKASILVVSDRILKGSQAADDRAVLILYLISKYSGNKMVL  354

Query  524   QEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLP  384
             QEML+ G   KL ++IQVDC     KE+A EIL  H+ EWKNSPC P
Sbjct  355   QEMLEFGAVKKLIMLIQVDCA-PYLKEKAREILSSHSGEWKNSPCFP  400



>ref|XP_002314258.1| hypothetical protein POPTR_0009s02140g [Populus trichocarpa]
 gb|EEE88213.1| hypothetical protein POPTR_0009s02140g [Populus trichocarpa]
Length=410

 Score =   310 bits (795),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 171/418 (41%), Positives = 260/418 (62%), Gaps = 19/418 (5%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGK-NATCPVTKQALSGTD  1401
             M+EI+VP YFLCPISL+I+KDPVT  TGITY+R++IE+W+ + K N TCPVTKQ+L    
Sbjct  1     MDEIEVPEYFLCPISLQILKDPVTTITGITYERESIEQWLKAAKSNPTCPVTKQSLPR--  58

Query  1400  DEFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEML-AKVL  1224
             D  LTPN  LRR+IQSWCT++A +GV+R PTPK P+ KS I +L++   +  + L  K L
Sbjct  59    DSELTPNHTLRRLIQSWCTVNAIYGVDRIPTPKSPIKKSQIFRLIKDLDAPDDHLRTKAL  118

Query  1223  QTLRSMAPENAANKRCMESAGVAE----FLAQIIKTSEDNPTDDALYVLHNLGLSENGLR  1056
             + + ++A EN  N+ CM  AGV +    F+ +  K  +    ++ L +L+ +      ++
Sbjct  119   RRMEALAKENERNRTCMVEAGVTKAAVLFIIKCFKEGKTAGLEEVLRILYLIWNPSQEIK  178

Query  1055  SILGHDTQFIDSLTRVMQ----HGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSF  888
              ++  +  FIDSLT +++    +   + +++A++LL    E        S         F
Sbjct  179   LLVRENQDFIDSLTWILRCDQINNHVDVKSHAMLLLHKTTEIVCQKLLESLKVD-----F  233

Query  887   FHQVV-QILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYC  711
             F +++ ++LR   S++A KS+L +L  VC  GRNR+K  EA A   +I+L L+  EK   
Sbjct  234   FKEIITRVLRKRISKQAVKSSLLVLTEVCHWGRNRMKIVEANAVFELIELELEKPEKNIT  293

Query  710   EWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPS  531
             E   ++L QLC CA+GR + LKHA  +A++S+++LRVS   ++R L IL SI+KFSA+  
Sbjct  294   ELIFNILAQLCSCADGREQFLKHAGSIAMISKRVLRVSPATDDRALHILDSISKFSASDE  353

Query  530   VVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIHNTIG  357
                EML++G  +KLC+VIQ DC     K++A  IL+LH+  W NSPC+ + L+    G
Sbjct  354   AALEMLRVGAVSKLCMVIQADCA-PYLKKKARGILRLHSHMWNNSPCIAVYLLTRYPG  410



>ref|XP_010247277.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Nelumbo nucifera]
Length=405

 Score =   310 bits (795),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 165/409 (40%), Positives = 256/409 (63%), Gaps = 16/409 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M++I++P YF+CPISL+IMKDPV + TGITYDR++IE+W+ SGKN TCPVTKQ L    D
Sbjct  1     MDDIEIPQYFVCPISLQIMKDPVIVVTGITYDRESIEQWLSSGKNTTCPVTKQPLPNESD  60

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN+ LRR+IQ+WC  +ASHGV+R PTPK    ++ ++KL+ Q    P++  + L+ 
Sbjct  61    --LTPNLTLRRLIQAWCITNASHGVDRIPTPKSFSDRTQVVKLI-QDLGVPQLRFQSLKK  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQII----KTSEDNPTDDALYVLHNLGLSENGLRSI  1050
             L ++A +N  N++ M  AGV + +  +I    K +  +   +AL V H + +     + +
Sbjct  118   LEAVASKNEKNRKSMVEAGVIKAMVSLITSCFKGALVDGLSEALNVFHLVWIPTEQTKKL  177

Query  1049  LGHDTQFIDSLTRVMQHGSYES---RAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQ  879
             +  +   ++S+  V+Q    +    +  A+++LK + E  +               FF +
Sbjct  178   VSDNHDLVESIIWVLQQKMDDQETVKTRALLVLKIITEVASGMLMERLKLD-----FFKK  232

Query  878   VVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGL  699
             +V +LR   S++A+K ALH+L   C  GRNR K  EAGA   +I++ L   EKR  E  +
Sbjct  233   MVGVLRHRISQQATKVALHVLLEACLCGRNRAKIIEAGAVFELIEIELGAPEKRITELVM  292

Query  698   SVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQE  519
             ++L+ LC   +GRA++L HA G+A+VS++ILRVS   ++R +RIL SIAKFS T  V+ E
Sbjct  293   AILDHLCCSPDGRAQLLGHAGGIAIVSKRILRVSPAVDDRAVRILMSIAKFSGTNEVLHE  352

Query  518   MLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             ML++G  +KLC+V+Q +      KE+A E+L+LH   W +SPC+ + L+
Sbjct  353   MLRVGAVSKLCMVLQAESA-ANVKEKAREVLRLHNNVWSSSPCIQVYLL  400



>ref|XP_002308324.2| hypothetical protein POPTR_0006s21920g [Populus trichocarpa]
 gb|EEE91847.2| hypothetical protein POPTR_0006s21920g [Populus trichocarpa]
Length=409

 Score =   310 bits (794),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 170/405 (42%), Positives = 250/405 (62%), Gaps = 17/405 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M++I+VP +F+CPISL+IMKDPVT  TGITYDR++IE W+F+ +N  CPVTKQ L    D
Sbjct  1     MDDIEVPKFFVCPISLQIMKDPVTTITGITYDRESIEHWLFTSQNTACPVTKQPLQKDLD  60

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WCT +ASHGV+R PTPKP + K+H+LKL++   S  E+  K L  
Sbjct  61    --LTPNHTLRRLIQAWCTENASHGVDRIPTPKPCLDKAHVLKLIKNL-SHHELQIKTLTR  117

Query  1217  LRSMAPENAANKRCMESAGVAE----FLAQIIKTSEDNPTDDALYVLHNLGLSENGLRSI  1050
             L  +A EN  N++CM  AG+ +    F+A   K  + +   +AL +L  + +  +  R+ 
Sbjct  118   LELLAAENERNRKCMVDAGLPKAMLLFIAACFKKGQVSGIQEALSILCFIRIPRSESRAF  177

Query  1049  LGH-DTQFIDSLTRVM--QHGSYES-RAYAVMLLKSMLEtttlnpslsqltttlnlSFFH  882
                 D + I+SLT V+  +  +Y + +++A  +LK +LE  + +             FF 
Sbjct  178   FSEIDDKIIESLTWVLGCKMENYATVKSHAASVLKMLLEEASSSVLERLKPE-----FFE  232

Query  881   QVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWG  702
             ++V +LR+  + +   +AL +L N C  GRNR    E+GA   +I+L L + E+R  E  
Sbjct  233   RIVGVLRERITHQGINAALQVLLNACPWGRNRKMMVESGAVFELIELELGSPERRTTELN  292

Query  701   LSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQ  522
               VL  LC CAEGRA+ L H   +AVV+++ILRVS   ++R + IL  I KFS T  V+Q
Sbjct  293   FGVLFHLCCCAEGRAQFLSHGGSIAVVAKRILRVSPAVDDRAILILSQICKFSGTSMVIQ  352

Query  521   EMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCL  387
             EM  +    KLC+++Q DC     K++A EIL+ H+ +WKNSPC+
Sbjct  353   EMADVKAVTKLCMLLQADCATYL-KDKAREILRSHSDKWKNSPCI  396



>ref|XP_008241066.1| PREDICTED: E3 ubiquitin-protein ligase PUB24 [Prunus mume]
Length=409

 Score =   310 bits (794),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 163/405 (40%), Positives = 253/405 (62%), Gaps = 17/405 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M++I+VP YF+CPISL+IM+DPVT  TGITYDRD+IE W+F  KN TCPVTKQ L    D
Sbjct  1     MDDIEVPQYFVCPISLQIMQDPVTAITGITYDRDSIEHWLFQSKNTTCPVTKQPLP--RD  58

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WCT +ASHG++R PTPKPP+ K+ +LKLL+   + P++  K+++ 
Sbjct  59    SELTPNHTLRRLIQAWCTENASHGIDRIPTPKPPLDKAQVLKLLKDFWN-PKLQLKIIRK  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQII-----KTSEDNPTDDALYVLHNLGLSENGLRS  1053
             +  +A ++  N++ +  AGVA+ +   I     K    +  ++AL +LH + +S   L  
Sbjct  118   IEFLATKSEGNRKYLVDAGVAKAMLLFIANRCYKEGLVDGLEEALSILHFVRISSEELSL  177

Query  1052  ILGHDTQFIDSLTRVMQ---HGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFH  882
             +   + Q  DSLT V             +AV++LKS+++    +   +         FF 
Sbjct  178   LFMENDQIFDSLTWVFGCKLQNQISVSTHAVLVLKSLIQKANSSVLETLNPD-----FFK  232

Query  881   QVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWG  702
             ++V +L++  +++ + +ALH++ + C  GRNRIK  +AGA   +I+L  +  EK+  E  
Sbjct  233   KLVGVLKNGVTQQGANAALHIMLDACPWGRNRIKMVDAGAVYELIELEFEAPEKKTTELI  292

Query  701   LSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQ  522
               +L  LC CA+GRA+ + H  G+ VVS ++ +VS  A++R + IL  I K+S T  V+Q
Sbjct  293   FGILFHLCSCADGRAQFVSHKGGIFVVSNRLWKVSPSADDRAILILSLICKYSGTNMVLQ  352

Query  521   EMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCL  387
             EML++G   +LC ++QVDC     K++A +IL+ H++EWK  PCL
Sbjct  353   EMLEVGAVYRLCTLLQVDCA-PYLKDKARQILRSHSEEWKKCPCL  396



>ref|XP_007132499.1| hypothetical protein PHAVU_011G099300g [Phaseolus vulgaris]
 gb|ESW04493.1| hypothetical protein PHAVU_011G099300g [Phaseolus vulgaris]
Length=410

 Score =   309 bits (792),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 167/413 (40%), Positives = 258/413 (62%), Gaps = 19/413 (5%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M E+++P YF+CPIS +IM+DPVT  TGITYDR+ IE+W+   K+  CPVTKQ+L  +  
Sbjct  1     MAEVEIPQYFVCPISFQIMEDPVTTVTGITYDREGIEEWLRKAKHCVCPVTKQSLPRST-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
             ++LTPN  LRR+IQ+WC+ + ++GV+R PTPK P++   + KLL+  ++ P      L+ 
Sbjct  60    QYLTPNHTLRRLIQAWCSAYTANGVDRIPTPKTPLSMIQVQKLLKGLEA-PHSCGTSLEK  118

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQII-KTSEDNPTD-----DALYVLHNLGLSENGLR  1056
             L ++A ++  N+ CM  AGVA  + ++I K  +D  T+     +AL ++H L  + + ++
Sbjct  119   LHALATQSQRNRTCMAEAGVARAMVKVINKNFKDGNTNTSSVQEALRIVHLLWNNHSSMK  178

Query  1055  SILGHDTQFIDSLTRVMQH----GSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSF  888
              ++G    FI SLT +++H     + +    A+ LLK  +E        +         F
Sbjct  179   PLVGESLDFIYSLTWILKHYLDDNNIKMVNEAMPLLKLTIEVADSTLLGNLSLE-----F  233

Query  887   FHQVVQILRD-NFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYC  711
             F ++V+ LR    S++  KSALH+L      GRNR +  EAGA T +I+L L+  EK   
Sbjct  234   FKEMVRTLRKRTLSQQTIKSALHVLIQTSLLGRNRTRIVEAGAVTQLIELELEKPEKNMT  293

Query  710   EWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPS  531
             E   ++L  LC CA+GR + ++HAAG+AVVS+++LRVS   ++R + +   IAKFSA+ +
Sbjct  294   ELIFNLLAHLCSCADGREQFVRHAAGIAVVSKRVLRVSAATDDRAIHVFSVIAKFSASNT  353

Query  530   VVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             VV EML++G  +KLC+V+Q DC     KE+A +IL+LH+K W NSPC+ L L 
Sbjct  354   VVLEMLRVGAVSKLCMVMQADCA-SYLKEKARDILRLHSKVWNNSPCIQLYLF  405



>gb|EMT03610.1| U-box domain-containing protein 23 [Aegilops tauschii]
Length=420

 Score =   308 bits (788),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 172/418 (41%), Positives = 258/418 (62%), Gaps = 37/418 (9%)
 Frame = -1

Query  1568  IQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEFL  1389
             ++VPPYFLCPISLEIM+DPVT++TGITYDR +IE+W+  G N TCPVT+Q L+  D E  
Sbjct  6     VEVPPYFLCPISLEIMRDPVTLATGITYDRSSIERWLSDGHN-TCPVTQQKLAEADREA-  63

Query  1388  TPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQ---AKSTPEMLAKVLQT  1218
             TPN  LRR+ Q+   LHA   VER PTP+PP+    +  ++ +   A    E+ A  L+ 
Sbjct  64    TPNHTLRRLTQAGGALHA---VERLPTPRPPLDAGRVAAIVEEGHGAGRQQELAA--LRE  118

Query  1217  LRSMAPENAANKRCMESA-GVAEFLAQIIK--------------------TSEDNPTDDA  1101
             ++++  EN  N+RC+E+  G  EFL  +++                    TS  +P +DA
Sbjct  119   IKAIVAENDRNRRCVEATPGAVEFLVSVLRNHATASKSAEDLLELSLDSPTSTSSPEEDA  178

Query  1100  LYVLHNLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpsl  921
             L V+ +L  S+  L  IL  +  F+D+L  +++  SY SR Y ++LLK+M+        +
Sbjct  179   LSVICSLKPSKKSLIRILEKNGDFLDTLVYMLRRPSYRSRCYGILLLKAMMSVMEPVRLM  238

Query  920   sqltttlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDL  741
             +  T  +         +      S KA K+AL++L  +C  GRNR+KA EAGA TV+++L
Sbjct  239   AVKTEVVQEVVRVVSDR-----VSAKAVKAALNVLCRLCPWGRNRVKAVEAGAMTVLVEL  293

Query  740   LLDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILY  561
             LLD   +   E  +  ++ LC CAEGR++++ H AGLAVV++K +R+S    E  +R L+
Sbjct  294   LLDEGGRHPTELAVVAIDHLCGCAEGRSDLVAHPAGLAVVAKKAMRISLTTTESAVRALH  353

Query  560   SIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCL  387
             ++A+ S TP+V+QEML +GV AKL LV+QVD G  + + +A E+LK+HA+ WK+SPC+
Sbjct  354   AVARHSPTPAVLQEMLAVGVVAKLLLVLQVDAG-ERARAKAKELLKMHARVWKDSPCM  410



>ref|XP_010263014.1| PREDICTED: E3 ubiquitin-protein ligase PUB24-like [Nelumbo nucifera]
Length=405

 Score =   307 bits (786),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 163/409 (40%), Positives = 255/409 (62%), Gaps = 16/409 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M+EI++P YF+CPISL+IMKDPVT+ TGITYDR++IE+W+F GKN TCPVTKQ L    D
Sbjct  1     MDEIEIPQYFICPISLQIMKDPVTMVTGITYDRESIEQWLFFGKNTTCPVTKQPLPKDSD  60

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WC  +AS+GV++ PTPK    ++ ++KL+++ +  P++  + L+ 
Sbjct  61    --LTPNHTLRRLIQAWCIANASNGVDQIPTPKSLFDRTQVVKLIQELR-IPQLQLQSLRK  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQII----KTSEDNPTDDALYVLHNLGLSENGLRSI  1050
             L ++A  N  N+  M  AGVA+ +  +I    + +  +   +A  V H +      ++ +
Sbjct  118   LEAIASRNEKNRGPMVEAGVAKAMVSLIMSRFREARTDGLSEAFSVFHLVCTPTEKMKKL  177

Query  1049  LGHDTQFIDSLTRVMQHGSYES---RAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQ  879
             +  +   ++S+  V+Q    +    +  AV++LK++ E  + +             FF  
Sbjct  178   VSENYDVVESIMWVLQQEMDDQETVKTRAVLVLKTITEVASGSLMERLKPE-----FFKA  232

Query  878   VVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGL  699
             +V +LR   S++A+K+ALH+L   C  GRNR    EAGA   +I++ L   EKR  E   
Sbjct  233   MVGVLRQQISQQATKAALHMLLEACPWGRNRSIIIEAGAVFDLIEIELRMPEKRTTELIF  292

Query  698   SVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQE  519
              +L+ LC   +GRA++L H+AG+A+VS++ILRVS   ++R + IL  IAKFS    VV E
Sbjct  293   GILDHLCCSPDGRAQLLGHSAGIAMVSKRILRVSPAVDDRAVHILSYIAKFSGNNEVVHE  352

Query  518   MLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             ML++G  +KLC+V+Q +C   K KE+A  +L+LH+  W NSPC+ + L+
Sbjct  353   MLRVGAVSKLCMVLQAECS-AKVKEKARGVLRLHSNVWNNSPCIAVYLL  400



>ref|XP_008391979.1| PREDICTED: E3 ubiquitin-protein ligase PUB24 [Malus domestica]
Length=403

 Score =   305 bits (782),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 169/404 (42%), Positives = 240/404 (59%), Gaps = 17/404 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M+ I+VP YF+CPISL+IMKDPVT  TGITYDR++IE W+F  KN TCPVTKQ L    D
Sbjct  1     MDGIEVPQYFICPISLQIMKDPVTAITGITYDRESIEHWLFQSKNITCPVTKQPLQ--KD  58

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  L R+IQ+WC  +AS+G+++ PTPK P  K+ +LKLL+     P++  K+++ 
Sbjct  59    SELTPNHTLHRLIQAWCIKNASYGIDQIPTPKTPPNKAQVLKLLKDFWH-PQLQLKIIRK  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQII-----KTSEDNPTDDALYVLHNLGLSENGLRS  1053
             L  +A EN  N++ M  AGVA  +   I     K  + +  ++AL +LH + +S   L  
Sbjct  118   LELLAVENEGNRKYMVEAGVANAMLLFITNRCYKNDQVDGLEEALSILHFVRISSEELNR  177

Query  1052  ILGHDTQFIDSLTRVM---QHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFH  882
                 +   IDSLT V             YAV++LK +++        +         FF 
Sbjct  178   HFMENYHIIDSLTWVFGCEMENQITVSTYAVLVLKYIIQKANSRVLETLNPD-----FFK  232

Query  881   QVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWG  702
             ++V +LR+  + +   +ALH++ + C  GRNRIK  EAGA   +I+L     EKR  E  
Sbjct  233   KLVGVLRNGVTEQGMNAALHVMLDACPWGRNRIKMVEAGAVHELIELEFGAPEKRTTELI  292

Query  701   LSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQ  522
               +L  LC CA+GR + + H  G++VVSR++LRVS  A++R + IL  I K+S T  V+Q
Sbjct  293   FGILFHLCSCADGRXQFISHKGGISVVSRRLLRVSPAADDRAVLILSMICKYSGTNLVLQ  352

Query  521   EMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPC  390
             EML+ G  A+LC +IQVDC     K +A EIL+ H +EWKN  C
Sbjct  353   EMLEFGAVARLCTLIQVDCP-PYLKGKAREILRSHYEEWKNCRC  395



>ref|XP_008351505.1| PREDICTED: E3 ubiquitin-protein ligase PUB24-like [Malus domestica]
Length=403

 Score =   305 bits (780),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 168/404 (42%), Positives = 240/404 (59%), Gaps = 17/404 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M+ I+VP YF+CPISL+IMKDPVT  TGITYDR++IE W+F  KN TCPVTKQ L    D
Sbjct  1     MDGIEVPQYFICPISLQIMKDPVTAITGITYDRESIEHWLFQSKNITCPVTKQPLQ--KD  58

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  L R+IQ+WC  +AS+G+++ PTPK P  K+ +LKLL+     P++  K+++ 
Sbjct  59    SELTPNHTLHRLIQAWCIKNASYGIDQIPTPKTPPNKAQVLKLLKDFWH-PQLQLKIIRK  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQII-----KTSEDNPTDDALYVLHNLGLSENGLRS  1053
             L  +A EN  N++ M  AGVA  +   I     K  + +  ++AL +LH + +S   L  
Sbjct  118   LELLAVENEGNRKYMVEAGVANAMLLFITNRCYKNDQVDGLEEALSILHFVRISSEELNR  177

Query  1052  ILGHDTQFIDSLTRVM---QHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFH  882
                 +   IDSLT V             YAV++LK +++        +         FF 
Sbjct  178   HFMENYHIIDSLTWVFGCEMENQITVSTYAVLVLKYIIQKANSRVLETLNPD-----FFK  232

Query  881   QVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWG  702
             ++V +LR+  + +   +ALH++ + C  G NRIK  EAGA   +I+L     EKR  E  
Sbjct  233   KLVGVLRNGVTEQGMNAALHVMLBACPWGXNRIKMVEAGAVHELIELEFGAPEKRTTELI  292

Query  701   LSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQ  522
               +L  LC CA+GR++ + H  G++VVSR++LRVS  A++R + IL  I K+S T  V+Q
Sbjct  293   FGILFHLCSCADGRSQFISHKGGISVVSRRLLRVSPAADDRAVLILSMICKYSGTNLVLQ  352

Query  521   EMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPC  390
             EML+ G  A+LC +IQVDC     K +A EIL+ H +EWKN  C
Sbjct  353   EMLEFGAVARLCTLIQVDCP-PYLKGKAREILRSHYEEWKNCRC  395



>ref|XP_007015663.1| Plant U-box 24, putative [Theobroma cacao]
 gb|EOY33282.1| Plant U-box 24, putative [Theobroma cacao]
Length=405

 Score =   304 bits (779),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 158/409 (39%), Positives = 252/409 (62%), Gaps = 16/409 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M+EI +P YFLCPISL+IMKDPVT  TGITYDR++IE+W+    + TCPVTKQ L    D
Sbjct  1     MDEIDIPQYFLCPISLQIMKDPVTAVTGITYDRESIEQWLKIATDTTCPVTKQPLPSDSD  60

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WCT + S+G++R PTPK P++KS ++KL+R+ + T       L+ 
Sbjct  61    --LTPNHTLRRLIQAWCTENESNGIDRIPTPKSPLSKSRVIKLMREFEHT-SFYVNALKK  117

Query  1217  LRSMAPENAANKRCMESAGVAE----FLAQIIKTSEDNPTDDALYVLHNLGLSENGLRSI  1050
             + ++  EN  N++CME AGVA+     L +  K       ++AL +++ +    + ++++
Sbjct  118   MEALGKENEKNRKCMEEAGVAKAVILLLRRCYKERRITGLEEALRLVYLIWTPSSEVKAL  177

Query  1049  LGHDTQFIDSLTRVM---QHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQ  879
             +  +   ID LT ++          + + +++L+ ++E                  FF +
Sbjct  178   VNENHDLIDCLTWILGCEMENPVVVKTHTMLVLRKVIEVANTRLVEKLKLE-----FFKE  232

Query  878   VVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGL  699
             ++++L+   S++A+KSAL ++  VC  GRN+ K  EA A   +I+  L   EK   E  +
Sbjct  233   ILRVLKLKISQQATKSALLIMIEVCLWGRNKSKIVEANAIFELIEFELQNPEKNITELNI  292

Query  698   SVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQE  519
             ++L  LC CA+GRA+ L+HA  +A+V+++ILRVS   +++ + IL  I+K+SAT  V+ E
Sbjct  293   NLLAHLCSCADGRAQFLRHAGSIAMVAKRILRVSPATDDQAVHILSLISKYSATKQVLLE  352

Query  518   MLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             ML++G   KLC+VIQ DC     KE+A  +L+LH+  W NSPC+ + L+
Sbjct  353   MLRVGAVTKLCMVIQADCA-AYLKEKARGVLRLHSNLWNNSPCIAVYLL  400



>ref|XP_011021424.1| PREDICTED: E3 ubiquitin-protein ligase PUB24-like [Populus euphratica]
Length=408

 Score =   303 bits (777),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 173/415 (42%), Positives = 260/415 (63%), Gaps = 24/415 (6%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGK-NATCPVTKQALSGTD  1401
             M +I++P YFLCPISLEI+KDPVT  TGITY+R++IE+W+ + + N TCPVTKQ L G  
Sbjct  1     MADIEIPEYFLCPISLEILKDPVTTITGITYERESIEQWLKTAQGNPTCPVTKQPLPG--  58

Query  1400  DEFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLA--KV  1227
             D  LTPN  LRR+IQSWCTL+A  G++R PTPK PV KS +L+L++     P+  +  K 
Sbjct  59    DSELTPNHTLRRLIQSWCTLNAIDGIDRIPTPKSPVKKSQVLRLMKDL-DVPDHHSSTKA  117

Query  1226  LQTLRSMAPENAANKRCMESAGVAE----FLAQIIKTSEDNPTDDALYVLHNLGLSENGL  1059
             L  L ++A +N  N+ CM  AGVA+    F+ +  K  +    ++ L +L+ +      +
Sbjct  118   LMKLEALAADNERNRICMVEAGVAKAMVLFIIKCFKEGKTTGLEEGLRILYLIWNQSQEI  177

Query  1058  RSILGHDTQFIDSLTRVMQ-----HGSYESRAYAVMLLKSMLEtttlnpslsqltttlnl  894
             + ++  + +FIDSLT +++     H + ++ A  V+         T+     +L   L +
Sbjct  178   KLLVRENQEFIDSLTWILRCKIDNHAAVKTHAMLVL-------HKTICVVCQKLLGRLEV  230

Query  893   SFFHQVV-QILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKR  717
              FF +++ ++LR   S+ A KSAL +L  VC GGRNR+K  EA A   +I+L L+  E+ 
Sbjct  231   DFFKEIITRVLRKRISKLAIKSALLILTEVCFGGRNRMKIVEANAVFELIELELEKPERN  290

Query  716   YCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSAT  537
               E   ++L QLC CA GR + LKHA  +A++S+++LRVS   ++R +RIL SI+KFSA 
Sbjct  291   ITELIFNLLAQLCSCAAGREQFLKHAGSIAMLSKRVLRVSPATDDRAVRILDSISKFSAG  350

Query  536   PSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
                V EML++G  +KLC++IQ DC     K++A  IL+LH+  W NSPC+ + L+
Sbjct  351   DEAVLEMLRVGAVSKLCMLIQADCA-PYLKKKARGILRLHSNTWNNSPCIAVYLL  404



>ref|XP_009348947.1| PREDICTED: E3 ubiquitin-protein ligase PUB24 [Pyrus x bretschneideri]
Length=403

 Score =   303 bits (776),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 167/405 (41%), Positives = 245/405 (60%), Gaps = 17/405 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M++++VP YF+CPISL+IMKDPVT  TGITYDR++IE W+F  KN TCPVTKQ L    D
Sbjct  1     MDDVEVPQYFICPISLQIMKDPVTAITGITYDRESIEHWLFQSKNITCPVTKQPLQ--KD  58

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  L R+I++WCT +AS+G+++ PTPK P+ K+ +LKLL+     P++  K+++ 
Sbjct  59    SELTPNHTLHRLIRAWCTENASYGIDQIPTPKTPLNKAQVLKLLKDFWH-PQLQLKIIRK  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQII-----KTSEDNPTDDALYVLHNLGLSENGLRS  1053
             L  +A E   N++ M  AGVA  +   I     K  + +  ++AL +LH + +S   L  
Sbjct  118   LELLAVEKEGNRKYMVEAGVANAMLLFITNRCYKNDQVDGLEEALSILHFVRISSEELNR  177

Query  1052  ILGHDTQFIDSLTRVMQ---HGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFH  882
                 + Q IDSLT V             YAV++LK +++    +   +         FF 
Sbjct  178   HFMENNQIIDSLTWVFGCEIENQITVSTYAVLVLKYIIQKANSSVLETLNPD-----FFK  232

Query  881   QVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWG  702
             ++V +LR+  + +   +ALH++ + C  GRNRIK  E GA   +I+L     EKR  E  
Sbjct  233   KLVGVLRNGVTEQGMNAALHVMLDACPWGRNRIKMVEVGAVHELIELEFGAPEKRTTELI  292

Query  701   LSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQ  522
               +L  LC CA+GRA+ + H  G++VVS+++LRVS  A++R + IL  I K+S T  V+Q
Sbjct  293   FGILFHLCSCADGRAQFVSHKGGISVVSKRLLRVSPAADDRAVLILSMICKYSGTNLVLQ  352

Query  521   EMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCL  387
             EML++G  A+LC +IQVD      K +A EIL+ H +EWKN  CL
Sbjct  353   EMLEVGAVARLCTLIQVD-RPPYLKGKAREILRSHYEEWKNCRCL  396



>ref|XP_009630105.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Nicotiana 
tomentosiformis]
Length=421

 Score =   303 bits (775),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 169/424 (40%), Positives = 261/424 (62%), Gaps = 30/424 (7%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKN--------ATCPVTK  1422
             MEE+++P YFLCPISL IMKDPVT  TGITYDR++IE W+ + +          TCPVTK
Sbjct  1     MEEVEIPQYFLCPISLMIMKDPVTTVTGITYDRESIEMWLLTAEEEAEAEAEAVTCPVTK  60

Query  1421  QALSGTDDEFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPE  1242
             Q L   D E LTPN +LRR+IQ+WC  +AS G++R PTPK P+ KSH+L+L+RQ  +  +
Sbjct  61    QKLPR-DTELLTPNHMLRRLIQAWCIANASKGIDRIPTPKYPLDKSHMLRLVRQV-NNHQ  118

Query  1241  MLAKVLQTLRSMAPENAANKRCMESAG-VAEFLAQIIKTSED----NPTDDALYVLHNLG  1077
             +  + L+ + ++  EN  NK+C+E  G +   ++ I+K+ ++    N  + AL + H + 
Sbjct  119   ICVEALRKIDALVIENEKNKKCLEEVGAIKAMVSFIVKSFKEKKLINGLEQALRIFHLVW  178

Query  1076  LSENGLRSILGHDTQFIDSL-----TRVMQHGSYESRAYAVMLLKSMLEtttlnpslsql  912
                     ++  +   I+++     + +M +     + +A+M+LK+++E ++ N      
Sbjct  179   SPTTKNEQLVKENHDLIEAILWILRSEMMNNNQVIIKTHAMMVLKNVIEVSSSNLLSELQ  238

Query  911   tttlnlSFFHQVVQILRD----NFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVID  744
                    FF  +V ILR     + S++A+K AL +L + C  GRN+ K  E+GA   +I+
Sbjct  239   PE-----FFQDMVNILRKESKYHISQQATKVALQVLIDTCPWGRNKHKIVESGAIFELIE  293

Query  743   LLLDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRIL  564
             L L   EKR  E    +L  LC CA+GRAE LKHAAG++V++++ LRVS   ++  ++IL
Sbjct  294   LELCNTEKRVSELIFCILAHLCTCADGRAEFLKHAAGISVITKRTLRVSSTTDDCAIQIL  353

Query  563   YSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLP  384
              SI+KFSAT  V+ EML++G  +KLC+VIQ DC     K++A EIL+ H+  W NSPC+ 
Sbjct  354   GSISKFSATKEVLIEMLRIGAVSKLCMVIQADCE-DYLKKKAMEILRTHSYAWSNSPCIQ  412

Query  383   LDLI  372
             + L+
Sbjct  413   IYLL  416



>emb|CAN80214.1| hypothetical protein VITISV_017908 [Vitis vinifera]
Length=437

 Score =   303 bits (775),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 160/397 (40%), Positives = 258/397 (65%), Gaps = 16/397 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M++I++P YFLCPISL+IMKDPVT  TGITYDR++IE+W+ + K+ TCPVTKQ L    D
Sbjct  7     MDDIEIPQYFLCPISLQIMKDPVTAMTGITYDRESIEQWLLTAKDTTCPVTKQPLE--RD  64

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WC  +A++GV++ PTPK P+ ++H++KL+R      ++  K LQ 
Sbjct  65    FVLTPNHTLRRLIQAWCAANATNGVDQIPTPKTPLDRTHVVKLIRDL-GVAQLYLKTLQK  123

Query  1217  LRSMAPENAANKRCMESAGVAE-FLAQIIKTSEDNPT---DDALYVLHNLGLSENGLRSI  1050
             + ++  +N  N+ CM  AG A+  +  IIK  ++N T   ++ L +LH +    + ++ +
Sbjct  124   MEALTRDNERNRNCMADAGAAKAIVLLIIKCFKENKTTGVEEGLRILHLIWSPTSEMKLL  183

Query  1049  LGHDTQFIDSLTRVM--QHGSYES-RAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQ  879
             L  +  F+D++T  +  +  +Y + R+ AV++LK+++E  + N             F ++
Sbjct  184   LKENYDFVDAVTWALGCETDNYVAVRSNAVLVLKNIVEVASPNLLERLKFE-----FLNR  238

Query  878   VVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGL  699
             +++ +R+  S+ A K+AL++L  VC  GRN+ +  EAGA   +I++ L+  EK+  E   
Sbjct  239   LIRTMREKISQAAMKAALYVLMEVCPWGRNKWQMIEAGAVFQLIEMELENPEKKITEIIF  298

Query  698   SVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQE  519
              +L  LC CA+GRA+ L HA  +A++S++ILRVS   ++R L I+  I+KFS T  V+ E
Sbjct  299   CLLGHLCSCADGRAQFLAHAGSMAMLSKRILRVSNTTDDRALHIIALISKFSGTNEVLME  358

Query  518   MLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKE  408
             ML++G  +KLC+V+Q DC     KE+A EIL+LH+K+
Sbjct  359   MLRVGAVSKLCMVLQADCA-KYLKEKAREILRLHSKK  394



>ref|XP_009791306.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Nicotiana 
sylvestris]
Length=417

 Score =   302 bits (773),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 169/424 (40%), Positives = 262/424 (62%), Gaps = 30/424 (7%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKN--------ATCPVTK  1422
             MEE+++P YFLCPISL IMKDPVT  TGITYDR++IE W+ + +          TCPVTK
Sbjct  1     MEEVEIPQYFLCPISLMIMKDPVTTVTGITYDRESIEMWLLTAEEEAEEEAEAVTCPVTK  60

Query  1421  QALSGTDDEFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPE  1242
             Q L   D E LTPN +LRR+IQ+WC  +AS G++R PTPK P+ KSH+L+L+RQ  +  +
Sbjct  61    QKLP-RDTELLTPNHMLRRLIQAWCIANASKGIDRIPTPKYPLDKSHMLRLVRQV-NNHQ  118

Query  1241  MLAKVLQTLRSMAPENAANKRCMESAG-VAEFLAQIIKTSED----NPTDDALYVLHNLG  1077
             +  + L+ + ++  EN  NK+C+E  G +   ++ I+K+ ++    N  + AL + H + 
Sbjct  119   ICIEALRKIEALVIENEKNKKCLEEVGAIKAMVSFIVKSFKEKKLINGLEHALRIFHLVW  178

Query  1076  LSENGLRSILGHDTQFIDSL-----TRVMQHGSYESRAYAVMLLKSMLEtttlnpslsql  912
                     ++  +   I+++     + +M +     + +A+M+LK+++E ++ N      
Sbjct  179   SPTTKNEQLVKENHDLIEAILWILRSEMMNNNQVIIKTHAMMVLKNVIEISSSNLLSGLQ  238

Query  911   tttlnlSFFHQVVQILRD----NFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVID  744
                    FF ++V ILR     + S++A+K AL +L + C  GRN+ K  E+GA   +I+
Sbjct  239   PE-----FFQEMVNILRKESKHHISQQATKVALQVLIDTCPWGRNKHKIIESGAIFELIE  293

Query  743   LLLDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRIL  564
             L L   EKR  E    +L  LC CA+GRAE LKHAAG++V++++ LRVS   ++  ++IL
Sbjct  294   LELCNTEKRVSELIFCILAHLCTCADGRAEFLKHAAGISVITKRTLRVSSTTDDCAIQIL  353

Query  563   YSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLP  384
              SI+KFSAT  V+ EML++G  +KLC+VIQ DC     K++A EIL+ H+  W NSPC+ 
Sbjct  354   GSISKFSATKEVLIEMLRVGAVSKLCMVIQADCE-DYLKKKAMEILRTHSYAWGNSPCIQ  412

Query  383   LDLI  372
             + L+
Sbjct  413   IHLL  416



>ref|XP_002299771.2| hypothetical protein POPTR_0001s22390g, partial [Populus trichocarpa]
 gb|EEE84576.2| hypothetical protein POPTR_0001s22390g, partial [Populus trichocarpa]
Length=403

 Score =   301 bits (770),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 167/414 (40%), Positives = 251/414 (61%), Gaps = 30/414 (7%)
 Frame = -1

Query  1562  VPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGK-NATCPVTKQALSGTDDEFLT  1386
             +P YFLCPISL+I+KDPVT  TGITY+R++IE W+ + + N TCPVTKQ L G  D  L 
Sbjct  1     IPEYFLCPISLQILKDPVTTITGITYERESIEHWLKTAQGNPTCPVTKQPLPG--DSELI  58

Query  1385  PNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTLRSM  1206
             PN  LRR+IQSWCTL+A  G++R PTPK P+ KS +L+L++          K L  L ++
Sbjct  59    PNHTLRRLIQSWCTLNAIDGIDRIPTPKSPIKKSQVLRLIKDLDVPDHSCTKALMKLEAL  118

Query  1205  APENAANKRCMESAGVAE----FLAQIIKTSEDNPTDDALYVLHNLGLSENGLRSILGHD  1038
             A EN  N+ CM  AGVA+    F+ +  K  +    ++ L +L+ +      ++ ++  +
Sbjct  119   AAENERNRTCMVEAGVAKAMVLFIIKCFKEGKTTGLEEGLRILYLIWNQSQEIKLLVREN  178

Query  1037  TQFIDSLTRVMQ---HGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQVV-Q  870
              +FIDSLT  ++       + + +A++LL+ +                  + FF ++V +
Sbjct  179   QEFIDSLTWTLRCKIDNHVDVKTHAMLLLERL-----------------KVDFFKEIVTR  221

Query  869   ILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLSVL  690
             +LR   S+ A KSAL +L  VC GGRNR+K  EA A   +I+L L+  E+   E   ++L
Sbjct  222   VLRKRISKLAIKSALLVLTEVCFGGRNRMKIVEANAVFELIELELEKPERNITELIFNLL  281

Query  689   EQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEMLQ  510
              QLC CA GR + LKHA  +A++S+++LRVS   ++R + IL SI+KFSA    V EML+
Sbjct  282   AQLCSCAAGREQFLKHAGSIALLSKRVLRVSPATDDRAVHILDSISKFSAGDEAVLEMLR  341

Query  509   LGVGAK-LCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIHNTIGVN  351
             +G  +K LC++IQ DC     K++A  IL+LH+  W NSPC+ +DL+   +G+ 
Sbjct  342   VGAVSKLLCMLIQADCA-PYLKKKARGILRLHSNTWNNSPCIAVDLLTRRLGLT  394



>ref|XP_009613982.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Nicotiana 
tomentosiformis]
Length=419

 Score =   300 bits (769),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 169/416 (41%), Positives = 268/416 (64%), Gaps = 17/416 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIF-SGKN-ATCPVTKQALSGT  1404
             MEE+++P YFLCP+SL+IMKDPVT  TGITYDR +IE+W+  + KN ATCPVTKQ+L   
Sbjct  1     MEEVEIPQYFLCPVSLQIMKDPVTTVTGITYDRQSIEQWLLMTDKNTATCPVTKQSLP-K  59

Query  1403  DDEFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVL  1224
             D E LTPN +L R+I+SW   +A +G+E+ P+PK P+ KSH+++L+RQ  +  E+  + L
Sbjct  60    DIELLTPNHMLGRLIRSWTIGNAENGIEQIPSPKYPLNKSHVIRLIRQVNNR-ELYVEAL  118

Query  1223  QTLRSMAPENAANKRCMESAGVAE-FLAQIIKTSEDNPT----DDALYVLHNLGLSENGL  1059
             + + +M  EN  NK+C+  AGV +  +  I+++ ++       ++ L + H +    +  
Sbjct  119   RKMGNMVSENEKNKKCLNEAGVIKAMVCFILRSFKEGKIIVGIEEVLRIFHLVWSPTHEN  178

Query  1058  RSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKS---MLEtttlnpslsqltttlnlSF  888
             + ++  +   I+++  +++     +    V+++K+   M+    ++ S S L ++L   F
Sbjct  179   KQLVKENHDLIEAILWILKREMINNNNNQVVIIKTHAIMVLKNVISVSSSNLLSSLTPEF  238

Query  887   FHQVVQILRDN----FSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEK  720
             F +++ ILR N     S++A+K+ALH+L + C  GRNR+K  E GA   +I+L L  NEK
Sbjct  239   FQEMLNILRKNSKTKVSQQATKAALHVLIDACPRGRNRLKMIELGAIFELIELELSNNEK  298

Query  719   RYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSA  540
             R  E    +L  LC  A+GRAE+LKHAAG+ VVS++ILR+S   ++  ++IL  I+KFSA
Sbjct  299   RVTELVFCLLLHLCSLADGRAELLKHAAGIVVVSKRILRISSATDDSAIQILGLISKFSA  358

Query  539   TPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             T  V+ EML++G  +KLC+VIQ DC     K++A EIL+ H+  W NSPC+ + L+
Sbjct  359   TKEVLIEMLRVGAVSKLCMVIQADCK-AFIKKKAMEILRAHSNVWSNSPCVQIYLL  413



>gb|KEH41885.1| E3 ubiquitin-protein ligase PUB23-like protein [Medicago truncatula]
Length=406

 Score =   300 bits (767),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 167/408 (41%), Positives = 247/408 (61%), Gaps = 19/408 (5%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M+EI+VP YF+CPISL+IMKDPVT  TGITYDRD+IE W+F+ KN TCPVTKQ L    D
Sbjct  1     MDEIEVPQYFICPISLQIMKDPVTAITGITYDRDSIEHWLFTNKNTTCPVTKQPLPLDSD  60

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQSWCT +AS G++R PTPKPP+TK+ + KLL+  K  P++  K L  
Sbjct  61    --LTPNHTLRRLIQSWCTQNASLGIDRIPTPKPPLTKTQVQKLLKGIKD-PKIQLKSLMQ  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTSEDN-----PTDDALYVLHNLGLSENGLRS  1053
             L  +A E A+N++ +   GV + +   I     N       ++AL  L  + +    +++
Sbjct  118   LELLAAEKASNRKILLENGVPKAMIMFIVDCYKNGEIYEGIEEALGFLQFVKVPTEEVKN  177

Query  1052  ILGHDTQFIDSLTRVM---QHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFH  882
             +L  + Q +DSLT ++      S   +++AV++LK  +         S +   L   FF 
Sbjct  178   LLFENNQILDSLTWILVSEMKNSVTVKSHAVLVLKKFIN-----KCDSTVLERLKPEFFE  232

Query  881   QVVQILRDN-FSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDL-LLDTNEKRYCE  708
             ++V++LR+   +++   SALH+    C  GRNR+   EAGA   +I++ L+  +EKR  E
Sbjct  233   RIVKVLRNGVITQQGLSSALHIFLYCCPLGRNRLMMVEAGAIYELIEIELMAIHEKRITE  292

Query  707   WGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSV  528
                 +L  LC CA GR + L H   +AV++ ++ +VS   ++R + IL  I+KFSAT  V
Sbjct  293   LTFGILFHLCSCANGRFQFLSHQGSIAVLTERLFKVSMTVDDRAVFILSLISKFSATKMV  352

Query  527   VQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLP  384
             + EML++G  AKL +++Q D      K++  EI K H++ WKNSPC P
Sbjct  353   LDEMLKVGTVAKLFVLLQTD-HAKYLKDKVMEIFKAHSEVWKNSPCFP  399



>ref|XP_004241334.1| PREDICTED: E3 ubiquitin-protein ligase PUB24-like [Solanum lycopersicum]
Length=420

 Score =   300 bits (768),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 168/419 (40%), Positives = 259/419 (62%), Gaps = 28/419 (7%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSG--KNATCPVTKQALSGT  1404
             MEE+++P YFLCPISL+IMKDPVT  TGITYDR+NIE W+     K +TCPVTKQ L   
Sbjct  1     MEEVEIPKYFLCPISLQIMKDPVTTVTGITYDRENIETWLLMAEEKTSTCPVTKQILP-R  59

Query  1403  DDEFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVL  1224
             D   LTPN +L + I+SW   +A  G+E+ P+PK P+ KSH+++L+RQ K+  ++  + L
Sbjct  60    DTALLTPNHMLGKFIRSWTICNAEKGIEQIPSPKYPLNKSHVIRLIRQVKNR-DLYLEAL  118

Query  1223  QTLRSMAPENAANKRCMESAGVAE----FLAQIIKTSE-DNPTDDALYVLHNLGLSENGL  1059
             + + +M  EN  N++C++  GV +    F+ +  K  E     ++AL + H +    +  
Sbjct  119   RKMVTMISENEENRKCLDEGGVIKAMVLFILRSFKEGELVMGIEEALRIFHFVWRPTHEN  178

Query  1058  RSILGHDTQFIDSLTRVMQHGS--YES-------RAYAVMLLKSMLEtttlnpslsqltt  906
             + ++  +   I+++  +++     Y++       + +A+++LK+++  ++ N   S    
Sbjct  179   KQLVKENHDLIEAILWILKSREVCYDNNQVVTSIKTHAMLVLKNVISVSSTNVLSSLTPE  238

Query  905   tlnlSFFHQVVQILRDN----FSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLL  738
                  FF Q++  LR N      ++A+K+ALH+L + C GGRNR+K  E GA   +I+L 
Sbjct  239   -----FFQQMLNSLRKNNVKYICQQATKAALHVLIDTCPGGRNRLKMIELGAVFELIELE  293

Query  737   LDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYS  558
             L  NEKR  E   S+L  LC  A+GRAE+LKHAAG+A+VS+KILR+S   +E  ++I+  
Sbjct  294   LSNNEKRVSELVFSLLSHLCSLADGRAELLKHAAGIAIVSKKILRISPATDESAIQIIGL  353

Query  557   IAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPL  381
             IAKFSAT  V+ EML++G   KLC+VIQ +C     K +A EIL+ H   W NSPC+ +
Sbjct  354   IAKFSATKEVLMEMLRVGGVTKLCMVIQANCEASLRK-KALEILRAHNNVWSNSPCVQI  411



>ref|XP_004497654.1| PREDICTED: E3 ubiquitin-protein ligase PUB24-like [Cicer arietinum]
Length=410

 Score =   299 bits (766),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 171/409 (42%), Positives = 245/409 (60%), Gaps = 20/409 (5%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNAT-CPVTKQALSGTD  1401
             M+EI+VP YF+CPISL+IMKDPVT  TGITYDRD+IE W+F+ KN T CPVTKQ L    
Sbjct  1     MDEIEVPQYFICPISLQIMKDPVTAITGITYDRDSIEHWLFTNKNTTYCPVTKQPLPLDS  60

Query  1400  DEFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQ  1221
             D  LTPN  LRR+IQSWCT +AS G++R PTPKPP+TK+H+LKLL+     P +  K L 
Sbjct  61    D--LTPNHTLRRLIQSWCTQNASLGIDRIPTPKPPLTKTHVLKLLKNFDD-PSVQLKSLI  117

Query  1220  TLRSMAPENAANKRCMESAGVAEFLAQII------KTSEDNPTDDALYVLHNLGLSENGL  1059
              L  +A EN  N++C+  A V + +   I      K S     ++AL  L  + +    +
Sbjct  118   QLELLAAENERNRKCLLEARVPKAMILFIVDCYRKKGSIFEGLEEALSFLQFVKVPTEEI  177

Query  1058  RSILGHDTQFIDSLTRVMQ---HGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSF  888
              ++L  +   IDSL  V+      S   +++A+++LK  +                   F
Sbjct  178   NNLLAENDDIIDSLIWVLSIEVKNSIFVKSHAILVLKRFINKVNTFVLERLKPE-----F  232

Query  887   FHQVVQILR-DNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYC  711
             F ++V+ILR D+ +++   SAL +L   C  GRNR+   E GA   ++++ L + EKR  
Sbjct  233   FERIVKILRKDSITQQGLCSALQVLLCACPLGRNRLMMVEVGAVFELVEVELISQEKRIT  292

Query  710   EWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPS  531
             E   S+L  LC CA GRA+ L H   +A++S +IL+VS   ++R + IL  I+KFSAT  
Sbjct  293   ELTFSILFHLCSCANGRAQFLSHEGSIALLSERILKVSMDVDDRAVFILSLISKFSATKI  352

Query  530   VVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLP  384
             V+QEML +G+  KL +++Q +      K++A EI+K H+  WKNSPC P
Sbjct  353   VLQEMLNVGIVNKLFMLLQAN-HAKYLKDKAMEIIKSHSDVWKNSPCFP  400



>ref|XP_007145788.1| hypothetical protein PHAVU_007G267800g [Phaseolus vulgaris]
 gb|ESW17782.1| hypothetical protein PHAVU_007G267800g [Phaseolus vulgaris]
Length=405

 Score =   298 bits (762),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 168/407 (41%), Positives = 244/407 (60%), Gaps = 21/407 (5%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             MEEI+VP YF+CPISL+IM+DPVT  TGITYDR++IE+W+F  KN+TCPV+KQ L    D
Sbjct  1     MEEIEVPQYFICPISLQIMRDPVTAITGITYDRESIEQWLFDNKNSTCPVSKQLLPRDSD  60

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WCT +A+ G+ R PTPKPP+ K  +LKLL+   +      K L  
Sbjct  61    --LTPNHTLRRLIQAWCTQNAALGIVRIPTPKPPLHKIQVLKLLKDLHN-----HKSLVQ  113

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQII-----KTSEDNPTDDALYVLHNLGLSENGLRS  1053
             L  +A EN  NK+C+  AGV   +   I     K        +AL +L  + + +N    
Sbjct  114   LELLAAENERNKKCLLEAGVPRAMIIFIINCYRKAQIQKGLHEALSILQFVKIPKNEWPQ  173

Query  1052  ILGHDTQFIDSLTRVMQHGSYES----RAYAVMLLKSMLEtttlnpslsqltttlnlSFF  885
             ++    Q +DSLT ++ H   E+    +++ V+LLK ++        L +L       FF
Sbjct  174   LVKDHDQTLDSLTWILCHEEMENSIAVKSHVVLLLKKIINKGDTCHVLERLKPE----FF  229

Query  884   HQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEW  705
               +V+ILR   +++ + +ALH+L +     RNRI   EAG    V+++ L   EKR  E 
Sbjct  230   EAMVKILRHGVTQQGTSAALHVLLSASSSTRNRIMMVEAGVVHEVVEIELGAPEKRVTEL  289

Query  704   GLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVV  525
              L++L  LC CA GRA+ L H   +AVV+ +IL+VS   ++R + +L  +AKFS T  V+
Sbjct  290   TLAILFHLCCCANGRAKFLSHEGAIAVVTERILKVSAAVDDRAVFVLAMVAKFSGTKVVL  349

Query  524   QEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLP  384
             QEML++G  AKLC+V+Q D      K++A E+LK H++ W +S C P
Sbjct  350   QEMLKMGSMAKLCMVVQAD-RAKYLKDKAMEVLKEHSEVWTDSLCFP  395



>dbj|BAF02552.1| hypothetical protein [Nicotiana benthamiana]
Length=425

 Score =   298 bits (763),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 171/421 (41%), Positives = 257/421 (61%), Gaps = 25/421 (6%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNAT----CPVTKQALS  1410
             MEE+++P YFLCPISL+IMKDPVT  TGITYDR++IE W+ + +  T    CPVTKQ L 
Sbjct  1     MEEVEIPQYFLCPISLQIMKDPVTTVTGITYDRESIEMWLLTAEEETETAACPVTKQPLP  60

Query  1409  GTDDEFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEML-A  1233
               D E LTPN +LRR+IQ+WC ++A  GV+R PTPK P+ KS+IL+LLRQ  +    L A
Sbjct  61    K-DTELLTPNHMLRRLIQAWCIVNAEKGVDRIPTPKYPMNKSNILRLLRQVNNNDHQLCA  119

Query  1232  KVLQTLRSMAPENAANKRCMESAGVAE----FLAQIIKTSEDNP-TDDALYVLHNLGLSE  1068
             + L+ +  +  EN  N++CME AG  +    F+ +  K  +  P  ++AL + H +   +
Sbjct  120   EALRKMADLVSENEKNRKCMEQAGAIKAMVCFIVKSFKYEKLFPGIEEALRIFHLIWNPK  179

Query  1067  NGLRSILGHDTQFIDSLTRVMQHGSYES----RAYAVMLLKSMLEtttlnpslsqltttl  900
             +  +  +  +     ++  +++     S    + +A+M+LK++ E ++            
Sbjct  180   SENKQYVKDNPDLXQAILWILKSNLNTSHVLVKTHAMMVLKNVTEVSSSXLLTGLDPE--  237

Query  899   nlSFFHQVVQILRDN----FSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLD  732
                FF Q+   LR N     S++A+K+AL +L + C  GRNR+K  E+GA   +I+L L 
Sbjct  238   ---FFQQMANTLRKNGKYYISQQATKAALQVLIDACLWGRNRLKIVESGAIFELIELELS  294

Query  731   TNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIA  552
               EKR  E    +L  LC  A+GRAE+LKHAAG+AVV+++ LR+S   ++  L+IL  I+
Sbjct  295   NPEKRVSELVFCLLANLCVLADGRAELLKHAAGIAVVTKRTLRISSATDDSALQILGLIS  354

Query  551   KFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             KFSAT  V+ EML++G  +KLC+ IQ DC     K++A EIL+ H+  W NSPC+ L  +
Sbjct  355   KFSATNEVLLEMLRVGGVSKLCMAIQADCE-PHLKKKAREILRAHSHVWSNSPCISLYTV  413

Query  371   H  369
             +
Sbjct  414   Y  414



>ref|XP_007027987.1| Plant U-box 24 [Theobroma cacao]
 gb|EOY08489.1| Plant U-box 24 [Theobroma cacao]
Length=408

 Score =   297 bits (761),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 169/415 (41%), Positives = 250/415 (60%), Gaps = 17/415 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M++I+VP YF+CPISL+IMKDPVT  TGITYDR++IE+W+  GKN +CPVT+Q L    D
Sbjct  1     MDDIEVPKYFVCPISLQIMKDPVTAITGITYDRESIEQWLLKGKNTSCPVTQQPLPRDSD  60

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WCT +AS GV+R PTPKP V K H  KL+++    P+   + L+ 
Sbjct  61    --LTPNHTLRRLIQAWCTENASLGVDRIPTPKPSVDKFHFRKLIKELDKHPDSKMEALRE  118

Query  1217  LRSMAPENAANKRCMESAGVAE----FLAQIIKTSEDNPTDDALYVLHNLGLSENGLRSI  1050
             L  +A +N  N++ M  AGV +    F+    K    N  ++AL VL  + +        
Sbjct  119   LDLLAAKNERNRKYMVEAGVPKAMLSFIVNCFKEDCVNGLEEALSVLSLIRIPSAEANLS  178

Query  1049  LGHDTQFIDSLTRVMQHGSYES---RAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQ  879
             L    + I SL  V+   S      +++A ++LK+++ET +               FF  
Sbjct  179   LNEKDEIIKSLIWVLGCESKTQVTVKSHAALVLKTIIETASSILLERLEPQ-----FFET  233

Query  878   VVQIL--RDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEW  705
              V +L  R   +++   +ALH+L +VC  GRNR+   E+GA + +I+L L + E+R  E 
Sbjct  234   AVGVLTQRSRVTQQGMNAALHVLLDVCPWGRNRLMMVESGAVSALIELELGSPERRTTEL  293

Query  704   GLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVV  525
              L +L  LC CA+GRAE L H  G+AVV+++I+RVS  A++R + IL  I+KFSAT  V+
Sbjct  294   ILGILFHLCSCADGRAEFLSHKGGVAVVTKRIMRVSPTADDRAVLILSLISKFSATNLVL  353

Query  524   QEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLIHNTI  360
              EML++G   KLC+++Q D G    K++A EIL+ H+ EW+   C+ + L+   I
Sbjct  354   HEMLEVGTVTKLCMLLQGD-GATYLKDKAMEILRSHSDEWQKFRCINITLLTRYI  407



>ref|XP_002323383.1| U-box domain-containing family protein [Populus trichocarpa]
 gb|EEF05144.1| U-box domain-containing family protein [Populus trichocarpa]
Length=408

 Score =   297 bits (760),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 162/404 (40%), Positives = 250/404 (62%), Gaps = 16/404 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M++I+VP +F+CPI L+IMKDPVT  TGITYDR++IE+W+F+ +N TCPVTKQ+L    D
Sbjct  1     MDDIEVPRFFICPIYLQIMKDPVTTITGITYDRESIERWLFTSENTTCPVTKQSLPKDSD  60

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WCT +ASHGV+R PTPKP + K+++LKL++   S  ++  + L  
Sbjct  61    --LTPNHTLRRLIQAWCTENASHGVDRIPTPKPCLDKAYVLKLIKNL-SHHKLQIEALTQ  117

Query  1217  LRSMAPENAANKRCMESAGVAE----FLAQIIKTSEDNPTDDALYVLHNLGLSENGLRSI  1050
             +  +A EN  N++CM  AG+ +    F+    +  + +   +AL +L  + +  +  R  
Sbjct  118   MEVLAAENERNRKCMVDAGLPKALLVFIVSCFENGQVSGIQEALSILRLIKIPRSESRVF  177

Query  1049  LGHDTQFIDSLTRVMQH--GSYES-RAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQ  879
             L  + + I+SLT ++ +   +Y + +++AV +L+ +LE  + +             FF +
Sbjct  178   LCENGKIIESLTWLLGYKMDNYATVKSHAVSVLRILLEDASSSVLKRLKPE-----FFER  232

Query  878   VVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGL  699
             +V +LR+  +++  K AL +L + C    NR    E+GA   +I+L L + E+R  E  L
Sbjct  233   IVGVLREKITQQGIKDALEVLLDACPWAGNRKMMVESGAVFELIELELGSPERRTTELNL  292

Query  698   SVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQE  519
              VL  LC CAEGRA+ L H   +AVV+++ILRVS   N+R + IL  I KFS T  V+QE
Sbjct  293   GVLFHLCCCAEGRAQFLSHGGSIAVVAKRILRVSPEVNDRAILILSLICKFSGTSMVIQE  352

Query  518   MLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCL  387
             M+ +    KL +++Q DC     K++A EIL+ H  EWKN PC+
Sbjct  353   MVDVKAVPKLFMLLQADCA-PYLKDKAREILRSHFDEWKNFPCI  395



>ref|XP_009601958.1| PREDICTED: E3 ubiquitin-protein ligase PUB24-like [Nicotiana 
tomentosiformis]
Length=419

 Score =   297 bits (760),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 176/422 (42%), Positives = 261/422 (62%), Gaps = 29/422 (7%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNAT----CPVTKQALS  1410
             MEE+++P YFLCPISL+IMKDPVT  TGITYDR++IE W+ + +  T    CPVTKQ L 
Sbjct  1     MEEVEIPQYFLCPISLQIMKDPVTTVTGITYDRESIEMWLLTAEEETETAACPVTKQPLP  60

Query  1409  GTDDEFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEML-A  1233
               D E LTPN +LRR+IQ+WCT++A  GV+R PTPK P+ KS+IL+L+RQ  +    L A
Sbjct  61    K-DTELLTPNHMLRRLIQAWCTVNAEKGVDRIPTPKYPMNKSNILRLIRQVNNNDHQLCA  119

Query  1232  KVLQTLRSMAPENAANKRCMESAGVAE----FLAQIIKTSEDNP-TDDALYVLHNLG--L  1074
             + L+ +  +  EN  N++C+E  G  +    F+ +  K  +  P  ++AL + H +    
Sbjct  120   EALRKMADLVSENEKNRKCLEQVGAIKAIVCFIVKSFKCEKLIPGIEEALRIFHLIWNPT  179

Query  1073  SENGLRSILGHDTQFIDSLTRVMQHGSYES----RAYAVMLLKSMLEtttlnpslsqltt  906
             SEN       HD   + ++  +++     S    + +A+M+LK++ E ++ N        
Sbjct  180   SENKQYVKDNHD--LVQAILWILKSELKTSHVLIKTHAMMVLKNVTEVSSSNLLSGLDPE  237

Query  905   tlnlSFFHQVVQILRDN----FSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLL  738
                  FF Q+V  LR N     S++A+K+AL +L + C  GRNR+K  E+GA   +I+L 
Sbjct  238   -----FFQQMVNTLRKNGKNYISQQATKAALQVLIDACPWGRNRLKIVESGAIFELIELE  292

Query  737   LDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYS  558
             L   EKR  E    +L  LC  A+GRA++LKHAAG+AVV+++ LR+S   ++  L+IL  
Sbjct  293   LSNPEKRVSELVFCLLANLCVLADGRADLLKHAAGIAVVTKRTLRISSATDDSALQILGL  352

Query  557   IAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLD  378
             I+KFSAT  V+ EML++G  +KLC+VIQ DC     K++A EIL+ H+  W NSPC+ + 
Sbjct  353   ISKFSATNEVLLEMLRVGGVSKLCMVIQADCE-PHLKKKAREILRAHSHVWSNSPCIQVY  411

Query  377   LI  372
             L+
Sbjct  412   LL  413



>ref|XP_011046429.1| PREDICTED: E3 ubiquitin-protein ligase PUB24 [Populus euphratica]
Length=409

 Score =   295 bits (756),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 164/405 (40%), Positives = 246/405 (61%), Gaps = 17/405 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M++I+VP +F+CPISL+IMKDPVT  TGITYDR++IE W+F+ +N  CPVTKQ L    D
Sbjct  1     MDDIEVPKFFICPISLQIMKDPVTTITGITYDRESIEHWLFTSQNTVCPVTKQPLQKDSD  60

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WCT +ASHGV+R PTPKP + K ++ KL++   S  E+  K L  
Sbjct  61    --LTPNHTLRRLIQAWCTENASHGVDRIPTPKPCLDKCYVRKLIKNL-SHHELQIKTLTR  117

Query  1217  LRSMAPENAANKRCMESAGVAE----FLAQIIKTSEDNPTDDALYVLHNLGLSENGLRSI  1050
             L  +A EN  N++CM  AG+ +    F+A   K  + +   +AL +L  + +  +  R+ 
Sbjct  118   LELLAAENERNRKCMVDAGLPKAMLLFIAACFKKGQVSGIQEALSILCFIRIPRSESRAF  177

Query  1049  LG-HDTQFIDSLTRVM--QHGSYES-RAYAVMLLKSMLEtttlnpslsqltttlnlSFFH  882
                +D + I+SLT V+  +  +Y + +++A  +LK +LE  + +             FF 
Sbjct  178   FSENDDKIIESLTWVLGCKMENYATVKSHAASVLKMLLEEASSSLLERLKPE-----FFE  232

Query  881   QVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWG  702
             ++V +LR+  + +   +AL +L   C  GRNR    E+ A   +I+L L + E+R  E  
Sbjct  233   RIVGVLRERITHQGINAALQVLLYACPWGRNRKMMVESCAVFELIELELGSPERRTTELN  292

Query  701   LSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQ  522
             L VL  LC CAEGRA+ L H   +AVV+++I+RVS   ++R + IL  I KFS T   +Q
Sbjct  293   LGVLFHLCCCAEGRAQFLSHRGSIAVVAKRIMRVSPAVDDRAIMILSQICKFSGTSMAIQ  352

Query  521   EMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCL  387
             EM  +    KLC+++Q DC     K++A EIL+ H+ +WK SPC+
Sbjct  353   EMADVKAVTKLCMLLQADCA-PYLKDKAREILRSHSDKWKKSPCI  396



>ref|XP_006378980.1| hypothetical protein POPTR_0009s021501g, partial [Populus trichocarpa]
 gb|ERP56777.1| hypothetical protein POPTR_0009s021501g, partial [Populus trichocarpa]
Length=302

 Score =   291 bits (744),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 150/310 (48%), Positives = 212/310 (68%), Gaps = 24/310 (8%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M++I VP +FLCPISL++M+DPVTISTGITYDR+NIE+W+FS KN TCPVTKQ L G D 
Sbjct  1     MDQIDVPYHFLCPISLQLMRDPVTISTGITYDRENIERWLFSCKNNTCPVTKQELFGKD-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ+WCTL+AS G+ER PTPKPP+ ++ I KLL  AK  P +  K L+ 
Sbjct  60    --LTPNHTLRRLIQAWCTLNASFGIERIPTPKPPIERAQIAKLLNDAKKFPHLQLKSLRR  117

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKT---------SEDN------PTDDALYVLHN  1083
             LRS+  E+  N+ C+E AG  +FLA I+K          S+DN       +D+AL +L++
Sbjct  118   LRSITLESERNRICLEEAGAVDFLATILKNGDSTSVDIASDDNESEFSRASDEALNILYH  177

Query  1082  LGLSENGLRSILGHD-TQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltt  906
             L +S+  L++++ +D  QF++SL ++++H SY+SRAYA MLLKS+ E      +      
Sbjct  178   LKISQRKLKNLITNDGDQFLESLLQILKHSSYQSRAYATMLLKSVFE-----VADPMHLI  232

Query  905   tlnlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTN  726
             ++    F ++V++L D  S+++SK+AL LL  VC   RNRI+A E  A +V+I+L LD +
Sbjct  233   SIRPEMFVELVRVLNDQISQQSSKAALKLLVEVCPWRRNRIRAVEGSAVSVLIELSLDKS  292

Query  725   EKRYCEWGLS  696
             EKR CE  L+
Sbjct  293   EKRACELVLA  302



>ref|XP_006361090.1| PREDICTED: E3 ubiquitin-protein ligase PUB24-like [Solanum tuberosum]
Length=421

 Score =   295 bits (754),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 168/423 (40%), Positives = 258/423 (61%), Gaps = 29/423 (7%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIF-SGKNA-TCPVTKQALSGT  1404
             MEE+++P YFLCPISL+IMKDPVT  TGITYDR+NIE W+  + +NA TCPVTKQ LS  
Sbjct  1     MEEVEIPKYFLCPISLQIMKDPVTTVTGITYDRENIETWLLMAEENAYTCPVTKQILS-R  59

Query  1403  DDEFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVL  1224
             D   LTPN +L + I+SW   +A  G+E+ P+PK P+ KSH+++L+RQ K+  ++  + L
Sbjct  60    DTALLTPNHMLGKFIRSWTICNAEKGIEQIPSPKYPLNKSHVIRLIRQVKNH-DLYLEAL  118

Query  1223  QTLRSMAPENAANKRCMESAGVAE----FLAQIIKTSE-DNPTDDALYVLHNLGLSENGL  1059
             + + +M  EN  N++C++  G  +    F+ +  K  E     ++AL + H +    +  
Sbjct  119   RKMVTMISENEENRKCLDEGGAIKAMVLFILRSFKEGELIMGIEEALRIFHLVWRPTHEN  178

Query  1058  RSILGHDTQFIDSLTRVMQHGSY----------ESRAYAVMLLKSMLEtttlnpslsqlt  909
             + ++  +   I+++  +++                + +A+++LK+++  ++ N   S   
Sbjct  179   KQLVKENHDLIEAILWILKSREMCNNNNNQVVTSIKTHAMLVLKNVISVSSTNLLSSLTP  238

Query  908   ttlnlSFFHQVVQILRDN----FSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDL  741
                   FF Q++  LR N     S++A+K+ LH+L + C  GRNR+K  E GA   +I+L
Sbjct  239   E-----FFQQMLNSLRKNNVKYVSQQATKAVLHVLIDTCPRGRNRLKMIELGAVFELIEL  293

Query  740   LLDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILY  561
              L  NEKR  E   S+L  LC  A+GRAE+LKHAAG+A+VS+KILR+S   +E  ++IL 
Sbjct  294   ELSNNEKRVSELVFSLLSHLCSLADGRAELLKHAAGIAIVSKKILRISPATDESAIQILG  353

Query  560   SIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPL  381
              IAKFSAT  V+ EML++G   KLC+VIQ +C     K +A EIL+ H   W NSPC+ +
Sbjct  354   LIAKFSATKEVLMEMLRVGGVTKLCMVIQANCEASLRK-KALEILRAHNNVWSNSPCVQI  412

Query  380   DLI  372
               +
Sbjct  413   YFV  415



>ref|XP_009790743.1| PREDICTED: E3 ubiquitin-protein ligase PUB24-like [Nicotiana 
sylvestris]
Length=419

 Score =   295 bits (754),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 177/427 (41%), Positives = 260/427 (61%), Gaps = 29/427 (7%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNAT----CPVTKQALS  1410
             MEE+++P YFLCPISL+IMKDPVT  TGITYDR++IE W+ + +  T    CPVTKQ L 
Sbjct  1     MEEVEIPQYFLCPISLQIMKDPVTTVTGITYDRESIEMWLLTAEEETETAACPVTKQPLP  60

Query  1409  GTDDEFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEML-A  1233
               D E LTPN +LRR+IQ+WC ++A  GV+R PTPK P+ KS+IL+L+RQ  +    L A
Sbjct  61    -KDTELLTPNHMLRRLIQAWCIVNAEKGVDRIPTPKYPMNKSNILRLIRQVNNNDHQLCA  119

Query  1232  KVLQTLRSMAPENAANKRCMESAGVAE----FLAQIIKTSEDNP-TDDALYVLHNLG--L  1074
             + L+ +  +  EN  N++CME  G  +    F+ +  K  +  P  ++AL +   +   +
Sbjct  120   EALRKMADLVSENEKNRKCMEQVGAIKAMVYFIVKSFKCEKLIPGIEEALRIFQLIWNPI  179

Query  1073  SENGLRSILGHDTQFIDSLTRVMQHGSYES----RAYAVMLLKSMLEtttlnpslsqltt  906
             SEN       HD   + ++  +++     S    + +A+M+LK++ E ++ N        
Sbjct  180   SENKQYVKDNHD--LVQAILWILKSELKTSHVLIKTHAMMVLKNVTEVSSSNLLSGLDPD  237

Query  905   tlnlSFFHQVVQILRDN----FSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLL  738
                  FF Q+   LR N     S++A+K+AL +L + C  GRNR+K  E+GA   +I+L 
Sbjct  238   -----FFRQMANTLRKNGKYYISQQATKAALQVLIDACPWGRNRLKIVESGAIFELIELE  292

Query  737   LDTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYS  558
             L   EKR  E    +L  LC  A+GRAE+LKHAAG+AVV+++ LR+S   ++  L+IL  
Sbjct  293   LSNPEKRVSELVFCLLANLCVLADGRAELLKHAAGIAVVTKRTLRISSATDDSALQILGL  352

Query  557   IAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLD  378
             IAKFSAT  V+ EML++G  +KLC+VIQ DC     K++A EIL+ H+  W NSPC+ + 
Sbjct  353   IAKFSATNEVLLEMLRVGGVSKLCMVIQADCE-PHLKKKAREILRAHSHIWSNSPCIQVY  411

Query  377   LIHNTIG  357
             L+    G
Sbjct  412   LLTRYPG  418



>gb|ABK25393.1| unknown [Picea sitchensis]
Length=417

 Score =   295 bits (754),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 159/406 (39%), Positives = 253/406 (62%), Gaps = 21/406 (5%)
 Frame = -1

Query  1565  QVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEFLT  1386
             ++P YF+CPIS++IM+DP+T+ T ITYDR+++EKWI+S    TCP T Q +   +   +T
Sbjct  11    EIPSYFICPISMQIMRDPITVCTSITYDRESMEKWIYSCGKNTCPATMQVMPNYN---MT  67

Query  1385  PNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKS-TPEMLAKVLQTLRS  1209
             PN  LRR+IQ WC  ++S GV+  PTPKPP+  + + KLL+  +S +P  L   L+ LRS
Sbjct  68    PNYTLRRLIQGWCLANSSKGVQPIPTPKPPIDSNQVNKLLQDFESCSPFQLINGLKKLRS  127

Query  1208  MAPENAANKRCMESAGVAEFLAQIIKTSEDN----------PTDDALYVLHNLGLSENGL  1059
             +A E+ AN+RC+   G    L  +I+ +               D+AL +L+ L +++   
Sbjct  128   LADESEANRRCIAVCGGDSALISVIEMNTVEMESGCYQCPMACDEALGILYKLPMADETA  187

Query  1058  RSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFHQ  879
              ++    T  +  ++ +++ GS   R Y+ MLLK++  +++    L QL    +      
Sbjct  188   ETLSRSKT--LKPISWILKKGSCNGRFYSAMLLKTV--SSSGQKILQQLVVNADDDLIEG  243

Query  878   VVQILRDNFSRKASKSALHLLANVCQGGR-NRIKAAEAGAATVVIDLLLDTNEKRYCEWG  702
             ++Q+L +    +A+ S+L +L  +C   R NRIKA EAGA  ++I+LL ++ ++  CE  
Sbjct  244   LLQLLTEEVCLQATTSSLEILMAICSPSRKNRIKAIEAGAIYILIELLPES-QRMNCEKM  302

Query  701   LSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQ  522
             L +L+ LC CAEGRA  + HA G+A +S+KI RVSQVA E+ +RIL+S+ KFS TP ++ 
Sbjct  303   LCLLDILCECAEGRATTIDHAMGIASISKKIFRVSQVATEKAIRILWSLCKFSPTPRLLN  362

Query  521   EMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLP  384
             EM+Q+G   KLC+++Q++C   K K++A E+L+ H K W  SPC+P
Sbjct  363   EMVQIGAVYKLCVLLQLEC-TSKTKQKAREMLRAHGKYWTISPCVP  407



>ref|XP_004293107.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Fragaria vesca 
subsp. vesca]
Length=476

 Score =   296 bits (758),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 167/413 (40%), Positives = 256/413 (62%), Gaps = 12/413 (3%)
 Frame = -1

Query  1583  IVMEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQAL-SG  1407
             I MEE+ +P YF+CPISL+IMKDPVT+ TGITYDR++IE+W  +  + +CPVTKQ L + 
Sbjct  63    ISMEEVDIPTYFICPISLQIMKDPVTVETGITYDRESIEQWFLTTNDMSCPVTKQPLPTD  122

Query  1406  TDDEFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKV  1227
               ++ +TPN  LRR+IQ WCT++A +GV+R PTPK P+ + + +KL++     P +    
Sbjct  123   NSNDSMTPNHTLRRLIQQWCTINAINGVDRIPTPKFPLNRIYAVKLVKDL-GVPHLQQAA  181

Query  1226  LQTLRSMAPENAANKRCMESAGVAE----FLAQIIKTSEDNPTDDALYVLHNL-GLSENG  1062
             L+ + ++A EN  N+R M  AGV +    F+    +  + N   +AL VLH++  + E  
Sbjct  182   LKKMEALASENERNRRSMAEAGVGKALILFIVTCFQEGKTNGLLEALRVLHHVWSVDEET  241

Query  1061  LRSILGHDTQFIDSLTRVM--QHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSF  888
               +++G++  F++SLT V+   H +  +    + +   ++   T+    +     L L F
Sbjct  242   KVAVIGNN-DFLESLTWVLGLNHDNGHNHMLLLKIEAILVLKMTIPVVNTAQLERLKLEF  300

Query  887   FHQVVQILRDN-FSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYC  711
             F  +  +L +   S+KA KSALH+L   C  GRNR+K  E+GA   +I+L L   EK   
Sbjct  301   FMNISTLLSEKKISQKAVKSALHVLVEACPWGRNRMKIVESGAIFQLIELELLKPEKHVT  360

Query  710   EWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPS  531
             E   ++L  LC CA+GRA+ LKH   +A+VS++ILRVS   ++ G++IL SI+KFSAT  
Sbjct  361   ELIFNLLANLCCCADGRAQFLKHDGSIAMVSKRILRVSHATDDLGVQILSSISKFSATHG  420

Query  530   VVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             VV EML +G  +KLC+V+Q DC     K++   IL+LH+  W NSPC+ + L+
Sbjct  421   VVLEMLLVGAVSKLCMVMQADCP-AYLKKKVRGILRLHSNVWNNSPCIAVYLL  472



>ref|XP_006494890.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Citrus sinensis]
Length=405

 Score =   294 bits (752),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 172/411 (42%), Positives = 254/411 (62%), Gaps = 20/411 (5%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M+EI+VP YF+CPISL+IMKDPVT  TGI+YDR++IEKW+ + K+ TCPVTKQ L    D
Sbjct  1     MDEIEVPQYFICPISLQIMKDPVTAITGISYDRESIEKWLKTAKDTTCPVTKQPLP--RD  58

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LT N  LRR+IQ+WCT    +G++R PTPK  + K  + KL+R   S   +    L+ 
Sbjct  59    SGLTSNHTLRRLIQAWCT---HNGIDRIPTPKSALNKDQVRKLVRDLDSG-HLRISTLKK  114

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTS-EDNPT---DDALYVLHNLGLSENGLRSI  1050
             + ++A EN  N++ +E A V   L  +I TS + N T   ++AL +L  +    N  +++
Sbjct  115   MEALAMENERNRKSLEEAFVVRALVLLIITSYKGNKTTGLEEALRILSLVWSPSNENKAL  174

Query  1049  LGHDTQ-FIDSLTRVMQHGSYES----RAYAVMLLKSMLEtttlnpslsqltttlnlSFF  885
             + H  Q  I +L  V+Q  + +     +  A+++LK +LE  +     S L       FF
Sbjct  175   VDHHNQDLIGALMWVLQWETNDRHVAVKTSAMIVLKMVLELASKGLLESTLNLD----FF  230

Query  884   HQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEW  705
              ++V++L++N S++A+KS LH+L   C  G NR+K  EA A   +I+L L   EK   E 
Sbjct  231   KEMVKLLKENISQQATKSGLHVLLQACPMGSNRVKITEANAVFELIELELSKPEKSTTEL  290

Query  704   GLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVV  525
               ++L QLC CA+GR +  +HA  +A+V++++LRVS   N+R + IL SI+KFSAT  VV
Sbjct  291   IFNLLAQLCSCADGRLKFREHAGAIAMVTKRLLRVSPATNDRAVHILSSISKFSATYEVV  350

Query  524   QEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
              EML +G  +KLC+V Q DC     K+RA EIL+LH+  W NSPC+ + L+
Sbjct  351   LEMLSVGAVSKLCMVTQADCE-KYLKDRAKEILRLHSNVWNNSPCIQVYLL  400



>ref|XP_009368316.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009337707.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Pyrus x bretschneideri]
Length=412

 Score =   294 bits (752),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 173/408 (42%), Positives = 254/408 (62%), Gaps = 12/408 (3%)
 Frame = -1

Query  1571  EIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEF  1392
             EI+VP YF+CPISL+IMKDPVT+ TGITYDR++IE+W  +  + +CPVTKQAL   DD  
Sbjct  5     EIEVPQYFICPISLQIMKDPVTVVTGITYDRESIEQWFLATNDLSCPVTKQALPRGDD--  62

Query  1391  LTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTLR  1212
             LTPN  LRR+IQ WC  +A+ GV+  PTP+ P+ K ++ +L+R    +   L   L+ L 
Sbjct  63    LTPNHTLRRLIQQWCKENATSGVDLIPTPRLPLDKIYLTRLVRDLGVSHLQLT-ALKKLE  121

Query  1211  SMAPENAANKR-CMESAGVAE----FLAQIIKTSEDNPTDDALYVLHNLG--LSENGLRS  1053
             ++  EN   KR  M  AGVA+     + +  +  E N   +A  +LH++     ++ ++ 
Sbjct  122   ALVLENDERKRLSMAEAGVAKAVILLVIRCFRGGETNGLLEAFRILHHVWNVSGDHEVQL  181

Query  1052  ILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSML-EtttlnpslsqltttlnlSFFHQV  876
             ++  +T F+DSLT V + G  +   + ++  +++L    T+      L   LNL FF  +
Sbjct  182   LVNGNTDFLDSLTWVFRCGLDQMDNHRLVKNEAILVSKMTMEVLSPCLLERLNLEFFKNI  241

Query  875   VQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWGLS  696
             V +L++  S+KA KSALH+L N C  GRNRIK  E+GA   +I+L L   EKR  E   +
Sbjct  242   VMVLKEKISQKAVKSALHILINACPWGRNRIKIVESGAVFQIIELELAKPEKRVTELIFN  301

Query  695   VLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQEM  516
             +L  LC CA+GR ++LKH  G+A+VS++ILRVS   ++R +  L SIA FSAT +V+ EM
Sbjct  302   LLANLCGCADGRDQLLKHGGGMAMVSKRILRVSPATDDRAVHTLSSIAMFSATHNVLSEM  361

Query  515   LQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             L +G  +KLC+V+Q D      KE+   IL+LH+  W NSPC+ + LI
Sbjct  362   LLVGAVSKLCMVMQSD-REAYLKEKVRGILRLHSNVWNNSPCIAVYLI  408



>gb|EYU36029.1| hypothetical protein MIMGU_mgv1a025035mg [Erythranthe guttata]
Length=421

 Score =   294 bits (752),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 162/428 (38%), Positives = 260/428 (61%), Gaps = 38/428 (9%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNAT-----CPVTKQAL  1413
             M+EI++P YF+CPISL+IMKDPVT +TGITYDRD I++WI S  +AT     CPVTKQAL
Sbjct  1     MDEIEIPQYFVCPISLQIMKDPVTTATGITYDRDTIQQWI-SSSSATAAVVYCPVTKQAL  59

Query  1412  SGTDDEFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLA  1233
             +   +  LTPN +LRR+IQ+WC  +A++GV+R PTPK P+ ++ ++KLLR        + 
Sbjct  60    TPGSE--LTPNHMLRRLIQAWCVANANNGVDRIPTPKSPLHRASVIKLLRDVNRN---VL  114

Query  1232  KVLQTLRSMAPENAANKRCMESAGVAE----FLAQIIKTSEDNP---------TDDALYV  1092
               L+ L  +A E+  N+ CM  AGVA+    F+ +  ++  D            ++A  +
Sbjct  115   TSLKKLDELAGESVKNRECMAEAGVAKAMILFVLRCFRSRGDYNNNININYVGVEEAFRI  174

Query  1091  LHNLGLSENGLRSILGHDTQFIDSLTRVMQHGSY--ESRAYAVMLLKSMLEtttlnpsls  918
             L     + +  ++++  +  F++S+  V+++      ++ +A+M+LK+++E  + N   +
Sbjct  175   LQLTWRNSDENKNLVEDNLDFVESVLWVLRNADVGNSAKTHALMVLKNVMEIASSNLLAN  234

Query  917   qltttlnlSFFHQVVQILRDN-FSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDL  741
                      FF ++V++LR N       K+ALH+L   C  GRNR +  EAG     +++
Sbjct  235   LELD-----FFEEIVKVLRRNCLQVDVIKAALHVLIQTCTSGRNRTRIVEAGGVFAAVEV  289

Query  740   LL-----DTNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERG  576
              +        EKR  E    +L +LC CA+GR E L+HA G+AV ++++LRVS   ++R 
Sbjct  290   EIGGGGGTAEEKRISELVFCLLAELCSCADGRQEFLRHAGGIAVAAKRLLRVSPAVDDRA  349

Query  575   LRILYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNS  396
             + +  SIA+FSAT  VV EML++G  +K+C+V+Q DC  G  K++A +IL+LH+  W NS
Sbjct  350   MYVFESIARFSATREVVAEMLRVGAVSKMCMVLQADCA-GYLKKKARQILRLHSNAWTNS  408

Query  395   PCLPLDLI  372
             PC+ + L+
Sbjct  409   PCIQVYLL  416



>ref|XP_006362629.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Solanum tuberosum]
Length=418

 Score =   293 bits (751),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 170/420 (40%), Positives = 258/420 (61%), Gaps = 26/420 (6%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGK----NATCPVTKQALS  1410
             M+E+++P YFLCPISL IMKDPVT  TGITYDR++IE W+ + +      TCPVTKQ L 
Sbjct  1     MDEVEIPQYFLCPISLMIMKDPVTTVTGITYDRESIEMWLLTAEEEAMTTTCPVTKQILP  60

Query  1409  GTDDEFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAK  1230
               D E LTPN +LRR+IQ+WC  +AS G++R PTPK P+ KSHIL+L+RQ  +  ++  +
Sbjct  61    -RDIELLTPNHMLRRIIQAWCIANASKGIDRIPTPKYPLNKSHILRLVRQV-NNDKLCVE  118

Query  1229  VLQTLRSMAPEN-AANKRCMESAG-VAEFLAQIIKTSED----NPTDDALYVLHNLGLSE  1068
              L+ +  +  EN   NK+C+E  G +   +  I+K+ ++    N  ++AL + H +  S 
Sbjct  119   ALRKIDVLVIENNEKNKKCLEEVGAIKAMVTFIVKSFKERKLINGLEEALRIFHLVWSST  178

Query  1067  NGLRSILGHDTQFIDSLTRVMQHGSYES----RAYAVMLLKSMLEtttlnpslsqltttl  900
                  ++  +   I++++ +++    ++    +  A+M+LK++ E  + N          
Sbjct  179   IENIQLVKENRDLIEAISWILRSDMTKNQVVIKTQAMMVLKNVTEVLSSNLLSRLNPE--  236

Query  899   nlSFFHQVVQILRD----NFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLD  732
                FF ++V  LR     + S++A+K AL +L N C  GRN+ K  E+GA   +I+L L 
Sbjct  237   ---FFQELVNTLRKESEHHISQQATKGALQVLINACPWGRNKHKIIESGAIFELIELELG  293

Query  731   TNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIA  552
               EKR  E  L VL  LC  A+GRAE LKHA GL+VV+++ LRVS   ++  ++I  SI+
Sbjct  294   NAEKRVSELVLCVLAHLCTLADGRAEFLKHAGGLSVVAKRTLRVSSSTDDCAIQIFGSIS  353

Query  551   KFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             + SAT  V+ EML++GV +KLC+VIQ  CG    K++A EILK H+  W NSPC+ + L+
Sbjct  354   RCSATKEVLMEMLRVGVVSKLCMVIQASCG-EYLKKKAMEILKTHSNVWSNSPCIQVYLL  412



>ref|XP_011090481.1| PREDICTED: E3 ubiquitin-protein ligase PUB24-like [Sesamum indicum]
Length=408

 Score =   293 bits (749),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 170/415 (41%), Positives = 259/415 (62%), Gaps = 25/415 (6%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSG---KNATCPVTKQALSG  1407
             M++I++P YFLCPISL+IMKDPVT  TGITYDR++IE+W+ +    +NA CPVTKQ L+ 
Sbjct  1     MDDIEIPRYFLCPISLQIMKDPVTTVTGITYDRESIEQWLVTASPSENAVCPVTKQPLAR  60

Query  1406  TDDEFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPE----M  1239
             T D  LTPN +LRR+IQ+WCT   ++ V+R PTPK P+ +S +LKL+R+ + + +    +
Sbjct  61    TAD--LTPNHMLRRLIQAWCT---TNAVDRIPTPKSPLHRSILLKLIRELRKSDQSDSFL  115

Query  1238  LAKVLQTLRSMAPENAANKRCMESAGV----AEFLAQIIKTSEDNPTDDALYVLHNLGLS  1071
                 L+ L  +A E   N + M  AGV    A F+ + +K    +  ++AL VL      
Sbjct  116   HVNALKKLDELAGETK-NHQLMAEAGVPKAVAHFVLRCVKEGRFSGLEEALRVLQRTWAP  174

Query  1070  ENGLRSILGHDTQFIDSLTRVMQHGSYES-RAYAVMLLKSMLEtttlnpslsqltttlnl  894
              +  + +L  +  F+ S+  V+      + + +A ++LKS+LE  +L             
Sbjct  175   TSENKRLLEDNMDFVKSMWWVLSSDLENAVKTHAAIVLKSVLEVASLGLKERLEFD----  230

Query  893   SFFHQVVQILRDN-FSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKR  717
              FF Q+V++LR N  S++  ++ LH+L   C  GRNR K  EAGA   +I++ L   +K+
Sbjct  231   -FFTQMVKLLRANTISQQGVRALLHVLIETCPCGRNRTKIVEAGAVLELIEMELCNPDKK  289

Query  716   YCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSAT  537
               E    +L  LC CA+GR ++LKHA G+AVV++++LRVS   ++R L I+ SIA+FSAT
Sbjct  290   TTELIFCLLALLCSCADGRQQLLKHAGGIAVVAKRLLRVSAAVDDRALCIMESIARFSAT  349

Query  536   PSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
               VV EML++G  +KLC+V+Q DC +   K++A EIL+LH+  W NSPC+ + L+
Sbjct  350   REVVMEMLRVGAVSKLCMVLQADCAIYL-KKKAREILRLHSNCWSNSPCIQVYLL  403



>ref|XP_006424087.1| hypothetical protein CICLE_v10028564mg [Citrus clementina]
 gb|ESR37327.1| hypothetical protein CICLE_v10028564mg [Citrus clementina]
 gb|KDO46583.1| hypothetical protein CISIN_1g015513mg [Citrus sinensis]
Length=405

 Score =   292 bits (748),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 172/411 (42%), Positives = 253/411 (62%), Gaps = 20/411 (5%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M+EI+VP YF+CPISL+IMKDPVT  TGI+YDR++IEKW+ + K+ TCPVTKQ L    D
Sbjct  1     MDEIEVPQYFICPISLQIMKDPVTAITGISYDRESIEKWLKTAKDTTCPVTKQPLP--RD  58

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LT N  LRR+IQ+WCT    +G++R PTPK  + K  + KL+R   S   +    L+ 
Sbjct  59    SGLTSNHTLRRLIQAWCT---HNGIDRIPTPKSALNKDQVRKLVRDLDSG-HLRISTLKK  114

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTS-EDNPT---DDALYVLHNLGLSENGLRSI  1050
             + ++A EN  N++ +E A V   L   I TS + N T   ++AL +L  +    N  +++
Sbjct  115   MEALAMENERNRKSLEEAFVVRALVLFIITSYKGNKTTGLEEALRILSLVWSPSNENKAL  174

Query  1049  LGHDTQ-FIDSLTRVMQHGSYES----RAYAVMLLKSMLEtttlnpslsqltttlnlSFF  885
             + H  Q  I +L  V+Q  + +     +  A+++LK +LE  +     S L       FF
Sbjct  175   VDHHNQDLIGALMWVLQWENNDRHVAVKTSAMIVLKMVLELASKGLLESTLNLD----FF  230

Query  884   HQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEW  705
              ++V++L++N S++A+KS LH+L   C  G NR+K  EA A   +I+L L   EK   E 
Sbjct  231   KEMVKLLKENISQQATKSGLHVLLQACPMGGNRVKITEANAVFELIELELTKPEKSTTEL  290

Query  704   GLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVV  525
               ++L QLC CA+GR +  +HA  +A+V++++LRVS   N+R + IL SI+KFSAT  VV
Sbjct  291   IFNLLAQLCSCADGRLKFREHAGAIAMVTKRLLRVSPATNDRAVHILSSISKFSATYEVV  350

Query  524   QEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
              EML +G  +KLC+V Q DC     K+RA EIL+LH+  W NSPC+ + L+
Sbjct  351   LEMLSVGAVSKLCMVTQADCE-KYLKDRAKEILRLHSNVWNNSPCIQVYLL  400



>ref|XP_004506267.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Cicer arietinum]
Length=412

 Score =   292 bits (747),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 154/415 (37%), Positives = 262/415 (63%), Gaps = 21/415 (5%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M EI++PPYF+CPIS +IMK+PVT  TGITYD+++IEKW+   KN  CPVT Q+L  +  
Sbjct  1     MAEIEIPPYFVCPISFQIMKEPVTTITGITYDKESIEKWLMKAKNCVCPVTNQSLPRSS-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
             E+LTPN  L+R+IQ+W + + +  V++  +PK  + ++H+ KL++  +  P      ++ 
Sbjct  60    EYLTPNHTLKRLIQAWISSNEAKEVDQIQSPKSSINRTHLNKLVKNLE-LPHCYENSMEK  118

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIKTS--EDNPT--DDALYVLHNL---GLSENGL  1059
             +  +A ++  N+ CM   GV + +  +IK S  E N    ++ L ++  L    +++N +
Sbjct  119   IHELAKQSERNRTCMVEVGVTKVMVMVIKKSFKEGNVICLEEGLKIIRLLWHESMNKNMM  178

Query  1058  RSILGHDTQFIDSLTRVMQ----HGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlS  891
             + ++G + +FI+SLT ++Q    + +++    A+ LLK  ++        +         
Sbjct  179   KPLVGENIEFINSLTWILQLHIENNNFKIVNEAMPLLKLTIDVMDSTLLGNLNID-----  233

Query  890   FFHQVVQIL--RDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKR  717
             FF  +V++L  R  FS++A KSALH+L +    GRNRI+  EAGA T +I+L L+  EK 
Sbjct  234   FFIAMVRVLQKRALFSKQAIKSALHVLIDTYPLGRNRIRIVEAGAITELIELELEKPEKN  293

Query  716   YCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSAT  537
               E   ++L  LC CA+GR + L+HAAG+A+++++ILRVS   ++R +++++ IA++S++
Sbjct  294   VTELVFNLLAHLCSCADGREQFLRHAAGIAMITKRILRVSTATDDRAIQVIFMIARYSSS  353

Query  536   PSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
               +V EML++G  +KLC+V+Q DC     KE+A +IL+LH+  W NSPC+ + L+
Sbjct  354   KDIVLEMLRVGAVSKLCMVMQADCS-SYLKEKARDILRLHSSTWNNSPCIQVYLM  407



>ref|XP_004975598.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Setaria italica]
Length=437

 Score =   292 bits (748),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 174/428 (41%), Positives = 251/428 (59%), Gaps = 44/428 (10%)
 Frame = -1

Query  1568  IQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEFL  1389
             ++VP +F+CPISLE+M+DPVT+S+GITYDRD+IE+W+F+  +  CPVTK  L G  D   
Sbjct  10    VEVPRFFVCPISLEVMRDPVTLSSGITYDRDSIERWVFTDGHGDCPVTKLPL-GAGDREP  68

Query  1388  TPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAK--STPEMLAKVLQTL  1215
             TPN  LRR+IQSWC   A+H VERFPTP+PPV    +  ++  A+    PE+LA  L+ L
Sbjct  69    TPNHTLRRLIQSWC---AAHAVERFPTPRPPVDADRVAAIVDAARKGGRPEVLA-ALREL  124

Query  1214  RSMAPENAANKRCMESA-GVAEFLAQIIK----------------TSEDNPT-----DDA  1101
               +  E+  N+RC+E A G  EFLA ++K                  ED+P      + A
Sbjct  125   AEIIGESDRNRRCVEGAPGAVEFLASVVKKHAASTLSKPLELMHDVPEDSPMSTSPEEAA  184

Query  1100  LYVLHNLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpsl  921
             L +LH+L  SE  L+ IL  +  F+D+L  V++  S+ +R + + LLK+ L     +   
Sbjct  185   LSILHSLKPSEETLKRILESNDDFVDTLASVLRWPSHRARTHGMHLLKAALSAMQPSRLS  244

Query  920   sqltttlnlSFFHQVVQILRDN-FSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVID  744
             +  T          VV++  D     KA K ALH+L  +   GRNRIKA EAGA   +++
Sbjct  245   TASTE-----LIEGVVRVAADRALPPKAVKLALHVLCRLSPWGRNRIKAVEAGAMAALVE  299

Query  743   LLLD---------TNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQV  591
             LLL+            KR  E     ++ LC CAEGR E++ H AGLA V+R   R+S  
Sbjct  300   LLLNEGCGGGSNGGGGKRAGELAAVAIDHLCGCAEGRQELVAHPAGLAAVARAATRLSPT  359

Query  590   ANERGLRILYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAK  411
               E  +R L+++A+ +ATP+V+QEML +GV A+L  ++Q      + +ERA E+LK+HA+
Sbjct  360   GTESAVRALHAVARHAATPAVLQEMLAVGVVARLLYLVQAGAAGERPRERAREMLKMHAR  419

Query  410   EWKNSPCL  387
              W+ SPCL
Sbjct  420   VWRGSPCL  427



>ref|XP_002265057.1| PREDICTED: E3 ubiquitin-protein ligase PUB23 [Vitis vinifera]
Length=406

 Score =   291 bits (745),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 164/405 (40%), Positives = 247/405 (61%), Gaps = 18/405 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M+++++P YF+CPISL+IM+DPVT  TGITYDR++IE W+F G N TCPVTKQ L    D
Sbjct  1     MDDVEIPEYFICPISLQIMRDPVTAITGITYDRESIENWLFKGNN-TCPVTKQPLPPDSD  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQSWCT +AS+GV R PTPK P+TKSH++KL+++    P++  K L+ 
Sbjct  60    --LTPNHTLRRLIQSWCTENASNGVVRIPTPKAPLTKSHVVKLVKELW-VPQLQLKTLRK  116

Query  1217  LRSMAPENAANKRCMESAGV----AEFLAQIIKTSEDNPTDDALYVLHNLGLSENGLRSI  1050
             L  +A EN  N+R M  AGV    + FL       +    ++AL +L+ + ++      +
Sbjct  117   LELLAMENERNRRYMVEAGVIKSMSSFLVACFNKQQTVGLEEALSILYLIRVNPTSETRL  176

Query  1049  LG-HDTQFIDSLTRVMQ---HGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSFFH  882
             L   + + +++ T ++Q    G    +A+A+++LK M++T +               F  
Sbjct  177   LPIENDRIMETFTWILQCKMDGHSSIKAHALLVLKVMVKTASSTQLERLKPE-----FLS  231

Query  881   QVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCEWG  702
              VV +LR+  S +   +ALH+L + C  GRNR+   E+GA   VI++ L   E+R  E  
Sbjct  232   SVVGVLREGISHQGINAALHILLDTCPWGRNRMSMIESGAIHDVIEIELGMPERRTTELI  291

Query  701   LSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSVVQ  522
             L +L  LC CA+GR++ L H+  +AVVS ++L VS  A++R + IL  I+K+  T  V++
Sbjct  292   LGILFHLCSCADGRSQFLSHSGAIAVVSNRMLNVSIAADDRAILILSLISKYCGTCVVLE  351

Query  521   EMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCL  387
             EM+ +   +KLC+V+Q D      KE+A EIL+ H   WKNSPC 
Sbjct  352   EMISVRAVSKLCVVLQADYA-HYLKEKAREILRSHYDFWKNSPCF  395



>ref|XP_002448808.1| hypothetical protein SORBIDRAFT_06g033630 [Sorghum bicolor]
 gb|EES13136.1| hypothetical protein SORBIDRAFT_06g033630 [Sorghum bicolor]
Length=426

 Score =   291 bits (744),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 176/417 (42%), Positives = 252/417 (60%), Gaps = 32/417 (8%)
 Frame = -1

Query  1571  EIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEF  1392
             E++VP YFLCPISL IM+DPVT+ TGITYDRD IE+W+ +   ATCP+TKQ +    D  
Sbjct  10    EVEVPCYFLCPISLSIMRDPVTLPTGITYDRDGIERWLLTA--ATCPLTKQPVPADCDP-  66

Query  1391  LTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKST------PEMLAK  1230
              TPN  LRR+IQSWC LHA+ GV+R  TPKP    + ++  L  A +       P++LA 
Sbjct  67    -TPNHTLRRLIQSWCALHAADGVDRVHTPKPRADVAALVSRLHDAAAAGSTAPQPQLLA-  124

Query  1229  VLQTLRSMAPENAANKRCMESA-GVAEFLAQII------KTSEDNPT------DDALYVL  1089
              L+ LR +A E+  N++ + +  G  + LA +       K+SE          D+AL V+
Sbjct  125   ALRELRDVAAESDRNRKLVAAVPGAVDVLAAVFAASANAKSSEGTAAAAAAVRDEALEVV  184

Query  1088  HNLGLSENGLRSILGHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqlt  909
              +L + E  LR +   +   + +L   +Q  S  SRA A +LL+ +              
Sbjct  185   SSLQVPEQCLRRVAETNEALVSALVSALQRSSAASRARAALLLERV-----TAALPPSRL  239

Query  908   ttlnlSFFHQVVQILRDN--FSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLL  735
              +L    F + V++LRD    SR A+K+ALH+L      GRNR+KA +AGA  V++D+L 
Sbjct  240   ASLPEQVFREAVELLRDRPAVSRPATKAALHVLVRTAAWGRNRVKAVDAGAVPVLVDMLF  299

Query  734   DTN-EKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYS  558
             D   E+R CE  L+ L++LC CAEGRA+++ H AG+A V RK LRVS+VA ++ +R+L S
Sbjct  300   DDGAERRACELVLAALDRLCGCAEGRADLVAHGAGVAAVGRKALRVSEVATDKAVRVLRS  359

Query  557   IAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCL  387
             +A+ +AT +VVQEM   GV A LC+V Q +    + +ERA E L+LHA+ W+ SPCL
Sbjct  360   VARHAATAAVVQEMAHAGVVATLCVVAQSEQYAERTRERARETLRLHARAWRTSPCL  416



>ref|XP_003539150.1| PREDICTED: E3 ubiquitin-protein ligase PUB24-like [Glycine max]
 gb|KHN19927.1| E3 ubiquitin-protein ligase PUB24 [Glycine soja]
Length=417

 Score =   290 bits (742),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 169/416 (41%), Positives = 258/416 (62%), Gaps = 18/416 (4%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M E+++P YF+CPIS +IM+DPVT  TGITYDR++IEKW+   K+  CPV+KQ L  +  
Sbjct  1     MAEVEIPQYFVCPISFQIMEDPVTTVTGITYDRESIEKWLLKAKDCVCPVSKQPLPRSS-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
             ++LTPN  LRR+IQ+WC+ + S+GV+R PTPK P++   + KLL+  +  P    K L+ 
Sbjct  60    QYLTPNHTLRRLIQAWCSANTSNGVDRIPTPKTPLSMVQVQKLLKGLE-VPCSYQKSLEK  118

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQIIK-------TSEDNPT--DDALYVLHNL-GLSE  1068
             L  +A     N+ CM  AGVA+ + ++I        T+ +N T  +  L ++H L    +
Sbjct  119   LHGLAT-TERNRICMAEAGVAKAMIKLINKSFKEGNTNLNNTTCIEKVLRIVHVLWSNDQ  177

Query  1067  NGLRSIL--GHDTQFIDSLTRVMQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnl  894
             + ++S L   ++  FI+SLT +++    ++    V     +L+ T    + S L  +L L
Sbjct  178   SSMKSTLVGENNLDFINSLTWILKVHLDDNNIKMVNEAMPLLKLTIEVAADSTLLGSLGL  237

Query  893   SFFHQVVQILRDN--FSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEK  720
              FF ++V++LR     S++A KSAL +L      GRNR +  EAGA T +I+L L+  EK
Sbjct  238   EFFKEIVRVLRKRALLSQQAIKSALCVLTETSTSGRNRTRIVEAGAVTELIELELEKPEK  297

Query  719   RYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSA  540
                E   ++L  LC CA+GR + L+HAA +AVVS+++LRVS   ++R + +   IAKFSA
Sbjct  298   NMTELIFNLLALLCSCADGREQFLRHAAAIAVVSKRVLRVSAATDDRAIHVFSVIAKFSA  357

Query  539   TPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             +  VV EML++G  +KLC+++Q DC     KE+A +IL+LH+K W NSPC+ L L 
Sbjct  358   SNEVVLEMLRVGAVSKLCMLMQADCA-SYLKEKARDILRLHSKVWNNSPCIQLYLF  412



>gb|ACG41924.1| ubiquitin-protein ligase [Zea mays]
Length=448

 Score =   291 bits (745),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 180/435 (41%), Positives = 257/435 (59%), Gaps = 52/435 (12%)
 Frame = -1

Query  1568  IQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEFL  1389
             ++VP +F+CPISLE+M+DPVT+S+GITYDRD+IE+W+F+  +  CPVTK  L G DD   
Sbjct  16    VEVPKFFVCPISLEVMRDPVTLSSGITYDRDSIERWLFTDGHGDCPVTKLPL-GADDLEP  74

Query  1388  TPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTLRS  1209
             TPN  LRR+IQSWC   A+H VERFPTP+PPV    +  ++  AK   +   +VL  LR 
Sbjct  75    TPNHTLRRLIQSWC---AAHAVERFPTPRPPVDADRVAAIVGCAKKGGQQ--EVLAALRE  129

Query  1208  MAP---ENAANKRCMESAGVA-EFLAQIIK-----TSED---------------------  1119
             +A    E+  N+RC+E    A EFL  ++K     TS                       
Sbjct  130   LADIIGESDRNRRCVEGVPEAVEFLVSVVKKHAAGTSSSKPLGGCRSQEEPMCGVPDSPK  189

Query  1118  --NPTDDALYVLHNLGLSENGLRSILGHDTQFIDSLTRVMQ-HGSYESRAYAVMLLKSML  948
               +P + AL +LH+L LSE  L+  L     F+D+L  V++   +Y +R YA+ LLK+ L
Sbjct  190   ACSPEEAALSILHSLKLSEASLKRALESSDGFVDTLASVLRWPPNYRARTYAMHLLKAAL  249

Query  947   EtttlnpslsqltttlnlSFFHQVVQILRD-NFSRKASKSALHLLANVCQGGRNRIKAAE  771
                          ++ +      VV+++ D   S KA K ALH+L  +C  GRNR+KA E
Sbjct  250   S-----AMQPSQLSSASTDLVEGVVRVVADRTLSPKAIKVALHVLCRLCPWGRNRVKAVE  304

Query  770   AGAATVVIDLLLD-------TNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRK  612
             AGA   V++LLL+       +N KR  E  +  ++ LC CAEGR E++ H AGLAVV+R 
Sbjct  305   AGAVAAVVELLLNEGCGCGGSNGKRAVELAVVAIDHLCGCAEGRLELVAHPAGLAVVARA  364

Query  611   ILRVSQVANERGLRILYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAE  432
               R+S  A E  +R L+++A+ SATP+V+QEML +GV A+L  ++Q      + +ERA E
Sbjct  365   ATRLSPTATESAVRALHAVARHSATPAVLQEMLAVGVVARLLYLVQAGASGERPRERARE  424

Query  431   ILKLHAKEWKNSPCL  387
             +LK+HA+ W+ SPCL
Sbjct  425   MLKMHARVWRGSPCL  439



>emb|CDP10594.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   290 bits (741),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 159/407 (39%), Positives = 248/407 (61%), Gaps = 19/407 (5%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             M+++++P YF+CPISL IMKDPVT  TGITYDR++IE+W+    NATCPV+KQ L    D
Sbjct  1     MDDVEIPEYFICPISLHIMKDPVTAVTGITYDRESIEQWLLKRHNATCPVSKQPLPR--D  58

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  L R+I++WCT +++  +++ PTPKPP++K H   L+R     P    + LQ 
Sbjct  59    SELTPNNTLCRLIRAWCTANSAPDMDQVPTPKPPMSKFHFANLIR-GLWLPNSQLEALQK  117

Query  1217  LRSMAPENAANKRCMESAGVAE----FLAQIIKTSEDNPTDDALYVLHNLGLSENGLRSI  1050
             L ++A EN +N++ M  AGV +    F+    +        +AL +   +  S N  + +
Sbjct  118   LEALARENESNRKQMVEAGVTKPVISFVVACHRKEVTTGLAEALSIFFLIRSSLNQTKLV  177

Query  1049  LGHDTQFIDSLTRVM----QH--GSYESRAYAVMLLKSMLEtttlnpslsqltttlnlSF  888
             L  + + ID+LT V+     H   S   + +A+  LK +++    +             F
Sbjct  178   LIGNDEIIDALTWVLVCDLDHLDHSLTIKTHAISALKMLVQKANSSTLGRLKPD-----F  232

Query  887   FHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRYCE  708
             F+++++ ++++ S++   +AL ++ + C  GRNRI   EAGA + +I+L   + EK+  E
Sbjct  233   FNRIIRYIKESNSQQGINAALQVMLDSCPSGRNRIMMVEAGAVSELIELEFSSAEKKTTE  292

Query  707   WGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATPSV  528
                 +L  LC CA+GRA+ L HAAG+A+V+++IL+VS  A+ R + IL  I+KFS T  V
Sbjct  293   LIFGILYHLCSCADGRAQFLSHAAGVAIVTKRILKVSPAADRRAMLILSLISKFSGTVGV  352

Query  527   VQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCL  387
             VQEML++G  AKLC+VIQ DC     K++A EIL+ H+  WK+SPC+
Sbjct  353   VQEMLRVGAVAKLCMVIQADCE-SHLKDKAREILRTHSNAWKDSPCI  398



>ref|XP_003540819.1| PREDICTED: E3 ubiquitin-protein ligase PUB24-like [Glycine max]
 gb|KHN21195.1| E3 ubiquitin-protein ligase PUB24 [Glycine soja]
Length=404

 Score =   289 bits (740),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 161/409 (39%), Positives = 252/409 (62%), Gaps = 21/409 (5%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             MEE+++P YF+CPIS +IM+DPVT  TGITYDR++IE+W+   K+  CPV+KQ L  +  
Sbjct  1     MEEVEIPQYFVCPISFQIMEDPVTTVTGITYDRESIEQWLLKAKDCVCPVSKQPLPRSS-  59

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
             ++LTPN  LRR+IQ+WC+ + ++GV+R PTPK P++   + KL++  ++ P      L+ 
Sbjct  60    QYLTPNHTLRRLIQAWCSANTANGVDRIPTPKTPLSMIQVQKLVKGLEA-PCSYQTSLEK  118

Query  1217  LRSMAPENAANKRCMESAGVAEFLAQII----KTSEDNPT--DDALYVLHNLGLSEN-GL  1059
             L ++A     N+ CM  A VA+ + ++I    K    N T  + AL ++H L  ++   +
Sbjct  119   LHALATIER-NRTCMAEASVAKAMIKLINKSFKEGNTNTTCIEKALRIVHVLWSNDQYSM  177

Query  1058  RSILGHDTQFIDSLTRV----MQHGSYESRAYAVMLLKSMLEtttlnpslsqltttlnlS  891
             ++++G D  FI+SLT +    +   + +    A+ LLK  +E        +         
Sbjct  178   KTLVGEDLDFINSLTWIVRLHLDENNIKMVNEAMPLLKLTIEVVDSTLLGNLSLE-----  232

Query  890   FFHQVVQILRDN-FSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEKRY  714
             FF ++V++LR    S++A K AL +L      GRNR +  EAGA T +I+L L+  EK  
Sbjct  233   FFKEMVRVLRKKRLSQQAIKYALWVLTETSTLGRNRTRIVEAGAVTELIELELEKPEKNM  292

Query  713   CEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSATP  534
              E   ++L  LC CA+GR + L+HAAG+AV+S+++ RVS   ++R + +   IAKFSA+ 
Sbjct  293   TELIFNLLALLCSCADGREQFLRHAAGIAVLSKRVFRVSAATDDRAIHVFSVIAKFSASN  352

Query  533   SVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCL  387
              VV EML++G  +KLC+V+Q DC     KE+A +IL+LH+K W NSPC+
Sbjct  353   EVVLEMLRVGAVSKLCMVMQADCA-SYLKEKARDILRLHSKVWNNSPCI  400



>ref|NP_001142289.1| ubiquitin-protein ligase [Zea mays]
 gb|ACF88102.1| unknown [Zea mays]
 tpg|DAA37871.1| TPA: ubiquitin-protein ligase [Zea mays]
Length=448

 Score =   291 bits (744),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 180/435 (41%), Positives = 257/435 (59%), Gaps = 52/435 (12%)
 Frame = -1

Query  1568  IQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDDEFL  1389
             ++VP +F+CPISLE+M+DPVT+S+GITYDRD+IE+W+F+  +  CPVTK  L G DD   
Sbjct  16    VEVPKFFVCPISLEVMRDPVTLSSGITYDRDSIERWLFTDGHGDCPVTKLPL-GADDLEP  74

Query  1388  TPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQTLRS  1209
             TPN  LRR+IQSWC   A+H VERFPTP+PPV    +  ++  AK   +   +VL  LR 
Sbjct  75    TPNHTLRRLIQSWC---AAHAVERFPTPRPPVDADRVAAIVGCAKKGGQQ--EVLAALRE  129

Query  1208  MAP---ENAANKRCMESAGVA-EFLAQIIK-----TSED---------------------  1119
             +A    E+  N+RC+E    A EFL  ++K     TS                       
Sbjct  130   LADIIGESDRNRRCVEGVPEAVEFLVSVVKKHAAGTSSSKPLGGCRSQEEPMCGVPDSPK  189

Query  1118  --NPTDDALYVLHNLGLSENGLRSILGHDTQFIDSLTRVMQ-HGSYESRAYAVMLLKSML  948
               +P + AL +LH+L LSE  L+  L     F+D+L  V++   +Y +R YA+ LLK+ L
Sbjct  190   ACSPEEAALSILHSLKLSEASLKRALESSDGFVDTLASVLRWPPNYRARTYAMHLLKAAL  249

Query  947   EtttlnpslsqltttlnlSFFHQVVQILRD-NFSRKASKSALHLLANVCQGGRNRIKAAE  771
                          ++ +      VV+++ D   S KA K ALH+L  +C  GRNR+KA E
Sbjct  250   S-----AMQPSQLSSASTDLVEGVVRVVADRTLSPKAIKVALHVLCRLCPWGRNRVKAVE  304

Query  770   AGAATVVIDLLLD-------TNEKRYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRK  612
             AGA   V++LLL+       +N KR  E  +  ++ LC CAEGR E++ H AGLAVV+R 
Sbjct  305   AGAVAAVVELLLNVGCGCGGSNGKRAVELAVVAIDHLCGCAEGRLELVAHPAGLAVVARA  364

Query  611   ILRVSQVANERGLRILYSIAKFSATPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAE  432
               R+S  A E  +R L+++A+ SATP+V+QEML +GV A+L  ++Q      + +ERA E
Sbjct  365   ATRLSPTATESAVRALHAVARHSATPAVLQEMLAVGVVARLLYLVQAGASGERPRERARE  424

Query  431   ILKLHAKEWKNSPCL  387
             +LK+HA+ W+ SPCL
Sbjct  425   MLKMHARVWRGSPCL  439



>ref|XP_008230326.1| PREDICTED: E3 ubiquitin-protein ligase PUB24-like [Prunus mume]
Length=411

 Score =   289 bits (740),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 168/416 (40%), Positives = 253/416 (61%), Gaps = 23/416 (6%)
 Frame = -1

Query  1577  MEEIQVPPYFLCPISLEIMKDPVTISTGITYDRDNIEKWIFSGKNATCPVTKQALSGTDD  1398
             MEEIQ+P YF+CPISL+IMKDPVT+ TGITYDR++IE+W  +  + +CPVTKQAL    D
Sbjct  1     MEEIQIPEYFICPISLQIMKDPVTVLTGITYDRESIEQWFSTTHDMSCPVTKQALP--RD  58

Query  1397  EFLTPNIILRRVIQSWCTLHASHGVERFPTPKPPVTKSHILKLLRQAKSTPEMLAKVLQT  1218
               LTPN  LRR+IQ WC  +A++GV   PTPK  + K ++  L+ Q      + A  L+ 
Sbjct  59    NALTPNHTLRRLIQQWCKENATNGVGLIPTPKLTLNKIYVSGLV-QDLGVSHLQANALKK  117

Query  1217  LRSMAPENAA-NKRCMESAGVAEFLAQII-----KTSEDNPTDDALYVLHNLG--LSENG  1062
             L ++A ENA  N+R M  AGVA+ +   I     + ++ N   +AL +LH++     ++ 
Sbjct  118   LEALALENAQRNRRSMGEAGVAKAMVLFIVRCYKEGAQRNGVLEALRILHHVWSVADDHE  177

Query  1061  LRSILGHDTQFIDSLTRV------MQHGSYESRAYAVMLLKSMLEtttlnpslsqltttl  900
             ++ I+     F++SLT V      M + +   ++ A++++K  +E  T +          
Sbjct  178   VKLIVNGSNDFLESLTWVLGCDPEMDNHAILMKSEAILVMKMAMEVITASQLELLNLE--  235

Query  899   nlSFFHQVVQILRDNFSRKASKSALHLLANVCQGGRNRIKAAEAGAATVVIDLLLDTNEK  720
                FF  +V + ++  S++A KSALH+L   C  GRNR+K  E+GA   +I+L L   E+
Sbjct  236   ---FFKNIVMVSKEKISQEALKSALHVLIEACLLGRNRMKMVESGAIFQLIELELARPER  292

Query  719   RYCEWGLSVLEQLCRCAEGRAEVLKHAAGLAVVSRKILRVSQVANERGLRILYSIAKFSA  540
                E   ++L  LC CA+GRA++LKHA G+A+VS++ILRVS   ++R + IL  IA FSA
Sbjct  293   HITELIFNLLANLCGCADGRAQLLKHAGGIALVSKRILRVSPATDDRAVHILSLIAMFSA  352

Query  539   TPSVVQEMLQLGVGAKLCLVIQVDCGVGKNKERAAEILKLHAKEWKNSPCLPLDLI  372
             T  V+ EML +G  +KLC+V+Q DC     K++   IL+LH+  W N PC+ + L+
Sbjct  353   THEVLLEMLLVGAVSKLCMVMQADC-TAHLKKKVRGILRLHSNVWNNQPCIAVYLV  407



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4732378313600